data_2EQG
# 
_entry.id   2EQG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EQG         
RCSB  RCSB026981   
WWPDB D_1000026981 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk003100168.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2EQG 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-30 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.P.'                                            1 
'Hayahsi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, H.P.'  1 
primary 'Hayashi, F.'  2 
primary 'Yokoyama, S.' 3 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor necrosis factor, alpha-induced protein 3' 5212.726 1 3.-.-.- ? 'A20-type zinc finger domain' ? 
2 non-polymer syn 'ZINC ION'                                       65.409   1 ?       ? ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Putative DNA-binding protein A20, Zinc finger protein A20' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk003100168.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  SER n 
1 9  LEU n 
1 10 MET n 
1 11 ASP n 
1 12 VAL n 
1 13 LYS n 
1 14 CYS n 
1 15 GLU n 
1 16 THR n 
1 17 PRO n 
1 18 ASN n 
1 19 CYS n 
1 20 PRO n 
1 21 PHE n 
1 22 PHE n 
1 23 MET n 
1 24 SER n 
1 25 VAL n 
1 26 ASN n 
1 27 THR n 
1 28 GLN n 
1 29 PRO n 
1 30 LEU n 
1 31 CYS n 
1 32 HIS n 
1 33 GLU n 
1 34 CYS n 
1 35 SER n 
1 36 GLU n 
1 37 ARG n 
1 38 ARG n 
1 39 GLN n 
1 40 LYS n 
1 41 ASN n 
1 42 GLN n 
1 43 ASN n 
1 44 SER n 
1 45 GLY n 
1 46 PRO n 
1 47 SER n 
1 48 SER n 
1 49 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TNFAIP3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P070115-04 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNAP3_HUMAN 
_struct_ref.pdbx_db_accession          P21580 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   SLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQN 
_struct_ref.pdbx_align_begin           381 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EQG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 43 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P21580 
_struct_ref_seq.db_align_beg                  381 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  416 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       43 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EQG GLY A 1  ? UNP P21580 ? ? 'EXPRESSION TAG' 1  1  
1 2EQG SER A 2  ? UNP P21580 ? ? 'EXPRESSION TAG' 2  2  
1 2EQG SER A 3  ? UNP P21580 ? ? 'EXPRESSION TAG' 3  3  
1 2EQG GLY A 4  ? UNP P21580 ? ? 'EXPRESSION TAG' 4  4  
1 2EQG SER A 5  ? UNP P21580 ? ? 'EXPRESSION TAG' 5  5  
1 2EQG SER A 6  ? UNP P21580 ? ? 'EXPRESSION TAG' 6  6  
1 2EQG GLY A 7  ? UNP P21580 ? ? 'EXPRESSION TAG' 7  7  
1 2EQG SER A 44 ? UNP P21580 ? ? 'EXPRESSION TAG' 44 8  
1 2EQG GLY A 45 ? UNP P21580 ? ? 'EXPRESSION TAG' 45 9  
1 2EQG PRO A 46 ? UNP P21580 ? ? 'EXPRESSION TAG' 46 10 
1 2EQG SER A 47 ? UNP P21580 ? ? 'EXPRESSION TAG' 47 11 
1 2EQG SER A 48 ? UNP P21580 ? ? 'EXPRESSION TAG' 48 12 
1 2EQG GLY A 49 ? UNP P21580 ? ? 'EXPRESSION TAG' 49 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.08mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.entry_id           2EQG 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.entry_id                                      2EQG 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
_pdbx_nmr_representative.entry_id             2EQG 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRVIEW 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9818   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2EQG 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EQG 
_struct.title                     
'Solution structure of the first A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3' 
_struct.pdbx_descriptor           'Tumor necrosis factor, alpha-induced protein 3 (E.C.3.-.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EQG 
_struct_keywords.text            
;zf-A20 domain, Tumor necrosis factor, alpha-induced protein 3, Putative DNA-binding protein A20, Zinc finger protein A20, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
;
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       CYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        31 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        40 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        CYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         31 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         40 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 201 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc2 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc3 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc4 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 201 1_555 ? ? ? ? ? ? ? 2.277 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 1  -0.02 
2  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 2  0.01  
3  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 3  -0.01 
4  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 4  -0.08 
5  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 5  0.00  
6  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 6  0.03  
7  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 7  0.02  
8  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 8  0.04  
9  GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 9  0.12  
10 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 10 -0.04 
11 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 11 -0.04 
12 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 12 -0.05 
13 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 13 -0.01 
14 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 14 -0.05 
15 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 15 0.05  
16 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 16 0.04  
17 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 17 -0.03 
18 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 18 0.03  
19 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 19 -0.06 
20 GLN 28 A . ? GLN 28 A PRO 29 A ? PRO 29 A 20 -0.02 
# 
_atom_sites.entry_id                    2EQG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -13.275 0.637   20.346  1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -12.260 1.215   21.207  1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -11.304 2.117   20.452  1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -10.088 2.025   20.621  1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -13.164 0.666   19.373  1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -12.746 1.790   21.982  1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -11.696 0.416   21.666  1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -11.854 2.990   19.614  1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -11.041 3.908   18.825  1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -10.174 3.147   17.827  1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -8.997  3.458   17.647  1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -10.158 4.757   19.742  1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -9.688  5.913   19.070  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -12.830 3.015   19.523  1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -11.710 4.559   18.281  1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -10.729 5.064   20.605  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -9.308  4.171   20.062  1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -9.101  5.653   18.357  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -10.766 2.147   17.182  1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -10.048 1.337   16.204  1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -10.857 1.193   14.919  1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -12.087 1.196   14.942  1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -9.740  -0.045  16.783  1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -8.786  -0.729  15.990  1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -11.707 1.948   17.369  1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -9.119  1.838   15.977  1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -9.347  0.065   17.783  1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -10.649 -0.629  16.816  1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -9.180  -0.968  15.149  1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -10.155 1.068   13.796  1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -10.823 0.925   12.516  1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -10.573 2.104   11.597  1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -10.611 3.256   12.029  1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -9.176  1.072   13.838  1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -10.468 0.026   12.035  1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -11.886 0.835   12.685  1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -10.314 1.817   10.325  1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -10.051 2.863   9.343   1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -10.765 2.566   8.029   1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -11.254 1.457   7.811   1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -8.546  2.997   9.100   1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -8.068  1.948   8.276   1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -10.297 0.879   10.041  1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -10.426 3.794   9.742   1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -8.345  3.940   8.616   1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -8.027  2.960   10.047  1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -7.242  2.215   7.865   1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -10.822 3.566   7.154   1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -11.480 3.415   5.862   1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -11.272 2.008   5.308   1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -12.221 1.348   4.887   1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -10.947 4.450   4.870   1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -9.554  4.289   4.664   1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -10.414 4.426   7.386   1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -12.537 3.579   6.007   1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -11.454 4.334   3.925   1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -11.129 5.442   5.257   1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -9.127  4.091   5.501   1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -10.021 1.557   5.310   1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -9.709  0.233   4.805   1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -9.717  -0.820  5.896   1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -9.448  -0.520  7.059   1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -9.304  2.128   5.658   1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -10.438 -0.035  4.055   1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -8.730  0.255   4.350   1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . SER A 1 8  ? -10.027 -2.057  5.520   1.00 0.00 ? 8   SER A N    1  
ATOM   67    C  CA   . SER A 1 8  ? -10.074 -3.157  6.476   1.00 0.00 ? 8   SER A CA   1  
ATOM   68    C  C    . SER A 1 8  ? -9.220  -4.327  6.000   1.00 0.00 ? 8   SER A C    1  
ATOM   69    O  O    . SER A 1 8  ? -9.457  -4.890  4.930   1.00 0.00 ? 8   SER A O    1  
ATOM   70    C  CB   . SER A 1 8  ? -11.518 -3.617  6.686   1.00 0.00 ? 8   SER A CB   1  
ATOM   71    O  OG   . SER A 1 8  ? -11.854 -4.666  5.795   1.00 0.00 ? 8   SER A OG   1  
ATOM   72    H  H    . SER A 1 8  ? -10.232 -2.233  4.578   1.00 0.00 ? 8   SER A H    1  
ATOM   73    H  HA   . SER A 1 8  ? -9.681  -2.797  7.415   1.00 0.00 ? 8   SER A HA   1  
ATOM   74    H  HB2  . SER A 1 8  ? -11.638 -3.969  7.699   1.00 0.00 ? 8   SER A HB2  1  
ATOM   75    H  HB3  . SER A 1 8  ? -12.187 -2.786  6.512   1.00 0.00 ? 8   SER A HB3  1  
ATOM   76    H  HG   . SER A 1 8  ? -11.348 -4.572  4.984   1.00 0.00 ? 8   SER A HG   1  
ATOM   77    N  N    . LEU A 1 9  ? -8.225  -4.690  6.802   1.00 0.00 ? 9   LEU A N    1  
ATOM   78    C  CA   . LEU A 1 9  ? -7.333  -5.794  6.464   1.00 0.00 ? 9   LEU A CA   1  
ATOM   79    C  C    . LEU A 1 9  ? -8.127  -7.055  6.138   1.00 0.00 ? 9   LEU A C    1  
ATOM   80    O  O    . LEU A 1 9  ? -8.759  -7.645  7.013   1.00 0.00 ? 9   LEU A O    1  
ATOM   81    C  CB   . LEU A 1 9  ? -6.369  -6.069  7.620   1.00 0.00 ? 9   LEU A CB   1  
ATOM   82    C  CG   . LEU A 1 9  ? -5.458  -4.910  8.024   1.00 0.00 ? 9   LEU A CG   1  
ATOM   83    C  CD1  . LEU A 1 9  ? -4.725  -5.233  9.317   1.00 0.00 ? 9   LEU A CD1  1  
ATOM   84    C  CD2  . LEU A 1 9  ? -4.468  -4.597  6.912   1.00 0.00 ? 9   LEU A CD2  1  
ATOM   85    H  H    . LEU A 1 9  ? -8.085  -4.204  7.642   1.00 0.00 ? 9   LEU A H    1  
ATOM   86    H  HA   . LEU A 1 9  ? -6.764  -5.505  5.593   1.00 0.00 ? 9   LEU A HA   1  
ATOM   87    H  HB2  . LEU A 1 9  ? -6.957  -6.343  8.483   1.00 0.00 ? 9   LEU A HB2  1  
ATOM   88    H  HB3  . LEU A 1 9  ? -5.742  -6.901  7.335   1.00 0.00 ? 9   LEU A HB3  1  
ATOM   89    H  HG   . LEU A 1 9  ? -6.060  -4.028  8.195   1.00 0.00 ? 9   LEU A HG   1  
ATOM   90    H  HD11 . LEU A 1 9  ? -5.443  -5.406  10.104  1.00 0.00 ? 9   LEU A HD11 1  
ATOM   91    H  HD12 . LEU A 1 9  ? -4.088  -4.404  9.587   1.00 0.00 ? 9   LEU A HD12 1  
ATOM   92    H  HD13 . LEU A 1 9  ? -4.122  -6.119  9.177   1.00 0.00 ? 9   LEU A HD13 1  
ATOM   93    H  HD21 . LEU A 1 9  ? -4.083  -3.597  7.043   1.00 0.00 ? 9   LEU A HD21 1  
ATOM   94    H  HD22 . LEU A 1 9  ? -4.966  -4.669  5.957   1.00 0.00 ? 9   LEU A HD22 1  
ATOM   95    H  HD23 . LEU A 1 9  ? -3.652  -5.305  6.946   1.00 0.00 ? 9   LEU A HD23 1  
ATOM   96    N  N    . MET A 1 10 ? -8.087  -7.462  4.873   1.00 0.00 ? 10  MET A N    1  
ATOM   97    C  CA   . MET A 1 10 ? -8.800  -8.655  4.433   1.00 0.00 ? 10  MET A CA   1  
ATOM   98    C  C    . MET A 1 10 ? -7.941  -9.901  4.618   1.00 0.00 ? 10  MET A C    1  
ATOM   99    O  O    . MET A 1 10 ? -6.794  -9.816  5.056   1.00 0.00 ? 10  MET A O    1  
ATOM   100   C  CB   . MET A 1 10 ? -9.210  -8.517  2.965   1.00 0.00 ? 10  MET A CB   1  
ATOM   101   C  CG   . MET A 1 10 ? -10.238 -7.425  2.721   1.00 0.00 ? 10  MET A CG   1  
ATOM   102   S  SD   . MET A 1 10 ? -11.933 -8.019  2.878   1.00 0.00 ? 10  MET A SD   1  
ATOM   103   C  CE   . MET A 1 10 ? -12.608 -7.541  1.289   1.00 0.00 ? 10  MET A CE   1  
ATOM   104   H  H    . MET A 1 10 ? -7.566  -6.949  4.221   1.00 0.00 ? 10  MET A H    1  
ATOM   105   H  HA   . MET A 1 10 ? -9.689  -8.751  5.037   1.00 0.00 ? 10  MET A HA   1  
ATOM   106   H  HB2  . MET A 1 10 ? -8.332  -8.292  2.378   1.00 0.00 ? 10  MET A HB2  1  
ATOM   107   H  HB3  . MET A 1 10 ? -9.627  -9.455  2.630   1.00 0.00 ? 10  MET A HB3  1  
ATOM   108   H  HG2  . MET A 1 10 ? -10.082 -6.634  3.439   1.00 0.00 ? 10  MET A HG2  1  
ATOM   109   H  HG3  . MET A 1 10 ? -10.099 -7.035  1.723   1.00 0.00 ? 10  MET A HG3  1  
ATOM   110   H  HE1  . MET A 1 10 ? -12.722 -8.418  0.669   1.00 0.00 ? 10  MET A HE1  1  
ATOM   111   H  HE2  . MET A 1 10 ? -13.572 -7.074  1.433   1.00 0.00 ? 10  MET A HE2  1  
ATOM   112   H  HE3  . MET A 1 10 ? -11.938 -6.844  0.809   1.00 0.00 ? 10  MET A HE3  1  
ATOM   113   N  N    . ASP A 1 11 ? -8.503  -11.057 4.282   1.00 0.00 ? 11  ASP A N    1  
ATOM   114   C  CA   . ASP A 1 11 ? -7.788  -12.321 4.411   1.00 0.00 ? 11  ASP A CA   1  
ATOM   115   C  C    . ASP A 1 11 ? -6.820  -12.519 3.249   1.00 0.00 ? 11  ASP A C    1  
ATOM   116   O  O    . ASP A 1 11 ? -6.273  -13.606 3.060   1.00 0.00 ? 11  ASP A O    1  
ATOM   117   C  CB   . ASP A 1 11 ? -8.776  -13.487 4.472   1.00 0.00 ? 11  ASP A CB   1  
ATOM   118   C  CG   . ASP A 1 11 ? -9.912  -13.335 3.479   1.00 0.00 ? 11  ASP A CG   1  
ATOM   119   O  OD1  . ASP A 1 11 ? -9.692  -12.722 2.414   1.00 0.00 ? 11  ASP A OD1  1  
ATOM   120   O  OD2  . ASP A 1 11 ? -11.021 -13.831 3.767   1.00 0.00 ? 11  ASP A OD2  1  
ATOM   121   H  H    . ASP A 1 11 ? -9.421  -11.060 3.939   1.00 0.00 ? 11  ASP A H    1  
ATOM   122   H  HA   . ASP A 1 11 ? -7.225  -12.291 5.331   1.00 0.00 ? 11  ASP A HA   1  
ATOM   123   H  HB2  . ASP A 1 11 ? -8.252  -14.406 4.253   1.00 0.00 ? 11  ASP A HB2  1  
ATOM   124   H  HB3  . ASP A 1 11 ? -9.195  -13.544 5.465   1.00 0.00 ? 11  ASP A HB3  1  
ATOM   125   N  N    . VAL A 1 12 ? -6.612  -11.461 2.472   1.00 0.00 ? 12  VAL A N    1  
ATOM   126   C  CA   . VAL A 1 12 ? -5.710  -11.517 1.328   1.00 0.00 ? 12  VAL A CA   1  
ATOM   127   C  C    . VAL A 1 12 ? -4.347  -10.927 1.673   1.00 0.00 ? 12  VAL A C    1  
ATOM   128   O  O    . VAL A 1 12 ? -4.255  -9.841  2.245   1.00 0.00 ? 12  VAL A O    1  
ATOM   129   C  CB   . VAL A 1 12 ? -6.291  -10.764 0.117   1.00 0.00 ? 12  VAL A CB   1  
ATOM   130   C  CG1  . VAL A 1 12 ? -5.326  -10.815 -1.058  1.00 0.00 ? 12  VAL A CG1  1  
ATOM   131   C  CG2  . VAL A 1 12 ? -7.644  -11.342 -0.270  1.00 0.00 ? 12  VAL A CG2  1  
ATOM   132   H  H    . VAL A 1 12 ? -7.077  -10.621 2.673   1.00 0.00 ? 12  VAL A H    1  
ATOM   133   H  HA   . VAL A 1 12 ? -5.583  -12.554 1.053   1.00 0.00 ? 12  VAL A HA   1  
ATOM   134   H  HB   . VAL A 1 12 ? -6.431  -9.730  0.395   1.00 0.00 ? 12  VAL A HB   1  
ATOM   135   H  HG11 . VAL A 1 12 ? -4.519  -10.116 -0.890  1.00 0.00 ? 12  VAL A HG11 1  
ATOM   136   H  HG12 . VAL A 1 12 ? -4.925  -11.813 -1.152  1.00 0.00 ? 12  VAL A HG12 1  
ATOM   137   H  HG13 . VAL A 1 12 ? -5.848  -10.549 -1.965  1.00 0.00 ? 12  VAL A HG13 1  
ATOM   138   H  HG21 . VAL A 1 12 ? -8.413  -10.906 0.350   1.00 0.00 ? 12  VAL A HG21 1  
ATOM   139   H  HG22 . VAL A 1 12 ? -7.847  -11.119 -1.307  1.00 0.00 ? 12  VAL A HG22 1  
ATOM   140   H  HG23 . VAL A 1 12 ? -7.633  -12.413 -0.128  1.00 0.00 ? 12  VAL A HG23 1  
ATOM   141   N  N    . LYS A 1 13 ? -3.289  -11.650 1.321   1.00 0.00 ? 13  LYS A N    1  
ATOM   142   C  CA   . LYS A 1 13 ? -1.930  -11.198 1.591   1.00 0.00 ? 13  LYS A CA   1  
ATOM   143   C  C    . LYS A 1 13 ? -1.549  -10.039 0.676   1.00 0.00 ? 13  LYS A C    1  
ATOM   144   O  O    . LYS A 1 13 ? -2.035  -9.939  -0.451  1.00 0.00 ? 13  LYS A O    1  
ATOM   145   C  CB   . LYS A 1 13 ? -0.941  -12.352 1.407   1.00 0.00 ? 13  LYS A CB   1  
ATOM   146   C  CG   . LYS A 1 13 ? -0.937  -13.339 2.562   1.00 0.00 ? 13  LYS A CG   1  
ATOM   147   C  CD   . LYS A 1 13 ? -2.046  -14.368 2.420   1.00 0.00 ? 13  LYS A CD   1  
ATOM   148   C  CE   . LYS A 1 13 ? -1.695  -15.429 1.389   1.00 0.00 ? 13  LYS A CE   1  
ATOM   149   N  NZ   . LYS A 1 13 ? -2.522  -16.656 1.552   1.00 0.00 ? 13  LYS A NZ   1  
ATOM   150   H  H    . LYS A 1 13 ? -3.427  -12.508 0.867   1.00 0.00 ? 13  LYS A H    1  
ATOM   151   H  HA   . LYS A 1 13 ? -1.889  -10.861 2.616   1.00 0.00 ? 13  LYS A HA   1  
ATOM   152   H  HB2  . LYS A 1 13 ? -1.195  -12.888 0.504   1.00 0.00 ? 13  LYS A HB2  1  
ATOM   153   H  HB3  . LYS A 1 13 ? 0.054   -11.945 1.306   1.00 0.00 ? 13  LYS A HB3  1  
ATOM   154   H  HG2  . LYS A 1 13 ? 0.014   -13.852 2.582   1.00 0.00 ? 13  LYS A HG2  1  
ATOM   155   H  HG3  . LYS A 1 13 ? -1.076  -12.798 3.487   1.00 0.00 ? 13  LYS A HG3  1  
ATOM   156   H  HD2  . LYS A 1 13 ? -2.204  -14.848 3.374   1.00 0.00 ? 13  LYS A HD2  1  
ATOM   157   H  HD3  . LYS A 1 13 ? -2.953  -13.866 2.113   1.00 0.00 ? 13  LYS A HD3  1  
ATOM   158   H  HE2  . LYS A 1 13 ? -1.860  -15.022 0.403   1.00 0.00 ? 13  LYS A HE2  1  
ATOM   159   H  HE3  . LYS A 1 13 ? -0.653  -15.689 1.501   1.00 0.00 ? 13  LYS A HE3  1  
ATOM   160   H  HZ1  . LYS A 1 13 ? -2.644  -17.130 0.634   1.00 0.00 ? 13  LYS A HZ1  1  
ATOM   161   H  HZ2  . LYS A 1 13 ? -3.458  -16.408 1.930   1.00 0.00 ? 13  LYS A HZ2  1  
ATOM   162   H  HZ3  . LYS A 1 13 ? -2.058  -17.315 2.210   1.00 0.00 ? 13  LYS A HZ3  1  
ATOM   163   N  N    . CYS A 1 14 ? -0.677  -9.165  1.167   1.00 0.00 ? 14  CYS A N    1  
ATOM   164   C  CA   . CYS A 1 14 ? -0.231  -8.013  0.394   1.00 0.00 ? 14  CYS A CA   1  
ATOM   165   C  C    . CYS A 1 14 ? 0.276   -8.443  -0.980  1.00 0.00 ? 14  CYS A C    1  
ATOM   166   O  O    . CYS A 1 14 ? 0.918   -9.483  -1.117  1.00 0.00 ? 14  CYS A O    1  
ATOM   167   C  CB   . CYS A 1 14 ? 0.872   -7.264  1.145   1.00 0.00 ? 14  CYS A CB   1  
ATOM   168   S  SG   . CYS A 1 14 ? 1.581   -5.862  0.223   1.00 0.00 ? 14  CYS A SG   1  
ATOM   169   H  H    . CYS A 1 14 ? -0.325  -9.298  2.073   1.00 0.00 ? 14  CYS A H    1  
ATOM   170   H  HA   . CYS A 1 14 ? -1.075  -7.354  0.262   1.00 0.00 ? 14  CYS A HA   1  
ATOM   171   H  HB2  . CYS A 1 14 ? 0.469   -6.878  2.070   1.00 0.00 ? 14  CYS A HB2  1  
ATOM   172   H  HB3  . CYS A 1 14 ? 1.675   -7.951  1.368   1.00 0.00 ? 14  CYS A HB3  1  
ATOM   173   N  N    . GLU A 1 15 ? -0.017  -7.633  -1.993  1.00 0.00 ? 15  GLU A N    1  
ATOM   174   C  CA   . GLU A 1 15 ? 0.408   -7.931  -3.355  1.00 0.00 ? 15  GLU A CA   1  
ATOM   175   C  C    . GLU A 1 15 ? 1.811   -8.532  -3.368  1.00 0.00 ? 15  GLU A C    1  
ATOM   176   O  O    . GLU A 1 15 ? 2.010   -9.665  -3.808  1.00 0.00 ? 15  GLU A O    1  
ATOM   177   C  CB   . GLU A 1 15 ? 0.377   -6.663  -4.212  1.00 0.00 ? 15  GLU A CB   1  
ATOM   178   C  CG   . GLU A 1 15 ? 0.576   -6.926  -5.695  1.00 0.00 ? 15  GLU A CG   1  
ATOM   179   C  CD   . GLU A 1 15 ? 1.954   -7.475  -6.010  1.00 0.00 ? 15  GLU A CD   1  
ATOM   180   O  OE1  . GLU A 1 15 ? 2.950   -6.788  -5.702  1.00 0.00 ? 15  GLU A OE1  1  
ATOM   181   O  OE2  . GLU A 1 15 ? 2.036   -8.590  -6.565  1.00 0.00 ? 15  GLU A OE2  1  
ATOM   182   H  H    . GLU A 1 15 ? -0.533  -6.818  -1.820  1.00 0.00 ? 15  GLU A H    1  
ATOM   183   H  HA   . GLU A 1 15 ? -0.282  -8.651  -3.769  1.00 0.00 ? 15  GLU A HA   1  
ATOM   184   H  HB2  . GLU A 1 15 ? -0.578  -6.176  -4.078  1.00 0.00 ? 15  GLU A HB2  1  
ATOM   185   H  HB3  . GLU A 1 15 ? 1.159   -5.998  -3.877  1.00 0.00 ? 15  GLU A HB3  1  
ATOM   186   H  HG2  . GLU A 1 15 ? -0.164  -7.641  -6.024  1.00 0.00 ? 15  GLU A HG2  1  
ATOM   187   H  HG3  . GLU A 1 15 ? 0.442   -5.998  -6.233  1.00 0.00 ? 15  GLU A HG3  1  
ATOM   188   N  N    . THR A 1 16 ? 2.782   -7.764  -2.883  1.00 0.00 ? 16  THR A N    1  
ATOM   189   C  CA   . THR A 1 16 ? 4.166   -8.218  -2.840  1.00 0.00 ? 16  THR A CA   1  
ATOM   190   C  C    . THR A 1 16 ? 4.277   -9.579  -2.162  1.00 0.00 ? 16  THR A C    1  
ATOM   191   O  O    . THR A 1 16 ? 3.848   -9.768  -1.023  1.00 0.00 ? 16  THR A O    1  
ATOM   192   C  CB   . THR A 1 16 ? 5.065   -7.212  -2.098  1.00 0.00 ? 16  THR A CB   1  
ATOM   193   O  OG1  . THR A 1 16 ? 5.070   -5.957  -2.788  1.00 0.00 ? 16  THR A OG1  1  
ATOM   194   C  CG2  . THR A 1 16 ? 6.487   -7.738  -1.982  1.00 0.00 ? 16  THR A CG2  1  
ATOM   195   H  H    . THR A 1 16 ? 2.560   -6.870  -2.548  1.00 0.00 ? 16  THR A H    1  
ATOM   196   H  HA   . THR A 1 16 ? 4.521   -8.304  -3.857  1.00 0.00 ? 16  THR A HA   1  
ATOM   197   H  HB   . THR A 1 16 ? 4.669   -7.065  -1.103  1.00 0.00 ? 16  THR A HB   1  
ATOM   198   H  HG1  . THR A 1 16 ? 4.434   -5.364  -2.380  1.00 0.00 ? 16  THR A HG1  1  
ATOM   199   H  HG21 . THR A 1 16 ? 6.610   -8.586  -2.639  1.00 0.00 ? 16  THR A HG21 1  
ATOM   200   H  HG22 . THR A 1 16 ? 6.677   -8.042  -0.963  1.00 0.00 ? 16  THR A HG22 1  
ATOM   201   H  HG23 . THR A 1 16 ? 7.182   -6.961  -2.262  1.00 0.00 ? 16  THR A HG23 1  
ATOM   202   N  N    . PRO A 1 17 ? 4.867   -10.550 -2.874  1.00 0.00 ? 17  PRO A N    1  
ATOM   203   C  CA   . PRO A 1 17 ? 5.050   -11.910 -2.359  1.00 0.00 ? 17  PRO A CA   1  
ATOM   204   C  C    . PRO A 1 17 ? 6.081   -11.972 -1.238  1.00 0.00 ? 17  PRO A C    1  
ATOM   205   O  O    . PRO A 1 17 ? 6.340   -13.036 -0.677  1.00 0.00 ? 17  PRO A O    1  
ATOM   206   C  CB   . PRO A 1 17 ? 5.542   -12.689 -3.581  1.00 0.00 ? 17  PRO A CB   1  
ATOM   207   C  CG   . PRO A 1 17 ? 6.180   -11.663 -4.453  1.00 0.00 ? 17  PRO A CG   1  
ATOM   208   C  CD   . PRO A 1 17 ? 5.402   -10.395 -4.237  1.00 0.00 ? 17  PRO A CD   1  
ATOM   209   H  HA   . PRO A 1 17 ? 4.118   -12.332 -2.013  1.00 0.00 ? 17  PRO A HA   1  
ATOM   210   H  HB2  . PRO A 1 17 ? 6.253   -13.441 -3.270  1.00 0.00 ? 17  PRO A HB2  1  
ATOM   211   H  HB3  . PRO A 1 17 ? 4.704   -13.159 -4.074  1.00 0.00 ? 17  PRO A HB3  1  
ATOM   212   H  HG2  . PRO A 1 17 ? 7.211   -11.525 -4.163  1.00 0.00 ? 17  PRO A HG2  1  
ATOM   213   H  HG3  . PRO A 1 17 ? 6.118   -11.970 -5.486  1.00 0.00 ? 17  PRO A HG3  1  
ATOM   214   H  HD2  . PRO A 1 17 ? 6.054   -9.536  -4.300  1.00 0.00 ? 17  PRO A HD2  1  
ATOM   215   H  HD3  . PRO A 1 17 ? 4.601   -10.316 -4.958  1.00 0.00 ? 17  PRO A HD3  1  
ATOM   216   N  N    . ASN A 1 18 ? 6.667   -10.823 -0.915  1.00 0.00 ? 18  ASN A N    1  
ATOM   217   C  CA   . ASN A 1 18 ? 7.671   -10.747 0.141   1.00 0.00 ? 18  ASN A CA   1  
ATOM   218   C  C    . ASN A 1 18 ? 7.104   -10.064 1.382   1.00 0.00 ? 18  ASN A C    1  
ATOM   219   O  O    . ASN A 1 18 ? 7.655   -10.186 2.477   1.00 0.00 ? 18  ASN A O    1  
ATOM   220   C  CB   . ASN A 1 18 ? 8.904   -9.990  -0.354  1.00 0.00 ? 18  ASN A CB   1  
ATOM   221   C  CG   . ASN A 1 18 ? 9.432   -10.537 -1.666  1.00 0.00 ? 18  ASN A CG   1  
ATOM   222   O  OD1  . ASN A 1 18 ? 9.429   -9.847  -2.685  1.00 0.00 ? 18  ASN A OD1  1  
ATOM   223   N  ND2  . ASN A 1 18 ? 9.887   -11.784 -1.646  1.00 0.00 ? 18  ASN A ND2  1  
ATOM   224   H  H    . ASN A 1 18 ? 6.419   -10.007 -1.398  1.00 0.00 ? 18  ASN A H    1  
ATOM   225   H  HA   . ASN A 1 18 ? 7.958   -11.756 0.398   1.00 0.00 ? 18  ASN A HA   1  
ATOM   226   H  HB2  . ASN A 1 18 ? 8.647   -8.950  -0.497  1.00 0.00 ? 18  ASN A HB2  1  
ATOM   227   H  HB3  . ASN A 1 18 ? 9.686   -10.064 0.387   1.00 0.00 ? 18  ASN A HB3  1  
ATOM   228   H  HD21 . ASN A 1 18 ? 9.858   -12.275 -0.798  1.00 0.00 ? 18  ASN A HD21 1  
ATOM   229   H  HD22 . ASN A 1 18 ? 10.235  -12.163 -2.481  1.00 0.00 ? 18  ASN A HD22 1  
ATOM   230   N  N    . CYS A 1 19 ? 6.000   -9.346  1.204   1.00 0.00 ? 19  CYS A N    1  
ATOM   231   C  CA   . CYS A 1 19 ? 5.358   -8.644  2.308   1.00 0.00 ? 19  CYS A CA   1  
ATOM   232   C  C    . CYS A 1 19 ? 4.419   -9.573  3.072   1.00 0.00 ? 19  CYS A C    1  
ATOM   233   O  O    . CYS A 1 19 ? 3.369   -9.981  2.575   1.00 0.00 ? 19  CYS A O    1  
ATOM   234   C  CB   . CYS A 1 19 ? 4.582   -7.433  1.786   1.00 0.00 ? 19  CYS A CB   1  
ATOM   235   S  SG   . CYS A 1 19 ? 4.141   -6.221  3.074   1.00 0.00 ? 19  CYS A SG   1  
ATOM   236   H  H    . CYS A 1 19 ? 5.608   -9.287  0.307   1.00 0.00 ? 19  CYS A H    1  
ATOM   237   H  HA   . CYS A 1 19 ? 6.131   -8.303  2.979   1.00 0.00 ? 19  CYS A HA   1  
ATOM   238   H  HB2  . CYS A 1 19 ? 5.181   -6.922  1.047   1.00 0.00 ? 19  CYS A HB2  1  
ATOM   239   H  HB3  . CYS A 1 19 ? 3.665   -7.773  1.327   1.00 0.00 ? 19  CYS A HB3  1  
ATOM   240   N  N    . PRO A 1 20 ? 4.805   -9.917  4.309   1.00 0.00 ? 20  PRO A N    1  
ATOM   241   C  CA   . PRO A 1 20 ? 4.012   -10.801 5.168   1.00 0.00 ? 20  PRO A CA   1  
ATOM   242   C  C    . PRO A 1 20 ? 2.724   -10.141 5.648   1.00 0.00 ? 20  PRO A C    1  
ATOM   243   O  O    . PRO A 1 20 ? 1.863   -10.794 6.239   1.00 0.00 ? 20  PRO A O    1  
ATOM   244   C  CB   . PRO A 1 20 ? 4.944   -11.076 6.351   1.00 0.00 ? 20  PRO A CB   1  
ATOM   245   C  CG   . PRO A 1 20 ? 5.858   -9.900  6.394   1.00 0.00 ? 20  PRO A CG   1  
ATOM   246   C  CD   . PRO A 1 20 ? 6.045   -9.469  4.965   1.00 0.00 ? 20  PRO A CD   1  
ATOM   247   H  HA   . PRO A 1 20 ? 3.776   -11.731 4.671   1.00 0.00 ? 20  PRO A HA   1  
ATOM   248   H  HB2  . PRO A 1 20 ? 4.363   -11.159 7.259   1.00 0.00 ? 20  PRO A HB2  1  
ATOM   249   H  HB3  . PRO A 1 20 ? 5.488   -11.993 6.181   1.00 0.00 ? 20  PRO A HB3  1  
ATOM   250   H  HG2  . PRO A 1 20 ? 5.409   -9.106  6.970   1.00 0.00 ? 20  PRO A HG2  1  
ATOM   251   H  HG3  . PRO A 1 20 ? 6.806   -10.188 6.824   1.00 0.00 ? 20  PRO A HG3  1  
ATOM   252   H  HD2  . PRO A 1 20 ? 6.146   -8.395  4.906   1.00 0.00 ? 20  PRO A HD2  1  
ATOM   253   H  HD3  . PRO A 1 20 ? 6.907   -9.955  4.533   1.00 0.00 ? 20  PRO A HD3  1  
ATOM   254   N  N    . PHE A 1 21 ? 2.597   -8.844  5.389   1.00 0.00 ? 21  PHE A N    1  
ATOM   255   C  CA   . PHE A 1 21 ? 1.413   -8.096  5.794   1.00 0.00 ? 21  PHE A CA   1  
ATOM   256   C  C    . PHE A 1 21 ? 0.295   -8.248  4.767   1.00 0.00 ? 21  PHE A C    1  
ATOM   257   O  O    . PHE A 1 21 ? 0.549   -8.504  3.589   1.00 0.00 ? 21  PHE A O    1  
ATOM   258   C  CB   . PHE A 1 21 ? 1.756   -6.616  5.976   1.00 0.00 ? 21  PHE A CB   1  
ATOM   259   C  CG   . PHE A 1 21 ? 2.642   -6.347  7.159   1.00 0.00 ? 21  PHE A CG   1  
ATOM   260   C  CD1  . PHE A 1 21 ? 2.136   -6.407  8.447   1.00 0.00 ? 21  PHE A CD1  1  
ATOM   261   C  CD2  . PHE A 1 21 ? 3.980   -6.033  6.983   1.00 0.00 ? 21  PHE A CD2  1  
ATOM   262   C  CE1  . PHE A 1 21 ? 2.948   -6.160  9.538   1.00 0.00 ? 21  PHE A CE1  1  
ATOM   263   C  CE2  . PHE A 1 21 ? 4.796   -5.786  8.070   1.00 0.00 ? 21  PHE A CE2  1  
ATOM   264   C  CZ   . PHE A 1 21 ? 4.280   -5.848  9.349   1.00 0.00 ? 21  PHE A CZ   1  
ATOM   265   H  H    . PHE A 1 21 ? 3.317   -8.379  4.914   1.00 0.00 ? 21  PHE A H    1  
ATOM   266   H  HA   . PHE A 1 21 ? 1.075   -8.497  6.737   1.00 0.00 ? 21  PHE A HA   1  
ATOM   267   H  HB2  . PHE A 1 21 ? 2.267   -6.261  5.093   1.00 0.00 ? 21  PHE A HB2  1  
ATOM   268   H  HB3  . PHE A 1 21 ? 0.843   -6.056  6.108   1.00 0.00 ? 21  PHE A HB3  1  
ATOM   269   H  HD1  . PHE A 1 21 ? 1.093   -6.651  8.597   1.00 0.00 ? 21  PHE A HD1  1  
ATOM   270   H  HD2  . PHE A 1 21 ? 4.385   -5.983  5.983   1.00 0.00 ? 21  PHE A HD2  1  
ATOM   271   H  HE1  . PHE A 1 21 ? 2.540   -6.210  10.537  1.00 0.00 ? 21  PHE A HE1  1  
ATOM   272   H  HE2  . PHE A 1 21 ? 5.837   -5.542  7.919   1.00 0.00 ? 21  PHE A HE2  1  
ATOM   273   H  HZ   . PHE A 1 21 ? 4.916   -5.656  10.200  1.00 0.00 ? 21  PHE A HZ   1  
ATOM   274   N  N    . PHE A 1 22 ? -0.944  -8.089  5.221   1.00 0.00 ? 22  PHE A N    1  
ATOM   275   C  CA   . PHE A 1 22 ? -2.101  -8.210  4.343   1.00 0.00 ? 22  PHE A CA   1  
ATOM   276   C  C    . PHE A 1 22 ? -2.457  -6.861  3.723   1.00 0.00 ? 22  PHE A C    1  
ATOM   277   O  O    . PHE A 1 22 ? -2.083  -5.810  4.242   1.00 0.00 ? 22  PHE A O    1  
ATOM   278   C  CB   . PHE A 1 22 ? -3.301  -8.760  5.118   1.00 0.00 ? 22  PHE A CB   1  
ATOM   279   C  CG   . PHE A 1 22 ? -3.068  -10.130 5.688   1.00 0.00 ? 22  PHE A CG   1  
ATOM   280   C  CD1  . PHE A 1 22 ? -3.328  -11.263 4.934   1.00 0.00 ? 22  PHE A CD1  1  
ATOM   281   C  CD2  . PHE A 1 22 ? -2.589  -10.285 6.979   1.00 0.00 ? 22  PHE A CD2  1  
ATOM   282   C  CE1  . PHE A 1 22 ? -3.115  -12.524 5.457   1.00 0.00 ? 22  PHE A CE1  1  
ATOM   283   C  CE2  . PHE A 1 22 ? -2.375  -11.544 7.508   1.00 0.00 ? 22  PHE A CE2  1  
ATOM   284   C  CZ   . PHE A 1 22 ? -2.637  -12.665 6.745   1.00 0.00 ? 22  PHE A CZ   1  
ATOM   285   H  H    . PHE A 1 22 ? -1.082  -7.886  6.170   1.00 0.00 ? 22  PHE A H    1  
ATOM   286   H  HA   . PHE A 1 22 ? -1.847  -8.899  3.553   1.00 0.00 ? 22  PHE A HA   1  
ATOM   287   H  HB2  . PHE A 1 22 ? -3.528  -8.094  5.936   1.00 0.00 ? 22  PHE A HB2  1  
ATOM   288   H  HB3  . PHE A 1 22 ? -4.152  -8.815  4.457   1.00 0.00 ? 22  PHE A HB3  1  
ATOM   289   H  HD1  . PHE A 1 22 ? -3.701  -11.154 3.926   1.00 0.00 ? 22  PHE A HD1  1  
ATOM   290   H  HD2  . PHE A 1 22 ? -2.384  -9.408  7.577   1.00 0.00 ? 22  PHE A HD2  1  
ATOM   291   H  HE1  . PHE A 1 22 ? -3.321  -13.399 4.859   1.00 0.00 ? 22  PHE A HE1  1  
ATOM   292   H  HE2  . PHE A 1 22 ? -2.001  -11.650 8.516   1.00 0.00 ? 22  PHE A HE2  1  
ATOM   293   H  HZ   . PHE A 1 22 ? -2.471  -13.649 7.156   1.00 0.00 ? 22  PHE A HZ   1  
ATOM   294   N  N    . MET A 1 23 ? -3.182  -6.901  2.610   1.00 0.00 ? 23  MET A N    1  
ATOM   295   C  CA   . MET A 1 23 ? -3.590  -5.683  1.920   1.00 0.00 ? 23  MET A CA   1  
ATOM   296   C  C    . MET A 1 23 ? -4.986  -5.251  2.357   1.00 0.00 ? 23  MET A C    1  
ATOM   297   O  O    . MET A 1 23 ? -5.930  -6.040  2.319   1.00 0.00 ? 23  MET A O    1  
ATOM   298   C  CB   . MET A 1 23 ? -3.560  -5.896  0.405   1.00 0.00 ? 23  MET A CB   1  
ATOM   299   C  CG   . MET A 1 23 ? -4.251  -7.173  -0.043  1.00 0.00 ? 23  MET A CG   1  
ATOM   300   S  SD   . MET A 1 23 ? -4.886  -7.065  -1.727  1.00 0.00 ? 23  MET A SD   1  
ATOM   301   C  CE   . MET A 1 23 ? -3.690  -8.070  -2.604  1.00 0.00 ? 23  MET A CE   1  
ATOM   302   H  H    . MET A 1 23 ? -3.451  -7.770  2.244   1.00 0.00 ? 23  MET A H    1  
ATOM   303   H  HA   . MET A 1 23 ? -2.887  -4.905  2.179   1.00 0.00 ? 23  MET A HA   1  
ATOM   304   H  HB2  . MET A 1 23 ? -4.049  -5.060  -0.073  1.00 0.00 ? 23  MET A HB2  1  
ATOM   305   H  HB3  . MET A 1 23 ? -2.532  -5.935  0.079   1.00 0.00 ? 23  MET A HB3  1  
ATOM   306   H  HG2  . MET A 1 23 ? -3.544  -7.987  0.008   1.00 0.00 ? 23  MET A HG2  1  
ATOM   307   H  HG3  . MET A 1 23 ? -5.075  -7.373  0.626   1.00 0.00 ? 23  MET A HG3  1  
ATOM   308   H  HE1  . MET A 1 23 ? -2.834  -7.464  -2.866  1.00 0.00 ? 23  MET A HE1  1  
ATOM   309   H  HE2  . MET A 1 23 ? -3.374  -8.887  -1.973  1.00 0.00 ? 23  MET A HE2  1  
ATOM   310   H  HE3  . MET A 1 23 ? -4.141  -8.464  -3.503  1.00 0.00 ? 23  MET A HE3  1  
ATOM   311   N  N    . SER A 1 24 ? -5.108  -3.994  2.773   1.00 0.00 ? 24  SER A N    1  
ATOM   312   C  CA   . SER A 1 24 ? -6.389  -3.459  3.221   1.00 0.00 ? 24  SER A CA   1  
ATOM   313   C  C    . SER A 1 24 ? -7.312  -3.194  2.036   1.00 0.00 ? 24  SER A C    1  
ATOM   314   O  O    . SER A 1 24 ? -6.923  -3.365  0.881   1.00 0.00 ? 24  SER A O    1  
ATOM   315   C  CB   . SER A 1 24 ? -6.176  -2.169  4.015   1.00 0.00 ? 24  SER A CB   1  
ATOM   316   O  OG   . SER A 1 24 ? -7.175  -2.010  5.008   1.00 0.00 ? 24  SER A OG   1  
ATOM   317   H  H    . SER A 1 24 ? -4.318  -3.414  2.780   1.00 0.00 ? 24  SER A H    1  
ATOM   318   H  HA   . SER A 1 24 ? -6.849  -4.195  3.864   1.00 0.00 ? 24  SER A HA   1  
ATOM   319   H  HB2  . SER A 1 24 ? -5.210  -2.200  4.495   1.00 0.00 ? 24  SER A HB2  1  
ATOM   320   H  HB3  . SER A 1 24 ? -6.217  -1.325  3.342   1.00 0.00 ? 24  SER A HB3  1  
ATOM   321   H  HG   . SER A 1 24 ? -7.000  -2.610  5.736   1.00 0.00 ? 24  SER A HG   1  
ATOM   322   N  N    . VAL A 1 25 ? -8.539  -2.776  2.332   1.00 0.00 ? 25  VAL A N    1  
ATOM   323   C  CA   . VAL A 1 25 ? -9.519  -2.486  1.292   1.00 0.00 ? 25  VAL A CA   1  
ATOM   324   C  C    . VAL A 1 25 ? -9.237  -1.141  0.631   1.00 0.00 ? 25  VAL A C    1  
ATOM   325   O  O    . VAL A 1 25 ? -9.697  -0.875  -0.479  1.00 0.00 ? 25  VAL A O    1  
ATOM   326   C  CB   . VAL A 1 25 ? -10.951 -2.477  1.857   1.00 0.00 ? 25  VAL A CB   1  
ATOM   327   C  CG1  . VAL A 1 25 ? -11.915 -1.852  0.861   1.00 0.00 ? 25  VAL A CG1  1  
ATOM   328   C  CG2  . VAL A 1 25 ? -11.388 -3.888  2.221   1.00 0.00 ? 25  VAL A CG2  1  
ATOM   329   H  H    . VAL A 1 25 ? -8.790  -2.658  3.271   1.00 0.00 ? 25  VAL A H    1  
ATOM   330   H  HA   . VAL A 1 25 ? -9.453  -3.264  0.545   1.00 0.00 ? 25  VAL A HA   1  
ATOM   331   H  HB   . VAL A 1 25 ? -10.958 -1.878  2.756   1.00 0.00 ? 25  VAL A HB   1  
ATOM   332   H  HG11 . VAL A 1 25 ? -11.617 -0.832  0.664   1.00 0.00 ? 25  VAL A HG11 1  
ATOM   333   H  HG12 . VAL A 1 25 ? -11.899 -2.417  -0.059  1.00 0.00 ? 25  VAL A HG12 1  
ATOM   334   H  HG13 . VAL A 1 25 ? -12.914 -1.861  1.272   1.00 0.00 ? 25  VAL A HG13 1  
ATOM   335   H  HG21 . VAL A 1 25 ? -10.524 -4.533  2.265   1.00 0.00 ? 25  VAL A HG21 1  
ATOM   336   H  HG22 . VAL A 1 25 ? -11.878 -3.876  3.183   1.00 0.00 ? 25  VAL A HG22 1  
ATOM   337   H  HG23 . VAL A 1 25 ? -12.075 -4.257  1.473   1.00 0.00 ? 25  VAL A HG23 1  
ATOM   338   N  N    . ASN A 1 26 ? -8.477  -0.297  1.320   1.00 0.00 ? 26  ASN A N    1  
ATOM   339   C  CA   . ASN A 1 26 ? -8.133  1.022   0.800   1.00 0.00 ? 26  ASN A CA   1  
ATOM   340   C  C    . ASN A 1 26 ? -6.656  1.091   0.426   1.00 0.00 ? 26  ASN A C    1  
ATOM   341   O  O    . ASN A 1 26 ? -6.179  2.106   -0.082  1.00 0.00 ? 26  ASN A O    1  
ATOM   342   C  CB   . ASN A 1 26 ? -8.461  2.102   1.833   1.00 0.00 ? 26  ASN A CB   1  
ATOM   343   C  CG   . ASN A 1 26 ? -8.665  3.465   1.200   1.00 0.00 ? 26  ASN A CG   1  
ATOM   344   O  OD1  . ASN A 1 26 ? -9.791  3.856   0.893   1.00 0.00 ? 26  ASN A OD1  1  
ATOM   345   N  ND2  . ASN A 1 26 ? -7.573  4.194   1.001   1.00 0.00 ? 26  ASN A ND2  1  
ATOM   346   H  H    . ASN A 1 26 ? -8.139  -0.566  2.200   1.00 0.00 ? 26  ASN A H    1  
ATOM   347   H  HA   . ASN A 1 26 ? -8.725  1.193   -0.086  1.00 0.00 ? 26  ASN A HA   1  
ATOM   348   H  HB2  . ASN A 1 26 ? -9.367  1.830   2.355   1.00 0.00 ? 26  ASN A HB2  1  
ATOM   349   H  HB3  . ASN A 1 26 ? -7.649  2.172   2.542   1.00 0.00 ? 26  ASN A HB3  1  
ATOM   350   H  HD21 . ASN A 1 26 ? -6.709  3.818   1.270   1.00 0.00 ? 26  ASN A HD21 1  
ATOM   351   H  HD22 . ASN A 1 26 ? -7.676  5.079   0.593   1.00 0.00 ? 26  ASN A HD22 1  
ATOM   352   N  N    . THR A 1 27 ? -5.935  0.003   0.681   1.00 0.00 ? 27  THR A N    1  
ATOM   353   C  CA   . THR A 1 27 ? -4.512  -0.060  0.373   1.00 0.00 ? 27  THR A CA   1  
ATOM   354   C  C    . THR A 1 27 ? -4.238  -1.040  -0.762  1.00 0.00 ? 27  THR A C    1  
ATOM   355   O  O    . THR A 1 27 ? -3.208  -0.957  -1.431  1.00 0.00 ? 27  THR A O    1  
ATOM   356   C  CB   . THR A 1 27 ? -3.688  -0.477  1.606   1.00 0.00 ? 27  THR A CB   1  
ATOM   357   O  OG1  . THR A 1 27 ? -3.960  -1.843  1.938   1.00 0.00 ? 27  THR A OG1  1  
ATOM   358   C  CG2  . THR A 1 27 ? -4.008  0.413   2.797   1.00 0.00 ? 27  THR A CG2  1  
ATOM   359   H  H    . THR A 1 27 ? -6.372  -0.774  1.088   1.00 0.00 ? 27  THR A H    1  
ATOM   360   H  HA   . THR A 1 27 ? -4.192  0.926   0.069   1.00 0.00 ? 27  THR A HA   1  
ATOM   361   H  HB   . THR A 1 27 ? -2.638  -0.374  1.370   1.00 0.00 ? 27  THR A HB   1  
ATOM   362   H  HG1  . THR A 1 27 ? -3.802  -2.397  1.169   1.00 0.00 ? 27  THR A HG1  1  
ATOM   363   H  HG21 . THR A 1 27 ? -4.622  -0.131  3.498   1.00 0.00 ? 27  THR A HG21 1  
ATOM   364   H  HG22 . THR A 1 27 ? -4.539  1.291   2.458   1.00 0.00 ? 27  THR A HG22 1  
ATOM   365   H  HG23 . THR A 1 27 ? -3.089  0.713   3.280   1.00 0.00 ? 27  THR A HG23 1  
ATOM   366   N  N    . GLN A 1 28 ? -5.167  -1.967  -0.974  1.00 0.00 ? 28  GLN A N    1  
ATOM   367   C  CA   . GLN A 1 28 ? -5.025  -2.963  -2.030  1.00 0.00 ? 28  GLN A CA   1  
ATOM   368   C  C    . GLN A 1 28 ? -4.721  -2.298  -3.368  1.00 0.00 ? 28  GLN A C    1  
ATOM   369   O  O    . GLN A 1 28 ? -5.108  -1.158  -3.625  1.00 0.00 ? 28  GLN A O    1  
ATOM   370   C  CB   . GLN A 1 28 ? -6.298  -3.803  -2.142  1.00 0.00 ? 28  GLN A CB   1  
ATOM   371   C  CG   . GLN A 1 28 ? -7.468  -3.056  -2.763  1.00 0.00 ? 28  GLN A CG   1  
ATOM   372   C  CD   . GLN A 1 28 ? -8.514  -3.988  -3.342  1.00 0.00 ? 28  GLN A CD   1  
ATOM   373   O  OE1  . GLN A 1 28 ? -8.274  -4.664  -4.343  1.00 0.00 ? 28  GLN A OE1  1  
ATOM   374   N  NE2  . GLN A 1 28 ? -9.684  -4.028  -2.715  1.00 0.00 ? 28  GLN A NE2  1  
ATOM   375   H  H    . GLN A 1 28 ? -5.966  -1.981  -0.408  1.00 0.00 ? 28  GLN A H    1  
ATOM   376   H  HA   . GLN A 1 28 ? -4.201  -3.608  -1.767  1.00 0.00 ? 28  GLN A HA   1  
ATOM   377   H  HB2  . GLN A 1 28 ? -6.090  -4.671  -2.749  1.00 0.00 ? 28  GLN A HB2  1  
ATOM   378   H  HB3  . GLN A 1 28 ? -6.590  -4.126  -1.153  1.00 0.00 ? 28  GLN A HB3  1  
ATOM   379   H  HG2  . GLN A 1 28 ? -7.933  -2.446  -2.003  1.00 0.00 ? 28  GLN A HG2  1  
ATOM   380   H  HG3  . GLN A 1 28 ? -7.094  -2.422  -3.553  1.00 0.00 ? 28  GLN A HG3  1  
ATOM   381   H  HE21 . GLN A 1 28 ? -9.804  -3.461  -1.925  1.00 0.00 ? 28  GLN A HE21 1  
ATOM   382   H  HE22 . GLN A 1 28 ? -10.378 -4.621  -3.068  1.00 0.00 ? 28  GLN A HE22 1  
ATOM   383   N  N    . PRO A 1 29 ? -4.011  -3.026  -4.243  1.00 0.00 ? 29  PRO A N    1  
ATOM   384   C  CA   . PRO A 1 29 ? -3.545  -4.384  -3.948  1.00 0.00 ? 29  PRO A CA   1  
ATOM   385   C  C    . PRO A 1 29 ? -2.446  -4.404  -2.891  1.00 0.00 ? 29  PRO A C    1  
ATOM   386   O  O    . PRO A 1 29 ? -2.162  -5.444  -2.295  1.00 0.00 ? 29  PRO A O    1  
ATOM   387   C  CB   . PRO A 1 29 ? -3.001  -4.873  -5.293  1.00 0.00 ? 29  PRO A CB   1  
ATOM   388   C  CG   . PRO A 1 29 ? -2.625  -3.630  -6.023  1.00 0.00 ? 29  PRO A CG   1  
ATOM   389   C  CD   . PRO A 1 29 ? -3.608  -2.579  -5.587  1.00 0.00 ? 29  PRO A CD   1  
ATOM   390   H  HA   . PRO A 1 29 ? -4.357  -5.023  -3.633  1.00 0.00 ? 29  PRO A HA   1  
ATOM   391   H  HB2  . PRO A 1 29 ? -2.144  -5.510  -5.128  1.00 0.00 ? 29  PRO A HB2  1  
ATOM   392   H  HB3  . PRO A 1 29 ? -3.769  -5.421  -5.818  1.00 0.00 ? 29  PRO A HB3  1  
ATOM   393   H  HG2  . PRO A 1 29 ? -1.621  -3.337  -5.757  1.00 0.00 ? 29  PRO A HG2  1  
ATOM   394   H  HG3  . PRO A 1 29 ? -2.699  -3.793  -7.088  1.00 0.00 ? 29  PRO A HG3  1  
ATOM   395   H  HD2  . PRO A 1 29 ? -3.132  -1.611  -5.545  1.00 0.00 ? 29  PRO A HD2  1  
ATOM   396   H  HD3  . PRO A 1 29 ? -4.457  -2.556  -6.255  1.00 0.00 ? 29  PRO A HD3  1  
ATOM   397   N  N    . LEU A 1 30 ? -1.832  -3.248  -2.662  1.00 0.00 ? 30  LEU A N    1  
ATOM   398   C  CA   . LEU A 1 30 ? -0.763  -3.132  -1.676  1.00 0.00 ? 30  LEU A CA   1  
ATOM   399   C  C    . LEU A 1 30 ? -1.335  -2.997  -0.268  1.00 0.00 ? 30  LEU A C    1  
ATOM   400   O  O    . LEU A 1 30 ? -2.541  -2.824  -0.090  1.00 0.00 ? 30  LEU A O    1  
ATOM   401   C  CB   . LEU A 1 30 ? 0.124   -1.928  -1.995  1.00 0.00 ? 30  LEU A CB   1  
ATOM   402   C  CG   . LEU A 1 30 ? 0.947   -2.024  -3.281  1.00 0.00 ? 30  LEU A CG   1  
ATOM   403   C  CD1  . LEU A 1 30 ? 1.573   -0.679  -3.615  1.00 0.00 ? 30  LEU A CD1  1  
ATOM   404   C  CD2  . LEU A 1 30 ? 2.020   -3.095  -3.149  1.00 0.00 ? 30  LEU A CD2  1  
ATOM   405   H  H    . LEU A 1 30 ? -2.101  -2.454  -3.168  1.00 0.00 ? 30  LEU A H    1  
ATOM   406   H  HA   . LEU A 1 30 ? -0.168  -4.032  -1.725  1.00 0.00 ? 30  LEU A HA   1  
ATOM   407   H  HB2  . LEU A 1 30 ? -0.512  -1.060  -2.074  1.00 0.00 ? 30  LEU A HB2  1  
ATOM   408   H  HB3  . LEU A 1 30 ? 0.811   -1.796  -1.171  1.00 0.00 ? 30  LEU A HB3  1  
ATOM   409   H  HG   . LEU A 1 30 ? 0.296   -2.300  -4.098  1.00 0.00 ? 30  LEU A HG   1  
ATOM   410   H  HD11 . LEU A 1 30 ? 2.647   -0.781  -3.654  1.00 0.00 ? 30  LEU A HD11 1  
ATOM   411   H  HD12 . LEU A 1 30 ? 1.308   0.041   -2.854  1.00 0.00 ? 30  LEU A HD12 1  
ATOM   412   H  HD13 . LEU A 1 30 ? 1.207   -0.340  -4.573  1.00 0.00 ? 30  LEU A HD13 1  
ATOM   413   H  HD21 . LEU A 1 30 ? 2.223   -3.522  -4.119  1.00 0.00 ? 30  LEU A HD21 1  
ATOM   414   H  HD22 . LEU A 1 30 ? 1.674   -3.869  -2.479  1.00 0.00 ? 30  LEU A HD22 1  
ATOM   415   H  HD23 . LEU A 1 30 ? 2.923   -2.654  -2.752  1.00 0.00 ? 30  LEU A HD23 1  
ATOM   416   N  N    . CYS A 1 31 ? -0.461  -3.076  0.730   1.00 0.00 ? 31  CYS A N    1  
ATOM   417   C  CA   . CYS A 1 31 ? -0.877  -2.962  2.123   1.00 0.00 ? 31  CYS A CA   1  
ATOM   418   C  C    . CYS A 1 31 ? -0.563  -1.573  2.671   1.00 0.00 ? 31  CYS A C    1  
ATOM   419   O  O    . CYS A 1 31 ? -0.003  -0.729  1.971   1.00 0.00 ? 31  CYS A O    1  
ATOM   420   C  CB   . CYS A 1 31 ? -0.183  -4.027  2.973   1.00 0.00 ? 31  CYS A CB   1  
ATOM   421   S  SG   . CYS A 1 31 ? 1.559   -3.656  3.354   1.00 0.00 ? 31  CYS A SG   1  
ATOM   422   H  H    . CYS A 1 31 ? 0.488   -3.216  0.525   1.00 0.00 ? 31  CYS A H    1  
ATOM   423   H  HA   . CYS A 1 31 ? -1.944  -3.119  2.164   1.00 0.00 ? 31  CYS A HA   1  
ATOM   424   H  HB2  . CYS A 1 31 ? -0.710  -4.126  3.912   1.00 0.00 ? 31  CYS A HB2  1  
ATOM   425   H  HB3  . CYS A 1 31 ? -0.212  -4.971  2.449   1.00 0.00 ? 31  CYS A HB3  1  
ATOM   426   N  N    . HIS A 1 32 ? -0.927  -1.343  3.929   1.00 0.00 ? 32  HIS A N    1  
ATOM   427   C  CA   . HIS A 1 32 ? -0.684  -0.057  4.573   1.00 0.00 ? 32  HIS A CA   1  
ATOM   428   C  C    . HIS A 1 32 ? 0.798   0.302   4.525   1.00 0.00 ? 32  HIS A C    1  
ATOM   429   O  O    . HIS A 1 32 ? 1.158   1.459   4.307   1.00 0.00 ? 32  HIS A O    1  
ATOM   430   C  CB   . HIS A 1 32 ? -1.166  -0.090  6.023   1.00 0.00 ? 32  HIS A CB   1  
ATOM   431   C  CG   . HIS A 1 32 ? -1.625  1.242   6.532   1.00 0.00 ? 32  HIS A CG   1  
ATOM   432   N  ND1  . HIS A 1 32 ? -2.474  1.385   7.609   1.00 0.00 ? 32  HIS A ND1  1  
ATOM   433   C  CD2  . HIS A 1 32 ? -1.345  2.497   6.106   1.00 0.00 ? 32  HIS A CD2  1  
ATOM   434   C  CE1  . HIS A 1 32 ? -2.699  2.669   7.822   1.00 0.00 ? 32  HIS A CE1  1  
ATOM   435   N  NE2  . HIS A 1 32 ? -2.025  3.365   6.924   1.00 0.00 ? 32  HIS A NE2  1  
ATOM   436   H  H    . HIS A 1 32 ? -1.370  -2.055  4.436   1.00 0.00 ? 32  HIS A H    1  
ATOM   437   H  HA   . HIS A 1 32 ? -1.241  0.694   4.034   1.00 0.00 ? 32  HIS A HA   1  
ATOM   438   H  HB2  . HIS A 1 32 ? -1.995  -0.778  6.105   1.00 0.00 ? 32  HIS A HB2  1  
ATOM   439   H  HB3  . HIS A 1 32 ? -0.359  -0.428  6.657   1.00 0.00 ? 32  HIS A HB3  1  
ATOM   440   H  HD1  . HIS A 1 32 ? -2.856  0.654   8.137   1.00 0.00 ? 32  HIS A HD1  1  
ATOM   441   H  HD2  . HIS A 1 32 ? -0.706  2.765   5.277   1.00 0.00 ? 32  HIS A HD2  1  
ATOM   442   H  HE1  . HIS A 1 32 ? -3.326  3.081   8.599   1.00 0.00 ? 32  HIS A HE1  1  
ATOM   443   N  N    . GLU A 1 33 ? 1.651   -0.696  4.731   1.00 0.00 ? 33  GLU A N    1  
ATOM   444   C  CA   . GLU A 1 33 ? 3.094   -0.483  4.713   1.00 0.00 ? 33  GLU A CA   1  
ATOM   445   C  C    . GLU A 1 33 ? 3.561   -0.041  3.329   1.00 0.00 ? 33  GLU A C    1  
ATOM   446   O  O    . GLU A 1 33 ? 4.028   1.084   3.149   1.00 0.00 ? 33  GLU A O    1  
ATOM   447   C  CB   . GLU A 1 33 ? 3.825   -1.762  5.126   1.00 0.00 ? 33  GLU A CB   1  
ATOM   448   C  CG   . GLU A 1 33 ? 5.280   -1.536  5.502   1.00 0.00 ? 33  GLU A CG   1  
ATOM   449   C  CD   . GLU A 1 33 ? 5.776   -2.528  6.536   1.00 0.00 ? 33  GLU A CD   1  
ATOM   450   O  OE1  . GLU A 1 33 ? 5.051   -2.766  7.524   1.00 0.00 ? 33  GLU A OE1  1  
ATOM   451   O  OE2  . GLU A 1 33 ? 6.889   -3.066  6.356   1.00 0.00 ? 33  GLU A OE2  1  
ATOM   452   H  H    . GLU A 1 33 ? 1.303   -1.596  4.899   1.00 0.00 ? 33  GLU A H    1  
ATOM   453   H  HA   . GLU A 1 33 ? 3.323   0.297   5.423   1.00 0.00 ? 33  GLU A HA   1  
ATOM   454   H  HB2  . GLU A 1 33 ? 3.318   -2.194  5.975   1.00 0.00 ? 33  GLU A HB2  1  
ATOM   455   H  HB3  . GLU A 1 33 ? 3.793   -2.462  4.304   1.00 0.00 ? 33  GLU A HB3  1  
ATOM   456   H  HG2  . GLU A 1 33 ? 5.887   -1.631  4.614   1.00 0.00 ? 33  GLU A HG2  1  
ATOM   457   H  HG3  . GLU A 1 33 ? 5.385   -0.539  5.902   1.00 0.00 ? 33  GLU A HG3  1  
ATOM   458   N  N    . CYS A 1 34 ? 3.432   -0.935  2.354   1.00 0.00 ? 34  CYS A N    1  
ATOM   459   C  CA   . CYS A 1 34 ? 3.841   -0.640  0.986   1.00 0.00 ? 34  CYS A CA   1  
ATOM   460   C  C    . CYS A 1 34 ? 3.123   0.599   0.459   1.00 0.00 ? 34  CYS A C    1  
ATOM   461   O  O    . CYS A 1 34 ? 3.757   1.544   -0.011  1.00 0.00 ? 34  CYS A O    1  
ATOM   462   C  CB   . CYS A 1 34 ? 3.554   -1.835  0.076   1.00 0.00 ? 34  CYS A CB   1  
ATOM   463   S  SG   . CYS A 1 34 ? 4.280   -3.402  0.656   1.00 0.00 ? 34  CYS A SG   1  
ATOM   464   H  H    . CYS A 1 34 ? 3.053   -1.816  2.559   1.00 0.00 ? 34  CYS A H    1  
ATOM   465   H  HA   . CYS A 1 34 ? 4.904   -0.449  0.991   1.00 0.00 ? 34  CYS A HA   1  
ATOM   466   H  HB2  . CYS A 1 34 ? 2.485   -1.976  0.006   1.00 0.00 ? 34  CYS A HB2  1  
ATOM   467   H  HB3  . CYS A 1 34 ? 3.950   -1.633  -0.908  1.00 0.00 ? 34  CYS A HB3  1  
ATOM   468   N  N    . SER A 1 35 ? 1.796   0.587   0.541   1.00 0.00 ? 35  SER A N    1  
ATOM   469   C  CA   . SER A 1 35 ? 0.991   1.707   0.069   1.00 0.00 ? 35  SER A CA   1  
ATOM   470   C  C    . SER A 1 35 ? 1.697   3.034   0.335   1.00 0.00 ? 35  SER A C    1  
ATOM   471   O  O    . SER A 1 35 ? 2.122   3.720   -0.594  1.00 0.00 ? 35  SER A O    1  
ATOM   472   C  CB   . SER A 1 35 ? -0.379  1.700   0.749   1.00 0.00 ? 35  SER A CB   1  
ATOM   473   O  OG   . SER A 1 35 ? -1.103  2.882   0.451   1.00 0.00 ? 35  SER A OG   1  
ATOM   474   H  H    . SER A 1 35 ? 1.349   -0.196  0.926   1.00 0.00 ? 35  SER A H    1  
ATOM   475   H  HA   . SER A 1 35 ? 0.855   1.593   -0.996  1.00 0.00 ? 35  SER A HA   1  
ATOM   476   H  HB2  . SER A 1 35 ? -0.945  0.849   0.403   1.00 0.00 ? 35  SER A HB2  1  
ATOM   477   H  HB3  . SER A 1 35 ? -0.246  1.633   1.820   1.00 0.00 ? 35  SER A HB3  1  
ATOM   478   H  HG   . SER A 1 35 ? -1.212  3.400   1.252   1.00 0.00 ? 35  SER A HG   1  
ATOM   479   N  N    . GLU A 1 36 ? 1.816   3.388   1.611   1.00 0.00 ? 36  GLU A N    1  
ATOM   480   C  CA   . GLU A 1 36 ? 2.469   4.632   2.000   1.00 0.00 ? 36  GLU A CA   1  
ATOM   481   C  C    . GLU A 1 36 ? 3.899   4.685   1.469   1.00 0.00 ? 36  GLU A C    1  
ATOM   482   O  O    . GLU A 1 36 ? 4.348   5.716   0.966   1.00 0.00 ? 36  GLU A O    1  
ATOM   483   C  CB   . GLU A 1 36 ? 2.474   4.777   3.523   1.00 0.00 ? 36  GLU A CB   1  
ATOM   484   C  CG   . GLU A 1 36 ? 3.321   3.734   4.232   1.00 0.00 ? 36  GLU A CG   1  
ATOM   485   C  CD   . GLU A 1 36 ? 3.367   3.942   5.733   1.00 0.00 ? 36  GLU A CD   1  
ATOM   486   O  OE1  . GLU A 1 36 ? 4.256   4.682   6.204   1.00 0.00 ? 36  GLU A OE1  1  
ATOM   487   O  OE2  . GLU A 1 36 ? 2.513   3.363   6.437   1.00 0.00 ? 36  GLU A OE2  1  
ATOM   488   H  H    . GLU A 1 36 ? 1.457   2.798   2.307   1.00 0.00 ? 36  GLU A H    1  
ATOM   489   H  HA   . GLU A 1 36 ? 1.909   5.449   1.571   1.00 0.00 ? 36  GLU A HA   1  
ATOM   490   H  HB2  . GLU A 1 36 ? 2.854   5.755   3.778   1.00 0.00 ? 36  GLU A HB2  1  
ATOM   491   H  HB3  . GLU A 1 36 ? 1.459   4.691   3.883   1.00 0.00 ? 36  GLU A HB3  1  
ATOM   492   H  HG2  . GLU A 1 36 ? 2.909   2.757   4.031   1.00 0.00 ? 36  GLU A HG2  1  
ATOM   493   H  HG3  . GLU A 1 36 ? 4.329   3.785   3.845   1.00 0.00 ? 36  GLU A HG3  1  
ATOM   494   N  N    . ARG A 1 37 ? 4.609   3.568   1.585   1.00 0.00 ? 37  ARG A N    1  
ATOM   495   C  CA   . ARG A 1 37 ? 5.988   3.487   1.119   1.00 0.00 ? 37  ARG A CA   1  
ATOM   496   C  C    . ARG A 1 37 ? 6.101   3.953   -0.330  1.00 0.00 ? 37  ARG A C    1  
ATOM   497   O  O    . ARG A 1 37 ? 7.059   4.631   -0.701  1.00 0.00 ? 37  ARG A O    1  
ATOM   498   C  CB   . ARG A 1 37 ? 6.509   2.054   1.247   1.00 0.00 ? 37  ARG A CB   1  
ATOM   499   C  CG   . ARG A 1 37 ? 6.947   1.689   2.656   1.00 0.00 ? 37  ARG A CG   1  
ATOM   500   C  CD   . ARG A 1 37 ? 7.394   0.238   2.742   1.00 0.00 ? 37  ARG A CD   1  
ATOM   501   N  NE   . ARG A 1 37 ? 8.822   0.088   2.476   1.00 0.00 ? 37  ARG A NE   1  
ATOM   502   C  CZ   . ARG A 1 37 ? 9.762   0.239   3.402   1.00 0.00 ? 37  ARG A CZ   1  
ATOM   503   N  NH1  . ARG A 1 37 ? 9.426   0.542   4.649   1.00 0.00 ? 37  ARG A NH1  1  
ATOM   504   N  NH2  . ARG A 1 37 ? 11.041  0.086   3.083   1.00 0.00 ? 37  ARG A NH2  1  
ATOM   505   H  H    . ARG A 1 37 ? 4.196   2.779   1.995   1.00 0.00 ? 37  ARG A H    1  
ATOM   506   H  HA   . ARG A 1 37 ? 6.587   4.135   1.741   1.00 0.00 ? 37  ARG A HA   1  
ATOM   507   H  HB2  . ARG A 1 37 ? 5.727   1.371   0.949   1.00 0.00 ? 37  ARG A HB2  1  
ATOM   508   H  HB3  . ARG A 1 37 ? 7.354   1.931   0.587   1.00 0.00 ? 37  ARG A HB3  1  
ATOM   509   H  HG2  . ARG A 1 37 ? 7.772   2.325   2.942   1.00 0.00 ? 37  ARG A HG2  1  
ATOM   510   H  HG3  . ARG A 1 37 ? 6.119   1.843   3.331   1.00 0.00 ? 37  ARG A HG3  1  
ATOM   511   H  HD2  . ARG A 1 37 ? 7.181   -0.132  3.734   1.00 0.00 ? 37  ARG A HD2  1  
ATOM   512   H  HD3  . ARG A 1 37 ? 6.839   -0.338  2.016   1.00 0.00 ? 37  ARG A HD3  1  
ATOM   513   H  HE   . ARG A 1 37 ? 9.092   -0.136  1.561   1.00 0.00 ? 37  ARG A HE   1  
ATOM   514   H  HH11 . ARG A 1 37 ? 8.463   0.656   4.892   1.00 0.00 ? 37  ARG A HH11 1  
ATOM   515   H  HH12 . ARG A 1 37 ? 10.136  0.654   5.345   1.00 0.00 ? 37  ARG A HH12 1  
ATOM   516   H  HH21 . ARG A 1 37 ? 11.297  -0.143  2.145   1.00 0.00 ? 37  ARG A HH21 1  
ATOM   517   H  HH22 . ARG A 1 37 ? 11.747  0.200   3.781   1.00 0.00 ? 37  ARG A HH22 1  
ATOM   518   N  N    . ARG A 1 38 ? 5.116   3.585   -1.142  1.00 0.00 ? 38  ARG A N    1  
ATOM   519   C  CA   . ARG A 1 38 ? 5.105   3.963   -2.550  1.00 0.00 ? 38  ARG A CA   1  
ATOM   520   C  C    . ARG A 1 38 ? 4.813   5.452   -2.711  1.00 0.00 ? 38  ARG A C    1  
ATOM   521   O  O    . ARG A 1 38 ? 5.457   6.138   -3.504  1.00 0.00 ? 38  ARG A O    1  
ATOM   522   C  CB   . ARG A 1 38 ? 4.063   3.143   -3.313  1.00 0.00 ? 38  ARG A CB   1  
ATOM   523   C  CG   . ARG A 1 38 ? 4.331   3.056   -4.807  1.00 0.00 ? 38  ARG A CG   1  
ATOM   524   C  CD   . ARG A 1 38 ? 3.772   1.771   -5.398  1.00 0.00 ? 38  ARG A CD   1  
ATOM   525   N  NE   . ARG A 1 38 ? 4.543   0.600   -4.989  1.00 0.00 ? 38  ARG A NE   1  
ATOM   526   C  CZ   . ARG A 1 38 ? 4.567   -0.539  -5.671  1.00 0.00 ? 38  ARG A CZ   1  
ATOM   527   N  NH1  . ARG A 1 38 ? 3.867   -0.660  -6.791  1.00 0.00 ? 38  ARG A NH1  1  
ATOM   528   N  NH2  . ARG A 1 38 ? 5.292   -1.561  -5.234  1.00 0.00 ? 38  ARG A NH2  1  
ATOM   529   H  H    . ARG A 1 38 ? 4.379   3.044   -0.787  1.00 0.00 ? 38  ARG A H    1  
ATOM   530   H  HA   . ARG A 1 38 ? 6.083   3.754   -2.958  1.00 0.00 ? 38  ARG A HA   1  
ATOM   531   H  HB2  . ARG A 1 38 ? 4.048   2.140   -2.913  1.00 0.00 ? 38  ARG A HB2  1  
ATOM   532   H  HB3  . ARG A 1 38 ? 3.092   3.594   -3.169  1.00 0.00 ? 38  ARG A HB3  1  
ATOM   533   H  HG2  . ARG A 1 38 ? 3.863   3.897   -5.297  1.00 0.00 ? 38  ARG A HG2  1  
ATOM   534   H  HG3  . ARG A 1 38 ? 5.397   3.086   -4.974  1.00 0.00 ? 38  ARG A HG3  1  
ATOM   535   H  HD2  . ARG A 1 38 ? 2.751   1.652   -5.068  1.00 0.00 ? 38  ARG A HD2  1  
ATOM   536   H  HD3  . ARG A 1 38 ? 3.795   1.847   -6.475  1.00 0.00 ? 38  ARG A HD3  1  
ATOM   537   H  HE   . ARG A 1 38 ? 5.067   0.667   -4.164  1.00 0.00 ? 38  ARG A HE   1  
ATOM   538   H  HH11 . ARG A 1 38 ? 3.320   0.108   -7.123  1.00 0.00 ? 38  ARG A HH11 1  
ATOM   539   H  HH12 . ARG A 1 38 ? 3.887   -1.519  -7.303  1.00 0.00 ? 38  ARG A HH12 1  
ATOM   540   H  HH21 . ARG A 1 38 ? 5.821   -1.473  -4.391  1.00 0.00 ? 38  ARG A HH21 1  
ATOM   541   H  HH22 . ARG A 1 38 ? 5.309   -2.418  -5.748  1.00 0.00 ? 38  ARG A HH22 1  
ATOM   542   N  N    . GLN A 1 39 ? 3.839   5.944   -1.952  1.00 0.00 ? 39  GLN A N    1  
ATOM   543   C  CA   . GLN A 1 39 ? 3.462   7.351   -2.011  1.00 0.00 ? 39  GLN A CA   1  
ATOM   544   C  C    . GLN A 1 39 ? 4.696   8.242   -2.108  1.00 0.00 ? 39  GLN A C    1  
ATOM   545   O  O    . GLN A 1 39 ? 4.757   9.148   -2.940  1.00 0.00 ? 39  GLN A O    1  
ATOM   546   C  CB   . GLN A 1 39 ? 2.639   7.733   -0.780  1.00 0.00 ? 39  GLN A CB   1  
ATOM   547   C  CG   . GLN A 1 39 ? 1.846   9.019   -0.952  1.00 0.00 ? 39  GLN A CG   1  
ATOM   548   C  CD   . GLN A 1 39 ? 2.725   10.254  -0.931  1.00 0.00 ? 39  GLN A CD   1  
ATOM   549   O  OE1  . GLN A 1 39 ? 3.860   10.213  -0.456  1.00 0.00 ? 39  GLN A OE1  1  
ATOM   550   N  NE2  . GLN A 1 39 ? 2.203   11.361  -1.446  1.00 0.00 ? 39  GLN A NE2  1  
ATOM   551   H  H    . GLN A 1 39 ? 3.363   5.347   -1.339  1.00 0.00 ? 39  GLN A H    1  
ATOM   552   H  HA   . GLN A 1 39 ? 2.859   7.496   -2.895  1.00 0.00 ? 39  GLN A HA   1  
ATOM   553   H  HB2  . GLN A 1 39 ? 1.946   6.934   -0.563  1.00 0.00 ? 39  GLN A HB2  1  
ATOM   554   H  HB3  . GLN A 1 39 ? 3.306   7.858   0.060   1.00 0.00 ? 39  GLN A HB3  1  
ATOM   555   H  HG2  . GLN A 1 39 ? 1.327   8.982   -1.898  1.00 0.00 ? 39  GLN A HG2  1  
ATOM   556   H  HG3  . GLN A 1 39 ? 1.126   9.092   -0.151  1.00 0.00 ? 39  GLN A HG3  1  
ATOM   557   H  HE21 . GLN A 1 39 ? 1.292   11.319  -1.805  1.00 0.00 ? 39  GLN A HE21 1  
ATOM   558   H  HE22 . GLN A 1 39 ? 2.749   12.174  -1.444  1.00 0.00 ? 39  GLN A HE22 1  
ATOM   559   N  N    . LYS A 1 40 ? 5.678   7.980   -1.253  1.00 0.00 ? 40  LYS A N    1  
ATOM   560   C  CA   . LYS A 1 40 ? 6.912   8.756   -1.241  1.00 0.00 ? 40  LYS A CA   1  
ATOM   561   C  C    . LYS A 1 40 ? 7.410   9.007   -2.661  1.00 0.00 ? 40  LYS A C    1  
ATOM   562   O  O    . LYS A 1 40 ? 7.797   10.123  -3.005  1.00 0.00 ? 40  LYS A O    1  
ATOM   563   C  CB   . LYS A 1 40 ? 7.989   8.029   -0.433  1.00 0.00 ? 40  LYS A CB   1  
ATOM   564   C  CG   . LYS A 1 40 ? 9.329   8.744   -0.424  1.00 0.00 ? 40  LYS A CG   1  
ATOM   565   C  CD   . LYS A 1 40 ? 10.438  7.845   0.097   1.00 0.00 ? 40  LYS A CD   1  
ATOM   566   C  CE   . LYS A 1 40 ? 11.071  7.035   -1.024  1.00 0.00 ? 40  LYS A CE   1  
ATOM   567   N  NZ   . LYS A 1 40 ? 10.392  5.723   -1.212  1.00 0.00 ? 40  LYS A NZ   1  
ATOM   568   H  H    . LYS A 1 40 ? 5.570   7.244   -0.613  1.00 0.00 ? 40  LYS A H    1  
ATOM   569   H  HA   . LYS A 1 40 ? 6.702   9.706   -0.773  1.00 0.00 ? 40  LYS A HA   1  
ATOM   570   H  HB2  . LYS A 1 40 ? 7.651   7.929   0.587   1.00 0.00 ? 40  LYS A HB2  1  
ATOM   571   H  HB3  . LYS A 1 40 ? 8.134   7.044   -0.854  1.00 0.00 ? 40  LYS A HB3  1  
ATOM   572   H  HG2  . LYS A 1 40 ? 9.571   9.050   -1.431  1.00 0.00 ? 40  LYS A HG2  1  
ATOM   573   H  HG3  . LYS A 1 40 ? 9.257   9.616   0.211   1.00 0.00 ? 40  LYS A HG3  1  
ATOM   574   H  HD2  . LYS A 1 40 ? 11.199  8.456   0.558   1.00 0.00 ? 40  LYS A HD2  1  
ATOM   575   H  HD3  . LYS A 1 40 ? 10.024  7.167   0.830   1.00 0.00 ? 40  LYS A HD3  1  
ATOM   576   H  HE2  . LYS A 1 40 ? 11.004  7.600   -1.941  1.00 0.00 ? 40  LYS A HE2  1  
ATOM   577   H  HE3  . LYS A 1 40 ? 12.110  6.863   -0.783  1.00 0.00 ? 40  LYS A HE3  1  
ATOM   578   H  HZ1  . LYS A 1 40 ? 9.696   5.569   -0.456  1.00 0.00 ? 40  LYS A HZ1  1  
ATOM   579   H  HZ2  . LYS A 1 40 ? 11.091  4.953   -1.187  1.00 0.00 ? 40  LYS A HZ2  1  
ATOM   580   H  HZ3  . LYS A 1 40 ? 9.903   5.702   -2.129  1.00 0.00 ? 40  LYS A HZ3  1  
ATOM   581   N  N    . ASN A 1 41 ? 7.394   7.963   -3.482  1.00 0.00 ? 41  ASN A N    1  
ATOM   582   C  CA   . ASN A 1 41 ? 7.843   8.071   -4.866  1.00 0.00 ? 41  ASN A CA   1  
ATOM   583   C  C    . ASN A 1 41 ? 7.372   9.381   -5.490  1.00 0.00 ? 41  ASN A C    1  
ATOM   584   O  O    . ASN A 1 41 ? 8.172   10.146  -6.028  1.00 0.00 ? 41  ASN A O    1  
ATOM   585   C  CB   . ASN A 1 41 ? 7.326   6.887   -5.686  1.00 0.00 ? 41  ASN A CB   1  
ATOM   586   C  CG   . ASN A 1 41 ? 8.082   5.606   -5.393  1.00 0.00 ? 41  ASN A CG   1  
ATOM   587   O  OD1  . ASN A 1 41 ? 9.243   5.457   -5.774  1.00 0.00 ? 41  ASN A OD1  1  
ATOM   588   N  ND2  . ASN A 1 41 ? 7.425   4.674   -4.714  1.00 0.00 ? 41  ASN A ND2  1  
ATOM   589   H  H    . ASN A 1 41 ? 7.074   7.098   -3.151  1.00 0.00 ? 41  ASN A H    1  
ATOM   590   H  HA   . ASN A 1 41 ? 8.922   8.053   -4.866  1.00 0.00 ? 41  ASN A HA   1  
ATOM   591   H  HB2  . ASN A 1 41 ? 6.282   6.727   -5.456  1.00 0.00 ? 41  ASN A HB2  1  
ATOM   592   H  HB3  . ASN A 1 41 ? 7.428   7.113   -6.737  1.00 0.00 ? 41  ASN A HB3  1  
ATOM   593   H  HD21 . ASN A 1 41 ? 6.502   4.861   -4.443  1.00 0.00 ? 41  ASN A HD21 1  
ATOM   594   H  HD22 . ASN A 1 41 ? 7.890   3.836   -4.510  1.00 0.00 ? 41  ASN A HD22 1  
ATOM   595   N  N    . GLN A 1 42 ? 6.069   9.632   -5.412  1.00 0.00 ? 42  GLN A N    1  
ATOM   596   C  CA   . GLN A 1 42 ? 5.492   10.850  -5.969  1.00 0.00 ? 42  GLN A CA   1  
ATOM   597   C  C    . GLN A 1 42 ? 5.253   11.888  -4.878  1.00 0.00 ? 42  GLN A C    1  
ATOM   598   O  O    . GLN A 1 42 ? 4.602   11.607  -3.872  1.00 0.00 ? 42  GLN A O    1  
ATOM   599   C  CB   . GLN A 1 42 ? 4.178   10.535  -6.686  1.00 0.00 ? 42  GLN A CB   1  
ATOM   600   C  CG   . GLN A 1 42 ? 4.365   10.073  -8.123  1.00 0.00 ? 42  GLN A CG   1  
ATOM   601   C  CD   . GLN A 1 42 ? 4.656   8.589   -8.225  1.00 0.00 ? 42  GLN A CD   1  
ATOM   602   O  OE1  . GLN A 1 42 ? 5.491   8.057   -7.493  1.00 0.00 ? 42  GLN A OE1  1  
ATOM   603   N  NE2  . GLN A 1 42 ? 3.968   7.912   -9.137  1.00 0.00 ? 42  GLN A NE2  1  
ATOM   604   H  H    . GLN A 1 42 ? 5.483   8.984   -4.970  1.00 0.00 ? 42  GLN A H    1  
ATOM   605   H  HA   . GLN A 1 42 ? 6.194   11.253  -6.684  1.00 0.00 ? 42  GLN A HA   1  
ATOM   606   H  HB2  . GLN A 1 42 ? 3.664   9.756   -6.144  1.00 0.00 ? 42  GLN A HB2  1  
ATOM   607   H  HB3  . GLN A 1 42 ? 3.564   11.424  -6.694  1.00 0.00 ? 42  GLN A HB3  1  
ATOM   608   H  HG2  . GLN A 1 42 ? 3.462   10.286  -8.676  1.00 0.00 ? 42  GLN A HG2  1  
ATOM   609   H  HG3  . GLN A 1 42 ? 5.189   10.619  -8.558  1.00 0.00 ? 42  GLN A HG3  1  
ATOM   610   H  HE21 . GLN A 1 42 ? 3.320   8.403   -9.686  1.00 0.00 ? 42  GLN A HE21 1  
ATOM   611   H  HE22 . GLN A 1 42 ? 4.137   6.952   -9.226  1.00 0.00 ? 42  GLN A HE22 1  
ATOM   612   N  N    . ASN A 1 43 ? 5.785   13.089  -5.083  1.00 0.00 ? 43  ASN A N    1  
ATOM   613   C  CA   . ASN A 1 43 ? 5.630   14.169  -4.115  1.00 0.00 ? 43  ASN A CA   1  
ATOM   614   C  C    . ASN A 1 43 ? 5.338   15.491  -4.818  1.00 0.00 ? 43  ASN A C    1  
ATOM   615   O  O    . ASN A 1 43 ? 5.882   15.771  -5.887  1.00 0.00 ? 43  ASN A O    1  
ATOM   616   C  CB   . ASN A 1 43 ? 6.892   14.301  -3.260  1.00 0.00 ? 43  ASN A CB   1  
ATOM   617   C  CG   . ASN A 1 43 ? 8.158   14.051  -4.057  1.00 0.00 ? 43  ASN A CG   1  
ATOM   618   O  OD1  . ASN A 1 43 ? 8.477   12.912  -4.396  1.00 0.00 ? 43  ASN A OD1  1  
ATOM   619   N  ND2  . ASN A 1 43 ? 8.887   15.119  -4.359  1.00 0.00 ? 43  ASN A ND2  1  
ATOM   620   H  H    . ASN A 1 43 ? 6.294   13.252  -5.904  1.00 0.00 ? 43  ASN A H    1  
ATOM   621   H  HA   . ASN A 1 43 ? 4.796   13.923  -3.475  1.00 0.00 ? 43  ASN A HA   1  
ATOM   622   H  HB2  . ASN A 1 43 ? 6.939   15.299  -2.850  1.00 0.00 ? 43  ASN A HB2  1  
ATOM   623   H  HB3  . ASN A 1 43 ? 6.849   13.586  -2.453  1.00 0.00 ? 43  ASN A HB3  1  
ATOM   624   H  HD21 . ASN A 1 43 ? 8.572   15.996  -4.055  1.00 0.00 ? 43  ASN A HD21 1  
ATOM   625   H  HD22 . ASN A 1 43 ? 9.711   14.987  -4.873  1.00 0.00 ? 43  ASN A HD22 1  
ATOM   626   N  N    . SER A 1 44 ? 4.477   16.301  -4.210  1.00 0.00 ? 44  SER A N    1  
ATOM   627   C  CA   . SER A 1 44 ? 4.110   17.592  -4.779  1.00 0.00 ? 44  SER A CA   1  
ATOM   628   C  C    . SER A 1 44 ? 4.851   18.726  -4.076  1.00 0.00 ? 44  SER A C    1  
ATOM   629   O  O    . SER A 1 44 ? 4.489   19.894  -4.207  1.00 0.00 ? 44  SER A O    1  
ATOM   630   C  CB   . SER A 1 44 ? 2.599   17.810  -4.670  1.00 0.00 ? 44  SER A CB   1  
ATOM   631   O  OG   . SER A 1 44 ? 2.223   18.117  -3.339  1.00 0.00 ? 44  SER A OG   1  
ATOM   632   H  H    . SER A 1 44 ? 4.076   16.021  -3.360  1.00 0.00 ? 44  SER A H    1  
ATOM   633   H  HA   . SER A 1 44 ? 4.390   17.587  -5.822  1.00 0.00 ? 44  SER A HA   1  
ATOM   634   H  HB2  . SER A 1 44 ? 2.309   18.629  -5.311  1.00 0.00 ? 44  SER A HB2  1  
ATOM   635   H  HB3  . SER A 1 44 ? 2.085   16.912  -4.979  1.00 0.00 ? 44  SER A HB3  1  
ATOM   636   H  HG   . SER A 1 44 ? 1.268   18.063  -3.255  1.00 0.00 ? 44  SER A HG   1  
ATOM   637   N  N    . GLY A 1 45 ? 5.891   18.370  -3.329  1.00 0.00 ? 45  GLY A N    1  
ATOM   638   C  CA   . GLY A 1 45 ? 6.668   19.367  -2.616  1.00 0.00 ? 45  GLY A CA   1  
ATOM   639   C  C    . GLY A 1 45 ? 5.941   19.906  -1.399  1.00 0.00 ? 45  GLY A C    1  
ATOM   640   O  O    . GLY A 1 45 ? 5.010   19.290  -0.882  1.00 0.00 ? 45  GLY A O    1  
ATOM   641   H  H    . GLY A 1 45 ? 6.134   17.423  -3.261  1.00 0.00 ? 45  GLY A H    1  
ATOM   642   H  HA2  . GLY A 1 45 ? 7.599   18.923  -2.298  1.00 0.00 ? 45  GLY A HA2  1  
ATOM   643   H  HA3  . GLY A 1 45 ? 6.881   20.187  -3.285  1.00 0.00 ? 45  GLY A HA3  1  
ATOM   644   N  N    . PRO A 1 46 ? 6.371   21.084  -0.923  1.00 0.00 ? 46  PRO A N    1  
ATOM   645   C  CA   . PRO A 1 46 ? 5.769   21.732  0.247   1.00 0.00 ? 46  PRO A CA   1  
ATOM   646   C  C    . PRO A 1 46 ? 4.362   22.248  -0.035  1.00 0.00 ? 46  PRO A C    1  
ATOM   647   O  O    . PRO A 1 46 ? 4.116   22.874  -1.066  1.00 0.00 ? 46  PRO A O    1  
ATOM   648   C  CB   . PRO A 1 46 ? 6.719   22.898  0.534   1.00 0.00 ? 46  PRO A CB   1  
ATOM   649   C  CG   . PRO A 1 46 ? 7.362   23.194  -0.776  1.00 0.00 ? 46  PRO A CG   1  
ATOM   650   C  CD   . PRO A 1 46 ? 7.476   21.875  -1.489  1.00 0.00 ? 46  PRO A CD   1  
ATOM   651   H  HA   . PRO A 1 46 ? 5.744   21.068  1.099   1.00 0.00 ? 46  PRO A HA   1  
ATOM   652   H  HB2  . PRO A 1 46 ? 6.153   23.744  0.899   1.00 0.00 ? 46  PRO A HB2  1  
ATOM   653   H  HB3  . PRO A 1 46 ? 7.447   22.600  1.273   1.00 0.00 ? 46  PRO A HB3  1  
ATOM   654   H  HG2  . PRO A 1 46 ? 6.745   23.875  -1.343  1.00 0.00 ? 46  PRO A HG2  1  
ATOM   655   H  HG3  . PRO A 1 46 ? 8.342   23.619  -0.616  1.00 0.00 ? 46  PRO A HG3  1  
ATOM   656   H  HD2  . PRO A 1 46 ? 7.348   22.009  -2.553  1.00 0.00 ? 46  PRO A HD2  1  
ATOM   657   H  HD3  . PRO A 1 46 ? 8.429   21.413  -1.277  1.00 0.00 ? 46  PRO A HD3  1  
ATOM   658   N  N    . SER A 1 47 ? 3.443   21.980  0.886   1.00 0.00 ? 47  SER A N    1  
ATOM   659   C  CA   . SER A 1 47 ? 2.059   22.415  0.735   1.00 0.00 ? 47  SER A CA   1  
ATOM   660   C  C    . SER A 1 47 ? 1.993   23.876  0.299   1.00 0.00 ? 47  SER A C    1  
ATOM   661   O  O    . SER A 1 47 ? 1.270   24.225  -0.634  1.00 0.00 ? 47  SER A O    1  
ATOM   662   C  CB   . SER A 1 47 ? 1.296   22.227  2.047   1.00 0.00 ? 47  SER A CB   1  
ATOM   663   O  OG   . SER A 1 47 ? 1.958   22.878  3.119   1.00 0.00 ? 47  SER A OG   1  
ATOM   664   H  H    . SER A 1 47 ? 3.701   21.476  1.687   1.00 0.00 ? 47  SER A H    1  
ATOM   665   H  HA   . SER A 1 47 ? 1.601   21.803  -0.028  1.00 0.00 ? 47  SER A HA   1  
ATOM   666   H  HB2  . SER A 1 47 ? 0.305   22.642  1.947   1.00 0.00 ? 47  SER A HB2  1  
ATOM   667   H  HB3  . SER A 1 47 ? 1.225   21.173  2.271   1.00 0.00 ? 47  SER A HB3  1  
ATOM   668   H  HG   . SER A 1 47 ? 1.437   22.786  3.920   1.00 0.00 ? 47  SER A HG   1  
ATOM   669   N  N    . SER A 1 48 ? 2.755   24.725  0.982   1.00 0.00 ? 48  SER A N    1  
ATOM   670   C  CA   . SER A 1 48 ? 2.781   26.149  0.669   1.00 0.00 ? 48  SER A CA   1  
ATOM   671   C  C    . SER A 1 48 ? 3.058   26.375  -0.814  1.00 0.00 ? 48  SER A C    1  
ATOM   672   O  O    . SER A 1 48 ? 2.315   27.079  -1.496  1.00 0.00 ? 48  SER A O    1  
ATOM   673   C  CB   . SER A 1 48 ? 3.842   26.858  1.512   1.00 0.00 ? 48  SER A CB   1  
ATOM   674   O  OG   . SER A 1 48 ? 3.622   28.258  1.537   1.00 0.00 ? 48  SER A OG   1  
ATOM   675   H  H    . SER A 1 48 ? 3.310   24.386  1.715   1.00 0.00 ? 48  SER A H    1  
ATOM   676   H  HA   . SER A 1 48 ? 1.811   26.559  0.908   1.00 0.00 ? 48  SER A HA   1  
ATOM   677   H  HB2  . SER A 1 48 ? 3.806   26.482  2.523   1.00 0.00 ? 48  SER A HB2  1  
ATOM   678   H  HB3  . SER A 1 48 ? 4.819   26.667  1.091   1.00 0.00 ? 48  SER A HB3  1  
ATOM   679   H  HG   . SER A 1 48 ? 4.326   28.702  1.057   1.00 0.00 ? 48  SER A HG   1  
ATOM   680   N  N    . GLY A 1 49 ? 4.135   25.770  -1.307  1.00 0.00 ? 49  GLY A N    1  
ATOM   681   C  CA   . GLY A 1 49 ? 4.492   25.916  -2.706  1.00 0.00 ? 49  GLY A CA   1  
ATOM   682   C  C    . GLY A 1 49 ? 3.781   24.915  -3.594  1.00 0.00 ? 49  GLY A C    1  
ATOM   683   O  O    . GLY A 1 49 ? 4.449   24.148  -4.286  1.00 0.00 ? 49  GLY A O    1  
ATOM   684   H  H    . GLY A 1 49 ? 4.690   25.220  -0.716  1.00 0.00 ? 49  GLY A H    1  
ATOM   685   H  HA2  . GLY A 1 49 ? 4.236   26.914  -3.029  1.00 0.00 ? 49  GLY A HA2  1  
ATOM   686   H  HA3  . GLY A 1 49 ? 5.559   25.778  -2.809  1.00 0.00 ? 49  GLY A HA3  1  
HETATM 687   ZN ZN   . ZN  B 2 .  ? 2.841   -4.716  1.833   1.00 0.00 ? 201 ZN  A ZN   1  
ATOM   688   N  N    . GLY A 1 1  ? -20.125 -3.089  7.666   1.00 0.00 ? 1   GLY A N    2  
ATOM   689   C  CA   . GLY A 1 1  ? -19.692 -3.431  9.009   1.00 0.00 ? 1   GLY A CA   2  
ATOM   690   C  C    . GLY A 1 1  ? -18.885 -2.324  9.657   1.00 0.00 ? 1   GLY A C    2  
ATOM   691   O  O    . GLY A 1 1  ? -19.299 -1.165  9.662   1.00 0.00 ? 1   GLY A O    2  
ATOM   692   H  H1   . GLY A 1 1  ? -20.563 -2.228  7.499   1.00 0.00 ? 1   GLY A H1   2  
ATOM   693   H  HA2  . GLY A 1 1  ? -20.563 -3.630  9.616   1.00 0.00 ? 1   GLY A HA2  2  
ATOM   694   H  HA3  . GLY A 1 1  ? -19.086 -4.323  8.962   1.00 0.00 ? 1   GLY A HA3  2  
ATOM   695   N  N    . SER A 1 2  ? -17.729 -2.681  10.207  1.00 0.00 ? 2   SER A N    2  
ATOM   696   C  CA   . SER A 1 2  ? -16.863 -1.710  10.867  1.00 0.00 ? 2   SER A CA   2  
ATOM   697   C  C    . SER A 1 2  ? -16.332 -0.689  9.866   1.00 0.00 ? 2   SER A C    2  
ATOM   698   O  O    . SER A 1 2  ? -15.604 -1.035  8.936   1.00 0.00 ? 2   SER A O    2  
ATOM   699   C  CB   . SER A 1 2  ? -15.697 -2.421  11.556  1.00 0.00 ? 2   SER A CB   2  
ATOM   700   O  OG   . SER A 1 2  ? -16.161 -3.312  12.555  1.00 0.00 ? 2   SER A OG   2  
ATOM   701   H  H    . SER A 1 2  ? -17.453 -3.621  10.171  1.00 0.00 ? 2   SER A H    2  
ATOM   702   H  HA   . SER A 1 2  ? -17.451 -1.195  11.612  1.00 0.00 ? 2   SER A HA   2  
ATOM   703   H  HB2  . SER A 1 2  ? -15.136 -2.980  10.823  1.00 0.00 ? 2   SER A HB2  2  
ATOM   704   H  HB3  . SER A 1 2  ? -15.053 -1.685  12.017  1.00 0.00 ? 2   SER A HB3  2  
ATOM   705   H  HG   . SER A 1 2  ? -15.429 -3.566  13.122  1.00 0.00 ? 2   SER A HG   2  
ATOM   706   N  N    . SER A 1 3  ? -16.701 0.573   10.065  1.00 0.00 ? 3   SER A N    2  
ATOM   707   C  CA   . SER A 1 3  ? -16.266 1.646   9.179   1.00 0.00 ? 3   SER A CA   2  
ATOM   708   C  C    . SER A 1 3  ? -14.853 2.101   9.531   1.00 0.00 ? 3   SER A C    2  
ATOM   709   O  O    . SER A 1 3  ? -14.589 2.530   10.653  1.00 0.00 ? 3   SER A O    2  
ATOM   710   C  CB   . SER A 1 3  ? -17.232 2.829   9.263   1.00 0.00 ? 3   SER A CB   2  
ATOM   711   O  OG   . SER A 1 3  ? -18.538 2.451   8.866   1.00 0.00 ? 3   SER A OG   2  
ATOM   712   H  H    . SER A 1 3  ? -17.283 0.786   10.825  1.00 0.00 ? 3   SER A H    2  
ATOM   713   H  HA   . SER A 1 3  ? -16.267 1.263   8.169   1.00 0.00 ? 3   SER A HA   2  
ATOM   714   H  HB2  . SER A 1 3  ? -17.268 3.189   10.280  1.00 0.00 ? 3   SER A HB2  2  
ATOM   715   H  HB3  . SER A 1 3  ? -16.885 3.620   8.614   1.00 0.00 ? 3   SER A HB3  2  
ATOM   716   H  HG   . SER A 1 3  ? -19.085 3.234   8.775   1.00 0.00 ? 3   SER A HG   2  
ATOM   717   N  N    . GLY A 1 4  ? -13.948 2.005   8.562   1.00 0.00 ? 4   GLY A N    2  
ATOM   718   C  CA   . GLY A 1 4  ? -12.573 2.410   8.788   1.00 0.00 ? 4   GLY A CA   2  
ATOM   719   C  C    . GLY A 1 4  ? -12.127 3.502   7.836   1.00 0.00 ? 4   GLY A C    2  
ATOM   720   O  O    . GLY A 1 4  ? -11.859 3.242   6.663   1.00 0.00 ? 4   GLY A O    2  
ATOM   721   H  H    . GLY A 1 4  ? -14.216 1.655   7.686   1.00 0.00 ? 4   GLY A H    2  
ATOM   722   H  HA2  . GLY A 1 4  ? -12.477 2.768   9.802   1.00 0.00 ? 4   GLY A HA2  2  
ATOM   723   H  HA3  . GLY A 1 4  ? -11.931 1.551   8.658   1.00 0.00 ? 4   GLY A HA3  2  
ATOM   724   N  N    . SER A 1 5  ? -12.047 4.729   8.342   1.00 0.00 ? 5   SER A N    2  
ATOM   725   C  CA   . SER A 1 5  ? -11.635 5.866   7.527   1.00 0.00 ? 5   SER A CA   2  
ATOM   726   C  C    . SER A 1 5  ? -10.310 5.582   6.827   1.00 0.00 ? 5   SER A C    2  
ATOM   727   O  O    . SER A 1 5  ? -9.978  6.210   5.822   1.00 0.00 ? 5   SER A O    2  
ATOM   728   C  CB   . SER A 1 5  ? -11.509 7.121   8.393   1.00 0.00 ? 5   SER A CB   2  
ATOM   729   O  OG   . SER A 1 5  ? -10.981 6.809   9.670   1.00 0.00 ? 5   SER A OG   2  
ATOM   730   H  H    . SER A 1 5  ? -12.273 4.873   9.285   1.00 0.00 ? 5   SER A H    2  
ATOM   731   H  HA   . SER A 1 5  ? -12.396 6.031   6.779   1.00 0.00 ? 5   SER A HA   2  
ATOM   732   H  HB2  . SER A 1 5  ? -10.851 7.826   7.907   1.00 0.00 ? 5   SER A HB2  2  
ATOM   733   H  HB3  . SER A 1 5  ? -12.485 7.568   8.519   1.00 0.00 ? 5   SER A HB3  2  
ATOM   734   H  HG   . SER A 1 5  ? -10.510 5.974   9.627   1.00 0.00 ? 5   SER A HG   2  
ATOM   735   N  N    . SER A 1 6  ? -9.556  4.629   7.367   1.00 0.00 ? 6   SER A N    2  
ATOM   736   C  CA   . SER A 1 6  ? -8.264  4.263   6.797   1.00 0.00 ? 6   SER A CA   2  
ATOM   737   C  C    . SER A 1 6  ? -8.395  3.037   5.898   1.00 0.00 ? 6   SER A C    2  
ATOM   738   O  O    . SER A 1 6  ? -8.022  3.071   4.726   1.00 0.00 ? 6   SER A O    2  
ATOM   739   C  CB   . SER A 1 6  ? -7.252  3.986   7.911   1.00 0.00 ? 6   SER A CB   2  
ATOM   740   O  OG   . SER A 1 6  ? -7.775  3.074   8.860   1.00 0.00 ? 6   SER A OG   2  
ATOM   741   H  H    . SER A 1 6  ? -9.875  4.164   8.168   1.00 0.00 ? 6   SER A H    2  
ATOM   742   H  HA   . SER A 1 6  ? -7.915  5.095   6.204   1.00 0.00 ? 6   SER A HA   2  
ATOM   743   H  HB2  . SER A 1 6  ? -6.355  3.566   7.482   1.00 0.00 ? 6   SER A HB2  2  
ATOM   744   H  HB3  . SER A 1 6  ? -7.012  4.912   8.413   1.00 0.00 ? 6   SER A HB3  2  
ATOM   745   H  HG   . SER A 1 6  ? -7.058  2.564   9.243   1.00 0.00 ? 6   SER A HG   2  
ATOM   746   N  N    . GLY A 1 7  ? -8.928  1.955   6.456   1.00 0.00 ? 7   GLY A N    2  
ATOM   747   C  CA   . GLY A 1 7  ? -9.099  0.734   5.692   1.00 0.00 ? 7   GLY A CA   2  
ATOM   748   C  C    . GLY A 1 7  ? -9.327  -0.477  6.576   1.00 0.00 ? 7   GLY A C    2  
ATOM   749   O  O    . GLY A 1 7  ? -9.384  -0.358  7.800   1.00 0.00 ? 7   GLY A O    2  
ATOM   750   H  H    . GLY A 1 7  ? -9.208  1.986   7.395   1.00 0.00 ? 7   GLY A H    2  
ATOM   751   H  HA2  . GLY A 1 7  ? -9.947  0.850   5.033   1.00 0.00 ? 7   GLY A HA2  2  
ATOM   752   H  HA3  . GLY A 1 7  ? -8.213  0.568   5.096   1.00 0.00 ? 7   GLY A HA3  2  
ATOM   753   N  N    . SER A 1 8  ? -9.459  -1.645  5.955   1.00 0.00 ? 8   SER A N    2  
ATOM   754   C  CA   . SER A 1 8  ? -9.688  -2.881  6.693   1.00 0.00 ? 8   SER A CA   2  
ATOM   755   C  C    . SER A 1 8  ? -8.801  -4.003  6.162   1.00 0.00 ? 8   SER A C    2  
ATOM   756   O  O    . SER A 1 8  ? -8.884  -4.374  4.990   1.00 0.00 ? 8   SER A O    2  
ATOM   757   C  CB   . SER A 1 8  ? -11.159 -3.291  6.601   1.00 0.00 ? 8   SER A CB   2  
ATOM   758   O  OG   . SER A 1 8  ? -11.942 -2.600  7.559   1.00 0.00 ? 8   SER A OG   2  
ATOM   759   H  H    . SER A 1 8  ? -9.404  -1.674  4.977   1.00 0.00 ? 8   SER A H    2  
ATOM   760   H  HA   . SER A 1 8  ? -9.438  -2.700  7.728   1.00 0.00 ? 8   SER A HA   2  
ATOM   761   H  HB2  . SER A 1 8  ? -11.532 -3.061  5.615   1.00 0.00 ? 8   SER A HB2  2  
ATOM   762   H  HB3  . SER A 1 8  ? -11.245 -4.353  6.780   1.00 0.00 ? 8   SER A HB3  2  
ATOM   763   H  HG   . SER A 1 8  ? -11.388 -2.344  8.300   1.00 0.00 ? 8   SER A HG   2  
ATOM   764   N  N    . LEU A 1 9  ? -7.952  -4.540  7.031   1.00 0.00 ? 9   LEU A N    2  
ATOM   765   C  CA   . LEU A 1 9  ? -7.049  -5.621  6.651   1.00 0.00 ? 9   LEU A CA   2  
ATOM   766   C  C    . LEU A 1 9  ? -7.822  -6.791  6.051   1.00 0.00 ? 9   LEU A C    2  
ATOM   767   O  O    . LEU A 1 9  ? -8.506  -7.525  6.763   1.00 0.00 ? 9   LEU A O    2  
ATOM   768   C  CB   . LEU A 1 9  ? -6.247  -6.093  7.865   1.00 0.00 ? 9   LEU A CB   2  
ATOM   769   C  CG   . LEU A 1 9  ? -5.056  -5.220  8.264   1.00 0.00 ? 9   LEU A CG   2  
ATOM   770   C  CD1  . LEU A 1 9  ? -4.578  -5.576  9.662   1.00 0.00 ? 9   LEU A CD1  2  
ATOM   771   C  CD2  . LEU A 1 9  ? -3.925  -5.369  7.257   1.00 0.00 ? 9   LEU A CD2  2  
ATOM   772   H  H    . LEU A 1 9  ? -7.932  -4.203  7.951   1.00 0.00 ? 9   LEU A H    2  
ATOM   773   H  HA   . LEU A 1 9  ? -6.367  -5.236  5.907   1.00 0.00 ? 9   LEU A HA   2  
ATOM   774   H  HB2  . LEU A 1 9  ? -6.920  -6.139  8.708   1.00 0.00 ? 9   LEU A HB2  2  
ATOM   775   H  HB3  . LEU A 1 9  ? -5.875  -7.084  7.649   1.00 0.00 ? 9   LEU A HB3  2  
ATOM   776   H  HG   . LEU A 1 9  ? -5.364  -4.183  8.271   1.00 0.00 ? 9   LEU A HG   2  
ATOM   777   H  HD11 . LEU A 1 9  ? -5.374  -5.403  10.370  1.00 0.00 ? 9   LEU A HD11 2  
ATOM   778   H  HD12 . LEU A 1 9  ? -3.728  -4.962  9.919   1.00 0.00 ? 9   LEU A HD12 2  
ATOM   779   H  HD13 . LEU A 1 9  ? -4.291  -6.617  9.690   1.00 0.00 ? 9   LEU A HD13 2  
ATOM   780   H  HD21 . LEU A 1 9  ? -4.086  -6.257  6.663   1.00 0.00 ? 9   LEU A HD21 2  
ATOM   781   H  HD22 . LEU A 1 9  ? -2.985  -5.453  7.782   1.00 0.00 ? 9   LEU A HD22 2  
ATOM   782   H  HD23 . LEU A 1 9  ? -3.901  -4.503  6.612   1.00 0.00 ? 9   LEU A HD23 2  
ATOM   783   N  N    . MET A 1 10 ? -7.705  -6.960  4.738   1.00 0.00 ? 10  MET A N    2  
ATOM   784   C  CA   . MET A 1 10 ? -8.390  -8.043  4.043   1.00 0.00 ? 10  MET A CA   2  
ATOM   785   C  C    . MET A 1 10 ? -7.794  -9.395  4.423   1.00 0.00 ? 10  MET A C    2  
ATOM   786   O  O    . MET A 1 10 ? -6.777  -9.464  5.113   1.00 0.00 ? 10  MET A O    2  
ATOM   787   C  CB   . MET A 1 10 ? -8.304  -7.842  2.529   1.00 0.00 ? 10  MET A CB   2  
ATOM   788   C  CG   . MET A 1 10 ? -8.899  -6.526  2.056   1.00 0.00 ? 10  MET A CG   2  
ATOM   789   S  SD   . MET A 1 10 ? -9.508  -6.608  0.361   1.00 0.00 ? 10  MET A SD   2  
ATOM   790   C  CE   . MET A 1 10 ? -11.095 -7.399  0.610   1.00 0.00 ? 10  MET A CE   2  
ATOM   791   H  H    . MET A 1 10 ? -7.144  -6.342  4.224   1.00 0.00 ? 10  MET A H    2  
ATOM   792   H  HA   . MET A 1 10 ? -9.428  -8.024  4.341   1.00 0.00 ? 10  MET A HA   2  
ATOM   793   H  HB2  . MET A 1 10 ? -7.266  -7.871  2.233   1.00 0.00 ? 10  MET A HB2  2  
ATOM   794   H  HB3  . MET A 1 10 ? -8.832  -8.647  2.040   1.00 0.00 ? 10  MET A HB3  2  
ATOM   795   H  HG2  . MET A 1 10 ? -9.720  -6.263  2.706   1.00 0.00 ? 10  MET A HG2  2  
ATOM   796   H  HG3  . MET A 1 10 ? -8.138  -5.762  2.114   1.00 0.00 ? 10  MET A HG3  2  
ATOM   797   H  HE1  . MET A 1 10 ? -11.821 -6.661  0.918   1.00 0.00 ? 10  MET A HE1  2  
ATOM   798   H  HE2  . MET A 1 10 ? -11.418 -7.857  -0.314  1.00 0.00 ? 10  MET A HE2  2  
ATOM   799   H  HE3  . MET A 1 10 ? -11.004 -8.156  1.374   1.00 0.00 ? 10  MET A HE3  2  
ATOM   800   N  N    . ASP A 1 11 ? -8.433  -10.467 3.968   1.00 0.00 ? 11  ASP A N    2  
ATOM   801   C  CA   . ASP A 1 11 ? -7.966  -11.817 4.260   1.00 0.00 ? 11  ASP A CA   2  
ATOM   802   C  C    . ASP A 1 11 ? -6.972  -12.289 3.203   1.00 0.00 ? 11  ASP A C    2  
ATOM   803   O  O    . ASP A 1 11 ? -6.638  -13.472 3.133   1.00 0.00 ? 11  ASP A O    2  
ATOM   804   C  CB   . ASP A 1 11 ? -9.148  -12.785 4.334   1.00 0.00 ? 11  ASP A CB   2  
ATOM   805   C  CG   . ASP A 1 11 ? -10.034 -12.525 5.537   1.00 0.00 ? 11  ASP A CG   2  
ATOM   806   O  OD1  . ASP A 1 11 ? -10.962 -11.696 5.422   1.00 0.00 ? 11  ASP A OD1  2  
ATOM   807   O  OD2  . ASP A 1 11 ? -9.801  -13.150 6.592   1.00 0.00 ? 11  ASP A OD2  2  
ATOM   808   H  H    . ASP A 1 11 ? -9.239  -10.348 3.423   1.00 0.00 ? 11  ASP A H    2  
ATOM   809   H  HA   . ASP A 1 11 ? -7.469  -11.796 5.218   1.00 0.00 ? 11  ASP A HA   2  
ATOM   810   H  HB2  . ASP A 1 11 ? -9.746  -12.681 3.441   1.00 0.00 ? 11  ASP A HB2  2  
ATOM   811   H  HB3  . ASP A 1 11 ? -8.774  -13.796 4.397   1.00 0.00 ? 11  ASP A HB3  2  
ATOM   812   N  N    . VAL A 1 12 ? -6.504  -11.355 2.380   1.00 0.00 ? 12  VAL A N    2  
ATOM   813   C  CA   . VAL A 1 12 ? -5.549  -11.675 1.326   1.00 0.00 ? 12  VAL A CA   2  
ATOM   814   C  C    . VAL A 1 12 ? -4.190  -11.043 1.605   1.00 0.00 ? 12  VAL A C    2  
ATOM   815   O  O    . VAL A 1 12 ? -4.105  -9.902  2.059   1.00 0.00 ? 12  VAL A O    2  
ATOM   816   C  CB   . VAL A 1 12 ? -6.051  -11.198 -0.050  1.00 0.00 ? 12  VAL A CB   2  
ATOM   817   C  CG1  . VAL A 1 12 ? -6.341  -9.705  -0.025  1.00 0.00 ? 12  VAL A CG1  2  
ATOM   818   C  CG2  . VAL A 1 12 ? -5.038  -11.535 -1.133  1.00 0.00 ? 12  VAL A CG2  2  
ATOM   819   H  H    . VAL A 1 12 ? -6.808  -10.430 2.485   1.00 0.00 ? 12  VAL A H    2  
ATOM   820   H  HA   . VAL A 1 12 ? -5.436  -12.749 1.292   1.00 0.00 ? 12  VAL A HA   2  
ATOM   821   H  HB   . VAL A 1 12 ? -6.972  -11.717 -0.274  1.00 0.00 ? 12  VAL A HB   2  
ATOM   822   H  HG11 . VAL A 1 12 ? -6.065  -9.269  -0.974  1.00 0.00 ? 12  VAL A HG11 2  
ATOM   823   H  HG12 . VAL A 1 12 ? -7.394  -9.545  0.154   1.00 0.00 ? 12  VAL A HG12 2  
ATOM   824   H  HG13 . VAL A 1 12 ? -5.766  -9.240  0.764   1.00 0.00 ? 12  VAL A HG13 2  
ATOM   825   H  HG21 . VAL A 1 12 ? -5.124  -12.578 -1.396  1.00 0.00 ? 12  VAL A HG21 2  
ATOM   826   H  HG22 . VAL A 1 12 ? -5.227  -10.926 -2.005  1.00 0.00 ? 12  VAL A HG22 2  
ATOM   827   H  HG23 . VAL A 1 12 ? -4.040  -11.338 -0.767  1.00 0.00 ? 12  VAL A HG23 2  
ATOM   828   N  N    . LYS A 1 13 ? -3.128  -11.793 1.331   1.00 0.00 ? 13  LYS A N    2  
ATOM   829   C  CA   . LYS A 1 13 ? -1.771  -11.307 1.551   1.00 0.00 ? 13  LYS A CA   2  
ATOM   830   C  C    . LYS A 1 13 ? -1.451  -10.144 0.617   1.00 0.00 ? 13  LYS A C    2  
ATOM   831   O  O    . LYS A 1 13 ? -2.000  -10.047 -0.481  1.00 0.00 ? 13  LYS A O    2  
ATOM   832   C  CB   . LYS A 1 13 ? -0.762  -12.438 1.338   1.00 0.00 ? 13  LYS A CB   2  
ATOM   833   C  CG   . LYS A 1 13 ? -0.527  -13.284 2.577   1.00 0.00 ? 13  LYS A CG   2  
ATOM   834   C  CD   . LYS A 1 13 ? -1.574  -14.376 2.714   1.00 0.00 ? 13  LYS A CD   2  
ATOM   835   C  CE   . LYS A 1 13 ? -1.401  -15.451 1.651   1.00 0.00 ? 13  LYS A CE   2  
ATOM   836   N  NZ   . LYS A 1 13 ? -2.092  -16.716 2.024   1.00 0.00 ? 13  LYS A NZ   2  
ATOM   837   H  H    . LYS A 1 13 ? -3.260  -12.696 0.971   1.00 0.00 ? 13  LYS A H    2  
ATOM   838   H  HA   . LYS A 1 13 ? -1.703  -10.963 2.572   1.00 0.00 ? 13  LYS A HA   2  
ATOM   839   H  HB2  . LYS A 1 13 ? -1.122  -13.083 0.550   1.00 0.00 ? 13  LYS A HB2  2  
ATOM   840   H  HB3  . LYS A 1 13 ? 0.183   -12.009 1.037   1.00 0.00 ? 13  LYS A HB3  2  
ATOM   841   H  HG2  . LYS A 1 13 ? 0.449   -13.743 2.510   1.00 0.00 ? 13  LYS A HG2  2  
ATOM   842   H  HG3  . LYS A 1 13 ? -0.567  -12.648 3.450   1.00 0.00 ? 13  LYS A HG3  2  
ATOM   843   H  HD2  . LYS A 1 13 ? -1.483  -14.832 3.688   1.00 0.00 ? 13  LYS A HD2  2  
ATOM   844   H  HD3  . LYS A 1 13 ? -2.556  -13.936 2.611   1.00 0.00 ? 13  LYS A HD3  2  
ATOM   845   H  HE2  . LYS A 1 13 ? -1.809  -15.089 0.721   1.00 0.00 ? 13  LYS A HE2  2  
ATOM   846   H  HE3  . LYS A 1 13 ? -0.346  -15.650 1.528   1.00 0.00 ? 13  LYS A HE3  2  
ATOM   847   H  HZ1  . LYS A 1 13 ? -1.589  -17.531 1.619   1.00 0.00 ? 13  LYS A HZ1  2  
ATOM   848   H  HZ2  . LYS A 1 13 ? -3.067  -16.710 1.663   1.00 0.00 ? 13  LYS A HZ2  2  
ATOM   849   H  HZ3  . LYS A 1 13 ? -2.118  -16.818 3.059   1.00 0.00 ? 13  LYS A HZ3  2  
ATOM   850   N  N    . CYS A 1 14 ? -0.559  -9.264  1.060   1.00 0.00 ? 14  CYS A N    2  
ATOM   851   C  CA   . CYS A 1 14 ? -0.166  -8.108  0.264   1.00 0.00 ? 14  CYS A CA   2  
ATOM   852   C  C    . CYS A 1 14 ? 0.277   -8.534  -1.133  1.00 0.00 ? 14  CYS A C    2  
ATOM   853   O  O    . CYS A 1 14 ? 0.923   -9.568  -1.301  1.00 0.00 ? 14  CYS A O    2  
ATOM   854   C  CB   . CYS A 1 14 ? 0.965   -7.346  0.958   1.00 0.00 ? 14  CYS A CB   2  
ATOM   855   S  SG   . CYS A 1 14 ? 1.689   -6.011  -0.048  1.00 0.00 ? 14  CYS A SG   2  
ATOM   856   H  H    . CYS A 1 14 ? -0.156  -9.395  1.944   1.00 0.00 ? 14  CYS A H    2  
ATOM   857   H  HA   . CYS A 1 14 ? -1.023  -7.459  0.174   1.00 0.00 ? 14  CYS A HA   2  
ATOM   858   H  HB2  . CYS A 1 14 ? 0.584   -6.902  1.866   1.00 0.00 ? 14  CYS A HB2  2  
ATOM   859   H  HB3  . CYS A 1 14 ? 1.756   -8.037  1.206   1.00 0.00 ? 14  CYS A HB3  2  
ATOM   860   N  N    . GLU A 1 15 ? -0.076  -7.730  -2.131  1.00 0.00 ? 15  GLU A N    2  
ATOM   861   C  CA   . GLU A 1 15 ? 0.285   -8.025  -3.513  1.00 0.00 ? 15  GLU A CA   2  
ATOM   862   C  C    . GLU A 1 15 ? 1.692   -8.608  -3.595  1.00 0.00 ? 15  GLU A C    2  
ATOM   863   O  O    . GLU A 1 15 ? 1.897   -9.693  -4.142  1.00 0.00 ? 15  GLU A O    2  
ATOM   864   C  CB   . GLU A 1 15 ? 0.194   -6.759  -4.368  1.00 0.00 ? 15  GLU A CB   2  
ATOM   865   C  CG   . GLU A 1 15 ? 0.296   -7.025  -5.861  1.00 0.00 ? 15  GLU A CG   2  
ATOM   866   C  CD   . GLU A 1 15 ? 1.727   -7.225  -6.321  1.00 0.00 ? 15  GLU A CD   2  
ATOM   867   O  OE1  . GLU A 1 15 ? 2.629   -6.571  -5.755  1.00 0.00 ? 15  GLU A OE1  2  
ATOM   868   O  OE2  . GLU A 1 15 ? 1.946   -8.034  -7.246  1.00 0.00 ? 15  GLU A OE2  2  
ATOM   869   H  H    . GLU A 1 15 ? -0.591  -6.920  -1.933  1.00 0.00 ? 15  GLU A H    2  
ATOM   870   H  HA   . GLU A 1 15 ? -0.416  -8.754  -3.890  1.00 0.00 ? 15  GLU A HA   2  
ATOM   871   H  HB2  . GLU A 1 15 ? -0.751  -6.274  -4.173  1.00 0.00 ? 15  GLU A HB2  2  
ATOM   872   H  HB3  . GLU A 1 15 ? 0.995   -6.092  -4.087  1.00 0.00 ? 15  GLU A HB3  2  
ATOM   873   H  HG2  . GLU A 1 15 ? -0.268  -7.915  -6.095  1.00 0.00 ? 15  GLU A HG2  2  
ATOM   874   H  HG3  . GLU A 1 15 ? -0.123  -6.183  -6.392  1.00 0.00 ? 15  GLU A HG3  2  
ATOM   875   N  N    . THR A 1 16 ? 2.661   -7.880  -3.049  1.00 0.00 ? 16  THR A N    2  
ATOM   876   C  CA   . THR A 1 16 ? 4.050   -8.322  -3.062  1.00 0.00 ? 16  THR A CA   2  
ATOM   877   C  C    . THR A 1 16 ? 4.181   -9.738  -2.512  1.00 0.00 ? 16  THR A C    2  
ATOM   878   O  O    . THR A 1 16 ? 3.761   -10.036 -1.393  1.00 0.00 ? 16  THR A O    2  
ATOM   879   C  CB   . THR A 1 16 ? 4.948   -7.379  -2.239  1.00 0.00 ? 16  THR A CB   2  
ATOM   880   O  OG1  . THR A 1 16 ? 4.937   -6.068  -2.814  1.00 0.00 ? 16  THR A OG1  2  
ATOM   881   C  CG2  . THR A 1 16 ? 6.375   -7.902  -2.183  1.00 0.00 ? 16  THR A CG2  2  
ATOM   882   H  H    . THR A 1 16 ? 2.435   -7.024  -2.629  1.00 0.00 ? 16  THR A H    2  
ATOM   883   H  HA   . THR A 1 16 ? 4.394   -8.311  -4.086  1.00 0.00 ? 16  THR A HA   2  
ATOM   884   H  HB   . THR A 1 16 ? 4.560   -7.325  -1.232  1.00 0.00 ? 16  THR A HB   2  
ATOM   885   H  HG1  . THR A 1 16 ? 4.169   -5.585  -2.498  1.00 0.00 ? 16  THR A HG1  2  
ATOM   886   H  HG21 . THR A 1 16 ? 6.582   -8.277  -1.192  1.00 0.00 ? 16  THR A HG21 2  
ATOM   887   H  HG22 . THR A 1 16 ? 7.061   -7.102  -2.416  1.00 0.00 ? 16  THR A HG22 2  
ATOM   888   H  HG23 . THR A 1 16 ? 6.494   -8.700  -2.902  1.00 0.00 ? 16  THR A HG23 2  
ATOM   889   N  N    . PRO A 1 17 ? 4.777   -10.632 -3.314  1.00 0.00 ? 17  PRO A N    2  
ATOM   890   C  CA   . PRO A 1 17 ? 4.978   -12.032 -2.927  1.00 0.00 ? 17  PRO A CA   2  
ATOM   891   C  C    . PRO A 1 17 ? 6.017   -12.184 -1.821  1.00 0.00 ? 17  PRO A C    2  
ATOM   892   O  O    . PRO A 1 17 ? 6.310   -13.295 -1.381  1.00 0.00 ? 17  PRO A O    2  
ATOM   893   C  CB   . PRO A 1 17 ? 5.471   -12.689 -4.218  1.00 0.00 ? 17  PRO A CB   2  
ATOM   894   C  CG   . PRO A 1 17 ? 6.093   -11.580 -4.995  1.00 0.00 ? 17  PRO A CG   2  
ATOM   895   C  CD   . PRO A 1 17 ? 5.302   -10.346 -4.660  1.00 0.00 ? 17  PRO A CD   2  
ATOM   896   H  HA   . PRO A 1 17 ? 4.053   -12.495 -2.616  1.00 0.00 ? 17  PRO A HA   2  
ATOM   897   H  HB2  . PRO A 1 17 ? 6.192   -13.459 -3.981  1.00 0.00 ? 17  PRO A HB2  2  
ATOM   898   H  HB3  . PRO A 1 17 ? 4.636   -13.122 -4.748  1.00 0.00 ? 17  PRO A HB3  2  
ATOM   899   H  HG2  . PRO A 1 17 ? 7.123   -11.457 -4.699  1.00 0.00 ? 17  PRO A HG2  2  
ATOM   900   H  HG3  . PRO A 1 17 ? 6.027   -11.791 -6.052  1.00 0.00 ? 17  PRO A HG3  2  
ATOM   901   H  HD2  . PRO A 1 17 ? 5.944   -9.478  -4.647  1.00 0.00 ? 17  PRO A HD2  2  
ATOM   902   H  HD3  . PRO A 1 17 ? 4.496   -10.211 -5.366  1.00 0.00 ? 17  PRO A HD3  2  
ATOM   903   N  N    . ASN A 1 18 ? 6.571   -11.061 -1.377  1.00 0.00 ? 18  ASN A N    2  
ATOM   904   C  CA   . ASN A 1 18 ? 7.578   -11.070 -0.322  1.00 0.00 ? 18  ASN A CA   2  
ATOM   905   C  C    . ASN A 1 18 ? 7.063   -10.362 0.927   1.00 0.00 ? 18  ASN A C    2  
ATOM   906   O  O    . ASN A 1 18 ? 7.694   -10.406 1.984   1.00 0.00 ? 18  ASN A O    2  
ATOM   907   C  CB   . ASN A 1 18 ? 8.863   -10.399 -0.810  1.00 0.00 ? 18  ASN A CB   2  
ATOM   908   C  CG   . ASN A 1 18 ? 9.372   -10.997 -2.107  1.00 0.00 ? 18  ASN A CG   2  
ATOM   909   O  OD1  . ASN A 1 18 ? 10.046  -12.028 -2.106  1.00 0.00 ? 18  ASN A OD1  2  
ATOM   910   N  ND2  . ASN A 1 18 ? 9.052   -10.352 -3.222  1.00 0.00 ? 18  ASN A ND2  2  
ATOM   911   H  H    . ASN A 1 18 ? 6.296   -10.205 -1.768  1.00 0.00 ? 18  ASN A H    2  
ATOM   912   H  HA   . ASN A 1 18 ? 7.791   -12.100 -0.076  1.00 0.00 ? 18  ASN A HA   2  
ATOM   913   H  HB2  . ASN A 1 18 ? 8.674   -9.347  -0.971  1.00 0.00 ? 18  ASN A HB2  2  
ATOM   914   H  HB3  . ASN A 1 18 ? 9.629   -10.511 -0.057  1.00 0.00 ? 18  ASN A HB3  2  
ATOM   915   H  HD21 . ASN A 1 18 ? 8.513   -9.536  -3.147  1.00 0.00 ? 18  ASN A HD21 2  
ATOM   916   H  HD22 . ASN A 1 18 ? 9.367   -10.717 -4.075  1.00 0.00 ? 18  ASN A HD22 2  
ATOM   917   N  N    . CYS A 1 19 ? 5.913   -9.709  0.799   1.00 0.00 ? 19  CYS A N    2  
ATOM   918   C  CA   . CYS A 1 19 ? 5.312   -8.991  1.917   1.00 0.00 ? 19  CYS A CA   2  
ATOM   919   C  C    . CYS A 1 19 ? 4.276   -9.858  2.627   1.00 0.00 ? 19  CYS A C    2  
ATOM   920   O  O    . CYS A 1 19 ? 3.195   -10.130 2.104   1.00 0.00 ? 19  CYS A O    2  
ATOM   921   C  CB   . CYS A 1 19 ? 4.660   -7.697  1.427   1.00 0.00 ? 19  CYS A CB   2  
ATOM   922   S  SG   . CYS A 1 19 ? 4.284   -6.506  2.753   1.00 0.00 ? 19  CYS A SG   2  
ATOM   923   H  H    . CYS A 1 19 ? 5.456   -9.710  -0.069  1.00 0.00 ? 19  CYS A H    2  
ATOM   924   H  HA   . CYS A 1 19 ? 6.098   -8.747  2.615   1.00 0.00 ? 19  CYS A HA   2  
ATOM   925   H  HB2  . CYS A 1 19 ? 5.325   -7.210  0.729   1.00 0.00 ? 19  CYS A HB2  2  
ATOM   926   H  HB3  . CYS A 1 19 ? 3.734   -7.936  0.927   1.00 0.00 ? 19  CYS A HB3  2  
ATOM   927   N  N    . PRO A 1 20 ? 4.613   -10.304 3.846   1.00 0.00 ? 20  PRO A N    2  
ATOM   928   C  CA   . PRO A 1 20 ? 3.726   -11.146 4.654   1.00 0.00 ? 20  PRO A CA   2  
ATOM   929   C  C    . PRO A 1 20 ? 2.507   -10.383 5.162   1.00 0.00 ? 20  PRO A C    2  
ATOM   930   O  O    . PRO A 1 20 ? 1.521   -10.983 5.591   1.00 0.00 ? 20  PRO A O    2  
ATOM   931   C  CB   . PRO A 1 20 ? 4.614   -11.575 5.825   1.00 0.00 ? 20  PRO A CB   2  
ATOM   932   C  CG   . PRO A 1 20 ? 5.642   -10.503 5.933   1.00 0.00 ? 20  PRO A CG   2  
ATOM   933   C  CD   . PRO A 1 20 ? 5.885   -10.019 4.530   1.00 0.00 ? 20  PRO A CD   2  
ATOM   934   H  HA   . PRO A 1 20 ? 3.401   -12.019 4.108   1.00 0.00 ? 20  PRO A HA   2  
ATOM   935   H  HB2  . PRO A 1 20 ? 4.018   -11.645 6.725   1.00 0.00 ? 20  PRO A HB2  2  
ATOM   936   H  HB3  . PRO A 1 20 ? 5.063   -12.532 5.609   1.00 0.00 ? 20  PRO A HB3  2  
ATOM   937   H  HG2  . PRO A 1 20 ? 5.271   -9.698  6.549   1.00 0.00 ? 20  PRO A HG2  2  
ATOM   938   H  HG3  . PRO A 1 20 ? 6.552   -10.908 6.352   1.00 0.00 ? 20  PRO A HG3  2  
ATOM   939   H  HD2  . PRO A 1 20 ? 6.096   -8.960  4.528   1.00 0.00 ? 20  PRO A HD2  2  
ATOM   940   H  HD3  . PRO A 1 20 ? 6.697   -10.568 4.077   1.00 0.00 ? 20  PRO A HD3  2  
ATOM   941   N  N    . PHE A 1 21 ? 2.580   -9.057  5.109   1.00 0.00 ? 21  PHE A N    2  
ATOM   942   C  CA   . PHE A 1 21 ? 1.482   -8.213  5.565   1.00 0.00 ? 21  PHE A CA   2  
ATOM   943   C  C    . PHE A 1 21 ? 0.291   -8.309  4.615   1.00 0.00 ? 21  PHE A C    2  
ATOM   944   O  O    . PHE A 1 21 ? 0.459   -8.469  3.406   1.00 0.00 ? 21  PHE A O    2  
ATOM   945   C  CB   . PHE A 1 21 ? 1.942   -6.758  5.677   1.00 0.00 ? 21  PHE A CB   2  
ATOM   946   C  CG   . PHE A 1 21 ? 2.838   -6.502  6.855   1.00 0.00 ? 21  PHE A CG   2  
ATOM   947   C  CD1  . PHE A 1 21 ? 2.395   -6.743  8.145   1.00 0.00 ? 21  PHE A CD1  2  
ATOM   948   C  CD2  . PHE A 1 21 ? 4.124   -6.020  6.672   1.00 0.00 ? 21  PHE A CD2  2  
ATOM   949   C  CE1  . PHE A 1 21 ? 3.217   -6.510  9.231   1.00 0.00 ? 21  PHE A CE1  2  
ATOM   950   C  CE2  . PHE A 1 21 ? 4.951   -5.784  7.754   1.00 0.00 ? 21  PHE A CE2  2  
ATOM   951   C  CZ   . PHE A 1 21 ? 4.497   -6.028  9.035   1.00 0.00 ? 21  PHE A CZ   2  
ATOM   952   H  H    . PHE A 1 21 ? 3.392   -8.637  4.757   1.00 0.00 ? 21  PHE A H    2  
ATOM   953   H  HA   . PHE A 1 21 ? 1.178   -8.562  6.540   1.00 0.00 ? 21  PHE A HA   2  
ATOM   954   H  HB2  . PHE A 1 21 ? 2.485   -6.489  4.784   1.00 0.00 ? 21  PHE A HB2  2  
ATOM   955   H  HB3  . PHE A 1 21 ? 1.076   -6.120  5.773   1.00 0.00 ? 21  PHE A HB3  2  
ATOM   956   H  HD1  . PHE A 1 21 ? 1.393   -7.120  8.300   1.00 0.00 ? 21  PHE A HD1  2  
ATOM   957   H  HD2  . PHE A 1 21 ? 4.481   -5.827  5.671   1.00 0.00 ? 21  PHE A HD2  2  
ATOM   958   H  HE1  . PHE A 1 21 ? 2.858   -6.702  10.232  1.00 0.00 ? 21  PHE A HE1  2  
ATOM   959   H  HE2  . PHE A 1 21 ? 5.951   -5.408  7.598   1.00 0.00 ? 21  PHE A HE2  2  
ATOM   960   H  HZ   . PHE A 1 21 ? 5.141   -5.846  9.882   1.00 0.00 ? 21  PHE A HZ   2  
ATOM   961   N  N    . PHE A 1 22 ? -0.911  -8.211  5.171   1.00 0.00 ? 22  PHE A N    2  
ATOM   962   C  CA   . PHE A 1 22 ? -2.131  -8.289  4.375   1.00 0.00 ? 22  PHE A CA   2  
ATOM   963   C  C    . PHE A 1 22 ? -2.448  -6.941  3.733   1.00 0.00 ? 22  PHE A C    2  
ATOM   964   O  O    . PHE A 1 22 ? -2.035  -5.893  4.229   1.00 0.00 ? 22  PHE A O    2  
ATOM   965   C  CB   . PHE A 1 22 ? -3.305  -8.741  5.245   1.00 0.00 ? 22  PHE A CB   2  
ATOM   966   C  CG   . PHE A 1 22 ? -3.162  -10.144 5.763   1.00 0.00 ? 22  PHE A CG   2  
ATOM   967   C  CD1  . PHE A 1 22 ? -3.316  -11.229 4.915   1.00 0.00 ? 22  PHE A CD1  2  
ATOM   968   C  CD2  . PHE A 1 22 ? -2.873  -10.377 7.098   1.00 0.00 ? 22  PHE A CD2  2  
ATOM   969   C  CE1  . PHE A 1 22 ? -3.185  -12.520 5.390   1.00 0.00 ? 22  PHE A CE1  2  
ATOM   970   C  CE2  . PHE A 1 22 ? -2.741  -11.667 7.578   1.00 0.00 ? 22  PHE A CE2  2  
ATOM   971   C  CZ   . PHE A 1 22 ? -2.897  -12.740 6.723   1.00 0.00 ? 22  PHE A CZ   2  
ATOM   972   H  H    . PHE A 1 22 ? -0.981  -8.084  6.141   1.00 0.00 ? 22  PHE A H    2  
ATOM   973   H  HA   . PHE A 1 22 ? -1.970  -9.017  3.595   1.00 0.00 ? 22  PHE A HA   2  
ATOM   974   H  HB2  . PHE A 1 22 ? -3.390  -8.081  6.095   1.00 0.00 ? 22  PHE A HB2  2  
ATOM   975   H  HB3  . PHE A 1 22 ? -4.214  -8.692  4.664   1.00 0.00 ? 22  PHE A HB3  2  
ATOM   976   H  HD1  . PHE A 1 22 ? -3.540  -11.059 3.872   1.00 0.00 ? 22  PHE A HD1  2  
ATOM   977   H  HD2  . PHE A 1 22 ? -2.751  -9.538  7.769   1.00 0.00 ? 22  PHE A HD2  2  
ATOM   978   H  HE1  . PHE A 1 22 ? -3.307  -13.357 4.719   1.00 0.00 ? 22  PHE A HE1  2  
ATOM   979   H  HE2  . PHE A 1 22 ? -2.516  -11.834 8.621   1.00 0.00 ? 22  PHE A HE2  2  
ATOM   980   H  HZ   . PHE A 1 22 ? -2.794  -13.748 7.096   1.00 0.00 ? 22  PHE A HZ   2  
ATOM   981   N  N    . MET A 1 23 ? -3.184  -6.978  2.627   1.00 0.00 ? 23  MET A N    2  
ATOM   982   C  CA   . MET A 1 23 ? -3.557  -5.760  1.918   1.00 0.00 ? 23  MET A CA   2  
ATOM   983   C  C    . MET A 1 23 ? -4.951  -5.296  2.330   1.00 0.00 ? 23  MET A C    2  
ATOM   984   O  O    . MET A 1 23 ? -5.934  -6.014  2.147   1.00 0.00 ? 23  MET A O    2  
ATOM   985   C  CB   . MET A 1 23 ? -3.510  -5.990  0.406   1.00 0.00 ? 23  MET A CB   2  
ATOM   986   C  CG   . MET A 1 23 ? -4.239  -7.248  -0.040  1.00 0.00 ? 23  MET A CG   2  
ATOM   987   S  SD   . MET A 1 23 ? -4.669  -7.217  -1.791  1.00 0.00 ? 23  MET A SD   2  
ATOM   988   C  CE   . MET A 1 23 ? -3.912  -8.741  -2.352  1.00 0.00 ? 23  MET A CE   2  
ATOM   989   H  H    . MET A 1 23 ? -3.484  -7.844  2.280   1.00 0.00 ? 23  MET A H    2  
ATOM   990   H  HA   . MET A 1 23 ? -2.844  -4.993  2.178   1.00 0.00 ? 23  MET A HA   2  
ATOM   991   H  HB2  . MET A 1 23 ? -3.961  -5.144  -0.090  1.00 0.00 ? 23  MET A HB2  2  
ATOM   992   H  HB3  . MET A 1 23 ? -2.479  -6.070  0.097   1.00 0.00 ? 23  MET A HB3  2  
ATOM   993   H  HG2  . MET A 1 23 ? -3.604  -8.101  0.144   1.00 0.00 ? 23  MET A HG2  2  
ATOM   994   H  HG3  . MET A 1 23 ? -5.146  -7.345  0.538   1.00 0.00 ? 23  MET A HG3  2  
ATOM   995   H  HE1  . MET A 1 23 ? -2.906  -8.539  -2.691  1.00 0.00 ? 23  MET A HE1  2  
ATOM   996   H  HE2  . MET A 1 23 ? -3.882  -9.449  -1.537  1.00 0.00 ? 23  MET A HE2  2  
ATOM   997   H  HE3  . MET A 1 23 ? -4.491  -9.152  -3.165  1.00 0.00 ? 23  MET A HE3  2  
ATOM   998   N  N    . SER A 1 24 ? -5.028  -4.092  2.888   1.00 0.00 ? 24  SER A N    2  
ATOM   999   C  CA   . SER A 1 24 ? -6.301  -3.535  3.330   1.00 0.00 ? 24  SER A CA   2  
ATOM   1000  C  C    . SER A 1 24 ? -7.179  -3.172  2.136   1.00 0.00 ? 24  SER A C    2  
ATOM   1001  O  O    . SER A 1 24 ? -6.769  -3.312  0.984   1.00 0.00 ? 24  SER A O    2  
ATOM   1002  C  CB   . SER A 1 24 ? -6.065  -2.298  4.199   1.00 0.00 ? 24  SER A CB   2  
ATOM   1003  O  OG   . SER A 1 24 ? -5.182  -2.587  5.269   1.00 0.00 ? 24  SER A OG   2  
ATOM   1004  H  H    . SER A 1 24 ? -4.208  -3.568  3.007   1.00 0.00 ? 24  SER A H    2  
ATOM   1005  H  HA   . SER A 1 24 ? -6.806  -4.287  3.918   1.00 0.00 ? 24  SER A HA   2  
ATOM   1006  H  HB2  . SER A 1 24 ? -5.636  -1.513  3.595   1.00 0.00 ? 24  SER A HB2  2  
ATOM   1007  H  HB3  . SER A 1 24 ? -7.009  -1.963  4.606   1.00 0.00 ? 24  SER A HB3  2  
ATOM   1008  H  HG   . SER A 1 24 ? -5.236  -3.520  5.486   1.00 0.00 ? 24  SER A HG   2  
ATOM   1009  N  N    . VAL A 1 25 ? -8.390  -2.704  2.421   1.00 0.00 ? 25  VAL A N    2  
ATOM   1010  C  CA   . VAL A 1 25 ? -9.327  -2.320  1.372   1.00 0.00 ? 25  VAL A CA   2  
ATOM   1011  C  C    . VAL A 1 25 ? -8.941  -0.980  0.754   1.00 0.00 ? 25  VAL A C    2  
ATOM   1012  O  O    . VAL A 1 25 ? -9.285  -0.691  -0.391  1.00 0.00 ? 25  VAL A O    2  
ATOM   1013  C  CB   . VAL A 1 25 ? -10.767 -2.228  1.912   1.00 0.00 ? 25  VAL A CB   2  
ATOM   1014  C  CG1  . VAL A 1 25 ? -11.728 -1.826  0.803   1.00 0.00 ? 25  VAL A CG1  2  
ATOM   1015  C  CG2  . VAL A 1 25 ? -11.185 -3.549  2.539   1.00 0.00 ? 25  VAL A CG2  2  
ATOM   1016  H  H    . VAL A 1 25 ? -8.660  -2.615  3.359   1.00 0.00 ? 25  VAL A H    2  
ATOM   1017  H  HA   . VAL A 1 25 ? -9.300  -3.080  0.605   1.00 0.00 ? 25  VAL A HA   2  
ATOM   1018  H  HB   . VAL A 1 25 ? -10.795 -1.465  2.676   1.00 0.00 ? 25  VAL A HB   2  
ATOM   1019  H  HG11 . VAL A 1 25 ? -11.204 -1.819  -0.142  1.00 0.00 ? 25  VAL A HG11 2  
ATOM   1020  H  HG12 . VAL A 1 25 ? -12.543 -2.534  0.759   1.00 0.00 ? 25  VAL A HG12 2  
ATOM   1021  H  HG13 . VAL A 1 25 ? -12.118 -0.840  1.005   1.00 0.00 ? 25  VAL A HG13 2  
ATOM   1022  H  HG21 . VAL A 1 25 ? -10.638 -4.357  2.077   1.00 0.00 ? 25  VAL A HG21 2  
ATOM   1023  H  HG22 . VAL A 1 25 ? -10.971 -3.527  3.597   1.00 0.00 ? 25  VAL A HG22 2  
ATOM   1024  H  HG23 . VAL A 1 25 ? -12.245 -3.699  2.389   1.00 0.00 ? 25  VAL A HG23 2  
ATOM   1025  N  N    . ASN A 1 26 ? -8.223  -0.166  1.521   1.00 0.00 ? 26  ASN A N    2  
ATOM   1026  C  CA   . ASN A 1 26 ? -7.790  1.144   1.049   1.00 0.00 ? 26  ASN A CA   2  
ATOM   1027  C  C    . ASN A 1 26 ? -6.316  1.121   0.658   1.00 0.00 ? 26  ASN A C    2  
ATOM   1028  O  O    . ASN A 1 26 ? -5.764  2.127   0.209   1.00 0.00 ? 26  ASN A O    2  
ATOM   1029  C  CB   . ASN A 1 26 ? -8.026  2.202   2.129   1.00 0.00 ? 26  ASN A CB   2  
ATOM   1030  C  CG   . ASN A 1 26 ? -7.998  3.612   1.573   1.00 0.00 ? 26  ASN A CG   2  
ATOM   1031  O  OD1  . ASN A 1 26 ? -8.568  3.886   0.516   1.00 0.00 ? 26  ASN A OD1  2  
ATOM   1032  N  ND2  . ASN A 1 26 ? -7.333  4.516   2.283   1.00 0.00 ? 26  ASN A ND2  2  
ATOM   1033  H  H    . ASN A 1 26 ? -7.980  -0.452  2.426   1.00 0.00 ? 26  ASN A H    2  
ATOM   1034  H  HA   . ASN A 1 26 ? -8.378  1.394   0.179   1.00 0.00 ? 26  ASN A HA   2  
ATOM   1035  H  HB2  . ASN A 1 26 ? -8.991  2.034   2.584   1.00 0.00 ? 26  ASN A HB2  2  
ATOM   1036  H  HB3  . ASN A 1 26 ? -7.258  2.117   2.883   1.00 0.00 ? 26  ASN A HB3  2  
ATOM   1037  H  HD21 . ASN A 1 26 ? -6.903  4.226   3.115   1.00 0.00 ? 26  ASN A HD21 2  
ATOM   1038  H  HD22 . ASN A 1 26 ? -7.300  5.436   1.947   1.00 0.00 ? 26  ASN A HD22 2  
ATOM   1039  N  N    . THR A 1 27 ? -5.681  -0.035  0.830   1.00 0.00 ? 27  THR A N    2  
ATOM   1040  C  CA   . THR A 1 27 ? -4.271  -0.190  0.495   1.00 0.00 ? 27  THR A CA   2  
ATOM   1041  C  C    . THR A 1 27 ? -4.084  -1.172  -0.656  1.00 0.00 ? 27  THR A C    2  
ATOM   1042  O  O    . THR A 1 27 ? -3.080  -1.124  -1.366  1.00 0.00 ? 27  THR A O    2  
ATOM   1043  C  CB   . THR A 1 27 ? -3.456  -0.677  1.708   1.00 0.00 ? 27  THR A CB   2  
ATOM   1044  O  OG1  . THR A 1 27 ? -3.825  -2.021  2.038   1.00 0.00 ? 27  THR A OG1  2  
ATOM   1045  C  CG2  . THR A 1 27 ? -3.684  0.226   2.911   1.00 0.00 ? 27  THR A CG2  2  
ATOM   1046  H  H    . THR A 1 27 ? -6.175  -0.800  1.191   1.00 0.00 ? 27  THR A H    2  
ATOM   1047  H  HA   . THR A 1 27 ? -3.891  0.776   0.197   1.00 0.00 ? 27  THR A HA   2  
ATOM   1048  H  HB   . THR A 1 27 ? -2.407  -0.652  1.451   1.00 0.00 ? 27  THR A HB   2  
ATOM   1049  H  HG1  . THR A 1 27 ? -3.892  -2.541  1.233   1.00 0.00 ? 27  THR A HG1  2  
ATOM   1050  H  HG21 . THR A 1 27 ? -3.236  1.191   2.726   1.00 0.00 ? 27  THR A HG21 2  
ATOM   1051  H  HG22 . THR A 1 27 ? -3.233  -0.218  3.786   1.00 0.00 ? 27  THR A HG22 2  
ATOM   1052  H  HG23 . THR A 1 27 ? -4.745  0.347   3.074   1.00 0.00 ? 27  THR A HG23 2  
ATOM   1053  N  N    . GLN A 1 28 ? -5.057  -2.060  -0.834  1.00 0.00 ? 28  GLN A N    2  
ATOM   1054  C  CA   . GLN A 1 28 ? -4.998  -3.053  -1.900  1.00 0.00 ? 28  GLN A CA   2  
ATOM   1055  C  C    . GLN A 1 28 ? -4.734  -2.390  -3.248  1.00 0.00 ? 28  GLN A C    2  
ATOM   1056  O  O    . GLN A 1 28 ? -5.084  -1.232  -3.477  1.00 0.00 ? 28  GLN A O    2  
ATOM   1057  C  CB   . GLN A 1 28 ? -6.303  -3.849  -1.957  1.00 0.00 ? 28  GLN A CB   2  
ATOM   1058  C  CG   . GLN A 1 28 ? -7.526  -2.992  -2.237  1.00 0.00 ? 28  GLN A CG   2  
ATOM   1059  C  CD   . GLN A 1 28 ? -8.753  -3.818  -2.570  1.00 0.00 ? 28  GLN A CD   2  
ATOM   1060  O  OE1  . GLN A 1 28 ? -8.676  -4.790  -3.323  1.00 0.00 ? 28  GLN A OE1  2  
ATOM   1061  N  NE2  . GLN A 1 28 ? -9.895  -3.436  -2.010  1.00 0.00 ? 28  GLN A NE2  2  
ATOM   1062  H  H    . GLN A 1 28 ? -5.831  -2.047  -0.235  1.00 0.00 ? 28  GLN A H    2  
ATOM   1063  H  HA   . GLN A 1 28 ? -4.184  -3.728  -1.679  1.00 0.00 ? 28  GLN A HA   2  
ATOM   1064  H  HB2  . GLN A 1 28 ? -6.223  -4.592  -2.736  1.00 0.00 ? 28  GLN A HB2  2  
ATOM   1065  H  HB3  . GLN A 1 28 ? -6.448  -4.347  -1.009  1.00 0.00 ? 28  GLN A HB3  2  
ATOM   1066  H  HG2  . GLN A 1 28 ? -7.740  -2.396  -1.363  1.00 0.00 ? 28  GLN A HG2  2  
ATOM   1067  H  HG3  . GLN A 1 28 ? -7.310  -2.342  -3.071  1.00 0.00 ? 28  GLN A HG3  2  
ATOM   1068  H  HE21 . GLN A 1 28 ? -9.881  -2.651  -1.422  1.00 0.00 ? 28  GLN A HE21 2  
ATOM   1069  H  HE22 . GLN A 1 28 ? -10.703 -3.951  -2.209  1.00 0.00 ? 28  GLN A HE22 2  
ATOM   1070  N  N    . PRO A 1 29 ? -4.100  -3.140  -4.162  1.00 0.00 ? 29  PRO A N    2  
ATOM   1071  C  CA   . PRO A 1 29 ? -3.677  -4.519  -3.901  1.00 0.00 ? 29  PRO A CA   2  
ATOM   1072  C  C    . PRO A 1 29 ? -2.529  -4.593  -2.901  1.00 0.00 ? 29  PRO A C    2  
ATOM   1073  O  O    . PRO A 1 29 ? -2.174  -5.673  -2.426  1.00 0.00 ? 29  PRO A O    2  
ATOM   1074  C  CB   . PRO A 1 29 ? -3.223  -5.017  -5.275  1.00 0.00 ? 29  PRO A CB   2  
ATOM   1075  C  CG   . PRO A 1 29 ? -2.832  -3.785  -6.015  1.00 0.00 ? 29  PRO A CG   2  
ATOM   1076  C  CD   . PRO A 1 29 ? -3.747  -2.698  -5.522  1.00 0.00 ? 29  PRO A CD   2  
ATOM   1077  H  HA   . PRO A 1 29 ? -4.499  -5.125  -3.549  1.00 0.00 ? 29  PRO A HA   2  
ATOM   1078  H  HB2  . PRO A 1 29 ? -2.386  -5.691  -5.157  1.00 0.00 ? 29  PRO A HB2  2  
ATOM   1079  H  HB3  . PRO A 1 29 ? -4.039  -5.529  -5.764  1.00 0.00 ? 29  PRO A HB3  2  
ATOM   1080  H  HG2  . PRO A 1 29 ? -1.804  -3.537  -5.798  1.00 0.00 ? 29  PRO A HG2  2  
ATOM   1081  H  HG3  . PRO A 1 29 ? -2.967  -3.936  -7.076  1.00 0.00 ? 29  PRO A HG3  2  
ATOM   1082  H  HD2  . PRO A 1 29 ? -3.229  -1.751  -5.498  1.00 0.00 ? 29  PRO A HD2  2  
ATOM   1083  H  HD3  . PRO A 1 29 ? -4.626  -2.633  -6.146  1.00 0.00 ? 29  PRO A HD3  2  
ATOM   1084  N  N    . LEU A 1 30 ? -1.951  -3.440  -2.584  1.00 0.00 ? 30  LEU A N    2  
ATOM   1085  C  CA   . LEU A 1 30 ? -0.841  -3.374  -1.639  1.00 0.00 ? 30  LEU A CA   2  
ATOM   1086  C  C    . LEU A 1 30 ? -1.352  -3.239  -0.208  1.00 0.00 ? 30  LEU A C    2  
ATOM   1087  O  O    . LEU A 1 30 ? -2.555  -3.117  0.024   1.00 0.00 ? 30  LEU A O    2  
ATOM   1088  C  CB   . LEU A 1 30 ? 0.075   -2.197  -1.979  1.00 0.00 ? 30  LEU A CB   2  
ATOM   1089  C  CG   . LEU A 1 30 ? 0.930   -2.353  -3.237  1.00 0.00 ? 30  LEU A CG   2  
ATOM   1090  C  CD1  . LEU A 1 30 ? 1.573   -1.027  -3.613  1.00 0.00 ? 30  LEU A CD1  2  
ATOM   1091  C  CD2  . LEU A 1 30 ? 1.992   -3.423  -3.030  1.00 0.00 ? 30  LEU A CD2  2  
ATOM   1092  H  H    . LEU A 1 30 ? -2.277  -2.612  -2.994  1.00 0.00 ? 30  LEU A H    2  
ATOM   1093  H  HA   . LEU A 1 30 ? -0.280  -4.292  -1.723  1.00 0.00 ? 30  LEU A HA   2  
ATOM   1094  H  HB2  . LEU A 1 30 ? -0.544  -1.322  -2.107  1.00 0.00 ? 30  LEU A HB2  2  
ATOM   1095  H  HB3  . LEU A 1 30 ? 0.741   -2.045  -1.141  1.00 0.00 ? 30  LEU A HB3  2  
ATOM   1096  H  HG   . LEU A 1 30 ? 0.298   -2.662  -4.058  1.00 0.00 ? 30  LEU A HG   2  
ATOM   1097  H  HD11 . LEU A 1 30 ? 1.147   -0.671  -4.539  1.00 0.00 ? 30  LEU A HD11 2  
ATOM   1098  H  HD12 . LEU A 1 30 ? 2.637   -1.165  -3.735  1.00 0.00 ? 30  LEU A HD12 2  
ATOM   1099  H  HD13 . LEU A 1 30 ? 1.391   -0.304  -2.831  1.00 0.00 ? 30  LEU A HD13 2  
ATOM   1100  H  HD21 . LEU A 1 30 ? 1.686   -4.085  -2.233  1.00 0.00 ? 30  LEU A HD21 2  
ATOM   1101  H  HD22 . LEU A 1 30 ? 2.929   -2.954  -2.769  1.00 0.00 ? 30  LEU A HD22 2  
ATOM   1102  H  HD23 . LEU A 1 30 ? 2.115   -3.989  -3.942  1.00 0.00 ? 30  LEU A HD23 2  
ATOM   1103  N  N    . CYS A 1 31 ? -0.430  -3.259  0.748   1.00 0.00 ? 31  CYS A N    2  
ATOM   1104  C  CA   . CYS A 1 31 ? -0.785  -3.138  2.157   1.00 0.00 ? 31  CYS A CA   2  
ATOM   1105  C  C    . CYS A 1 31 ? -0.399  -1.764  2.699   1.00 0.00 ? 31  CYS A C    2  
ATOM   1106  O  O    . CYS A 1 31 ? 0.568   -1.154  2.242   1.00 0.00 ? 31  CYS A O    2  
ATOM   1107  C  CB   . CYS A 1 31 ? -0.096  -4.232  2.975   1.00 0.00 ? 31  CYS A CB   2  
ATOM   1108  S  SG   . CYS A 1 31 ? 1.691   -3.969  3.213   1.00 0.00 ? 31  CYS A SG   2  
ATOM   1109  H  H    . CYS A 1 31 ? 0.514   -3.359  0.501   1.00 0.00 ? 31  CYS A H    2  
ATOM   1110  H  HA   . CYS A 1 31 ? -1.854  -3.257  2.241   1.00 0.00 ? 31  CYS A HA   2  
ATOM   1111  H  HB2  . CYS A 1 31 ? -0.553  -4.281  3.952   1.00 0.00 ? 31  CYS A HB2  2  
ATOM   1112  H  HB3  . CYS A 1 31 ? -0.226  -5.180  2.474   1.00 0.00 ? 31  CYS A HB3  2  
ATOM   1113  N  N    . HIS A 1 32 ? -1.163  -1.283  3.675   1.00 0.00 ? 32  HIS A N    2  
ATOM   1114  C  CA   . HIS A 1 32 ? -0.901  0.018   4.280   1.00 0.00 ? 32  HIS A CA   2  
ATOM   1115  C  C    . HIS A 1 32 ? 0.598   0.295   4.345   1.00 0.00 ? 32  HIS A C    2  
ATOM   1116  O  O    . HIS A 1 32 ? 1.061   1.355   3.926   1.00 0.00 ? 32  HIS A O    2  
ATOM   1117  C  CB   . HIS A 1 32 ? -1.505  0.082   5.683   1.00 0.00 ? 32  HIS A CB   2  
ATOM   1118  C  CG   . HIS A 1 32 ? -1.908  1.463   6.099   1.00 0.00 ? 32  HIS A CG   2  
ATOM   1119  N  ND1  . HIS A 1 32 ? -2.910  1.712   7.013   1.00 0.00 ? 32  HIS A ND1  2  
ATOM   1120  C  CD2  . HIS A 1 32 ? -1.436  2.675   5.722   1.00 0.00 ? 32  HIS A CD2  2  
ATOM   1121  C  CE1  . HIS A 1 32 ? -3.038  3.016   7.178   1.00 0.00 ? 32  HIS A CE1  2  
ATOM   1122  N  NE2  . HIS A 1 32 ? -2.155  3.623   6.406   1.00 0.00 ? 32  HIS A NE2  2  
ATOM   1123  H  H    . HIS A 1 32 ? -1.919  -1.817  3.996   1.00 0.00 ? 32  HIS A H    2  
ATOM   1124  H  HA   . HIS A 1 32 ? -1.367  0.770   3.662   1.00 0.00 ? 32  HIS A HA   2  
ATOM   1125  H  HB2  . HIS A 1 32 ? -2.384  -0.544  5.718   1.00 0.00 ? 32  HIS A HB2  2  
ATOM   1126  H  HB3  . HIS A 1 32 ? -0.780  -0.282  6.397   1.00 0.00 ? 32  HIS A HB3  2  
ATOM   1127  H  HD1  . HIS A 1 32 ? -3.448  1.034   7.471   1.00 0.00 ? 32  HIS A HD1  2  
ATOM   1128  H  HD2  . HIS A 1 32 ? -0.641  2.861   5.013   1.00 0.00 ? 32  HIS A HD2  2  
ATOM   1129  H  HE1  . HIS A 1 32 ? -3.744  3.504   7.834   1.00 0.00 ? 32  HIS A HE1  2  
ATOM   1130  N  N    . GLU A 1 33 ? 1.350   -0.666  4.874   1.00 0.00 ? 33  GLU A N    2  
ATOM   1131  C  CA   . GLU A 1 33 ? 2.796   -0.523  4.996   1.00 0.00 ? 33  GLU A CA   2  
ATOM   1132  C  C    . GLU A 1 33 ? 3.424   -0.179  3.648   1.00 0.00 ? 33  GLU A C    2  
ATOM   1133  O  O    . GLU A 1 33 ? 4.306   0.676   3.561   1.00 0.00 ? 33  GLU A O    2  
ATOM   1134  C  CB   . GLU A 1 33 ? 3.414   -1.811  5.544   1.00 0.00 ? 33  GLU A CB   2  
ATOM   1135  C  CG   . GLU A 1 33 ? 4.928   -1.760  5.655   1.00 0.00 ? 33  GLU A CG   2  
ATOM   1136  C  CD   . GLU A 1 33 ? 5.559   -3.140  5.668   1.00 0.00 ? 33  GLU A CD   2  
ATOM   1137  O  OE1  . GLU A 1 33 ? 5.337   -3.903  4.704   1.00 0.00 ? 33  GLU A OE1  2  
ATOM   1138  O  OE2  . GLU A 1 33 ? 6.274   -3.455  6.641   1.00 0.00 ? 33  GLU A OE2  2  
ATOM   1139  H  H    . GLU A 1 33 ? 0.922   -1.488  5.191   1.00 0.00 ? 33  GLU A H    2  
ATOM   1140  H  HA   . GLU A 1 33 ? 2.993   0.282   5.687   1.00 0.00 ? 33  GLU A HA   2  
ATOM   1141  H  HB2  . GLU A 1 33 ? 3.007   -2.001  6.527   1.00 0.00 ? 33  GLU A HB2  2  
ATOM   1142  H  HB3  . GLU A 1 33 ? 3.149   -2.629  4.891   1.00 0.00 ? 33  GLU A HB3  2  
ATOM   1143  H  HG2  . GLU A 1 33 ? 5.320   -1.210  4.813   1.00 0.00 ? 33  GLU A HG2  2  
ATOM   1144  H  HG3  . GLU A 1 33 ? 5.193   -1.252  6.570   1.00 0.00 ? 33  GLU A HG3  2  
ATOM   1145  N  N    . CYS A 1 34 ? 2.963   -0.851  2.598   1.00 0.00 ? 34  CYS A N    2  
ATOM   1146  C  CA   . CYS A 1 34 ? 3.478   -0.619  1.255   1.00 0.00 ? 34  CYS A CA   2  
ATOM   1147  C  C    . CYS A 1 34 ? 2.873   0.645   0.651   1.00 0.00 ? 34  CYS A C    2  
ATOM   1148  O  O    . CYS A 1 34 ? 3.590   1.571   0.275   1.00 0.00 ? 34  CYS A O    2  
ATOM   1149  C  CB   . CYS A 1 34 ? 3.179   -1.821  0.356   1.00 0.00 ? 34  CYS A CB   2  
ATOM   1150  S  SG   . CYS A 1 34 ? 4.239   -3.268  0.674   1.00 0.00 ? 34  CYS A SG   2  
ATOM   1151  H  H    . CYS A 1 34 ? 2.259   -1.521  2.731   1.00 0.00 ? 34  CYS A H    2  
ATOM   1152  H  HA   . CYS A 1 34 ? 4.548   -0.492  1.326   1.00 0.00 ? 34  CYS A HA   2  
ATOM   1153  H  HB2  . CYS A 1 34 ? 2.154   -2.126  0.507   1.00 0.00 ? 34  CYS A HB2  2  
ATOM   1154  H  HB3  . CYS A 1 34 ? 3.316   -1.532  -0.675  1.00 0.00 ? 34  CYS A HB3  2  
ATOM   1155  N  N    . SER A 1 35 ? 1.547   0.674   0.560   1.00 0.00 ? 35  SER A N    2  
ATOM   1156  C  CA   . SER A 1 35 ? 0.844   1.821   -0.001  1.00 0.00 ? 35  SER A CA   2  
ATOM   1157  C  C    . SER A 1 35 ? 1.570   3.121   0.334   1.00 0.00 ? 35  SER A C    2  
ATOM   1158  O  O    . SER A 1 35 ? 1.940   3.884   -0.557  1.00 0.00 ? 35  SER A O    2  
ATOM   1159  C  CB   . SER A 1 35 ? -0.591  1.876   0.527   1.00 0.00 ? 35  SER A CB   2  
ATOM   1160  O  OG   . SER A 1 35 ? -1.194  3.125   0.237   1.00 0.00 ? 35  SER A OG   2  
ATOM   1161  H  H    . SER A 1 35 ? 1.029   -0.096  0.877   1.00 0.00 ? 35  SER A H    2  
ATOM   1162  H  HA   . SER A 1 35 ? 0.819   1.703   -1.074  1.00 0.00 ? 35  SER A HA   2  
ATOM   1163  H  HB2  . SER A 1 35 ? -1.172  1.093   0.063   1.00 0.00 ? 35  SER A HB2  2  
ATOM   1164  H  HB3  . SER A 1 35 ? -0.583  1.732   1.598   1.00 0.00 ? 35  SER A HB3  2  
ATOM   1165  H  HG   . SER A 1 35 ? -0.731  3.543   -0.492  1.00 0.00 ? 35  SER A HG   2  
ATOM   1166  N  N    . GLU A 1 36 ? 1.771   3.363   1.626   1.00 0.00 ? 36  GLU A N    2  
ATOM   1167  C  CA   . GLU A 1 36 ? 2.452   4.570   2.079   1.00 0.00 ? 36  GLU A CA   2  
ATOM   1168  C  C    . GLU A 1 36 ? 3.764   4.770   1.325   1.00 0.00 ? 36  GLU A C    2  
ATOM   1169  O  O    . GLU A 1 36 ? 4.105   5.887   0.936   1.00 0.00 ? 36  GLU A O    2  
ATOM   1170  C  CB   . GLU A 1 36 ? 2.721   4.496   3.583   1.00 0.00 ? 36  GLU A CB   2  
ATOM   1171  C  CG   . GLU A 1 36 ? 3.569   3.304   3.992   1.00 0.00 ? 36  GLU A CG   2  
ATOM   1172  C  CD   . GLU A 1 36 ? 4.026   3.380   5.436   1.00 0.00 ? 36  GLU A CD   2  
ATOM   1173  O  OE1  . GLU A 1 36 ? 4.198   4.507   5.945   1.00 0.00 ? 36  GLU A OE1  2  
ATOM   1174  O  OE2  . GLU A 1 36 ? 4.212   2.312   6.056   1.00 0.00 ? 36  GLU A OE2  2  
ATOM   1175  H  H    . GLU A 1 36 ? 1.452   2.716   2.289   1.00 0.00 ? 36  GLU A H    2  
ATOM   1176  H  HA   . GLU A 1 36 ? 1.805   5.411   1.879   1.00 0.00 ? 36  GLU A HA   2  
ATOM   1177  H  HB2  . GLU A 1 36 ? 3.231   5.397   3.890   1.00 0.00 ? 36  GLU A HB2  2  
ATOM   1178  H  HB3  . GLU A 1 36 ? 1.776   4.434   4.103   1.00 0.00 ? 36  GLU A HB3  2  
ATOM   1179  H  HG2  . GLU A 1 36 ? 2.988   2.403   3.862   1.00 0.00 ? 36  GLU A HG2  2  
ATOM   1180  H  HG3  . GLU A 1 36 ? 4.441   3.263   3.355   1.00 0.00 ? 36  GLU A HG3  2  
ATOM   1181  N  N    . ARG A 1 37 ? 4.496   3.679   1.124   1.00 0.00 ? 37  ARG A N    2  
ATOM   1182  C  CA   . ARG A 1 37 ? 5.771   3.733   0.420   1.00 0.00 ? 37  ARG A CA   2  
ATOM   1183  C  C    . ARG A 1 37 ? 5.579   4.217   -1.014  1.00 0.00 ? 37  ARG A C    2  
ATOM   1184  O  O    . ARG A 1 37 ? 6.316   5.080   -1.492  1.00 0.00 ? 37  ARG A O    2  
ATOM   1185  C  CB   . ARG A 1 37 ? 6.437   2.356   0.420   1.00 0.00 ? 37  ARG A CB   2  
ATOM   1186  C  CG   . ARG A 1 37 ? 6.593   1.755   1.807   1.00 0.00 ? 37  ARG A CG   2  
ATOM   1187  C  CD   . ARG A 1 37 ? 7.736   2.405   2.571   1.00 0.00 ? 37  ARG A CD   2  
ATOM   1188  N  NE   . ARG A 1 37 ? 9.037   2.077   1.994   1.00 0.00 ? 37  ARG A NE   2  
ATOM   1189  C  CZ   . ARG A 1 37 ? 10.174  2.651   2.371   1.00 0.00 ? 37  ARG A CZ   2  
ATOM   1190  N  NH1  . ARG A 1 37 ? 10.170  3.577   3.320   1.00 0.00 ? 37  ARG A NH1  2  
ATOM   1191  N  NH2  . ARG A 1 37 ? 11.318  2.299   1.798   1.00 0.00 ? 37  ARG A NH2  2  
ATOM   1192  H  H    . ARG A 1 37 ? 4.171   2.816   1.458   1.00 0.00 ? 37  ARG A H    2  
ATOM   1193  H  HA   . ARG A 1 37 ? 6.409   4.432   0.941   1.00 0.00 ? 37  ARG A HA   2  
ATOM   1194  H  HB2  . ARG A 1 37 ? 5.841   1.680   -0.176  1.00 0.00 ? 37  ARG A HB2  2  
ATOM   1195  H  HB3  . ARG A 1 37 ? 7.418   2.444   -0.023  1.00 0.00 ? 37  ARG A HB3  2  
ATOM   1196  H  HG2  . ARG A 1 37 ? 5.676   1.903   2.358   1.00 0.00 ? 37  ARG A HG2  2  
ATOM   1197  H  HG3  . ARG A 1 37 ? 6.791   0.698   1.711   1.00 0.00 ? 37  ARG A HG3  2  
ATOM   1198  H  HD2  . ARG A 1 37 ? 7.603   3.476   2.548   1.00 0.00 ? 37  ARG A HD2  2  
ATOM   1199  H  HD3  . ARG A 1 37 ? 7.709   2.061   3.594   1.00 0.00 ? 37  ARG A HD3  2  
ATOM   1200  H  HE   . ARG A 1 37 ? 9.062   1.395   1.291   1.00 0.00 ? 37  ARG A HE   2  
ATOM   1201  H  HH11 . ARG A 1 37 ? 9.310   3.843   3.754   1.00 0.00 ? 37  ARG A HH11 2  
ATOM   1202  H  HH12 . ARG A 1 37 ? 11.028  4.006   3.603   1.00 0.00 ? 37  ARG A HH12 2  
ATOM   1203  H  HH21 . ARG A 1 37 ? 11.324  1.601   1.083   1.00 0.00 ? 37  ARG A HH21 2  
ATOM   1204  H  HH22 . ARG A 1 37 ? 12.173  2.731   2.083   1.00 0.00 ? 37  ARG A HH22 2  
ATOM   1205  N  N    . ARG A 1 38 ? 4.586   3.655   -1.696  1.00 0.00 ? 38  ARG A N    2  
ATOM   1206  C  CA   . ARG A 1 38 ? 4.299   4.028   -3.075  1.00 0.00 ? 38  ARG A CA   2  
ATOM   1207  C  C    . ARG A 1 38 ? 3.931   5.505   -3.174  1.00 0.00 ? 38  ARG A C    2  
ATOM   1208  O  O    . ARG A 1 38 ? 4.602   6.277   -3.858  1.00 0.00 ? 38  ARG A O    2  
ATOM   1209  C  CB   . ARG A 1 38 ? 3.162   3.169   -3.632  1.00 0.00 ? 38  ARG A CB   2  
ATOM   1210  C  CG   . ARG A 1 38 ? 3.633   1.874   -4.271  1.00 0.00 ? 38  ARG A CG   2  
ATOM   1211  C  CD   . ARG A 1 38 ? 4.249   2.119   -5.640  1.00 0.00 ? 38  ARG A CD   2  
ATOM   1212  N  NE   . ARG A 1 38 ? 3.238   2.437   -6.645  1.00 0.00 ? 38  ARG A NE   2  
ATOM   1213  C  CZ   . ARG A 1 38 ? 2.624   1.521   -7.386  1.00 0.00 ? 38  ARG A CZ   2  
ATOM   1214  N  NH1  . ARG A 1 38 ? 2.916   0.237   -7.234  1.00 0.00 ? 38  ARG A NH1  2  
ATOM   1215  N  NH2  . ARG A 1 38 ? 1.715   1.889   -8.280  1.00 0.00 ? 38  ARG A NH2  2  
ATOM   1216  H  H    . ARG A 1 38 ? 4.034   2.972   -1.260  1.00 0.00 ? 38  ARG A H    2  
ATOM   1217  H  HA   . ARG A 1 38 ? 5.190   3.852   -3.659  1.00 0.00 ? 38  ARG A HA   2  
ATOM   1218  H  HB2  . ARG A 1 38 ? 2.485   2.922   -2.827  1.00 0.00 ? 38  ARG A HB2  2  
ATOM   1219  H  HB3  . ARG A 1 38 ? 2.628   3.740   -4.377  1.00 0.00 ? 38  ARG A HB3  2  
ATOM   1220  H  HG2  . ARG A 1 38 ? 4.375   1.417   -3.632  1.00 0.00 ? 38  ARG A HG2  2  
ATOM   1221  H  HG3  . ARG A 1 38 ? 2.790   1.208   -4.379  1.00 0.00 ? 38  ARG A HG3  2  
ATOM   1222  H  HD2  . ARG A 1 38 ? 4.941   2.945   -5.566  1.00 0.00 ? 38  ARG A HD2  2  
ATOM   1223  H  HD3  . ARG A 1 38 ? 4.780   1.230   -5.946  1.00 0.00 ? 38  ARG A HD3  2  
ATOM   1224  H  HE   . ARG A 1 38 ? 3.007   3.380   -6.774  1.00 0.00 ? 38  ARG A HE   2  
ATOM   1225  H  HH11 . ARG A 1 38 ? 3.600   -0.043  -6.560  1.00 0.00 ? 38  ARG A HH11 2  
ATOM   1226  H  HH12 . ARG A 1 38 ? 2.452   -0.451  -7.792  1.00 0.00 ? 38  ARG A HH12 2  
ATOM   1227  H  HH21 . ARG A 1 38 ? 1.492   2.856   -8.397  1.00 0.00 ? 38  ARG A HH21 2  
ATOM   1228  H  HH22 . ARG A 1 38 ? 1.254   1.199   -8.836  1.00 0.00 ? 38  ARG A HH22 2  
ATOM   1229  N  N    . GLN A 1 39 ? 2.860   5.890   -2.486  1.00 0.00 ? 39  GLN A N    2  
ATOM   1230  C  CA   . GLN A 1 39 ? 2.402   7.274   -2.498  1.00 0.00 ? 39  GLN A CA   2  
ATOM   1231  C  C    . GLN A 1 39 ? 3.584   8.238   -2.517  1.00 0.00 ? 39  GLN A C    2  
ATOM   1232  O  O    . GLN A 1 39 ? 3.629   9.166   -3.326  1.00 0.00 ? 39  GLN A O    2  
ATOM   1233  C  CB   . GLN A 1 39 ? 1.522   7.552   -1.278  1.00 0.00 ? 39  GLN A CB   2  
ATOM   1234  C  CG   . GLN A 1 39 ? 0.086   7.082   -1.444  1.00 0.00 ? 39  GLN A CG   2  
ATOM   1235  C  CD   . GLN A 1 39 ? -0.688  7.913   -2.448  1.00 0.00 ? 39  GLN A CD   2  
ATOM   1236  O  OE1  . GLN A 1 39 ? -0.284  8.047   -3.604  1.00 0.00 ? 39  GLN A OE1  2  
ATOM   1237  N  NE2  . GLN A 1 39 ? -1.809  8.477   -2.012  1.00 0.00 ? 39  GLN A NE2  2  
ATOM   1238  H  H    . GLN A 1 39 ? 2.367   5.228   -1.960  1.00 0.00 ? 39  GLN A H    2  
ATOM   1239  H  HA   . GLN A 1 39 ? 1.818   7.423   -3.393  1.00 0.00 ? 39  GLN A HA   2  
ATOM   1240  H  HB2  . GLN A 1 39 ? 1.946   7.051   -0.421  1.00 0.00 ? 39  GLN A HB2  2  
ATOM   1241  H  HB3  . GLN A 1 39 ? 1.510   8.617   -1.093  1.00 0.00 ? 39  GLN A HB3  2  
ATOM   1242  H  HG2  . GLN A 1 39 ? 0.093   6.056   -1.780  1.00 0.00 ? 39  GLN A HG2  2  
ATOM   1243  H  HG3  . GLN A 1 39 ? -0.412  7.143   -0.488  1.00 0.00 ? 39  GLN A HG3  2  
ATOM   1244  H  HE21 . GLN A 1 39 ? -2.068  8.327   -1.079  1.00 0.00 ? 39  GLN A HE21 2  
ATOM   1245  H  HE22 . GLN A 1 39 ? -2.328  9.020   -2.640  1.00 0.00 ? 39  GLN A HE22 2  
ATOM   1246  N  N    . LYS A 1 40 ? 4.540   8.013   -1.622  1.00 0.00 ? 40  LYS A N    2  
ATOM   1247  C  CA   . LYS A 1 40 ? 5.723   8.861   -1.536  1.00 0.00 ? 40  LYS A CA   2  
ATOM   1248  C  C    . LYS A 1 40 ? 6.876   8.269   -2.340  1.00 0.00 ? 40  LYS A C    2  
ATOM   1249  O  O    . LYS A 1 40 ? 7.386   7.197   -2.015  1.00 0.00 ? 40  LYS A O    2  
ATOM   1250  C  CB   . LYS A 1 40 ? 6.144   9.037   -0.075  1.00 0.00 ? 40  LYS A CB   2  
ATOM   1251  C  CG   . LYS A 1 40 ? 6.888   10.334  0.191   1.00 0.00 ? 40  LYS A CG   2  
ATOM   1252  C  CD   . LYS A 1 40 ? 7.671   10.271  1.492   1.00 0.00 ? 40  LYS A CD   2  
ATOM   1253  C  CE   . LYS A 1 40 ? 8.241   11.631  1.866   1.00 0.00 ? 40  LYS A CE   2  
ATOM   1254  N  NZ   . LYS A 1 40 ? 7.211   12.514  2.479   1.00 0.00 ? 40  LYS A NZ   2  
ATOM   1255  H  H    . LYS A 1 40 ? 4.447   7.257   -1.004  1.00 0.00 ? 40  LYS A H    2  
ATOM   1256  H  HA   . LYS A 1 40 ? 5.471   9.826   -1.948  1.00 0.00 ? 40  LYS A HA   2  
ATOM   1257  H  HB2  . LYS A 1 40 ? 5.261   9.019   0.546   1.00 0.00 ? 40  LYS A HB2  2  
ATOM   1258  H  HB3  . LYS A 1 40 ? 6.786   8.214   0.203   1.00 0.00 ? 40  LYS A HB3  2  
ATOM   1259  H  HG2  . LYS A 1 40 ? 7.576   10.517  -0.622  1.00 0.00 ? 40  LYS A HG2  2  
ATOM   1260  H  HG3  . LYS A 1 40 ? 6.174   11.143  0.249   1.00 0.00 ? 40  LYS A HG3  2  
ATOM   1261  H  HD2  . LYS A 1 40 ? 7.013   9.940   2.282   1.00 0.00 ? 40  LYS A HD2  2  
ATOM   1262  H  HD3  . LYS A 1 40 ? 8.484   9.568   1.379   1.00 0.00 ? 40  LYS A HD3  2  
ATOM   1263  H  HE2  . LYS A 1 40 ? 9.046   11.488  2.570   1.00 0.00 ? 40  LYS A HE2  2  
ATOM   1264  H  HE3  . LYS A 1 40 ? 8.623   12.104  0.973   1.00 0.00 ? 40  LYS A HE3  2  
ATOM   1265  H  HZ1  . LYS A 1 40 ? 7.215   12.404  3.513   1.00 0.00 ? 40  LYS A HZ1  2  
ATOM   1266  H  HZ2  . LYS A 1 40 ? 6.267   12.266  2.119   1.00 0.00 ? 40  LYS A HZ2  2  
ATOM   1267  H  HZ3  . LYS A 1 40 ? 7.408   13.508  2.246   1.00 0.00 ? 40  LYS A HZ3  2  
ATOM   1268  N  N    . ASN A 1 41 ? 7.282   8.974   -3.391  1.00 0.00 ? 41  ASN A N    2  
ATOM   1269  C  CA   . ASN A 1 41 ? 8.376   8.518   -4.241  1.00 0.00 ? 41  ASN A CA   2  
ATOM   1270  C  C    . ASN A 1 41 ? 9.044   9.695   -4.946  1.00 0.00 ? 41  ASN A C    2  
ATOM   1271  O  O    . ASN A 1 41 ? 8.373   10.528  -5.554  1.00 0.00 ? 41  ASN A O    2  
ATOM   1272  C  CB   . ASN A 1 41 ? 7.861   7.515   -5.275  1.00 0.00 ? 41  ASN A CB   2  
ATOM   1273  C  CG   . ASN A 1 41 ? 8.959   7.023   -6.199  1.00 0.00 ? 41  ASN A CG   2  
ATOM   1274  O  OD1  . ASN A 1 41 ? 9.759   7.810   -6.705  1.00 0.00 ? 41  ASN A OD1  2  
ATOM   1275  N  ND2  . ASN A 1 41 ? 9.000   5.715   -6.425  1.00 0.00 ? 41  ASN A ND2  2  
ATOM   1276  H  H    . ASN A 1 41 ? 6.836   9.821   -3.600  1.00 0.00 ? 41  ASN A H    2  
ATOM   1277  H  HA   . ASN A 1 41 ? 9.104   8.030   -3.611  1.00 0.00 ? 41  ASN A HA   2  
ATOM   1278  H  HB2  . ASN A 1 41 ? 7.441   6.662   -4.762  1.00 0.00 ? 41  ASN A HB2  2  
ATOM   1279  H  HB3  . ASN A 1 41 ? 7.095   7.984   -5.873  1.00 0.00 ? 41  ASN A HB3  2  
ATOM   1280  H  HD21 . ASN A 1 41 ? 8.330   5.148   -5.988  1.00 0.00 ? 41  ASN A HD21 2  
ATOM   1281  H  HD22 . ASN A 1 41 ? 9.700   5.370   -7.018  1.00 0.00 ? 41  ASN A HD22 2  
ATOM   1282  N  N    . GLN A 1 42 ? 10.369  9.754   -4.860  1.00 0.00 ? 42  GLN A N    2  
ATOM   1283  C  CA   . GLN A 1 42 ? 11.127  10.829  -5.490  1.00 0.00 ? 42  GLN A CA   2  
ATOM   1284  C  C    . GLN A 1 42 ? 11.118  10.684  -7.008  1.00 0.00 ? 42  GLN A C    2  
ATOM   1285  O  O    . GLN A 1 42 ? 10.709  11.595  -7.726  1.00 0.00 ? 42  GLN A O    2  
ATOM   1286  C  CB   . GLN A 1 42 ? 12.567  10.835  -4.975  1.00 0.00 ? 42  GLN A CB   2  
ATOM   1287  C  CG   . GLN A 1 42 ? 12.746  11.606  -3.677  1.00 0.00 ? 42  GLN A CG   2  
ATOM   1288  C  CD   . GLN A 1 42 ? 12.343  10.799  -2.458  1.00 0.00 ? 42  GLN A CD   2  
ATOM   1289  O  OE1  . GLN A 1 42 ? 12.511  9.579   -2.424  1.00 0.00 ? 42  GLN A OE1  2  
ATOM   1290  N  NE2  . GLN A 1 42 ? 11.808  11.476  -1.450  1.00 0.00 ? 42  GLN A NE2  2  
ATOM   1291  H  H    . GLN A 1 42 ? 10.847  9.060   -4.362  1.00 0.00 ? 42  GLN A H    2  
ATOM   1292  H  HA   . GLN A 1 42 ? 10.657  11.764  -5.227  1.00 0.00 ? 42  GLN A HA   2  
ATOM   1293  H  HB2  . GLN A 1 42 ? 12.882  9.816   -4.809  1.00 0.00 ? 42  GLN A HB2  2  
ATOM   1294  H  HB3  . GLN A 1 42 ? 13.203  11.283  -5.724  1.00 0.00 ? 42  GLN A HB3  2  
ATOM   1295  H  HG2  . GLN A 1 42 ? 13.785  11.883  -3.578  1.00 0.00 ? 42  GLN A HG2  2  
ATOM   1296  H  HG3  . GLN A 1 42 ? 12.138  12.498  -3.717  1.00 0.00 ? 42  GLN A HG3  2  
ATOM   1297  H  HE21 . GLN A 1 42 ? 11.703  12.446  -1.548  1.00 0.00 ? 42  GLN A HE21 2  
ATOM   1298  H  HE22 . GLN A 1 42 ? 11.538  10.979  -0.650  1.00 0.00 ? 42  GLN A HE22 2  
ATOM   1299  N  N    . ASN A 1 43 ? 11.573  9.532   -7.490  1.00 0.00 ? 43  ASN A N    2  
ATOM   1300  C  CA   . ASN A 1 43 ? 11.618  9.268   -8.924  1.00 0.00 ? 43  ASN A CA   2  
ATOM   1301  C  C    . ASN A 1 43 ? 10.303  9.659   -9.591  1.00 0.00 ? 43  ASN A C    2  
ATOM   1302  O  O    . ASN A 1 43 ? 10.286  10.430  -10.550 1.00 0.00 ? 43  ASN A O    2  
ATOM   1303  C  CB   . ASN A 1 43 ? 11.915  7.790   -9.183  1.00 0.00 ? 43  ASN A CB   2  
ATOM   1304  C  CG   . ASN A 1 43 ? 12.393  7.535   -10.599 1.00 0.00 ? 43  ASN A CG   2  
ATOM   1305  O  OD1  . ASN A 1 43 ? 11.751  7.945   -11.566 1.00 0.00 ? 43  ASN A OD1  2  
ATOM   1306  N  ND2  . ASN A 1 43 ? 13.526  6.854   -10.727 1.00 0.00 ? 43  ASN A ND2  2  
ATOM   1307  H  H    . ASN A 1 43 ? 11.886  8.843   -6.868  1.00 0.00 ? 43  ASN A H    2  
ATOM   1308  H  HA   . ASN A 1 43 ? 12.413  9.865   -9.346  1.00 0.00 ? 43  ASN A HA   2  
ATOM   1309  H  HB2  . ASN A 1 43 ? 12.683  7.458   -8.499  1.00 0.00 ? 43  ASN A HB2  2  
ATOM   1310  H  HB3  . ASN A 1 43 ? 11.017  7.214   -9.016  1.00 0.00 ? 43  ASN A HB3  2  
ATOM   1311  H  HD21 . ASN A 1 43 ? 13.983  6.558   -9.913  1.00 0.00 ? 43  ASN A HD21 2  
ATOM   1312  H  HD22 . ASN A 1 43 ? 13.858  6.676   -11.632 1.00 0.00 ? 43  ASN A HD22 2  
ATOM   1313  N  N    . SER A 1 44 ? 9.202   9.122   -9.075  1.00 0.00 ? 44  SER A N    2  
ATOM   1314  C  CA   . SER A 1 44 ? 7.882   9.411   -9.622  1.00 0.00 ? 44  SER A CA   2  
ATOM   1315  C  C    . SER A 1 44 ? 7.546   10.892  -9.475  1.00 0.00 ? 44  SER A C    2  
ATOM   1316  O  O    . SER A 1 44 ? 8.124   11.592  -8.645  1.00 0.00 ? 44  SER A O    2  
ATOM   1317  C  CB   . SER A 1 44 ? 6.818   8.564   -8.921  1.00 0.00 ? 44  SER A CB   2  
ATOM   1318  O  OG   . SER A 1 44 ? 6.813   7.238   -9.420  1.00 0.00 ? 44  SER A OG   2  
ATOM   1319  H  H    . SER A 1 44 ? 9.280   8.514   -8.310  1.00 0.00 ? 44  SER A H    2  
ATOM   1320  H  HA   . SER A 1 44 ? 7.895   9.160   -10.672 1.00 0.00 ? 44  SER A HA   2  
ATOM   1321  H  HB2  . SER A 1 44 ? 7.025   8.536   -7.862  1.00 0.00 ? 44  SER A HB2  2  
ATOM   1322  H  HB3  . SER A 1 44 ? 5.845   9.003   -9.086  1.00 0.00 ? 44  SER A HB3  2  
ATOM   1323  H  HG   . SER A 1 44 ? 6.228   7.184   -10.180 1.00 0.00 ? 44  SER A HG   2  
ATOM   1324  N  N    . GLY A 1 45 ? 6.605   11.363  -10.289 1.00 0.00 ? 45  GLY A N    2  
ATOM   1325  C  CA   . GLY A 1 45 ? 6.208   12.758  -10.235 1.00 0.00 ? 45  GLY A CA   2  
ATOM   1326  C  C    . GLY A 1 45 ? 4.839   12.994  -10.841 1.00 0.00 ? 45  GLY A C    2  
ATOM   1327  O  O    . GLY A 1 45 ? 4.709   13.369  -12.007 1.00 0.00 ? 45  GLY A O    2  
ATOM   1328  H  H    . GLY A 1 45 ? 6.178   10.758  -10.932 1.00 0.00 ? 45  GLY A H    2  
ATOM   1329  H  HA2  . GLY A 1 45 ? 6.194   13.077  -9.204  1.00 0.00 ? 45  GLY A HA2  2  
ATOM   1330  H  HA3  . GLY A 1 45 ? 6.934   13.348  -10.774 1.00 0.00 ? 45  GLY A HA3  2  
ATOM   1331  N  N    . PRO A 1 46 ? 3.786   12.771  -10.040 1.00 0.00 ? 46  PRO A N    2  
ATOM   1332  C  CA   . PRO A 1 46 ? 2.401   12.955  -10.484 1.00 0.00 ? 46  PRO A CA   2  
ATOM   1333  C  C    . PRO A 1 46 ? 2.051   14.423  -10.698 1.00 0.00 ? 46  PRO A C    2  
ATOM   1334  O  O    . PRO A 1 46 ? 2.726   15.314  -10.182 1.00 0.00 ? 46  PRO A O    2  
ATOM   1335  C  CB   . PRO A 1 46 ? 1.579   12.372  -9.331  1.00 0.00 ? 46  PRO A CB   2  
ATOM   1336  C  CG   . PRO A 1 46 ? 2.461   12.496  -8.137  1.00 0.00 ? 46  PRO A CG   2  
ATOM   1337  C  CD   . PRO A 1 46 ? 3.867   12.323  -8.640  1.00 0.00 ? 46  PRO A CD   2  
ATOM   1338  H  HA   . PRO A 1 46 ? 2.198   12.402  -11.389 1.00 0.00 ? 46  PRO A HA   2  
ATOM   1339  H  HB2  . PRO A 1 46 ? 0.668   12.941  -9.212  1.00 0.00 ? 46  PRO A HB2  2  
ATOM   1340  H  HB3  . PRO A 1 46 ? 1.341   11.340  -9.540  1.00 0.00 ? 46  PRO A HB3  2  
ATOM   1341  H  HG2  . PRO A 1 46 ? 2.340   13.471  -7.691  1.00 0.00 ? 46  PRO A HG2  2  
ATOM   1342  H  HG3  . PRO A 1 46 ? 2.221   11.723  -7.422  1.00 0.00 ? 46  PRO A HG3  2  
ATOM   1343  H  HD2  . PRO A 1 46 ? 4.549   12.941  -8.076  1.00 0.00 ? 46  PRO A HD2  2  
ATOM   1344  H  HD3  . PRO A 1 46 ? 4.162   11.285  -8.585  1.00 0.00 ? 46  PRO A HD3  2  
ATOM   1345  N  N    . SER A 1 47 ? 0.992   14.669  -11.462 1.00 0.00 ? 47  SER A N    2  
ATOM   1346  C  CA   . SER A 1 47 ? 0.554   16.031  -11.747 1.00 0.00 ? 47  SER A CA   2  
ATOM   1347  C  C    . SER A 1 47 ? -0.729  16.358  -10.990 1.00 0.00 ? 47  SER A C    2  
ATOM   1348  O  O    . SER A 1 47 ? -1.591  15.499  -10.805 1.00 0.00 ? 47  SER A O    2  
ATOM   1349  C  CB   . SER A 1 47 ? 0.334   16.214  -13.250 1.00 0.00 ? 47  SER A CB   2  
ATOM   1350  O  OG   . SER A 1 47 ? -0.572  15.248  -13.755 1.00 0.00 ? 47  SER A OG   2  
ATOM   1351  H  H    . SER A 1 47 ? 0.494   13.916  -11.846 1.00 0.00 ? 47  SER A H    2  
ATOM   1352  H  HA   . SER A 1 47 ? 1.332   16.704  -11.421 1.00 0.00 ? 47  SER A HA   2  
ATOM   1353  H  HB2  . SER A 1 47 ? -0.069  17.198  -13.435 1.00 0.00 ? 47  SER A HB2  2  
ATOM   1354  H  HB3  . SER A 1 47 ? 1.278   16.109  -13.765 1.00 0.00 ? 47  SER A HB3  2  
ATOM   1355  H  HG   . SER A 1 47 ? -0.105  14.424  -13.916 1.00 0.00 ? 47  SER A HG   2  
ATOM   1356  N  N    . SER A 1 48 ? -0.849  17.609  -10.555 1.00 0.00 ? 48  SER A N    2  
ATOM   1357  C  CA   . SER A 1 48 ? -2.025  18.051  -9.814  1.00 0.00 ? 48  SER A CA   2  
ATOM   1358  C  C    . SER A 1 48 ? -3.300  17.771  -10.602 1.00 0.00 ? 48  SER A C    2  
ATOM   1359  O  O    . SER A 1 48 ? -4.209  17.099  -10.116 1.00 0.00 ? 48  SER A O    2  
ATOM   1360  C  CB   . SER A 1 48 ? -1.924  19.545  -9.500  1.00 0.00 ? 48  SER A CB   2  
ATOM   1361  O  OG   . SER A 1 48 ? -3.073  19.999  -8.807  1.00 0.00 ? 48  SER A OG   2  
ATOM   1362  H  H    . SER A 1 48 ? -0.128  18.248  -10.734 1.00 0.00 ? 48  SER A H    2  
ATOM   1363  H  HA   . SER A 1 48 ? -2.060  17.498  -8.887  1.00 0.00 ? 48  SER A HA   2  
ATOM   1364  H  HB2  . SER A 1 48 ? -1.054  19.723  -8.885  1.00 0.00 ? 48  SER A HB2  2  
ATOM   1365  H  HB3  . SER A 1 48 ? -1.831  20.098  -10.423 1.00 0.00 ? 48  SER A HB3  2  
ATOM   1366  H  HG   . SER A 1 48 ? -3.472  19.266  -8.333  1.00 0.00 ? 48  SER A HG   2  
ATOM   1367  N  N    . GLY A 1 49 ? -3.360  18.291  -11.824 1.00 0.00 ? 49  GLY A N    2  
ATOM   1368  C  CA   . GLY A 1 49 ? -4.528  18.087  -12.661 1.00 0.00 ? 49  GLY A CA   2  
ATOM   1369  C  C    . GLY A 1 49 ? -4.865  16.620  -12.838 1.00 0.00 ? 49  GLY A C    2  
ATOM   1370  O  O    . GLY A 1 49 ? -5.184  16.208  -13.953 1.00 0.00 ? 49  GLY A O    2  
ATOM   1371  H  H    . GLY A 1 49 ? -2.605  18.818  -12.160 1.00 0.00 ? 49  GLY A H    2  
ATOM   1372  H  HA2  . GLY A 1 49 ? -5.372  18.588  -12.212 1.00 0.00 ? 49  GLY A HA2  2  
ATOM   1373  H  HA3  . GLY A 1 49 ? -4.340  18.520  -13.633 1.00 0.00 ? 49  GLY A HA3  2  
HETATM 1374  ZN ZN   . ZN  B 2 .  ? 3.004   -4.930  1.573   1.00 0.00 ? 201 ZN  A ZN   2  
ATOM   1375  N  N    . GLY A 1 1  ? -3.211  10.693  16.945  1.00 0.00 ? 1   GLY A N    3  
ATOM   1376  C  CA   . GLY A 1 1  ? -4.570  10.289  16.634  1.00 0.00 ? 1   GLY A CA   3  
ATOM   1377  C  C    . GLY A 1 1  ? -4.660  9.509   15.337  1.00 0.00 ? 1   GLY A C    3  
ATOM   1378  O  O    . GLY A 1 1  ? -4.321  10.023  14.271  1.00 0.00 ? 1   GLY A O    3  
ATOM   1379  H  H1   . GLY A 1 1  ? -2.658  11.117  16.256  1.00 0.00 ? 1   GLY A H1   3  
ATOM   1380  H  HA2  . GLY A 1 1  ? -4.944  9.674   17.439  1.00 0.00 ? 1   GLY A HA2  3  
ATOM   1381  H  HA3  . GLY A 1 1  ? -5.186  11.172  16.553  1.00 0.00 ? 1   GLY A HA3  3  
ATOM   1382  N  N    . SER A 1 2  ? -5.117  8.265   15.427  1.00 0.00 ? 2   SER A N    3  
ATOM   1383  C  CA   . SER A 1 2  ? -5.246  7.411   14.252  1.00 0.00 ? 2   SER A CA   3  
ATOM   1384  C  C    . SER A 1 2  ? -6.570  7.665   13.539  1.00 0.00 ? 2   SER A C    3  
ATOM   1385  O  O    . SER A 1 2  ? -7.637  7.620   14.152  1.00 0.00 ? 2   SER A O    3  
ATOM   1386  C  CB   . SER A 1 2  ? -5.144  5.938   14.653  1.00 0.00 ? 2   SER A CB   3  
ATOM   1387  O  OG   . SER A 1 2  ? -5.471  5.090   13.566  1.00 0.00 ? 2   SER A OG   3  
ATOM   1388  H  H    . SER A 1 2  ? -5.371  7.912   16.306  1.00 0.00 ? 2   SER A H    3  
ATOM   1389  H  HA   . SER A 1 2  ? -4.436  7.649   13.579  1.00 0.00 ? 2   SER A HA   3  
ATOM   1390  H  HB2  . SER A 1 2  ? -4.135  5.722   14.970  1.00 0.00 ? 2   SER A HB2  3  
ATOM   1391  H  HB3  . SER A 1 2  ? -5.827  5.741   15.466  1.00 0.00 ? 2   SER A HB3  3  
ATOM   1392  H  HG   . SER A 1 2  ? -5.629  5.621   12.782  1.00 0.00 ? 2   SER A HG   3  
ATOM   1393  N  N    . SER A 1 3  ? -6.493  7.931   12.239  1.00 0.00 ? 3   SER A N    3  
ATOM   1394  C  CA   . SER A 1 3  ? -7.684  8.197   11.441  1.00 0.00 ? 3   SER A CA   3  
ATOM   1395  C  C    . SER A 1 3  ? -7.849  7.148   10.346  1.00 0.00 ? 3   SER A C    3  
ATOM   1396  O  O    . SER A 1 3  ? -7.000  6.275   10.174  1.00 0.00 ? 3   SER A O    3  
ATOM   1397  C  CB   . SER A 1 3  ? -7.607  9.592   10.819  1.00 0.00 ? 3   SER A CB   3  
ATOM   1398  O  OG   . SER A 1 3  ? -7.896  10.595  11.777  1.00 0.00 ? 3   SER A OG   3  
ATOM   1399  H  H    . SER A 1 3  ? -5.613  7.953   11.807  1.00 0.00 ? 3   SER A H    3  
ATOM   1400  H  HA   . SER A 1 3  ? -8.540  8.152   12.098  1.00 0.00 ? 3   SER A HA   3  
ATOM   1401  H  HB2  . SER A 1 3  ? -6.612  9.757   10.433  1.00 0.00 ? 3   SER A HB2  3  
ATOM   1402  H  HB3  . SER A 1 3  ? -8.323  9.664   10.012  1.00 0.00 ? 3   SER A HB3  3  
ATOM   1403  H  HG   . SER A 1 3  ? -8.450  11.270  11.378  1.00 0.00 ? 3   SER A HG   3  
ATOM   1404  N  N    . GLY A 1 4  ? -8.951  7.241   9.607   1.00 0.00 ? 4   GLY A N    3  
ATOM   1405  C  CA   . GLY A 1 4  ? -9.209  6.294   8.537   1.00 0.00 ? 4   GLY A CA   3  
ATOM   1406  C  C    . GLY A 1 4  ? -9.690  4.953   9.054   1.00 0.00 ? 4   GLY A C    3  
ATOM   1407  O  O    . GLY A 1 4  ? -9.055  3.925   8.818   1.00 0.00 ? 4   GLY A O    3  
ATOM   1408  H  H    . GLY A 1 4  ? -9.594  7.958   9.789   1.00 0.00 ? 4   GLY A H    3  
ATOM   1409  H  HA2  . GLY A 1 4  ? -9.960  6.706   7.880   1.00 0.00 ? 4   GLY A HA2  3  
ATOM   1410  H  HA3  . GLY A 1 4  ? -8.298  6.145   7.977   1.00 0.00 ? 4   GLY A HA3  3  
ATOM   1411  N  N    . SER A 1 5  ? -10.815 4.962   9.761   1.00 0.00 ? 5   SER A N    3  
ATOM   1412  C  CA   . SER A 1 5  ? -11.378 3.737   10.317  1.00 0.00 ? 5   SER A CA   3  
ATOM   1413  C  C    . SER A 1 5  ? -11.864 2.810   9.208   1.00 0.00 ? 5   SER A C    3  
ATOM   1414  O  O    . SER A 1 5  ? -11.600 1.608   9.228   1.00 0.00 ? 5   SER A O    3  
ATOM   1415  C  CB   . SER A 1 5  ? -12.533 4.066   11.265  1.00 0.00 ? 5   SER A CB   3  
ATOM   1416  O  OG   . SER A 1 5  ? -12.110 4.930   12.305  1.00 0.00 ? 5   SER A OG   3  
ATOM   1417  H  H    . SER A 1 5  ? -11.276 5.813   9.915   1.00 0.00 ? 5   SER A H    3  
ATOM   1418  H  HA   . SER A 1 5  ? -10.599 3.237   10.873  1.00 0.00 ? 5   SER A HA   3  
ATOM   1419  H  HB2  . SER A 1 5  ? -13.323 4.550   10.711  1.00 0.00 ? 5   SER A HB2  3  
ATOM   1420  H  HB3  . SER A 1 5  ? -12.908 3.152   11.702  1.00 0.00 ? 5   SER A HB3  3  
ATOM   1421  H  HG   . SER A 1 5  ? -11.199 4.732   12.535  1.00 0.00 ? 5   SER A HG   3  
ATOM   1422  N  N    . SER A 1 6  ? -12.576 3.378   8.240   1.00 0.00 ? 6   SER A N    3  
ATOM   1423  C  CA   . SER A 1 6  ? -13.103 2.603   7.123   1.00 0.00 ? 6   SER A CA   3  
ATOM   1424  C  C    . SER A 1 6  ? -12.106 1.534   6.684   1.00 0.00 ? 6   SER A C    3  
ATOM   1425  O  O    . SER A 1 6  ? -12.433 0.350   6.626   1.00 0.00 ? 6   SER A O    3  
ATOM   1426  C  CB   . SER A 1 6  ? -13.432 3.523   5.946   1.00 0.00 ? 6   SER A CB   3  
ATOM   1427  O  OG   . SER A 1 6  ? -14.465 2.977   5.145   1.00 0.00 ? 6   SER A OG   3  
ATOM   1428  H  H    . SER A 1 6  ? -12.753 4.341   8.279   1.00 0.00 ? 6   SER A H    3  
ATOM   1429  H  HA   . SER A 1 6  ? -14.009 2.118   7.454   1.00 0.00 ? 6   SER A HA   3  
ATOM   1430  H  HB2  . SER A 1 6  ? -13.753 4.483   6.321   1.00 0.00 ? 6   SER A HB2  3  
ATOM   1431  H  HB3  . SER A 1 6  ? -12.549 3.652   5.336   1.00 0.00 ? 6   SER A HB3  3  
ATOM   1432  H  HG   . SER A 1 6  ? -15.281 3.460   5.301   1.00 0.00 ? 6   SER A HG   3  
ATOM   1433  N  N    . GLY A 1 7  ? -10.885 1.963   6.377   1.00 0.00 ? 7   GLY A N    3  
ATOM   1434  C  CA   . GLY A 1 7  ? -9.858  1.033   5.947   1.00 0.00 ? 7   GLY A CA   3  
ATOM   1435  C  C    . GLY A 1 7  ? -9.764  -0.183  6.848   1.00 0.00 ? 7   GLY A C    3  
ATOM   1436  O  O    . GLY A 1 7  ? -9.577  -0.054  8.058   1.00 0.00 ? 7   GLY A O    3  
ATOM   1437  H  H    . GLY A 1 7  ? -10.681 2.920   6.442   1.00 0.00 ? 7   GLY A H    3  
ATOM   1438  H  HA2  . GLY A 1 7  ? -10.080 0.707   4.942   1.00 0.00 ? 7   GLY A HA2  3  
ATOM   1439  H  HA3  . GLY A 1 7  ? -8.905  1.541   5.948   1.00 0.00 ? 7   GLY A HA3  3  
ATOM   1440  N  N    . SER A 1 8  ? -9.895  -1.367  6.258   1.00 0.00 ? 8   SER A N    3  
ATOM   1441  C  CA   . SER A 1 8  ? -9.829  -2.610  7.016   1.00 0.00 ? 8   SER A CA   3  
ATOM   1442  C  C    . SER A 1 8  ? -8.929  -3.625  6.319   1.00 0.00 ? 8   SER A C    3  
ATOM   1443  O  O    . SER A 1 8  ? -8.868  -3.677  5.089   1.00 0.00 ? 8   SER A O    3  
ATOM   1444  C  CB   . SER A 1 8  ? -11.231 -3.196  7.199   1.00 0.00 ? 8   SER A CB   3  
ATOM   1445  O  OG   . SER A 1 8  ? -11.232 -4.219  8.179   1.00 0.00 ? 8   SER A OG   3  
ATOM   1446  H  H    . SER A 1 8  ? -10.042 -1.404  5.290   1.00 0.00 ? 8   SER A H    3  
ATOM   1447  H  HA   . SER A 1 8  ? -9.414  -2.385  7.987   1.00 0.00 ? 8   SER A HA   3  
ATOM   1448  H  HB2  . SER A 1 8  ? -11.907 -2.415  7.511   1.00 0.00 ? 8   SER A HB2  3  
ATOM   1449  H  HB3  . SER A 1 8  ? -11.569 -3.612  6.261   1.00 0.00 ? 8   SER A HB3  3  
ATOM   1450  H  HG   . SER A 1 8  ? -10.456 -4.130  8.737   1.00 0.00 ? 8   SER A HG   3  
ATOM   1451  N  N    . LEU A 1 9  ? -8.231  -4.430  7.111   1.00 0.00 ? 9   LEU A N    3  
ATOM   1452  C  CA   . LEU A 1 9  ? -7.332  -5.445  6.572   1.00 0.00 ? 9   LEU A CA   3  
ATOM   1453  C  C    . LEU A 1 9  ? -8.118  -6.625  6.009   1.00 0.00 ? 9   LEU A C    3  
ATOM   1454  O  O    . LEU A 1 9  ? -9.102  -7.067  6.601   1.00 0.00 ? 9   LEU A O    3  
ATOM   1455  C  CB   . LEU A 1 9  ? -6.369  -5.931  7.656   1.00 0.00 ? 9   LEU A CB   3  
ATOM   1456  C  CG   . LEU A 1 9  ? -5.328  -4.917  8.133   1.00 0.00 ? 9   LEU A CG   3  
ATOM   1457  C  CD1  . LEU A 1 9  ? -4.777  -5.316  9.493   1.00 0.00 ? 9   LEU A CD1  3  
ATOM   1458  C  CD2  . LEU A 1 9  ? -4.204  -4.789  7.116   1.00 0.00 ? 9   LEU A CD2  3  
ATOM   1459  H  H    . LEU A 1 9  ? -8.321  -4.342  8.083   1.00 0.00 ? 9   LEU A H    3  
ATOM   1460  H  HA   . LEU A 1 9  ? -6.764  -4.993  5.773   1.00 0.00 ? 9   LEU A HA   3  
ATOM   1461  H  HB2  . LEU A 1 9  ? -6.956  -6.228  8.511   1.00 0.00 ? 9   LEU A HB2  3  
ATOM   1462  H  HB3  . LEU A 1 9  ? -5.841  -6.790  7.268   1.00 0.00 ? 9   LEU A HB3  3  
ATOM   1463  H  HG   . LEU A 1 9  ? -5.799  -3.949  8.236   1.00 0.00 ? 9   LEU A HG   3  
ATOM   1464  H  HD11 . LEU A 1 9  ? -5.586  -5.378  10.205  1.00 0.00 ? 9   LEU A HD11 3  
ATOM   1465  H  HD12 . LEU A 1 9  ? -4.063  -4.577  9.823   1.00 0.00 ? 9   LEU A HD12 3  
ATOM   1466  H  HD13 . LEU A 1 9  ? -4.290  -6.278  9.415   1.00 0.00 ? 9   LEU A HD13 3  
ATOM   1467  H  HD21 . LEU A 1 9  ? -4.294  -5.572  6.378   1.00 0.00 ? 9   LEU A HD21 3  
ATOM   1468  H  HD22 . LEU A 1 9  ? -3.252  -4.877  7.620   1.00 0.00 ? 9   LEU A HD22 3  
ATOM   1469  H  HD23 . LEU A 1 9  ? -4.266  -3.826  6.630   1.00 0.00 ? 9   LEU A HD23 3  
ATOM   1470  N  N    . MET A 1 10 ? -7.676  -7.130  4.862   1.00 0.00 ? 10  MET A N    3  
ATOM   1471  C  CA   . MET A 1 10 ? -8.337  -8.261  4.220   1.00 0.00 ? 10  MET A CA   3  
ATOM   1472  C  C    . MET A 1 10 ? -7.635  -9.570  4.569   1.00 0.00 ? 10  MET A C    3  
ATOM   1473  O  O    . MET A 1 10 ? -6.529  -9.567  5.108   1.00 0.00 ? 10  MET A O    3  
ATOM   1474  C  CB   . MET A 1 10 ? -8.362  -8.071  2.703   1.00 0.00 ? 10  MET A CB   3  
ATOM   1475  C  CG   . MET A 1 10 ? -9.309  -6.974  2.243   1.00 0.00 ? 10  MET A CG   3  
ATOM   1476  S  SD   . MET A 1 10 ? -11.017 -7.537  2.118   1.00 0.00 ? 10  MET A SD   3  
ATOM   1477  C  CE   . MET A 1 10 ? -11.428 -7.005  0.458   1.00 0.00 ? 10  MET A CE   3  
ATOM   1478  H  H    . MET A 1 10 ? -6.887  -6.734  4.436   1.00 0.00 ? 10  MET A H    3  
ATOM   1479  H  HA   . MET A 1 10 ? -9.352  -8.302  4.586   1.00 0.00 ? 10  MET A HA   3  
ATOM   1480  H  HB2  . MET A 1 10 ? -7.367  -7.822  2.366   1.00 0.00 ? 10  MET A HB2  3  
ATOM   1481  H  HB3  . MET A 1 10 ? -8.669  -8.997  2.240   1.00 0.00 ? 10  MET A HB3  3  
ATOM   1482  H  HG2  . MET A 1 10 ? -9.265  -6.159  2.950   1.00 0.00 ? 10  MET A HG2  3  
ATOM   1483  H  HG3  . MET A 1 10 ? -8.987  -6.623  1.274   1.00 0.00 ? 10  MET A HG3  3  
ATOM   1484  H  HE1  . MET A 1 10 ? -12.371 -7.443  0.163   1.00 0.00 ? 10  MET A HE1  3  
ATOM   1485  H  HE2  . MET A 1 10 ? -11.509 -5.928  0.434   1.00 0.00 ? 10  MET A HE2  3  
ATOM   1486  H  HE3  . MET A 1 10 ? -10.654 -7.324  -0.224  1.00 0.00 ? 10  MET A HE3  3  
ATOM   1487  N  N    . ASP A 1 11 ? -8.286  -10.686 4.258   1.00 0.00 ? 11  ASP A N    3  
ATOM   1488  C  CA   . ASP A 1 11 ? -7.723  -12.002 4.538   1.00 0.00 ? 11  ASP A CA   3  
ATOM   1489  C  C    . ASP A 1 11 ? -6.758  -12.426 3.435   1.00 0.00 ? 11  ASP A C    3  
ATOM   1490  O  O    . ASP A 1 11 ? -6.396  -13.598 3.330   1.00 0.00 ? 11  ASP A O    3  
ATOM   1491  C  CB   . ASP A 1 11 ? -8.840  -13.037 4.682   1.00 0.00 ? 11  ASP A CB   3  
ATOM   1492  C  CG   . ASP A 1 11 ? -9.829  -12.984 3.534   1.00 0.00 ? 11  ASP A CG   3  
ATOM   1493  O  OD1  . ASP A 1 11 ? -9.401  -12.708 2.394   1.00 0.00 ? 11  ASP A OD1  3  
ATOM   1494  O  OD2  . ASP A 1 11 ? -11.031 -13.220 3.776   1.00 0.00 ? 11  ASP A OD2  3  
ATOM   1495  H  H    . ASP A 1 11 ? -9.165  -10.623 3.829   1.00 0.00 ? 11  ASP A H    3  
ATOM   1496  H  HA   . ASP A 1 11 ? -7.181  -11.939 5.469   1.00 0.00 ? 11  ASP A HA   3  
ATOM   1497  H  HB2  . ASP A 1 11 ? -8.404  -14.025 4.711   1.00 0.00 ? 11  ASP A HB2  3  
ATOM   1498  H  HB3  . ASP A 1 11 ? -9.374  -12.855 5.603   1.00 0.00 ? 11  ASP A HB3  3  
ATOM   1499  N  N    . VAL A 1 12 ? -6.346  -11.465 2.615   1.00 0.00 ? 12  VAL A N    3  
ATOM   1500  C  CA   . VAL A 1 12 ? -5.423  -11.738 1.520   1.00 0.00 ? 12  VAL A CA   3  
ATOM   1501  C  C    . VAL A 1 12 ? -4.067  -11.087 1.769   1.00 0.00 ? 12  VAL A C    3  
ATOM   1502  O  O    . VAL A 1 12 ? -3.987  -9.926  2.169   1.00 0.00 ? 12  VAL A O    3  
ATOM   1503  C  CB   . VAL A 1 12 ? -5.982  -11.236 0.176   1.00 0.00 ? 12  VAL A CB   3  
ATOM   1504  C  CG1  . VAL A 1 12 ? -6.365  -9.767  0.271   1.00 0.00 ? 12  VAL A CG1  3  
ATOM   1505  C  CG2  . VAL A 1 12 ? -4.971  -11.460 -0.939  1.00 0.00 ? 12  VAL A CG2  3  
ATOM   1506  H  H    . VAL A 1 12 ? -6.669  -10.550 2.750   1.00 0.00 ? 12  VAL A H    3  
ATOM   1507  H  HA   . VAL A 1 12 ? -5.291  -12.809 1.454   1.00 0.00 ? 12  VAL A HA   3  
ATOM   1508  H  HB   . VAL A 1 12 ? -6.872  -11.803 -0.055  1.00 0.00 ? 12  VAL A HB   3  
ATOM   1509  H  HG11 . VAL A 1 12 ? -7.374  -9.683  0.647   1.00 0.00 ? 12  VAL A HG11 3  
ATOM   1510  H  HG12 . VAL A 1 12 ? -5.686  -9.261  0.942   1.00 0.00 ? 12  VAL A HG12 3  
ATOM   1511  H  HG13 . VAL A 1 12 ? -6.308  -9.316  -0.708  1.00 0.00 ? 12  VAL A HG13 3  
ATOM   1512  H  HG21 . VAL A 1 12 ? -3.978  -11.242 -0.574  1.00 0.00 ? 12  VAL A HG21 3  
ATOM   1513  H  HG22 . VAL A 1 12 ? -5.017  -12.489 -1.264  1.00 0.00 ? 12  VAL A HG22 3  
ATOM   1514  H  HG23 . VAL A 1 12 ? -5.200  -10.809 -1.770  1.00 0.00 ? 12  VAL A HG23 3  
ATOM   1515  N  N    . LYS A 1 13 ? -3.001  -11.843 1.528   1.00 0.00 ? 13  LYS A N    3  
ATOM   1516  C  CA   . LYS A 1 13 ? -1.646  -11.340 1.723   1.00 0.00 ? 13  LYS A CA   3  
ATOM   1517  C  C    . LYS A 1 13 ? -1.350  -10.188 0.769   1.00 0.00 ? 13  LYS A C    3  
ATOM   1518  O  O    . LYS A 1 13 ? -1.977  -10.063 -0.284  1.00 0.00 ? 13  LYS A O    3  
ATOM   1519  C  CB   . LYS A 1 13 ? -0.628  -12.464 1.515   1.00 0.00 ? 13  LYS A CB   3  
ATOM   1520  C  CG   . LYS A 1 13 ? -0.446  -13.354 2.732   1.00 0.00 ? 13  LYS A CG   3  
ATOM   1521  C  CD   . LYS A 1 13 ? -1.513  -14.434 2.797   1.00 0.00 ? 13  LYS A CD   3  
ATOM   1522  C  CE   . LYS A 1 13 ? -1.235  -15.552 1.804   1.00 0.00 ? 13  LYS A CE   3  
ATOM   1523  N  NZ   . LYS A 1 13 ? -2.011  -16.783 2.123   1.00 0.00 ? 13  LYS A NZ   3  
ATOM   1524  H  H    . LYS A 1 13 ? -3.128  -12.762 1.210   1.00 0.00 ? 13  LYS A H    3  
ATOM   1525  H  HA   . LYS A 1 13 ? -1.569  -10.980 2.738   1.00 0.00 ? 13  LYS A HA   3  
ATOM   1526  H  HB2  . LYS A 1 13 ? -0.954  -13.080 0.690   1.00 0.00 ? 13  LYS A HB2  3  
ATOM   1527  H  HB3  . LYS A 1 13 ? 0.329   -12.025 1.269   1.00 0.00 ? 13  LYS A HB3  3  
ATOM   1528  H  HG2  . LYS A 1 13 ? 0.524   -13.824 2.681   1.00 0.00 ? 13  LYS A HG2  3  
ATOM   1529  H  HG3  . LYS A 1 13 ? -0.508  -12.746 3.624   1.00 0.00 ? 13  LYS A HG3  3  
ATOM   1530  H  HD2  . LYS A 1 13 ? -1.532  -14.850 3.794   1.00 0.00 ? 13  LYS A HD2  3  
ATOM   1531  H  HD3  . LYS A 1 13 ? -2.473  -13.993 2.571   1.00 0.00 ? 13  LYS A HD3  3  
ATOM   1532  H  HE2  . LYS A 1 13 ? -1.505  -15.213 0.816   1.00 0.00 ? 13  LYS A HE2  3  
ATOM   1533  H  HE3  . LYS A 1 13 ? -0.181  -15.785 1.830   1.00 0.00 ? 13  LYS A HE3  3  
ATOM   1534  H  HZ1  . LYS A 1 13 ? -1.402  -17.621 2.036   1.00 0.00 ? 13  LYS A HZ1  3  
ATOM   1535  H  HZ2  . LYS A 1 13 ? -2.812  -16.879 1.467   1.00 0.00 ? 13  LYS A HZ2  3  
ATOM   1536  H  HZ3  . LYS A 1 13 ? -2.377  -16.732 3.095   1.00 0.00 ? 13  LYS A HZ3  3  
ATOM   1537  N  N    . CYS A 1 14 ? -0.390  -9.348  1.142   1.00 0.00 ? 14  CYS A N    3  
ATOM   1538  C  CA   . CYS A 1 14 ? -0.010  -8.207  0.319   1.00 0.00 ? 14  CYS A CA   3  
ATOM   1539  C  C    . CYS A 1 14 ? 0.503   -8.665  -1.044  1.00 0.00 ? 14  CYS A C    3  
ATOM   1540  O  O    . CYS A 1 14 ? 1.136   -9.713  -1.159  1.00 0.00 ? 14  CYS A O    3  
ATOM   1541  C  CB   . CYS A 1 14 ? 1.063   -7.376  1.026   1.00 0.00 ? 14  CYS A CB   3  
ATOM   1542  S  SG   . CYS A 1 14 ? 1.777   -6.053  -0.002  1.00 0.00 ? 14  CYS A SG   3  
ATOM   1543  H  H    . CYS A 1 14 ? 0.074   -9.500  1.992   1.00 0.00 ? 14  CYS A H    3  
ATOM   1544  H  HA   . CYS A 1 14 ? -0.887  -7.596  0.172   1.00 0.00 ? 14  CYS A HA   3  
ATOM   1545  H  HB2  . CYS A 1 14 ? 0.630   -6.914  1.901   1.00 0.00 ? 14  CYS A HB2  3  
ATOM   1546  H  HB3  . CYS A 1 14 ? 1.869   -8.027  1.331   1.00 0.00 ? 14  CYS A HB3  3  
ATOM   1547  N  N    . GLU A 1 15 ? 0.223   -7.871  -2.073  1.00 0.00 ? 15  GLU A N    3  
ATOM   1548  C  CA   . GLU A 1 15 ? 0.655   -8.196  -3.427  1.00 0.00 ? 15  GLU A CA   3  
ATOM   1549  C  C    . GLU A 1 15 ? 2.069   -8.770  -3.424  1.00 0.00 ? 15  GLU A C    3  
ATOM   1550  O  O    . GLU A 1 15 ? 2.298   -9.891  -3.880  1.00 0.00 ? 15  GLU A O    3  
ATOM   1551  C  CB   . GLU A 1 15 ? 0.600   -6.952  -4.316  1.00 0.00 ? 15  GLU A CB   3  
ATOM   1552  C  CG   . GLU A 1 15 ? 1.203   -7.162  -5.695  1.00 0.00 ? 15  GLU A CG   3  
ATOM   1553  C  CD   . GLU A 1 15 ? 0.297   -7.956  -6.614  1.00 0.00 ? 15  GLU A CD   3  
ATOM   1554  O  OE1  . GLU A 1 15 ? -0.856  -7.528  -6.827  1.00 0.00 ? 15  GLU A OE1  3  
ATOM   1555  O  OE2  . GLU A 1 15 ? 0.742   -9.008  -7.121  1.00 0.00 ? 15  GLU A OE2  3  
ATOM   1556  H  H    . GLU A 1 15 ? -0.286  -7.048  -1.918  1.00 0.00 ? 15  GLU A H    3  
ATOM   1557  H  HA   . GLU A 1 15 ? -0.021  -8.939  -3.822  1.00 0.00 ? 15  GLU A HA   3  
ATOM   1558  H  HB2  . GLU A 1 15 ? -0.432  -6.657  -4.438  1.00 0.00 ? 15  GLU A HB2  3  
ATOM   1559  H  HB3  . GLU A 1 15 ? 1.137   -6.152  -3.829  1.00 0.00 ? 15  GLU A HB3  3  
ATOM   1560  H  HG2  . GLU A 1 15 ? 1.389   -6.197  -6.143  1.00 0.00 ? 15  GLU A HG2  3  
ATOM   1561  H  HG3  . GLU A 1 15 ? 2.138   -7.693  -5.587  1.00 0.00 ? 15  GLU A HG3  3  
ATOM   1562  N  N    . THR A 1 16 ? 3.016   -7.993  -2.907  1.00 0.00 ? 16  THR A N    3  
ATOM   1563  C  CA   . THR A 1 16 ? 4.407   -8.421  -2.845  1.00 0.00 ? 16  THR A CA   3  
ATOM   1564  C  C    . THR A 1 16 ? 4.532   -9.792  -2.189  1.00 0.00 ? 16  THR A C    3  
ATOM   1565  O  O    . THR A 1 16 ? 4.070   -10.015 -1.070  1.00 0.00 ? 16  THR A O    3  
ATOM   1566  C  CB   . THR A 1 16 ? 5.272   -7.412  -2.068  1.00 0.00 ? 16  THR A CB   3  
ATOM   1567  O  OG1  . THR A 1 16 ? 5.302   -6.158  -2.758  1.00 0.00 ? 16  THR A OG1  3  
ATOM   1568  C  CG2  . THR A 1 16 ? 6.690   -7.935  -1.894  1.00 0.00 ? 16  THR A CG2  3  
ATOM   1569  H  H    . THR A 1 16 ? 2.771   -7.110  -2.559  1.00 0.00 ? 16  THR A H    3  
ATOM   1570  H  HA   . THR A 1 16 ? 4.783   -8.481  -3.857  1.00 0.00 ? 16  THR A HA   3  
ATOM   1571  H  HB   . THR A 1 16 ? 4.836   -7.265  -1.090  1.00 0.00 ? 16  THR A HB   3  
ATOM   1572  H  HG1  . THR A 1 16 ? 4.967   -5.467  -2.182  1.00 0.00 ? 16  THR A HG1  3  
ATOM   1573  H  HG21 . THR A 1 16 ? 7.394   -7.160  -2.157  1.00 0.00 ? 16  THR A HG21 3  
ATOM   1574  H  HG22 . THR A 1 16 ? 6.840   -8.790  -2.536  1.00 0.00 ? 16  THR A HG22 3  
ATOM   1575  H  HG23 . THR A 1 16 ? 6.843   -8.226  -0.865  1.00 0.00 ? 16  THR A HG23 3  
ATOM   1576  N  N    . PRO A 1 17 ? 5.172   -10.733 -2.900  1.00 0.00 ? 17  PRO A N    3  
ATOM   1577  C  CA   . PRO A 1 17 ? 5.373   -12.098 -2.405  1.00 0.00 ? 17  PRO A CA   3  
ATOM   1578  C  C    . PRO A 1 17 ? 6.367   -12.155 -1.250  1.00 0.00 ? 17  PRO A C    3  
ATOM   1579  O  O    . PRO A 1 17 ? 6.695   -13.232 -0.754  1.00 0.00 ? 17  PRO A O    3  
ATOM   1580  C  CB   . PRO A 1 17 ? 5.927   -12.839 -3.624  1.00 0.00 ? 17  PRO A CB   3  
ATOM   1581  C  CG   . PRO A 1 17 ? 6.567   -11.779 -4.453  1.00 0.00 ? 17  PRO A CG   3  
ATOM   1582  C  CD   . PRO A 1 17 ? 5.748   -10.536 -4.241  1.00 0.00 ? 17  PRO A CD   3  
ATOM   1583  H  HA   . PRO A 1 17 ? 4.441   -12.550 -2.099  1.00 0.00 ? 17  PRO A HA   3  
ATOM   1584  H  HB2  . PRO A 1 17 ? 6.647   -13.579 -3.303  1.00 0.00 ? 17  PRO A HB2  3  
ATOM   1585  H  HB3  . PRO A 1 17 ? 5.119   -13.321 -4.154  1.00 0.00 ? 17  PRO A HB3  3  
ATOM   1586  H  HG2  . PRO A 1 17 ? 7.582   -11.620 -4.126  1.00 0.00 ? 17  PRO A HG2  3  
ATOM   1587  H  HG3  . PRO A 1 17 ? 6.547   -12.067 -5.494  1.00 0.00 ? 17  PRO A HG3  3  
ATOM   1588  H  HD2  . PRO A 1 17 ? 6.379   -9.660  -4.265  1.00 0.00 ? 17  PRO A HD2  3  
ATOM   1589  H  HD3  . PRO A 1 17 ? 4.970   -10.464 -4.987  1.00 0.00 ? 17  PRO A HD3  3  
ATOM   1590  N  N    . ASN A 1 18 ? 6.843   -10.988 -0.827  1.00 0.00 ? 18  ASN A N    3  
ATOM   1591  C  CA   . ASN A 1 18 ? 7.801   -10.906 0.270   1.00 0.00 ? 18  ASN A CA   3  
ATOM   1592  C  C    . ASN A 1 18 ? 7.198   -10.171 1.464   1.00 0.00 ? 18  ASN A C    3  
ATOM   1593  O  O    . ASN A 1 18 ? 7.734   -10.220 2.572   1.00 0.00 ? 18  ASN A O    3  
ATOM   1594  C  CB   . ASN A 1 18 ? 9.076   -10.196 -0.190  1.00 0.00 ? 18  ASN A CB   3  
ATOM   1595  C  CG   . ASN A 1 18 ? 9.476   -10.583 -1.601  1.00 0.00 ? 18  ASN A CG   3  
ATOM   1596  O  OD1  . ASN A 1 18 ? 9.884   -11.716 -1.853  1.00 0.00 ? 18  ASN A OD1  3  
ATOM   1597  N  ND2  . ASN A 1 18 ? 9.360   -9.639  -2.528  1.00 0.00 ? 18  ASN A ND2  3  
ATOM   1598  H  H    . ASN A 1 18 ? 6.544   -10.163 -1.263  1.00 0.00 ? 18  ASN A H    3  
ATOM   1599  H  HA   . ASN A 1 18 ? 8.048   -11.913 0.570   1.00 0.00 ? 18  ASN A HA   3  
ATOM   1600  H  HB2  . ASN A 1 18 ? 8.915   -9.128  -0.162  1.00 0.00 ? 18  ASN A HB2  3  
ATOM   1601  H  HB3  . ASN A 1 18 ? 9.884   -10.452 0.478   1.00 0.00 ? 18  ASN A HB3  3  
ATOM   1602  H  HD21 . ASN A 1 18 ? 9.028   -8.759  -2.254  1.00 0.00 ? 18  ASN A HD21 3  
ATOM   1603  H  HD22 . ASN A 1 18 ? 9.612   -9.862  -3.448  1.00 0.00 ? 18  ASN A HD22 3  
ATOM   1604  N  N    . CYS A 1 19 ? 6.081   -9.491  1.231   1.00 0.00 ? 19  CYS A N    3  
ATOM   1605  C  CA   . CYS A 1 19 ? 5.405   -8.746  2.285   1.00 0.00 ? 19  CYS A CA   3  
ATOM   1606  C  C    . CYS A 1 19 ? 4.369   -9.618  2.989   1.00 0.00 ? 19  CYS A C    3  
ATOM   1607  O  O    . CYS A 1 19 ? 3.346   -9.995  2.417   1.00 0.00 ? 19  CYS A O    3  
ATOM   1608  C  CB   . CYS A 1 19 ? 4.730   -7.500  1.706   1.00 0.00 ? 19  CYS A CB   3  
ATOM   1609  S  SG   . CYS A 1 19 ? 4.233   -6.274  2.958   1.00 0.00 ? 19  CYS A SG   3  
ATOM   1610  H  H    . CYS A 1 19 ? 5.702   -9.490  0.326   1.00 0.00 ? 19  CYS A H    3  
ATOM   1611  H  HA   . CYS A 1 19 ? 6.148   -8.440  3.005   1.00 0.00 ? 19  CYS A HA   3  
ATOM   1612  H  HB2  . CYS A 1 19 ? 5.413   -7.015  1.025   1.00 0.00 ? 19  CYS A HB2  3  
ATOM   1613  H  HB3  . CYS A 1 19 ? 3.843   -7.798  1.167   1.00 0.00 ? 19  CYS A HB3  3  
ATOM   1614  N  N    . PRO A 1 20 ? 4.638   -9.946  4.261   1.00 0.00 ? 20  PRO A N    3  
ATOM   1615  C  CA   . PRO A 1 20 ? 3.742   -10.776 5.071   1.00 0.00 ? 20  PRO A CA   3  
ATOM   1616  C  C    . PRO A 1 20 ? 2.448   -10.054 5.429   1.00 0.00 ? 20  PRO A C    3  
ATOM   1617  O  O    . PRO A 1 20 ? 1.466   -10.679 5.830   1.00 0.00 ? 20  PRO A O    3  
ATOM   1618  C  CB   . PRO A 1 20 ? 4.563   -11.059 6.332   1.00 0.00 ? 20  PRO A CB   3  
ATOM   1619  C  CG   . PRO A 1 20 ? 5.520   -9.920  6.424   1.00 0.00 ? 20  PRO A CG   3  
ATOM   1620  C  CD   . PRO A 1 20 ? 5.839   -9.532  5.007   1.00 0.00 ? 20  PRO A CD   3  
ATOM   1621  H  HA   . PRO A 1 20 ? 3.508   -11.707 4.576   1.00 0.00 ? 20  PRO A HA   3  
ATOM   1622  H  HB2  . PRO A 1 20 ? 3.908   -11.096 7.191   1.00 0.00 ? 20  PRO A HB2  3  
ATOM   1623  H  HB3  . PRO A 1 20 ? 5.080   -12.001 6.226   1.00 0.00 ? 20  PRO A HB3  3  
ATOM   1624  H  HG2  . PRO A 1 20 ? 5.059   -9.095  6.945   1.00 0.00 ? 20  PRO A HG2  3  
ATOM   1625  H  HG3  . PRO A 1 20 ? 6.416   -10.235 6.937   1.00 0.00 ? 20  PRO A HG3  3  
ATOM   1626  H  HD2  . PRO A 1 20 ? 5.989   -8.465  4.933   1.00 0.00 ? 20  PRO A HD2  3  
ATOM   1627  H  HD3  . PRO A 1 20 ? 6.711   -10.063 4.657   1.00 0.00 ? 20  PRO A HD3  3  
ATOM   1628  N  N    . PHE A 1 21 ? 2.453   -8.733  5.282   1.00 0.00 ? 21  PHE A N    3  
ATOM   1629  C  CA   . PHE A 1 21 ? 1.279   -7.925  5.590   1.00 0.00 ? 21  PHE A CA   3  
ATOM   1630  C  C    . PHE A 1 21 ? 0.096   -8.327  4.714   1.00 0.00 ? 21  PHE A C    3  
ATOM   1631  O  O    . PHE A 1 21 ? 0.244   -9.105  3.771   1.00 0.00 ? 21  PHE A O    3  
ATOM   1632  C  CB   . PHE A 1 21 ? 1.590   -6.440  5.395   1.00 0.00 ? 21  PHE A CB   3  
ATOM   1633  C  CG   . PHE A 1 21 ? 2.439   -5.857  6.489   1.00 0.00 ? 21  PHE A CG   3  
ATOM   1634  C  CD1  . PHE A 1 21 ? 2.110   -6.057  7.820   1.00 0.00 ? 21  PHE A CD1  3  
ATOM   1635  C  CD2  . PHE A 1 21 ? 3.564   -5.107  6.186   1.00 0.00 ? 21  PHE A CD2  3  
ATOM   1636  C  CE1  . PHE A 1 21 ? 2.889   -5.523  8.829   1.00 0.00 ? 21  PHE A CE1  3  
ATOM   1637  C  CE2  . PHE A 1 21 ? 4.347   -4.571  7.191   1.00 0.00 ? 21  PHE A CE2  3  
ATOM   1638  C  CZ   . PHE A 1 21 ? 4.008   -4.777  8.514   1.00 0.00 ? 21  PHE A CZ   3  
ATOM   1639  H  H    . PHE A 1 21 ? 3.266   -8.291  4.958   1.00 0.00 ? 21  PHE A H    3  
ATOM   1640  H  HA   . PHE A 1 21 ? 1.021   -8.097  6.623   1.00 0.00 ? 21  PHE A HA   3  
ATOM   1641  H  HB2  . PHE A 1 21 ? 2.117   -6.309  4.462   1.00 0.00 ? 21  PHE A HB2  3  
ATOM   1642  H  HB3  . PHE A 1 21 ? 0.664   -5.887  5.362   1.00 0.00 ? 21  PHE A HB3  3  
ATOM   1643  H  HD1  . PHE A 1 21 ? 1.234   -6.641  8.068   1.00 0.00 ? 21  PHE A HD1  3  
ATOM   1644  H  HD2  . PHE A 1 21 ? 3.830   -4.944  5.152   1.00 0.00 ? 21  PHE A HD2  3  
ATOM   1645  H  HE1  . PHE A 1 21 ? 2.621   -5.687  9.863   1.00 0.00 ? 21  PHE A HE1  3  
ATOM   1646  H  HE2  . PHE A 1 21 ? 5.221   -3.988  6.942   1.00 0.00 ? 21  PHE A HE2  3  
ATOM   1647  H  HZ   . PHE A 1 21 ? 4.618   -4.359  9.301   1.00 0.00 ? 21  PHE A HZ   3  
ATOM   1648  N  N    . PHE A 1 22 ? -1.078  -7.792  5.032   1.00 0.00 ? 22  PHE A N    3  
ATOM   1649  C  CA   . PHE A 1 22 ? -2.287  -8.095  4.276   1.00 0.00 ? 22  PHE A CA   3  
ATOM   1650  C  C    . PHE A 1 22 ? -2.763  -6.872  3.498   1.00 0.00 ? 22  PHE A C    3  
ATOM   1651  O  O    . PHE A 1 22 ? -2.482  -5.735  3.876   1.00 0.00 ? 22  PHE A O    3  
ATOM   1652  C  CB   . PHE A 1 22 ? -3.393  -8.579  5.215   1.00 0.00 ? 22  PHE A CB   3  
ATOM   1653  C  CG   . PHE A 1 22 ? -3.112  -9.919  5.832   1.00 0.00 ? 22  PHE A CG   3  
ATOM   1654  C  CD1  . PHE A 1 22 ? -3.136  -11.070 5.062   1.00 0.00 ? 22  PHE A CD1  3  
ATOM   1655  C  CD2  . PHE A 1 22 ? -2.823  -10.027 7.183   1.00 0.00 ? 22  PHE A CD2  3  
ATOM   1656  C  CE1  . PHE A 1 22 ? -2.878  -12.305 5.628   1.00 0.00 ? 22  PHE A CE1  3  
ATOM   1657  C  CE2  . PHE A 1 22 ? -2.564  -11.259 7.755   1.00 0.00 ? 22  PHE A CE2  3  
ATOM   1658  C  CZ   . PHE A 1 22 ? -2.591  -12.399 6.976   1.00 0.00 ? 22  PHE A CZ   3  
ATOM   1659  H  H    . PHE A 1 22 ? -1.132  -7.178  5.795   1.00 0.00 ? 22  PHE A H    3  
ATOM   1660  H  HA   . PHE A 1 22 ? -2.050  -8.882  3.576   1.00 0.00 ? 22  PHE A HA   3  
ATOM   1661  H  HB2  . PHE A 1 22 ? -3.515  -7.865  6.015   1.00 0.00 ? 22  PHE A HB2  3  
ATOM   1662  H  HB3  . PHE A 1 22 ? -4.317  -8.654  4.662   1.00 0.00 ? 22  PHE A HB3  3  
ATOM   1663  H  HD1  . PHE A 1 22 ? -3.360  -10.998 4.007   1.00 0.00 ? 22  PHE A HD1  3  
ATOM   1664  H  HD2  . PHE A 1 22 ? -2.802  -9.136  7.794   1.00 0.00 ? 22  PHE A HD2  3  
ATOM   1665  H  HE1  . PHE A 1 22 ? -2.900  -13.195 5.016   1.00 0.00 ? 22  PHE A HE1  3  
ATOM   1666  H  HE2  . PHE A 1 22 ? -2.340  -11.329 8.809   1.00 0.00 ? 22  PHE A HE2  3  
ATOM   1667  H  HZ   . PHE A 1 22 ? -2.390  -13.362 7.420   1.00 0.00 ? 22  PHE A HZ   3  
ATOM   1668  N  N    . MET A 1 23 ? -3.485  -7.115  2.409   1.00 0.00 ? 23  MET A N    3  
ATOM   1669  C  CA   . MET A 1 23 ? -4.002  -6.034  1.578   1.00 0.00 ? 23  MET A CA   3  
ATOM   1670  C  C    . MET A 1 23 ? -5.179  -5.341  2.256   1.00 0.00 ? 23  MET A C    3  
ATOM   1671  O  O    . MET A 1 23 ? -6.200  -5.967  2.541   1.00 0.00 ? 23  MET A O    3  
ATOM   1672  C  CB   . MET A 1 23 ? -4.430  -6.572  0.211   1.00 0.00 ? 23  MET A CB   3  
ATOM   1673  C  CG   . MET A 1 23 ? -3.437  -7.551  -0.394  1.00 0.00 ? 23  MET A CG   3  
ATOM   1674  S  SD   . MET A 1 23 ? -4.118  -8.448  -1.803  1.00 0.00 ? 23  MET A SD   3  
ATOM   1675  C  CE   . MET A 1 23 ? -2.780  -8.290  -2.983  1.00 0.00 ? 23  MET A CE   3  
ATOM   1676  H  H    . MET A 1 23 ? -3.677  -8.043  2.158   1.00 0.00 ? 23  MET A H    3  
ATOM   1677  H  HA   . MET A 1 23 ? -3.208  -5.315  1.439   1.00 0.00 ? 23  MET A HA   3  
ATOM   1678  H  HB2  . MET A 1 23 ? -5.380  -7.075  0.317   1.00 0.00 ? 23  MET A HB2  3  
ATOM   1679  H  HB3  . MET A 1 23 ? -4.545  -5.742  -0.470  1.00 0.00 ? 23  MET A HB3  3  
ATOM   1680  H  HG2  . MET A 1 23 ? -2.566  -7.004  -0.722  1.00 0.00 ? 23  MET A HG2  3  
ATOM   1681  H  HG3  . MET A 1 23 ? -3.149  -8.264  0.364   1.00 0.00 ? 23  MET A HG3  3  
ATOM   1682  H  HE1  . MET A 1 23 ? -2.985  -8.909  -3.845  1.00 0.00 ? 23  MET A HE1  3  
ATOM   1683  H  HE2  . MET A 1 23 ? -2.692  -7.259  -3.293  1.00 0.00 ? 23  MET A HE2  3  
ATOM   1684  H  HE3  . MET A 1 23 ? -1.855  -8.607  -2.523  1.00 0.00 ? 23  MET A HE3  3  
ATOM   1685  N  N    . SER A 1 24 ? -5.030  -4.045  2.513   1.00 0.00 ? 24  SER A N    3  
ATOM   1686  C  CA   . SER A 1 24 ? -6.080  -3.269  3.162   1.00 0.00 ? 24  SER A CA   3  
ATOM   1687  C  C    . SER A 1 24 ? -7.188  -2.921  2.173   1.00 0.00 ? 24  SER A C    3  
ATOM   1688  O  O    . SER A 1 24 ? -7.099  -3.236  0.987   1.00 0.00 ? 24  SER A O    3  
ATOM   1689  C  CB   . SER A 1 24 ? -5.498  -1.989  3.765   1.00 0.00 ? 24  SER A CB   3  
ATOM   1690  O  OG   . SER A 1 24 ? -6.221  -1.594  4.918   1.00 0.00 ? 24  SER A OG   3  
ATOM   1691  H  H    . SER A 1 24 ? -4.193  -3.602  2.262   1.00 0.00 ? 24  SER A H    3  
ATOM   1692  H  HA   . SER A 1 24 ? -6.497  -3.873  3.954   1.00 0.00 ? 24  SER A HA   3  
ATOM   1693  H  HB2  . SER A 1 24 ? -4.469  -2.160  4.042   1.00 0.00 ? 24  SER A HB2  3  
ATOM   1694  H  HB3  . SER A 1 24 ? -5.548  -1.195  3.034   1.00 0.00 ? 24  SER A HB3  3  
ATOM   1695  H  HG   . SER A 1 24 ? -5.718  -1.817  5.704   1.00 0.00 ? 24  SER A HG   3  
ATOM   1696  N  N    . VAL A 1 25 ? -8.234  -2.268  2.671   1.00 0.00 ? 25  VAL A N    3  
ATOM   1697  C  CA   . VAL A 1 25 ? -9.360  -1.875  1.833   1.00 0.00 ? 25  VAL A CA   3  
ATOM   1698  C  C    . VAL A 1 25 ? -9.069  -0.571  1.098   1.00 0.00 ? 25  VAL A C    3  
ATOM   1699  O  O    . VAL A 1 25 ? -9.674  -0.280  0.067   1.00 0.00 ? 25  VAL A O    3  
ATOM   1700  C  CB   . VAL A 1 25 ? -10.646 -1.708  2.663   1.00 0.00 ? 25  VAL A CB   3  
ATOM   1701  C  CG1  . VAL A 1 25 ? -11.779 -1.184  1.794   1.00 0.00 ? 25  VAL A CG1  3  
ATOM   1702  C  CG2  . VAL A 1 25 ? -11.032 -3.025  3.319   1.00 0.00 ? 25  VAL A CG2  3  
ATOM   1703  H  H    . VAL A 1 25 ? -8.247  -2.045  3.625   1.00 0.00 ? 25  VAL A H    3  
ATOM   1704  H  HA   . VAL A 1 25 ? -9.525  -2.658  1.107   1.00 0.00 ? 25  VAL A HA   3  
ATOM   1705  H  HB   . VAL A 1 25 ? -10.456 -0.984  3.443   1.00 0.00 ? 25  VAL A HB   3  
ATOM   1706  H  HG11 . VAL A 1 25 ? -12.683 -1.733  2.012   1.00 0.00 ? 25  VAL A HG11 3  
ATOM   1707  H  HG12 . VAL A 1 25 ? -11.935 -0.135  1.999   1.00 0.00 ? 25  VAL A HG12 3  
ATOM   1708  H  HG13 . VAL A 1 25 ? -11.523 -1.313  0.753   1.00 0.00 ? 25  VAL A HG13 3  
ATOM   1709  H  HG21 . VAL A 1 25 ? -10.427 -3.821  2.912   1.00 0.00 ? 25  VAL A HG21 3  
ATOM   1710  H  HG22 . VAL A 1 25 ? -10.869 -2.958  4.384   1.00 0.00 ? 25  VAL A HG22 3  
ATOM   1711  H  HG23 . VAL A 1 25 ? -12.075 -3.232  3.126   1.00 0.00 ? 25  VAL A HG23 3  
ATOM   1712  N  N    . ASN A 1 26 ? -8.138  0.210   1.636   1.00 0.00 ? 26  ASN A N    3  
ATOM   1713  C  CA   . ASN A 1 26 ? -7.767  1.484   1.031   1.00 0.00 ? 26  ASN A CA   3  
ATOM   1714  C  C    . ASN A 1 26 ? -6.328  1.448   0.527   1.00 0.00 ? 26  ASN A C    3  
ATOM   1715  O  O    . ASN A 1 26 ? -5.822  2.432   -0.015  1.00 0.00 ? 26  ASN A O    3  
ATOM   1716  C  CB   . ASN A 1 26 ? -7.937  2.621   2.041   1.00 0.00 ? 26  ASN A CB   3  
ATOM   1717  C  CG   . ASN A 1 26 ? -6.927  2.547   3.170   1.00 0.00 ? 26  ASN A CG   3  
ATOM   1718  O  OD1  . ASN A 1 26 ? -5.914  3.246   3.157   1.00 0.00 ? 26  ASN A OD1  3  
ATOM   1719  N  ND2  . ASN A 1 26 ? -7.201  1.698   4.153   1.00 0.00 ? 26  ASN A ND2  3  
ATOM   1720  H  H    . ASN A 1 26 ? -7.691  -0.076  2.459   1.00 0.00 ? 26  ASN A H    3  
ATOM   1721  H  HA   . ASN A 1 26 ? -8.425  1.657   0.193   1.00 0.00 ? 26  ASN A HA   3  
ATOM   1722  H  HB2  . ASN A 1 26 ? -7.812  3.566   1.533   1.00 0.00 ? 26  ASN A HB2  3  
ATOM   1723  H  HB3  . ASN A 1 26 ? -8.929  2.573   2.465   1.00 0.00 ? 26  ASN A HB3  3  
ATOM   1724  H  HD21 . ASN A 1 26 ? -8.027  1.173   4.096   1.00 0.00 ? 26  ASN A HD21 3  
ATOM   1725  H  HD22 . ASN A 1 26 ? -6.565  1.630   4.896   1.00 0.00 ? 26  ASN A HD22 3  
ATOM   1726  N  N    . THR A 1 27 ? -5.671  0.306   0.708   1.00 0.00 ? 27  THR A N    3  
ATOM   1727  C  CA   . THR A 1 27 ? -4.290  0.140   0.273   1.00 0.00 ? 27  THR A CA   3  
ATOM   1728  C  C    . THR A 1 27 ? -4.187  -0.886  -0.850  1.00 0.00 ? 27  THR A C    3  
ATOM   1729  O  O    . THR A 1 27 ? -3.167  -0.970  -1.533  1.00 0.00 ? 27  THR A O    3  
ATOM   1730  C  CB   . THR A 1 27 ? -3.383  -0.297  1.438   1.00 0.00 ? 27  THR A CB   3  
ATOM   1731  O  OG1  . THR A 1 27 ? -3.703  -1.636  1.832   1.00 0.00 ? 27  THR A OG1  3  
ATOM   1732  C  CG2  . THR A 1 27 ? -3.540  0.639   2.627   1.00 0.00 ? 27  THR A CG2  3  
ATOM   1733  H  H    . THR A 1 27 ? -6.128  -0.443  1.146   1.00 0.00 ? 27  THR A H    3  
ATOM   1734  H  HA   . THR A 1 27 ? -3.939  1.095   -0.091  1.00 0.00 ? 27  THR A HA   3  
ATOM   1735  H  HB   . THR A 1 27 ? -2.355  -0.264  1.105   1.00 0.00 ? 27  THR A HB   3  
ATOM   1736  H  HG1  . THR A 1 27 ? -3.782  -2.189  1.051   1.00 0.00 ? 27  THR A HG1  3  
ATOM   1737  H  HG21 . THR A 1 27 ? -2.915  1.507   2.486   1.00 0.00 ? 27  THR A HG21 3  
ATOM   1738  H  HG22 . THR A 1 27 ? -3.244  0.126   3.530   1.00 0.00 ? 27  THR A HG22 3  
ATOM   1739  H  HG23 . THR A 1 27 ? -4.572  0.947   2.708   1.00 0.00 ? 27  THR A HG23 3  
ATOM   1740  N  N    . GLN A 1 28 ? -5.249  -1.663  -1.035  1.00 0.00 ? 28  GLN A N    3  
ATOM   1741  C  CA   . GLN A 1 28 ? -5.276  -2.683  -2.076  1.00 0.00 ? 28  GLN A CA   3  
ATOM   1742  C  C    . GLN A 1 28 ? -4.912  -2.088  -3.432  1.00 0.00 ? 28  GLN A C    3  
ATOM   1743  O  O    . GLN A 1 28 ? -5.192  -0.924  -3.722  1.00 0.00 ? 28  GLN A O    3  
ATOM   1744  C  CB   . GLN A 1 28 ? -6.659  -3.334  -2.146  1.00 0.00 ? 28  GLN A CB   3  
ATOM   1745  C  CG   . GLN A 1 28 ? -7.743  -2.404  -2.668  1.00 0.00 ? 28  GLN A CG   3  
ATOM   1746  C  CD   . GLN A 1 28 ? -9.083  -3.097  -2.817  1.00 0.00 ? 28  GLN A CD   3  
ATOM   1747  O  OE1  . GLN A 1 28 ? -9.337  -3.773  -3.814  1.00 0.00 ? 28  GLN A OE1  3  
ATOM   1748  N  NE2  . GLN A 1 28 ? -9.950  -2.931  -1.825  1.00 0.00 ? 28  GLN A NE2  3  
ATOM   1749  H  H    . GLN A 1 28 ? -6.032  -1.547  -0.458  1.00 0.00 ? 28  GLN A H    3  
ATOM   1750  H  HA   . GLN A 1 28 ? -4.547  -3.437  -1.821  1.00 0.00 ? 28  GLN A HA   3  
ATOM   1751  H  HB2  . GLN A 1 28 ? -6.607  -4.193  -2.798  1.00 0.00 ? 28  GLN A HB2  3  
ATOM   1752  H  HB3  . GLN A 1 28 ? -6.941  -3.660  -1.156  1.00 0.00 ? 28  GLN A HB3  3  
ATOM   1753  H  HG2  . GLN A 1 28 ? -7.856  -1.581  -1.978  1.00 0.00 ? 28  GLN A HG2  3  
ATOM   1754  H  HG3  . GLN A 1 28 ? -7.440  -2.025  -3.633  1.00 0.00 ? 28  GLN A HG3  3  
ATOM   1755  H  HE21 . GLN A 1 28 ? -9.679  -2.377  -1.062  1.00 0.00 ? 28  GLN A HE21 3  
ATOM   1756  H  HE22 . GLN A 1 28 ? -10.824 -3.366  -1.896  1.00 0.00 ? 28  GLN A HE22 3  
ATOM   1757  N  N    . PRO A 1 29 ? -4.273  -2.903  -4.285  1.00 0.00 ? 29  PRO A N    3  
ATOM   1758  C  CA   . PRO A 1 29 ? -3.935  -4.289  -3.951  1.00 0.00 ? 29  PRO A CA   3  
ATOM   1759  C  C    . PRO A 1 29 ? -2.843  -4.381  -2.891  1.00 0.00 ? 29  PRO A C    3  
ATOM   1760  O  O    . PRO A 1 29 ? -2.746  -5.374  -2.169  1.00 0.00 ? 29  PRO A O    3  
ATOM   1761  C  CB   . PRO A 1 29 ? -3.440  -4.863  -5.281  1.00 0.00 ? 29  PRO A CB   3  
ATOM   1762  C  CG   . PRO A 1 29 ? -2.950  -3.682  -6.044  1.00 0.00 ? 29  PRO A CG   3  
ATOM   1763  C  CD   . PRO A 1 29 ? -3.831  -2.533  -5.640  1.00 0.00 ? 29  PRO A CD   3  
ATOM   1764  H  HA   . PRO A 1 29 ? -4.803  -4.841  -3.620  1.00 0.00 ? 29  PRO A HA   3  
ATOM   1765  H  HB2  . PRO A 1 29 ? -2.645  -5.573  -5.096  1.00 0.00 ? 29  PRO A HB2  3  
ATOM   1766  H  HB3  . PRO A 1 29 ? -4.255  -5.353  -5.792  1.00 0.00 ? 29  PRO A HB3  3  
ATOM   1767  H  HG2  . PRO A 1 29 ? -1.923  -3.476  -5.784  1.00 0.00 ? 29  PRO A HG2  3  
ATOM   1768  H  HG3  . PRO A 1 29 ? -3.040  -3.867  -7.105  1.00 0.00 ? 29  PRO A HG3  3  
ATOM   1769  H  HD2  . PRO A 1 29 ? -3.267  -1.612  -5.624  1.00 0.00 ? 29  PRO A HD2  3  
ATOM   1770  H  HD3  . PRO A 1 29 ? -4.674  -2.450  -6.310  1.00 0.00 ? 29  PRO A HD3  3  
ATOM   1771  N  N    . LEU A 1 30 ? -2.022  -3.340  -2.803  1.00 0.00 ? 30  LEU A N    3  
ATOM   1772  C  CA   . LEU A 1 30 ? -0.936  -3.302  -1.830  1.00 0.00 ? 30  LEU A CA   3  
ATOM   1773  C  C    . LEU A 1 30 ? -1.480  -3.203  -0.409  1.00 0.00 ? 30  LEU A C    3  
ATOM   1774  O  O    . LEU A 1 30 ? -2.690  -3.106  -0.202  1.00 0.00 ? 30  LEU A O    3  
ATOM   1775  C  CB   . LEU A 1 30 ? -0.009  -2.120  -2.117  1.00 0.00 ? 30  LEU A CB   3  
ATOM   1776  C  CG   . LEU A 1 30 ? 1.039   -2.337  -3.209  1.00 0.00 ? 30  LEU A CG   3  
ATOM   1777  C  CD1  . LEU A 1 30 ? 1.756   -1.034  -3.529  1.00 0.00 ? 30  LEU A CD1  3  
ATOM   1778  C  CD2  . LEU A 1 30 ? 2.035   -3.407  -2.788  1.00 0.00 ? 30  LEU A CD2  3  
ATOM   1779  H  H    . LEU A 1 30 ? -2.149  -2.578  -3.406  1.00 0.00 ? 30  LEU A H    3  
ATOM   1780  H  HA   . LEU A 1 30 ? -0.375  -4.220  -1.925  1.00 0.00 ? 30  LEU A HA   3  
ATOM   1781  H  HB2  . LEU A 1 30 ? -0.623  -1.282  -2.410  1.00 0.00 ? 30  LEU A HB2  3  
ATOM   1782  H  HB3  . LEU A 1 30 ? 0.512   -1.879  -1.201  1.00 0.00 ? 30  LEU A HB3  3  
ATOM   1783  H  HG   . LEU A 1 30 ? 0.545   -2.675  -4.110  1.00 0.00 ? 30  LEU A HG   3  
ATOM   1784  H  HD11 . LEU A 1 30 ? 2.260   -1.125  -4.479  1.00 0.00 ? 30  LEU A HD11 3  
ATOM   1785  H  HD12 . LEU A 1 30 ? 2.479   -0.823  -2.755  1.00 0.00 ? 30  LEU A HD12 3  
ATOM   1786  H  HD13 . LEU A 1 30 ? 1.036   -0.230  -3.577  1.00 0.00 ? 30  LEU A HD13 3  
ATOM   1787  H  HD21 . LEU A 1 30 ? 2.181   -3.362  -1.719  1.00 0.00 ? 30  LEU A HD21 3  
ATOM   1788  H  HD22 . LEU A 1 30 ? 2.977   -3.238  -3.287  1.00 0.00 ? 30  LEU A HD22 3  
ATOM   1789  H  HD23 . LEU A 1 30 ? 1.654   -4.381  -3.059  1.00 0.00 ? 30  LEU A HD23 3  
ATOM   1790  N  N    . CYS A 1 31 ? -0.580  -3.226  0.568   1.00 0.00 ? 31  CYS A N    3  
ATOM   1791  C  CA   . CYS A 1 31 ? -0.969  -3.137  1.970   1.00 0.00 ? 31  CYS A CA   3  
ATOM   1792  C  C    . CYS A 1 31 ? -0.632  -1.763  2.541   1.00 0.00 ? 31  CYS A C    3  
ATOM   1793  O  O    . CYS A 1 31 ? -0.072  -0.911  1.850   1.00 0.00 ? 31  CYS A O    3  
ATOM   1794  C  CB   . CYS A 1 31 ? -0.268  -4.226  2.785   1.00 0.00 ? 31  CYS A CB   3  
ATOM   1795  S  SG   . CYS A 1 31 ? 1.479   -3.869  3.156   1.00 0.00 ? 31  CYS A SG   3  
ATOM   1796  H  H    . CYS A 1 31 ? 0.371   -3.306  0.340   1.00 0.00 ? 31  CYS A H    3  
ATOM   1797  H  HA   . CYS A 1 31 ? -2.036  -3.286  2.028   1.00 0.00 ? 31  CYS A HA   3  
ATOM   1798  H  HB2  . CYS A 1 31 ? -0.784  -4.349  3.726   1.00 0.00 ? 31  CYS A HB2  3  
ATOM   1799  H  HB3  . CYS A 1 31 ? -0.305  -5.156  2.237   1.00 0.00 ? 31  CYS A HB3  3  
ATOM   1800  N  N    . HIS A 1 32 ? -0.977  -1.554  3.808   1.00 0.00 ? 32  HIS A N    3  
ATOM   1801  C  CA   . HIS A 1 32 ? -0.712  -0.284  4.474   1.00 0.00 ? 32  HIS A CA   3  
ATOM   1802  C  C    . HIS A 1 32 ? 0.772   0.066   4.403   1.00 0.00 ? 32  HIS A C    3  
ATOM   1803  O  O    . HIS A 1 32 ? 1.141   1.158   3.971   1.00 0.00 ? 32  HIS A O    3  
ATOM   1804  C  CB   . HIS A 1 32 ? -1.165  -0.344  5.933   1.00 0.00 ? 32  HIS A CB   3  
ATOM   1805  C  CG   . HIS A 1 32 ? -1.591  0.982   6.482   1.00 0.00 ? 32  HIS A CG   3  
ATOM   1806  N  ND1  . HIS A 1 32 ? -2.454  1.112   7.550   1.00 0.00 ? 32  HIS A ND1  3  
ATOM   1807  C  CD2  . HIS A 1 32 ? -1.268  2.242   6.106   1.00 0.00 ? 32  HIS A CD2  3  
ATOM   1808  C  CE1  . HIS A 1 32 ? -2.644  2.394   7.807   1.00 0.00 ? 32  HIS A CE1  3  
ATOM   1809  N  NE2  . HIS A 1 32 ? -1.935  3.101   6.945   1.00 0.00 ? 32  HIS A NE2  3  
ATOM   1810  H  H    . HIS A 1 32 ? -1.421  -2.272  4.307   1.00 0.00 ? 32  HIS A H    3  
ATOM   1811  H  HA   . HIS A 1 32 ? -1.274  0.482   3.962   1.00 0.00 ? 32  HIS A HA   3  
ATOM   1812  H  HB2  . HIS A 1 32 ? -2.002  -1.021  6.015   1.00 0.00 ? 32  HIS A HB2  3  
ATOM   1813  H  HB3  . HIS A 1 32 ? -0.350  -0.710  6.541   1.00 0.00 ? 32  HIS A HB3  3  
ATOM   1814  H  HD1  . HIS A 1 32 ? -2.866  0.374   8.046   1.00 0.00 ? 32  HIS A HD1  3  
ATOM   1815  H  HD2  . HIS A 1 32 ? -0.608  2.521   5.297   1.00 0.00 ? 32  HIS A HD2  3  
ATOM   1816  H  HE1  . HIS A 1 32 ? -3.271  2.796   8.588   1.00 0.00 ? 32  HIS A HE1  3  
ATOM   1817  N  N    . GLU A 1 33 ? 1.616   -0.867  4.832   1.00 0.00 ? 33  GLU A N    3  
ATOM   1818  C  CA   . GLU A 1 33 ? 3.059   -0.654  4.818   1.00 0.00 ? 33  GLU A CA   3  
ATOM   1819  C  C    . GLU A 1 33 ? 3.525   -0.173  3.447   1.00 0.00 ? 33  GLU A C    3  
ATOM   1820  O  O    . GLU A 1 33 ? 4.109   0.903   3.320   1.00 0.00 ? 33  GLU A O    3  
ATOM   1821  C  CB   . GLU A 1 33 ? 3.790   -1.945  5.194   1.00 0.00 ? 33  GLU A CB   3  
ATOM   1822  C  CG   . GLU A 1 33 ? 5.298   -1.862  5.024   1.00 0.00 ? 33  GLU A CG   3  
ATOM   1823  C  CD   . GLU A 1 33 ? 5.944   -0.904  6.006   1.00 0.00 ? 33  GLU A CD   3  
ATOM   1824  O  OE1  . GLU A 1 33 ? 5.389   -0.722  7.110   1.00 0.00 ? 33  GLU A OE1  3  
ATOM   1825  O  OE2  . GLU A 1 33 ? 7.005   -0.338  5.670   1.00 0.00 ? 33  GLU A OE2  3  
ATOM   1826  H  H    . GLU A 1 33 ? 1.261   -1.717  5.165   1.00 0.00 ? 33  GLU A H    3  
ATOM   1827  H  HA   . GLU A 1 33 ? 3.289   0.105   5.550   1.00 0.00 ? 33  GLU A HA   3  
ATOM   1828  H  HB2  . GLU A 1 33 ? 3.577   -2.178  6.227   1.00 0.00 ? 33  GLU A HB2  3  
ATOM   1829  H  HB3  . GLU A 1 33 ? 3.423   -2.747  4.571   1.00 0.00 ? 33  GLU A HB3  3  
ATOM   1830  H  HG2  . GLU A 1 33 ? 5.719   -2.845  5.173   1.00 0.00 ? 33  GLU A HG2  3  
ATOM   1831  H  HG3  . GLU A 1 33 ? 5.516   -1.527  4.020   1.00 0.00 ? 33  GLU A HG3  3  
ATOM   1832  N  N    . CYS A 1 34 ? 3.264   -0.980  2.424   1.00 0.00 ? 34  CYS A N    3  
ATOM   1833  C  CA   . CYS A 1 34 ? 3.657   -0.639  1.062   1.00 0.00 ? 34  CYS A CA   3  
ATOM   1834  C  C    . CYS A 1 34 ? 2.972   0.645   0.603   1.00 0.00 ? 34  CYS A C    3  
ATOM   1835  O  O    . CYS A 1 34 ? 3.630   1.648   0.328   1.00 0.00 ? 34  CYS A O    3  
ATOM   1836  C  CB   . CYS A 1 34 ? 3.311   -1.783  0.107   1.00 0.00 ? 34  CYS A CB   3  
ATOM   1837  S  SG   . CYS A 1 34 ? 4.177   -3.344  0.472   1.00 0.00 ? 34  CYS A SG   3  
ATOM   1838  H  H    . CYS A 1 34 ? 2.796   -1.826  2.588   1.00 0.00 ? 34  CYS A H    3  
ATOM   1839  H  HA   . CYS A 1 34 ? 4.725   -0.485  1.053   1.00 0.00 ? 34  CYS A HA   3  
ATOM   1840  H  HB2  . CYS A 1 34 ? 2.249   -1.978  0.160   1.00 0.00 ? 34  CYS A HB2  3  
ATOM   1841  H  HB3  . CYS A 1 34 ? 3.568   -1.492  -0.900  1.00 0.00 ? 34  CYS A HB3  3  
ATOM   1842  N  N    . SER A 1 35 ? 1.646   0.606   0.523   1.00 0.00 ? 35  SER A N    3  
ATOM   1843  C  CA   . SER A 1 35 ? 0.871   1.765   0.095   1.00 0.00 ? 35  SER A CA   3  
ATOM   1844  C  C    . SER A 1 35 ? 1.536   3.061   0.548   1.00 0.00 ? 35  SER A C    3  
ATOM   1845  O  O    . SER A 1 35 ? 1.964   3.871   -0.273  1.00 0.00 ? 35  SER A O    3  
ATOM   1846  C  CB   . SER A 1 35 ? -0.552  1.687   0.651   1.00 0.00 ? 35  SER A CB   3  
ATOM   1847  O  OG   . SER A 1 35 ? -1.167  2.964   0.661   1.00 0.00 ? 35  SER A OG   3  
ATOM   1848  H  H    . SER A 1 35 ? 1.177   -0.223  0.756   1.00 0.00 ? 35  SER A H    3  
ATOM   1849  H  HA   . SER A 1 35 ? 0.828   1.754   -0.984  1.00 0.00 ? 35  SER A HA   3  
ATOM   1850  H  HB2  . SER A 1 35 ? -1.141  1.023   0.037   1.00 0.00 ? 35  SER A HB2  3  
ATOM   1851  H  HB3  . SER A 1 35 ? -0.520  1.308   1.663   1.00 0.00 ? 35  SER A HB3  3  
ATOM   1852  H  HG   . SER A 1 35 ? -1.256  3.270   1.566   1.00 0.00 ? 35  SER A HG   3  
ATOM   1853  N  N    . GLU A 1 36 ? 1.618   3.248   1.862   1.00 0.00 ? 36  GLU A N    3  
ATOM   1854  C  CA   . GLU A 1 36 ? 2.231   4.446   2.424   1.00 0.00 ? 36  GLU A CA   3  
ATOM   1855  C  C    . GLU A 1 36 ? 3.714   4.515   2.074   1.00 0.00 ? 36  GLU A C    3  
ATOM   1856  O  O    . GLU A 1 36 ? 4.226   5.570   1.698   1.00 0.00 ? 36  GLU A O    3  
ATOM   1857  C  CB   . GLU A 1 36 ? 2.053   4.471   3.944   1.00 0.00 ? 36  GLU A CB   3  
ATOM   1858  C  CG   . GLU A 1 36 ? 2.915   3.455   4.674   1.00 0.00 ? 36  GLU A CG   3  
ATOM   1859  C  CD   . GLU A 1 36 ? 2.471   3.236   6.108   1.00 0.00 ? 36  GLU A CD   3  
ATOM   1860  O  OE1  . GLU A 1 36 ? 1.339   2.749   6.309   1.00 0.00 ? 36  GLU A OE1  3  
ATOM   1861  O  OE2  . GLU A 1 36 ? 3.255   3.552   7.027   1.00 0.00 ? 36  GLU A OE2  3  
ATOM   1862  H  H    . GLU A 1 36 ? 1.259   2.566   2.466   1.00 0.00 ? 36  GLU A H    3  
ATOM   1863  H  HA   . GLU A 1 36 ? 1.732   5.304   1.999   1.00 0.00 ? 36  GLU A HA   3  
ATOM   1864  H  HB2  . GLU A 1 36 ? 2.306   5.456   4.308   1.00 0.00 ? 36  GLU A HB2  3  
ATOM   1865  H  HB3  . GLU A 1 36 ? 1.018   4.267   4.176   1.00 0.00 ? 36  GLU A HB3  3  
ATOM   1866  H  HG2  . GLU A 1 36 ? 2.861   2.513   4.149   1.00 0.00 ? 36  GLU A HG2  3  
ATOM   1867  H  HG3  . GLU A 1 36 ? 3.936   3.805   4.679   1.00 0.00 ? 36  GLU A HG3  3  
ATOM   1868  N  N    . ARG A 1 37 ? 4.399   3.383   2.200   1.00 0.00 ? 37  ARG A N    3  
ATOM   1869  C  CA   . ARG A 1 37 ? 5.824   3.315   1.899   1.00 0.00 ? 37  ARG A CA   3  
ATOM   1870  C  C    . ARG A 1 37 ? 6.130   3.990   0.565   1.00 0.00 ? 37  ARG A C    3  
ATOM   1871  O  O    . ARG A 1 37 ? 6.955   4.901   0.494   1.00 0.00 ? 37  ARG A O    3  
ATOM   1872  C  CB   . ARG A 1 37 ? 6.290   1.858   1.865   1.00 0.00 ? 37  ARG A CB   3  
ATOM   1873  C  CG   . ARG A 1 37 ? 7.716   1.687   1.368   1.00 0.00 ? 37  ARG A CG   3  
ATOM   1874  C  CD   . ARG A 1 37 ? 7.906   0.350   0.668   1.00 0.00 ? 37  ARG A CD   3  
ATOM   1875  N  NE   . ARG A 1 37 ? 9.315   0.054   0.425   1.00 0.00 ? 37  ARG A NE   3  
ATOM   1876  C  CZ   . ARG A 1 37 ? 9.740   -0.763  -0.533  1.00 0.00 ? 37  ARG A CZ   3  
ATOM   1877  N  NH1  . ARG A 1 37 ? 8.869   -1.362  -1.333  1.00 0.00 ? 37  ARG A NH1  3  
ATOM   1878  N  NH2  . ARG A 1 37 ? 11.039  -0.982  -0.691  1.00 0.00 ? 37  ARG A NH2  3  
ATOM   1879  H  H    . ARG A 1 37 ? 3.936   2.575   2.504   1.00 0.00 ? 37  ARG A H    3  
ATOM   1880  H  HA   . ARG A 1 37 ? 6.354   3.835   2.682   1.00 0.00 ? 37  ARG A HA   3  
ATOM   1881  H  HB2  . ARG A 1 37 ? 6.229   1.449   2.862   1.00 0.00 ? 37  ARG A HB2  3  
ATOM   1882  H  HB3  . ARG A 1 37 ? 5.636   1.299   1.214   1.00 0.00 ? 37  ARG A HB3  3  
ATOM   1883  H  HG2  . ARG A 1 37 ? 7.943   2.481   0.671   1.00 0.00 ? 37  ARG A HG2  3  
ATOM   1884  H  HG3  . ARG A 1 37 ? 8.390   1.741   2.210   1.00 0.00 ? 37  ARG A HG3  3  
ATOM   1885  H  HD2  . ARG A 1 37 ? 7.486   -0.428  1.287   1.00 0.00 ? 37  ARG A HD2  3  
ATOM   1886  H  HD3  . ARG A 1 37 ? 7.385   0.378   -0.278  1.00 0.00 ? 37  ARG A HD3  3  
ATOM   1887  H  HE   . ARG A 1 37 ? 9.976   0.486   1.004   1.00 0.00 ? 37  ARG A HE   3  
ATOM   1888  H  HH11 . ARG A 1 37 ? 7.889   -1.198  -1.216  1.00 0.00 ? 37  ARG A HH11 3  
ATOM   1889  H  HH12 . ARG A 1 37 ? 9.191   -1.976  -2.053  1.00 0.00 ? 37  ARG A HH12 3  
ATOM   1890  H  HH21 . ARG A 1 37 ? 11.699  -0.532  -0.090  1.00 0.00 ? 37  ARG A HH21 3  
ATOM   1891  H  HH22 . ARG A 1 37 ? 11.358  -1.597  -1.411  1.00 0.00 ? 37  ARG A HH22 3  
ATOM   1892  N  N    . ARG A 1 38 ? 5.461   3.536   -0.490  1.00 0.00 ? 38  ARG A N    3  
ATOM   1893  C  CA   . ARG A 1 38 ? 5.663   4.094   -1.821  1.00 0.00 ? 38  ARG A CA   3  
ATOM   1894  C  C    . ARG A 1 38 ? 5.403   5.598   -1.825  1.00 0.00 ? 38  ARG A C    3  
ATOM   1895  O  O    . ARG A 1 38 ? 6.298   6.391   -2.116  1.00 0.00 ? 38  ARG A O    3  
ATOM   1896  C  CB   . ARG A 1 38 ? 4.745   3.404   -2.832  1.00 0.00 ? 38  ARG A CB   3  
ATOM   1897  C  CG   . ARG A 1 38 ? 5.221   3.527   -4.270  1.00 0.00 ? 38  ARG A CG   3  
ATOM   1898  C  CD   . ARG A 1 38 ? 4.797   2.327   -5.102  1.00 0.00 ? 38  ARG A CD   3  
ATOM   1899  N  NE   . ARG A 1 38 ? 3.427   2.457   -5.592  1.00 0.00 ? 38  ARG A NE   3  
ATOM   1900  C  CZ   . ARG A 1 38 ? 3.104   3.106   -6.705  1.00 0.00 ? 38  ARG A CZ   3  
ATOM   1901  N  NH1  . ARG A 1 38 ? 4.047   3.680   -7.440  1.00 0.00 ? 38  ARG A NH1  3  
ATOM   1902  N  NH2  . ARG A 1 38 ? 1.835   3.181   -7.086  1.00 0.00 ? 38  ARG A NH2  3  
ATOM   1903  H  H    . ARG A 1 38 ? 4.817   2.807   -0.370  1.00 0.00 ? 38  ARG A H    3  
ATOM   1904  H  HA   . ARG A 1 38 ? 6.691   3.918   -2.103  1.00 0.00 ? 38  ARG A HA   3  
ATOM   1905  H  HB2  . ARG A 1 38 ? 4.683   2.354   -2.585  1.00 0.00 ? 38  ARG A HB2  3  
ATOM   1906  H  HB3  . ARG A 1 38 ? 3.761   3.841   -2.762  1.00 0.00 ? 38  ARG A HB3  3  
ATOM   1907  H  HG2  . ARG A 1 38 ? 4.797   4.420   -4.705  1.00 0.00 ? 38  ARG A HG2  3  
ATOM   1908  H  HG3  . ARG A 1 38 ? 6.298   3.597   -4.278  1.00 0.00 ? 38  ARG A HG3  3  
ATOM   1909  H  HD2  . ARG A 1 38 ? 5.464   2.236   -5.946  1.00 0.00 ? 38  ARG A HD2  3  
ATOM   1910  H  HD3  . ARG A 1 38 ? 4.868   1.439   -4.491  1.00 0.00 ? 38  ARG A HD3  3  
ATOM   1911  H  HE   . ARG A 1 38 ? 2.715   2.040   -5.065  1.00 0.00 ? 38  ARG A HE   3  
ATOM   1912  H  HH11 . ARG A 1 38 ? 5.004   3.624   -7.155  1.00 0.00 ? 38  ARG A HH11 3  
ATOM   1913  H  HH12 . ARG A 1 38 ? 3.801   4.167   -8.278  1.00 0.00 ? 38  ARG A HH12 3  
ATOM   1914  H  HH21 . ARG A 1 38 ? 1.122   2.749   -6.536  1.00 0.00 ? 38  ARG A HH21 3  
ATOM   1915  H  HH22 . ARG A 1 38 ? 1.593   3.670   -7.924  1.00 0.00 ? 38  ARG A HH22 3  
ATOM   1916  N  N    . GLN A 1 39 ? 4.172   5.981   -1.501  1.00 0.00 ? 39  GLN A N    3  
ATOM   1917  C  CA   . GLN A 1 39 ? 3.794   7.389   -1.469  1.00 0.00 ? 39  GLN A CA   3  
ATOM   1918  C  C    . GLN A 1 39 ? 4.907   8.237   -0.864  1.00 0.00 ? 39  GLN A C    3  
ATOM   1919  O  O    . GLN A 1 39 ? 5.456   9.122   -1.521  1.00 0.00 ? 39  GLN A O    3  
ATOM   1920  C  CB   . GLN A 1 39 ? 2.503   7.574   -0.670  1.00 0.00 ? 39  GLN A CB   3  
ATOM   1921  C  CG   . GLN A 1 39 ? 1.265   7.058   -1.386  1.00 0.00 ? 39  GLN A CG   3  
ATOM   1922  C  CD   . GLN A 1 39 ? 1.234   7.445   -2.851  1.00 0.00 ? 39  GLN A CD   3  
ATOM   1923  O  OE1  . GLN A 1 39 ? 1.164   6.586   -3.731  1.00 0.00 ? 39  GLN A OE1  3  
ATOM   1924  N  NE2  . GLN A 1 39 ? 1.285   8.744   -3.122  1.00 0.00 ? 39  GLN A NE2  3  
ATOM   1925  H  H    . GLN A 1 39 ? 3.503   5.301   -1.279  1.00 0.00 ? 39  GLN A H    3  
ATOM   1926  H  HA   . GLN A 1 39 ? 3.627   7.710   -2.486  1.00 0.00 ? 39  GLN A HA   3  
ATOM   1927  H  HB2  . GLN A 1 39 ? 2.596   7.048   0.268   1.00 0.00 ? 39  GLN A HB2  3  
ATOM   1928  H  HB3  . GLN A 1 39 ? 2.365   8.627   -0.472  1.00 0.00 ? 39  GLN A HB3  3  
ATOM   1929  H  HG2  . GLN A 1 39 ? 1.247   5.980   -1.314  1.00 0.00 ? 39  GLN A HG2  3  
ATOM   1930  H  HG3  . GLN A 1 39 ? 0.390   7.465   -0.902  1.00 0.00 ? 39  GLN A HG3  3  
ATOM   1931  H  HE21 . GLN A 1 39 ? 1.341   9.371   -2.370  1.00 0.00 ? 39  GLN A HE21 3  
ATOM   1932  H  HE22 . GLN A 1 39 ? 1.268   9.023   -4.060  1.00 0.00 ? 39  GLN A HE22 3  
ATOM   1933  N  N    . LYS A 1 40 ? 5.237   7.962   0.394   1.00 0.00 ? 40  LYS A N    3  
ATOM   1934  C  CA   . LYS A 1 40 ? 6.285   8.699   1.089   1.00 0.00 ? 40  LYS A CA   3  
ATOM   1935  C  C    . LYS A 1 40 ? 7.482   8.937   0.174   1.00 0.00 ? 40  LYS A C    3  
ATOM   1936  O  O    . LYS A 1 40 ? 7.820   10.079  -0.137  1.00 0.00 ? 40  LYS A O    3  
ATOM   1937  C  CB   . LYS A 1 40 ? 6.730   7.936   2.339   1.00 0.00 ? 40  LYS A CB   3  
ATOM   1938  C  CG   . LYS A 1 40 ? 7.299   8.830   3.427   1.00 0.00 ? 40  LYS A CG   3  
ATOM   1939  C  CD   . LYS A 1 40 ? 6.216   9.671   4.081   1.00 0.00 ? 40  LYS A CD   3  
ATOM   1940  C  CE   . LYS A 1 40 ? 6.796   10.917  4.734   1.00 0.00 ? 40  LYS A CE   3  
ATOM   1941  N  NZ   . LYS A 1 40 ? 7.385   10.620  6.069   1.00 0.00 ? 40  LYS A NZ   3  
ATOM   1942  H  H    . LYS A 1 40 ? 4.763   7.244   0.865   1.00 0.00 ? 40  LYS A H    3  
ATOM   1943  H  HA   . LYS A 1 40 ? 5.879   9.654   1.386   1.00 0.00 ? 40  LYS A HA   3  
ATOM   1944  H  HB2  . LYS A 1 40 ? 5.880   7.407   2.745   1.00 0.00 ? 40  LYS A HB2  3  
ATOM   1945  H  HB3  . LYS A 1 40 ? 7.489   7.219   2.058   1.00 0.00 ? 40  LYS A HB3  3  
ATOM   1946  H  HG2  . LYS A 1 40 ? 7.765   8.213   4.181   1.00 0.00 ? 40  LYS A HG2  3  
ATOM   1947  H  HG3  . LYS A 1 40 ? 8.038   9.487   2.990   1.00 0.00 ? 40  LYS A HG3  3  
ATOM   1948  H  HD2  . LYS A 1 40 ? 5.503   9.973   3.328   1.00 0.00 ? 40  LYS A HD2  3  
ATOM   1949  H  HD3  . LYS A 1 40 ? 5.718   9.079   4.835   1.00 0.00 ? 40  LYS A HD3  3  
ATOM   1950  H  HE2  . LYS A 1 40 ? 7.564   11.319  4.092   1.00 0.00 ? 40  LYS A HE2  3  
ATOM   1951  H  HE3  . LYS A 1 40 ? 6.007   11.645  4.852   1.00 0.00 ? 40  LYS A HE3  3  
ATOM   1952  H  HZ1  . LYS A 1 40 ? 6.653   10.677  6.804   1.00 0.00 ? 40  LYS A HZ1  3  
ATOM   1953  H  HZ2  . LYS A 1 40 ? 8.136   11.305  6.288   1.00 0.00 ? 40  LYS A HZ2  3  
ATOM   1954  H  HZ3  . LYS A 1 40 ? 7.793   9.663   6.074   1.00 0.00 ? 40  LYS A HZ3  3  
ATOM   1955  N  N    . ASN A 1 41 ? 8.118   7.852   -0.256  1.00 0.00 ? 41  ASN A N    3  
ATOM   1956  C  CA   . ASN A 1 41 ? 9.276   7.944   -1.138  1.00 0.00 ? 41  ASN A CA   3  
ATOM   1957  C  C    . ASN A 1 41 ? 8.846   8.227   -2.574  1.00 0.00 ? 41  ASN A C    3  
ATOM   1958  O  O    . ASN A 1 41 ? 8.294   7.359   -3.248  1.00 0.00 ? 41  ASN A O    3  
ATOM   1959  C  CB   . ASN A 1 41 ? 10.089  6.649   -1.082  1.00 0.00 ? 41  ASN A CB   3  
ATOM   1960  C  CG   . ASN A 1 41 ? 11.125  6.663   0.025   1.00 0.00 ? 41  ASN A CG   3  
ATOM   1961  O  OD1  . ASN A 1 41 ? 12.289  6.992   -0.204  1.00 0.00 ? 41  ASN A OD1  3  
ATOM   1962  N  ND2  . ASN A 1 41 ? 10.705  6.305   1.232   1.00 0.00 ? 41  ASN A ND2  3  
ATOM   1963  H  H    . ASN A 1 41 ? 7.801   6.969   0.026   1.00 0.00 ? 41  ASN A H    3  
ATOM   1964  H  HA   . ASN A 1 41 ? 9.892   8.760   -0.791  1.00 0.00 ? 41  ASN A HA   3  
ATOM   1965  H  HB2  . ASN A 1 41 ? 9.420   5.818   -0.912  1.00 0.00 ? 41  ASN A HB2  3  
ATOM   1966  H  HB3  . ASN A 1 41 ? 10.597  6.509   -2.025  1.00 0.00 ? 41  ASN A HB3  3  
ATOM   1967  H  HD21 . ASN A 1 41 ? 9.764   6.055   1.340   1.00 0.00 ? 41  ASN A HD21 3  
ATOM   1968  H  HD22 . ASN A 1 41 ? 11.354  6.306   1.967   1.00 0.00 ? 41  ASN A HD22 3  
ATOM   1969  N  N    . GLN A 1 42 ? 9.104   9.447   -3.034  1.00 0.00 ? 42  GLN A N    3  
ATOM   1970  C  CA   . GLN A 1 42 ? 8.744   9.844   -4.390  1.00 0.00 ? 42  GLN A CA   3  
ATOM   1971  C  C    . GLN A 1 42 ? 9.968   9.849   -5.299  1.00 0.00 ? 42  GLN A C    3  
ATOM   1972  O  O    . GLN A 1 42 ? 11.014  10.392  -4.945  1.00 0.00 ? 42  GLN A O    3  
ATOM   1973  C  CB   . GLN A 1 42 ? 8.093   11.228  -4.382  1.00 0.00 ? 42  GLN A CB   3  
ATOM   1974  C  CG   . GLN A 1 42 ? 8.953   12.301  -3.734  1.00 0.00 ? 42  GLN A CG   3  
ATOM   1975  C  CD   . GLN A 1 42 ? 8.554   13.702  -4.154  1.00 0.00 ? 42  GLN A CD   3  
ATOM   1976  O  OE1  . GLN A 1 42 ? 7.544   14.236  -3.695  1.00 0.00 ? 42  GLN A OE1  3  
ATOM   1977  N  NE2  . GLN A 1 42 ? 9.346   14.305  -5.032  1.00 0.00 ? 42  GLN A NE2  3  
ATOM   1978  H  H    . GLN A 1 42 ? 9.547   10.095  -2.448  1.00 0.00 ? 42  GLN A H    3  
ATOM   1979  H  HA   . GLN A 1 42 ? 8.033   9.124   -4.768  1.00 0.00 ? 42  GLN A HA   3  
ATOM   1980  H  HB2  . GLN A 1 42 ? 7.893   11.524  -5.401  1.00 0.00 ? 42  GLN A HB2  3  
ATOM   1981  H  HB3  . GLN A 1 42 ? 7.159   11.171  -3.843  1.00 0.00 ? 42  GLN A HB3  3  
ATOM   1982  H  HG2  . GLN A 1 42 ? 8.855   12.223  -2.661  1.00 0.00 ? 42  GLN A HG2  3  
ATOM   1983  H  HG3  . GLN A 1 42 ? 9.983   12.137  -4.013  1.00 0.00 ? 42  GLN A HG3  3  
ATOM   1984  H  HE21 . GLN A 1 42 ? 10.133  13.818  -5.356  1.00 0.00 ? 42  GLN A HE21 3  
ATOM   1985  H  HE22 . GLN A 1 42 ? 9.112   15.211  -5.321  1.00 0.00 ? 42  GLN A HE22 3  
ATOM   1986  N  N    . ASN A 1 43 ? 9.830   9.241   -6.473  1.00 0.00 ? 43  ASN A N    3  
ATOM   1987  C  CA   . ASN A 1 43 ? 10.926  9.175   -7.433  1.00 0.00 ? 43  ASN A CA   3  
ATOM   1988  C  C    . ASN A 1 43 ? 11.268  10.564  -7.964  1.00 0.00 ? 43  ASN A C    3  
ATOM   1989  O  O    . ASN A 1 43 ? 10.453  11.484  -7.898  1.00 0.00 ? 43  ASN A O    3  
ATOM   1990  C  CB   . ASN A 1 43 ? 10.558  8.249   -8.594  1.00 0.00 ? 43  ASN A CB   3  
ATOM   1991  C  CG   . ASN A 1 43 ? 9.666   8.929   -9.615  1.00 0.00 ? 43  ASN A CG   3  
ATOM   1992  O  OD1  . ASN A 1 43 ? 8.717   9.628   -9.260  1.00 0.00 ? 43  ASN A OD1  3  
ATOM   1993  N  ND2  . ASN A 1 43 ? 9.967   8.725   -10.893 1.00 0.00 ? 43  ASN A ND2  3  
ATOM   1994  H  H    . ASN A 1 43 ? 8.971   8.827   -6.699  1.00 0.00 ? 43  ASN A H    3  
ATOM   1995  H  HA   . ASN A 1 43 ? 11.789  8.774   -6.924  1.00 0.00 ? 43  ASN A HA   3  
ATOM   1996  H  HB2  . ASN A 1 43 ? 11.463  7.930   -9.092  1.00 0.00 ? 43  ASN A HB2  3  
ATOM   1997  H  HB3  . ASN A 1 43 ? 10.040  7.385   -8.208  1.00 0.00 ? 43  ASN A HB3  3  
ATOM   1998  H  HD21 . ASN A 1 43 ? 10.738  8.156   -11.102 1.00 0.00 ? 43  ASN A HD21 3  
ATOM   1999  H  HD22 . ASN A 1 43 ? 9.407   9.153   -11.574 1.00 0.00 ? 43  ASN A HD22 3  
ATOM   2000  N  N    . SER A 1 44 ? 12.480  10.708  -8.490  1.00 0.00 ? 44  SER A N    3  
ATOM   2001  C  CA   . SER A 1 44 ? 12.932  11.985  -9.030  1.00 0.00 ? 44  SER A CA   3  
ATOM   2002  C  C    . SER A 1 44 ? 12.277  12.268  -10.378 1.00 0.00 ? 44  SER A C    3  
ATOM   2003  O  O    . SER A 1 44 ? 11.878  11.349  -11.092 1.00 0.00 ? 44  SER A O    3  
ATOM   2004  C  CB   . SER A 1 44 ? 14.455  11.989  -9.180  1.00 0.00 ? 44  SER A CB   3  
ATOM   2005  O  OG   . SER A 1 44 ? 14.900  10.847  -9.892  1.00 0.00 ? 44  SER A OG   3  
ATOM   2006  H  H    . SER A 1 44 ? 13.085  9.937   -8.514  1.00 0.00 ? 44  SER A H    3  
ATOM   2007  H  HA   . SER A 1 44 ? 12.646  12.759  -8.334  1.00 0.00 ? 44  SER A HA   3  
ATOM   2008  H  HB2  . SER A 1 44 ? 14.759  12.874  -9.717  1.00 0.00 ? 44  SER A HB2  3  
ATOM   2009  H  HB3  . SER A 1 44 ? 14.910  11.988  -8.200  1.00 0.00 ? 44  SER A HB3  3  
ATOM   2010  H  HG   . SER A 1 44 ? 14.868  11.025  -10.835 1.00 0.00 ? 44  SER A HG   3  
ATOM   2011  N  N    . GLY A 1 45 ? 12.168  13.549  -10.719 1.00 0.00 ? 45  GLY A N    3  
ATOM   2012  C  CA   . GLY A 1 45 ? 11.560  13.931  -11.980 1.00 0.00 ? 45  GLY A CA   3  
ATOM   2013  C  C    . GLY A 1 45 ? 12.390  14.947  -12.740 1.00 0.00 ? 45  GLY A C    3  
ATOM   2014  O  O    . GLY A 1 45 ? 13.157  15.714  -12.157 1.00 0.00 ? 45  GLY A O    3  
ATOM   2015  H  H    . GLY A 1 45 ? 12.503  14.239  -10.110 1.00 0.00 ? 45  GLY A H    3  
ATOM   2016  H  HA2  . GLY A 1 45 ? 11.440  13.050  -12.592 1.00 0.00 ? 45  GLY A HA2  3  
ATOM   2017  H  HA3  . GLY A 1 45 ? 10.586  14.356  -11.783 1.00 0.00 ? 45  GLY A HA3  3  
ATOM   2018  N  N    . PRO A 1 46 ? 12.244  14.959  -14.073 1.00 0.00 ? 46  PRO A N    3  
ATOM   2019  C  CA   . PRO A 1 46 ? 12.979  15.882  -14.942 1.00 0.00 ? 46  PRO A CA   3  
ATOM   2020  C  C    . PRO A 1 46 ? 12.515  17.325  -14.779 1.00 0.00 ? 46  PRO A C    3  
ATOM   2021  O  O    . PRO A 1 46 ? 11.323  17.619  -14.876 1.00 0.00 ? 46  PRO A O    3  
ATOM   2022  C  CB   . PRO A 1 46 ? 12.661  15.373  -16.350 1.00 0.00 ? 46  PRO A CB   3  
ATOM   2023  C  CG   . PRO A 1 46 ? 11.353  14.673  -16.213 1.00 0.00 ? 46  PRO A CG   3  
ATOM   2024  C  CD   . PRO A 1 46 ? 11.348  14.073  -14.834 1.00 0.00 ? 46  PRO A CD   3  
ATOM   2025  H  HA   . PRO A 1 46 ? 14.044  15.826  -14.769 1.00 0.00 ? 46  PRO A HA   3  
ATOM   2026  H  HB2  . PRO A 1 46 ? 12.592  16.210  -17.031 1.00 0.00 ? 46  PRO A HB2  3  
ATOM   2027  H  HB3  . PRO A 1 46 ? 13.438  14.699  -16.677 1.00 0.00 ? 46  PRO A HB3  3  
ATOM   2028  H  HG2  . PRO A 1 46 ? 10.545  15.380  -16.318 1.00 0.00 ? 46  PRO A HG2  3  
ATOM   2029  H  HG3  . PRO A 1 46 ? 11.274  13.896  -16.959 1.00 0.00 ? 46  PRO A HG3  3  
ATOM   2030  H  HD2  . PRO A 1 46 ? 10.350  14.086  -14.421 1.00 0.00 ? 46  PRO A HD2  3  
ATOM   2031  H  HD3  . PRO A 1 46 ? 11.734  13.064  -14.860 1.00 0.00 ? 46  PRO A HD3  3  
ATOM   2032  N  N    . SER A 1 47 ? 13.463  18.223  -14.533 1.00 0.00 ? 47  SER A N    3  
ATOM   2033  C  CA   . SER A 1 47 ? 13.151  19.636  -14.354 1.00 0.00 ? 47  SER A CA   3  
ATOM   2034  C  C    . SER A 1 47 ? 12.223  19.840  -13.160 1.00 0.00 ? 47  SER A C    3  
ATOM   2035  O  O    . SER A 1 47 ? 11.277  20.626  -13.222 1.00 0.00 ? 47  SER A O    3  
ATOM   2036  C  CB   . SER A 1 47 ? 12.504  20.201  -15.619 1.00 0.00 ? 47  SER A CB   3  
ATOM   2037  O  OG   . SER A 1 47 ? 13.480  20.494  -16.604 1.00 0.00 ? 47  SER A OG   3  
ATOM   2038  H  H    . SER A 1 47 ? 14.396  17.927  -14.467 1.00 0.00 ? 47  SER A H    3  
ATOM   2039  H  HA   . SER A 1 47 ? 14.077  20.160  -14.168 1.00 0.00 ? 47  SER A HA   3  
ATOM   2040  H  HB2  . SER A 1 47 ? 11.811  19.477  -16.021 1.00 0.00 ? 47  SER A HB2  3  
ATOM   2041  H  HB3  . SER A 1 47 ? 11.973  21.110  -15.374 1.00 0.00 ? 47  SER A HB3  3  
ATOM   2042  H  HG   . SER A 1 47 ? 14.169  19.827  -16.580 1.00 0.00 ? 47  SER A HG   3  
ATOM   2043  N  N    . SER A 1 48 ? 12.500  19.126  -12.074 1.00 0.00 ? 48  SER A N    3  
ATOM   2044  C  CA   . SER A 1 48 ? 11.689  19.225  -10.866 1.00 0.00 ? 48  SER A CA   3  
ATOM   2045  C  C    . SER A 1 48 ? 11.420  20.684  -10.510 1.00 0.00 ? 48  SER A C    3  
ATOM   2046  O  O    . SER A 1 48 ? 10.274  21.088  -10.322 1.00 0.00 ? 48  SER A O    3  
ATOM   2047  C  CB   . SER A 1 48 ? 12.386  18.523  -9.699  1.00 0.00 ? 48  SER A CB   3  
ATOM   2048  O  OG   . SER A 1 48 ? 11.447  18.085  -8.733  1.00 0.00 ? 48  SER A OG   3  
ATOM   2049  H  H    . SER A 1 48 ? 13.268  18.517  -12.086 1.00 0.00 ? 48  SER A H    3  
ATOM   2050  H  HA   . SER A 1 48 ? 10.747  18.734  -11.059 1.00 0.00 ? 48  SER A HA   3  
ATOM   2051  H  HB2  . SER A 1 48 ? 12.929  17.667  -10.070 1.00 0.00 ? 48  SER A HB2  3  
ATOM   2052  H  HB3  . SER A 1 48 ? 13.075  19.210  -9.229  1.00 0.00 ? 48  SER A HB3  3  
ATOM   2053  H  HG   . SER A 1 48 ? 11.473  18.669  -7.972  1.00 0.00 ? 48  SER A HG   3  
ATOM   2054  N  N    . GLY A 1 49 ? 12.489  21.470  -10.418 1.00 0.00 ? 49  GLY A N    3  
ATOM   2055  C  CA   . GLY A 1 49 ? 12.348  22.876  -10.084 1.00 0.00 ? 49  GLY A CA   3  
ATOM   2056  C  C    . GLY A 1 49 ? 11.103  23.494  -10.688 1.00 0.00 ? 49  GLY A C    3  
ATOM   2057  O  O    . GLY A 1 49 ? 10.666  24.543  -10.218 1.00 0.00 ? 49  GLY A O    3  
ATOM   2058  H  H    . GLY A 1 49 ? 13.379  21.093  -10.578 1.00 0.00 ? 49  GLY A H    3  
ATOM   2059  H  HA2  . GLY A 1 49 ? 12.303  22.977  -9.010  1.00 0.00 ? 49  GLY A HA2  3  
ATOM   2060  H  HA3  . GLY A 1 49 ? 13.214  23.409  -10.450 1.00 0.00 ? 49  GLY A HA3  3  
HETATM 2061  ZN ZN   . ZN  B 2 .  ? 2.933   -4.828  1.637   1.00 0.00 ? 201 ZN  A ZN   3  
ATOM   2062  N  N    . GLY A 1 1  ? -19.017 14.662  12.732  1.00 0.00 ? 1   GLY A N    4  
ATOM   2063  C  CA   . GLY A 1 1  ? -20.015 14.413  11.709  1.00 0.00 ? 1   GLY A CA   4  
ATOM   2064  C  C    . GLY A 1 1  ? -19.814 13.079  11.016  1.00 0.00 ? 1   GLY A C    4  
ATOM   2065  O  O    . GLY A 1 1  ? -20.683 12.209  11.067  1.00 0.00 ? 1   GLY A O    4  
ATOM   2066  H  H1   . GLY A 1 1  ? -18.649 15.564  12.846  1.00 0.00 ? 1   GLY A H1   4  
ATOM   2067  H  HA2  . GLY A 1 1  ? -20.993 14.426  12.164  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   2068  H  HA3  . GLY A 1 1  ? -19.961 15.200  10.971  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   2069  N  N    . SER A 1 2  ? -18.666 12.919  10.365  1.00 0.00 ? 2   SER A N    4  
ATOM   2070  C  CA   . SER A 1 2  ? -18.357 11.684  9.655   1.00 0.00 ? 2   SER A CA   4  
ATOM   2071  C  C    . SER A 1 2  ? -17.027 11.103  10.127  1.00 0.00 ? 2   SER A C    4  
ATOM   2072  O  O    . SER A 1 2  ? -16.311 11.724  10.912  1.00 0.00 ? 2   SER A O    4  
ATOM   2073  C  CB   . SER A 1 2  ? -18.309 11.936  8.146   1.00 0.00 ? 2   SER A CB   4  
ATOM   2074  O  OG   . SER A 1 2  ? -17.137 12.646  7.786   1.00 0.00 ? 2   SER A OG   4  
ATOM   2075  H  H    . SER A 1 2  ? -18.013 13.650  10.361  1.00 0.00 ? 2   SER A H    4  
ATOM   2076  H  HA   . SER A 1 2  ? -19.142 10.973  9.867   1.00 0.00 ? 2   SER A HA   4  
ATOM   2077  H  HB2  . SER A 1 2  ? -18.317 10.991  7.625   1.00 0.00 ? 2   SER A HB2  4  
ATOM   2078  H  HB3  . SER A 1 2  ? -19.172 12.517  7.854   1.00 0.00 ? 2   SER A HB3  4  
ATOM   2079  H  HG   . SER A 1 2  ? -16.639 12.866  8.576   1.00 0.00 ? 2   SER A HG   4  
ATOM   2080  N  N    . SER A 1 3  ? -16.705 9.908   9.643   1.00 0.00 ? 3   SER A N    4  
ATOM   2081  C  CA   . SER A 1 3  ? -15.463 9.241   10.018  1.00 0.00 ? 3   SER A CA   4  
ATOM   2082  C  C    . SER A 1 3  ? -14.315 9.683   9.115   1.00 0.00 ? 3   SER A C    4  
ATOM   2083  O  O    . SER A 1 3  ? -13.240 10.046  9.592   1.00 0.00 ? 3   SER A O    4  
ATOM   2084  C  CB   . SER A 1 3  ? -15.632 7.723   9.941   1.00 0.00 ? 3   SER A CB   4  
ATOM   2085  O  OG   . SER A 1 3  ? -14.616 7.059   10.672  1.00 0.00 ? 3   SER A OG   4  
ATOM   2086  H  H    . SER A 1 3  ? -17.317 9.464   9.020   1.00 0.00 ? 3   SER A H    4  
ATOM   2087  H  HA   . SER A 1 3  ? -15.233 9.518   11.035  1.00 0.00 ? 3   SER A HA   4  
ATOM   2088  H  HB2  . SER A 1 3  ? -16.592 7.449   10.351  1.00 0.00 ? 3   SER A HB2  4  
ATOM   2089  H  HB3  . SER A 1 3  ? -15.580 7.410   8.908   1.00 0.00 ? 3   SER A HB3  4  
ATOM   2090  H  HG   . SER A 1 3  ? -14.317 7.622   11.389  1.00 0.00 ? 3   SER A HG   4  
ATOM   2091  N  N    . GLY A 1 4  ? -14.552 9.649   7.807   1.00 0.00 ? 4   GLY A N    4  
ATOM   2092  C  CA   . GLY A 1 4  ? -13.529 10.048  6.858   1.00 0.00 ? 4   GLY A CA   4  
ATOM   2093  C  C    . GLY A 1 4  ? -13.048 8.891   6.005   1.00 0.00 ? 4   GLY A C    4  
ATOM   2094  O  O    . GLY A 1 4  ? -13.825 8.295   5.259   1.00 0.00 ? 4   GLY A O    4  
ATOM   2095  H  H    . GLY A 1 4  ? -15.428 9.351   7.484   1.00 0.00 ? 4   GLY A H    4  
ATOM   2096  H  HA2  . GLY A 1 4  ? -13.932 10.814  6.212   1.00 0.00 ? 4   GLY A HA2  4  
ATOM   2097  H  HA3  . GLY A 1 4  ? -12.689 10.454  7.401   1.00 0.00 ? 4   GLY A HA3  4  
ATOM   2098  N  N    . SER A 1 5  ? -11.761 8.574   6.112   1.00 0.00 ? 5   SER A N    4  
ATOM   2099  C  CA   . SER A 1 5  ? -11.175 7.484   5.340   1.00 0.00 ? 5   SER A CA   4  
ATOM   2100  C  C    . SER A 1 5  ? -10.663 6.381   6.261   1.00 0.00 ? 5   SER A C    4  
ATOM   2101  O  O    . SER A 1 5  ? -9.806  6.616   7.113   1.00 0.00 ? 5   SER A O    4  
ATOM   2102  C  CB   . SER A 1 5  ? -10.033 8.007   4.467   1.00 0.00 ? 5   SER A CB   4  
ATOM   2103  O  OG   . SER A 1 5  ? -8.861  8.222   5.234   1.00 0.00 ? 5   SER A OG   4  
ATOM   2104  H  H    . SER A 1 5  ? -11.192 9.087   6.724   1.00 0.00 ? 5   SER A H    4  
ATOM   2105  H  HA   . SER A 1 5  ? -11.947 7.077   4.704   1.00 0.00 ? 5   SER A HA   4  
ATOM   2106  H  HB2  . SER A 1 5  ? -9.816  7.285   3.694   1.00 0.00 ? 5   SER A HB2  4  
ATOM   2107  H  HB3  . SER A 1 5  ? -10.330 8.942   4.013   1.00 0.00 ? 5   SER A HB3  4  
ATOM   2108  H  HG   . SER A 1 5  ? -8.115  7.799   4.804   1.00 0.00 ? 5   SER A HG   4  
ATOM   2109  N  N    . SER A 1 6  ? -11.194 5.176   6.082   1.00 0.00 ? 6   SER A N    4  
ATOM   2110  C  CA   . SER A 1 6  ? -10.794 4.035   6.898   1.00 0.00 ? 6   SER A CA   4  
ATOM   2111  C  C    . SER A 1 6  ? -10.952 2.730   6.123   1.00 0.00 ? 6   SER A C    4  
ATOM   2112  O  O    . SER A 1 6  ? -12.052 2.374   5.704   1.00 0.00 ? 6   SER A O    4  
ATOM   2113  C  CB   . SER A 1 6  ? -11.625 3.983   8.182   1.00 0.00 ? 6   SER A CB   4  
ATOM   2114  O  OG   . SER A 1 6  ? -12.963 3.605   7.908   1.00 0.00 ? 6   SER A OG   4  
ATOM   2115  H  H    . SER A 1 6  ? -11.873 5.051   5.386   1.00 0.00 ? 6   SER A H    4  
ATOM   2116  H  HA   . SER A 1 6  ? -9.754  4.162   7.158   1.00 0.00 ? 6   SER A HA   4  
ATOM   2117  H  HB2  . SER A 1 6  ? -11.192 3.263   8.859   1.00 0.00 ? 6   SER A HB2  4  
ATOM   2118  H  HB3  . SER A 1 6  ? -11.627 4.959   8.646   1.00 0.00 ? 6   SER A HB3  4  
ATOM   2119  H  HG   . SER A 1 6  ? -13.328 3.146   8.668   1.00 0.00 ? 6   SER A HG   4  
ATOM   2120  N  N    . GLY A 1 7  ? -9.842  2.022   5.937   1.00 0.00 ? 7   GLY A N    4  
ATOM   2121  C  CA   . GLY A 1 7  ? -9.878  0.765   5.213   1.00 0.00 ? 7   GLY A CA   4  
ATOM   2122  C  C    . GLY A 1 7  ? -10.089 -0.425  6.127   1.00 0.00 ? 7   GLY A C    4  
ATOM   2123  O  O    . GLY A 1 7  ? -10.567 -0.275  7.252   1.00 0.00 ? 7   GLY A O    4  
ATOM   2124  H  H    . GLY A 1 7  ? -8.993  2.356   6.294   1.00 0.00 ? 7   GLY A H    4  
ATOM   2125  H  HA2  . GLY A 1 7  ? -10.681 0.799   4.492   1.00 0.00 ? 7   GLY A HA2  4  
ATOM   2126  H  HA3  . GLY A 1 7  ? -8.942  0.639   4.688   1.00 0.00 ? 7   GLY A HA3  4  
ATOM   2127  N  N    . SER A 1 8  ? -9.733  -1.611  5.644   1.00 0.00 ? 8   SER A N    4  
ATOM   2128  C  CA   . SER A 1 8  ? -9.892  -2.833  6.425   1.00 0.00 ? 8   SER A CA   4  
ATOM   2129  C  C    . SER A 1 8  ? -8.954  -3.925  5.920   1.00 0.00 ? 8   SER A C    4  
ATOM   2130  O  O    . SER A 1 8  ? -8.987  -4.295  4.746   1.00 0.00 ? 8   SER A O    4  
ATOM   2131  C  CB   . SER A 1 8  ? -11.341 -3.320  6.360   1.00 0.00 ? 8   SER A CB   4  
ATOM   2132  O  OG   . SER A 1 8  ? -11.557 -4.399  7.253   1.00 0.00 ? 8   SER A OG   4  
ATOM   2133  H  H    . SER A 1 8  ? -9.358  -1.666  4.741   1.00 0.00 ? 8   SER A H    4  
ATOM   2134  H  HA   . SER A 1 8  ? -9.643  -2.606  7.450   1.00 0.00 ? 8   SER A HA   4  
ATOM   2135  H  HB2  . SER A 1 8  ? -12.003 -2.510  6.627   1.00 0.00 ? 8   SER A HB2  4  
ATOM   2136  H  HB3  . SER A 1 8  ? -11.563 -3.650  5.355   1.00 0.00 ? 8   SER A HB3  4  
ATOM   2137  H  HG   . SER A 1 8  ? -12.075 -5.078  6.816   1.00 0.00 ? 8   SER A HG   4  
ATOM   2138  N  N    . LEU A 1 9  ? -8.118  -4.438  6.816   1.00 0.00 ? 9   LEU A N    4  
ATOM   2139  C  CA   . LEU A 1 9  ? -7.169  -5.489  6.464   1.00 0.00 ? 9   LEU A CA   4  
ATOM   2140  C  C    . LEU A 1 9  ? -7.896  -6.739  5.979   1.00 0.00 ? 9   LEU A C    4  
ATOM   2141  O  O    . LEU A 1 9  ? -8.503  -7.461  6.769   1.00 0.00 ? 9   LEU A O    4  
ATOM   2142  C  CB   . LEU A 1 9  ? -6.287  -5.831  7.666   1.00 0.00 ? 9   LEU A CB   4  
ATOM   2143  C  CG   . LEU A 1 9  ? -5.071  -4.931  7.885   1.00 0.00 ? 9   LEU A CG   4  
ATOM   2144  C  CD1  . LEU A 1 9  ? -4.560  -5.062  9.311   1.00 0.00 ? 9   LEU A CD1  4  
ATOM   2145  C  CD2  . LEU A 1 9  ? -3.971  -5.270  6.889   1.00 0.00 ? 9   LEU A CD2  4  
ATOM   2146  H  H    . LEU A 1 9  ? -8.138  -4.103  7.737   1.00 0.00 ? 9   LEU A H    4  
ATOM   2147  H  HA   . LEU A 1 9  ? -6.545  -5.117  5.665   1.00 0.00 ? 9   LEU A HA   4  
ATOM   2148  H  HB2  . LEU A 1 9  ? -6.902  -5.778  8.552   1.00 0.00 ? 9   LEU A HB2  4  
ATOM   2149  H  HB3  . LEU A 1 9  ? -5.932  -6.844  7.537   1.00 0.00 ? 9   LEU A HB3  4  
ATOM   2150  H  HG   . LEU A 1 9  ? -5.360  -3.901  7.728   1.00 0.00 ? 9   LEU A HG   4  
ATOM   2151  H  HD11 . LEU A 1 9  ? -5.375  -5.340  9.962   1.00 0.00 ? 9   LEU A HD11 4  
ATOM   2152  H  HD12 . LEU A 1 9  ? -4.148  -4.117  9.634   1.00 0.00 ? 9   LEU A HD12 4  
ATOM   2153  H  HD13 . LEU A 1 9  ? -3.792  -5.821  9.350   1.00 0.00 ? 9   LEU A HD13 4  
ATOM   2154  H  HD21 . LEU A 1 9  ? -3.468  -4.364  6.586   1.00 0.00 ? 9   LEU A HD21 4  
ATOM   2155  H  HD22 . LEU A 1 9  ? -4.405  -5.749  6.024   1.00 0.00 ? 9   LEU A HD22 4  
ATOM   2156  H  HD23 . LEU A 1 9  ? -3.260  -5.939  7.352   1.00 0.00 ? 9   LEU A HD23 4  
ATOM   2157  N  N    . MET A 1 10 ? -7.828  -6.989  4.675   1.00 0.00 ? 10  MET A N    4  
ATOM   2158  C  CA   . MET A 1 10 ? -8.477  -8.154  4.086   1.00 0.00 ? 10  MET A CA   4  
ATOM   2159  C  C    . MET A 1 10 ? -7.718  -9.431  4.431   1.00 0.00 ? 10  MET A C    4  
ATOM   2160  O  O    . MET A 1 10 ? -6.589  -9.381  4.920   1.00 0.00 ? 10  MET A O    4  
ATOM   2161  C  CB   . MET A 1 10 ? -8.572  -7.997  2.567   1.00 0.00 ? 10  MET A CB   4  
ATOM   2162  C  CG   . MET A 1 10 ? -9.848  -7.312  2.106   1.00 0.00 ? 10  MET A CG   4  
ATOM   2163  S  SD   . MET A 1 10 ? -11.279 -8.409  2.148   1.00 0.00 ? 10  MET A SD   4  
ATOM   2164  C  CE   . MET A 1 10 ? -12.078 -7.983  0.603   1.00 0.00 ? 10  MET A CE   4  
ATOM   2165  H  H    . MET A 1 10 ? -7.328  -6.376  4.096   1.00 0.00 ? 10  MET A H    4  
ATOM   2166  H  HA   . MET A 1 10 ? -9.473  -8.220  4.495   1.00 0.00 ? 10  MET A HA   4  
ATOM   2167  H  HB2  . MET A 1 10 ? -7.731  -7.414  2.224   1.00 0.00 ? 10  MET A HB2  4  
ATOM   2168  H  HB3  . MET A 1 10 ? -8.530  -8.976  2.113   1.00 0.00 ? 10  MET A HB3  4  
ATOM   2169  H  HG2  . MET A 1 10 ? -10.041 -6.468  2.750   1.00 0.00 ? 10  MET A HG2  4  
ATOM   2170  H  HG3  . MET A 1 10 ? -9.707  -6.965  1.093   1.00 0.00 ? 10  MET A HG3  4  
ATOM   2171  H  HE1  . MET A 1 10 ? -11.617 -7.096  0.192   1.00 0.00 ? 10  MET A HE1  4  
ATOM   2172  H  HE2  . MET A 1 10 ? -11.971 -8.800  -0.095  1.00 0.00 ? 10  MET A HE2  4  
ATOM   2173  H  HE3  . MET A 1 10 ? -13.127 -7.795  0.780   1.00 0.00 ? 10  MET A HE3  4  
ATOM   2174  N  N    . ASP A 1 11 ? -8.344  -10.574 4.172   1.00 0.00 ? 11  ASP A N    4  
ATOM   2175  C  CA   . ASP A 1 11 ? -7.727  -11.865 4.455   1.00 0.00 ? 11  ASP A CA   4  
ATOM   2176  C  C    . ASP A 1 11 ? -6.781  -12.273 3.329   1.00 0.00 ? 11  ASP A C    4  
ATOM   2177  O  O    . ASP A 1 11 ? -6.344  -13.421 3.257   1.00 0.00 ? 11  ASP A O    4  
ATOM   2178  C  CB   . ASP A 1 11 ? -8.801  -12.936 4.648   1.00 0.00 ? 11  ASP A CB   4  
ATOM   2179  C  CG   . ASP A 1 11 ? -9.811  -12.954 3.518   1.00 0.00 ? 11  ASP A CG   4  
ATOM   2180  O  OD1  . ASP A 1 11 ? -10.520 -11.942 3.341   1.00 0.00 ? 11  ASP A OD1  4  
ATOM   2181  O  OD2  . ASP A 1 11 ? -9.893  -13.981 2.811   1.00 0.00 ? 11  ASP A OD2  4  
ATOM   2182  H  H    . ASP A 1 11 ? -9.243  -10.549 3.782   1.00 0.00 ? 11  ASP A H    4  
ATOM   2183  H  HA   . ASP A 1 11 ? -7.159  -11.768 5.368   1.00 0.00 ? 11  ASP A HA   4  
ATOM   2184  H  HB2  . ASP A 1 11 ? -8.328  -13.906 4.699   1.00 0.00 ? 11  ASP A HB2  4  
ATOM   2185  H  HB3  . ASP A 1 11 ? -9.325  -12.748 5.574   1.00 0.00 ? 11  ASP A HB3  4  
ATOM   2186  N  N    . VAL A 1 12 ? -6.470  -11.324 2.452   1.00 0.00 ? 12  VAL A N    4  
ATOM   2187  C  CA   . VAL A 1 12 ? -5.576  -11.584 1.330   1.00 0.00 ? 12  VAL A CA   4  
ATOM   2188  C  C    . VAL A 1 12 ? -4.188  -11.009 1.588   1.00 0.00 ? 12  VAL A C    4  
ATOM   2189  O  O    . VAL A 1 12 ? -4.049  -9.878  2.056   1.00 0.00 ? 12  VAL A O    4  
ATOM   2190  C  CB   . VAL A 1 12 ? -6.130  -10.991 0.021   1.00 0.00 ? 12  VAL A CB   4  
ATOM   2191  C  CG1  . VAL A 1 12 ? -5.232  -11.352 -1.152  1.00 0.00 ? 12  VAL A CG1  4  
ATOM   2192  C  CG2  . VAL A 1 12 ? -7.554  -11.470 -0.219  1.00 0.00 ? 12  VAL A CG2  4  
ATOM   2193  H  H    . VAL A 1 12 ? -6.849  -10.428 2.562   1.00 0.00 ? 12  VAL A H    4  
ATOM   2194  H  HA   . VAL A 1 12 ? -5.494  -12.655 1.209   1.00 0.00 ? 12  VAL A HA   4  
ATOM   2195  H  HB   . VAL A 1 12 ? -6.146  -9.915  0.116   1.00 0.00 ? 12  VAL A HB   4  
ATOM   2196  H  HG11 . VAL A 1 12 ? -4.302  -11.756 -0.781  1.00 0.00 ? 12  VAL A HG11 4  
ATOM   2197  H  HG12 . VAL A 1 12 ? -5.725  -12.089 -1.770  1.00 0.00 ? 12  VAL A HG12 4  
ATOM   2198  H  HG13 . VAL A 1 12 ? -5.031  -10.467 -1.737  1.00 0.00 ? 12  VAL A HG13 4  
ATOM   2199  H  HG21 . VAL A 1 12 ? -8.233  -10.913 0.409   1.00 0.00 ? 12  VAL A HG21 4  
ATOM   2200  H  HG22 . VAL A 1 12 ? -7.814  -11.317 -1.256  1.00 0.00 ? 12  VAL A HG22 4  
ATOM   2201  H  HG23 . VAL A 1 12 ? -7.626  -12.522 0.018   1.00 0.00 ? 12  VAL A HG23 4  
ATOM   2202  N  N    . LYS A 1 13 ? -3.161  -11.794 1.279   1.00 0.00 ? 13  LYS A N    4  
ATOM   2203  C  CA   . LYS A 1 13 ? -1.782  -11.363 1.476   1.00 0.00 ? 13  LYS A CA   4  
ATOM   2204  C  C    . LYS A 1 13 ? -1.446  -10.185 0.567   1.00 0.00 ? 13  LYS A C    4  
ATOM   2205  O  O    . LYS A 1 13 ? -1.990  -10.058 -0.530  1.00 0.00 ? 13  LYS A O    4  
ATOM   2206  C  CB   . LYS A 1 13 ? -0.820  -12.522 1.202   1.00 0.00 ? 13  LYS A CB   4  
ATOM   2207  C  CG   . LYS A 1 13 ? -0.532  -13.374 2.426   1.00 0.00 ? 13  LYS A CG   4  
ATOM   2208  C  CD   . LYS A 1 13 ? -1.570  -14.471 2.599   1.00 0.00 ? 13  LYS A CD   4  
ATOM   2209  C  CE   . LYS A 1 13 ? -1.353  -15.604 1.608   1.00 0.00 ? 13  LYS A CE   4  
ATOM   2210  N  NZ   . LYS A 1 13 ? -2.271  -16.748 1.864   1.00 0.00 ? 13  LYS A NZ   4  
ATOM   2211  H  H    . LYS A 1 13 ? -3.335  -12.685 0.910   1.00 0.00 ? 13  LYS A H    4  
ATOM   2212  H  HA   . LYS A 1 13 ? -1.675  -11.052 2.504   1.00 0.00 ? 13  LYS A HA   4  
ATOM   2213  H  HB2  . LYS A 1 13 ? -1.247  -13.156 0.440   1.00 0.00 ? 13  LYS A HB2  4  
ATOM   2214  H  HB3  . LYS A 1 13 ? 0.115   -12.120 0.842   1.00 0.00 ? 13  LYS A HB3  4  
ATOM   2215  H  HG2  . LYS A 1 13 ? 0.441   -13.829 2.316   1.00 0.00 ? 13  LYS A HG2  4  
ATOM   2216  H  HG3  . LYS A 1 13 ? -0.540  -12.743 3.303   1.00 0.00 ? 13  LYS A HG3  4  
ATOM   2217  H  HD2  . LYS A 1 13 ? -1.500  -14.866 3.601   1.00 0.00 ? 13  LYS A HD2  4  
ATOM   2218  H  HD3  . LYS A 1 13 ? -2.554  -14.051 2.443   1.00 0.00 ? 13  LYS A HD3  4  
ATOM   2219  H  HE2  . LYS A 1 13 ? -1.526  -15.231 0.610   1.00 0.00 ? 13  LYS A HE2  4  
ATOM   2220  H  HE3  . LYS A 1 13 ? -0.332  -15.947 1.691   1.00 0.00 ? 13  LYS A HE3  4  
ATOM   2221  H  HZ1  . LYS A 1 13 ? -3.074  -16.438 2.447   1.00 0.00 ? 13  LYS A HZ1  4  
ATOM   2222  H  HZ2  . LYS A 1 13 ? -1.765  -17.507 2.364   1.00 0.00 ? 13  LYS A HZ2  4  
ATOM   2223  H  HZ3  . LYS A 1 13 ? -2.634  -17.124 0.965   1.00 0.00 ? 13  LYS A HZ3  4  
ATOM   2224  N  N    . CYS A 1 14 ? -0.545  -9.325  1.031   1.00 0.00 ? 14  CYS A N    4  
ATOM   2225  C  CA   . CYS A 1 14 ? -0.134  -8.157  0.260   1.00 0.00 ? 14  CYS A CA   4  
ATOM   2226  C  C    . CYS A 1 14 ? 0.330   -8.562  -1.136  1.00 0.00 ? 14  CYS A C    4  
ATOM   2227  O  O    . CYS A 1 14 ? 0.995   -9.583  -1.307  1.00 0.00 ? 14  CYS A O    4  
ATOM   2228  C  CB   . CYS A 1 14 ? 0.986   -7.410  0.985   1.00 0.00 ? 14  CYS A CB   4  
ATOM   2229  S  SG   . CYS A 1 14 ? 1.789   -6.117  -0.017  1.00 0.00 ? 14  CYS A SG   4  
ATOM   2230  H  H    . CYS A 1 14 ? -0.146  -9.479  1.913   1.00 0.00 ? 14  CYS A H    4  
ATOM   2231  H  HA   . CYS A 1 14 ? -0.989  -7.504  0.167   1.00 0.00 ? 14  CYS A HA   4  
ATOM   2232  H  HB2  . CYS A 1 14 ? 0.581   -6.935  1.867   1.00 0.00 ? 14  CYS A HB2  4  
ATOM   2233  H  HB3  . CYS A 1 14 ? 1.747   -8.117  1.281   1.00 0.00 ? 14  CYS A HB3  4  
ATOM   2234  N  N    . GLU A 1 15 ? -0.027  -7.754  -2.130  1.00 0.00 ? 15  GLU A N    4  
ATOM   2235  C  CA   . GLU A 1 15 ? 0.353   -8.029  -3.510  1.00 0.00 ? 15  GLU A CA   4  
ATOM   2236  C  C    . GLU A 1 15 ? 1.753   -8.633  -3.580  1.00 0.00 ? 15  GLU A C    4  
ATOM   2237  O  O    . GLU A 1 15 ? 1.940   -9.741  -4.084  1.00 0.00 ? 15  GLU A O    4  
ATOM   2238  C  CB   . GLU A 1 15 ? 0.297   -6.747  -4.343  1.00 0.00 ? 15  GLU A CB   4  
ATOM   2239  C  CG   . GLU A 1 15 ? 0.550   -6.971  -5.824  1.00 0.00 ? 15  GLU A CG   4  
ATOM   2240  C  CD   . GLU A 1 15 ? -0.193  -8.176  -6.367  1.00 0.00 ? 15  GLU A CD   4  
ATOM   2241  O  OE1  . GLU A 1 15 ? -1.434  -8.218  -6.234  1.00 0.00 ? 15  GLU A OE1  4  
ATOM   2242  O  OE2  . GLU A 1 15 ? 0.467   -9.077  -6.926  1.00 0.00 ? 15  GLU A OE2  4  
ATOM   2243  H  H    . GLU A 1 15 ? -0.558  -6.955  -1.930  1.00 0.00 ? 15  GLU A H    4  
ATOM   2244  H  HA   . GLU A 1 15 ? -0.353  -8.740  -3.913  1.00 0.00 ? 15  GLU A HA   4  
ATOM   2245  H  HB2  . GLU A 1 15 ? -0.680  -6.300  -4.229  1.00 0.00 ? 15  GLU A HB2  4  
ATOM   2246  H  HB3  . GLU A 1 15 ? 1.043   -6.059  -3.972  1.00 0.00 ? 15  GLU A HB3  4  
ATOM   2247  H  HG2  . GLU A 1 15 ? 0.230   -6.095  -6.368  1.00 0.00 ? 15  GLU A HG2  4  
ATOM   2248  H  HG3  . GLU A 1 15 ? 1.609   -7.121  -5.977  1.00 0.00 ? 15  GLU A HG3  4  
ATOM   2249  N  N    . THR A 1 16 ? 2.735   -7.896  -3.070  1.00 0.00 ? 16  THR A N    4  
ATOM   2250  C  CA   . THR A 1 16 ? 4.117   -8.357  -3.075  1.00 0.00 ? 16  THR A CA   4  
ATOM   2251  C  C    . THR A 1 16 ? 4.234   -9.753  -2.473  1.00 0.00 ? 16  THR A C    4  
ATOM   2252  O  O    . THR A 1 16 ? 3.810   -10.006 -1.346  1.00 0.00 ? 16  THR A O    4  
ATOM   2253  C  CB   . THR A 1 16 ? 5.033   -7.395  -2.294  1.00 0.00 ? 16  THR A CB   4  
ATOM   2254  O  OG1  . THR A 1 16 ? 5.089   -6.126  -2.955  1.00 0.00 ? 16  THR A OG1  4  
ATOM   2255  C  CG2  . THR A 1 16 ? 6.436   -7.968  -2.165  1.00 0.00 ? 16  THR A CG2  4  
ATOM   2256  H  H    . THR A 1 16 ? 2.523   -7.022  -2.682  1.00 0.00 ? 16  THR A H    4  
ATOM   2257  H  HA   . THR A 1 16 ? 4.455   -8.388  -4.101  1.00 0.00 ? 16  THR A HA   4  
ATOM   2258  H  HB   . THR A 1 16 ? 4.624   -7.259  -1.303  1.00 0.00 ? 16  THR A HB   4  
ATOM   2259  H  HG1  . THR A 1 16 ? 4.574   -5.484  -2.460  1.00 0.00 ? 16  THR A HG1  4  
ATOM   2260  H  HG21 . THR A 1 16 ? 7.161   -7.186  -2.333  1.00 0.00 ? 16  THR A HG21 4  
ATOM   2261  H  HG22 . THR A 1 16 ? 6.574   -8.750  -2.898  1.00 0.00 ? 16  THR A HG22 4  
ATOM   2262  H  HG23 . THR A 1 16 ? 6.569   -8.376  -1.174  1.00 0.00 ? 16  THR A HG23 4  
ATOM   2263  N  N    . PRO A 1 17 ? 4.824   -10.681 -3.241  1.00 0.00 ? 17  PRO A N    4  
ATOM   2264  C  CA   . PRO A 1 17 ? 5.011   -12.068 -2.803  1.00 0.00 ? 17  PRO A CA   4  
ATOM   2265  C  C    . PRO A 1 17 ? 6.047   -12.189 -1.691  1.00 0.00 ? 17  PRO A C    4  
ATOM   2266  O  O    . PRO A 1 17 ? 6.335   -13.287 -1.216  1.00 0.00 ? 17  PRO A O    4  
ATOM   2267  C  CB   . PRO A 1 17 ? 5.500   -12.776 -4.069  1.00 0.00 ? 17  PRO A CB   4  
ATOM   2268  C  CG   . PRO A 1 17 ? 6.133   -11.702 -4.884  1.00 0.00 ? 17  PRO A CG   4  
ATOM   2269  C  CD   . PRO A 1 17 ? 5.353   -10.449 -4.596  1.00 0.00 ? 17  PRO A CD   4  
ATOM   2270  H  HA   . PRO A 1 17 ? 4.081   -12.510 -2.478  1.00 0.00 ? 17  PRO A HA   4  
ATOM   2271  H  HB2  . PRO A 1 17 ? 6.214   -13.543 -3.802  1.00 0.00 ? 17  PRO A HB2  4  
ATOM   2272  H  HB3  . PRO A 1 17 ? 4.662   -13.220 -4.584  1.00 0.00 ? 17  PRO A HB3  4  
ATOM   2273  H  HG2  . PRO A 1 17 ? 7.164   -11.577 -4.591  1.00 0.00 ? 17  PRO A HG2  4  
ATOM   2274  H  HG3  . PRO A 1 17 ? 6.067   -11.950 -5.933  1.00 0.00 ? 17  PRO A HG3  4  
ATOM   2275  H  HD2  . PRO A 1 17 ? 6.003   -9.587  -4.613  1.00 0.00 ? 17  PRO A HD2  4  
ATOM   2276  H  HD3  . PRO A 1 17 ? 4.549   -10.332 -5.308  1.00 0.00 ? 17  PRO A HD3  4  
ATOM   2277  N  N    . ASN A 1 18 ? 6.603   -11.054 -1.280  1.00 0.00 ? 18  ASN A N    4  
ATOM   2278  C  CA   . ASN A 1 18 ? 7.607   -11.034 -0.223  1.00 0.00 ? 18  ASN A CA   4  
ATOM   2279  C  C    . ASN A 1 18 ? 7.091   -10.289 1.004   1.00 0.00 ? 18  ASN A C    4  
ATOM   2280  O  O    . ASN A 1 18 ? 7.777   -10.196 2.023   1.00 0.00 ? 18  ASN A O    4  
ATOM   2281  C  CB   . ASN A 1 18 ? 8.895   -10.380 -0.726  1.00 0.00 ? 18  ASN A CB   4  
ATOM   2282  C  CG   . ASN A 1 18 ? 9.630   -11.247 -1.731  1.00 0.00 ? 18  ASN A CG   4  
ATOM   2283  O  OD1  . ASN A 1 18 ? 9.605   -10.980 -2.933  1.00 0.00 ? 18  ASN A OD1  4  
ATOM   2284  N  ND2  . ASN A 1 18 ? 10.287  -12.292 -1.242  1.00 0.00 ? 18  ASN A ND2  4  
ATOM   2285  H  H    . ASN A 1 18 ? 6.332   -10.210 -1.698  1.00 0.00 ? 18  ASN A H    4  
ATOM   2286  H  HA   . ASN A 1 18 ? 7.818   -12.057 0.054   1.00 0.00 ? 18  ASN A HA   4  
ATOM   2287  H  HB2  . ASN A 1 18 ? 8.653   -9.440  -1.201  1.00 0.00 ? 18  ASN A HB2  4  
ATOM   2288  H  HB3  . ASN A 1 18 ? 9.551   -10.197 0.111   1.00 0.00 ? 18  ASN A HB3  4  
ATOM   2289  H  HD21 . ASN A 1 18 ? 10.263  -12.443 -0.274  1.00 0.00 ? 18  ASN A HD21 4  
ATOM   2290  H  HD22 . ASN A 1 18 ? 10.771  -12.868 -1.869  1.00 0.00 ? 18  ASN A HD22 4  
ATOM   2291  N  N    . CYS A 1 19 ? 5.877   -9.758  0.900   1.00 0.00 ? 19  CYS A N    4  
ATOM   2292  C  CA   . CYS A 1 19 ? 5.267   -9.021  1.999   1.00 0.00 ? 19  CYS A CA   4  
ATOM   2293  C  C    . CYS A 1 19 ? 4.206   -9.865  2.698   1.00 0.00 ? 19  CYS A C    4  
ATOM   2294  O  O    . CYS A 1 19 ? 3.120   -10.104 2.170   1.00 0.00 ? 19  CYS A O    4  
ATOM   2295  C  CB   . CYS A 1 19 ? 4.644   -7.721  1.486   1.00 0.00 ? 19  CYS A CB   4  
ATOM   2296  S  SG   . CYS A 1 19 ? 4.296   -6.497  2.790   1.00 0.00 ? 19  CYS A SG   4  
ATOM   2297  H  H    . CYS A 1 19 ? 5.379   -9.865  0.062   1.00 0.00 ? 19  CYS A H    4  
ATOM   2298  H  HA   . CYS A 1 19 ? 6.044   -8.781  2.710   1.00 0.00 ? 19  CYS A HA   4  
ATOM   2299  H  HB2  . CYS A 1 19 ? 5.319   -7.263  0.778   1.00 0.00 ? 19  CYS A HB2  4  
ATOM   2300  H  HB3  . CYS A 1 19 ? 3.712   -7.949  0.991   1.00 0.00 ? 19  CYS A HB3  4  
ATOM   2301  N  N    . PRO A 1 20 ? 4.525   -10.328 3.916   1.00 0.00 ? 20  PRO A N    4  
ATOM   2302  C  CA   . PRO A 1 20 ? 3.613   -11.153 4.714   1.00 0.00 ? 20  PRO A CA   4  
ATOM   2303  C  C    . PRO A 1 20 ? 2.412   -10.362 5.223   1.00 0.00 ? 20  PRO A C    4  
ATOM   2304  O  O    . PRO A 1 20 ? 1.427   -10.938 5.683   1.00 0.00 ? 20  PRO A O    4  
ATOM   2305  C  CB   . PRO A 1 20 ? 4.484   -11.614 5.885   1.00 0.00 ? 20  PRO A CB   4  
ATOM   2306  C  CG   . PRO A 1 20 ? 5.541   -10.570 6.005   1.00 0.00 ? 20  PRO A CG   4  
ATOM   2307  C  CD   . PRO A 1 20 ? 5.802   -10.083 4.607   1.00 0.00 ? 20  PRO A CD   4  
ATOM   2308  H  HA   . PRO A 1 20 ? 3.268   -12.013 4.160   1.00 0.00 ? 20  PRO A HA   4  
ATOM   2309  H  HB2  . PRO A 1 20 ? 3.884   -11.675 6.782   1.00 0.00 ? 20  PRO A HB2  4  
ATOM   2310  H  HB3  . PRO A 1 20 ? 4.909   -12.581 5.663   1.00 0.00 ? 20  PRO A HB3  4  
ATOM   2311  H  HG2  . PRO A 1 20 ? 5.188   -9.760  6.625   1.00 0.00 ? 20  PRO A HG2  4  
ATOM   2312  H  HG3  . PRO A 1 20 ? 6.437   -11.003 6.425   1.00 0.00 ? 20  PRO A HG3  4  
ATOM   2313  H  HD2  . PRO A 1 20 ? 6.041   -9.029  4.613   1.00 0.00 ? 20  PRO A HD2  4  
ATOM   2314  H  HD3  . PRO A 1 20 ? 6.601   -10.650 4.153   1.00 0.00 ? 20  PRO A HD3  4  
ATOM   2315  N  N    . PHE A 1 21 ? 2.501   -9.039  5.135   1.00 0.00 ? 21  PHE A N    4  
ATOM   2316  C  CA   . PHE A 1 21 ? 1.422   -8.169  5.587   1.00 0.00 ? 21  PHE A CA   4  
ATOM   2317  C  C    . PHE A 1 21 ? 0.214   -8.274  4.661   1.00 0.00 ? 21  PHE A C    4  
ATOM   2318  O  O    . PHE A 1 21 ? 0.359   -8.444  3.450   1.00 0.00 ? 21  PHE A O    4  
ATOM   2319  C  CB   . PHE A 1 21 ? 1.902   -6.718  5.655   1.00 0.00 ? 21  PHE A CB   4  
ATOM   2320  C  CG   . PHE A 1 21 ? 2.900   -6.467  6.749   1.00 0.00 ? 21  PHE A CG   4  
ATOM   2321  C  CD1  . PHE A 1 21 ? 4.247   -6.719  6.547   1.00 0.00 ? 21  PHE A CD1  4  
ATOM   2322  C  CD2  . PHE A 1 21 ? 2.490   -5.978  7.979   1.00 0.00 ? 21  PHE A CD2  4  
ATOM   2323  C  CE1  . PHE A 1 21 ? 5.167   -6.489  7.552   1.00 0.00 ? 21  PHE A CE1  4  
ATOM   2324  C  CE2  . PHE A 1 21 ? 3.406   -5.747  8.989   1.00 0.00 ? 21  PHE A CE2  4  
ATOM   2325  C  CZ   . PHE A 1 21 ? 4.746   -6.002  8.774   1.00 0.00 ? 21  PHE A CZ   4  
ATOM   2326  H  H    . PHE A 1 21 ? 3.313   -8.638  4.759   1.00 0.00 ? 21  PHE A H    4  
ATOM   2327  H  HA   . PHE A 1 21 ? 1.131   -8.489  6.576   1.00 0.00 ? 21  PHE A HA   4  
ATOM   2328  H  HB2  . PHE A 1 21 ? 2.367   -6.456  4.716   1.00 0.00 ? 21  PHE A HB2  4  
ATOM   2329  H  HB3  . PHE A 1 21 ? 1.053   -6.073  5.824   1.00 0.00 ? 21  PHE A HB3  4  
ATOM   2330  H  HD1  . PHE A 1 21 ? 4.578   -7.099  5.592   1.00 0.00 ? 21  PHE A HD1  4  
ATOM   2331  H  HD2  . PHE A 1 21 ? 1.441   -5.779  8.148   1.00 0.00 ? 21  PHE A HD2  4  
ATOM   2332  H  HE1  . PHE A 1 21 ? 6.215   -6.689  7.382   1.00 0.00 ? 21  PHE A HE1  4  
ATOM   2333  H  HE2  . PHE A 1 21 ? 3.073   -5.365  9.943   1.00 0.00 ? 21  PHE A HE2  4  
ATOM   2334  H  HZ   . PHE A 1 21 ? 5.463   -5.822  9.562   1.00 0.00 ? 21  PHE A HZ   4  
ATOM   2335  N  N    . PHE A 1 22 ? -0.978  -8.173  5.238   1.00 0.00 ? 22  PHE A N    4  
ATOM   2336  C  CA   . PHE A 1 22 ? -2.212  -8.258  4.466   1.00 0.00 ? 22  PHE A CA   4  
ATOM   2337  C  C    . PHE A 1 22 ? -2.573  -6.903  3.866   1.00 0.00 ? 22  PHE A C    4  
ATOM   2338  O  O    . PHE A 1 22 ? -2.327  -5.859  4.471   1.00 0.00 ? 22  PHE A O    4  
ATOM   2339  C  CB   . PHE A 1 22 ? -3.358  -8.760  5.348   1.00 0.00 ? 22  PHE A CB   4  
ATOM   2340  C  CG   . PHE A 1 22 ? -3.157  -10.161 5.851   1.00 0.00 ? 22  PHE A CG   4  
ATOM   2341  C  CD1  . PHE A 1 22 ? -3.146  -11.232 4.972   1.00 0.00 ? 22  PHE A CD1  4  
ATOM   2342  C  CD2  . PHE A 1 22 ? -2.981  -10.406 7.203   1.00 0.00 ? 22  PHE A CD2  4  
ATOM   2343  C  CE1  . PHE A 1 22 ? -2.963  -12.522 5.433   1.00 0.00 ? 22  PHE A CE1  4  
ATOM   2344  C  CE2  . PHE A 1 22 ? -2.797  -11.694 7.670   1.00 0.00 ? 22  PHE A CE2  4  
ATOM   2345  C  CZ   . PHE A 1 22 ? -2.787  -12.753 6.784   1.00 0.00 ? 22  PHE A CZ   4  
ATOM   2346  H  H    . PHE A 1 22 ? -1.030  -8.038  6.208   1.00 0.00 ? 22  PHE A H    4  
ATOM   2347  H  HA   . PHE A 1 22 ? -2.052  -8.962  3.664   1.00 0.00 ? 22  PHE A HA   4  
ATOM   2348  H  HB2  . PHE A 1 22 ? -3.453  -8.110  6.205   1.00 0.00 ? 22  PHE A HB2  4  
ATOM   2349  H  HB3  . PHE A 1 22 ? -4.275  -8.738  4.780   1.00 0.00 ? 22  PHE A HB3  4  
ATOM   2350  H  HD1  . PHE A 1 22 ? -3.282  -11.052 3.916   1.00 0.00 ? 22  PHE A HD1  4  
ATOM   2351  H  HD2  . PHE A 1 22 ? -2.988  -9.578  7.898   1.00 0.00 ? 22  PHE A HD2  4  
ATOM   2352  H  HE1  . PHE A 1 22 ? -2.955  -13.348 4.738   1.00 0.00 ? 22  PHE A HE1  4  
ATOM   2353  H  HE2  . PHE A 1 22 ? -2.659  -11.871 8.727   1.00 0.00 ? 22  PHE A HE2  4  
ATOM   2354  H  HZ   . PHE A 1 22 ? -2.644  -13.760 7.146   1.00 0.00 ? 22  PHE A HZ   4  
ATOM   2355  N  N    . MET A 1 23 ? -3.158  -6.927  2.673   1.00 0.00 ? 23  MET A N    4  
ATOM   2356  C  CA   . MET A 1 23 ? -3.553  -5.700  1.991   1.00 0.00 ? 23  MET A CA   4  
ATOM   2357  C  C    . MET A 1 23 ? -4.977  -5.303  2.369   1.00 0.00 ? 23  MET A C    4  
ATOM   2358  O  O    . MET A 1 23 ? -5.910  -6.093  2.229   1.00 0.00 ? 23  MET A O    4  
ATOM   2359  C  CB   . MET A 1 23 ? -3.446  -5.877  0.475   1.00 0.00 ? 23  MET A CB   4  
ATOM   2360  C  CG   . MET A 1 23 ? -4.052  -7.176  -0.030  1.00 0.00 ? 23  MET A CG   4  
ATOM   2361  S  SD   . MET A 1 23 ? -4.677  -7.042  -1.716  1.00 0.00 ? 23  MET A SD   4  
ATOM   2362  C  CE   . MET A 1 23 ? -3.764  -8.356  -2.521  1.00 0.00 ? 23  MET A CE   4  
ATOM   2363  H  H    . MET A 1 23 ? -3.328  -7.790  2.240   1.00 0.00 ? 23  MET A H    4  
ATOM   2364  H  HA   . MET A 1 23 ? -2.879  -4.917  2.301   1.00 0.00 ? 23  MET A HA   4  
ATOM   2365  H  HB2  . MET A 1 23 ? -3.955  -5.056  -0.008  1.00 0.00 ? 23  MET A HB2  4  
ATOM   2366  H  HB3  . MET A 1 23 ? -2.404  -5.859  0.195   1.00 0.00 ? 23  MET A HB3  4  
ATOM   2367  H  HG2  . MET A 1 23 ? -3.296  -7.946  -0.002  1.00 0.00 ? 23  MET A HG2  4  
ATOM   2368  H  HG3  . MET A 1 23 ? -4.868  -7.453  0.621   1.00 0.00 ? 23  MET A HG3  4  
ATOM   2369  H  HE1  . MET A 1 23 ? -2.842  -7.960  -2.922  1.00 0.00 ? 23  MET A HE1  4  
ATOM   2370  H  HE2  . MET A 1 23 ? -3.540  -9.131  -1.803  1.00 0.00 ? 23  MET A HE2  4  
ATOM   2371  H  HE3  . MET A 1 23 ? -4.358  -8.768  -3.323  1.00 0.00 ? 23  MET A HE3  4  
ATOM   2372  N  N    . SER A 1 24 ? -5.135  -4.073  2.848   1.00 0.00 ? 24  SER A N    4  
ATOM   2373  C  CA   . SER A 1 24 ? -6.445  -3.573  3.250   1.00 0.00 ? 24  SER A CA   4  
ATOM   2374  C  C    . SER A 1 24 ? -7.293  -3.227  2.030   1.00 0.00 ? 24  SER A C    4  
ATOM   2375  O  O    . SER A 1 24 ? -6.840  -3.347  0.891   1.00 0.00 ? 24  SER A O    4  
ATOM   2376  C  CB   . SER A 1 24 ? -6.291  -2.340  4.143   1.00 0.00 ? 24  SER A CB   4  
ATOM   2377  O  OG   . SER A 1 24 ? -5.496  -2.630  5.280   1.00 0.00 ? 24  SER A OG   4  
ATOM   2378  H  H    . SER A 1 24 ? -4.353  -3.490  2.936   1.00 0.00 ? 24  SER A H    4  
ATOM   2379  H  HA   . SER A 1 24 ? -6.940  -4.352  3.809   1.00 0.00 ? 24  SER A HA   4  
ATOM   2380  H  HB2  . SER A 1 24 ? -5.819  -1.548  3.582   1.00 0.00 ? 24  SER A HB2  4  
ATOM   2381  H  HB3  . SER A 1 24 ? -7.267  -2.015  4.475   1.00 0.00 ? 24  SER A HB3  4  
ATOM   2382  H  HG   . SER A 1 24 ? -5.721  -2.027  5.991   1.00 0.00 ? 24  SER A HG   4  
ATOM   2383  N  N    . VAL A 1 25 ? -8.526  -2.798  2.276   1.00 0.00 ? 25  VAL A N    4  
ATOM   2384  C  CA   . VAL A 1 25 ? -9.439  -2.434  1.199   1.00 0.00 ? 25  VAL A CA   4  
ATOM   2385  C  C    . VAL A 1 25 ? -9.062  -1.088  0.591   1.00 0.00 ? 25  VAL A C    4  
ATOM   2386  O  O    . VAL A 1 25 ? -9.331  -0.827  -0.581  1.00 0.00 ? 25  VAL A O    4  
ATOM   2387  C  CB   . VAL A 1 25 ? -10.896 -2.372  1.694   1.00 0.00 ? 25  VAL A CB   4  
ATOM   2388  C  CG1  . VAL A 1 25 ? -11.837 -2.043  0.545   1.00 0.00 ? 25  VAL A CG1  4  
ATOM   2389  C  CG2  . VAL A 1 25 ? -11.289 -3.682  2.358   1.00 0.00 ? 25  VAL A CG2  4  
ATOM   2390  H  H    . VAL A 1 25 ? -8.830  -2.724  3.205   1.00 0.00 ? 25  VAL A H    4  
ATOM   2391  H  HA   . VAL A 1 25 ? -9.373  -3.195  0.434   1.00 0.00 ? 25  VAL A HA   4  
ATOM   2392  H  HB   . VAL A 1 25 ? -10.971 -1.583  2.429   1.00 0.00 ? 25  VAL A HB   4  
ATOM   2393  H  HG11 . VAL A 1 25 ? -11.442 -1.209  -0.016  1.00 0.00 ? 25  VAL A HG11 4  
ATOM   2394  H  HG12 . VAL A 1 25 ? -11.929 -2.903  -0.102  1.00 0.00 ? 25  VAL A HG12 4  
ATOM   2395  H  HG13 . VAL A 1 25 ? -12.809 -1.783  0.939   1.00 0.00 ? 25  VAL A HG13 4  
ATOM   2396  H  HG21 . VAL A 1 25 ? -12.349 -3.845  2.235   1.00 0.00 ? 25  VAL A HG21 4  
ATOM   2397  H  HG22 . VAL A 1 25 ? -10.744 -4.495  1.901   1.00 0.00 ? 25  VAL A HG22 4  
ATOM   2398  H  HG23 . VAL A 1 25 ? -11.052 -3.638  3.412   1.00 0.00 ? 25  VAL A HG23 4  
ATOM   2399  N  N    . ASN A 1 26 ? -8.436  -0.236  1.396   1.00 0.00 ? 26  ASN A N    4  
ATOM   2400  C  CA   . ASN A 1 26 ? -8.022  1.085   0.938   1.00 0.00 ? 26  ASN A CA   4  
ATOM   2401  C  C    . ASN A 1 26 ? -6.541  1.093   0.568   1.00 0.00 ? 26  ASN A C    4  
ATOM   2402  O  O    . ASN A 1 26 ? -6.011  2.102   0.103   1.00 0.00 ? 26  ASN A O    4  
ATOM   2403  C  CB   . ASN A 1 26 ? -8.295  2.132   2.019   1.00 0.00 ? 26  ASN A CB   4  
ATOM   2404  C  CG   . ASN A 1 26 ? -7.123  2.304   2.967   1.00 0.00 ? 26  ASN A CG   4  
ATOM   2405  O  OD1  . ASN A 1 26 ? -6.994  1.574   3.950   1.00 0.00 ? 26  ASN A OD1  4  
ATOM   2406  N  ND2  . ASN A 1 26 ? -6.262  3.272   2.674   1.00 0.00 ? 26  ASN A ND2  4  
ATOM   2407  H  H    . ASN A 1 26 ? -8.249  -0.501  2.321   1.00 0.00 ? 26  ASN A H    4  
ATOM   2408  H  HA   . ASN A 1 26 ? -8.601  1.328   0.060   1.00 0.00 ? 26  ASN A HA   4  
ATOM   2409  H  HB2  . ASN A 1 26 ? -8.493  3.084   1.548   1.00 0.00 ? 26  ASN A HB2  4  
ATOM   2410  H  HB3  . ASN A 1 26 ? -9.158  1.832   2.593   1.00 0.00 ? 26  ASN A HB3  4  
ATOM   2411  H  HD21 . ASN A 1 26 ? -6.429  3.814   1.875   1.00 0.00 ? 26  ASN A HD21 4  
ATOM   2412  H  HD22 . ASN A 1 26 ? -5.495  3.404   3.270   1.00 0.00 ? 26  ASN A HD22 4  
ATOM   2413  N  N    . THR A 1 27 ? -5.878  -0.040  0.779   1.00 0.00 ? 27  THR A N    4  
ATOM   2414  C  CA   . THR A 1 27 ? -4.460  -0.164  0.469   1.00 0.00 ? 27  THR A CA   4  
ATOM   2415  C  C    . THR A 1 27 ? -4.230  -1.145  -0.675  1.00 0.00 ? 27  THR A C    4  
ATOM   2416  O  O    . THR A 1 27 ? -3.236  -1.053  -1.393  1.00 0.00 ? 27  THR A O    4  
ATOM   2417  C  CB   . THR A 1 27 ? -3.655  -0.629  1.698   1.00 0.00 ? 27  THR A CB   4  
ATOM   2418  O  OG1  . THR A 1 27 ? -3.994  -1.982  2.022   1.00 0.00 ? 27  THR A OG1  4  
ATOM   2419  C  CG2  . THR A 1 27 ? -3.929  0.268   2.895   1.00 0.00 ? 27  THR A CG2  4  
ATOM   2420  H  H    . THR A 1 27 ? -6.356  -0.810  1.152   1.00 0.00 ? 27  THR A H    4  
ATOM   2421  H  HA   . THR A 1 27 ? -4.096  0.809   0.174   1.00 0.00 ? 27  THR A HA   4  
ATOM   2422  H  HB   . THR A 1 27 ? -2.602  -0.576  1.460   1.00 0.00 ? 27  THR A HB   4  
ATOM   2423  H  HG1  . THR A 1 27 ? -3.567  -2.577  1.399   1.00 0.00 ? 27  THR A HG1  4  
ATOM   2424  H  HG21 . THR A 1 27 ? -3.111  0.962   3.019   1.00 0.00 ? 27  THR A HG21 4  
ATOM   2425  H  HG22 . THR A 1 27 ? -4.025  -0.337  3.784   1.00 0.00 ? 27  THR A HG22 4  
ATOM   2426  H  HG23 . THR A 1 27 ? -4.845  0.816   2.732   1.00 0.00 ? 27  THR A HG23 4  
ATOM   2427  N  N    . GLN A 1 28 ? -5.157  -2.084  -0.839  1.00 0.00 ? 28  GLN A N    4  
ATOM   2428  C  CA   . GLN A 1 28 ? -5.055  -3.082  -1.897  1.00 0.00 ? 28  GLN A CA   4  
ATOM   2429  C  C    . GLN A 1 28 ? -4.825  -2.418  -3.250  1.00 0.00 ? 28  GLN A C    4  
ATOM   2430  O  O    . GLN A 1 28 ? -5.231  -1.280  -3.489  1.00 0.00 ? 28  GLN A O    4  
ATOM   2431  C  CB   . GLN A 1 28 ? -6.322  -3.938  -1.944  1.00 0.00 ? 28  GLN A CB   4  
ATOM   2432  C  CG   . GLN A 1 28 ? -7.581  -3.145  -2.257  1.00 0.00 ? 28  GLN A CG   4  
ATOM   2433  C  CD   . GLN A 1 28 ? -8.751  -4.032  -2.632  1.00 0.00 ? 28  GLN A CD   4  
ATOM   2434  O  OE1  . GLN A 1 28 ? -9.155  -4.088  -3.794  1.00 0.00 ? 28  GLN A OE1  4  
ATOM   2435  N  NE2  . GLN A 1 28 ? -9.303  -4.732  -1.648  1.00 0.00 ? 28  GLN A NE2  4  
ATOM   2436  H  H    . GLN A 1 28 ? -5.927  -2.105  -0.234  1.00 0.00 ? 28  GLN A H    4  
ATOM   2437  H  HA   . GLN A 1 28 ? -4.211  -3.716  -1.673  1.00 0.00 ? 28  GLN A HA   4  
ATOM   2438  H  HB2  . GLN A 1 28 ? -6.202  -4.696  -2.702  1.00 0.00 ? 28  GLN A HB2  4  
ATOM   2439  H  HB3  . GLN A 1 28 ? -6.454  -4.417  -0.985  1.00 0.00 ? 28  GLN A HB3  4  
ATOM   2440  H  HG2  . GLN A 1 28 ? -7.853  -2.566  -1.387  1.00 0.00 ? 28  GLN A HG2  4  
ATOM   2441  H  HG3  . GLN A 1 28 ? -7.374  -2.478  -3.081  1.00 0.00 ? 28  GLN A HG3  4  
ATOM   2442  H  HE21 . GLN A 1 28 ? -8.929  -4.636  -0.747  1.00 0.00 ? 28  GLN A HE21 4  
ATOM   2443  H  HE22 . GLN A 1 28 ? -10.061 -5.313  -1.862  1.00 0.00 ? 28  GLN A HE22 4  
ATOM   2444  N  N    . PRO A 1 29 ? -4.158  -3.144  -4.160  1.00 0.00 ? 29  PRO A N    4  
ATOM   2445  C  CA   . PRO A 1 29 ? -3.669  -4.499  -3.887  1.00 0.00 ? 29  PRO A CA   4  
ATOM   2446  C  C    . PRO A 1 29 ? -2.517  -4.510  -2.889  1.00 0.00 ? 29  PRO A C    4  
ATOM   2447  O  O    . PRO A 1 29 ? -2.151  -5.561  -2.360  1.00 0.00 ? 29  PRO A O    4  
ATOM   2448  C  CB   . PRO A 1 29 ? -3.194  -4.987  -5.258  1.00 0.00 ? 29  PRO A CB   4  
ATOM   2449  C  CG   . PRO A 1 29 ? -2.863  -3.744  -6.009  1.00 0.00 ? 29  PRO A CG   4  
ATOM   2450  C  CD   . PRO A 1 29 ? -3.828  -2.698  -5.524  1.00 0.00 ? 29  PRO A CD   4  
ATOM   2451  H  HA   . PRO A 1 29 ? -4.461  -5.142  -3.529  1.00 0.00 ? 29  PRO A HA   4  
ATOM   2452  H  HB2  . PRO A 1 29 ? -2.326  -5.619  -5.137  1.00 0.00 ? 29  PRO A HB2  4  
ATOM   2453  H  HB3  . PRO A 1 29 ? -3.985  -5.541  -5.741  1.00 0.00 ? 29  PRO A HB3  4  
ATOM   2454  H  HG2  . PRO A 1 29 ? -1.848  -3.445  -5.796  1.00 0.00 ? 29  PRO A HG2  4  
ATOM   2455  H  HG3  . PRO A 1 29 ? -2.993  -3.910  -7.069  1.00 0.00 ? 29  PRO A HG3  4  
ATOM   2456  H  HD2  . PRO A 1 29 ? -3.356  -1.727  -5.508  1.00 0.00 ? 29  PRO A HD2  4  
ATOM   2457  H  HD3  . PRO A 1 29 ? -4.710  -2.680  -6.147  1.00 0.00 ? 29  PRO A HD3  4  
ATOM   2458  N  N    . LEU A 1 30 ? -1.949  -3.337  -2.636  1.00 0.00 ? 30  LEU A N    4  
ATOM   2459  C  CA   . LEU A 1 30 ? -0.837  -3.211  -1.699  1.00 0.00 ? 30  LEU A CA   4  
ATOM   2460  C  C    . LEU A 1 30 ? -1.343  -3.107  -0.264  1.00 0.00 ? 30  LEU A C    4  
ATOM   2461  O  O    . LEU A 1 30 ? -2.541  -2.947  -0.027  1.00 0.00 ? 30  LEU A O    4  
ATOM   2462  C  CB   . LEU A 1 30 ? 0.009   -1.985  -2.044  1.00 0.00 ? 30  LEU A CB   4  
ATOM   2463  C  CG   . LEU A 1 30 ? 0.882   -2.101  -3.294  1.00 0.00 ? 30  LEU A CG   4  
ATOM   2464  C  CD1  . LEU A 1 30 ? 1.555   -0.772  -3.601  1.00 0.00 ? 30  LEU A CD1  4  
ATOM   2465  C  CD2  . LEU A 1 30 ? 1.920   -3.199  -3.120  1.00 0.00 ? 30  LEU A CD2  4  
ATOM   2466  H  H    . LEU A 1 30 ? -2.284  -2.535  -3.088  1.00 0.00 ? 30  LEU A H    4  
ATOM   2467  H  HA   . LEU A 1 30 ? -0.226  -4.097  -1.790  1.00 0.00 ? 30  LEU A HA   4  
ATOM   2468  H  HB2  . LEU A 1 30 ? -0.660  -1.150  -2.184  1.00 0.00 ? 30  LEU A HB2  4  
ATOM   2469  H  HB3  . LEU A 1 30 ? 0.659   -1.785  -1.203  1.00 0.00 ? 30  LEU A HB3  4  
ATOM   2470  H  HG   . LEU A 1 30 ? 0.258   -2.361  -4.138  1.00 0.00 ? 30  LEU A HG   4  
ATOM   2471  H  HD11 . LEU A 1 30 ? 2.467   -0.949  -4.151  1.00 0.00 ? 30  LEU A HD11 4  
ATOM   2472  H  HD12 . LEU A 1 30 ? 1.785   -0.264  -2.676  1.00 0.00 ? 30  LEU A HD12 4  
ATOM   2473  H  HD13 . LEU A 1 30 ? 0.890   -0.160  -4.192  1.00 0.00 ? 30  LEU A HD13 4  
ATOM   2474  H  HD21 . LEU A 1 30 ? 1.989   -3.467  -2.076  1.00 0.00 ? 30  LEU A HD21 4  
ATOM   2475  H  HD22 . LEU A 1 30 ? 2.880   -2.844  -3.465  1.00 0.00 ? 30  LEU A HD22 4  
ATOM   2476  H  HD23 . LEU A 1 30 ? 1.628   -4.065  -3.696  1.00 0.00 ? 30  LEU A HD23 4  
ATOM   2477  N  N    . CYS A 1 31 ? -0.423  -3.197  0.690   1.00 0.00 ? 31  CYS A N    4  
ATOM   2478  C  CA   . CYS A 1 31 ? -0.774  -3.111  2.103   1.00 0.00 ? 31  CYS A CA   4  
ATOM   2479  C  C    . CYS A 1 31 ? -0.361  -1.763  2.685   1.00 0.00 ? 31  CYS A C    4  
ATOM   2480  O  O    . CYS A 1 31 ? 0.578   -1.128  2.203   1.00 0.00 ? 31  CYS A O    4  
ATOM   2481  C  CB   . CYS A 1 31 ? -0.106  -4.244  2.885   1.00 0.00 ? 31  CYS A CB   4  
ATOM   2482  S  SG   . CYS A 1 31 ? 1.673   -3.990  3.188   1.00 0.00 ? 31  CYS A SG   4  
ATOM   2483  H  H    . CYS A 1 31 ? 0.517   -3.324  0.438   1.00 0.00 ? 31  CYS A H    4  
ATOM   2484  H  HA   . CYS A 1 31 ? -1.845  -3.212  2.185   1.00 0.00 ? 31  CYS A HA   4  
ATOM   2485  H  HB2  . CYS A 1 31 ? -0.591  -4.342  3.846   1.00 0.00 ? 31  CYS A HB2  4  
ATOM   2486  H  HB3  . CYS A 1 31 ? -0.218  -5.166  2.335   1.00 0.00 ? 31  CYS A HB3  4  
ATOM   2487  N  N    . HIS A 1 32 ? -1.068  -1.332  3.725   1.00 0.00 ? 32  HIS A N    4  
ATOM   2488  C  CA   . HIS A 1 32 ? -0.774  -0.059  4.374   1.00 0.00 ? 32  HIS A CA   4  
ATOM   2489  C  C    . HIS A 1 32 ? 0.722   0.237   4.337   1.00 0.00 ? 32  HIS A C    4  
ATOM   2490  O  O    . HIS A 1 32 ? 1.144   1.284   3.846   1.00 0.00 ? 32  HIS A O    4  
ATOM   2491  C  CB   . HIS A 1 32 ? -1.267  -0.075  5.821   1.00 0.00 ? 32  HIS A CB   4  
ATOM   2492  C  CG   . HIS A 1 32 ? -1.673  1.273   6.331   1.00 0.00 ? 32  HIS A CG   4  
ATOM   2493  N  ND1  . HIS A 1 32 ? -2.751  1.467   7.169   1.00 0.00 ? 32  HIS A ND1  4  
ATOM   2494  C  CD2  . HIS A 1 32 ? -1.138  2.498   6.118   1.00 0.00 ? 32  HIS A CD2  4  
ATOM   2495  C  CE1  . HIS A 1 32 ? -2.863  2.754   7.448   1.00 0.00 ? 32  HIS A CE1  4  
ATOM   2496  N  NE2  . HIS A 1 32 ? -1.896  3.401   6.823   1.00 0.00 ? 32  HIS A NE2  4  
ATOM   2497  H  H    . HIS A 1 32 ? -1.804  -1.883  4.063   1.00 0.00 ? 32  HIS A H    4  
ATOM   2498  H  HA   . HIS A 1 32 ? -1.296  0.717   3.834   1.00 0.00 ? 32  HIS A HA   4  
ATOM   2499  H  HB2  . HIS A 1 32 ? -2.123  -0.729  5.896   1.00 0.00 ? 32  HIS A HB2  4  
ATOM   2500  H  HB3  . HIS A 1 32 ? -0.479  -0.448  6.459   1.00 0.00 ? 32  HIS A HB3  4  
ATOM   2501  H  HD1  . HIS A 1 32 ? -3.347  0.767   7.507   1.00 0.00 ? 32  HIS A HD1  4  
ATOM   2502  H  HD2  . HIS A 1 32 ? -0.276  2.724   5.507   1.00 0.00 ? 32  HIS A HD2  4  
ATOM   2503  H  HE1  . HIS A 1 32 ? -3.616  3.201   8.079   1.00 0.00 ? 32  HIS A HE1  4  
ATOM   2504  N  N    . GLU A 1 33 ? 1.517   -0.690  4.860   1.00 0.00 ? 33  GLU A N    4  
ATOM   2505  C  CA   . GLU A 1 33 ? 2.966   -0.526  4.888   1.00 0.00 ? 33  GLU A CA   4  
ATOM   2506  C  C    . GLU A 1 33 ? 3.497   -0.146  3.509   1.00 0.00 ? 33  GLU A C    4  
ATOM   2507  O  O    . GLU A 1 33 ? 4.238   0.827   3.363   1.00 0.00 ? 33  GLU A O    4  
ATOM   2508  C  CB   . GLU A 1 33 ? 3.639   -1.814  5.368   1.00 0.00 ? 33  GLU A CB   4  
ATOM   2509  C  CG   . GLU A 1 33 ? 5.156   -1.733  5.399   1.00 0.00 ? 33  GLU A CG   4  
ATOM   2510  C  CD   . GLU A 1 33 ? 5.773   -2.724  6.367   1.00 0.00 ? 33  GLU A CD   4  
ATOM   2511  O  OE1  . GLU A 1 33 ? 5.177   -2.952  7.441   1.00 0.00 ? 33  GLU A OE1  4  
ATOM   2512  O  OE2  . GLU A 1 33 ? 6.851   -3.269  6.052   1.00 0.00 ? 33  GLU A OE2  4  
ATOM   2513  H  H    . GLU A 1 33 ? 1.121   -1.503  5.237   1.00 0.00 ? 33  GLU A H    4  
ATOM   2514  H  HA   . GLU A 1 33 ? 3.197   0.269   5.581   1.00 0.00 ? 33  GLU A HA   4  
ATOM   2515  H  HB2  . GLU A 1 33 ? 3.290   -2.038  6.365   1.00 0.00 ? 33  GLU A HB2  4  
ATOM   2516  H  HB3  . GLU A 1 33 ? 3.356   -2.621  4.708   1.00 0.00 ? 33  GLU A HB3  4  
ATOM   2517  H  HG2  . GLU A 1 33 ? 5.535   -1.938  4.409   1.00 0.00 ? 33  GLU A HG2  4  
ATOM   2518  H  HG3  . GLU A 1 33 ? 5.444   -0.735  5.694   1.00 0.00 ? 33  GLU A HG3  4  
ATOM   2519  N  N    . CYS A 1 34 ? 3.113   -0.920  2.499   1.00 0.00 ? 34  CYS A N    4  
ATOM   2520  C  CA   . CYS A 1 34 ? 3.550   -0.667  1.132   1.00 0.00 ? 34  CYS A CA   4  
ATOM   2521  C  C    . CYS A 1 34 ? 2.933   0.621   0.594   1.00 0.00 ? 34  CYS A C    4  
ATOM   2522  O  O    . CYS A 1 34 ? 3.644   1.567   0.254   1.00 0.00 ? 34  CYS A O    4  
ATOM   2523  C  CB   . CYS A 1 34 ? 3.172   -1.842  0.228   1.00 0.00 ? 34  CYS A CB   4  
ATOM   2524  S  SG   . CYS A 1 34 ? 4.116   -3.365  0.556   1.00 0.00 ? 34  CYS A SG   4  
ATOM   2525  H  H    . CYS A 1 34 ? 2.521   -1.681  2.679   1.00 0.00 ? 34  CYS A H    4  
ATOM   2526  H  HA   . CYS A 1 34 ? 4.624   -0.561  1.140   1.00 0.00 ? 34  CYS A HA   4  
ATOM   2527  H  HB2  . CYS A 1 34 ? 2.125   -2.070  0.365   1.00 0.00 ? 34  CYS A HB2  4  
ATOM   2528  H  HB3  . CYS A 1 34 ? 3.343   -1.564  -0.802  1.00 0.00 ? 34  CYS A HB3  4  
ATOM   2529  N  N    . SER A 1 35 ? 1.607   0.650   0.519   1.00 0.00 ? 35  SER A N    4  
ATOM   2530  C  CA   . SER A 1 35 ? 0.894   1.820   0.019   1.00 0.00 ? 35  SER A CA   4  
ATOM   2531  C  C    . SER A 1 35 ? 1.618   3.105   0.410   1.00 0.00 ? 35  SER A C    4  
ATOM   2532  O  O    . SER A 1 35 ? 2.079   3.855   -0.449  1.00 0.00 ? 35  SER A O    4  
ATOM   2533  C  CB   . SER A 1 35 ? -0.537  1.842   0.561   1.00 0.00 ? 35  SER A CB   4  
ATOM   2534  O  OG   . SER A 1 35 ? -1.248  2.967   0.076   1.00 0.00 ? 35  SER A OG   4  
ATOM   2535  H  H    . SER A 1 35 ? 1.095   -0.136  0.805   1.00 0.00 ? 35  SER A H    4  
ATOM   2536  H  HA   . SER A 1 35 ? 0.861   1.753   -1.058  1.00 0.00 ? 35  SER A HA   4  
ATOM   2537  H  HB2  . SER A 1 35 ? -1.050  0.945   0.251   1.00 0.00 ? 35  SER A HB2  4  
ATOM   2538  H  HB3  . SER A 1 35 ? -0.509  1.886   1.640   1.00 0.00 ? 35  SER A HB3  4  
ATOM   2539  H  HG   . SER A 1 35 ? -0.950  3.176   -0.812  1.00 0.00 ? 35  SER A HG   4  
ATOM   2540  N  N    . GLU A 1 36 ? 1.712   3.351   1.713   1.00 0.00 ? 36  GLU A N    4  
ATOM   2541  C  CA   . GLU A 1 36 ? 2.379   4.545   2.218   1.00 0.00 ? 36  GLU A CA   4  
ATOM   2542  C  C    . GLU A 1 36 ? 3.806   4.637   1.687   1.00 0.00 ? 36  GLU A C    4  
ATOM   2543  O  O    . GLU A 1 36 ? 4.237   5.689   1.213   1.00 0.00 ? 36  GLU A O    4  
ATOM   2544  C  CB   . GLU A 1 36 ? 2.392   4.541   3.748   1.00 0.00 ? 36  GLU A CB   4  
ATOM   2545  C  CG   . GLU A 1 36 ? 3.283   3.465   4.346   1.00 0.00 ? 36  GLU A CG   4  
ATOM   2546  C  CD   . GLU A 1 36 ? 3.231   3.440   5.862   1.00 0.00 ? 36  GLU A CD   4  
ATOM   2547  O  OE1  . GLU A 1 36 ? 2.122   3.582   6.419   1.00 0.00 ? 36  GLU A OE1  4  
ATOM   2548  O  OE2  . GLU A 1 36 ? 4.298   3.279   6.490   1.00 0.00 ? 36  GLU A OE2  4  
ATOM   2549  H  H    . GLU A 1 36 ? 1.324   2.714   2.349   1.00 0.00 ? 36  GLU A H    4  
ATOM   2550  H  HA   . GLU A 1 36 ? 1.824   5.405   1.875   1.00 0.00 ? 36  GLU A HA   4  
ATOM   2551  H  HB2  . GLU A 1 36 ? 2.739   5.502   4.096   1.00 0.00 ? 36  GLU A HB2  4  
ATOM   2552  H  HB3  . GLU A 1 36 ? 1.384   4.382   4.104   1.00 0.00 ? 36  GLU A HB3  4  
ATOM   2553  H  HG2  . GLU A 1 36 ? 2.964   2.503   3.975   1.00 0.00 ? 36  GLU A HG2  4  
ATOM   2554  H  HG3  . GLU A 1 36 ? 4.302   3.648   4.039   1.00 0.00 ? 36  GLU A HG3  4  
ATOM   2555  N  N    . ARG A 1 37 ? 4.535   3.529   1.770   1.00 0.00 ? 37  ARG A N    4  
ATOM   2556  C  CA   . ARG A 1 37 ? 5.914   3.484   1.300   1.00 0.00 ? 37  ARG A CA   4  
ATOM   2557  C  C    . ARG A 1 37 ? 6.011   3.958   -0.147  1.00 0.00 ? 37  ARG A C    4  
ATOM   2558  O  O    . ARG A 1 37 ? 6.949   4.664   -0.518  1.00 0.00 ? 37  ARG A O    4  
ATOM   2559  C  CB   . ARG A 1 37 ? 6.471   2.065   1.421   1.00 0.00 ? 37  ARG A CB   4  
ATOM   2560  C  CG   . ARG A 1 37 ? 7.147   1.787   2.754   1.00 0.00 ? 37  ARG A CG   4  
ATOM   2561  C  CD   . ARG A 1 37 ? 7.838   0.433   2.758   1.00 0.00 ? 37  ARG A CD   4  
ATOM   2562  N  NE   . ARG A 1 37 ? 8.729   0.275   3.904   1.00 0.00 ? 37  ARG A NE   4  
ATOM   2563  C  CZ   . ARG A 1 37 ? 9.968   0.752   3.941   1.00 0.00 ? 37  ARG A CZ   4  
ATOM   2564  N  NH1  . ARG A 1 37 ? 10.461  1.412   2.902   1.00 0.00 ? 37  ARG A NH1  4  
ATOM   2565  N  NH2  . ARG A 1 37 ? 10.718  0.568   5.021   1.00 0.00 ? 37  ARG A NH2  4  
ATOM   2566  H  H    . ARG A 1 37 ? 4.136   2.722   2.158   1.00 0.00 ? 37  ARG A H    4  
ATOM   2567  H  HA   . ARG A 1 37 ? 6.499   4.145   1.923   1.00 0.00 ? 37  ARG A HA   4  
ATOM   2568  H  HB2  . ARG A 1 37 ? 5.661   1.361   1.300   1.00 0.00 ? 37  ARG A HB2  4  
ATOM   2569  H  HB3  . ARG A 1 37 ? 7.195   1.907   0.636   1.00 0.00 ? 37  ARG A HB3  4  
ATOM   2570  H  HG2  . ARG A 1 37 ? 7.883   2.555   2.941   1.00 0.00 ? 37  ARG A HG2  4  
ATOM   2571  H  HG3  . ARG A 1 37 ? 6.401   1.803   3.535   1.00 0.00 ? 37  ARG A HG3  4  
ATOM   2572  H  HD2  . ARG A 1 37 ? 7.085   -0.341  2.791   1.00 0.00 ? 37  ARG A HD2  4  
ATOM   2573  H  HD3  . ARG A 1 37 ? 8.413   0.335   1.849   1.00 0.00 ? 37  ARG A HD3  4  
ATOM   2574  H  HE   . ARG A 1 37 ? 8.386   -0.209  4.683   1.00 0.00 ? 37  ARG A HE   4  
ATOM   2575  H  HH11 . ARG A 1 37 ? 9.897   1.552   2.088   1.00 0.00 ? 37  ARG A HH11 4  
ATOM   2576  H  HH12 . ARG A 1 37 ? 11.394  1.770   2.934   1.00 0.00 ? 37  ARG A HH12 4  
ATOM   2577  H  HH21 . ARG A 1 37 ? 10.351  0.071   5.806   1.00 0.00 ? 37  ARG A HH21 4  
ATOM   2578  H  HH22 . ARG A 1 37 ? 11.651  0.927   5.048   1.00 0.00 ? 37  ARG A HH22 4  
ATOM   2579  N  N    . ARG A 1 38 ? 5.035   3.564   -0.960  1.00 0.00 ? 38  ARG A N    4  
ATOM   2580  C  CA   . ARG A 1 38 ? 5.011   3.947   -2.366  1.00 0.00 ? 38  ARG A CA   4  
ATOM   2581  C  C    . ARG A 1 38 ? 4.749   5.443   -2.518  1.00 0.00 ? 38  ARG A C    4  
ATOM   2582  O  O    . ARG A 1 38 ? 5.524   6.156   -3.154  1.00 0.00 ? 38  ARG A O    4  
ATOM   2583  C  CB   . ARG A 1 38 ? 3.940   3.152   -3.115  1.00 0.00 ? 38  ARG A CB   4  
ATOM   2584  C  CG   . ARG A 1 38 ? 3.709   3.632   -4.538  1.00 0.00 ? 38  ARG A CG   4  
ATOM   2585  C  CD   . ARG A 1 38 ? 2.624   2.822   -5.230  1.00 0.00 ? 38  ARG A CD   4  
ATOM   2586  N  NE   . ARG A 1 38 ? 1.311   3.040   -4.629  1.00 0.00 ? 38  ARG A NE   4  
ATOM   2587  C  CZ   . ARG A 1 38 ? 0.166   2.823   -5.266  1.00 0.00 ? 38  ARG A CZ   4  
ATOM   2588  N  NH1  . ARG A 1 38 ? 0.172   2.383   -6.517  1.00 0.00 ? 38  ARG A NH1  4  
ATOM   2589  N  NH2  . ARG A 1 38 ? -0.989  3.044   -4.652  1.00 0.00 ? 38  ARG A NH2  4  
ATOM   2590  H  H    . ARG A 1 38 ? 4.315   3.002   -0.605  1.00 0.00 ? 38  ARG A H    4  
ATOM   2591  H  HA   . ARG A 1 38 ? 5.978   3.719   -2.789  1.00 0.00 ? 38  ARG A HA   4  
ATOM   2592  H  HB2  . ARG A 1 38 ? 4.239   2.115   -3.153  1.00 0.00 ? 38  ARG A HB2  4  
ATOM   2593  H  HB3  . ARG A 1 38 ? 3.008   3.231   -2.576  1.00 0.00 ? 38  ARG A HB3  4  
ATOM   2594  H  HG2  . ARG A 1 38 ? 3.408   4.669   -4.514  1.00 0.00 ? 38  ARG A HG2  4  
ATOM   2595  H  HG3  . ARG A 1 38 ? 4.629   3.535   -5.095  1.00 0.00 ? 38  ARG A HG3  4  
ATOM   2596  H  HD2  . ARG A 1 38 ? 2.585   3.111   -6.270  1.00 0.00 ? 38  ARG A HD2  4  
ATOM   2597  H  HD3  . ARG A 1 38 ? 2.874   1.774   -5.157  1.00 0.00 ? 38  ARG A HD3  4  
ATOM   2598  H  HE   . ARG A 1 38 ? 1.283   3.365   -3.705  1.00 0.00 ? 38  ARG A HE   4  
ATOM   2599  H  HH11 . ARG A 1 38 ? 1.041   2.214   -6.982  1.00 0.00 ? 38  ARG A HH11 4  
ATOM   2600  H  HH12 . ARG A 1 38 ? -0.691  2.219   -6.994  1.00 0.00 ? 38  ARG A HH12 4  
ATOM   2601  H  HH21 . ARG A 1 38 ? -0.998  3.375   -3.709  1.00 0.00 ? 38  ARG A HH21 4  
ATOM   2602  H  HH22 . ARG A 1 38 ? -1.850  2.881   -5.132  1.00 0.00 ? 38  ARG A HH22 4  
ATOM   2603  N  N    . GLN A 1 39 ? 3.652   5.909   -1.930  1.00 0.00 ? 39  GLN A N    4  
ATOM   2604  C  CA   . GLN A 1 39 ? 3.288   7.319   -2.002  1.00 0.00 ? 39  GLN A CA   4  
ATOM   2605  C  C    . GLN A 1 39 ? 4.501   8.208   -1.750  1.00 0.00 ? 39  GLN A C    4  
ATOM   2606  O  O    . GLN A 1 39 ? 4.870   9.027   -2.592  1.00 0.00 ? 39  GLN A O    4  
ATOM   2607  C  CB   . GLN A 1 39 ? 2.189   7.636   -0.986  1.00 0.00 ? 39  GLN A CB   4  
ATOM   2608  C  CG   . GLN A 1 39 ? 0.802   7.204   -1.435  1.00 0.00 ? 39  GLN A CG   4  
ATOM   2609  C  CD   . GLN A 1 39 ? 0.139   8.223   -2.341  1.00 0.00 ? 39  GLN A CD   4  
ATOM   2610  O  OE1  . GLN A 1 39 ? 0.751   8.722   -3.286  1.00 0.00 ? 39  GLN A OE1  4  
ATOM   2611  N  NE2  . GLN A 1 39 ? -1.120  8.537   -2.057  1.00 0.00 ? 39  GLN A NE2  4  
ATOM   2612  H  H    . GLN A 1 39 ? 3.075   5.290   -1.437  1.00 0.00 ? 39  GLN A H    4  
ATOM   2613  H  HA   . GLN A 1 39 ? 2.914   7.514   -2.995  1.00 0.00 ? 39  GLN A HA   4  
ATOM   2614  H  HB2  . GLN A 1 39 ? 2.417   7.132   -0.058  1.00 0.00 ? 39  GLN A HB2  4  
ATOM   2615  H  HB3  . GLN A 1 39 ? 2.172   8.701   -0.813  1.00 0.00 ? 39  GLN A HB3  4  
ATOM   2616  H  HG2  . GLN A 1 39 ? 0.886   6.270   -1.971  1.00 0.00 ? 39  GLN A HG2  4  
ATOM   2617  H  HG3  . GLN A 1 39 ? 0.183   7.063   -0.562  1.00 0.00 ? 39  GLN A HG3  4  
ATOM   2618  H  HE21 . GLN A 1 39 ? -1.543  8.100   -1.288  1.00 0.00 ? 39  GLN A HE21 4  
ATOM   2619  H  HE22 . GLN A 1 39 ? -1.572  9.193   -2.625  1.00 0.00 ? 39  GLN A HE22 4  
ATOM   2620  N  N    . LYS A 1 40 ? 5.118   8.042   -0.585  1.00 0.00 ? 40  LYS A N    4  
ATOM   2621  C  CA   . LYS A 1 40 ? 6.291   8.829   -0.221  1.00 0.00 ? 40  LYS A CA   4  
ATOM   2622  C  C    . LYS A 1 40 ? 7.423   8.611   -1.219  1.00 0.00 ? 40  LYS A C    4  
ATOM   2623  O  O    . LYS A 1 40 ? 8.073   9.561   -1.653  1.00 0.00 ? 40  LYS A O    4  
ATOM   2624  C  CB   . LYS A 1 40 ? 6.761   8.460   1.188   1.00 0.00 ? 40  LYS A CB   4  
ATOM   2625  C  CG   . LYS A 1 40 ? 6.084   9.264   2.285   1.00 0.00 ? 40  LYS A CG   4  
ATOM   2626  C  CD   . LYS A 1 40 ? 6.702   8.982   3.644   1.00 0.00 ? 40  LYS A CD   4  
ATOM   2627  C  CE   . LYS A 1 40 ? 5.970   9.723   4.753   1.00 0.00 ? 40  LYS A CE   4  
ATOM   2628  N  NZ   . LYS A 1 40 ? 6.188   9.089   6.082   1.00 0.00 ? 40  LYS A NZ   4  
ATOM   2629  H  H    . LYS A 1 40 ? 4.777   7.373   0.046   1.00 0.00 ? 40  LYS A H    4  
ATOM   2630  H  HA   . LYS A 1 40 ? 6.009   9.871   -0.236  1.00 0.00 ? 40  LYS A HA   4  
ATOM   2631  H  HB2  . LYS A 1 40 ? 6.557   7.413   1.360   1.00 0.00 ? 40  LYS A HB2  4  
ATOM   2632  H  HB3  . LYS A 1 40 ? 7.826   8.626   1.254   1.00 0.00 ? 40  LYS A HB3  4  
ATOM   2633  H  HG2  . LYS A 1 40 ? 6.189   10.316  2.065   1.00 0.00 ? 40  LYS A HG2  4  
ATOM   2634  H  HG3  . LYS A 1 40 ? 5.036   9.004   2.315   1.00 0.00 ? 40  LYS A HG3  4  
ATOM   2635  H  HD2  . LYS A 1 40 ? 6.650   7.922   3.841   1.00 0.00 ? 40  LYS A HD2  4  
ATOM   2636  H  HD3  . LYS A 1 40 ? 7.735   9.299   3.633   1.00 0.00 ? 40  LYS A HD3  4  
ATOM   2637  H  HE2  . LYS A 1 40 ? 6.329   10.741  4.786   1.00 0.00 ? 40  LYS A HE2  4  
ATOM   2638  H  HE3  . LYS A 1 40 ? 4.913   9.722   4.532   1.00 0.00 ? 40  LYS A HE3  4  
ATOM   2639  H  HZ1  . LYS A 1 40 ? 5.306   9.100   6.633   1.00 0.00 ? 40  LYS A HZ1  4  
ATOM   2640  H  HZ2  . LYS A 1 40 ? 6.921   9.606   6.609   1.00 0.00 ? 40  LYS A HZ2  4  
ATOM   2641  H  HZ3  . LYS A 1 40 ? 6.496   8.103   5.961   1.00 0.00 ? 40  LYS A HZ3  4  
ATOM   2642  N  N    . ASN A 1 41 ? 7.654   7.352   -1.580  1.00 0.00 ? 41  ASN A N    4  
ATOM   2643  C  CA   . ASN A 1 41 ? 8.707   7.010   -2.529  1.00 0.00 ? 41  ASN A CA   4  
ATOM   2644  C  C    . ASN A 1 41 ? 8.595   7.854   -3.794  1.00 0.00 ? 41  ASN A C    4  
ATOM   2645  O  O    . ASN A 1 41 ? 9.595   8.360   -4.305  1.00 0.00 ? 41  ASN A O    4  
ATOM   2646  C  CB   . ASN A 1 41 ? 8.638   5.524   -2.886  1.00 0.00 ? 41  ASN A CB   4  
ATOM   2647  C  CG   . ASN A 1 41 ? 9.844   5.064   -3.682  1.00 0.00 ? 41  ASN A CG   4  
ATOM   2648  O  OD1  . ASN A 1 41 ? 10.669  4.294   -3.191  1.00 0.00 ? 41  ASN A OD1  4  
ATOM   2649  N  ND2  . ASN A 1 41 ? 9.950   5.535   -4.919  1.00 0.00 ? 41  ASN A ND2  4  
ATOM   2650  H  H    . ASN A 1 41 ? 7.102   6.637   -1.200  1.00 0.00 ? 41  ASN A H    4  
ATOM   2651  H  HA   . ASN A 1 41 ? 9.657   7.214   -2.057  1.00 0.00 ? 41  ASN A HA   4  
ATOM   2652  H  HB2  . ASN A 1 41 ? 8.590   4.943   -1.976  1.00 0.00 ? 41  ASN A HB2  4  
ATOM   2653  H  HB3  . ASN A 1 41 ? 7.750   5.341   -3.472  1.00 0.00 ? 41  ASN A HB3  4  
ATOM   2654  H  HD21 . ASN A 1 41 ? 9.255   6.145   -5.244  1.00 0.00 ? 41  ASN A HD21 4  
ATOM   2655  H  HD22 . ASN A 1 41 ? 10.719  5.254   -5.457  1.00 0.00 ? 41  ASN A HD22 4  
ATOM   2656  N  N    . GLN A 1 42 ? 7.373   8.002   -4.294  1.00 0.00 ? 42  GLN A N    4  
ATOM   2657  C  CA   . GLN A 1 42 ? 7.131   8.785   -5.500  1.00 0.00 ? 42  GLN A CA   4  
ATOM   2658  C  C    . GLN A 1 42 ? 7.311   10.275  -5.228  1.00 0.00 ? 42  GLN A C    4  
ATOM   2659  O  O    . GLN A 1 42 ? 6.921   10.774  -4.173  1.00 0.00 ? 42  GLN A O    4  
ATOM   2660  C  CB   . GLN A 1 42 ? 5.721   8.519   -6.032  1.00 0.00 ? 42  GLN A CB   4  
ATOM   2661  C  CG   . GLN A 1 42 ? 5.471   7.064   -6.392  1.00 0.00 ? 42  GLN A CG   4  
ATOM   2662  C  CD   . GLN A 1 42 ? 6.130   6.664   -7.697  1.00 0.00 ? 42  GLN A CD   4  
ATOM   2663  O  OE1  . GLN A 1 42 ? 6.686   7.502   -8.408  1.00 0.00 ? 42  GLN A OE1  4  
ATOM   2664  N  NE2  . GLN A 1 42 ? 6.071   5.378   -8.021  1.00 0.00 ? 42  GLN A NE2  4  
ATOM   2665  H  H    . GLN A 1 42 ? 6.617   7.575   -3.842  1.00 0.00 ? 42  GLN A H    4  
ATOM   2666  H  HA   . GLN A 1 42 ? 7.850   8.478   -6.244  1.00 0.00 ? 42  GLN A HA   4  
ATOM   2667  H  HB2  . GLN A 1 42 ? 5.004   8.810   -5.279  1.00 0.00 ? 42  GLN A HB2  4  
ATOM   2668  H  HB3  . GLN A 1 42 ? 5.564   9.118   -6.917  1.00 0.00 ? 42  GLN A HB3  4  
ATOM   2669  H  HG2  . GLN A 1 42 ? 5.863   6.439   -5.603  1.00 0.00 ? 42  GLN A HG2  4  
ATOM   2670  H  HG3  . GLN A 1 42 ? 4.407   6.906   -6.480  1.00 0.00 ? 42  GLN A HG3  4  
ATOM   2671  H  HE21 . GLN A 1 42 ? 5.611   4.767   -7.408  1.00 0.00 ? 42  GLN A HE21 4  
ATOM   2672  H  HE22 . GLN A 1 42 ? 6.488   5.092   -8.860  1.00 0.00 ? 42  GLN A HE22 4  
ATOM   2673  N  N    . ASN A 1 43 ? 7.905   10.979  -6.186  1.00 0.00 ? 43  ASN A N    4  
ATOM   2674  C  CA   . ASN A 1 43 ? 8.139   12.412  -6.048  1.00 0.00 ? 43  ASN A CA   4  
ATOM   2675  C  C    . ASN A 1 43 ? 6.880   13.203  -6.390  1.00 0.00 ? 43  ASN A C    4  
ATOM   2676  O  O    . ASN A 1 43 ? 6.892   14.434  -6.401  1.00 0.00 ? 43  ASN A O    4  
ATOM   2677  C  CB   . ASN A 1 43 ? 9.292   12.851  -6.953  1.00 0.00 ? 43  ASN A CB   4  
ATOM   2678  C  CG   . ASN A 1 43 ? 9.941   14.137  -6.479  1.00 0.00 ? 43  ASN A CG   4  
ATOM   2679  O  OD1  . ASN A 1 43 ? 9.645   14.631  -5.390  1.00 0.00 ? 43  ASN A OD1  4  
ATOM   2680  N  ND2  . ASN A 1 43 ? 10.831  14.687  -7.297  1.00 0.00 ? 43  ASN A ND2  4  
ATOM   2681  H  H    . ASN A 1 43 ? 8.194   10.524  -7.004  1.00 0.00 ? 43  ASN A H    4  
ATOM   2682  H  HA   . ASN A 1 43 ? 8.405   12.607  -5.020  1.00 0.00 ? 43  ASN A HA   4  
ATOM   2683  H  HB2  . ASN A 1 43 ? 10.044  12.076  -6.968  1.00 0.00 ? 43  ASN A HB2  4  
ATOM   2684  H  HB3  . ASN A 1 43 ? 8.918   13.005  -7.954  1.00 0.00 ? 43  ASN A HB3  4  
ATOM   2685  H  HD21 . ASN A 1 43 ? 11.016  14.239  -8.148  1.00 0.00 ? 43  ASN A HD21 4  
ATOM   2686  H  HD22 . ASN A 1 43 ? 11.266  15.519  -7.015  1.00 0.00 ? 43  ASN A HD22 4  
ATOM   2687  N  N    . SER A 1 44 ? 5.795   12.488  -6.668  1.00 0.00 ? 44  SER A N    4  
ATOM   2688  C  CA   . SER A 1 44 ? 4.528   13.122  -7.013  1.00 0.00 ? 44  SER A CA   4  
ATOM   2689  C  C    . SER A 1 44 ? 3.833   13.661  -5.766  1.00 0.00 ? 44  SER A C    4  
ATOM   2690  O  O    . SER A 1 44 ? 3.702   12.961  -4.763  1.00 0.00 ? 44  SER A O    4  
ATOM   2691  C  CB   . SER A 1 44 ? 3.614   12.128  -7.730  1.00 0.00 ? 44  SER A CB   4  
ATOM   2692  O  OG   . SER A 1 44 ? 2.507   12.787  -8.321  1.00 0.00 ? 44  SER A OG   4  
ATOM   2693  H  H    . SER A 1 44 ? 5.848   11.509  -6.642  1.00 0.00 ? 44  SER A H    4  
ATOM   2694  H  HA   . SER A 1 44 ? 4.741   13.947  -7.677  1.00 0.00 ? 44  SER A HA   4  
ATOM   2695  H  HB2  . SER A 1 44 ? 4.172   11.623  -8.505  1.00 0.00 ? 44  SER A HB2  4  
ATOM   2696  H  HB3  . SER A 1 44 ? 3.248   11.401  -7.019  1.00 0.00 ? 44  SER A HB3  4  
ATOM   2697  H  HG   . SER A 1 44 ? 2.804   13.297  -9.078  1.00 0.00 ? 44  SER A HG   4  
ATOM   2698  N  N    . GLY A 1 45 ? 3.389   14.913  -5.838  1.00 0.00 ? 45  GLY A N    4  
ATOM   2699  C  CA   . GLY A 1 45 ? 2.713   15.526  -4.710  1.00 0.00 ? 45  GLY A CA   4  
ATOM   2700  C  C    . GLY A 1 45 ? 3.658   15.834  -3.565  1.00 0.00 ? 45  GLY A C    4  
ATOM   2701  O  O    . GLY A 1 45 ? 3.951   14.982  -2.727  1.00 0.00 ? 45  GLY A O    4  
ATOM   2702  H  H    . GLY A 1 45 ? 3.522   15.424  -6.664  1.00 0.00 ? 45  GLY A H    4  
ATOM   2703  H  HA2  . GLY A 1 45 ? 2.249   16.444  -5.038  1.00 0.00 ? 45  GLY A HA2  4  
ATOM   2704  H  HA3  . GLY A 1 45 ? 1.946   14.853  -4.356  1.00 0.00 ? 45  GLY A HA3  4  
ATOM   2705  N  N    . PRO A 1 46 ? 4.153   17.080  -3.521  1.00 0.00 ? 46  PRO A N    4  
ATOM   2706  C  CA   . PRO A 1 46 ? 5.079   17.527  -2.476  1.00 0.00 ? 46  PRO A CA   4  
ATOM   2707  C  C    . PRO A 1 46 ? 4.404   17.642  -1.114  1.00 0.00 ? 46  PRO A C    4  
ATOM   2708  O  O    . PRO A 1 46 ? 5.012   17.354  -0.083  1.00 0.00 ? 46  PRO A O    4  
ATOM   2709  C  CB   . PRO A 1 46 ? 5.530   18.905  -2.967  1.00 0.00 ? 46  PRO A CB   4  
ATOM   2710  C  CG   . PRO A 1 46 ? 4.418   19.379  -3.839  1.00 0.00 ? 46  PRO A CG   4  
ATOM   2711  C  CD   . PRO A 1 46 ? 3.847   18.148  -4.487  1.00 0.00 ? 46  PRO A CD   4  
ATOM   2712  H  HA   . PRO A 1 46 ? 5.935   16.873  -2.398  1.00 0.00 ? 46  PRO A HA   4  
ATOM   2713  H  HB2  . PRO A 1 46 ? 5.677   19.561  -2.121  1.00 0.00 ? 46  PRO A HB2  4  
ATOM   2714  H  HB3  . PRO A 1 46 ? 6.452   18.810  -3.521  1.00 0.00 ? 46  PRO A HB3  4  
ATOM   2715  H  HG2  . PRO A 1 46 ? 3.666   19.871  -3.240  1.00 0.00 ? 46  PRO A HG2  4  
ATOM   2716  H  HG3  . PRO A 1 46 ? 4.802   20.054  -4.589  1.00 0.00 ? 46  PRO A HG3  4  
ATOM   2717  H  HD2  . PRO A 1 46 ? 2.781   18.253  -4.621  1.00 0.00 ? 46  PRO A HD2  4  
ATOM   2718  H  HD3  . PRO A 1 46 ? 4.332   17.961  -5.434  1.00 0.00 ? 46  PRO A HD3  4  
ATOM   2719  N  N    . SER A 1 47 ? 3.143   18.064  -1.117  1.00 0.00 ? 47  SER A N    4  
ATOM   2720  C  CA   . SER A 1 47 ? 2.387   18.220  0.120   1.00 0.00 ? 47  SER A CA   4  
ATOM   2721  C  C    . SER A 1 47 ? 2.574   17.008  1.028   1.00 0.00 ? 47  SER A C    4  
ATOM   2722  O  O    . SER A 1 47 ? 2.770   17.147  2.235   1.00 0.00 ? 47  SER A O    4  
ATOM   2723  C  CB   . SER A 1 47 ? 0.901   18.416  -0.188  1.00 0.00 ? 47  SER A CB   4  
ATOM   2724  O  OG   . SER A 1 47 ? 0.680   19.635  -0.876  1.00 0.00 ? 47  SER A OG   4  
ATOM   2725  H  H    . SER A 1 47 ? 2.713   18.278  -1.971  1.00 0.00 ? 47  SER A H    4  
ATOM   2726  H  HA   . SER A 1 47 ? 2.759   19.097  0.628   1.00 0.00 ? 47  SER A HA   4  
ATOM   2727  H  HB2  . SER A 1 47 ? 0.553   17.601  -0.803  1.00 0.00 ? 47  SER A HB2  4  
ATOM   2728  H  HB3  . SER A 1 47 ? 0.344   18.433  0.738   1.00 0.00 ? 47  SER A HB3  4  
ATOM   2729  H  HG   . SER A 1 47 ? 0.933   20.371  -0.314  1.00 0.00 ? 47  SER A HG   4  
ATOM   2730  N  N    . SER A 1 48 ? 2.511   15.819  0.437   1.00 0.00 ? 48  SER A N    4  
ATOM   2731  C  CA   . SER A 1 48 ? 2.670   14.581  1.192   1.00 0.00 ? 48  SER A CA   4  
ATOM   2732  C  C    . SER A 1 48 ? 4.141   14.192  1.294   1.00 0.00 ? 48  SER A C    4  
ATOM   2733  O  O    . SER A 1 48 ? 4.628   13.836  2.367   1.00 0.00 ? 48  SER A O    4  
ATOM   2734  C  CB   . SER A 1 48 ? 1.876   13.452  0.532   1.00 0.00 ? 48  SER A CB   4  
ATOM   2735  O  OG   . SER A 1 48 ? 2.262   12.189  1.047   1.00 0.00 ? 48  SER A OG   4  
ATOM   2736  H  H    . SER A 1 48 ? 2.352   15.773  -0.529  1.00 0.00 ? 48  SER A H    4  
ATOM   2737  H  HA   . SER A 1 48 ? 2.284   14.748  2.187   1.00 0.00 ? 48  SER A HA   4  
ATOM   2738  H  HB2  . SER A 1 48 ? 0.824   13.597  0.721   1.00 0.00 ? 48  SER A HB2  4  
ATOM   2739  H  HB3  . SER A 1 48 ? 2.057   13.463  -0.533  1.00 0.00 ? 48  SER A HB3  4  
ATOM   2740  H  HG   . SER A 1 48 ? 1.486   11.722  1.365   1.00 0.00 ? 48  SER A HG   4  
ATOM   2741  N  N    . GLY A 1 49 ? 4.845   14.262  0.168   1.00 0.00 ? 49  GLY A N    4  
ATOM   2742  C  CA   . GLY A 1 49 ? 6.254   13.914  0.151   1.00 0.00 ? 49  GLY A CA   4  
ATOM   2743  C  C    . GLY A 1 49 ? 7.148   15.099  0.460   1.00 0.00 ? 49  GLY A C    4  
ATOM   2744  O  O    . GLY A 1 49 ? 7.101   15.609  1.578   1.00 0.00 ? 49  GLY A O    4  
ATOM   2745  H  H    . GLY A 1 49 ? 4.404   14.552  -0.658  1.00 0.00 ? 49  GLY A H    4  
ATOM   2746  H  HA2  . GLY A 1 49 ? 6.432   13.142  0.885   1.00 0.00 ? 49  GLY A HA2  4  
ATOM   2747  H  HA3  . GLY A 1 49 ? 6.507   13.532  -0.827  1.00 0.00 ? 49  GLY A HA3  4  
HETATM 2748  ZN ZN   . ZN  B 2 .  ? 2.980   -4.970  1.644   1.00 0.00 ? 201 ZN  A ZN   4  
ATOM   2749  N  N    . GLY A 1 1  ? -11.219 6.896   -6.918  1.00 0.00 ? 1   GLY A N    5  
ATOM   2750  C  CA   . GLY A 1 1  ? -10.232 7.950   -6.778  1.00 0.00 ? 1   GLY A CA   5  
ATOM   2751  C  C    . GLY A 1 1  ? -9.779  8.133   -5.343  1.00 0.00 ? 1   GLY A C    5  
ATOM   2752  O  O    . GLY A 1 1  ? -8.682  7.716   -4.973  1.00 0.00 ? 1   GLY A O    5  
ATOM   2753  H  H1   . GLY A 1 1  ? -10.972 6.049   -7.345  1.00 0.00 ? 1   GLY A H1   5  
ATOM   2754  H  HA2  . GLY A 1 1  ? -9.374  7.707   -7.387  1.00 0.00 ? 1   GLY A HA2  5  
ATOM   2755  H  HA3  . GLY A 1 1  ? -10.660 8.877   -7.130  1.00 0.00 ? 1   GLY A HA3  5  
ATOM   2756  N  N    . SER A 1 2  ? -10.626 8.761   -4.533  1.00 0.00 ? 2   SER A N    5  
ATOM   2757  C  CA   . SER A 1 2  ? -10.305 9.004   -3.131  1.00 0.00 ? 2   SER A CA   5  
ATOM   2758  C  C    . SER A 1 2  ? -11.076 8.049   -2.224  1.00 0.00 ? 2   SER A C    5  
ATOM   2759  O  O    . SER A 1 2  ? -12.237 7.732   -2.482  1.00 0.00 ? 2   SER A O    5  
ATOM   2760  C  CB   . SER A 1 2  ? -10.625 10.452  -2.757  1.00 0.00 ? 2   SER A CB   5  
ATOM   2761  O  OG   . SER A 1 2  ? -12.022 10.645  -2.614  1.00 0.00 ? 2   SER A OG   5  
ATOM   2762  H  H    . SER A 1 2  ? -11.486 9.070   -4.887  1.00 0.00 ? 2   SER A H    5  
ATOM   2763  H  HA   . SER A 1 2  ? -9.247  8.832   -2.999  1.00 0.00 ? 2   SER A HA   5  
ATOM   2764  H  HB2  . SER A 1 2  ? -10.143 10.694  -1.822  1.00 0.00 ? 2   SER A HB2  5  
ATOM   2765  H  HB3  . SER A 1 2  ? -10.259 11.110  -3.531  1.00 0.00 ? 2   SER A HB3  5  
ATOM   2766  H  HG   . SER A 1 2  ? -12.184 11.382  -2.021  1.00 0.00 ? 2   SER A HG   5  
ATOM   2767  N  N    . SER A 1 3  ? -10.420 7.595   -1.161  1.00 0.00 ? 3   SER A N    5  
ATOM   2768  C  CA   . SER A 1 3  ? -11.041 6.673   -0.217  1.00 0.00 ? 3   SER A CA   5  
ATOM   2769  C  C    . SER A 1 3  ? -11.670 7.432   0.949   1.00 0.00 ? 3   SER A C    5  
ATOM   2770  O  O    . SER A 1 3  ? -12.873 7.339   1.187   1.00 0.00 ? 3   SER A O    5  
ATOM   2771  C  CB   . SER A 1 3  ? -10.008 5.674   0.308   1.00 0.00 ? 3   SER A CB   5  
ATOM   2772  O  OG   . SER A 1 3  ? -10.636 4.602   0.990   1.00 0.00 ? 3   SER A OG   5  
ATOM   2773  H  H    . SER A 1 3  ? -9.496  7.884   -1.010  1.00 0.00 ? 3   SER A H    5  
ATOM   2774  H  HA   . SER A 1 3  ? -11.817 6.134   -0.740  1.00 0.00 ? 3   SER A HA   5  
ATOM   2775  H  HB2  . SER A 1 3  ? -9.443  5.276   -0.521  1.00 0.00 ? 3   SER A HB2  5  
ATOM   2776  H  HB3  . SER A 1 3  ? -9.340  6.178   0.991   1.00 0.00 ? 3   SER A HB3  5  
ATOM   2777  H  HG   . SER A 1 3  ? -11.513 4.461   0.626   1.00 0.00 ? 3   SER A HG   5  
ATOM   2778  N  N    . GLY A 1 4  ? -10.844 8.182   1.672   1.00 0.00 ? 4   GLY A N    5  
ATOM   2779  C  CA   . GLY A 1 4  ? -11.336 8.946   2.804   1.00 0.00 ? 4   GLY A CA   5  
ATOM   2780  C  C    . GLY A 1 4  ? -11.537 8.089   4.038   1.00 0.00 ? 4   GLY A C    5  
ATOM   2781  O  O    . GLY A 1 4  ? -11.158 8.480   5.142   1.00 0.00 ? 4   GLY A O    5  
ATOM   2782  H  H    . GLY A 1 4  ? -9.894  8.218   1.435   1.00 0.00 ? 4   GLY A H    5  
ATOM   2783  H  HA2  . GLY A 1 4  ? -10.627 9.727   3.032   1.00 0.00 ? 4   GLY A HA2  5  
ATOM   2784  H  HA3  . GLY A 1 4  ? -12.280 9.398   2.536   1.00 0.00 ? 4   GLY A HA3  5  
ATOM   2785  N  N    . SER A 1 5  ? -12.137 6.918   3.852   1.00 0.00 ? 5   SER A N    5  
ATOM   2786  C  CA   . SER A 1 5  ? -12.393 6.005   4.960   1.00 0.00 ? 5   SER A CA   5  
ATOM   2787  C  C    . SER A 1 5  ? -11.088 5.427   5.501   1.00 0.00 ? 5   SER A C    5  
ATOM   2788  O  O    . SER A 1 5  ? -10.029 5.582   4.892   1.00 0.00 ? 5   SER A O    5  
ATOM   2789  C  CB   . SER A 1 5  ? -13.319 4.873   4.513   1.00 0.00 ? 5   SER A CB   5  
ATOM   2790  O  OG   . SER A 1 5  ? -13.761 4.108   5.621   1.00 0.00 ? 5   SER A OG   5  
ATOM   2791  H  H    . SER A 1 5  ? -12.416 6.662   2.948   1.00 0.00 ? 5   SER A H    5  
ATOM   2792  H  HA   . SER A 1 5  ? -12.877 6.566   5.746   1.00 0.00 ? 5   SER A HA   5  
ATOM   2793  H  HB2  . SER A 1 5  ? -14.180 5.291   4.014   1.00 0.00 ? 5   SER A HB2  5  
ATOM   2794  H  HB3  . SER A 1 5  ? -12.787 4.225   3.832   1.00 0.00 ? 5   SER A HB3  5  
ATOM   2795  H  HG   . SER A 1 5  ? -14.481 3.535   5.348   1.00 0.00 ? 5   SER A HG   5  
ATOM   2796  N  N    . SER A 1 6  ? -11.174 4.761   6.647   1.00 0.00 ? 6   SER A N    5  
ATOM   2797  C  CA   . SER A 1 6  ? -10.000 4.162   7.273   1.00 0.00 ? 6   SER A CA   5  
ATOM   2798  C  C    . SER A 1 6  ? -9.589  2.885   6.546   1.00 0.00 ? 6   SER A C    5  
ATOM   2799  O  O    . SER A 1 6  ? -8.471  2.774   6.047   1.00 0.00 ? 6   SER A O    5  
ATOM   2800  C  CB   . SER A 1 6  ? -10.281 3.857   8.745   1.00 0.00 ? 6   SER A CB   5  
ATOM   2801  O  OG   . SER A 1 6  ? -9.092  3.915   9.514   1.00 0.00 ? 6   SER A OG   5  
ATOM   2802  H  H    . SER A 1 6  ? -12.047 4.672   7.084   1.00 0.00 ? 6   SER A H    5  
ATOM   2803  H  HA   . SER A 1 6  ? -9.191  4.875   7.210   1.00 0.00 ? 6   SER A HA   5  
ATOM   2804  H  HB2  . SER A 1 6  ? -10.982 4.581   9.133   1.00 0.00 ? 6   SER A HB2  5  
ATOM   2805  H  HB3  . SER A 1 6  ? -10.703 2.866   8.831   1.00 0.00 ? 6   SER A HB3  5  
ATOM   2806  H  HG   . SER A 1 6  ? -8.381  4.272   8.977   1.00 0.00 ? 6   SER A HG   5  
ATOM   2807  N  N    . GLY A 1 7  ? -10.504 1.922   6.492   1.00 0.00 ? 7   GLY A N    5  
ATOM   2808  C  CA   . GLY A 1 7  ? -10.219 0.665   5.826   1.00 0.00 ? 7   GLY A CA   5  
ATOM   2809  C  C    . GLY A 1 7  ? -10.109 -0.494  6.796   1.00 0.00 ? 7   GLY A C    5  
ATOM   2810  O  O    . GLY A 1 7  ? -10.185 -0.306  8.010   1.00 0.00 ? 7   GLY A O    5  
ATOM   2811  H  H    . GLY A 1 7  ? -11.380 2.066   6.909   1.00 0.00 ? 7   GLY A H    5  
ATOM   2812  H  HA2  . GLY A 1 7  ? -11.010 0.456   5.121   1.00 0.00 ? 7   GLY A HA2  5  
ATOM   2813  H  HA3  . GLY A 1 7  ? -9.287  0.759   5.288   1.00 0.00 ? 7   GLY A HA3  5  
ATOM   2814  N  N    . SER A 1 8  ? -9.931  -1.698  6.261   1.00 0.00 ? 8   SER A N    5  
ATOM   2815  C  CA   . SER A 1 8  ? -9.816  -2.893  7.088   1.00 0.00 ? 8   SER A CA   5  
ATOM   2816  C  C    . SER A 1 8  ? -8.939  -3.941  6.410   1.00 0.00 ? 8   SER A C    5  
ATOM   2817  O  O    . SER A 1 8  ? -8.951  -4.080  5.186   1.00 0.00 ? 8   SER A O    5  
ATOM   2818  C  CB   . SER A 1 8  ? -11.201 -3.478  7.373   1.00 0.00 ? 8   SER A CB   5  
ATOM   2819  O  OG   . SER A 1 8  ? -11.827 -2.805  8.451   1.00 0.00 ? 8   SER A OG   5  
ATOM   2820  H  H    . SER A 1 8  ? -9.879  -1.784  5.286   1.00 0.00 ? 8   SER A H    5  
ATOM   2821  H  HA   . SER A 1 8  ? -9.357  -2.607  8.022   1.00 0.00 ? 8   SER A HA   5  
ATOM   2822  H  HB2  . SER A 1 8  ? -11.819 -3.376  6.494   1.00 0.00 ? 8   SER A HB2  5  
ATOM   2823  H  HB3  . SER A 1 8  ? -11.102 -4.524  7.625   1.00 0.00 ? 8   SER A HB3  5  
ATOM   2824  H  HG   . SER A 1 8  ? -11.197 -2.213  8.868   1.00 0.00 ? 8   SER A HG   5  
ATOM   2825  N  N    . LEU A 1 9  ? -8.178  -4.676  7.213   1.00 0.00 ? 9   LEU A N    5  
ATOM   2826  C  CA   . LEU A 1 9  ? -7.294  -5.713  6.692   1.00 0.00 ? 9   LEU A CA   5  
ATOM   2827  C  C    . LEU A 1 9  ? -8.096  -6.856  6.078   1.00 0.00 ? 9   LEU A C    5  
ATOM   2828  O  O    . LEU A 1 9  ? -8.924  -7.474  6.746   1.00 0.00 ? 9   LEU A O    5  
ATOM   2829  C  CB   . LEU A 1 9  ? -6.392  -6.248  7.805   1.00 0.00 ? 9   LEU A CB   5  
ATOM   2830  C  CG   . LEU A 1 9  ? -5.507  -5.217  8.507   1.00 0.00 ? 9   LEU A CG   5  
ATOM   2831  C  CD1  . LEU A 1 9  ? -4.797  -5.844  9.696   1.00 0.00 ? 9   LEU A CD1  5  
ATOM   2832  C  CD2  . LEU A 1 9  ? -4.499  -4.627  7.531   1.00 0.00 ? 9   LEU A CD2  5  
ATOM   2833  H  H    . LEU A 1 9  ? -8.211  -4.520  8.179   1.00 0.00 ? 9   LEU A H    5  
ATOM   2834  H  HA   . LEU A 1 9  ? -6.679  -5.268  5.924   1.00 0.00 ? 9   LEU A HA   5  
ATOM   2835  H  HB2  . LEU A 1 9  ? -7.023  -6.704  8.552   1.00 0.00 ? 9   LEU A HB2  5  
ATOM   2836  H  HB3  . LEU A 1 9  ? -5.746  -7.000  7.374   1.00 0.00 ? 9   LEU A HB3  5  
ATOM   2837  H  HG   . LEU A 1 9  ? -6.127  -4.412  8.876   1.00 0.00 ? 9   LEU A HG   5  
ATOM   2838  H  HD11 . LEU A 1 9  ? -5.460  -5.855  10.547  1.00 0.00 ? 9   LEU A HD11 5  
ATOM   2839  H  HD12 . LEU A 1 9  ? -3.916  -5.267  9.934   1.00 0.00 ? 9   LEU A HD12 5  
ATOM   2840  H  HD13 . LEU A 1 9  ? -4.508  -6.856  9.450   1.00 0.00 ? 9   LEU A HD13 5  
ATOM   2841  H  HD21 . LEU A 1 9  ? -3.542  -4.524  8.021   1.00 0.00 ? 9   LEU A HD21 5  
ATOM   2842  H  HD22 . LEU A 1 9  ? -4.842  -3.657  7.202   1.00 0.00 ? 9   LEU A HD22 5  
ATOM   2843  H  HD23 . LEU A 1 9  ? -4.399  -5.282  6.677   1.00 0.00 ? 9   LEU A HD23 5  
ATOM   2844  N  N    . MET A 1 10 ? -7.844  -7.131  4.803   1.00 0.00 ? 10  MET A N    5  
ATOM   2845  C  CA   . MET A 1 10 ? -8.540  -8.202  4.100   1.00 0.00 ? 10  MET A CA   5  
ATOM   2846  C  C    . MET A 1 10 ? -7.924  -9.558  4.428   1.00 0.00 ? 10  MET A C    5  
ATOM   2847  O  O    . MET A 1 10 ? -6.887  -9.637  5.087   1.00 0.00 ? 10  MET A O    5  
ATOM   2848  C  CB   . MET A 1 10 ? -8.498  -7.962  2.590   1.00 0.00 ? 10  MET A CB   5  
ATOM   2849  C  CG   . MET A 1 10 ? -9.104  -6.633  2.168   1.00 0.00 ? 10  MET A CG   5  
ATOM   2850  S  SD   . MET A 1 10 ? -9.804  -6.685  0.507   1.00 0.00 ? 10  MET A SD   5  
ATOM   2851  C  CE   . MET A 1 10 ? -11.254 -7.700  0.782   1.00 0.00 ? 10  MET A CE   5  
ATOM   2852  H  H    . MET A 1 10 ? -7.172  -6.603  4.322   1.00 0.00 ? 10  MET A H    5  
ATOM   2853  H  HA   . MET A 1 10 ? -9.569  -8.198  4.427   1.00 0.00 ? 10  MET A HA   5  
ATOM   2854  H  HB2  . MET A 1 10 ? -7.469  -7.984  2.262   1.00 0.00 ? 10  MET A HB2  5  
ATOM   2855  H  HB3  . MET A 1 10 ? -9.042  -8.754  2.096   1.00 0.00 ? 10  MET A HB3  5  
ATOM   2856  H  HG2  . MET A 1 10 ? -9.887  -6.373  2.865   1.00 0.00 ? 10  MET A HG2  5  
ATOM   2857  H  HG3  . MET A 1 10 ? -8.334  -5.877  2.197   1.00 0.00 ? 10  MET A HG3  5  
ATOM   2858  H  HE1  . MET A 1 10 ? -11.985 -7.138  1.345   1.00 0.00 ? 10  MET A HE1  5  
ATOM   2859  H  HE2  . MET A 1 10 ? -11.677 -7.989  -0.169  1.00 0.00 ? 10  MET A HE2  5  
ATOM   2860  H  HE3  . MET A 1 10 ? -10.974 -8.584  1.335   1.00 0.00 ? 10  MET A HE3  5  
ATOM   2861  N  N    . ASP A 1 11 ? -8.570  -10.624 3.966   1.00 0.00 ? 11  ASP A N    5  
ATOM   2862  C  CA   . ASP A 1 11 ? -8.084  -11.977 4.210   1.00 0.00 ? 11  ASP A CA   5  
ATOM   2863  C  C    . ASP A 1 11 ? -7.073  -12.392 3.146   1.00 0.00 ? 11  ASP A C    5  
ATOM   2864  O  O    . ASP A 1 11 ? -6.757  -13.573 3.003   1.00 0.00 ? 11  ASP A O    5  
ATOM   2865  C  CB   . ASP A 1 11 ? -9.253  -12.964 4.234   1.00 0.00 ? 11  ASP A CB   5  
ATOM   2866  C  CG   . ASP A 1 11 ? -10.254 -12.650 5.329   1.00 0.00 ? 11  ASP A CG   5  
ATOM   2867  O  OD1  . ASP A 1 11 ? -9.833  -12.521 6.497   1.00 0.00 ? 11  ASP A OD1  5  
ATOM   2868  O  OD2  . ASP A 1 11 ? -11.458 -12.535 5.017   1.00 0.00 ? 11  ASP A OD2  5  
ATOM   2869  H  H    . ASP A 1 11 ? -9.392  -10.497 3.447   1.00 0.00 ? 11  ASP A H    5  
ATOM   2870  H  HA   . ASP A 1 11 ? -7.598  -11.986 5.174   1.00 0.00 ? 11  ASP A HA   5  
ATOM   2871  H  HB2  . ASP A 1 11 ? -9.765  -12.929 3.283   1.00 0.00 ? 11  ASP A HB2  5  
ATOM   2872  H  HB3  . ASP A 1 11 ? -8.870  -13.961 4.396   1.00 0.00 ? 11  ASP A HB3  5  
ATOM   2873  N  N    . VAL A 1 12 ? -6.570  -11.413 2.402   1.00 0.00 ? 12  VAL A N    5  
ATOM   2874  C  CA   . VAL A 1 12 ? -5.594  -11.676 1.350   1.00 0.00 ? 12  VAL A CA   5  
ATOM   2875  C  C    . VAL A 1 12 ? -4.251  -11.032 1.674   1.00 0.00 ? 12  VAL A C    5  
ATOM   2876  O  O    . VAL A 1 12 ? -4.192  -9.908  2.173   1.00 0.00 ? 12  VAL A O    5  
ATOM   2877  C  CB   . VAL A 1 12 ? -6.085  -11.157 -0.014  1.00 0.00 ? 12  VAL A CB   5  
ATOM   2878  C  CG1  . VAL A 1 12 ? -6.446  -9.682  0.075   1.00 0.00 ? 12  VAL A CG1  5  
ATOM   2879  C  CG2  . VAL A 1 12 ? -5.031  -11.393 -1.084  1.00 0.00 ? 12  VAL A CG2  5  
ATOM   2880  H  H    . VAL A 1 12 ? -6.861  -10.491 2.564   1.00 0.00 ? 12  VAL A H    5  
ATOM   2881  H  HA   . VAL A 1 12 ? -5.462  -12.746 1.278   1.00 0.00 ? 12  VAL A HA   5  
ATOM   2882  H  HB   . VAL A 1 12 ? -6.975  -11.706 -0.287  1.00 0.00 ? 12  VAL A HB   5  
ATOM   2883  H  HG11 . VAL A 1 12 ? -6.259  -9.208  -0.878  1.00 0.00 ? 12  VAL A HG11 5  
ATOM   2884  H  HG12 . VAL A 1 12 ? -7.491  -9.581  0.329   1.00 0.00 ? 12  VAL A HG12 5  
ATOM   2885  H  HG13 . VAL A 1 12 ? -5.842  -9.209  0.835   1.00 0.00 ? 12  VAL A HG13 5  
ATOM   2886  H  HG21 . VAL A 1 12 ? -5.504  -11.428 -2.055  1.00 0.00 ? 12  VAL A HG21 5  
ATOM   2887  H  HG22 . VAL A 1 12 ? -4.311  -10.589 -1.063  1.00 0.00 ? 12  VAL A HG22 5  
ATOM   2888  H  HG23 . VAL A 1 12 ? -4.529  -12.331 -0.895  1.00 0.00 ? 12  VAL A HG23 5  
ATOM   2889  N  N    . LYS A 1 13 ? -3.171  -11.751 1.385   1.00 0.00 ? 13  LYS A N    5  
ATOM   2890  C  CA   . LYS A 1 13 ? -1.827  -11.250 1.642   1.00 0.00 ? 13  LYS A CA   5  
ATOM   2891  C  C    . LYS A 1 13 ? -1.494  -10.084 0.718   1.00 0.00 ? 13  LYS A C    5  
ATOM   2892  O  O    . LYS A 1 13 ? -2.085  -9.939  -0.353  1.00 0.00 ? 13  LYS A O    5  
ATOM   2893  C  CB   . LYS A 1 13 ? -0.799  -12.370 1.459   1.00 0.00 ? 13  LYS A CB   5  
ATOM   2894  C  CG   . LYS A 1 13 ? -0.659  -13.272 2.673   1.00 0.00 ? 13  LYS A CG   5  
ATOM   2895  C  CD   . LYS A 1 13 ? -1.799  -14.272 2.759   1.00 0.00 ? 13  LYS A CD   5  
ATOM   2896  C  CE   . LYS A 1 13 ? -1.665  -15.362 1.707   1.00 0.00 ? 13  LYS A CE   5  
ATOM   2897  N  NZ   . LYS A 1 13 ? -2.805  -16.319 1.751   1.00 0.00 ? 13  LYS A NZ   5  
ATOM   2898  H  H    . LYS A 1 13 ? -3.282  -12.641 0.988   1.00 0.00 ? 13  LYS A H    5  
ATOM   2899  H  HA   . LYS A 1 13 ? -1.791  -10.905 2.665   1.00 0.00 ? 13  LYS A HA   5  
ATOM   2900  H  HB2  . LYS A 1 13 ? -1.095  -12.978 0.617   1.00 0.00 ? 13  LYS A HB2  5  
ATOM   2901  H  HB3  . LYS A 1 13 ? 0.164   -11.927 1.252   1.00 0.00 ? 13  LYS A HB3  5  
ATOM   2902  H  HG2  . LYS A 1 13 ? 0.274   -13.811 2.604   1.00 0.00 ? 13  LYS A HG2  5  
ATOM   2903  H  HG3  . LYS A 1 13 ? -0.659  -12.662 3.565   1.00 0.00 ? 13  LYS A HG3  5  
ATOM   2904  H  HD2  . LYS A 1 13 ? -1.792  -14.730 3.737   1.00 0.00 ? 13  LYS A HD2  5  
ATOM   2905  H  HD3  . LYS A 1 13 ? -2.735  -13.752 2.610   1.00 0.00 ? 13  LYS A HD3  5  
ATOM   2906  H  HE2  . LYS A 1 13 ? -1.632  -14.901 0.732   1.00 0.00 ? 13  LYS A HE2  5  
ATOM   2907  H  HE3  . LYS A 1 13 ? -0.746  -15.902 1.881   1.00 0.00 ? 13  LYS A HE3  5  
ATOM   2908  H  HZ1  . LYS A 1 13 ? -2.464  -17.290 1.599   1.00 0.00 ? 13  LYS A HZ1  5  
ATOM   2909  H  HZ2  . LYS A 1 13 ? -3.497  -16.086 1.010   1.00 0.00 ? 13  LYS A HZ2  5  
ATOM   2910  H  HZ3  . LYS A 1 13 ? -3.277  -16.270 2.677   1.00 0.00 ? 13  LYS A HZ3  5  
ATOM   2911  N  N    . CYS A 1 14 ? -0.543  -9.255  1.136   1.00 0.00 ? 14  CYS A N    5  
ATOM   2912  C  CA   . CYS A 1 14 ? -0.131  -8.102  0.346   1.00 0.00 ? 14  CYS A CA   5  
ATOM   2913  C  C    . CYS A 1 14 ? 0.349   -8.534  -1.037  1.00 0.00 ? 14  CYS A C    5  
ATOM   2914  O  O    . CYS A 1 14 ? 1.057   -9.531  -1.175  1.00 0.00 ? 14  CYS A O    5  
ATOM   2915  C  CB   . CYS A 1 14 ? 0.979   -7.334  1.066   1.00 0.00 ? 14  CYS A CB   5  
ATOM   2916  S  SG   . CYS A 1 14 ? 1.709   -5.986  0.083   1.00 0.00 ? 14  CYS A SG   5  
ATOM   2917  H  H    . CYS A 1 14 ? -0.108  -9.423  1.999   1.00 0.00 ? 14  CYS A H    5  
ATOM   2918  H  HA   . CYS A 1 14 ? -0.987  -7.455  0.230   1.00 0.00 ? 14  CYS A HA   5  
ATOM   2919  H  HB2  . CYS A 1 14 ? 0.578   -6.900  1.970   1.00 0.00 ? 14  CYS A HB2  5  
ATOM   2920  H  HB3  . CYS A 1 14 ? 1.772   -8.020  1.324   1.00 0.00 ? 14  CYS A HB3  5  
ATOM   2921  N  N    . GLU A 1 15 ? -0.042  -7.776  -2.057  1.00 0.00 ? 15  GLU A N    5  
ATOM   2922  C  CA   . GLU A 1 15 ? 0.348   -8.082  -3.428  1.00 0.00 ? 15  GLU A CA   5  
ATOM   2923  C  C    . GLU A 1 15 ? 1.752   -8.678  -3.475  1.00 0.00 ? 15  GLU A C    5  
ATOM   2924  O  O    . GLU A 1 15 ? 1.944   -9.812  -3.917  1.00 0.00 ? 15  GLU A O    5  
ATOM   2925  C  CB   . GLU A 1 15 ? 0.290   -6.820  -4.292  1.00 0.00 ? 15  GLU A CB   5  
ATOM   2926  C  CG   . GLU A 1 15 ? 0.657   -7.060  -5.746  1.00 0.00 ? 15  GLU A CG   5  
ATOM   2927  C  CD   . GLU A 1 15 ? -0.115  -8.211  -6.361  1.00 0.00 ? 15  GLU A CD   5  
ATOM   2928  O  OE1  . GLU A 1 15 ? -1.358  -8.118  -6.440  1.00 0.00 ? 15  GLU A OE1  5  
ATOM   2929  O  OE2  . GLU A 1 15 ? 0.524   -9.206  -6.763  1.00 0.00 ? 15  GLU A OE2  5  
ATOM   2930  H  H    . GLU A 1 15 ? -0.606  -6.994  -1.883  1.00 0.00 ? 15  GLU A H    5  
ATOM   2931  H  HA   . GLU A 1 15 ? -0.351  -8.806  -3.818  1.00 0.00 ? 15  GLU A HA   5  
ATOM   2932  H  HB2  . GLU A 1 15 ? -0.713  -6.420  -4.256  1.00 0.00 ? 15  GLU A HB2  5  
ATOM   2933  H  HB3  . GLU A 1 15 ? 0.973   -6.089  -3.886  1.00 0.00 ? 15  GLU A HB3  5  
ATOM   2934  H  HG2  . GLU A 1 15 ? 0.446   -6.164  -6.310  1.00 0.00 ? 15  GLU A HG2  5  
ATOM   2935  H  HG3  . GLU A 1 15 ? 1.713   -7.281  -5.806  1.00 0.00 ? 15  GLU A HG3  5  
ATOM   2936  N  N    . THR A 1 16 ? 2.732   -7.907  -3.015  1.00 0.00 ? 16  THR A N    5  
ATOM   2937  C  CA   . THR A 1 16 ? 4.118   -8.356  -3.005  1.00 0.00 ? 16  THR A CA   5  
ATOM   2938  C  C    . THR A 1 16 ? 4.251   -9.715  -2.326  1.00 0.00 ? 16  THR A C    5  
ATOM   2939  O  O    . THR A 1 16 ? 3.840   -9.906  -1.181  1.00 0.00 ? 16  THR A O    5  
ATOM   2940  C  CB   . THR A 1 16 ? 5.032   -7.345  -2.288  1.00 0.00 ? 16  THR A CB   5  
ATOM   2941  O  OG1  . THR A 1 16 ? 5.064   -6.112  -3.015  1.00 0.00 ? 16  THR A OG1  5  
ATOM   2942  C  CG2  . THR A 1 16 ? 6.444   -7.895  -2.149  1.00 0.00 ? 16  THR A CG2  5  
ATOM   2943  H  H    . THR A 1 16 ? 2.516   -7.013  -2.676  1.00 0.00 ? 16  THR A H    5  
ATOM   2944  H  HA   . THR A 1 16 ? 4.448   -8.443  -4.030  1.00 0.00 ? 16  THR A HA   5  
ATOM   2945  H  HB   . THR A 1 16 ? 4.634   -7.161  -1.300  1.00 0.00 ? 16  THR A HB   5  
ATOM   2946  H  HG1  . THR A 1 16 ? 4.666   -5.417  -2.485  1.00 0.00 ? 16  THR A HG1  5  
ATOM   2947  H  HG21 . THR A 1 16 ? 7.156   -7.108  -2.347  1.00 0.00 ? 16  THR A HG21 5  
ATOM   2948  H  HG22 . THR A 1 16 ? 6.589   -8.698  -2.856  1.00 0.00 ? 16  THR A HG22 5  
ATOM   2949  H  HG23 . THR A 1 16 ? 6.587   -8.268  -1.146  1.00 0.00 ? 16  THR A HG23 5  
ATOM   2950  N  N    . PRO A 1 17 ? 4.838   -10.682 -3.046  1.00 0.00 ? 17  PRO A N    5  
ATOM   2951  C  CA   . PRO A 1 17 ? 5.039   -12.040 -2.531  1.00 0.00 ? 17  PRO A CA   5  
ATOM   2952  C  C    . PRO A 1 17 ? 6.088   -12.091 -1.425  1.00 0.00 ? 17  PRO A C    5  
ATOM   2953  O  O    . PRO A 1 17 ? 6.344   -13.147 -0.849  1.00 0.00 ? 17  PRO A O    5  
ATOM   2954  C  CB   . PRO A 1 17 ? 5.520   -12.817 -3.759  1.00 0.00 ? 17  PRO A CB   5  
ATOM   2955  C  CG   . PRO A 1 17 ? 6.137   -11.787 -4.642  1.00 0.00 ? 17  PRO A CG   5  
ATOM   2956  C  CD   . PRO A 1 17 ? 5.351   -10.525 -4.417  1.00 0.00 ? 17  PRO A CD   5  
ATOM   2957  H  HA   . PRO A 1 17 ? 4.116   -12.469 -2.171  1.00 0.00 ? 17  PRO A HA   5  
ATOM   2958  H  HB2  . PRO A 1 17 ? 6.241   -13.563 -3.457  1.00 0.00 ? 17  PRO A HB2  5  
ATOM   2959  H  HB3  . PRO A 1 17 ? 4.679   -13.295 -4.239  1.00 0.00 ? 17  PRO A HB3  5  
ATOM   2960  H  HG2  . PRO A 1 17 ? 7.170   -11.640 -4.367  1.00 0.00 ? 17  PRO A HG2  5  
ATOM   2961  H  HG3  . PRO A 1 17 ? 6.062   -12.096 -5.674  1.00 0.00 ? 17  PRO A HG3  5  
ATOM   2962  H  HD2  . PRO A 1 17 ? 5.996   -9.661  -4.491  1.00 0.00 ? 17  PRO A HD2  5  
ATOM   2963  H  HD3  . PRO A 1 17 ? 4.540   -10.454 -5.126  1.00 0.00 ? 17  PRO A HD3  5  
ATOM   2964  N  N    . ASN A 1 18 ? 6.690   -10.943 -1.133  1.00 0.00 ? 18  ASN A N    5  
ATOM   2965  C  CA   . ASN A 1 18 ? 7.711   -10.858 -0.095  1.00 0.00 ? 18  ASN A CA   5  
ATOM   2966  C  C    . ASN A 1 18 ? 7.164   -10.167 1.151   1.00 0.00 ? 18  ASN A C    5  
ATOM   2967  O  O    . ASN A 1 18 ? 7.742   -10.267 2.233   1.00 0.00 ? 18  ASN A O    5  
ATOM   2968  C  CB   . ASN A 1 18 ? 8.935   -10.101 -0.615  1.00 0.00 ? 18  ASN A CB   5  
ATOM   2969  C  CG   . ASN A 1 18 ? 10.191  -10.423 0.171   1.00 0.00 ? 18  ASN A CG   5  
ATOM   2970  O  OD1  . ASN A 1 18 ? 10.557  -9.703  1.100   1.00 0.00 ? 18  ASN A OD1  5  
ATOM   2971  N  ND2  . ASN A 1 18 ? 10.858  -11.510 -0.200  1.00 0.00 ? 18  ASN A ND2  5  
ATOM   2972  H  H    . ASN A 1 18 ? 6.442   -10.134 -1.627  1.00 0.00 ? 18  ASN A H    5  
ATOM   2973  H  HA   . ASN A 1 18 ? 8.004   -11.864 0.164   1.00 0.00 ? 18  ASN A HA   5  
ATOM   2974  H  HB2  . ASN A 1 18 ? 9.102   -10.367 -1.649  1.00 0.00 ? 18  ASN A HB2  5  
ATOM   2975  H  HB3  . ASN A 1 18 ? 8.751   -9.039  -0.546  1.00 0.00 ? 18  ASN A HB3  5  
ATOM   2976  H  HD21 . ASN A 1 18 ? 10.507  -12.036 -0.949  1.00 0.00 ? 18  ASN A HD21 5  
ATOM   2977  H  HD22 . ASN A 1 18 ? 11.673  -11.742 0.292   1.00 0.00 ? 18  ASN A HD22 5  
ATOM   2978  N  N    . CYS A 1 19 ? 6.045   -9.468  0.990   1.00 0.00 ? 19  CYS A N    5  
ATOM   2979  C  CA   . CYS A 1 19 ? 5.419   -8.761  2.100   1.00 0.00 ? 19  CYS A CA   5  
ATOM   2980  C  C    . CYS A 1 19 ? 4.444   -9.670  2.843   1.00 0.00 ? 19  CYS A C    5  
ATOM   2981  O  O    . CYS A 1 19 ? 3.383   -10.031 2.334   1.00 0.00 ? 19  CYS A O    5  
ATOM   2982  C  CB   . CYS A 1 19 ? 4.687   -7.517  1.592   1.00 0.00 ? 19  CYS A CB   5  
ATOM   2983  S  SG   . CYS A 1 19 ? 4.316   -6.291  2.887   1.00 0.00 ? 19  CYS A SG   5  
ATOM   2984  H  H    . CYS A 1 19 ? 5.631   -9.426  0.102   1.00 0.00 ? 19  CYS A H    5  
ATOM   2985  H  HA   . CYS A 1 19 ? 6.198   -8.456  2.782   1.00 0.00 ? 19  CYS A HA   5  
ATOM   2986  H  HB2  . CYS A 1 19 ? 5.297   -7.030  0.845   1.00 0.00 ? 19  CYS A HB2  5  
ATOM   2987  H  HB3  . CYS A 1 19 ? 3.751   -7.817  1.145   1.00 0.00 ? 19  CYS A HB3  5  
ATOM   2988  N  N    . PRO A 1 20 ? 4.811   -10.048 4.076   1.00 0.00 ? 20  PRO A N    5  
ATOM   2989  C  CA   . PRO A 1 20 ? 3.983   -10.918 4.917   1.00 0.00 ? 20  PRO A CA   5  
ATOM   2990  C  C    . PRO A 1 20 ? 2.716   -10.222 5.401   1.00 0.00 ? 20  PRO A C    5  
ATOM   2991  O  O    . PRO A 1 20 ? 1.780   -10.870 5.870   1.00 0.00 ? 20  PRO A O    5  
ATOM   2992  C  CB   . PRO A 1 20 ? 4.898   -11.246 6.099   1.00 0.00 ? 20  PRO A CB   5  
ATOM   2993  C  CG   . PRO A 1 20 ? 5.853   -10.104 6.166   1.00 0.00 ? 20  PRO A CG   5  
ATOM   2994  C  CD   . PRO A 1 20 ? 6.062   -9.655  4.746   1.00 0.00 ? 20  PRO A CD   5  
ATOM   2995  H  HA   . PRO A 1 20 ? 3.717   -11.830 4.402   1.00 0.00 ? 20  PRO A HA   5  
ATOM   2996  H  HB2  . PRO A 1 20 ? 4.310   -11.323 7.002   1.00 0.00 ? 20  PRO A HB2  5  
ATOM   2997  H  HB3  . PRO A 1 20 ? 5.411   -12.178 5.915   1.00 0.00 ? 20  PRO A HB3  5  
ATOM   2998  H  HG2  . PRO A 1 20 ? 5.429   -9.304  6.754   1.00 0.00 ? 20  PRO A HG2  5  
ATOM   2999  H  HG3  . PRO A 1 20 ? 6.788   -10.432 6.596   1.00 0.00 ? 20  PRO A HG3  5  
ATOM   3000  H  HD2  . PRO A 1 20 ? 6.201   -8.585  4.706   1.00 0.00 ? 20  PRO A HD2  5  
ATOM   3001  H  HD3  . PRO A 1 20 ? 6.908   -10.164 4.310   1.00 0.00 ? 20  PRO A HD3  5  
ATOM   3002  N  N    . PHE A 1 21 ? 2.692   -8.898  5.284   1.00 0.00 ? 21  PHE A N    5  
ATOM   3003  C  CA   . PHE A 1 21 ? 1.539   -8.114  5.711   1.00 0.00 ? 21  PHE A CA   5  
ATOM   3004  C  C    . PHE A 1 21 ? 0.390   -8.251  4.717   1.00 0.00 ? 21  PHE A C    5  
ATOM   3005  O  O    . PHE A 1 21 ? 0.608   -8.458  3.523   1.00 0.00 ? 21  PHE A O    5  
ATOM   3006  C  CB   . PHE A 1 21 ? 1.926   -6.641  5.861   1.00 0.00 ? 21  PHE A CB   5  
ATOM   3007  C  CG   . PHE A 1 21 ? 2.709   -6.351  7.109   1.00 0.00 ? 21  PHE A CG   5  
ATOM   3008  C  CD1  . PHE A 1 21 ? 3.973   -6.888  7.290   1.00 0.00 ? 21  PHE A CD1  5  
ATOM   3009  C  CD2  . PHE A 1 21 ? 2.182   -5.540  8.102   1.00 0.00 ? 21  PHE A CD2  5  
ATOM   3010  C  CE1  . PHE A 1 21 ? 4.696   -6.624  8.438   1.00 0.00 ? 21  PHE A CE1  5  
ATOM   3011  C  CE2  . PHE A 1 21 ? 2.900   -5.272  9.252   1.00 0.00 ? 21  PHE A CE2  5  
ATOM   3012  C  CZ   . PHE A 1 21 ? 4.159   -5.814  9.420   1.00 0.00 ? 21  PHE A CZ   5  
ATOM   3013  H  H    . PHE A 1 21 ? 3.469   -8.438  4.903   1.00 0.00 ? 21  PHE A H    5  
ATOM   3014  H  HA   . PHE A 1 21 ? 1.218   -8.492  6.669   1.00 0.00 ? 21  PHE A HA   5  
ATOM   3015  H  HB2  . PHE A 1 21 ? 2.529   -6.346  5.016   1.00 0.00 ? 21  PHE A HB2  5  
ATOM   3016  H  HB3  . PHE A 1 21 ? 1.028   -6.042  5.884   1.00 0.00 ? 21  PHE A HB3  5  
ATOM   3017  H  HD1  . PHE A 1 21 ? 4.395   -7.521  6.523   1.00 0.00 ? 21  PHE A HD1  5  
ATOM   3018  H  HD2  . PHE A 1 21 ? 1.196   -5.116  7.971   1.00 0.00 ? 21  PHE A HD2  5  
ATOM   3019  H  HE1  . PHE A 1 21 ? 5.680   -7.048  8.567   1.00 0.00 ? 21  PHE A HE1  5  
ATOM   3020  H  HE2  . PHE A 1 21 ? 2.477   -4.638  10.017  1.00 0.00 ? 21  PHE A HE2  5  
ATOM   3021  H  HZ   . PHE A 1 21 ? 4.722   -5.606  10.318  1.00 0.00 ? 21  PHE A HZ   5  
ATOM   3022  N  N    . PHE A 1 22 ? -0.835  -8.135  5.218   1.00 0.00 ? 22  PHE A N    5  
ATOM   3023  C  CA   . PHE A 1 22 ? -2.020  -8.247  4.376   1.00 0.00 ? 22  PHE A CA   5  
ATOM   3024  C  C    . PHE A 1 22 ? -2.375  -6.900  3.754   1.00 0.00 ? 22  PHE A C    5  
ATOM   3025  O  O    . PHE A 1 22 ? -2.017  -5.847  4.282   1.00 0.00 ? 22  PHE A O    5  
ATOM   3026  C  CB   . PHE A 1 22 ? -3.203  -8.774  5.190   1.00 0.00 ? 22  PHE A CB   5  
ATOM   3027  C  CG   . PHE A 1 22 ? -3.022  -10.187 5.666   1.00 0.00 ? 22  PHE A CG   5  
ATOM   3028  C  CD1  . PHE A 1 22 ? -2.263  -10.461 6.792   1.00 0.00 ? 22  PHE A CD1  5  
ATOM   3029  C  CD2  . PHE A 1 22 ? -3.612  -11.241 4.986   1.00 0.00 ? 22  PHE A CD2  5  
ATOM   3030  C  CE1  . PHE A 1 22 ? -2.095  -11.761 7.232   1.00 0.00 ? 22  PHE A CE1  5  
ATOM   3031  C  CE2  . PHE A 1 22 ? -3.447  -12.542 5.422   1.00 0.00 ? 22  PHE A CE2  5  
ATOM   3032  C  CZ   . PHE A 1 22 ? -2.687  -12.803 6.545   1.00 0.00 ? 22  PHE A CZ   5  
ATOM   3033  H  H    . PHE A 1 22 ? -0.945  -7.970  6.178   1.00 0.00 ? 22  PHE A H    5  
ATOM   3034  H  HA   . PHE A 1 22 ? -1.798  -8.947  3.585   1.00 0.00 ? 22  PHE A HA   5  
ATOM   3035  H  HB2  . PHE A 1 22 ? -3.340  -8.147  6.059   1.00 0.00 ? 22  PHE A HB2  5  
ATOM   3036  H  HB3  . PHE A 1 22 ? -4.094  -8.738  4.582   1.00 0.00 ? 22  PHE A HB3  5  
ATOM   3037  H  HD1  . PHE A 1 22 ? -1.799  -9.646  7.329   1.00 0.00 ? 22  PHE A HD1  5  
ATOM   3038  H  HD2  . PHE A 1 22 ? -4.205  -11.039 4.107   1.00 0.00 ? 22  PHE A HD2  5  
ATOM   3039  H  HE1  . PHE A 1 22 ? -1.500  -11.960 8.111   1.00 0.00 ? 22  PHE A HE1  5  
ATOM   3040  H  HE2  . PHE A 1 22 ? -3.911  -13.355 4.883   1.00 0.00 ? 22  PHE A HE2  5  
ATOM   3041  H  HZ   . PHE A 1 22 ? -2.558  -13.818 6.888   1.00 0.00 ? 22  PHE A HZ   5  
ATOM   3042  N  N    . MET A 1 23 ? -3.081  -6.941  2.629   1.00 0.00 ? 23  MET A N    5  
ATOM   3043  C  CA   . MET A 1 23 ? -3.485  -5.724  1.935   1.00 0.00 ? 23  MET A CA   5  
ATOM   3044  C  C    . MET A 1 23 ? -4.857  -5.257  2.412   1.00 0.00 ? 23  MET A C    5  
ATOM   3045  O  O    . MET A 1 23 ? -5.831  -6.007  2.360   1.00 0.00 ? 23  MET A O    5  
ATOM   3046  C  CB   . MET A 1 23 ? -3.510  -5.957  0.423   1.00 0.00 ? 23  MET A CB   5  
ATOM   3047  C  CG   . MET A 1 23 ? -4.281  -7.202  0.013   1.00 0.00 ? 23  MET A CG   5  
ATOM   3048  S  SD   . MET A 1 23 ? -4.940  -7.090  -1.662  1.00 0.00 ? 23  MET A SD   5  
ATOM   3049  C  CE   . MET A 1 23 ? -3.794  -8.144  -2.547  1.00 0.00 ? 23  MET A CE   5  
ATOM   3050  H  H    . MET A 1 23 ? -3.337  -7.811  2.256   1.00 0.00 ? 23  MET A H    5  
ATOM   3051  H  HA   . MET A 1 23 ? -2.759  -4.958  2.160   1.00 0.00 ? 23  MET A HA   5  
ATOM   3052  H  HB2  . MET A 1 23 ? -3.968  -5.103  -0.053  1.00 0.00 ? 23  MET A HB2  5  
ATOM   3053  H  HB3  . MET A 1 23 ? -2.495  -6.057  0.069   1.00 0.00 ? 23  MET A HB3  5  
ATOM   3054  H  HG2  . MET A 1 23 ? -3.620  -8.054  0.068   1.00 0.00 ? 23  MET A HG2  5  
ATOM   3055  H  HG3  . MET A 1 23 ? -5.103  -7.342  0.700   1.00 0.00 ? 23  MET A HG3  5  
ATOM   3056  H  HE1  . MET A 1 23 ? -4.252  -9.107  -2.721  1.00 0.00 ? 23  MET A HE1  5  
ATOM   3057  H  HE2  . MET A 1 23 ? -3.543  -7.689  -3.494  1.00 0.00 ? 23  MET A HE2  5  
ATOM   3058  H  HE3  . MET A 1 23 ? -2.896  -8.272  -1.960  1.00 0.00 ? 23  MET A HE3  5  
ATOM   3059  N  N    . SER A 1 24 ? -4.925  -4.013  2.877   1.00 0.00 ? 24  SER A N    5  
ATOM   3060  C  CA   . SER A 1 24 ? -6.177  -3.448  3.367   1.00 0.00 ? 24  SER A CA   5  
ATOM   3061  C  C    . SER A 1 24 ? -7.151  -3.208  2.218   1.00 0.00 ? 24  SER A C    5  
ATOM   3062  O  O    . SER A 1 24 ? -6.832  -3.457  1.055   1.00 0.00 ? 24  SER A O    5  
ATOM   3063  C  CB   . SER A 1 24 ? -5.912  -2.136  4.108   1.00 0.00 ? 24  SER A CB   5  
ATOM   3064  O  OG   . SER A 1 24 ? -6.887  -1.912  5.112   1.00 0.00 ? 24  SER A OG   5  
ATOM   3065  H  H    . SER A 1 24 ? -4.113  -3.464  2.893   1.00 0.00 ? 24  SER A H    5  
ATOM   3066  H  HA   . SER A 1 24 ? -6.615  -4.157  4.053   1.00 0.00 ? 24  SER A HA   5  
ATOM   3067  H  HB2  . SER A 1 24 ? -4.938  -2.177  4.571   1.00 0.00 ? 24  SER A HB2  5  
ATOM   3068  H  HB3  . SER A 1 24 ? -5.942  -1.316  3.405   1.00 0.00 ? 24  SER A HB3  5  
ATOM   3069  H  HG   . SER A 1 24 ? -7.622  -1.420  4.741   1.00 0.00 ? 24  SER A HG   5  
ATOM   3070  N  N    . VAL A 1 25 ? -8.343  -2.723  2.552   1.00 0.00 ? 25  VAL A N    5  
ATOM   3071  C  CA   . VAL A 1 25 ? -9.365  -2.449  1.549   1.00 0.00 ? 25  VAL A CA   5  
ATOM   3072  C  C    . VAL A 1 25 ? -9.066  -1.156  0.799   1.00 0.00 ? 25  VAL A C    5  
ATOM   3073  O  O    . VAL A 1 25 ? -9.455  -0.993  -0.356  1.00 0.00 ? 25  VAL A O    5  
ATOM   3074  C  CB   . VAL A 1 25 ? -10.764 -2.347  2.187   1.00 0.00 ? 25  VAL A CB   5  
ATOM   3075  C  CG1  . VAL A 1 25 ? -11.810 -2.025  1.131   1.00 0.00 ? 25  VAL A CG1  5  
ATOM   3076  C  CG2  . VAL A 1 25 ? -11.110 -3.636  2.917   1.00 0.00 ? 25  VAL A CG2  5  
ATOM   3077  H  H    . VAL A 1 25 ? -8.539  -2.545  3.496   1.00 0.00 ? 25  VAL A H    5  
ATOM   3078  H  HA   . VAL A 1 25 ? -9.372  -3.269  0.846   1.00 0.00 ? 25  VAL A HA   5  
ATOM   3079  H  HB   . VAL A 1 25 ? -10.751 -1.542  2.907   1.00 0.00 ? 25  VAL A HB   5  
ATOM   3080  H  HG11 . VAL A 1 25 ? -11.683 -2.685  0.286   1.00 0.00 ? 25  VAL A HG11 5  
ATOM   3081  H  HG12 . VAL A 1 25 ? -12.797 -2.159  1.549   1.00 0.00 ? 25  VAL A HG12 5  
ATOM   3082  H  HG13 . VAL A 1 25 ? -11.692 -1.001  0.808   1.00 0.00 ? 25  VAL A HG13 5  
ATOM   3083  H  HG21 . VAL A 1 25 ? -12.041 -4.027  2.535   1.00 0.00 ? 25  VAL A HG21 5  
ATOM   3084  H  HG22 . VAL A 1 25 ? -10.324 -4.359  2.763   1.00 0.00 ? 25  VAL A HG22 5  
ATOM   3085  H  HG23 . VAL A 1 25 ? -11.212 -3.435  3.974   1.00 0.00 ? 25  VAL A HG23 5  
ATOM   3086  N  N    . ASN A 1 26 ? -8.371  -0.239  1.465   1.00 0.00 ? 26  ASN A N    5  
ATOM   3087  C  CA   . ASN A 1 26 ? -8.019  1.041   0.861   1.00 0.00 ? 26  ASN A CA   5  
ATOM   3088  C  C    . ASN A 1 26 ? -6.544  1.072   0.474   1.00 0.00 ? 26  ASN A C    5  
ATOM   3089  O  O    . ASN A 1 26 ? -6.044  2.076   -0.036  1.00 0.00 ? 26  ASN A O    5  
ATOM   3090  C  CB   . ASN A 1 26 ? -8.328  2.187   1.827   1.00 0.00 ? 26  ASN A CB   5  
ATOM   3091  C  CG   . ASN A 1 26 ? -7.210  2.420   2.824   1.00 0.00 ? 26  ASN A CG   5  
ATOM   3092  O  OD1  . ASN A 1 26 ? -7.191  1.825   3.902   1.00 0.00 ? 26  ASN A OD1  5  
ATOM   3093  N  ND2  . ASN A 1 26 ? -6.272  3.290   2.468   1.00 0.00 ? 26  ASN A ND2  5  
ATOM   3094  H  H    . ASN A 1 26 ? -8.089  -0.427  2.384   1.00 0.00 ? 26  ASN A H    5  
ATOM   3095  H  HA   . ASN A 1 26 ? -8.616  1.162   -0.030  1.00 0.00 ? 26  ASN A HA   5  
ATOM   3096  H  HB2  . ASN A 1 26 ? -8.476  3.096   1.262   1.00 0.00 ? 26  ASN A HB2  5  
ATOM   3097  H  HB3  . ASN A 1 26 ? -9.231  1.956   2.372   1.00 0.00 ? 26  ASN A HB3  5  
ATOM   3098  H  HD21 . ASN A 1 26 ? -6.352  3.726   1.594   1.00 0.00 ? 26  ASN A HD21 5  
ATOM   3099  H  HD22 . ASN A 1 26 ? -5.537  3.459   3.094   1.00 0.00 ? 26  ASN A HD22 5  
ATOM   3100  N  N    . THR A 1 27 ? -5.850  -0.036  0.718   1.00 0.00 ? 27  THR A N    5  
ATOM   3101  C  CA   . THR A 1 27 ? -4.432  -0.136  0.395   1.00 0.00 ? 27  THR A CA   5  
ATOM   3102  C  C    . THR A 1 27 ? -4.195  -1.123  -0.742  1.00 0.00 ? 27  THR A C    5  
ATOM   3103  O  O    . THR A 1 27 ? -3.198  -1.031  -1.458  1.00 0.00 ? 27  THR A O    5  
ATOM   3104  C  CB   . THR A 1 27 ? -3.607  -0.574  1.620   1.00 0.00 ? 27  THR A CB   5  
ATOM   3105  O  OG1  . THR A 1 27 ? -3.926  -1.926  1.968   1.00 0.00 ? 27  THR A OG1  5  
ATOM   3106  C  CG2  . THR A 1 27 ? -3.877  0.337   2.808   1.00 0.00 ? 27  THR A CG2  5  
ATOM   3107  H  H    . THR A 1 27 ? -6.304  -0.803  1.125   1.00 0.00 ? 27  THR A H    5  
ATOM   3108  H  HA   . THR A 1 27 ? -4.090  0.842   0.088   1.00 0.00 ? 27  THR A HA   5  
ATOM   3109  H  HB   . THR A 1 27 ? -2.558  -0.512  1.369   1.00 0.00 ? 27  THR A HB   5  
ATOM   3110  H  HG1  . THR A 1 27 ? -3.807  -2.490  1.199   1.00 0.00 ? 27  THR A HG1  5  
ATOM   3111  H  HG21 . THR A 1 27 ? -3.924  -0.253  3.711   1.00 0.00 ? 27  THR A HG21 5  
ATOM   3112  H  HG22 . THR A 1 27 ? -4.817  0.849   2.663   1.00 0.00 ? 27  THR A HG22 5  
ATOM   3113  H  HG23 . THR A 1 27 ? -3.081  1.063   2.893   1.00 0.00 ? 27  THR A HG23 5  
ATOM   3114  N  N    . GLN A 1 28 ? -5.118  -2.066  -0.902  1.00 0.00 ? 28  GLN A N    5  
ATOM   3115  C  CA   . GLN A 1 28 ? -5.008  -3.071  -1.954  1.00 0.00 ? 28  GLN A CA   5  
ATOM   3116  C  C    . GLN A 1 28 ? -4.777  -2.415  -3.311  1.00 0.00 ? 28  GLN A C    5  
ATOM   3117  O  O    . GLN A 1 28 ? -5.177  -1.276  -3.554  1.00 0.00 ? 28  GLN A O    5  
ATOM   3118  C  CB   . GLN A 1 28 ? -6.271  -3.932  -1.999  1.00 0.00 ? 28  GLN A CB   5  
ATOM   3119  C  CG   . GLN A 1 28 ? -7.452  -3.246  -2.667  1.00 0.00 ? 28  GLN A CG   5  
ATOM   3120  C  CD   . GLN A 1 28 ? -8.625  -4.182  -2.881  1.00 0.00 ? 28  GLN A CD   5  
ATOM   3121  O  OE1  . GLN A 1 28 ? -8.622  -4.999  -3.802  1.00 0.00 ? 28  GLN A OE1  5  
ATOM   3122  N  NE2  . GLN A 1 28 ? -9.638  -4.067  -2.030  1.00 0.00 ? 28  GLN A NE2  5  
ATOM   3123  H  H    . GLN A 1 28 ? -5.890  -2.087  -0.300  1.00 0.00 ? 28  GLN A H    5  
ATOM   3124  H  HA   . GLN A 1 28 ? -4.162  -3.700  -1.723  1.00 0.00 ? 28  GLN A HA   5  
ATOM   3125  H  HB2  . GLN A 1 28 ? -6.054  -4.840  -2.543  1.00 0.00 ? 28  GLN A HB2  5  
ATOM   3126  H  HB3  . GLN A 1 28 ? -6.555  -4.187  -0.988  1.00 0.00 ? 28  GLN A HB3  5  
ATOM   3127  H  HG2  . GLN A 1 28 ? -7.775  -2.426  -2.043  1.00 0.00 ? 28  GLN A HG2  5  
ATOM   3128  H  HG3  . GLN A 1 28 ? -7.134  -2.864  -3.626  1.00 0.00 ? 28  GLN A HG3  5  
ATOM   3129  H  HE21 . GLN A 1 28 ? -9.572  -3.393  -1.321  1.00 0.00 ? 28  GLN A HE21 5  
ATOM   3130  H  HE22 . GLN A 1 28 ? -10.409 -4.659  -2.146  1.00 0.00 ? 28  GLN A HE22 5  
ATOM   3131  N  N    . PRO A 1 29 ? -4.115  -3.148  -4.218  1.00 0.00 ? 29  PRO A N    5  
ATOM   3132  C  CA   . PRO A 1 29 ? -3.633  -4.504  -3.940  1.00 0.00 ? 29  PRO A CA   5  
ATOM   3133  C  C    . PRO A 1 29 ? -2.478  -4.516  -2.944  1.00 0.00 ? 29  PRO A C    5  
ATOM   3134  O  O    . PRO A 1 29 ? -2.089  -5.572  -2.442  1.00 0.00 ? 29  PRO A O    5  
ATOM   3135  C  CB   . PRO A 1 29 ? -3.162  -5.001  -5.309  1.00 0.00 ? 29  PRO A CB   5  
ATOM   3136  C  CG   . PRO A 1 29 ? -2.826  -3.763  -6.067  1.00 0.00 ? 29  PRO A CG   5  
ATOM   3137  C  CD   . PRO A 1 29 ? -3.785  -2.710  -5.585  1.00 0.00 ? 29  PRO A CD   5  
ATOM   3138  H  HA   . PRO A 1 29 ? -4.426  -5.141  -3.578  1.00 0.00 ? 29  PRO A HA   5  
ATOM   3139  H  HB2  . PRO A 1 29 ? -2.297  -5.637  -5.186  1.00 0.00 ? 29  PRO A HB2  5  
ATOM   3140  H  HB3  . PRO A 1 29 ? -3.957  -5.554  -5.788  1.00 0.00 ? 29  PRO A HB3  5  
ATOM   3141  H  HG2  . PRO A 1 29 ? -1.809  -3.469  -5.857  1.00 0.00 ? 29  PRO A HG2  5  
ATOM   3142  H  HG3  . PRO A 1 29 ? -2.958  -3.933  -7.125  1.00 0.00 ? 29  PRO A HG3  5  
ATOM   3143  H  HD2  . PRO A 1 29 ? -3.308  -1.741  -5.575  1.00 0.00 ? 29  PRO A HD2  5  
ATOM   3144  H  HD3  . PRO A 1 29 ? -4.669  -2.691  -6.206  1.00 0.00 ? 29  PRO A HD3  5  
ATOM   3145  N  N    . LEU A 1 30 ? -1.935  -3.338  -2.660  1.00 0.00 ? 30  LEU A N    5  
ATOM   3146  C  CA   . LEU A 1 30 ? -0.825  -3.212  -1.722  1.00 0.00 ? 30  LEU A CA   5  
ATOM   3147  C  C    . LEU A 1 30 ? -1.334  -3.086  -0.290  1.00 0.00 ? 30  LEU A C    5  
ATOM   3148  O  O    . LEU A 1 30 ? -2.533  -2.926  -0.057  1.00 0.00 ? 30  LEU A O    5  
ATOM   3149  C  CB   . LEU A 1 30 ? 0.035   -1.999  -2.079  1.00 0.00 ? 30  LEU A CB   5  
ATOM   3150  C  CG   . LEU A 1 30 ? 0.925   -2.146  -3.314  1.00 0.00 ? 30  LEU A CG   5  
ATOM   3151  C  CD1  . LEU A 1 30 ? 1.645   -0.841  -3.611  1.00 0.00 ? 30  LEU A CD1  5  
ATOM   3152  C  CD2  . LEU A 1 30 ? 1.924   -3.277  -3.119  1.00 0.00 ? 30  LEU A CD2  5  
ATOM   3153  H  H    . LEU A 1 30 ? -2.289  -2.532  -3.091  1.00 0.00 ? 30  LEU A H    5  
ATOM   3154  H  HA   . LEU A 1 30 ? -0.223  -4.106  -1.800  1.00 0.00 ? 30  LEU A HA   5  
ATOM   3155  H  HB2  . LEU A 1 30 ? -0.626  -1.163  -2.246  1.00 0.00 ? 30  LEU A HB2  5  
ATOM   3156  H  HB3  . LEU A 1 30 ? 0.674   -1.787  -1.233  1.00 0.00 ? 30  LEU A HB3  5  
ATOM   3157  H  HG   . LEU A 1 30 ? 0.307   -2.388  -4.168  1.00 0.00 ? 30  LEU A HG   5  
ATOM   3158  H  HD11 . LEU A 1 30 ? 1.535   -0.599  -4.658  1.00 0.00 ? 30  LEU A HD11 5  
ATOM   3159  H  HD12 . LEU A 1 30 ? 2.694   -0.946  -3.375  1.00 0.00 ? 30  LEU A HD12 5  
ATOM   3160  H  HD13 . LEU A 1 30 ? 1.219   -0.050  -3.012  1.00 0.00 ? 30  LEU A HD13 5  
ATOM   3161  H  HD21 . LEU A 1 30 ? 2.923   -2.911  -3.307  1.00 0.00 ? 30  LEU A HD21 5  
ATOM   3162  H  HD22 . LEU A 1 30 ? 1.699   -4.079  -3.807  1.00 0.00 ? 30  LEU A HD22 5  
ATOM   3163  H  HD23 . LEU A 1 30 ? 1.859   -3.644  -2.105  1.00 0.00 ? 30  LEU A HD23 5  
ATOM   3164  N  N    . CYS A 1 31 ? -0.415  -3.157  0.667   1.00 0.00 ? 31  CYS A N    5  
ATOM   3165  C  CA   . CYS A 1 31 ? -0.769  -3.049  2.077   1.00 0.00 ? 31  CYS A CA   5  
ATOM   3166  C  C    . CYS A 1 31 ? -0.404  -1.673  2.626   1.00 0.00 ? 31  CYS A C    5  
ATOM   3167  O  O    . CYS A 1 31 ? 0.436   -0.971  2.062   1.00 0.00 ? 31  CYS A O    5  
ATOM   3168  C  CB   . CYS A 1 31 ? -0.062  -4.138  2.887   1.00 0.00 ? 31  CYS A CB   5  
ATOM   3169  S  SG   . CYS A 1 31 ? 1.690   -3.783  3.239   1.00 0.00 ? 31  CYS A SG   5  
ATOM   3170  H  H    . CYS A 1 31 ? 0.525   -3.286  0.419   1.00 0.00 ? 31  CYS A H    5  
ATOM   3171  H  HA   . CYS A 1 31 ? -1.837  -3.185  2.163   1.00 0.00 ? 31  CYS A HA   5  
ATOM   3172  H  HB2  . CYS A 1 31 ? -0.568  -4.257  3.834   1.00 0.00 ? 31  CYS A HB2  5  
ATOM   3173  H  HB3  . CYS A 1 31 ? -0.106  -5.068  2.341   1.00 0.00 ? 31  CYS A HB3  5  
ATOM   3174  N  N    . HIS A 1 32 ? -1.040  -1.294  3.730   1.00 0.00 ? 32  HIS A N    5  
ATOM   3175  C  CA   . HIS A 1 32 ? -0.782  -0.002  4.356   1.00 0.00 ? 32  HIS A CA   5  
ATOM   3176  C  C    . HIS A 1 32 ? 0.702   0.346   4.290   1.00 0.00 ? 32  HIS A C    5  
ATOM   3177  O  O    . HIS A 1 32 ? 1.075   1.426   3.832   1.00 0.00 ? 32  HIS A O    5  
ATOM   3178  C  CB   . HIS A 1 32 ? -1.251  -0.014  5.811   1.00 0.00 ? 32  HIS A CB   5  
ATOM   3179  C  CG   . HIS A 1 32 ? -0.481  0.917   6.696   1.00 0.00 ? 32  HIS A CG   5  
ATOM   3180  N  ND1  . HIS A 1 32 ? -0.220  0.650   8.023   1.00 0.00 ? 32  HIS A ND1  5  
ATOM   3181  C  CD2  . HIS A 1 32 ? 0.087   2.118   6.437   1.00 0.00 ? 32  HIS A CD2  5  
ATOM   3182  C  CE1  . HIS A 1 32 ? 0.474   1.647   8.543   1.00 0.00 ? 32  HIS A CE1  5  
ATOM   3183  N  NE2  . HIS A 1 32 ? 0.674   2.551   7.600   1.00 0.00 ? 32  HIS A NE2  5  
ATOM   3184  H  H    . HIS A 1 32 ? -1.699  -1.897  4.132   1.00 0.00 ? 32  HIS A H    5  
ATOM   3185  H  HA   . HIS A 1 32 ? -1.339  0.747   3.813   1.00 0.00 ? 32  HIS A HA   5  
ATOM   3186  H  HB2  . HIS A 1 32 ? -2.291  0.276   5.850   1.00 0.00 ? 32  HIS A HB2  5  
ATOM   3187  H  HB3  . HIS A 1 32 ? -1.146  -1.013  6.208   1.00 0.00 ? 32  HIS A HB3  5  
ATOM   3188  H  HD1  . HIS A 1 32 ? -0.502  -0.150  8.513   1.00 0.00 ? 32  HIS A HD1  5  
ATOM   3189  H  HD2  . HIS A 1 32 ? 0.080   2.640   5.490   1.00 0.00 ? 32  HIS A HD2  5  
ATOM   3190  H  HE1  . HIS A 1 32 ? 0.820   1.713   9.563   1.00 0.00 ? 32  HIS A HE1  5  
ATOM   3191  N  N    . GLU A 1 33 ? 1.542   -0.575  4.751   1.00 0.00 ? 33  GLU A N    5  
ATOM   3192  C  CA   . GLU A 1 33 ? 2.985   -0.363  4.746   1.00 0.00 ? 33  GLU A CA   5  
ATOM   3193  C  C    . GLU A 1 33 ? 3.466   0.074   3.365   1.00 0.00 ? 33  GLU A C    5  
ATOM   3194  O  O    . GLU A 1 33 ? 4.034   1.154   3.205   1.00 0.00 ? 33  GLU A O    5  
ATOM   3195  C  CB   . GLU A 1 33 ? 3.712   -1.640  5.171   1.00 0.00 ? 33  GLU A CB   5  
ATOM   3196  C  CG   . GLU A 1 33 ? 5.042   -1.383  5.860   1.00 0.00 ? 33  GLU A CG   5  
ATOM   3197  C  CD   . GLU A 1 33 ? 4.900   -1.230  7.362   1.00 0.00 ? 33  GLU A CD   5  
ATOM   3198  O  OE1  . GLU A 1 33 ? 4.090   -0.386  7.798   1.00 0.00 ? 33  GLU A OE1  5  
ATOM   3199  O  OE2  . GLU A 1 33 ? 5.600   -1.954  8.101   1.00 0.00 ? 33  GLU A OE2  5  
ATOM   3200  H  H    . GLU A 1 33 ? 1.184   -1.416  5.104   1.00 0.00 ? 33  GLU A H    5  
ATOM   3201  H  HA   . GLU A 1 33 ? 3.208   0.420   5.455   1.00 0.00 ? 33  GLU A HA   5  
ATOM   3202  H  HB2  . GLU A 1 33 ? 3.079   -2.192  5.850   1.00 0.00 ? 33  GLU A HB2  5  
ATOM   3203  H  HB3  . GLU A 1 33 ? 3.896   -2.243  4.294   1.00 0.00 ? 33  GLU A HB3  5  
ATOM   3204  H  HG2  . GLU A 1 33 ? 5.703   -2.212  5.659   1.00 0.00 ? 33  GLU A HG2  5  
ATOM   3205  H  HG3  . GLU A 1 33 ? 5.471   -0.476  5.459   1.00 0.00 ? 33  GLU A HG3  5  
ATOM   3206  N  N    . CYS A 1 34 ? 3.233   -0.775  2.369   1.00 0.00 ? 34  CYS A N    5  
ATOM   3207  C  CA   . CYS A 1 34 ? 3.642   -0.480  1.001   1.00 0.00 ? 34  CYS A CA   5  
ATOM   3208  C  C    . CYS A 1 34 ? 2.937   0.769   0.480   1.00 0.00 ? 34  CYS A C    5  
ATOM   3209  O  O    . CYS A 1 34 ? 3.579   1.774   0.172   1.00 0.00 ? 34  CYS A O    5  
ATOM   3210  C  CB   . CYS A 1 34 ? 3.338   -1.669  0.088   1.00 0.00 ? 34  CYS A CB   5  
ATOM   3211  S  SG   . CYS A 1 34 ? 4.158   -3.218  0.585   1.00 0.00 ? 34  CYS A SG   5  
ATOM   3212  H  H    . CYS A 1 34 ? 2.775   -1.621  2.558   1.00 0.00 ? 34  CYS A H    5  
ATOM   3213  H  HA   . CYS A 1 34 ? 4.707   -0.302  1.004   1.00 0.00 ? 34  CYS A HA   5  
ATOM   3214  H  HB2  . CYS A 1 34 ? 2.273   -1.848  0.086   1.00 0.00 ? 34  CYS A HB2  5  
ATOM   3215  H  HB3  . CYS A 1 34 ? 3.660   -1.434  -0.916  1.00 0.00 ? 34  CYS A HB3  5  
ATOM   3216  N  N    . SER A 1 35 ? 1.613   0.699   0.385   1.00 0.00 ? 35  SER A N    5  
ATOM   3217  C  CA   . SER A 1 35 ? 0.821   1.822   -0.102  1.00 0.00 ? 35  SER A CA   5  
ATOM   3218  C  C    . SER A 1 35 ? 1.304   3.133   0.510   1.00 0.00 ? 35  SER A C    5  
ATOM   3219  O  O    . SER A 1 35 ? 1.145   4.201   -0.081  1.00 0.00 ? 35  SER A O    5  
ATOM   3220  C  CB   . SER A 1 35 ? -0.659  1.609   0.224   1.00 0.00 ? 35  SER A CB   5  
ATOM   3221  O  OG   . SER A 1 35 ? -1.480  2.459   -0.557  1.00 0.00 ? 35  SER A OG   5  
ATOM   3222  H  H    . SER A 1 35 ? 1.159   -0.130  0.646   1.00 0.00 ? 35  SER A H    5  
ATOM   3223  H  HA   . SER A 1 35 ? 0.941   1.872   -1.174  1.00 0.00 ? 35  SER A HA   5  
ATOM   3224  H  HB2  . SER A 1 35 ? -0.925  0.583   0.019   1.00 0.00 ? 35  SER A HB2  5  
ATOM   3225  H  HB3  . SER A 1 35 ? -0.829  1.823   1.269   1.00 0.00 ? 35  SER A HB3  5  
ATOM   3226  H  HG   . SER A 1 35 ? -2.013  1.929   -1.154  1.00 0.00 ? 35  SER A HG   5  
ATOM   3227  N  N    . GLU A 1 36 ? 1.895   3.043   1.697   1.00 0.00 ? 36  GLU A N    5  
ATOM   3228  C  CA   . GLU A 1 36 ? 2.400   4.222   2.390   1.00 0.00 ? 36  GLU A CA   5  
ATOM   3229  C  C    . GLU A 1 36 ? 3.818   4.554   1.934   1.00 0.00 ? 36  GLU A C    5  
ATOM   3230  O  O    . GLU A 1 36 ? 4.065   5.615   1.361   1.00 0.00 ? 36  GLU A O    5  
ATOM   3231  C  CB   . GLU A 1 36 ? 2.378   4.001   3.904   1.00 0.00 ? 36  GLU A CB   5  
ATOM   3232  C  CG   . GLU A 1 36 ? 3.323   4.914   4.667   1.00 0.00 ? 36  GLU A CG   5  
ATOM   3233  C  CD   . GLU A 1 36 ? 2.829   5.227   6.066   1.00 0.00 ? 36  GLU A CD   5  
ATOM   3234  O  OE1  . GLU A 1 36 ? 2.035   6.179   6.216   1.00 0.00 ? 36  GLU A OE1  5  
ATOM   3235  O  OE2  . GLU A 1 36 ? 3.236   4.519   7.010   1.00 0.00 ? 36  GLU A OE2  5  
ATOM   3236  H  H    . GLU A 1 36 ? 1.992   2.163   2.118   1.00 0.00 ? 36  GLU A H    5  
ATOM   3237  H  HA   . GLU A 1 36 ? 1.754   5.052   2.148   1.00 0.00 ? 36  GLU A HA   5  
ATOM   3238  H  HB2  . GLU A 1 36 ? 1.375   4.170   4.266   1.00 0.00 ? 36  GLU A HB2  5  
ATOM   3239  H  HB3  . GLU A 1 36 ? 2.657   2.978   4.110   1.00 0.00 ? 36  GLU A HB3  5  
ATOM   3240  H  HG2  . GLU A 1 36 ? 4.286   4.433   4.741   1.00 0.00 ? 36  GLU A HG2  5  
ATOM   3241  H  HG3  . GLU A 1 36 ? 3.425   5.841   4.121   1.00 0.00 ? 36  GLU A HG3  5  
ATOM   3242  N  N    . ARG A 1 37 ? 4.747   3.640   2.195   1.00 0.00 ? 37  ARG A N    5  
ATOM   3243  C  CA   . ARG A 1 37 ? 6.140   3.836   1.814   1.00 0.00 ? 37  ARG A CA   5  
ATOM   3244  C  C    . ARG A 1 37 ? 6.246   4.327   0.373   1.00 0.00 ? 37  ARG A C    5  
ATOM   3245  O  O    . ARG A 1 37 ? 7.110   5.140   0.046   1.00 0.00 ? 37  ARG A O    5  
ATOM   3246  C  CB   . ARG A 1 37 ? 6.924   2.532   1.978   1.00 0.00 ? 37  ARG A CB   5  
ATOM   3247  C  CG   . ARG A 1 37 ? 6.762   1.573   0.810   1.00 0.00 ? 37  ARG A CG   5  
ATOM   3248  C  CD   . ARG A 1 37 ? 7.395   0.222   1.107   1.00 0.00 ? 37  ARG A CD   5  
ATOM   3249  N  NE   . ARG A 1 37 ? 8.850   0.263   0.994   1.00 0.00 ? 37  ARG A NE   5  
ATOM   3250  C  CZ   . ARG A 1 37 ? 9.660   -0.577  1.629   1.00 0.00 ? 37  ARG A CZ   5  
ATOM   3251  N  NH1  . ARG A 1 37 ? 9.160   -1.517  2.418   1.00 0.00 ? 37  ARG A NH1  5  
ATOM   3252  N  NH2  . ARG A 1 37 ? 10.975  -0.477  1.475   1.00 0.00 ? 37  ARG A NH2  5  
ATOM   3253  H  H    . ARG A 1 37 ? 4.489   2.814   2.655   1.00 0.00 ? 37  ARG A H    5  
ATOM   3254  H  HA   . ARG A 1 37 ? 6.561   4.584   2.468   1.00 0.00 ? 37  ARG A HA   5  
ATOM   3255  H  HB2  . ARG A 1 37 ? 7.974   2.767   2.079   1.00 0.00 ? 37  ARG A HB2  5  
ATOM   3256  H  HB3  . ARG A 1 37 ? 6.587   2.034   2.874   1.00 0.00 ? 37  ARG A HB3  5  
ATOM   3257  H  HG2  . ARG A 1 37 ? 5.709   1.430   0.617   1.00 0.00 ? 37  ARG A HG2  5  
ATOM   3258  H  HG3  . ARG A 1 37 ? 7.236   1.999   -0.062  1.00 0.00 ? 37  ARG A HG3  5  
ATOM   3259  H  HD2  . ARG A 1 37 ? 7.130   -0.071  2.112   1.00 0.00 ? 37  ARG A HD2  5  
ATOM   3260  H  HD3  . ARG A 1 37 ? 7.008   -0.503  0.407   1.00 0.00 ? 37  ARG A HD3  5  
ATOM   3261  H  HE   . ARG A 1 37 ? 9.241   0.950   0.416   1.00 0.00 ? 37  ARG A HE   5  
ATOM   3262  H  HH11 . ARG A 1 37 ? 8.170   -1.596  2.535   1.00 0.00 ? 37  ARG A HH11 5  
ATOM   3263  H  HH12 . ARG A 1 37 ? 9.772   -2.149  2.894   1.00 0.00 ? 37  ARG A HH12 5  
ATOM   3264  H  HH21 . ARG A 1 37 ? 11.356  0.231   0.881   1.00 0.00 ? 37  ARG A HH21 5  
ATOM   3265  H  HH22 . ARG A 1 37 ? 11.583  -1.109  1.954   1.00 0.00 ? 37  ARG A HH22 5  
ATOM   3266  N  N    . ARG A 1 38 ? 5.361   3.827   -0.484  1.00 0.00 ? 38  ARG A N    5  
ATOM   3267  C  CA   . ARG A 1 38 ? 5.356   4.214   -1.889  1.00 0.00 ? 38  ARG A CA   5  
ATOM   3268  C  C    . ARG A 1 38 ? 4.979   5.684   -2.048  1.00 0.00 ? 38  ARG A C    5  
ATOM   3269  O  O    . ARG A 1 38 ? 5.631   6.425   -2.783  1.00 0.00 ? 38  ARG A O    5  
ATOM   3270  C  CB   . ARG A 1 38 ? 4.379   3.338   -2.677  1.00 0.00 ? 38  ARG A CB   5  
ATOM   3271  C  CG   . ARG A 1 38 ? 5.017   2.088   -3.261  1.00 0.00 ? 38  ARG A CG   5  
ATOM   3272  C  CD   . ARG A 1 38 ? 4.344   1.675   -4.561  1.00 0.00 ? 38  ARG A CD   5  
ATOM   3273  N  NE   . ARG A 1 38 ? 2.899   1.532   -4.408  1.00 0.00 ? 38  ARG A NE   5  
ATOM   3274  C  CZ   . ARG A 1 38 ? 2.038   1.655   -5.412  1.00 0.00 ? 38  ARG A CZ   5  
ATOM   3275  N  NH1  . ARG A 1 38 ? 2.475   1.920   -6.635  1.00 0.00 ? 38  ARG A NH1  5  
ATOM   3276  N  NH2  . ARG A 1 38 ? 0.737   1.511   -5.194  1.00 0.00 ? 38  ARG A NH2  5  
ATOM   3277  H  H    . ARG A 1 38 ? 4.696   3.183   -0.163  1.00 0.00 ? 38  ARG A H    5  
ATOM   3278  H  HA   . ARG A 1 38 ? 6.352   4.066   -2.278  1.00 0.00 ? 38  ARG A HA   5  
ATOM   3279  H  HB2  . ARG A 1 38 ? 3.577   3.034   -2.022  1.00 0.00 ? 38  ARG A HB2  5  
ATOM   3280  H  HB3  . ARG A 1 38 ? 3.969   3.920   -3.489  1.00 0.00 ? 38  ARG A HB3  5  
ATOM   3281  H  HG2  . ARG A 1 38 ? 6.061   2.285   -3.456  1.00 0.00 ? 38  ARG A HG2  5  
ATOM   3282  H  HG3  . ARG A 1 38 ? 4.928   1.283   -2.547  1.00 0.00 ? 38  ARG A HG3  5  
ATOM   3283  H  HD2  . ARG A 1 38 ? 4.545   2.427   -5.310  1.00 0.00 ? 38  ARG A HD2  5  
ATOM   3284  H  HD3  . ARG A 1 38 ? 4.758   0.730   -4.880  1.00 0.00 ? 38  ARG A HD3  5  
ATOM   3285  H  HE   . ARG A 1 38 ? 2.555   1.336   -3.512  1.00 0.00 ? 38  ARG A HE   5  
ATOM   3286  H  HH11 . ARG A 1 38 ? 3.455   2.028   -6.803  1.00 0.00 ? 38  ARG A HH11 5  
ATOM   3287  H  HH12 . ARG A 1 38 ? 1.824   2.010   -7.390  1.00 0.00 ? 38  ARG A HH12 5  
ATOM   3288  H  HH21 . ARG A 1 38 ? 0.404   1.311   -4.273  1.00 0.00 ? 38  ARG A HH21 5  
ATOM   3289  H  HH22 . ARG A 1 38 ? 0.090   1.603   -5.950  1.00 0.00 ? 38  ARG A HH22 5  
ATOM   3290  N  N    . GLN A 1 39 ? 3.924   6.097   -1.353  1.00 0.00 ? 39  GLN A N    5  
ATOM   3291  C  CA   . GLN A 1 39 ? 3.461   7.478   -1.418  1.00 0.00 ? 39  GLN A CA   5  
ATOM   3292  C  C    . GLN A 1 39 ? 4.625   8.451   -1.266  1.00 0.00 ? 39  GLN A C    5  
ATOM   3293  O  O    . GLN A 1 39 ? 4.884   9.270   -2.149  1.00 0.00 ? 39  GLN A O    5  
ATOM   3294  C  CB   . GLN A 1 39 ? 2.417   7.740   -0.331  1.00 0.00 ? 39  GLN A CB   5  
ATOM   3295  C  CG   . GLN A 1 39 ? 1.022   7.261   -0.698  1.00 0.00 ? 39  GLN A CG   5  
ATOM   3296  C  CD   . GLN A 1 39 ? 0.318   8.197   -1.661  1.00 0.00 ? 39  GLN A CD   5  
ATOM   3297  O  OE1  . GLN A 1 39 ? 0.787   8.427   -2.776  1.00 0.00 ? 39  GLN A OE1  5  
ATOM   3298  N  NE2  . GLN A 1 39 ? -0.814  8.744   -1.234  1.00 0.00 ? 39  GLN A NE2  5  
ATOM   3299  H  H    . GLN A 1 39 ? 3.446   5.459   -0.785  1.00 0.00 ? 39  GLN A H    5  
ATOM   3300  H  HA   . GLN A 1 39 ? 3.005   7.630   -2.385  1.00 0.00 ? 39  GLN A HA   5  
ATOM   3301  H  HB2  . GLN A 1 39 ? 2.722   7.234   0.573   1.00 0.00 ? 39  GLN A HB2  5  
ATOM   3302  H  HB3  . GLN A 1 39 ? 2.371   8.802   -0.141  1.00 0.00 ? 39  GLN A HB3  5  
ATOM   3303  H  HG2  . GLN A 1 39 ? 1.099   6.287   -1.159  1.00 0.00 ? 39  GLN A HG2  5  
ATOM   3304  H  HG3  . GLN A 1 39 ? 0.432   7.185   0.203   1.00 0.00 ? 39  GLN A HG3  5  
ATOM   3305  H  HE21 . GLN A 1 39 ? -1.127  8.516   -0.333  1.00 0.00 ? 39  GLN A HE21 5  
ATOM   3306  H  HE22 . GLN A 1 39 ? -1.289  9.353   -1.836  1.00 0.00 ? 39  GLN A HE22 5  
ATOM   3307  N  N    . LYS A 1 40 ? 5.326   8.357   -0.141  1.00 0.00 ? 40  LYS A N    5  
ATOM   3308  C  CA   . LYS A 1 40 ? 6.464   9.227   0.127   1.00 0.00 ? 40  LYS A CA   5  
ATOM   3309  C  C    . LYS A 1 40 ? 7.438   9.227   -1.047  1.00 0.00 ? 40  LYS A C    5  
ATOM   3310  O  O    . LYS A 1 40 ? 7.956   10.273  -1.436  1.00 0.00 ? 40  LYS A O    5  
ATOM   3311  C  CB   . LYS A 1 40 ? 7.185   8.781   1.401   1.00 0.00 ? 40  LYS A CB   5  
ATOM   3312  C  CG   . LYS A 1 40 ? 7.964   9.893   2.081   1.00 0.00 ? 40  LYS A CG   5  
ATOM   3313  C  CD   . LYS A 1 40 ? 8.880   9.351   3.165   1.00 0.00 ? 40  LYS A CD   5  
ATOM   3314  C  CE   . LYS A 1 40 ? 9.912   10.383  3.591   1.00 0.00 ? 40  LYS A CE   5  
ATOM   3315  N  NZ   . LYS A 1 40 ? 9.290   11.520  4.325   1.00 0.00 ? 40  LYS A NZ   5  
ATOM   3316  H  H    . LYS A 1 40 ? 5.071   7.684   0.525   1.00 0.00 ? 40  LYS A H    5  
ATOM   3317  H  HA   . LYS A 1 40 ? 6.089   10.230  0.268   1.00 0.00 ? 40  LYS A HA   5  
ATOM   3318  H  HB2  . LYS A 1 40 ? 6.453   8.402   2.100   1.00 0.00 ? 40  LYS A HB2  5  
ATOM   3319  H  HB3  . LYS A 1 40 ? 7.875   7.988   1.151   1.00 0.00 ? 40  LYS A HB3  5  
ATOM   3320  H  HG2  . LYS A 1 40 ? 8.562   10.405  1.343   1.00 0.00 ? 40  LYS A HG2  5  
ATOM   3321  H  HG3  . LYS A 1 40 ? 7.266   10.588  2.527   1.00 0.00 ? 40  LYS A HG3  5  
ATOM   3322  H  HD2  . LYS A 1 40 ? 8.285   9.078   4.025   1.00 0.00 ? 40  LYS A HD2  5  
ATOM   3323  H  HD3  . LYS A 1 40 ? 9.391   8.477   2.788   1.00 0.00 ? 40  LYS A HD3  5  
ATOM   3324  H  HE2  . LYS A 1 40 ? 10.637  9.905   4.232   1.00 0.00 ? 40  LYS A HE2  5  
ATOM   3325  H  HE3  . LYS A 1 40 ? 10.407  10.763  2.709   1.00 0.00 ? 40  LYS A HE3  5  
ATOM   3326  H  HZ1  . LYS A 1 40 ? 9.920   12.347  4.303   1.00 0.00 ? 40  LYS A HZ1  5  
ATOM   3327  H  HZ2  . LYS A 1 40 ? 9.120   11.254  5.316   1.00 0.00 ? 40  LYS A HZ2  5  
ATOM   3328  H  HZ3  . LYS A 1 40 ? 8.383   11.775  3.886   1.00 0.00 ? 40  LYS A HZ3  5  
ATOM   3329  N  N    . ASN A 1 41 ? 7.681   8.047   -1.608  1.00 0.00 ? 41  ASN A N    5  
ATOM   3330  C  CA   . ASN A 1 41 ? 8.592   7.911   -2.738  1.00 0.00 ? 41  ASN A CA   5  
ATOM   3331  C  C    . ASN A 1 41 ? 8.048   8.636   -3.966  1.00 0.00 ? 41  ASN A C    5  
ATOM   3332  O  O    . ASN A 1 41 ? 8.786   9.324   -4.670  1.00 0.00 ? 41  ASN A O    5  
ATOM   3333  C  CB   . ASN A 1 41 ? 8.819   6.433   -3.063  1.00 0.00 ? 41  ASN A CB   5  
ATOM   3334  C  CG   . ASN A 1 41 ? 9.777   5.768   -2.093  1.00 0.00 ? 41  ASN A CG   5  
ATOM   3335  O  OD1  . ASN A 1 41 ? 9.964   6.235   -0.970  1.00 0.00 ? 41  ASN A OD1  5  
ATOM   3336  N  ND2  . ASN A 1 41 ? 10.389  4.672   -2.525  1.00 0.00 ? 41  ASN A ND2  5  
ATOM   3337  H  H    . ASN A 1 41 ? 7.238   7.248   -1.253  1.00 0.00 ? 41  ASN A H    5  
ATOM   3338  H  HA   . ASN A 1 41 ? 9.535   8.358   -2.460  1.00 0.00 ? 41  ASN A HA   5  
ATOM   3339  H  HB2  . ASN A 1 41 ? 7.873   5.912   -3.019  1.00 0.00 ? 41  ASN A HB2  5  
ATOM   3340  H  HB3  . ASN A 1 41 ? 9.226   6.348   -4.059  1.00 0.00 ? 41  ASN A HB3  5  
ATOM   3341  H  HD21 . ASN A 1 41 ? 10.191  4.357   -3.432  1.00 0.00 ? 41  ASN A HD21 5  
ATOM   3342  H  HD22 . ASN A 1 41 ? 11.013  4.221   -1.918  1.00 0.00 ? 41  ASN A HD22 5  
ATOM   3343  N  N    . GLN A 1 42 ? 6.752   8.475   -4.214  1.00 0.00 ? 42  GLN A N    5  
ATOM   3344  C  CA   . GLN A 1 42 ? 6.109   9.114   -5.357  1.00 0.00 ? 42  GLN A CA   5  
ATOM   3345  C  C    . GLN A 1 42 ? 6.494   10.587  -5.444  1.00 0.00 ? 42  GLN A C    5  
ATOM   3346  O  O    . GLN A 1 42 ? 7.007   11.045  -6.464  1.00 0.00 ? 42  GLN A O    5  
ATOM   3347  C  CB   . GLN A 1 42 ? 4.589   8.976   -5.256  1.00 0.00 ? 42  GLN A CB   5  
ATOM   3348  C  CG   . GLN A 1 42 ? 3.869   9.204   -6.575  1.00 0.00 ? 42  GLN A CG   5  
ATOM   3349  C  CD   . GLN A 1 42 ? 3.907   10.652  -7.019  1.00 0.00 ? 42  GLN A CD   5  
ATOM   3350  O  OE1  . GLN A 1 42 ? 4.384   10.967  -8.110  1.00 0.00 ? 42  GLN A OE1  5  
ATOM   3351  N  NE2  . GLN A 1 42 ? 3.404   11.545  -6.174  1.00 0.00 ? 42  GLN A NE2  5  
ATOM   3352  H  H    . GLN A 1 42 ? 6.217   7.914   -3.616  1.00 0.00 ? 42  GLN A H    5  
ATOM   3353  H  HA   . GLN A 1 42 ? 6.448   8.613   -6.251  1.00 0.00 ? 42  GLN A HA   5  
ATOM   3354  H  HB2  . GLN A 1 42 ? 4.352   7.983   -4.907  1.00 0.00 ? 42  GLN A HB2  5  
ATOM   3355  H  HB3  . GLN A 1 42 ? 4.221   9.698   -4.541  1.00 0.00 ? 42  GLN A HB3  5  
ATOM   3356  H  HG2  . GLN A 1 42 ? 4.338   8.598   -7.336  1.00 0.00 ? 42  GLN A HG2  5  
ATOM   3357  H  HG3  . GLN A 1 42 ? 2.837   8.903   -6.463  1.00 0.00 ? 42  GLN A HG3  5  
ATOM   3358  H  HE21 . GLN A 1 42 ? 3.043   11.221  -5.322  1.00 0.00 ? 42  GLN A HE21 5  
ATOM   3359  H  HE22 . GLN A 1 42 ? 3.417   12.488  -6.435  1.00 0.00 ? 42  GLN A HE22 5  
ATOM   3360  N  N    . ASN A 1 43 ? 6.242   11.324  -4.367  1.00 0.00 ? 43  ASN A N    5  
ATOM   3361  C  CA   . ASN A 1 43 ? 6.562   12.747  -4.323  1.00 0.00 ? 43  ASN A CA   5  
ATOM   3362  C  C    . ASN A 1 43 ? 7.081   13.145  -2.945  1.00 0.00 ? 43  ASN A C    5  
ATOM   3363  O  O    . ASN A 1 43 ? 6.417   12.923  -1.932  1.00 0.00 ? 43  ASN A O    5  
ATOM   3364  C  CB   . ASN A 1 43 ? 5.327   13.579  -4.675  1.00 0.00 ? 43  ASN A CB   5  
ATOM   3365  C  CG   . ASN A 1 43 ? 5.607   15.069  -4.646  1.00 0.00 ? 43  ASN A CG   5  
ATOM   3366  O  OD1  . ASN A 1 43 ? 6.710   15.511  -4.966  1.00 0.00 ? 43  ASN A OD1  5  
ATOM   3367  N  ND2  . ASN A 1 43 ? 4.605   15.851  -4.259  1.00 0.00 ? 43  ASN A ND2  5  
ATOM   3368  H  H    . ASN A 1 43 ? 5.832   10.902  -3.584  1.00 0.00 ? 43  ASN A H    5  
ATOM   3369  H  HA   . ASN A 1 43 ? 7.333   12.936  -5.054  1.00 0.00 ? 43  ASN A HA   5  
ATOM   3370  H  HB2  . ASN A 1 43 ? 4.994   13.315  -5.668  1.00 0.00 ? 43  ASN A HB2  5  
ATOM   3371  H  HB3  . ASN A 1 43 ? 4.541   13.364  -3.967  1.00 0.00 ? 43  ASN A HB3  5  
ATOM   3372  H  HD21 . ASN A 1 43 ? 3.754   15.429  -4.018  1.00 0.00 ? 43  ASN A HD21 5  
ATOM   3373  H  HD22 . ASN A 1 43 ? 4.758   16.819  -4.231  1.00 0.00 ? 43  ASN A HD22 5  
ATOM   3374  N  N    . SER A 1 44 ? 8.271   13.735  -2.915  1.00 0.00 ? 44  SER A N    5  
ATOM   3375  C  CA   . SER A 1 44 ? 8.882   14.162  -1.661  1.00 0.00 ? 44  SER A CA   5  
ATOM   3376  C  C    . SER A 1 44 ? 8.641   15.649  -1.418  1.00 0.00 ? 44  SER A C    5  
ATOM   3377  O  O    . SER A 1 44 ? 8.257   16.383  -2.327  1.00 0.00 ? 44  SER A O    5  
ATOM   3378  C  CB   . SER A 1 44 ? 10.384  13.873  -1.676  1.00 0.00 ? 44  SER A CB   5  
ATOM   3379  O  OG   . SER A 1 44 ? 11.019  14.533  -2.758  1.00 0.00 ? 44  SER A OG   5  
ATOM   3380  H  H    . SER A 1 44 ? 8.752   13.885  -3.756  1.00 0.00 ? 44  SER A H    5  
ATOM   3381  H  HA   . SER A 1 44 ? 8.424   13.600  -0.861  1.00 0.00 ? 44  SER A HA   5  
ATOM   3382  H  HB2  . SER A 1 44 ? 10.824  14.217  -0.753  1.00 0.00 ? 44  SER A HB2  5  
ATOM   3383  H  HB3  . SER A 1 44 ? 10.542  12.809  -1.776  1.00 0.00 ? 44  SER A HB3  5  
ATOM   3384  H  HG   . SER A 1 44 ? 11.400  13.881  -3.351  1.00 0.00 ? 44  SER A HG   5  
ATOM   3385  N  N    . GLY A 1 45 ? 8.870   16.085  -0.183  1.00 0.00 ? 45  GLY A N    5  
ATOM   3386  C  CA   . GLY A 1 45 ? 8.673   17.481  0.159   1.00 0.00 ? 45  GLY A CA   5  
ATOM   3387  C  C    . GLY A 1 45 ? 9.712   18.386  -0.475  1.00 0.00 ? 45  GLY A C    5  
ATOM   3388  O  O    . GLY A 1 45 ? 9.446   19.080  -1.456  1.00 0.00 ? 45  GLY A O    5  
ATOM   3389  H  H    . GLY A 1 45 ? 9.175   15.453  0.501   1.00 0.00 ? 45  GLY A H    5  
ATOM   3390  H  HA2  . GLY A 1 45 ? 7.693   17.788  -0.175  1.00 0.00 ? 45  GLY A HA2  5  
ATOM   3391  H  HA3  . GLY A 1 45 ? 8.726   17.588  1.232   1.00 0.00 ? 45  GLY A HA3  5  
ATOM   3392  N  N    . PRO A 1 46 ? 10.927  18.387  0.093   1.00 0.00 ? 46  PRO A N    5  
ATOM   3393  C  CA   . PRO A 1 46 ? 12.033  19.209  -0.405  1.00 0.00 ? 46  PRO A CA   5  
ATOM   3394  C  C    . PRO A 1 46 ? 12.556  18.723  -1.752  1.00 0.00 ? 46  PRO A C    5  
ATOM   3395  O  O    . PRO A 1 46 ? 13.502  17.938  -1.815  1.00 0.00 ? 46  PRO A O    5  
ATOM   3396  C  CB   . PRO A 1 46 ? 13.107  19.051  0.674   1.00 0.00 ? 46  PRO A CB   5  
ATOM   3397  C  CG   . PRO A 1 46 ? 12.809  17.739  1.315   1.00 0.00 ? 46  PRO A CG   5  
ATOM   3398  C  CD   . PRO A 1 46 ? 11.314  17.584  1.266   1.00 0.00 ? 46  PRO A CD   5  
ATOM   3399  H  HA   . PRO A 1 46 ? 11.750  20.249  -0.484  1.00 0.00 ? 46  PRO A HA   5  
ATOM   3400  H  HB2  . PRO A 1 46 ? 14.085  19.053  0.215   1.00 0.00 ? 46  PRO A HB2  5  
ATOM   3401  H  HB3  . PRO A 1 46 ? 13.033  19.862  1.382   1.00 0.00 ? 46  PRO A HB3  5  
ATOM   3402  H  HG2  . PRO A 1 46 ? 13.287  16.944  0.764   1.00 0.00 ? 46  PRO A HG2  5  
ATOM   3403  H  HG3  . PRO A 1 46 ? 13.151  17.746  2.340   1.00 0.00 ? 46  PRO A HG3  5  
ATOM   3404  H  HD2  . PRO A 1 46 ? 11.046  16.547  1.129   1.00 0.00 ? 46  PRO A HD2  5  
ATOM   3405  H  HD3  . PRO A 1 46 ? 10.864  17.976  2.166   1.00 0.00 ? 46  PRO A HD3  5  
ATOM   3406  N  N    . SER A 1 47 ? 11.933  19.194  -2.828  1.00 0.00 ? 47  SER A N    5  
ATOM   3407  C  CA   . SER A 1 47 ? 12.334  18.804  -4.175  1.00 0.00 ? 47  SER A CA   5  
ATOM   3408  C  C    . SER A 1 47 ? 13.711  19.365  -4.516  1.00 0.00 ? 47  SER A C    5  
ATOM   3409  O  O    . SER A 1 47 ? 14.652  18.616  -4.777  1.00 0.00 ? 47  SER A O    5  
ATOM   3410  C  CB   . SER A 1 47 ? 11.305  19.290  -5.197  1.00 0.00 ? 47  SER A CB   5  
ATOM   3411  O  OG   . SER A 1 47 ? 10.007  18.820  -4.877  1.00 0.00 ? 47  SER A OG   5  
ATOM   3412  H  H    . SER A 1 47 ? 11.185  19.816  -2.713  1.00 0.00 ? 47  SER A H    5  
ATOM   3413  H  HA   . SER A 1 47 ? 12.380  17.725  -4.208  1.00 0.00 ? 47  SER A HA   5  
ATOM   3414  H  HB2  . SER A 1 47 ? 11.292  20.369  -5.206  1.00 0.00 ? 47  SER A HB2  5  
ATOM   3415  H  HB3  . SER A 1 47 ? 11.576  18.926  -6.178  1.00 0.00 ? 47  SER A HB3  5  
ATOM   3416  H  HG   . SER A 1 47 ? 9.936   17.891  -5.110  1.00 0.00 ? 47  SER A HG   5  
ATOM   3417  N  N    . SER A 1 48 ? 13.820  20.690  -4.513  1.00 0.00 ? 48  SER A N    5  
ATOM   3418  C  CA   . SER A 1 48 ? 15.081  21.354  -4.825  1.00 0.00 ? 48  SER A CA   5  
ATOM   3419  C  C    . SER A 1 48 ? 15.625  20.880  -6.169  1.00 0.00 ? 48  SER A C    5  
ATOM   3420  O  O    . SER A 1 48 ? 16.829  20.684  -6.330  1.00 0.00 ? 48  SER A O    5  
ATOM   3421  C  CB   . SER A 1 48 ? 16.108  21.088  -3.724  1.00 0.00 ? 48  SER A CB   5  
ATOM   3422  O  OG   . SER A 1 48 ? 16.832  19.897  -3.978  1.00 0.00 ? 48  SER A OG   5  
ATOM   3423  H  H    . SER A 1 48 ? 13.034  21.234  -4.297  1.00 0.00 ? 48  SER A H    5  
ATOM   3424  H  HA   . SER A 1 48 ? 14.891  22.416  -4.881  1.00 0.00 ? 48  SER A HA   5  
ATOM   3425  H  HB2  . SER A 1 48 ? 16.803  21.913  -3.676  1.00 0.00 ? 48  SER A HB2  5  
ATOM   3426  H  HB3  . SER A 1 48 ? 15.599  20.991  -2.776  1.00 0.00 ? 48  SER A HB3  5  
ATOM   3427  H  HG   . SER A 1 48 ? 16.299  19.307  -4.517  1.00 0.00 ? 48  SER A HG   5  
ATOM   3428  N  N    . GLY A 1 49 ? 14.728  20.699  -7.134  1.00 0.00 ? 49  GLY A N    5  
ATOM   3429  C  CA   . GLY A 1 49 ? 15.136  20.249  -8.452  1.00 0.00 ? 49  GLY A CA   5  
ATOM   3430  C  C    . GLY A 1 49 ? 14.839  21.272  -9.531  1.00 0.00 ? 49  GLY A C    5  
ATOM   3431  O  O    . GLY A 1 49 ? 15.303  22.406  -9.425  1.00 0.00 ? 49  GLY A O    5  
ATOM   3432  H  H    . GLY A 1 49 ? 13.781  20.871  -6.948  1.00 0.00 ? 49  GLY A H    5  
ATOM   3433  H  HA2  . GLY A 1 49 ? 16.198  20.052  -8.440  1.00 0.00 ? 49  GLY A HA2  5  
ATOM   3434  H  HA3  . GLY A 1 49 ? 14.613  19.334  -8.686  1.00 0.00 ? 49  GLY A HA3  5  
HETATM 3435  ZN ZN   . ZN  B 2 .  ? 2.971   -4.794  1.668   1.00 0.00 ? 201 ZN  A ZN   5  
ATOM   3436  N  N    . GLY A 1 1  ? -18.785 -8.313  8.123   1.00 0.00 ? 1   GLY A N    6  
ATOM   3437  C  CA   . GLY A 1 1  ? -18.612 -7.261  9.107   1.00 0.00 ? 1   GLY A CA   6  
ATOM   3438  C  C    . GLY A 1 1  ? -19.032 -5.902  8.582   1.00 0.00 ? 1   GLY A C    6  
ATOM   3439  O  O    . GLY A 1 1  ? -19.004 -5.659  7.376   1.00 0.00 ? 1   GLY A O    6  
ATOM   3440  H  H1   . GLY A 1 1  ? -18.686 -8.111  7.170   1.00 0.00 ? 1   GLY A H1   6  
ATOM   3441  H  HA2  . GLY A 1 1  ? -19.203 -7.497  9.979   1.00 0.00 ? 1   GLY A HA2  6  
ATOM   3442  H  HA3  . GLY A 1 1  ? -17.570 -7.217  9.391   1.00 0.00 ? 1   GLY A HA3  6  
ATOM   3443  N  N    . SER A 1 2  ? -19.425 -5.014  9.490   1.00 0.00 ? 2   SER A N    6  
ATOM   3444  C  CA   . SER A 1 2  ? -19.858 -3.675  9.112   1.00 0.00 ? 2   SER A CA   6  
ATOM   3445  C  C    . SER A 1 2  ? -18.844 -3.018  8.181   1.00 0.00 ? 2   SER A C    6  
ATOM   3446  O  O    . SER A 1 2  ? -19.211 -2.395  7.185   1.00 0.00 ? 2   SER A O    6  
ATOM   3447  C  CB   . SER A 1 2  ? -20.059 -2.810  10.358  1.00 0.00 ? 2   SER A CB   6  
ATOM   3448  O  OG   . SER A 1 2  ? -18.909 -2.834  11.186  1.00 0.00 ? 2   SER A OG   6  
ATOM   3449  H  H    . SER A 1 2  ? -19.425 -5.268  10.437  1.00 0.00 ? 2   SER A H    6  
ATOM   3450  H  HA   . SER A 1 2  ? -20.801 -3.766  8.592   1.00 0.00 ? 2   SER A HA   6  
ATOM   3451  H  HB2  . SER A 1 2  ? -20.250 -1.790  10.058  1.00 0.00 ? 2   SER A HB2  6  
ATOM   3452  H  HB3  . SER A 1 2  ? -20.902 -3.184  10.921  1.00 0.00 ? 2   SER A HB3  6  
ATOM   3453  H  HG   . SER A 1 2  ? -18.400 -2.031  11.051  1.00 0.00 ? 2   SER A HG   6  
ATOM   3454  N  N    . SER A 1 3  ? -17.565 -3.163  8.513   1.00 0.00 ? 3   SER A N    6  
ATOM   3455  C  CA   . SER A 1 3  ? -16.496 -2.581  7.710   1.00 0.00 ? 3   SER A CA   6  
ATOM   3456  C  C    . SER A 1 3  ? -16.730 -1.089  7.492   1.00 0.00 ? 3   SER A C    6  
ATOM   3457  O  O    . SER A 1 3  ? -16.528 -0.571  6.395   1.00 0.00 ? 3   SER A O    6  
ATOM   3458  C  CB   . SER A 1 3  ? -16.397 -3.295  6.360   1.00 0.00 ? 3   SER A CB   6  
ATOM   3459  O  OG   . SER A 1 3  ? -15.089 -3.192  5.824   1.00 0.00 ? 3   SER A OG   6  
ATOM   3460  H  H    . SER A 1 3  ? -17.335 -3.671  9.319   1.00 0.00 ? 3   SER A H    6  
ATOM   3461  H  HA   . SER A 1 3  ? -15.569 -2.713  8.246   1.00 0.00 ? 3   SER A HA   6  
ATOM   3462  H  HB2  . SER A 1 3  ? -16.639 -4.339  6.490   1.00 0.00 ? 3   SER A HB2  6  
ATOM   3463  H  HB3  . SER A 1 3  ? -17.094 -2.847  5.667   1.00 0.00 ? 3   SER A HB3  6  
ATOM   3464  H  HG   . SER A 1 3  ? -15.127 -2.756  4.970   1.00 0.00 ? 3   SER A HG   6  
ATOM   3465  N  N    . GLY A 1 4  ? -17.160 -0.404  8.548   1.00 0.00 ? 4   GLY A N    6  
ATOM   3466  C  CA   . GLY A 1 4  ? -17.415 1.022   8.453   1.00 0.00 ? 4   GLY A CA   6  
ATOM   3467  C  C    . GLY A 1 4  ? -16.174 1.852   8.714   1.00 0.00 ? 4   GLY A C    6  
ATOM   3468  O  O    . GLY A 1 4  ? -16.128 2.628   9.669   1.00 0.00 ? 4   GLY A O    6  
ATOM   3469  H  H    . GLY A 1 4  ? -17.304 -0.870  9.398   1.00 0.00 ? 4   GLY A H    6  
ATOM   3470  H  HA2  . GLY A 1 4  ? -17.783 1.245   7.463   1.00 0.00 ? 4   GLY A HA2  6  
ATOM   3471  H  HA3  . GLY A 1 4  ? -18.172 1.289   9.176   1.00 0.00 ? 4   GLY A HA3  6  
ATOM   3472  N  N    . SER A 1 5  ? -15.164 1.688   7.865   1.00 0.00 ? 5   SER A N    6  
ATOM   3473  C  CA   . SER A 1 5  ? -13.915 2.424   8.013   1.00 0.00 ? 5   SER A CA   6  
ATOM   3474  C  C    . SER A 1 5  ? -13.238 2.622   6.659   1.00 0.00 ? 5   SER A C    6  
ATOM   3475  O  O    . SER A 1 5  ? -13.581 1.962   5.679   1.00 0.00 ? 5   SER A O    6  
ATOM   3476  C  CB   . SER A 1 5  ? -12.972 1.686   8.964   1.00 0.00 ? 5   SER A CB   6  
ATOM   3477  O  OG   . SER A 1 5  ? -13.397 1.819   10.309  1.00 0.00 ? 5   SER A OG   6  
ATOM   3478  H  H    . SER A 1 5  ? -15.262 1.054   7.124   1.00 0.00 ? 5   SER A H    6  
ATOM   3479  H  HA   . SER A 1 5  ? -14.148 3.393   8.430   1.00 0.00 ? 5   SER A HA   6  
ATOM   3480  H  HB2  . SER A 1 5  ? -12.954 0.637   8.708   1.00 0.00 ? 5   SER A HB2  6  
ATOM   3481  H  HB3  . SER A 1 5  ? -11.977 2.096   8.871   1.00 0.00 ? 5   SER A HB3  6  
ATOM   3482  H  HG   . SER A 1 5  ? -13.295 2.732   10.588  1.00 0.00 ? 5   SER A HG   6  
ATOM   3483  N  N    . SER A 1 6  ? -12.274 3.536   6.615   1.00 0.00 ? 6   SER A N    6  
ATOM   3484  C  CA   . SER A 1 6  ? -11.550 3.824   5.382   1.00 0.00 ? 6   SER A CA   6  
ATOM   3485  C  C    . SER A 1 6  ? -11.071 2.536   4.720   1.00 0.00 ? 6   SER A C    6  
ATOM   3486  O  O    . SER A 1 6  ? -11.205 2.360   3.510   1.00 0.00 ? 6   SER A O    6  
ATOM   3487  C  CB   . SER A 1 6  ? -10.357 4.739   5.668   1.00 0.00 ? 6   SER A CB   6  
ATOM   3488  O  OG   . SER A 1 6  ? -9.377  4.071   6.442   1.00 0.00 ? 6   SER A OG   6  
ATOM   3489  H  H    . SER A 1 6  ? -12.045 4.030   7.430   1.00 0.00 ? 6   SER A H    6  
ATOM   3490  H  HA   . SER A 1 6  ? -12.228 4.330   4.711   1.00 0.00 ? 6   SER A HA   6  
ATOM   3491  H  HB2  . SER A 1 6  ? -9.912  5.048   4.734   1.00 0.00 ? 6   SER A HB2  6  
ATOM   3492  H  HB3  . SER A 1 6  ? -10.697 5.609   6.211   1.00 0.00 ? 6   SER A HB3  6  
ATOM   3493  H  HG   . SER A 1 6  ? -9.255  4.534   7.274   1.00 0.00 ? 6   SER A HG   6  
ATOM   3494  N  N    . GLY A 1 7  ? -10.510 1.637   5.524   1.00 0.00 ? 7   GLY A N    6  
ATOM   3495  C  CA   . GLY A 1 7  ? -10.019 0.377   4.999   1.00 0.00 ? 7   GLY A CA   6  
ATOM   3496  C  C    . GLY A 1 7  ? -9.815  -0.663  6.083   1.00 0.00 ? 7   GLY A C    6  
ATOM   3497  O  O    . GLY A 1 7  ? -9.318  -0.352  7.165   1.00 0.00 ? 7   GLY A O    6  
ATOM   3498  H  H    . GLY A 1 7  ? -10.430 1.832   6.481   1.00 0.00 ? 7   GLY A H    6  
ATOM   3499  H  HA2  . GLY A 1 7  ? -10.729 -0.003  4.279   1.00 0.00 ? 7   GLY A HA2  6  
ATOM   3500  H  HA3  . GLY A 1 7  ? -9.076  0.550   4.502   1.00 0.00 ? 7   GLY A HA3  6  
ATOM   3501  N  N    . SER A 1 8  ? -10.203 -1.901  5.794   1.00 0.00 ? 8   SER A N    6  
ATOM   3502  C  CA   . SER A 1 8  ? -10.065 -2.989  6.755   1.00 0.00 ? 8   SER A CA   6  
ATOM   3503  C  C    . SER A 1 8  ? -9.182  -4.100  6.195   1.00 0.00 ? 8   SER A C    6  
ATOM   3504  O  O    . SER A 1 8  ? -9.433  -4.619  5.106   1.00 0.00 ? 8   SER A O    6  
ATOM   3505  C  CB   . SER A 1 8  ? -11.440 -3.551  7.121   1.00 0.00 ? 8   SER A CB   6  
ATOM   3506  O  OG   . SER A 1 8  ? -11.369 -4.351  8.288   1.00 0.00 ? 8   SER A OG   6  
ATOM   3507  H  H    . SER A 1 8  ? -10.592 -2.086  4.914   1.00 0.00 ? 8   SER A H    6  
ATOM   3508  H  HA   . SER A 1 8  ? -9.600  -2.589  7.644   1.00 0.00 ? 8   SER A HA   6  
ATOM   3509  H  HB2  . SER A 1 8  ? -12.124 -2.735  7.300   1.00 0.00 ? 8   SER A HB2  6  
ATOM   3510  H  HB3  . SER A 1 8  ? -11.808 -4.156  6.305   1.00 0.00 ? 8   SER A HB3  6  
ATOM   3511  H  HG   . SER A 1 8  ? -10.463 -4.637  8.427   1.00 0.00 ? 8   SER A HG   6  
ATOM   3512  N  N    . LEU A 1 9  ? -8.147  -4.460  6.946   1.00 0.00 ? 9   LEU A N    6  
ATOM   3513  C  CA   . LEU A 1 9  ? -7.225  -5.509  6.527   1.00 0.00 ? 9   LEU A CA   6  
ATOM   3514  C  C    . LEU A 1 9  ? -7.974  -6.805  6.230   1.00 0.00 ? 9   LEU A C    6  
ATOM   3515  O  O    . LEU A 1 9  ? -8.582  -7.399  7.120   1.00 0.00 ? 9   LEU A O    6  
ATOM   3516  C  CB   . LEU A 1 9  ? -6.171  -5.752  7.608   1.00 0.00 ? 9   LEU A CB   6  
ATOM   3517  C  CG   . LEU A 1 9  ? -5.299  -4.552  7.976   1.00 0.00 ? 9   LEU A CG   6  
ATOM   3518  C  CD1  . LEU A 1 9  ? -4.344  -4.911  9.104   1.00 0.00 ? 9   LEU A CD1  6  
ATOM   3519  C  CD2  . LEU A 1 9  ? -4.528  -4.060  6.760   1.00 0.00 ? 9   LEU A CD2  6  
ATOM   3520  H  H    . LEU A 1 9  ? -7.999  -4.010  7.804   1.00 0.00 ? 9   LEU A H    6  
ATOM   3521  H  HA   . LEU A 1 9  ? -6.734  -5.177  5.624   1.00 0.00 ? 9   LEU A HA   6  
ATOM   3522  H  HB2  . LEU A 1 9  ? -6.683  -6.075  8.502   1.00 0.00 ? 9   LEU A HB2  6  
ATOM   3523  H  HB3  . LEU A 1 9  ? -5.520  -6.542  7.263   1.00 0.00 ? 9   LEU A HB3  6  
ATOM   3524  H  HG   . LEU A 1 9  ? -5.932  -3.746  8.320   1.00 0.00 ? 9   LEU A HG   6  
ATOM   3525  H  HD11 . LEU A 1 9  ? -3.812  -4.027  9.421   1.00 0.00 ? 9   LEU A HD11 6  
ATOM   3526  H  HD12 . LEU A 1 9  ? -3.639  -5.651  8.757   1.00 0.00 ? 9   LEU A HD12 6  
ATOM   3527  H  HD13 . LEU A 1 9  ? -4.905  -5.312  9.936   1.00 0.00 ? 9   LEU A HD13 6  
ATOM   3528  H  HD21 . LEU A 1 9  ? -3.586  -3.638  7.077   1.00 0.00 ? 9   LEU A HD21 6  
ATOM   3529  H  HD22 . LEU A 1 9  ? -5.107  -3.304  6.249   1.00 0.00 ? 9   LEU A HD22 6  
ATOM   3530  H  HD23 . LEU A 1 9  ? -4.346  -4.888  6.090   1.00 0.00 ? 9   LEU A HD23 6  
ATOM   3531  N  N    . MET A 1 10 ? -7.922  -7.239  4.975   1.00 0.00 ? 10  MET A N    6  
ATOM   3532  C  CA   . MET A 1 10 ? -8.592  -8.466  4.562   1.00 0.00 ? 10  MET A CA   6  
ATOM   3533  C  C    . MET A 1 10 ? -7.672  -9.671  4.732   1.00 0.00 ? 10  MET A C    6  
ATOM   3534  O  O    . MET A 1 10 ? -6.493  -9.524  5.053   1.00 0.00 ? 10  MET A O    6  
ATOM   3535  C  CB   . MET A 1 10 ? -9.048  -8.359  3.106   1.00 0.00 ? 10  MET A CB   6  
ATOM   3536  C  CG   . MET A 1 10 ? -10.163 -7.348  2.891   1.00 0.00 ? 10  MET A CG   6  
ATOM   3537  S  SD   . MET A 1 10 ? -11.802 -8.059  3.136   1.00 0.00 ? 10  MET A SD   6  
ATOM   3538  C  CE   . MET A 1 10 ? -12.491 -7.897  1.491   1.00 0.00 ? 10  MET A CE   6  
ATOM   3539  H  H    . MET A 1 10 ? -7.420  -6.722  4.310   1.00 0.00 ? 10  MET A H    6  
ATOM   3540  H  HA   . MET A 1 10 ? -9.459  -8.598  5.193   1.00 0.00 ? 10  MET A HA   6  
ATOM   3541  H  HB2  . MET A 1 10 ? -8.205  -8.067  2.498   1.00 0.00 ? 10  MET A HB2  6  
ATOM   3542  H  HB3  . MET A 1 10 ? -9.401  -9.326  2.779   1.00 0.00 ? 10  MET A HB3  6  
ATOM   3543  H  HG2  . MET A 1 10 ? -10.033 -6.534  3.589   1.00 0.00 ? 10  MET A HG2  6  
ATOM   3544  H  HG3  . MET A 1 10 ? -10.097 -6.969  1.882   1.00 0.00 ? 10  MET A HG3  6  
ATOM   3545  H  HE1  . MET A 1 10 ? -11.782 -7.389  0.853   1.00 0.00 ? 10  MET A HE1  6  
ATOM   3546  H  HE2  . MET A 1 10 ? -12.699 -8.877  1.089   1.00 0.00 ? 10  MET A HE2  6  
ATOM   3547  H  HE3  . MET A 1 10 ? -13.406 -7.326  1.539   1.00 0.00 ? 10  MET A HE3  6  
ATOM   3548  N  N    . ASP A 1 11 ? -8.219  -10.862 4.514   1.00 0.00 ? 11  ASP A N    6  
ATOM   3549  C  CA   . ASP A 1 11 ? -7.447  -12.093 4.642   1.00 0.00 ? 11  ASP A CA   6  
ATOM   3550  C  C    . ASP A 1 11 ? -6.547  -12.299 3.427   1.00 0.00 ? 11  ASP A C    6  
ATOM   3551  O  O    . ASP A 1 11 ? -5.891  -13.332 3.295   1.00 0.00 ? 11  ASP A O    6  
ATOM   3552  C  CB   . ASP A 1 11 ? -8.382  -13.292 4.808   1.00 0.00 ? 11  ASP A CB   6  
ATOM   3553  C  CG   . ASP A 1 11 ? -9.407  -13.078 5.905   1.00 0.00 ? 11  ASP A CG   6  
ATOM   3554  O  OD1  . ASP A 1 11 ? -8.999  -12.892 7.070   1.00 0.00 ? 11  ASP A OD1  6  
ATOM   3555  O  OD2  . ASP A 1 11 ? -10.618 -13.099 5.598   1.00 0.00 ? 11  ASP A OD2  6  
ATOM   3556  H  H    . ASP A 1 11 ? -9.164  -10.915 4.260   1.00 0.00 ? 11  ASP A H    6  
ATOM   3557  H  HA   . ASP A 1 11 ? -6.828  -12.006 5.522   1.00 0.00 ? 11  ASP A HA   6  
ATOM   3558  H  HB2  . ASP A 1 11 ? -8.906  -13.463 3.879   1.00 0.00 ? 11  ASP A HB2  6  
ATOM   3559  H  HB3  . ASP A 1 11 ? -7.796  -14.166 5.053   1.00 0.00 ? 11  ASP A HB3  6  
ATOM   3560  N  N    . VAL A 1 12 ? -6.522  -11.308 2.541   1.00 0.00 ? 12  VAL A N    6  
ATOM   3561  C  CA   . VAL A 1 12 ? -5.703  -11.380 1.337   1.00 0.00 ? 12  VAL A CA   6  
ATOM   3562  C  C    . VAL A 1 12 ? -4.297  -10.853 1.597   1.00 0.00 ? 12  VAL A C    6  
ATOM   3563  O  O    . VAL A 1 12 ? -4.121  -9.751  2.117   1.00 0.00 ? 12  VAL A O    6  
ATOM   3564  C  CB   . VAL A 1 12 ? -6.334  -10.581 0.181   1.00 0.00 ? 12  VAL A CB   6  
ATOM   3565  C  CG1  . VAL A 1 12 ? -5.424  -10.598 -1.038  1.00 0.00 ? 12  VAL A CG1  6  
ATOM   3566  C  CG2  . VAL A 1 12 ? -7.708  -11.136 -0.162  1.00 0.00 ? 12  VAL A CG2  6  
ATOM   3567  H  H    . VAL A 1 12 ? -7.067  -10.510 2.701   1.00 0.00 ? 12  VAL A H    6  
ATOM   3568  H  HA   . VAL A 1 12 ? -5.640  -12.416 1.038   1.00 0.00 ? 12  VAL A HA   6  
ATOM   3569  H  HB   . VAL A 1 12 ? -6.452  -9.557  0.500   1.00 0.00 ? 12  VAL A HB   6  
ATOM   3570  H  HG11 . VAL A 1 12 ? -5.950  -10.182 -1.885  1.00 0.00 ? 12  VAL A HG11 6  
ATOM   3571  H  HG12 . VAL A 1 12 ? -4.541  -10.009 -0.837  1.00 0.00 ? 12  VAL A HG12 6  
ATOM   3572  H  HG13 . VAL A 1 12 ? -5.136  -11.615 -1.259  1.00 0.00 ? 12  VAL A HG13 6  
ATOM   3573  H  HG21 . VAL A 1 12 ? -8.215  -11.431 0.745   1.00 0.00 ? 12  VAL A HG21 6  
ATOM   3574  H  HG22 . VAL A 1 12 ? -8.286  -10.377 -0.668  1.00 0.00 ? 12  VAL A HG22 6  
ATOM   3575  H  HG23 . VAL A 1 12 ? -7.599  -11.995 -0.809  1.00 0.00 ? 12  VAL A HG23 6  
ATOM   3576  N  N    . LYS A 1 13 ? -3.296  -11.647 1.230   1.00 0.00 ? 13  LYS A N    6  
ATOM   3577  C  CA   . LYS A 1 13 ? -1.903  -11.261 1.421   1.00 0.00 ? 13  LYS A CA   6  
ATOM   3578  C  C    . LYS A 1 13 ? -1.551  -10.051 0.562   1.00 0.00 ? 13  LYS A C    6  
ATOM   3579  O  O    . LYS A 1 13 ? -2.050  -9.903  -0.555  1.00 0.00 ? 13  LYS A O    6  
ATOM   3580  C  CB   . LYS A 1 13 ? -0.977  -12.430 1.079   1.00 0.00 ? 13  LYS A CB   6  
ATOM   3581  C  CG   . LYS A 1 13 ? -0.751  -13.386 2.237   1.00 0.00 ? 13  LYS A CG   6  
ATOM   3582  C  CD   . LYS A 1 13 ? -1.790  -14.495 2.256   1.00 0.00 ? 13  LYS A CD   6  
ATOM   3583  C  CE   . LYS A 1 13 ? -1.564  -15.490 1.128   1.00 0.00 ? 13  LYS A CE   6  
ATOM   3584  N  NZ   . LYS A 1 13 ? -2.183  -16.812 1.423   1.00 0.00 ? 13  LYS A NZ   6  
ATOM   3585  H  H    . LYS A 1 13 ? -3.500  -12.514 0.820   1.00 0.00 ? 13  LYS A H    6  
ATOM   3586  H  HA   . LYS A 1 13 ? -1.771  -11.000 2.460   1.00 0.00 ? 13  LYS A HA   6  
ATOM   3587  H  HB2  . LYS A 1 13 ? -1.407  -12.986 0.258   1.00 0.00 ? 13  LYS A HB2  6  
ATOM   3588  H  HB3  . LYS A 1 13 ? -0.019  -12.036 0.772   1.00 0.00 ? 13  LYS A HB3  6  
ATOM   3589  H  HG2  . LYS A 1 13 ? 0.230   -13.829 2.140   1.00 0.00 ? 13  LYS A HG2  6  
ATOM   3590  H  HG3  . LYS A 1 13 ? -0.809  -12.834 3.164   1.00 0.00 ? 13  LYS A HG3  6  
ATOM   3591  H  HD2  . LYS A 1 13 ? -1.730  -15.017 3.199   1.00 0.00 ? 13  LYS A HD2  6  
ATOM   3592  H  HD3  . LYS A 1 13 ? -2.772  -14.057 2.146   1.00 0.00 ? 13  LYS A HD3  6  
ATOM   3593  H  HE2  . LYS A 1 13 ? -1.997  -15.094 0.223   1.00 0.00 ? 13  LYS A HE2  6  
ATOM   3594  H  HE3  . LYS A 1 13 ? -0.501  -15.623 0.991   1.00 0.00 ? 13  LYS A HE3  6  
ATOM   3595  H  HZ1  . LYS A 1 13 ? -3.220  -16.730 1.420   1.00 0.00 ? 13  LYS A HZ1  6  
ATOM   3596  H  HZ2  . LYS A 1 13 ? -1.875  -17.150 2.357   1.00 0.00 ? 13  LYS A HZ2  6  
ATOM   3597  H  HZ3  . LYS A 1 13 ? -1.899  -17.508 0.705   1.00 0.00 ? 13  LYS A HZ3  6  
ATOM   3598  N  N    . CYS A 1 14 ? -0.688  -9.188  1.088   1.00 0.00 ? 14  CYS A N    6  
ATOM   3599  C  CA   . CYS A 1 14 ? -0.268  -7.991  0.369   1.00 0.00 ? 14  CYS A CA   6  
ATOM   3600  C  C    . CYS A 1 14 ? 0.226   -8.343  -1.031  1.00 0.00 ? 14  CYS A C    6  
ATOM   3601  O  O    . CYS A 1 14 ? 0.844   -9.387  -1.237  1.00 0.00 ? 14  CYS A O    6  
ATOM   3602  C  CB   . CYS A 1 14 ? 0.833   -7.266  1.144   1.00 0.00 ? 14  CYS A CB   6  
ATOM   3603  S  SG   . CYS A 1 14 ? 1.573   -5.863  0.247   1.00 0.00 ? 14  CYS A SG   6  
ATOM   3604  H  H    . CYS A 1 14 ? -0.325  -9.360  1.983   1.00 0.00 ? 14  CYS A H    6  
ATOM   3605  H  HA   . CYS A 1 14 ? -1.124  -7.339  0.281   1.00 0.00 ? 14  CYS A HA   6  
ATOM   3606  H  HB2  . CYS A 1 14 ? 0.422   -6.885  2.067   1.00 0.00 ? 14  CYS A HB2  6  
ATOM   3607  H  HB3  . CYS A 1 14 ? 1.624   -7.966  1.370   1.00 0.00 ? 14  CYS A HB3  6  
ATOM   3608  N  N    . GLU A 1 15 ? -0.050  -7.464  -1.989  1.00 0.00 ? 15  GLU A N    6  
ATOM   3609  C  CA   . GLU A 1 15 ? 0.367   -7.683  -3.369  1.00 0.00 ? 15  GLU A CA   6  
ATOM   3610  C  C    . GLU A 1 15 ? 1.717   -8.391  -3.424  1.00 0.00 ? 15  GLU A C    6  
ATOM   3611  O  O    . GLU A 1 15 ? 1.832   -9.494  -3.958  1.00 0.00 ? 15  GLU A O    6  
ATOM   3612  C  CB   . GLU A 1 15 ? 0.446   -6.351  -4.118  1.00 0.00 ? 15  GLU A CB   6  
ATOM   3613  C  CG   . GLU A 1 15 ? 0.306   -6.491  -5.625  1.00 0.00 ? 15  GLU A CG   6  
ATOM   3614  C  CD   . GLU A 1 15 ? 1.493   -7.190  -6.259  1.00 0.00 ? 15  GLU A CD   6  
ATOM   3615  O  OE1  . GLU A 1 15 ? 2.636   -6.742  -6.029  1.00 0.00 ? 15  GLU A OE1  6  
ATOM   3616  O  OE2  . GLU A 1 15 ? 1.279   -8.184  -6.984  1.00 0.00 ? 15  GLU A OE2  6  
ATOM   3617  H  H    . GLU A 1 15 ? -0.546  -6.650  -1.762  1.00 0.00 ? 15  GLU A H    6  
ATOM   3618  H  HA   . GLU A 1 15 ? -0.374  -8.308  -3.844  1.00 0.00 ? 15  GLU A HA   6  
ATOM   3619  H  HB2  . GLU A 1 15 ? -0.342  -5.704  -3.762  1.00 0.00 ? 15  GLU A HB2  6  
ATOM   3620  H  HB3  . GLU A 1 15 ? 1.400   -5.890  -3.908  1.00 0.00 ? 15  GLU A HB3  6  
ATOM   3621  H  HG2  . GLU A 1 15 ? -0.585  -7.062  -5.839  1.00 0.00 ? 15  GLU A HG2  6  
ATOM   3622  H  HG3  . GLU A 1 15 ? 0.214   -5.506  -6.058  1.00 0.00 ? 15  GLU A HG3  6  
ATOM   3623  N  N    . THR A 1 16 ? 2.739   -7.748  -2.867  1.00 0.00 ? 16  THR A N    6  
ATOM   3624  C  CA   . THR A 1 16 ? 4.082   -8.314  -2.854  1.00 0.00 ? 16  THR A CA   6  
ATOM   3625  C  C    . THR A 1 16 ? 4.099   -9.673  -2.165  1.00 0.00 ? 16  THR A C    6  
ATOM   3626  O  O    . THR A 1 16 ? 3.675   -9.821  -1.019  1.00 0.00 ? 16  THR A O    6  
ATOM   3627  C  CB   . THR A 1 16 ? 5.079   -7.379  -2.143  1.00 0.00 ? 16  THR A CB   6  
ATOM   3628  O  OG1  . THR A 1 16 ? 5.214   -6.157  -2.878  1.00 0.00 ? 16  THR A OG1  6  
ATOM   3629  C  CG2  . THR A 1 16 ? 6.439   -8.044  -2.001  1.00 0.00 ? 16  THR A CG2  6  
ATOM   3630  H  H    . THR A 1 16 ? 2.585   -6.871  -2.457  1.00 0.00 ? 16  THR A H    6  
ATOM   3631  H  HA   . THR A 1 16 ? 4.403   -8.436  -3.878  1.00 0.00 ? 16  THR A HA   6  
ATOM   3632  H  HB   . THR A 1 16 ? 4.699   -7.156  -1.156  1.00 0.00 ? 16  THR A HB   6  
ATOM   3633  H  HG1  . THR A 1 16 ? 4.718   -5.462  -2.438  1.00 0.00 ? 16  THR A HG1  6  
ATOM   3634  H  HG21 . THR A 1 16 ? 6.567   -8.388  -0.986  1.00 0.00 ? 16  THR A HG21 6  
ATOM   3635  H  HG22 . THR A 1 16 ? 7.215   -7.332  -2.240  1.00 0.00 ? 16  THR A HG22 6  
ATOM   3636  H  HG23 . THR A 1 16 ? 6.500   -8.885  -2.677  1.00 0.00 ? 16  THR A HG23 6  
ATOM   3637  N  N    . PRO A 1 17 ? 4.601   -10.693 -2.878  1.00 0.00 ? 17  PRO A N    6  
ATOM   3638  C  CA   . PRO A 1 17 ? 4.686   -12.059 -2.354  1.00 0.00 ? 17  PRO A CA   6  
ATOM   3639  C  C    . PRO A 1 17 ? 5.727   -12.192 -1.248  1.00 0.00 ? 17  PRO A C    6  
ATOM   3640  O  O    . PRO A 1 17 ? 5.929   -13.274 -0.699  1.00 0.00 ? 17  PRO A O    6  
ATOM   3641  C  CB   . PRO A 1 17 ? 5.098   -12.883 -3.577  1.00 0.00 ? 17  PRO A CB   6  
ATOM   3642  C  CG   . PRO A 1 17 ? 5.800   -11.916 -4.466  1.00 0.00 ? 17  PRO A CG   6  
ATOM   3643  C  CD   . PRO A 1 17 ? 5.125   -10.589 -4.250  1.00 0.00 ? 17  PRO A CD   6  
ATOM   3644  H  HA   . PRO A 1 17 ? 3.730   -12.405 -1.990  1.00 0.00 ? 17  PRO A HA   6  
ATOM   3645  H  HB2  . PRO A 1 17 ? 5.753   -13.685 -3.269  1.00 0.00 ? 17  PRO A HB2  6  
ATOM   3646  H  HB3  . PRO A 1 17 ? 4.219   -13.290 -4.053  1.00 0.00 ? 17  PRO A HB3  6  
ATOM   3647  H  HG2  . PRO A 1 17 ? 6.842   -11.855 -4.193  1.00 0.00 ? 17  PRO A HG2  6  
ATOM   3648  H  HG3  . PRO A 1 17 ? 5.698   -12.224 -5.496  1.00 0.00 ? 17  PRO A HG3  6  
ATOM   3649  H  HD2  . PRO A 1 17 ? 5.841   -9.784  -4.331  1.00 0.00 ? 17  PRO A HD2  6  
ATOM   3650  H  HD3  . PRO A 1 17 ? 4.322   -10.455 -4.960  1.00 0.00 ? 17  PRO A HD3  6  
ATOM   3651  N  N    . ASN A 1 18 ? 6.385   -11.083 -0.924  1.00 0.00 ? 18  ASN A N    6  
ATOM   3652  C  CA   . ASN A 1 18 ? 7.406   -11.076 0.117   1.00 0.00 ? 18  ASN A CA   6  
ATOM   3653  C  C    . ASN A 1 18 ? 6.899   -10.368 1.370   1.00 0.00 ? 18  ASN A C    6  
ATOM   3654  O  O    . ASN A 1 18 ? 7.417   -10.578 2.468   1.00 0.00 ? 18  ASN A O    6  
ATOM   3655  C  CB   . ASN A 1 18 ? 8.677   -10.393 -0.390  1.00 0.00 ? 18  ASN A CB   6  
ATOM   3656  C  CG   . ASN A 1 18 ? 9.517   -11.307 -1.260  1.00 0.00 ? 18  ASN A CG   6  
ATOM   3657  O  OD1  . ASN A 1 18 ? 9.715   -11.044 -2.446  1.00 0.00 ? 18  ASN A OD1  6  
ATOM   3658  N  ND2  . ASN A 1 18 ? 10.016  -12.389 -0.673  1.00 0.00 ? 18  ASN A ND2  6  
ATOM   3659  H  H    . ASN A 1 18 ? 6.180   -10.250 -1.397  1.00 0.00 ? 18  ASN A H    6  
ATOM   3660  H  HA   . ASN A 1 18 ? 7.633   -12.102 0.365   1.00 0.00 ? 18  ASN A HA   6  
ATOM   3661  H  HB2  . ASN A 1 18 ? 8.404   -9.525  -0.972  1.00 0.00 ? 18  ASN A HB2  6  
ATOM   3662  H  HB3  . ASN A 1 18 ? 9.273   -10.081 0.455   1.00 0.00 ? 18  ASN A HB3  6  
ATOM   3663  H  HD21 . ASN A 1 18 ? 9.817   -12.534 0.276   1.00 0.00 ? 18  ASN A HD21 6  
ATOM   3664  H  HD22 . ASN A 1 18 ? 10.564  -12.997 -1.212  1.00 0.00 ? 18  ASN A HD22 6  
ATOM   3665  N  N    . CYS A 1 19 ? 5.883   -9.529  1.199   1.00 0.00 ? 19  CYS A N    6  
ATOM   3666  C  CA   . CYS A 1 19 ? 5.306   -8.790  2.315   1.00 0.00 ? 19  CYS A CA   6  
ATOM   3667  C  C    . CYS A 1 19 ? 4.375   -9.680  3.134   1.00 0.00 ? 19  CYS A C    6  
ATOM   3668  O  O    . CYS A 1 19 ? 3.315   -10.103 2.673   1.00 0.00 ? 19  CYS A O    6  
ATOM   3669  C  CB   . CYS A 1 19 ? 4.540   -7.568  1.803   1.00 0.00 ? 19  CYS A CB   6  
ATOM   3670  S  SG   . CYS A 1 19 ? 4.035   -6.405  3.110   1.00 0.00 ? 19  CYS A SG   6  
ATOM   3671  H  H    . CYS A 1 19 ? 5.513   -9.404  0.300   1.00 0.00 ? 19  CYS A H    6  
ATOM   3672  H  HA   . CYS A 1 19 ? 6.115   -8.457  2.947   1.00 0.00 ? 19  CYS A HA   6  
ATOM   3673  H  HB2  . CYS A 1 19 ? 5.165   -7.027  1.106   1.00 0.00 ? 19  CYS A HB2  6  
ATOM   3674  H  HB3  . CYS A 1 19 ? 3.647   -7.900  1.294   1.00 0.00 ? 19  CYS A HB3  6  
ATOM   3675  N  N    . PRO A 1 20 ? 4.780   -9.971  4.379   1.00 0.00 ? 20  PRO A N    6  
ATOM   3676  C  CA   . PRO A 1 20 ? 3.997   -10.812 5.290   1.00 0.00 ? 20  PRO A CA   6  
ATOM   3677  C  C    . PRO A 1 20 ? 2.720   -10.125 5.760   1.00 0.00 ? 20  PRO A C    6  
ATOM   3678  O  O    . PRO A 1 20 ? 1.908   -10.720 6.469   1.00 0.00 ? 20  PRO A O    6  
ATOM   3679  C  CB   . PRO A 1 20 ? 4.948   -11.039 6.468   1.00 0.00 ? 20  PRO A CB   6  
ATOM   3680  C  CG   . PRO A 1 20 ? 5.868   -9.867  6.444   1.00 0.00 ? 20  PRO A CG   6  
ATOM   3681  C  CD   . PRO A 1 20 ? 6.032   -9.500  4.995   1.00 0.00 ? 20  PRO A CD   6  
ATOM   3682  H  HA   . PRO A 1 20 ? 3.749   -11.761 4.838   1.00 0.00 ? 20  PRO A HA   6  
ATOM   3683  H  HB2  . PRO A 1 20 ? 4.381   -11.078 7.388   1.00 0.00 ? 20  PRO A HB2  6  
ATOM   3684  H  HB3  . PRO A 1 20 ? 5.484   -11.965 6.329   1.00 0.00 ? 20  PRO A HB3  6  
ATOM   3685  H  HG2  . PRO A 1 20 ? 5.431   -9.046  6.992   1.00 0.00 ? 20  PRO A HG2  6  
ATOM   3686  H  HG3  . PRO A 1 20 ? 6.821   -10.141 6.871   1.00 0.00 ? 20  PRO A HG3  6  
ATOM   3687  H  HD2  . PRO A 1 20 ? 6.137   -8.431  4.886   1.00 0.00 ? 20  PRO A HD2  6  
ATOM   3688  H  HD3  . PRO A 1 20 ? 6.885   -10.010 4.571   1.00 0.00 ? 20  PRO A HD3  6  
ATOM   3689  N  N    . PHE A 1 21 ? 2.548   -8.869  5.361   1.00 0.00 ? 21  PHE A N    6  
ATOM   3690  C  CA   . PHE A 1 21 ? 1.368   -8.101  5.743   1.00 0.00 ? 21  PHE A CA   6  
ATOM   3691  C  C    . PHE A 1 21 ? 0.245   -8.289  4.728   1.00 0.00 ? 21  PHE A C    6  
ATOM   3692  O  O    . PHE A 1 21 ? 0.490   -8.610  3.565   1.00 0.00 ? 21  PHE A O    6  
ATOM   3693  C  CB   . PHE A 1 21 ? 1.718   -6.616  5.863   1.00 0.00 ? 21  PHE A CB   6  
ATOM   3694  C  CG   . PHE A 1 21 ? 2.632   -6.306  7.014   1.00 0.00 ? 21  PHE A CG   6  
ATOM   3695  C  CD1  . PHE A 1 21 ? 3.922   -6.812  7.047   1.00 0.00 ? 21  PHE A CD1  6  
ATOM   3696  C  CD2  . PHE A 1 21 ? 2.202   -5.510  8.063   1.00 0.00 ? 21  PHE A CD2  6  
ATOM   3697  C  CE1  . PHE A 1 21 ? 4.765   -6.529  8.105   1.00 0.00 ? 21  PHE A CE1  6  
ATOM   3698  C  CE2  . PHE A 1 21 ? 3.040   -5.224  9.124   1.00 0.00 ? 21  PHE A CE2  6  
ATOM   3699  C  CZ   . PHE A 1 21 ? 4.324   -5.733  9.144   1.00 0.00 ? 21  PHE A CZ   6  
ATOM   3700  H  H    . PHE A 1 21 ? 3.231   -8.449  4.797   1.00 0.00 ? 21  PHE A H    6  
ATOM   3701  H  HA   . PHE A 1 21 ? 1.035   -8.462  6.703   1.00 0.00 ? 21  PHE A HA   6  
ATOM   3702  H  HB2  . PHE A 1 21 ? 2.207   -6.294  4.956   1.00 0.00 ? 21  PHE A HB2  6  
ATOM   3703  H  HB3  . PHE A 1 21 ? 0.809   -6.049  5.998   1.00 0.00 ? 21  PHE A HB3  6  
ATOM   3704  H  HD1  . PHE A 1 21 ? 4.269   -7.433  6.234   1.00 0.00 ? 21  PHE A HD1  6  
ATOM   3705  H  HD2  . PHE A 1 21 ? 1.197   -5.110  8.048   1.00 0.00 ? 21  PHE A HD2  6  
ATOM   3706  H  HE1  . PHE A 1 21 ? 5.768   -6.929  8.119   1.00 0.00 ? 21  PHE A HE1  6  
ATOM   3707  H  HE2  . PHE A 1 21 ? 2.692   -4.601  9.935   1.00 0.00 ? 21  PHE A HE2  6  
ATOM   3708  H  HZ   . PHE A 1 21 ? 4.980   -5.511  9.972   1.00 0.00 ? 21  PHE A HZ   6  
ATOM   3709  N  N    . PHE A 1 22 ? -0.990  -8.089  5.178   1.00 0.00 ? 22  PHE A N    6  
ATOM   3710  C  CA   . PHE A 1 22 ? -2.153  -8.239  4.310   1.00 0.00 ? 22  PHE A CA   6  
ATOM   3711  C  C    . PHE A 1 22 ? -2.535  -6.904  3.678   1.00 0.00 ? 22  PHE A C    6  
ATOM   3712  O  O    . PHE A 1 22 ? -2.261  -5.841  4.234   1.00 0.00 ? 22  PHE A O    6  
ATOM   3713  C  CB   . PHE A 1 22 ? -3.337  -8.799  5.101   1.00 0.00 ? 22  PHE A CB   6  
ATOM   3714  C  CG   . PHE A 1 22 ? -3.101  -10.184 5.633   1.00 0.00 ? 22  PHE A CG   6  
ATOM   3715  C  CD1  . PHE A 1 22 ? -3.169  -11.284 4.793   1.00 0.00 ? 22  PHE A CD1  6  
ATOM   3716  C  CD2  . PHE A 1 22 ? -2.811  -10.386 6.972   1.00 0.00 ? 22  PHE A CD2  6  
ATOM   3717  C  CE1  . PHE A 1 22 ? -2.953  -12.559 5.279   1.00 0.00 ? 22  PHE A CE1  6  
ATOM   3718  C  CE2  . PHE A 1 22 ? -2.594  -11.659 7.465   1.00 0.00 ? 22  PHE A CE2  6  
ATOM   3719  C  CZ   . PHE A 1 22 ? -2.664  -12.747 6.617   1.00 0.00 ? 22  PHE A CZ   6  
ATOM   3720  H  H    . PHE A 1 22 ? -1.122  -7.836  6.115   1.00 0.00 ? 22  PHE A H    6  
ATOM   3721  H  HA   . PHE A 1 22 ? -1.894  -8.934  3.526   1.00 0.00 ? 22  PHE A HA   6  
ATOM   3722  H  HB2  . PHE A 1 22 ? -3.538  -8.152  5.942   1.00 0.00 ? 22  PHE A HB2  6  
ATOM   3723  H  HB3  . PHE A 1 22 ? -4.205  -8.831  4.461   1.00 0.00 ? 22  PHE A HB3  6  
ATOM   3724  H  HD1  . PHE A 1 22 ? -3.394  -11.138 3.746   1.00 0.00 ? 22  PHE A HD1  6  
ATOM   3725  H  HD2  . PHE A 1 22 ? -2.755  -9.535  7.637   1.00 0.00 ? 22  PHE A HD2  6  
ATOM   3726  H  HE1  . PHE A 1 22 ? -3.009  -13.408 4.614   1.00 0.00 ? 22  PHE A HE1  6  
ATOM   3727  H  HE2  . PHE A 1 22 ? -2.368  -11.802 8.511   1.00 0.00 ? 22  PHE A HE2  6  
ATOM   3728  H  HZ   . PHE A 1 22 ? -2.495  -13.743 7.000   1.00 0.00 ? 22  PHE A HZ   6  
ATOM   3729  N  N    . MET A 1 23 ? -3.169  -6.968  2.512   1.00 0.00 ? 23  MET A N    6  
ATOM   3730  C  CA   . MET A 1 23 ? -3.590  -5.765  1.804   1.00 0.00 ? 23  MET A CA   6  
ATOM   3731  C  C    . MET A 1 23 ? -4.976  -5.320  2.263   1.00 0.00 ? 23  MET A C    6  
ATOM   3732  O  O    . MET A 1 23 ? -5.919  -6.111  2.274   1.00 0.00 ? 23  MET A O    6  
ATOM   3733  C  CB   . MET A 1 23 ? -3.595  -6.011  0.294   1.00 0.00 ? 23  MET A CB   6  
ATOM   3734  C  CG   . MET A 1 23 ? -4.234  -7.331  -0.104  1.00 0.00 ? 23  MET A CG   6  
ATOM   3735  S  SD   . MET A 1 23 ? -4.925  -7.293  -1.769  1.00 0.00 ? 23  MET A SD   6  
ATOM   3736  C  CE   . MET A 1 23 ? -3.777  -8.359  -2.637  1.00 0.00 ? 23  MET A CE   6  
ATOM   3737  H  H    . MET A 1 23 ? -3.360  -7.845  2.118   1.00 0.00 ? 23  MET A H    6  
ATOM   3738  H  HA   . MET A 1 23 ? -2.881  -4.983  2.030   1.00 0.00 ? 23  MET A HA   6  
ATOM   3739  H  HB2  . MET A 1 23 ? -4.139  -5.212  -0.187  1.00 0.00 ? 23  MET A HB2  6  
ATOM   3740  H  HB3  . MET A 1 23 ? -2.576  -6.007  -0.063  1.00 0.00 ? 23  MET A HB3  6  
ATOM   3741  H  HG2  . MET A 1 23 ? -3.484  -8.107  -0.059  1.00 0.00 ? 23  MET A HG2  6  
ATOM   3742  H  HG3  . MET A 1 23 ? -5.025  -7.557  0.595   1.00 0.00 ? 23  MET A HG3  6  
ATOM   3743  H  HE1  . MET A 1 23 ? -4.239  -9.320  -2.811  1.00 0.00 ? 23  MET A HE1  6  
ATOM   3744  H  HE2  . MET A 1 23 ? -3.513  -7.910  -3.583  1.00 0.00 ? 23  MET A HE2  6  
ATOM   3745  H  HE3  . MET A 1 23 ? -2.887  -8.491  -2.040  1.00 0.00 ? 23  MET A HE3  6  
ATOM   3746  N  N    . SER A 1 24 ? -5.090  -4.051  2.641   1.00 0.00 ? 24  SER A N    6  
ATOM   3747  C  CA   . SER A 1 24 ? -6.360  -3.503  3.104   1.00 0.00 ? 24  SER A CA   6  
ATOM   3748  C  C    . SER A 1 24 ? -7.314  -3.280  1.935   1.00 0.00 ? 24  SER A C    6  
ATOM   3749  O  O    . SER A 1 24 ? -6.964  -3.515  0.779   1.00 0.00 ? 24  SER A O    6  
ATOM   3750  C  CB   . SER A 1 24 ? -6.130  -2.186  3.848   1.00 0.00 ? 24  SER A CB   6  
ATOM   3751  O  OG   . SER A 1 24 ? -7.117  -1.985  4.845   1.00 0.00 ? 24  SER A OG   6  
ATOM   3752  H  H    . SER A 1 24 ? -4.301  -3.470  2.609   1.00 0.00 ? 24  SER A H    6  
ATOM   3753  H  HA   . SER A 1 24 ? -6.801  -4.218  3.783   1.00 0.00 ? 24  SER A HA   6  
ATOM   3754  H  HB2  . SER A 1 24 ? -5.159  -2.207  4.319   1.00 0.00 ? 24  SER A HB2  6  
ATOM   3755  H  HB3  . SER A 1 24 ? -6.172  -1.367  3.145   1.00 0.00 ? 24  SER A HB3  6  
ATOM   3756  H  HG   . SER A 1 24 ? -7.828  -1.448  4.487   1.00 0.00 ? 24  SER A HG   6  
ATOM   3757  N  N    . VAL A 1 25 ? -8.524  -2.825  2.246   1.00 0.00 ? 25  VAL A N    6  
ATOM   3758  C  CA   . VAL A 1 25 ? -9.531  -2.569  1.222   1.00 0.00 ? 25  VAL A CA   6  
ATOM   3759  C  C    . VAL A 1 25 ? -9.256  -1.256  0.498   1.00 0.00 ? 25  VAL A C    6  
ATOM   3760  O  O    . VAL A 1 25 ? -9.651  -1.076  -0.653  1.00 0.00 ? 25  VAL A O    6  
ATOM   3761  C  CB   . VAL A 1 25 ? -10.946 -2.523  1.827   1.00 0.00 ? 25  VAL A CB   6  
ATOM   3762  C  CG1  . VAL A 1 25 ? -11.975 -2.198  0.754   1.00 0.00 ? 25  VAL A CG1  6  
ATOM   3763  C  CG2  . VAL A 1 25 ? -11.276 -3.840  2.512   1.00 0.00 ? 25  VAL A CG2  6  
ATOM   3764  H  H    . VAL A 1 25 ? -8.745  -2.658  3.186   1.00 0.00 ? 25  VAL A H    6  
ATOM   3765  H  HA   . VAL A 1 25 ? -9.493  -3.378  0.507   1.00 0.00 ? 25  VAL A HA   6  
ATOM   3766  H  HB   . VAL A 1 25 ? -10.974 -1.739  2.569   1.00 0.00 ? 25  VAL A HB   6  
ATOM   3767  H  HG11 . VAL A 1 25 ? -12.934 -2.019  1.218   1.00 0.00 ? 25  VAL A HG11 6  
ATOM   3768  H  HG12 . VAL A 1 25 ? -11.665 -1.316  0.213   1.00 0.00 ? 25  VAL A HG12 6  
ATOM   3769  H  HG13 . VAL A 1 25 ? -12.056 -3.030  0.070   1.00 0.00 ? 25  VAL A HG13 6  
ATOM   3770  H  HG21 . VAL A 1 25 ? -11.520 -4.583  1.766   1.00 0.00 ? 25  VAL A HG21 6  
ATOM   3771  H  HG22 . VAL A 1 25 ? -10.423 -4.171  3.084   1.00 0.00 ? 25  VAL A HG22 6  
ATOM   3772  H  HG23 . VAL A 1 25 ? -12.121 -3.702  3.171   1.00 0.00 ? 25  VAL A HG23 6  
ATOM   3773  N  N    . ASN A 1 26 ? -8.575  -0.341  1.181   1.00 0.00 ? 26  ASN A N    6  
ATOM   3774  C  CA   . ASN A 1 26 ? -8.247  0.957   0.603   1.00 0.00 ? 26  ASN A CA   6  
ATOM   3775  C  C    . ASN A 1 26 ? -6.768  1.031   0.236   1.00 0.00 ? 26  ASN A C    6  
ATOM   3776  O  O    . ASN A 1 26 ? -6.292  2.046   -0.274  1.00 0.00 ? 26  ASN A O    6  
ATOM   3777  C  CB   . ASN A 1 26 ? -8.597  2.079   1.583   1.00 0.00 ? 26  ASN A CB   6  
ATOM   3778  C  CG   . ASN A 1 26 ? -8.562  3.447   0.931   1.00 0.00 ? 26  ASN A CG   6  
ATOM   3779  O  OD1  . ASN A 1 26 ? -8.916  3.600   -0.238  1.00 0.00 ? 26  ASN A OD1  6  
ATOM   3780  N  ND2  . ASN A 1 26 ? -8.134  4.452   1.687   1.00 0.00 ? 26  ASN A ND2  6  
ATOM   3781  H  H    . ASN A 1 26 ? -8.287  -0.543  2.096   1.00 0.00 ? 26  ASN A H    6  
ATOM   3782  H  HA   . ASN A 1 26 ? -8.835  1.078   -0.294  1.00 0.00 ? 26  ASN A HA   6  
ATOM   3783  H  HB2  . ASN A 1 26 ? -9.592  1.912   1.971   1.00 0.00 ? 26  ASN A HB2  6  
ATOM   3784  H  HB3  . ASN A 1 26 ? -7.891  2.070   2.399   1.00 0.00 ? 26  ASN A HB3  6  
ATOM   3785  H  HD21 . ASN A 1 26 ? -7.868  4.256   2.610   1.00 0.00 ? 26  ASN A HD21 6  
ATOM   3786  H  HD22 . ASN A 1 26 ? -8.101  5.347   1.291   1.00 0.00 ? 26  ASN A HD22 6  
ATOM   3787  N  N    . THR A 1 27 ? -6.044  -0.053  0.498   1.00 0.00 ? 27  THR A N    6  
ATOM   3788  C  CA   . THR A 1 27 ? -4.619  -0.112  0.196   1.00 0.00 ? 27  THR A CA   6  
ATOM   3789  C  C    . THR A 1 27 ? -4.333  -1.117  -0.914  1.00 0.00 ? 27  THR A C    6  
ATOM   3790  O  O    . THR A 1 27 ? -3.280  -1.070  -1.549  1.00 0.00 ? 27  THR A O    6  
ATOM   3791  C  CB   . THR A 1 27 ? -3.797  -0.492  1.441   1.00 0.00 ? 27  THR A CB   6  
ATOM   3792  O  OG1  . THR A 1 27 ? -4.015  -1.868  1.772   1.00 0.00 ? 27  THR A OG1  6  
ATOM   3793  C  CG2  . THR A 1 27 ? -4.172  0.385   2.626   1.00 0.00 ? 27  THR A CG2  6  
ATOM   3794  H  H    . THR A 1 27 ? -6.480  -0.831  0.904   1.00 0.00 ? 27  THR A H    6  
ATOM   3795  H  HA   . THR A 1 27 ? -4.307  0.869   -0.130  1.00 0.00 ? 27  THR A HA   6  
ATOM   3796  H  HB   . THR A 1 27 ? -2.749  -0.345  1.221   1.00 0.00 ? 27  THR A HB   6  
ATOM   3797  H  HG1  . THR A 1 27 ? -3.837  -2.415  1.002   1.00 0.00 ? 27  THR A HG1  6  
ATOM   3798  H  HG21 . THR A 1 27 ? -3.779  1.379   2.477   1.00 0.00 ? 27  THR A HG21 6  
ATOM   3799  H  HG22 . THR A 1 27 ? -3.756  -0.034  3.531   1.00 0.00 ? 27  THR A HG22 6  
ATOM   3800  H  HG23 . THR A 1 27 ? -5.247  0.432   2.713   1.00 0.00 ? 27  THR A HG23 6  
ATOM   3801  N  N    . GLN A 1 28 ? -5.278  -2.023  -1.143  1.00 0.00 ? 28  GLN A N    6  
ATOM   3802  C  CA   . GLN A 1 28 ? -5.126  -3.039  -2.178  1.00 0.00 ? 28  GLN A CA   6  
ATOM   3803  C  C    . GLN A 1 28 ? -4.779  -2.403  -3.520  1.00 0.00 ? 28  GLN A C    6  
ATOM   3804  O  O    . GLN A 1 28 ? -5.147  -1.263  -3.807  1.00 0.00 ? 28  GLN A O    6  
ATOM   3805  C  CB   . GLN A 1 28 ? -6.409  -3.862  -2.307  1.00 0.00 ? 28  GLN A CB   6  
ATOM   3806  C  CG   . GLN A 1 28 ? -7.540  -3.120  -3.001  1.00 0.00 ? 28  GLN A CG   6  
ATOM   3807  C  CD   . GLN A 1 28 ? -8.603  -4.054  -3.545  1.00 0.00 ? 28  GLN A CD   6  
ATOM   3808  O  OE1  . GLN A 1 28 ? -8.684  -4.284  -4.752  1.00 0.00 ? 28  GLN A OE1  6  
ATOM   3809  N  NE2  . GLN A 1 28 ? -9.426  -4.598  -2.656  1.00 0.00 ? 28  GLN A NE2  6  
ATOM   3810  H  H    . GLN A 1 28 ? -6.095  -2.009  -0.604  1.00 0.00 ? 28  GLN A H    6  
ATOM   3811  H  HA   . GLN A 1 28 ? -4.319  -3.693  -1.884  1.00 0.00 ? 28  GLN A HA   6  
ATOM   3812  H  HB2  . GLN A 1 28 ? -6.194  -4.756  -2.872  1.00 0.00 ? 28  GLN A HB2  6  
ATOM   3813  H  HB3  . GLN A 1 28 ? -6.744  -4.142  -1.319  1.00 0.00 ? 28  GLN A HB3  6  
ATOM   3814  H  HG2  . GLN A 1 28 ? -8.002  -2.449  -2.291  1.00 0.00 ? 28  GLN A HG2  6  
ATOM   3815  H  HG3  . GLN A 1 28 ? -7.129  -2.549  -3.820  1.00 0.00 ? 28  GLN A HG3  6  
ATOM   3816  H  HE21 . GLN A 1 28 ? -9.303  -4.367  -1.711  1.00 0.00 ? 28  GLN A HE21 6  
ATOM   3817  H  HE22 . GLN A 1 28 ? -10.123 -5.204  -2.980  1.00 0.00 ? 28  GLN A HE22 6  
ATOM   3818  N  N    . PRO A 1 29 ? -4.054  -3.154  -4.362  1.00 0.00 ? 29  PRO A N    6  
ATOM   3819  C  CA   . PRO A 1 29 ? -3.611  -4.511  -4.031  1.00 0.00 ? 29  PRO A CA   6  
ATOM   3820  C  C    . PRO A 1 29 ? -2.541  -4.522  -2.944  1.00 0.00 ? 29  PRO A C    6  
ATOM   3821  O  O    . PRO A 1 29 ? -2.352  -5.526  -2.255  1.00 0.00 ? 29  PRO A O    6  
ATOM   3822  C  CB   . PRO A 1 29 ? -3.037  -5.029  -5.352  1.00 0.00 ? 29  PRO A CB   6  
ATOM   3823  C  CG   . PRO A 1 29 ? -2.628  -3.804  -6.093  1.00 0.00 ? 29  PRO A CG   6  
ATOM   3824  C  CD   . PRO A 1 29 ? -3.611  -2.735  -5.702  1.00 0.00 ? 29  PRO A CD   6  
ATOM   3825  H  HA   . PRO A 1 29 ? -4.438  -5.135  -3.726  1.00 0.00 ? 29  PRO A HA   6  
ATOM   3826  H  HB2  . PRO A 1 29 ? -2.191  -5.672  -5.152  1.00 0.00 ? 29  PRO A HB2  6  
ATOM   3827  H  HB3  . PRO A 1 29 ? -3.796  -5.580  -5.887  1.00 0.00 ? 29  PRO A HB3  6  
ATOM   3828  H  HG2  . PRO A 1 29 ? -1.628  -3.517  -5.806  1.00 0.00 ? 29  PRO A HG2  6  
ATOM   3829  H  HG3  . PRO A 1 29 ? -2.676  -3.986  -7.157  1.00 0.00 ? 29  PRO A HG3  6  
ATOM   3830  H  HD2  . PRO A 1 29 ? -3.126  -1.772  -5.665  1.00 0.00 ? 29  PRO A HD2  6  
ATOM   3831  H  HD3  . PRO A 1 29 ? -4.441  -2.715  -6.393  1.00 0.00 ? 29  PRO A HD3  6  
ATOM   3832  N  N    . LEU A 1 30 ? -1.844  -3.402  -2.795  1.00 0.00 ? 30  LEU A N    6  
ATOM   3833  C  CA   . LEU A 1 30 ? -0.792  -3.282  -1.791  1.00 0.00 ? 30  LEU A CA   6  
ATOM   3834  C  C    . LEU A 1 30 ? -1.387  -3.147  -0.393  1.00 0.00 ? 30  LEU A C    6  
ATOM   3835  O  O    . LEU A 1 30 ? -2.603  -3.038  -0.232  1.00 0.00 ? 30  LEU A O    6  
ATOM   3836  C  CB   . LEU A 1 30 ? 0.099   -2.077  -2.098  1.00 0.00 ? 30  LEU A CB   6  
ATOM   3837  C  CG   . LEU A 1 30 ? 0.985   -2.196  -3.339  1.00 0.00 ? 30  LEU A CG   6  
ATOM   3838  C  CD1  . LEU A 1 30 ? 1.615   -0.853  -3.676  1.00 0.00 ? 30  LEU A CD1  6  
ATOM   3839  C  CD2  . LEU A 1 30 ? 2.059   -3.253  -3.127  1.00 0.00 ? 30  LEU A CD2  6  
ATOM   3840  H  H    . LEU A 1 30 ? -2.040  -2.636  -3.374  1.00 0.00 ? 30  LEU A H    6  
ATOM   3841  H  HA   . LEU A 1 30 ? -0.194  -4.181  -1.830  1.00 0.00 ? 30  LEU A HA   6  
ATOM   3842  H  HB2  . LEU A 1 30 ? -0.541  -1.218  -2.231  1.00 0.00 ? 30  LEU A HB2  6  
ATOM   3843  H  HB3  . LEU A 1 30 ? 0.742   -1.917  -1.245  1.00 0.00 ? 30  LEU A HB3  6  
ATOM   3844  H  HG   . LEU A 1 30 ? 0.377   -2.500  -4.180  1.00 0.00 ? 30  LEU A HG   6  
ATOM   3845  H  HD11 . LEU A 1 30 ? 1.421   -0.154  -2.876  1.00 0.00 ? 30  LEU A HD11 6  
ATOM   3846  H  HD12 . LEU A 1 30 ? 1.189   -0.477  -4.594  1.00 0.00 ? 30  LEU A HD12 6  
ATOM   3847  H  HD13 . LEU A 1 30 ? 2.681   -0.976  -3.797  1.00 0.00 ? 30  LEU A HD13 6  
ATOM   3848  H  HD21 . LEU A 1 30 ? 2.275   -3.740  -4.066  1.00 0.00 ? 30  LEU A HD21 6  
ATOM   3849  H  HD22 . LEU A 1 30 ? 1.708   -3.985  -2.414  1.00 0.00 ? 30  LEU A HD22 6  
ATOM   3850  H  HD23 . LEU A 1 30 ? 2.956   -2.784  -2.749  1.00 0.00 ? 30  LEU A HD23 6  
ATOM   3851  N  N    . CYS A 1 31 ? -0.522  -3.151  0.615   1.00 0.00 ? 31  CYS A N    6  
ATOM   3852  C  CA   . CYS A 1 31 ? -0.960  -3.027  2.000   1.00 0.00 ? 31  CYS A CA   6  
ATOM   3853  C  C    . CYS A 1 31 ? -0.636  -1.641  2.550   1.00 0.00 ? 31  CYS A C    6  
ATOM   3854  O  O    . CYS A 1 31 ? -0.045  -0.809  1.861   1.00 0.00 ? 31  CYS A O    6  
ATOM   3855  C  CB   . CYS A 1 31 ? -0.295  -4.099  2.865   1.00 0.00 ? 31  CYS A CB   6  
ATOM   3856  S  SG   . CYS A 1 31 ? 1.435   -3.732  3.305   1.00 0.00 ? 31  CYS A SG   6  
ATOM   3857  H  H    . CYS A 1 31 ? 0.436   -3.240  0.423   1.00 0.00 ? 31  CYS A H    6  
ATOM   3858  H  HA   . CYS A 1 31 ? -2.029  -3.169  2.024   1.00 0.00 ? 31  CYS A HA   6  
ATOM   3859  H  HB2  . CYS A 1 31 ? -0.852  -4.204  3.785   1.00 0.00 ? 31  CYS A HB2  6  
ATOM   3860  H  HB3  . CYS A 1 31 ? -0.307  -5.039  2.333   1.00 0.00 ? 31  CYS A HB3  6  
ATOM   3861  N  N    . HIS A 1 32 ? -1.029  -1.399  3.797   1.00 0.00 ? 32  HIS A N    6  
ATOM   3862  C  CA   . HIS A 1 32 ? -0.780  -0.114  4.441   1.00 0.00 ? 32  HIS A CA   6  
ATOM   3863  C  C    . HIS A 1 32 ? 0.704   0.238   4.398   1.00 0.00 ? 32  HIS A C    6  
ATOM   3864  O  O    . HIS A 1 32 ? 1.081   1.323   3.957   1.00 0.00 ? 32  HIS A O    6  
ATOM   3865  C  CB   . HIS A 1 32 ? -1.267  -0.143  5.890   1.00 0.00 ? 32  HIS A CB   6  
ATOM   3866  C  CG   . HIS A 1 32 ? -0.520  0.790   6.792   1.00 0.00 ? 32  HIS A CG   6  
ATOM   3867  N  ND1  . HIS A 1 32 ? 0.172   0.367   7.907   1.00 0.00 ? 32  HIS A ND1  6  
ATOM   3868  C  CD2  . HIS A 1 32 ? -0.358  2.133   6.738   1.00 0.00 ? 32  HIS A CD2  6  
ATOM   3869  C  CE1  . HIS A 1 32 ? 0.726   1.409   8.501   1.00 0.00 ? 32  HIS A CE1  6  
ATOM   3870  N  NE2  . HIS A 1 32 ? 0.420   2.493   7.811   1.00 0.00 ? 32  HIS A NE2  6  
ATOM   3871  H  H    . HIS A 1 32 ? -1.496  -2.101  4.296   1.00 0.00 ? 32  HIS A H    6  
ATOM   3872  H  HA   . HIS A 1 32 ? -1.332  0.640   3.901   1.00 0.00 ? 32  HIS A HA   6  
ATOM   3873  H  HB2  . HIS A 1 32 ? -2.311  0.133   5.918   1.00 0.00 ? 32  HIS A HB2  6  
ATOM   3874  H  HB3  . HIS A 1 32 ? -1.154  -1.144  6.281   1.00 0.00 ? 32  HIS A HB3  6  
ATOM   3875  H  HD1  . HIS A 1 32 ? 0.245   -0.559  8.218   1.00 0.00 ? 32  HIS A HD1  6  
ATOM   3876  H  HD2  . HIS A 1 32 ? -0.765  2.799   5.990   1.00 0.00 ? 32  HIS A HD2  6  
ATOM   3877  H  HE1  . HIS A 1 32 ? 1.328   1.381   9.397   1.00 0.00 ? 32  HIS A HE1  6  
ATOM   3878  N  N    . GLU A 1 33 ? 1.540   -0.688  4.859   1.00 0.00 ? 33  GLU A N    6  
ATOM   3879  C  CA   . GLU A 1 33 ? 2.982   -0.473  4.873   1.00 0.00 ? 33  GLU A CA   6  
ATOM   3880  C  C    . GLU A 1 33 ? 3.483   -0.048  3.496   1.00 0.00 ? 33  GLU A C    6  
ATOM   3881  O  O    . GLU A 1 33 ? 3.989   1.061   3.322   1.00 0.00 ? 33  GLU A O    6  
ATOM   3882  C  CB   . GLU A 1 33 ? 3.705   -1.746  5.321   1.00 0.00 ? 33  GLU A CB   6  
ATOM   3883  C  CG   . GLU A 1 33 ? 5.062   -1.485  5.952   1.00 0.00 ? 33  GLU A CG   6  
ATOM   3884  C  CD   . GLU A 1 33 ? 5.532   -2.635  6.822   1.00 0.00 ? 33  GLU A CD   6  
ATOM   3885  O  OE1  . GLU A 1 33 ? 4.836   -2.952  7.810   1.00 0.00 ? 33  GLU A OE1  6  
ATOM   3886  O  OE2  . GLU A 1 33 ? 6.593   -3.216  6.517   1.00 0.00 ? 33  GLU A OE2  6  
ATOM   3887  H  H    . GLU A 1 33 ? 1.179   -1.533  5.197   1.00 0.00 ? 33  GLU A H    6  
ATOM   3888  H  HA   . GLU A 1 33 ? 3.193   0.316   5.579   1.00 0.00 ? 33  GLU A HA   6  
ATOM   3889  H  HB2  . GLU A 1 33 ? 3.088   -2.261  6.043   1.00 0.00 ? 33  GLU A HB2  6  
ATOM   3890  H  HB3  . GLU A 1 33 ? 3.847   -2.385  4.462   1.00 0.00 ? 33  GLU A HB3  6  
ATOM   3891  H  HG2  . GLU A 1 33 ? 5.787   -1.331  5.166   1.00 0.00 ? 33  GLU A HG2  6  
ATOM   3892  H  HG3  . GLU A 1 33 ? 4.998   -0.595  6.560   1.00 0.00 ? 33  GLU A HG3  6  
ATOM   3893  N  N    . CYS A 1 34 ? 3.339   -0.939  2.520   1.00 0.00 ? 34  CYS A N    6  
ATOM   3894  C  CA   . CYS A 1 34 ? 3.777   -0.659  1.158   1.00 0.00 ? 34  CYS A CA   6  
ATOM   3895  C  C    . CYS A 1 34 ? 3.116   0.608   0.624   1.00 0.00 ? 34  CYS A C    6  
ATOM   3896  O  O    . CYS A 1 34 ? 3.793   1.580   0.288   1.00 0.00 ? 34  CYS A O    6  
ATOM   3897  C  CB   . CYS A 1 34 ? 3.453   -1.841  0.243   1.00 0.00 ? 34  CYS A CB   6  
ATOM   3898  S  SG   . CYS A 1 34 ? 4.256   -3.401  0.731   1.00 0.00 ? 34  CYS A SG   6  
ATOM   3899  H  H    . CYS A 1 34 ? 2.928   -1.806  2.721   1.00 0.00 ? 34  CYS A H    6  
ATOM   3900  H  HA   . CYS A 1 34 ? 4.846   -0.511  1.177   1.00 0.00 ? 34  CYS A HA   6  
ATOM   3901  H  HB2  . CYS A 1 34 ? 2.386   -2.007  0.246   1.00 0.00 ? 34  CYS A HB2  6  
ATOM   3902  H  HB3  . CYS A 1 34 ? 3.773   -1.607  -0.762  1.00 0.00 ? 34  CYS A HB3  6  
ATOM   3903  N  N    . SER A 1 35 ? 1.789   0.590   0.548   1.00 0.00 ? 35  SER A N    6  
ATOM   3904  C  CA   . SER A 1 35 ? 1.035   1.735   0.052   1.00 0.00 ? 35  SER A CA   6  
ATOM   3905  C  C    . SER A 1 35 ? 1.595   3.039   0.613   1.00 0.00 ? 35  SER A C    6  
ATOM   3906  O  O    . SER A 1 35 ? 1.658   4.051   -0.084  1.00 0.00 ? 35  SER A O    6  
ATOM   3907  C  CB   . SER A 1 35 ? -0.443  1.600   0.423   1.00 0.00 ? 35  SER A CB   6  
ATOM   3908  O  OG   . SER A 1 35 ? -1.247  2.461   -0.364  1.00 0.00 ? 35  SER A OG   6  
ATOM   3909  H  H    . SER A 1 35 ? 1.305   -0.215  0.831   1.00 0.00 ? 35  SER A H    6  
ATOM   3910  H  HA   . SER A 1 35 ? 1.127   1.752   -1.024  1.00 0.00 ? 35  SER A HA   6  
ATOM   3911  H  HB2  . SER A 1 35 ? -0.761  0.582   0.260   1.00 0.00 ? 35  SER A HB2  6  
ATOM   3912  H  HB3  . SER A 1 35 ? -0.574  1.856   1.465   1.00 0.00 ? 35  SER A HB3  6  
ATOM   3913  H  HG   . SER A 1 35 ? -0.947  2.436   -1.276  1.00 0.00 ? 35  SER A HG   6  
ATOM   3914  N  N    . GLU A 1 36 ? 2.001   3.005   1.879   1.00 0.00 ? 36  GLU A N    6  
ATOM   3915  C  CA   . GLU A 1 36 ? 2.555   4.183   2.535   1.00 0.00 ? 36  GLU A CA   6  
ATOM   3916  C  C    . GLU A 1 36 ? 3.874   4.596   1.888   1.00 0.00 ? 36  GLU A C    6  
ATOM   3917  O  O    . GLU A 1 36 ? 4.163   5.784   1.746   1.00 0.00 ? 36  GLU A O    6  
ATOM   3918  C  CB   . GLU A 1 36 ? 2.769   3.912   4.025   1.00 0.00 ? 36  GLU A CB   6  
ATOM   3919  C  CG   . GLU A 1 36 ? 3.805   4.819   4.667   1.00 0.00 ? 36  GLU A CG   6  
ATOM   3920  C  CD   . GLU A 1 36 ? 3.313   6.244   4.829   1.00 0.00 ? 36  GLU A CD   6  
ATOM   3921  O  OE1  . GLU A 1 36 ? 2.793   6.808   3.844   1.00 0.00 ? 36  GLU A OE1  6  
ATOM   3922  O  OE2  . GLU A 1 36 ? 3.448   6.794   5.942   1.00 0.00 ? 36  GLU A OE2  6  
ATOM   3923  H  H    . GLU A 1 36 ? 1.926   2.168   2.383   1.00 0.00 ? 36  GLU A H    6  
ATOM   3924  H  HA   . GLU A 1 36 ? 1.846   4.989   2.423   1.00 0.00 ? 36  GLU A HA   6  
ATOM   3925  H  HB2  . GLU A 1 36 ? 1.830   4.049   4.542   1.00 0.00 ? 36  GLU A HB2  6  
ATOM   3926  H  HB3  . GLU A 1 36 ? 3.091   2.888   4.149   1.00 0.00 ? 36  GLU A HB3  6  
ATOM   3927  H  HG2  . GLU A 1 36 ? 4.054   4.427   5.642   1.00 0.00 ? 36  GLU A HG2  6  
ATOM   3928  H  HG3  . GLU A 1 36 ? 4.690   4.827   4.048   1.00 0.00 ? 36  GLU A HG3  6  
ATOM   3929  N  N    . ARG A 1 37 ? 4.671   3.606   1.498   1.00 0.00 ? 37  ARG A N    6  
ATOM   3930  C  CA   . ARG A 1 37 ? 5.960   3.866   0.868   1.00 0.00 ? 37  ARG A CA   6  
ATOM   3931  C  C    . ARG A 1 37 ? 5.777   4.562   -0.478  1.00 0.00 ? 37  ARG A C    6  
ATOM   3932  O  O    . ARG A 1 37 ? 6.519   5.485   -0.816  1.00 0.00 ? 37  ARG A O    6  
ATOM   3933  C  CB   . ARG A 1 37 ? 6.730   2.558   0.676   1.00 0.00 ? 37  ARG A CB   6  
ATOM   3934  C  CG   . ARG A 1 37 ? 6.886   1.750   1.954   1.00 0.00 ? 37  ARG A CG   6  
ATOM   3935  C  CD   . ARG A 1 37 ? 7.741   2.483   2.976   1.00 0.00 ? 37  ARG A CD   6  
ATOM   3936  N  NE   . ARG A 1 37 ? 9.157   2.470   2.616   1.00 0.00 ? 37  ARG A NE   6  
ATOM   3937  C  CZ   . ARG A 1 37 ? 10.062  3.271   3.165   1.00 0.00 ? 37  ARG A CZ   6  
ATOM   3938  N  NH1  . ARG A 1 37 ? 9.703   4.144   4.095   1.00 0.00 ? 37  ARG A NH1  6  
ATOM   3939  N  NH2  . ARG A 1 37 ? 11.332  3.199   2.784   1.00 0.00 ? 37  ARG A NH2  6  
ATOM   3940  H  H    . ARG A 1 37 ? 4.385   2.679   1.637   1.00 0.00 ? 37  ARG A H    6  
ATOM   3941  H  HA   . ARG A 1 37 ? 6.524   4.514   1.521   1.00 0.00 ? 37  ARG A HA   6  
ATOM   3942  H  HB2  . ARG A 1 37 ? 6.209   1.949   -0.047  1.00 0.00 ? 37  ARG A HB2  6  
ATOM   3943  H  HB3  . ARG A 1 37 ? 7.715   2.787   0.299   1.00 0.00 ? 37  ARG A HB3  6  
ATOM   3944  H  HG2  . ARG A 1 37 ? 5.909   1.575   2.380   1.00 0.00 ? 37  ARG A HG2  6  
ATOM   3945  H  HG3  . ARG A 1 37 ? 7.353   0.806   1.718   1.00 0.00 ? 37  ARG A HG3  6  
ATOM   3946  H  HD2  . ARG A 1 37 ? 7.406   3.508   3.038   1.00 0.00 ? 37  ARG A HD2  6  
ATOM   3947  H  HD3  . ARG A 1 37 ? 7.619   2.006   3.937   1.00 0.00 ? 37  ARG A HD3  6  
ATOM   3948  H  HE   . ARG A 1 37 ? 9.444   1.832   1.930   1.00 0.00 ? 37  ARG A HE   6  
ATOM   3949  H  HH11 . ARG A 1 37 ? 8.747   4.200   4.385   1.00 0.00 ? 37  ARG A HH11 6  
ATOM   3950  H  HH12 . ARG A 1 37 ? 10.387  4.746   4.509   1.00 0.00 ? 37  ARG A HH12 6  
ATOM   3951  H  HH21 . ARG A 1 37 ? 11.607  2.542   2.083   1.00 0.00 ? 37  ARG A HH21 6  
ATOM   3952  H  HH22 . ARG A 1 37 ? 12.013  3.802   3.198   1.00 0.00 ? 37  ARG A HH22 6  
ATOM   3953  N  N    . ARG A 1 38 ? 4.785   4.114   -1.240  1.00 0.00 ? 38  ARG A N    6  
ATOM   3954  C  CA   . ARG A 1 38 ? 4.506   4.693   -2.549  1.00 0.00 ? 38  ARG A CA   6  
ATOM   3955  C  C    . ARG A 1 38 ? 3.964   6.113   -2.411  1.00 0.00 ? 38  ARG A C    6  
ATOM   3956  O  O    . ARG A 1 38 ? 4.394   7.022   -3.120  1.00 0.00 ? 38  ARG A O    6  
ATOM   3957  C  CB   . ARG A 1 38 ? 3.503   3.825   -3.311  1.00 0.00 ? 38  ARG A CB   6  
ATOM   3958  C  CG   . ARG A 1 38 ? 4.155   2.750   -4.165  1.00 0.00 ? 38  ARG A CG   6  
ATOM   3959  C  CD   . ARG A 1 38 ? 3.115   1.896   -4.875  1.00 0.00 ? 38  ARG A CD   6  
ATOM   3960  N  NE   . ARG A 1 38 ? 2.319   2.676   -5.820  1.00 0.00 ? 38  ARG A NE   6  
ATOM   3961  C  CZ   . ARG A 1 38 ? 1.521   2.132   -6.731  1.00 0.00 ? 38  ARG A CZ   6  
ATOM   3962  N  NH1  . ARG A 1 38 ? 1.411   0.814   -6.820  1.00 0.00 ? 38  ARG A NH1  6  
ATOM   3963  N  NH2  . ARG A 1 38 ? 0.829   2.908   -7.556  1.00 0.00 ? 38  ARG A NH2  6  
ATOM   3964  H  H    . ARG A 1 38 ? 4.228   3.376   -0.916  1.00 0.00 ? 38  ARG A H    6  
ATOM   3965  H  HA   . ARG A 1 38 ? 5.433   4.726   -3.102  1.00 0.00 ? 38  ARG A HA   6  
ATOM   3966  H  HB2  . ARG A 1 38 ? 2.850   3.341   -2.600  1.00 0.00 ? 38  ARG A HB2  6  
ATOM   3967  H  HB3  . ARG A 1 38 ? 2.914   4.459   -3.956  1.00 0.00 ? 38  ARG A HB3  6  
ATOM   3968  H  HG2  . ARG A 1 38 ? 4.782   3.223   -4.906  1.00 0.00 ? 38  ARG A HG2  6  
ATOM   3969  H  HG3  . ARG A 1 38 ? 4.757   2.116   -3.532  1.00 0.00 ? 38  ARG A HG3  6  
ATOM   3970  H  HD2  . ARG A 1 38 ? 3.621   1.107   -5.411  1.00 0.00 ? 38  ARG A HD2  6  
ATOM   3971  H  HD3  . ARG A 1 38 ? 2.458   1.465   -4.135  1.00 0.00 ? 38  ARG A HD3  6  
ATOM   3972  H  HE   . ARG A 1 38 ? 2.385   3.652   -5.772  1.00 0.00 ? 38  ARG A HE   6  
ATOM   3973  H  HH11 . ARG A 1 38 ? 1.931   0.227   -6.200  1.00 0.00 ? 38  ARG A HH11 6  
ATOM   3974  H  HH12 . ARG A 1 38 ? 0.808   0.407   -7.507  1.00 0.00 ? 38  ARG A HH12 6  
ATOM   3975  H  HH21 . ARG A 1 38 ? 0.908   3.902   -7.492  1.00 0.00 ? 38  ARG A HH21 6  
ATOM   3976  H  HH22 . ARG A 1 38 ? 0.228   2.498   -8.242  1.00 0.00 ? 38  ARG A HH22 6  
ATOM   3977  N  N    . GLN A 1 39 ? 3.019   6.293   -1.494  1.00 0.00 ? 39  GLN A N    6  
ATOM   3978  C  CA   . GLN A 1 39 ? 2.418   7.602   -1.265  1.00 0.00 ? 39  GLN A CA   6  
ATOM   3979  C  C    . GLN A 1 39 ? 3.457   8.710   -1.400  1.00 0.00 ? 39  GLN A C    6  
ATOM   3980  O  O    . GLN A 1 39 ? 3.243   9.695   -2.106  1.00 0.00 ? 39  GLN A O    6  
ATOM   3981  C  CB   . GLN A 1 39 ? 1.775   7.655   0.122   1.00 0.00 ? 39  GLN A CB   6  
ATOM   3982  C  CG   . GLN A 1 39 ? 0.602   8.619   0.212   1.00 0.00 ? 39  GLN A CG   6  
ATOM   3983  C  CD   . GLN A 1 39 ? 1.040   10.069  0.246   1.00 0.00 ? 39  GLN A CD   6  
ATOM   3984  O  OE1  . GLN A 1 39 ? 2.159   10.383  0.653   1.00 0.00 ? 39  GLN A OE1  6  
ATOM   3985  N  NE2  . GLN A 1 39 ? 0.158   10.964  -0.183  1.00 0.00 ? 39  GLN A NE2  6  
ATOM   3986  H  H    . GLN A 1 39 ? 2.718   5.529   -0.961  1.00 0.00 ? 39  GLN A H    6  
ATOM   3987  H  HA   . GLN A 1 39 ? 1.653   7.751   -2.012  1.00 0.00 ? 39  GLN A HA   6  
ATOM   3988  H  HB2  . GLN A 1 39 ? 1.423   6.668   0.381   1.00 0.00 ? 39  GLN A HB2  6  
ATOM   3989  H  HB3  . GLN A 1 39 ? 2.521   7.963   0.840   1.00 0.00 ? 39  GLN A HB3  6  
ATOM   3990  H  HG2  . GLN A 1 39 ? -0.035  8.471   -0.647  1.00 0.00 ? 39  GLN A HG2  6  
ATOM   3991  H  HG3  . GLN A 1 39 ? 0.045   8.404   1.112   1.00 0.00 ? 39  GLN A HG3  6  
ATOM   3992  H  HE21 . GLN A 1 39 ? -0.715  10.642  -0.492  1.00 0.00 ? 39  GLN A HE21 6  
ATOM   3993  H  HE22 . GLN A 1 39 ? 0.414   11.909  -0.171  1.00 0.00 ? 39  GLN A HE22 6  
ATOM   3994  N  N    . LYS A 1 40 ? 4.585   8.542   -0.716  1.00 0.00 ? 40  LYS A N    6  
ATOM   3995  C  CA   . LYS A 1 40 ? 5.659   9.527   -0.759  1.00 0.00 ? 40  LYS A CA   6  
ATOM   3996  C  C    . LYS A 1 40 ? 6.365   9.503   -2.111  1.00 0.00 ? 40  LYS A C    6  
ATOM   3997  O  O    . LYS A 1 40 ? 6.404   10.509  -2.819  1.00 0.00 ? 40  LYS A O    6  
ATOM   3998  C  CB   . LYS A 1 40 ? 6.669   9.259   0.359   1.00 0.00 ? 40  LYS A CB   6  
ATOM   3999  C  CG   . LYS A 1 40 ? 7.900   10.146  0.293   1.00 0.00 ? 40  LYS A CG   6  
ATOM   4000  C  CD   . LYS A 1 40 ? 7.710   11.425  1.091   1.00 0.00 ? 40  LYS A CD   6  
ATOM   4001  C  CE   . LYS A 1 40 ? 7.135   12.539  0.230   1.00 0.00 ? 40  LYS A CE   6  
ATOM   4002  N  NZ   . LYS A 1 40 ? 6.824   13.755  1.031   1.00 0.00 ? 40  LYS A NZ   6  
ATOM   4003  H  H    . LYS A 1 40 ? 4.697   7.735   -0.170  1.00 0.00 ? 40  LYS A H    6  
ATOM   4004  H  HA   . LYS A 1 40 ? 5.222   10.502  -0.612  1.00 0.00 ? 40  LYS A HA   6  
ATOM   4005  H  HB2  . LYS A 1 40 ? 6.185   9.421   1.311   1.00 0.00 ? 40  LYS A HB2  6  
ATOM   4006  H  HB3  . LYS A 1 40 ? 6.990   8.229   0.300   1.00 0.00 ? 40  LYS A HB3  6  
ATOM   4007  H  HG2  . LYS A 1 40 ? 8.744   9.606   0.695   1.00 0.00 ? 40  LYS A HG2  6  
ATOM   4008  H  HG3  . LYS A 1 40 ? 8.092   10.402  -0.740  1.00 0.00 ? 40  LYS A HG3  6  
ATOM   4009  H  HD2  . LYS A 1 40 ? 7.032   11.231  1.909   1.00 0.00 ? 40  LYS A HD2  6  
ATOM   4010  H  HD3  . LYS A 1 40 ? 8.667   11.741  1.482   1.00 0.00 ? 40  LYS A HD3  6  
ATOM   4011  H  HE2  . LYS A 1 40 ? 7.855   12.795  -0.532  1.00 0.00 ? 40  LYS A HE2  6  
ATOM   4012  H  HE3  . LYS A 1 40 ? 6.228   12.184  -0.236  1.00 0.00 ? 40  LYS A HE3  6  
ATOM   4013  H  HZ1  . LYS A 1 40 ? 7.622   14.421  0.995   1.00 0.00 ? 40  LYS A HZ1  6  
ATOM   4014  H  HZ2  . LYS A 1 40 ? 6.650   13.494  2.023   1.00 0.00 ? 40  LYS A HZ2  6  
ATOM   4015  H  HZ3  . LYS A 1 40 ? 5.977   14.225  0.654   1.00 0.00 ? 40  LYS A HZ3  6  
ATOM   4016  N  N    . ASN A 1 41 ? 6.920   8.348   -2.464  1.00 0.00 ? 41  ASN A N    6  
ATOM   4017  C  CA   . ASN A 1 41 ? 7.623   8.194   -3.733  1.00 0.00 ? 41  ASN A CA   6  
ATOM   4018  C  C    . ASN A 1 41 ? 6.850   8.859   -4.868  1.00 0.00 ? 41  ASN A C    6  
ATOM   4019  O  O    . ASN A 1 41 ? 7.324   9.819   -5.475  1.00 0.00 ? 41  ASN A O    6  
ATOM   4020  C  CB   . ASN A 1 41 ? 7.835   6.712   -4.045  1.00 0.00 ? 41  ASN A CB   6  
ATOM   4021  C  CG   . ASN A 1 41 ? 8.903   6.490   -5.099  1.00 0.00 ? 41  ASN A CG   6  
ATOM   4022  O  OD1  . ASN A 1 41 ? 9.922   7.180   -5.121  1.00 0.00 ? 41  ASN A OD1  6  
ATOM   4023  N  ND2  . ASN A 1 41 ? 8.673   5.523   -5.980  1.00 0.00 ? 41  ASN A ND2  6  
ATOM   4024  H  H    . ASN A 1 41 ? 6.855   7.581   -1.858  1.00 0.00 ? 41  ASN A H    6  
ATOM   4025  H  HA   . ASN A 1 41 ? 8.585   8.674   -3.638  1.00 0.00 ? 41  ASN A HA   6  
ATOM   4026  H  HB2  . ASN A 1 41 ? 8.136   6.199   -3.143  1.00 0.00 ? 41  ASN A HB2  6  
ATOM   4027  H  HB3  . ASN A 1 41 ? 6.909   6.288   -4.403  1.00 0.00 ? 41  ASN A HB3  6  
ATOM   4028  H  HD21 . ASN A 1 41 ? 7.839   5.014   -5.902  1.00 0.00 ? 41  ASN A HD21 6  
ATOM   4029  H  HD22 . ASN A 1 41 ? 9.347   5.358   -6.672  1.00 0.00 ? 41  ASN A HD22 6  
ATOM   4030  N  N    . GLN A 1 42 ? 5.658   8.342   -5.147  1.00 0.00 ? 42  GLN A N    6  
ATOM   4031  C  CA   . GLN A 1 42 ? 4.820   8.885   -6.209  1.00 0.00 ? 42  GLN A CA   6  
ATOM   4032  C  C    . GLN A 1 42 ? 4.008   10.074  -5.706  1.00 0.00 ? 42  GLN A C    6  
ATOM   4033  O  O    . GLN A 1 42 ? 3.796   10.230  -4.505  1.00 0.00 ? 42  GLN A O    6  
ATOM   4034  C  CB   . GLN A 1 42 ? 3.882   7.805   -6.751  1.00 0.00 ? 42  GLN A CB   6  
ATOM   4035  C  CG   . GLN A 1 42 ? 4.609   6.586   -7.296  1.00 0.00 ? 42  GLN A CG   6  
ATOM   4036  C  CD   . GLN A 1 42 ? 5.068   6.772   -8.729  1.00 0.00 ? 42  GLN A CD   6  
ATOM   4037  O  OE1  . GLN A 1 42 ? 4.879   7.836   -9.320  1.00 0.00 ? 42  GLN A OE1  6  
ATOM   4038  N  NE2  . GLN A 1 42 ? 5.674   5.735   -9.296  1.00 0.00 ? 42  GLN A NE2  6  
ATOM   4039  H  H    . GLN A 1 42 ? 5.335   7.577   -4.627  1.00 0.00 ? 42  GLN A H    6  
ATOM   4040  H  HA   . GLN A 1 42 ? 5.468   9.219   -7.005  1.00 0.00 ? 42  GLN A HA   6  
ATOM   4041  H  HB2  . GLN A 1 42 ? 3.227   7.482   -5.956  1.00 0.00 ? 42  GLN A HB2  6  
ATOM   4042  H  HB3  . GLN A 1 42 ? 3.288   8.228   -7.547  1.00 0.00 ? 42  GLN A HB3  6  
ATOM   4043  H  HG2  . GLN A 1 42 ? 5.475   6.394   -6.680  1.00 0.00 ? 42  GLN A HG2  6  
ATOM   4044  H  HG3  . GLN A 1 42 ? 3.943   5.737   -7.253  1.00 0.00 ? 42  GLN A HG3  6  
ATOM   4045  H  HE21 . GLN A 1 42 ? 5.788   4.919   -8.765  1.00 0.00 ? 42  GLN A HE21 6  
ATOM   4046  H  HE22 . GLN A 1 42 ? 5.979   5.828   -10.222 1.00 0.00 ? 42  GLN A HE22 6  
ATOM   4047  N  N    . ASN A 1 43 ? 3.555   10.911  -6.635  1.00 0.00 ? 43  ASN A N    6  
ATOM   4048  C  CA   . ASN A 1 43 ? 2.767   12.087  -6.286  1.00 0.00 ? 43  ASN A CA   6  
ATOM   4049  C  C    . ASN A 1 43 ? 1.866   12.502  -7.445  1.00 0.00 ? 43  ASN A C    6  
ATOM   4050  O  O    . ASN A 1 43 ? 1.952   11.948  -8.541  1.00 0.00 ? 43  ASN A O    6  
ATOM   4051  C  CB   . ASN A 1 43 ? 3.687   13.247  -5.900  1.00 0.00 ? 43  ASN A CB   6  
ATOM   4052  C  CG   . ASN A 1 43 ? 4.188   13.137  -4.472  1.00 0.00 ? 43  ASN A CG   6  
ATOM   4053  O  OD1  . ASN A 1 43 ? 3.440   13.366  -3.521  1.00 0.00 ? 43  ASN A OD1  6  
ATOM   4054  N  ND2  . ASN A 1 43 ? 5.459   12.786  -4.317  1.00 0.00 ? 43  ASN A ND2  6  
ATOM   4055  H  H    . ASN A 1 43 ? 3.757   10.733  -7.578  1.00 0.00 ? 43  ASN A H    6  
ATOM   4056  H  HA   . ASN A 1 43 ? 2.149   11.832  -5.438  1.00 0.00 ? 43  ASN A HA   6  
ATOM   4057  H  HB2  . ASN A 1 43 ? 4.542   13.256  -6.561  1.00 0.00 ? 43  ASN A HB2  6  
ATOM   4058  H  HB3  . ASN A 1 43 ? 3.148   14.177  -6.002  1.00 0.00 ? 43  ASN A HB3  6  
ATOM   4059  H  HD21 . ASN A 1 43 ? 5.995   12.619  -5.120  1.00 0.00 ? 43  ASN A HD21 6  
ATOM   4060  H  HD22 . ASN A 1 43 ? 5.808   12.707  -3.405  1.00 0.00 ? 43  ASN A HD22 6  
ATOM   4061  N  N    . SER A 1 44 ? 1.003   13.481  -7.196  1.00 0.00 ? 44  SER A N    6  
ATOM   4062  C  CA   . SER A 1 44 ? 0.084   13.969  -8.217  1.00 0.00 ? 44  SER A CA   6  
ATOM   4063  C  C    . SER A 1 44 ? 0.578   15.286  -8.809  1.00 0.00 ? 44  SER A C    6  
ATOM   4064  O  O    . SER A 1 44 ? 0.918   16.217  -8.081  1.00 0.00 ? 44  SER A O    6  
ATOM   4065  C  CB   . SER A 1 44 ? -1.316  14.155  -7.627  1.00 0.00 ? 44  SER A CB   6  
ATOM   4066  O  OG   . SER A 1 44 ? -2.260  14.456  -8.640  1.00 0.00 ? 44  SER A OG   6  
ATOM   4067  H  H    . SER A 1 44 ? 0.982   13.884  -6.302  1.00 0.00 ? 44  SER A H    6  
ATOM   4068  H  HA   . SER A 1 44 ? 0.039   13.229  -9.003  1.00 0.00 ? 44  SER A HA   6  
ATOM   4069  H  HB2  . SER A 1 44 ? -1.617  13.246  -7.129  1.00 0.00 ? 44  SER A HB2  6  
ATOM   4070  H  HB3  . SER A 1 44 ? -1.298  14.967  -6.915  1.00 0.00 ? 44  SER A HB3  6  
ATOM   4071  H  HG   . SER A 1 44 ? -3.070  14.778  -8.237  1.00 0.00 ? 44  SER A HG   6  
ATOM   4072  N  N    . GLY A 1 45 ? 0.614   15.355  -10.136 1.00 0.00 ? 45  GLY A N    6  
ATOM   4073  C  CA   . GLY A 1 45 ? 1.068   16.560  -10.804 1.00 0.00 ? 45  GLY A CA   6  
ATOM   4074  C  C    . GLY A 1 45 ? 0.134   16.992  -11.917 1.00 0.00 ? 45  GLY A C    6  
ATOM   4075  O  O    . GLY A 1 45 ? -1.044  16.636  -11.942 1.00 0.00 ? 45  GLY A O    6  
ATOM   4076  H  H    . GLY A 1 45 ? 0.330   14.580  -10.666 1.00 0.00 ? 45  GLY A H    6  
ATOM   4077  H  HA2  . GLY A 1 45 ? 1.138   17.356  -10.078 1.00 0.00 ? 45  GLY A HA2  6  
ATOM   4078  H  HA3  . GLY A 1 45 ? 2.047   16.380  -11.222 1.00 0.00 ? 45  GLY A HA3  6  
ATOM   4079  N  N    . PRO A 1 46 ? 0.662   17.781  -12.865 1.00 0.00 ? 46  PRO A N    6  
ATOM   4080  C  CA   . PRO A 1 46 ? -0.115  18.281  -14.003 1.00 0.00 ? 46  PRO A CA   6  
ATOM   4081  C  C    . PRO A 1 46 ? -0.478  17.174  -14.988 1.00 0.00 ? 46  PRO A C    6  
ATOM   4082  O  O    . PRO A 1 46 ? 0.331   16.290  -15.268 1.00 0.00 ? 46  PRO A O    6  
ATOM   4083  C  CB   . PRO A 1 46 ? 0.827   19.293  -14.659 1.00 0.00 ? 46  PRO A CB   6  
ATOM   4084  C  CG   . PRO A 1 46 ? 2.194   18.845  -14.271 1.00 0.00 ? 46  PRO A CG   6  
ATOM   4085  C  CD   . PRO A 1 46 ? 2.059   18.246  -12.899 1.00 0.00 ? 46  PRO A CD   6  
ATOM   4086  H  HA   . PRO A 1 46 ? -1.016  18.782  -13.679 1.00 0.00 ? 46  PRO A HA   6  
ATOM   4087  H  HB2  . PRO A 1 46 ? 0.692   19.271  -15.732 1.00 0.00 ? 46  PRO A HB2  6  
ATOM   4088  H  HB3  . PRO A 1 46 ? 0.615   20.283  -14.284 1.00 0.00 ? 46  PRO A HB3  6  
ATOM   4089  H  HG2  . PRO A 1 46 ? 2.550   18.105  -14.971 1.00 0.00 ? 46  PRO A HG2  6  
ATOM   4090  H  HG3  . PRO A 1 46 ? 2.863   19.692  -14.246 1.00 0.00 ? 46  PRO A HG3  6  
ATOM   4091  H  HD2  . PRO A 1 46 ? 2.743   17.419  -12.780 1.00 0.00 ? 46  PRO A HD2  6  
ATOM   4092  H  HD3  . PRO A 1 46 ? 2.234   18.995  -12.141 1.00 0.00 ? 46  PRO A HD3  6  
ATOM   4093  N  N    . SER A 1 47 ? -1.699  17.230  -15.510 1.00 0.00 ? 47  SER A N    6  
ATOM   4094  C  CA   . SER A 1 47 ? -2.169  16.230  -16.462 1.00 0.00 ? 47  SER A CA   6  
ATOM   4095  C  C    . SER A 1 47 ? -1.943  16.697  -17.897 1.00 0.00 ? 47  SER A C    6  
ATOM   4096  O  O    . SER A 1 47 ? -2.395  16.059  -18.847 1.00 0.00 ? 47  SER A O    6  
ATOM   4097  C  CB   . SER A 1 47 ? -3.654  15.940  -16.236 1.00 0.00 ? 47  SER A CB   6  
ATOM   4098  O  OG   . SER A 1 47 ? -4.455  17.043  -16.625 1.00 0.00 ? 47  SER A OG   6  
ATOM   4099  H  H    . SER A 1 47 ? -2.298  17.960  -15.247 1.00 0.00 ? 47  SER A H    6  
ATOM   4100  H  HA   . SER A 1 47 ? -1.605  15.325  -16.297 1.00 0.00 ? 47  SER A HA   6  
ATOM   4101  H  HB2  . SER A 1 47 ? -3.943  15.078  -16.818 1.00 0.00 ? 47  SER A HB2  6  
ATOM   4102  H  HB3  . SER A 1 47 ? -3.824  15.739  -15.188 1.00 0.00 ? 47  SER A HB3  6  
ATOM   4103  H  HG   . SER A 1 47 ? -4.235  17.296  -17.524 1.00 0.00 ? 47  SER A HG   6  
ATOM   4104  N  N    . SER A 1 48 ? -1.241  17.816  -18.045 1.00 0.00 ? 48  SER A N    6  
ATOM   4105  C  CA   . SER A 1 48 ? -0.957  18.371  -19.363 1.00 0.00 ? 48  SER A CA   6  
ATOM   4106  C  C    . SER A 1 48 ? 0.212   17.643  -20.019 1.00 0.00 ? 48  SER A C    6  
ATOM   4107  O  O    . SER A 1 48 ? 1.239   17.398  -19.388 1.00 0.00 ? 48  SER A O    6  
ATOM   4108  C  CB   . SER A 1 48 ? -0.645  19.865  -19.253 1.00 0.00 ? 48  SER A CB   6  
ATOM   4109  O  OG   . SER A 1 48 ? 0.604   20.080  -18.619 1.00 0.00 ? 48  SER A OG   6  
ATOM   4110  H  H    . SER A 1 48 ? -0.907  18.279  -17.248 1.00 0.00 ? 48  SER A H    6  
ATOM   4111  H  HA   . SER A 1 48 ? -1.837  18.240  -19.974 1.00 0.00 ? 48  SER A HA   6  
ATOM   4112  H  HB2  . SER A 1 48 ? -0.612  20.297  -20.242 1.00 0.00 ? 48  SER A HB2  6  
ATOM   4113  H  HB3  . SER A 1 48 ? -1.417  20.350  -18.674 1.00 0.00 ? 48  SER A HB3  6  
ATOM   4114  H  HG   . SER A 1 48 ? 0.881   20.989  -18.757 1.00 0.00 ? 48  SER A HG   6  
ATOM   4115  N  N    . GLY A 1 49 ? 0.046   17.298  -21.293 1.00 0.00 ? 49  GLY A N    6  
ATOM   4116  C  CA   . GLY A 1 49 ? 1.094   16.601  -22.015 1.00 0.00 ? 49  GLY A CA   6  
ATOM   4117  C  C    . GLY A 1 49 ? 0.658   15.227  -22.485 1.00 0.00 ? 49  GLY A C    6  
ATOM   4118  O  O    . GLY A 1 49 ? 0.319   14.389  -21.652 1.00 0.00 ? 49  GLY A O    6  
ATOM   4119  H  H    . GLY A 1 49 ? -0.795  17.519  -21.745 1.00 0.00 ? 49  GLY A H    6  
ATOM   4120  H  HA2  . GLY A 1 49 ? 1.378   17.191  -22.874 1.00 0.00 ? 49  GLY A HA2  6  
ATOM   4121  H  HA3  . GLY A 1 49 ? 1.951   16.492  -21.367 1.00 0.00 ? 49  GLY A HA3  6  
HETATM 4122  ZN ZN   . ZN  B 2 .  ? 2.814   -4.828  1.895   1.00 0.00 ? 201 ZN  A ZN   6  
ATOM   4123  N  N    . GLY A 1 1  ? -13.487 14.645  -6.060  1.00 0.00 ? 1   GLY A N    7  
ATOM   4124  C  CA   . GLY A 1 1  ? -13.423 13.419  -5.285  1.00 0.00 ? 1   GLY A CA   7  
ATOM   4125  C  C    . GLY A 1 1  ? -12.434 13.508  -4.140  1.00 0.00 ? 1   GLY A C    7  
ATOM   4126  O  O    . GLY A 1 1  ? -11.245 13.741  -4.354  1.00 0.00 ? 1   GLY A O    7  
ATOM   4127  H  H1   . GLY A 1 1  ? -13.207 14.643  -6.999  1.00 0.00 ? 1   GLY A H1   7  
ATOM   4128  H  HA2  . GLY A 1 1  ? -14.403 13.207  -4.885  1.00 0.00 ? 1   GLY A HA2  7  
ATOM   4129  H  HA3  . GLY A 1 1  ? -13.129 12.610  -5.937  1.00 0.00 ? 1   GLY A HA3  7  
ATOM   4130  N  N    . SER A 1 2  ? -12.926 13.324  -2.919  1.00 0.00 ? 2   SER A N    7  
ATOM   4131  C  CA   . SER A 1 2  ? -12.078 13.391  -1.734  1.00 0.00 ? 2   SER A CA   7  
ATOM   4132  C  C    . SER A 1 2  ? -11.890 12.006  -1.123  1.00 0.00 ? 2   SER A C    7  
ATOM   4133  O  O    . SER A 1 2  ? -12.699 11.104  -1.340  1.00 0.00 ? 2   SER A O    7  
ATOM   4134  C  CB   . SER A 1 2  ? -12.686 14.340  -0.699  1.00 0.00 ? 2   SER A CB   7  
ATOM   4135  O  OG   . SER A 1 2  ? -12.552 15.691  -1.106  1.00 0.00 ? 2   SER A OG   7  
ATOM   4136  H  H    . SER A 1 2  ? -13.884 13.142  -2.812  1.00 0.00 ? 2   SER A H    7  
ATOM   4137  H  HA   . SER A 1 2  ? -11.115 13.772  -2.038  1.00 0.00 ? 2   SER A HA   7  
ATOM   4138  H  HB2  . SER A 1 2  ? -13.734 14.115  -0.580  1.00 0.00 ? 2   SER A HB2  7  
ATOM   4139  H  HB3  . SER A 1 2  ? -12.179 14.209  0.246   1.00 0.00 ? 2   SER A HB3  7  
ATOM   4140  H  HG   . SER A 1 2  ? -11.622 15.932  -1.117  1.00 0.00 ? 2   SER A HG   7  
ATOM   4141  N  N    . SER A 1 3  ? -10.816 11.846  -0.356  1.00 0.00 ? 3   SER A N    7  
ATOM   4142  C  CA   . SER A 1 3  ? -10.518 10.571  0.285   1.00 0.00 ? 3   SER A CA   7  
ATOM   4143  C  C    . SER A 1 3  ? -11.048 10.545  1.716   1.00 0.00 ? 3   SER A C    7  
ATOM   4144  O  O    . SER A 1 3  ? -10.922 11.521  2.454   1.00 0.00 ? 3   SER A O    7  
ATOM   4145  C  CB   . SER A 1 3  ? -9.010  10.315  0.283   1.00 0.00 ? 3   SER A CB   7  
ATOM   4146  O  OG   . SER A 1 3  ? -8.673  9.243   1.146   1.00 0.00 ? 3   SER A OG   7  
ATOM   4147  H  H    . SER A 1 3  ? -10.209 12.603  -0.220  1.00 0.00 ? 3   SER A H    7  
ATOM   4148  H  HA   . SER A 1 3  ? -11.008 9.793   -0.281  1.00 0.00 ? 3   SER A HA   7  
ATOM   4149  H  HB2  . SER A 1 3  ? -8.691  10.069  -0.718  1.00 0.00 ? 3   SER A HB2  7  
ATOM   4150  H  HB3  . SER A 1 3  ? -8.496  11.205  0.616   1.00 0.00 ? 3   SER A HB3  7  
ATOM   4151  H  HG   . SER A 1 3  ? -7.770  9.350   1.453   1.00 0.00 ? 3   SER A HG   7  
ATOM   4152  N  N    . GLY A 1 4  ? -11.641 9.419   2.101   1.00 0.00 ? 4   GLY A N    7  
ATOM   4153  C  CA   . GLY A 1 4  ? -12.182 9.286   3.441   1.00 0.00 ? 4   GLY A CA   7  
ATOM   4154  C  C    . GLY A 1 4  ? -12.581 7.860   3.766   1.00 0.00 ? 4   GLY A C    7  
ATOM   4155  O  O    . GLY A 1 4  ? -13.711 7.605   4.184   1.00 0.00 ? 4   GLY A O    7  
ATOM   4156  H  H    . GLY A 1 4  ? -11.713 8.673   1.469   1.00 0.00 ? 4   GLY A H    7  
ATOM   4157  H  HA2  . GLY A 1 4  ? -11.436 9.611   4.152   1.00 0.00 ? 4   GLY A HA2  7  
ATOM   4158  H  HA3  . GLY A 1 4  ? -13.051 9.920   3.531   1.00 0.00 ? 4   GLY A HA3  7  
ATOM   4159  N  N    . SER A 1 5  ? -11.654 6.928   3.572   1.00 0.00 ? 5   SER A N    7  
ATOM   4160  C  CA   . SER A 1 5  ? -11.917 5.520   3.842   1.00 0.00 ? 5   SER A CA   7  
ATOM   4161  C  C    . SER A 1 5  ? -11.087 5.029   5.024   1.00 0.00 ? 5   SER A C    7  
ATOM   4162  O  O    . SER A 1 5  ? -10.003 5.546   5.293   1.00 0.00 ? 5   SER A O    7  
ATOM   4163  C  CB   . SER A 1 5  ? -11.611 4.675   2.604   1.00 0.00 ? 5   SER A CB   7  
ATOM   4164  O  OG   . SER A 1 5  ? -12.746 4.575   1.762   1.00 0.00 ? 5   SER A OG   7  
ATOM   4165  H  H    . SER A 1 5  ? -10.772 7.195   3.237   1.00 0.00 ? 5   SER A H    7  
ATOM   4166  H  HA   . SER A 1 5  ? -12.964 5.419   4.086   1.00 0.00 ? 5   SER A HA   7  
ATOM   4167  H  HB2  . SER A 1 5  ? -10.806 5.133   2.049   1.00 0.00 ? 5   SER A HB2  7  
ATOM   4168  H  HB3  . SER A 1 5  ? -11.317 3.682   2.912   1.00 0.00 ? 5   SER A HB3  7  
ATOM   4169  H  HG   . SER A 1 5  ? -12.464 4.559   0.844   1.00 0.00 ? 5   SER A HG   7  
ATOM   4170  N  N    . SER A 1 6  ? -11.604 4.026   5.727   1.00 0.00 ? 6   SER A N    7  
ATOM   4171  C  CA   . SER A 1 6  ? -10.913 3.466   6.883   1.00 0.00 ? 6   SER A CA   7  
ATOM   4172  C  C    . SER A 1 6  ? -9.913  2.398   6.453   1.00 0.00 ? 6   SER A C    7  
ATOM   4173  O  O    . SER A 1 6  ? -8.755  2.412   6.869   1.00 0.00 ? 6   SER A O    7  
ATOM   4174  C  CB   . SER A 1 6  ? -11.922 2.870   7.867   1.00 0.00 ? 6   SER A CB   7  
ATOM   4175  O  OG   . SER A 1 6  ? -11.264 2.234   8.949   1.00 0.00 ? 6   SER A OG   7  
ATOM   4176  H  H    . SER A 1 6  ? -12.472 3.655   5.462   1.00 0.00 ? 6   SER A H    7  
ATOM   4177  H  HA   . SER A 1 6  ? -10.379 4.268   7.370   1.00 0.00 ? 6   SER A HA   7  
ATOM   4178  H  HB2  . SER A 1 6  ? -12.550 3.657   8.255   1.00 0.00 ? 6   SER A HB2  7  
ATOM   4179  H  HB3  . SER A 1 6  ? -12.533 2.142   7.354   1.00 0.00 ? 6   SER A HB3  7  
ATOM   4180  H  HG   . SER A 1 6  ? -10.605 1.624   8.609   1.00 0.00 ? 6   SER A HG   7  
ATOM   4181  N  N    . GLY A 1 7  ? -10.369 1.471   5.616   1.00 0.00 ? 7   GLY A N    7  
ATOM   4182  C  CA   . GLY A 1 7  ? -9.503  0.407   5.143   1.00 0.00 ? 7   GLY A CA   7  
ATOM   4183  C  C    . GLY A 1 7  ? -9.378  -0.727  6.142   1.00 0.00 ? 7   GLY A C    7  
ATOM   4184  O  O    . GLY A 1 7  ? -8.685  -0.600  7.151   1.00 0.00 ? 7   GLY A O    7  
ATOM   4185  H  H    . GLY A 1 7  ? -11.302 1.509   5.318   1.00 0.00 ? 7   GLY A H    7  
ATOM   4186  H  HA2  . GLY A 1 7  ? -9.902  0.016   4.219   1.00 0.00 ? 7   GLY A HA2  7  
ATOM   4187  H  HA3  . GLY A 1 7  ? -8.520  0.815   4.955   1.00 0.00 ? 7   GLY A HA3  7  
ATOM   4188  N  N    . SER A 1 8  ? -10.052 -1.837  5.862   1.00 0.00 ? 8   SER A N    7  
ATOM   4189  C  CA   . SER A 1 8  ? -10.018 -2.996  6.746   1.00 0.00 ? 8   SER A CA   7  
ATOM   4190  C  C    . SER A 1 8  ? -9.080  -4.069  6.201   1.00 0.00 ? 8   SER A C    7  
ATOM   4191  O  O    . SER A 1 8  ? -9.248  -4.545  5.077   1.00 0.00 ? 8   SER A O    7  
ATOM   4192  C  CB   . SER A 1 8  ? -11.424 -3.573  6.920   1.00 0.00 ? 8   SER A CB   7  
ATOM   4193  O  OG   . SER A 1 8  ? -11.409 -4.706  7.771   1.00 0.00 ? 8   SER A OG   7  
ATOM   4194  H  H    . SER A 1 8  ? -10.587 -1.877  5.041   1.00 0.00 ? 8   SER A H    7  
ATOM   4195  H  HA   . SER A 1 8  ? -9.651  -2.669  7.707   1.00 0.00 ? 8   SER A HA   7  
ATOM   4196  H  HB2  . SER A 1 8  ? -12.068 -2.822  7.352   1.00 0.00 ? 8   SER A HB2  7  
ATOM   4197  H  HB3  . SER A 1 8  ? -11.811 -3.868  5.955   1.00 0.00 ? 8   SER A HB3  7  
ATOM   4198  H  HG   . SER A 1 8  ? -10.661 -5.264  7.548   1.00 0.00 ? 8   SER A HG   7  
ATOM   4199  N  N    . LEU A 1 9  ? -8.090  -4.444  7.004   1.00 0.00 ? 9   LEU A N    7  
ATOM   4200  C  CA   . LEU A 1 9  ? -7.124  -5.461  6.603   1.00 0.00 ? 9   LEU A CA   7  
ATOM   4201  C  C    . LEU A 1 9  ? -7.827  -6.758  6.216   1.00 0.00 ? 9   LEU A C    7  
ATOM   4202  O  O    . LEU A 1 9  ? -8.295  -7.502  7.077   1.00 0.00 ? 9   LEU A O    7  
ATOM   4203  C  CB   . LEU A 1 9  ? -6.131  -5.724  7.737   1.00 0.00 ? 9   LEU A CB   7  
ATOM   4204  C  CG   . LEU A 1 9  ? -5.065  -4.651  7.958   1.00 0.00 ? 9   LEU A CG   7  
ATOM   4205  C  CD1  . LEU A 1 9  ? -4.284  -4.928  9.233   1.00 0.00 ? 9   LEU A CD1  7  
ATOM   4206  C  CD2  . LEU A 1 9  ? -4.126  -4.578  6.762   1.00 0.00 ? 9   LEU A CD2  7  
ATOM   4207  H  H    . LEU A 1 9  ? -8.007  -4.029  7.887   1.00 0.00 ? 9   LEU A H    7  
ATOM   4208  H  HA   . LEU A 1 9  ? -6.586  -5.086  5.745   1.00 0.00 ? 9   LEU A HA   7  
ATOM   4209  H  HB2  . LEU A 1 9  ? -6.694  -5.823  8.652   1.00 0.00 ? 9   LEU A HB2  7  
ATOM   4210  H  HB3  . LEU A 1 9  ? -5.626  -6.655  7.524   1.00 0.00 ? 9   LEU A HB3  7  
ATOM   4211  H  HG   . LEU A 1 9  ? -5.547  -3.689  8.065   1.00 0.00 ? 9   LEU A HG   7  
ATOM   4212  H  HD11 . LEU A 1 9  ? -3.241  -4.702  9.074   1.00 0.00 ? 9   LEU A HD11 7  
ATOM   4213  H  HD12 . LEU A 1 9  ? -4.390  -5.969  9.501   1.00 0.00 ? 9   LEU A HD12 7  
ATOM   4214  H  HD13 . LEU A 1 9  ? -4.670  -4.311  10.032  1.00 0.00 ? 9   LEU A HD13 7  
ATOM   4215  H  HD21 . LEU A 1 9  ? -3.134  -4.318  7.099   1.00 0.00 ? 9   LEU A HD21 7  
ATOM   4216  H  HD22 . LEU A 1 9  ? -4.481  -3.826  6.072   1.00 0.00 ? 9   LEU A HD22 7  
ATOM   4217  H  HD23 . LEU A 1 9  ? -4.100  -5.537  6.266   1.00 0.00 ? 9   LEU A HD23 7  
ATOM   4218  N  N    . MET A 1 10 ? -7.894  -7.023  4.915   1.00 0.00 ? 10  MET A N    7  
ATOM   4219  C  CA   . MET A 1 10 ? -8.537  -8.232  4.415   1.00 0.00 ? 10  MET A CA   7  
ATOM   4220  C  C    . MET A 1 10 ? -7.653  -9.454  4.648   1.00 0.00 ? 10  MET A C    7  
ATOM   4221  O  O    . MET A 1 10 ? -6.516  -9.331  5.103   1.00 0.00 ? 10  MET A O    7  
ATOM   4222  C  CB   . MET A 1 10 ? -8.847  -8.091  2.923   1.00 0.00 ? 10  MET A CB   7  
ATOM   4223  C  CG   . MET A 1 10 ? -9.640  -6.839  2.584   1.00 0.00 ? 10  MET A CG   7  
ATOM   4224  S  SD   . MET A 1 10 ? -10.688 -7.053  1.132   1.00 0.00 ? 10  MET A SD   7  
ATOM   4225  C  CE   . MET A 1 10 ? -12.314 -6.857  1.857   1.00 0.00 ? 10  MET A CE   7  
ATOM   4226  H  H    . MET A 1 10 ? -7.502  -6.391  4.277   1.00 0.00 ? 10  MET A H    7  
ATOM   4227  H  HA   . MET A 1 10 ? -9.462  -8.363  4.955   1.00 0.00 ? 10  MET A HA   7  
ATOM   4228  H  HB2  . MET A 1 10 ? -7.917  -8.061  2.375   1.00 0.00 ? 10  MET A HB2  7  
ATOM   4229  H  HB3  . MET A 1 10 ? -9.417  -8.950  2.603   1.00 0.00 ? 10  MET A HB3  7  
ATOM   4230  H  HG2  . MET A 1 10 ? -10.265 -6.585  3.426   1.00 0.00 ? 10  MET A HG2  7  
ATOM   4231  H  HG3  . MET A 1 10 ? -8.948  -6.032  2.395   1.00 0.00 ? 10  MET A HG3  7  
ATOM   4232  H  HE1  . MET A 1 10 ? -12.814 -6.018  1.395   1.00 0.00 ? 10  MET A HE1  7  
ATOM   4233  H  HE2  . MET A 1 10 ? -12.892 -7.754  1.694   1.00 0.00 ? 10  MET A HE2  7  
ATOM   4234  H  HE3  . MET A 1 10 ? -12.216 -6.679  2.918   1.00 0.00 ? 10  MET A HE3  7  
ATOM   4235  N  N    . ASP A 1 11 ? -8.184  -10.631 4.335   1.00 0.00 ? 11  ASP A N    7  
ATOM   4236  C  CA   . ASP A 1 11 ? -7.443  -11.874 4.511   1.00 0.00 ? 11  ASP A CA   7  
ATOM   4237  C  C    . ASP A 1 11 ? -6.557  -12.154 3.301   1.00 0.00 ? 11  ASP A C    7  
ATOM   4238  O  O    . ASP A 1 11 ? -5.972  -13.231 3.183   1.00 0.00 ? 11  ASP A O    7  
ATOM   4239  C  CB   . ASP A 1 11 ? -8.408  -13.040 4.733   1.00 0.00 ? 11  ASP A CB   7  
ATOM   4240  C  CG   . ASP A 1 11 ? -7.709  -14.278 5.261   1.00 0.00 ? 11  ASP A CG   7  
ATOM   4241  O  OD1  . ASP A 1 11 ? -7.052  -14.182 6.319   1.00 0.00 ? 11  ASP A OD1  7  
ATOM   4242  O  OD2  . ASP A 1 11 ? -7.819  -15.341 4.617   1.00 0.00 ? 11  ASP A OD2  7  
ATOM   4243  H  H    . ASP A 1 11 ? -9.096  -10.663 3.976   1.00 0.00 ? 11  ASP A H    7  
ATOM   4244  H  HA   . ASP A 1 11 ? -6.817  -11.767 5.383   1.00 0.00 ? 11  ASP A HA   7  
ATOM   4245  H  HB2  . ASP A 1 11 ? -9.163  -12.744 5.447   1.00 0.00 ? 11  ASP A HB2  7  
ATOM   4246  H  HB3  . ASP A 1 11 ? -8.883  -13.290 3.795   1.00 0.00 ? 11  ASP A HB3  7  
ATOM   4247  N  N    . VAL A 1 12 ? -6.464  -11.178 2.403   1.00 0.00 ? 12  VAL A N    7  
ATOM   4248  C  CA   . VAL A 1 12 ? -5.650  -11.319 1.202   1.00 0.00 ? 12  VAL A CA   7  
ATOM   4249  C  C    . VAL A 1 12 ? -4.230  -10.816 1.439   1.00 0.00 ? 12  VAL A C    7  
ATOM   4250  O  O    . VAL A 1 12 ? -4.025  -9.684  1.877   1.00 0.00 ? 12  VAL A O    7  
ATOM   4251  C  CB   . VAL A 1 12 ? -6.263  -10.554 0.015   1.00 0.00 ? 12  VAL A CB   7  
ATOM   4252  C  CG1  . VAL A 1 12 ? -5.478  -10.826 -1.259  1.00 0.00 ? 12  VAL A CG1  7  
ATOM   4253  C  CG2  . VAL A 1 12 ? -7.727  -10.928 -0.161  1.00 0.00 ? 12  VAL A CG2  7  
ATOM   4254  H  H    . VAL A 1 12 ? -6.954  -10.343 2.553   1.00 0.00 ? 12  VAL A H    7  
ATOM   4255  H  HA   . VAL A 1 12 ? -5.611  -12.368 0.946   1.00 0.00 ? 12  VAL A HA   7  
ATOM   4256  H  HB   . VAL A 1 12 ? -6.206  -9.496  0.227   1.00 0.00 ? 12  VAL A HB   7  
ATOM   4257  H  HG11 . VAL A 1 12 ? -5.630  -10.014 -1.956  1.00 0.00 ? 12  VAL A HG11 7  
ATOM   4258  H  HG12 . VAL A 1 12 ? -4.427  -10.909 -1.024  1.00 0.00 ? 12  VAL A HG12 7  
ATOM   4259  H  HG13 . VAL A 1 12 ? -5.822  -11.749 -1.703  1.00 0.00 ? 12  VAL A HG13 7  
ATOM   4260  H  HG21 . VAL A 1 12 ? -8.350  -10.111 0.171   1.00 0.00 ? 12  VAL A HG21 7  
ATOM   4261  H  HG22 . VAL A 1 12 ? -7.923  -11.130 -1.203  1.00 0.00 ? 12  VAL A HG22 7  
ATOM   4262  H  HG23 . VAL A 1 12 ? -7.947  -11.809 0.425   1.00 0.00 ? 12  VAL A HG23 7  
ATOM   4263  N  N    . LYS A 1 13 ? -3.251  -11.665 1.145   1.00 0.00 ? 13  LYS A N    7  
ATOM   4264  C  CA   . LYS A 1 13 ? -1.849  -11.307 1.323   1.00 0.00 ? 13  LYS A CA   7  
ATOM   4265  C  C    . LYS A 1 13 ? -1.480  -10.105 0.460   1.00 0.00 ? 13  LYS A C    7  
ATOM   4266  O  O    . LYS A 1 13 ? -1.949  -9.972  -0.671  1.00 0.00 ? 13  LYS A O    7  
ATOM   4267  C  CB   . LYS A 1 13 ? -0.949  -12.495 0.973   1.00 0.00 ? 13  LYS A CB   7  
ATOM   4268  C  CG   . LYS A 1 13 ? -0.770  -13.480 2.115   1.00 0.00 ? 13  LYS A CG   7  
ATOM   4269  C  CD   . LYS A 1 13 ? -1.849  -14.550 2.103   1.00 0.00 ? 13  LYS A CD   7  
ATOM   4270  C  CE   . LYS A 1 13 ? -1.549  -15.633 1.078   1.00 0.00 ? 13  LYS A CE   7  
ATOM   4271  N  NZ   . LYS A 1 13 ? -2.473  -16.793 1.209   1.00 0.00 ? 13  LYS A NZ   7  
ATOM   4272  H  H    . LYS A 1 13 ? -3.477  -12.554 0.798   1.00 0.00 ? 13  LYS A H    7  
ATOM   4273  H  HA   . LYS A 1 13 ? -1.701  -11.049 2.361   1.00 0.00 ? 13  LYS A HA   7  
ATOM   4274  H  HB2  . LYS A 1 13 ? -1.380  -13.023 0.134   1.00 0.00 ? 13  LYS A HB2  7  
ATOM   4275  H  HB3  . LYS A 1 13 ? 0.025   -12.123 0.690   1.00 0.00 ? 13  LYS A HB3  7  
ATOM   4276  H  HG2  . LYS A 1 13 ? 0.194   -13.956 2.020   1.00 0.00 ? 13  LYS A HG2  7  
ATOM   4277  H  HG3  . LYS A 1 13 ? -0.819  -12.943 3.052   1.00 0.00 ? 13  LYS A HG3  7  
ATOM   4278  H  HD2  . LYS A 1 13 ? -1.906  -15.003 3.082   1.00 0.00 ? 13  LYS A HD2  7  
ATOM   4279  H  HD3  . LYS A 1 13 ? -2.797  -14.090 1.861   1.00 0.00 ? 13  LYS A HD3  7  
ATOM   4280  H  HE2  . LYS A 1 13 ? -1.651  -15.212 0.089   1.00 0.00 ? 13  LYS A HE2  7  
ATOM   4281  H  HE3  . LYS A 1 13 ? -0.534  -15.974 1.220   1.00 0.00 ? 13  LYS A HE3  7  
ATOM   4282  H  HZ1  . LYS A 1 13 ? -1.990  -17.583 1.683   1.00 0.00 ? 13  LYS A HZ1  7  
ATOM   4283  H  HZ2  . LYS A 1 13 ? -2.788  -17.107 0.269   1.00 0.00 ? 13  LYS A HZ2  7  
ATOM   4284  H  HZ3  . LYS A 1 13 ? -3.307  -16.524 1.770   1.00 0.00 ? 13  LYS A HZ3  7  
ATOM   4285  N  N    . CYS A 1 14 ? -0.635  -9.232  0.999   1.00 0.00 ? 14  CYS A N    7  
ATOM   4286  C  CA   . CYS A 1 14 ? -0.202  -8.041  0.278   1.00 0.00 ? 14  CYS A CA   7  
ATOM   4287  C  C    . CYS A 1 14 ? 0.335   -8.406  -1.103  1.00 0.00 ? 14  CYS A C    7  
ATOM   4288  O  O    . CYS A 1 14 ? 1.061   -9.387  -1.257  1.00 0.00 ? 14  CYS A O    7  
ATOM   4289  C  CB   . CYS A 1 14 ? 0.873   -7.300  1.076   1.00 0.00 ? 14  CYS A CB   7  
ATOM   4290  S  SG   . CYS A 1 14 ? 1.582   -5.863  0.210   1.00 0.00 ? 14  CYS A SG   7  
ATOM   4291  H  H    . CYS A 1 14 ? -0.295  -9.392  1.905   1.00 0.00 ? 14  CYS A H    7  
ATOM   4292  H  HA   . CYS A 1 14 ? -1.059  -7.395  0.159   1.00 0.00 ? 14  CYS A HA   7  
ATOM   4293  H  HB2  . CYS A 1 14 ? 0.443   -6.945  2.001   1.00 0.00 ? 14  CYS A HB2  7  
ATOM   4294  H  HB3  . CYS A 1 14 ? 1.680   -7.982  1.298   1.00 0.00 ? 14  CYS A HB3  7  
ATOM   4295  N  N    . GLU A 1 15 ? -0.029  -7.609  -2.103  1.00 0.00 ? 15  GLU A N    7  
ATOM   4296  C  CA   . GLU A 1 15 ? 0.416   -7.849  -3.470  1.00 0.00 ? 15  GLU A CA   7  
ATOM   4297  C  C    . GLU A 1 15 ? 1.835   -8.410  -3.491  1.00 0.00 ? 15  GLU A C    7  
ATOM   4298  O  O    . GLU A 1 15 ? 2.085   -9.479  -4.048  1.00 0.00 ? 15  GLU A O    7  
ATOM   4299  C  CB   . GLU A 1 15 ? 0.355   -6.555  -4.285  1.00 0.00 ? 15  GLU A CB   7  
ATOM   4300  C  CG   . GLU A 1 15 ? 0.371   -6.780  -5.787  1.00 0.00 ? 15  GLU A CG   7  
ATOM   4301  C  CD   . GLU A 1 15 ? 1.733   -7.206  -6.299  1.00 0.00 ? 15  GLU A CD   7  
ATOM   4302  O  OE1  . GLU A 1 15 ? 2.654   -6.363  -6.307  1.00 0.00 ? 15  GLU A OE1  7  
ATOM   4303  O  OE2  . GLU A 1 15 ? 1.878   -8.383  -6.692  1.00 0.00 ? 15  GLU A OE2  7  
ATOM   4304  H  H    . GLU A 1 15 ? -0.610  -6.842  -1.916  1.00 0.00 ? 15  GLU A H    7  
ATOM   4305  H  HA   . GLU A 1 15 ? -0.251  -8.574  -3.914  1.00 0.00 ? 15  GLU A HA   7  
ATOM   4306  H  HB2  . GLU A 1 15 ? -0.551  -6.025  -4.030  1.00 0.00 ? 15  GLU A HB2  7  
ATOM   4307  H  HB3  . GLU A 1 15 ? 1.205   -5.941  -4.025  1.00 0.00 ? 15  GLU A HB3  7  
ATOM   4308  H  HG2  . GLU A 1 15 ? -0.345  -7.551  -6.031  1.00 0.00 ? 15  GLU A HG2  7  
ATOM   4309  H  HG3  . GLU A 1 15 ? 0.089   -5.860  -6.279  1.00 0.00 ? 15  GLU A HG3  7  
ATOM   4310  N  N    . THR A 1 16 ? 2.762   -7.680  -2.878  1.00 0.00 ? 16  THR A N    7  
ATOM   4311  C  CA   . THR A 1 16 ? 4.156   -8.102  -2.827  1.00 0.00 ? 16  THR A CA   7  
ATOM   4312  C  C    . THR A 1 16 ? 4.285   -9.507  -2.249  1.00 0.00 ? 16  THR A C    7  
ATOM   4313  O  O    . THR A 1 16 ? 3.838   -9.790  -1.138  1.00 0.00 ? 16  THR A O    7  
ATOM   4314  C  CB   . THR A 1 16 ? 5.006   -7.132  -1.983  1.00 0.00 ? 16  THR A CB   7  
ATOM   4315  O  OG1  . THR A 1 16 ? 4.981   -5.825  -2.565  1.00 0.00 ? 16  THR A OG1  7  
ATOM   4316  C  CG2  . THR A 1 16 ? 6.443   -7.621  -1.881  1.00 0.00 ? 16  THR A CG2  7  
ATOM   4317  H  H    . THR A 1 16 ? 2.501   -6.837  -2.452  1.00 0.00 ? 16  THR A H    7  
ATOM   4318  H  HA   . THR A 1 16 ? 4.543   -8.100  -3.836  1.00 0.00 ? 16  THR A HA   7  
ATOM   4319  H  HB   . THR A 1 16 ? 4.586   -7.083  -0.988  1.00 0.00 ? 16  THR A HB   7  
ATOM   4320  H  HG1  . THR A 1 16 ? 4.077   -5.501  -2.587  1.00 0.00 ? 16  THR A HG1  7  
ATOM   4321  H  HG21 . THR A 1 16 ? 6.631   -7.976  -0.879  1.00 0.00 ? 16  THR A HG21 7  
ATOM   4322  H  HG22 . THR A 1 16 ? 7.116   -6.808  -2.107  1.00 0.00 ? 16  THR A HG22 7  
ATOM   4323  H  HG23 . THR A 1 16 ? 6.600   -8.425  -2.583  1.00 0.00 ? 16  THR A HG23 7  
ATOM   4324  N  N    . PRO A 1 17 ? 4.909   -10.409 -3.020  1.00 0.00 ? 17  PRO A N    7  
ATOM   4325  C  CA   . PRO A 1 17 ? 5.112   -11.800 -2.605  1.00 0.00 ? 17  PRO A CA   7  
ATOM   4326  C  C    . PRO A 1 17 ? 6.123   -11.925 -1.470  1.00 0.00 ? 17  PRO A C    7  
ATOM   4327  O  O    . PRO A 1 17 ? 6.416   -13.026 -1.005  1.00 0.00 ? 17  PRO A O    7  
ATOM   4328  C  CB   . PRO A 1 17 ? 5.644   -12.475 -3.872  1.00 0.00 ? 17  PRO A CB   7  
ATOM   4329  C  CG   . PRO A 1 17 ? 6.276   -11.373 -4.650  1.00 0.00 ? 17  PRO A CG   7  
ATOM   4330  C  CD   . PRO A 1 17 ? 5.466   -10.141 -4.357  1.00 0.00 ? 17  PRO A CD   7  
ATOM   4331  H  HA   . PRO A 1 17 ? 4.183   -12.266 -2.310  1.00 0.00 ? 17  PRO A HA   7  
ATOM   4332  H  HB2  . PRO A 1 17 ? 6.365   -13.234 -3.602  1.00 0.00 ? 17  PRO A HB2  7  
ATOM   4333  H  HB3  . PRO A 1 17 ? 4.827   -12.924 -4.415  1.00 0.00 ? 17  PRO A HB3  7  
ATOM   4334  H  HG2  . PRO A 1 17 ? 7.298   -11.236 -4.329  1.00 0.00 ? 17  PRO A HG2  7  
ATOM   4335  H  HG3  . PRO A 1 17 ? 6.241   -11.602 -5.705  1.00 0.00 ? 17  PRO A HG3  7  
ATOM   4336  H  HD2  . PRO A 1 17 ? 6.101   -9.267  -4.342  1.00 0.00 ? 17  PRO A HD2  7  
ATOM   4337  H  HD3  . PRO A 1 17 ? 4.678   -10.025 -5.086  1.00 0.00 ? 17  PRO A HD3  7  
ATOM   4338  N  N    . ASN A 1 18 ? 6.652   -10.789 -1.028  1.00 0.00 ? 18  ASN A N    7  
ATOM   4339  C  CA   . ASN A 1 18 ? 7.631   -10.771 0.053   1.00 0.00 ? 18  ASN A CA   7  
ATOM   4340  C  C    . ASN A 1 18 ? 7.061   -10.087 1.292   1.00 0.00 ? 18  ASN A C    7  
ATOM   4341  O  O    . ASN A 1 18 ? 7.662   -10.122 2.366   1.00 0.00 ? 18  ASN A O    7  
ATOM   4342  C  CB   . ASN A 1 18 ? 8.906   -10.057 -0.397  1.00 0.00 ? 18  ASN A CB   7  
ATOM   4343  C  CG   . ASN A 1 18 ? 9.465   -10.628 -1.686  1.00 0.00 ? 18  ASN A CG   7  
ATOM   4344  O  OD1  . ASN A 1 18 ? 8.885   -11.539 -2.276  1.00 0.00 ? 18  ASN A OD1  7  
ATOM   4345  N  ND2  . ASN A 1 18 ? 10.597  -10.092 -2.129  1.00 0.00 ? 18  ASN A ND2  7  
ATOM   4346  H  H    . ASN A 1 18 ? 6.379   -9.942  -1.438  1.00 0.00 ? 18  ASN A H    7  
ATOM   4347  H  HA   . ASN A 1 18 ? 7.870   -11.795 0.300   1.00 0.00 ? 18  ASN A HA   7  
ATOM   4348  H  HB2  . ASN A 1 18 ? 8.689   -9.010  -0.554  1.00 0.00 ? 18  ASN A HB2  7  
ATOM   4349  H  HB3  . ASN A 1 18 ? 9.657   -10.152 0.373   1.00 0.00 ? 18  ASN A HB3  7  
ATOM   4350  H  HD21 . ASN A 1 18 ? 11.002  -9.369  -1.606  1.00 0.00 ? 18  ASN A HD21 7  
ATOM   4351  H  HD22 . ASN A 1 18 ? 10.979  -10.442 -2.960  1.00 0.00 ? 18  ASN A HD22 7  
ATOM   4352  N  N    . CYS A 1 19 ? 5.897   -9.465  1.135   1.00 0.00 ? 19  CYS A N    7  
ATOM   4353  C  CA   . CYS A 1 19 ? 5.245   -8.772  2.239   1.00 0.00 ? 19  CYS A CA   7  
ATOM   4354  C  C    . CYS A 1 19 ? 4.250   -9.689  2.945   1.00 0.00 ? 19  CYS A C    7  
ATOM   4355  O  O    . CYS A 1 19 ? 3.189   -10.021 2.415   1.00 0.00 ? 19  CYS A O    7  
ATOM   4356  C  CB   . CYS A 1 19 ? 4.528   -7.519  1.730   1.00 0.00 ? 19  CYS A CB   7  
ATOM   4357  S  SG   . CYS A 1 19 ? 3.957   -6.401  3.051   1.00 0.00 ? 19  CYS A SG   7  
ATOM   4358  H  H    . CYS A 1 19 ? 5.466   -9.472  0.254   1.00 0.00 ? 19  CYS A H    7  
ATOM   4359  H  HA   . CYS A 1 19 ? 6.008   -8.478  2.944   1.00 0.00 ? 19  CYS A HA   7  
ATOM   4360  H  HB2  . CYS A 1 19 ? 5.202   -6.961  1.097   1.00 0.00 ? 19  CYS A HB2  7  
ATOM   4361  H  HB3  . CYS A 1 19 ? 3.664   -7.817  1.155   1.00 0.00 ? 19  CYS A HB3  7  
ATOM   4362  N  N    . PRO A 1 20 ? 4.599   -10.109 4.170   1.00 0.00 ? 20  PRO A N    7  
ATOM   4363  C  CA   . PRO A 1 20 ? 3.751   -10.992 4.976   1.00 0.00 ? 20  PRO A CA   7  
ATOM   4364  C  C    . PRO A 1 20 ? 2.489   -10.293 5.468   1.00 0.00 ? 20  PRO A C    7  
ATOM   4365  O  O    . PRO A 1 20 ? 1.564   -10.936 5.965   1.00 0.00 ? 20  PRO A O    7  
ATOM   4366  C  CB   . PRO A 1 20 ? 4.650   -11.367 6.157   1.00 0.00 ? 20  PRO A CB   7  
ATOM   4367  C  CG   . PRO A 1 20 ? 5.619   -10.241 6.267   1.00 0.00 ? 20  PRO A CG   7  
ATOM   4368  C  CD   . PRO A 1 20 ? 5.849   -9.753  4.864   1.00 0.00 ? 20  PRO A CD   7  
ATOM   4369  H  HA   . PRO A 1 20 ? 3.478   -11.884 4.432   1.00 0.00 ? 20  PRO A HA   7  
ATOM   4370  H  HB2  . PRO A 1 20 ? 4.051   -11.463 7.052   1.00 0.00 ? 20  PRO A HB2  7  
ATOM   4371  H  HB3  . PRO A 1 20 ? 5.151   -12.300 5.950   1.00 0.00 ? 20  PRO A HB3  7  
ATOM   4372  H  HG2  . PRO A 1 20 ? 5.200   -9.454  6.874   1.00 0.00 ? 20  PRO A HG2  7  
ATOM   4373  H  HG3  . PRO A 1 20 ? 6.545   -10.595 6.696   1.00 0.00 ? 20  PRO A HG3  7  
ATOM   4374  H  HD2  . PRO A 1 20 ? 6.003   -8.684  4.856   1.00 0.00 ? 20  PRO A HD2  7  
ATOM   4375  H  HD3  . PRO A 1 20 ? 6.693   -10.261 4.421   1.00 0.00 ? 20  PRO A HD3  7  
ATOM   4376  N  N    . PHE A 1 21 ? 2.456   -8.972  5.327   1.00 0.00 ? 21  PHE A N    7  
ATOM   4377  C  CA   . PHE A 1 21 ? 1.306   -8.185  5.758   1.00 0.00 ? 21  PHE A CA   7  
ATOM   4378  C  C    . PHE A 1 21 ? 0.157   -8.310  4.762   1.00 0.00 ? 21  PHE A C    7  
ATOM   4379  O  O    . PHE A 1 21 ? 0.376   -8.494  3.565   1.00 0.00 ? 21  PHE A O    7  
ATOM   4380  C  CB   . PHE A 1 21 ? 1.699   -6.715  5.919   1.00 0.00 ? 21  PHE A CB   7  
ATOM   4381  C  CG   . PHE A 1 21 ? 2.531   -6.447  7.141   1.00 0.00 ? 21  PHE A CG   7  
ATOM   4382  C  CD1  . PHE A 1 21 ? 3.789   -7.014  7.276   1.00 0.00 ? 21  PHE A CD1  7  
ATOM   4383  C  CD2  . PHE A 1 21 ? 2.057   -5.629  8.153   1.00 0.00 ? 21  PHE A CD2  7  
ATOM   4384  C  CE1  . PHE A 1 21 ? 4.556   -6.769  8.399   1.00 0.00 ? 21  PHE A CE1  7  
ATOM   4385  C  CE2  . PHE A 1 21 ? 2.820   -5.380  9.278   1.00 0.00 ? 21  PHE A CE2  7  
ATOM   4386  C  CZ   . PHE A 1 21 ? 4.072   -5.951  9.401   1.00 0.00 ? 21  PHE A CZ   7  
ATOM   4387  H  H    . PHE A 1 21 ? 3.224   -8.515  4.923   1.00 0.00 ? 21  PHE A H    7  
ATOM   4388  H  HA   . PHE A 1 21 ? 0.983   -8.569  6.713   1.00 0.00 ? 21  PHE A HA   7  
ATOM   4389  H  HB2  . PHE A 1 21 ? 2.269   -6.405  5.056   1.00 0.00 ? 21  PHE A HB2  7  
ATOM   4390  H  HB3  . PHE A 1 21 ? 0.804   -6.116  5.988   1.00 0.00 ? 21  PHE A HB3  7  
ATOM   4391  H  HD1  . PHE A 1 21 ? 4.170   -7.653  6.493   1.00 0.00 ? 21  PHE A HD1  7  
ATOM   4392  H  HD2  . PHE A 1 21 ? 1.077   -5.182  8.057   1.00 0.00 ? 21  PHE A HD2  7  
ATOM   4393  H  HE1  . PHE A 1 21 ? 5.535   -7.216  8.493   1.00 0.00 ? 21  PHE A HE1  7  
ATOM   4394  H  HE2  . PHE A 1 21 ? 2.438   -4.740  10.059  1.00 0.00 ? 21  PHE A HE2  7  
ATOM   4395  H  HZ   . PHE A 1 21 ? 4.669   -5.759  10.280  1.00 0.00 ? 21  PHE A HZ   7  
ATOM   4396  N  N    . PHE A 1 22 ? -1.068  -8.208  5.266   1.00 0.00 ? 22  PHE A N    7  
ATOM   4397  C  CA   . PHE A 1 22 ? -2.253  -8.311  4.422   1.00 0.00 ? 22  PHE A CA   7  
ATOM   4398  C  C    . PHE A 1 22 ? -2.585  -6.966  3.784   1.00 0.00 ? 22  PHE A C    7  
ATOM   4399  O  O    . PHE A 1 22 ? -2.223  -5.913  4.308   1.00 0.00 ? 22  PHE A O    7  
ATOM   4400  C  CB   . PHE A 1 22 ? -3.446  -8.809  5.240   1.00 0.00 ? 22  PHE A CB   7  
ATOM   4401  C  CG   . PHE A 1 22 ? -3.342  -10.254 5.635   1.00 0.00 ? 22  PHE A CG   7  
ATOM   4402  C  CD1  . PHE A 1 22 ? -3.296  -11.248 4.671   1.00 0.00 ? 22  PHE A CD1  7  
ATOM   4403  C  CD2  . PHE A 1 22 ? -3.288  -10.619 6.971   1.00 0.00 ? 22  PHE A CD2  7  
ATOM   4404  C  CE1  . PHE A 1 22 ? -3.200  -12.579 5.032   1.00 0.00 ? 22  PHE A CE1  7  
ATOM   4405  C  CE2  . PHE A 1 22 ? -3.192  -11.948 7.338   1.00 0.00 ? 22  PHE A CE2  7  
ATOM   4406  C  CZ   . PHE A 1 22 ? -3.147  -12.929 6.367   1.00 0.00 ? 22  PHE A CZ   7  
ATOM   4407  H  H    . PHE A 1 22 ? -1.178  -8.061  6.229   1.00 0.00 ? 22  PHE A H    7  
ATOM   4408  H  HA   . PHE A 1 22 ? -2.041  -9.024  3.640   1.00 0.00 ? 22  PHE A HA   7  
ATOM   4409  H  HB2  . PHE A 1 22 ? -3.523  -8.223  6.144   1.00 0.00 ? 22  PHE A HB2  7  
ATOM   4410  H  HB3  . PHE A 1 22 ? -4.348  -8.687  4.659   1.00 0.00 ? 22  PHE A HB3  7  
ATOM   4411  H  HD1  . PHE A 1 22 ? -3.336  -10.976 3.626   1.00 0.00 ? 22  PHE A HD1  7  
ATOM   4412  H  HD2  . PHE A 1 22 ? -3.323  -9.851  7.732   1.00 0.00 ? 22  PHE A HD2  7  
ATOM   4413  H  HE1  . PHE A 1 22 ? -3.165  -13.344 4.271   1.00 0.00 ? 22  PHE A HE1  7  
ATOM   4414  H  HE2  . PHE A 1 22 ? -3.151  -12.218 8.383   1.00 0.00 ? 22  PHE A HE2  7  
ATOM   4415  H  HZ   . PHE A 1 22 ? -3.073  -13.968 6.652   1.00 0.00 ? 22  PHE A HZ   7  
ATOM   4416  N  N    . MET A 1 23 ? -3.275  -7.010  2.649   1.00 0.00 ? 23  MET A N    7  
ATOM   4417  C  CA   . MET A 1 23 ? -3.656  -5.794  1.939   1.00 0.00 ? 23  MET A CA   7  
ATOM   4418  C  C    . MET A 1 23 ? -5.047  -5.332  2.361   1.00 0.00 ? 23  MET A C    7  
ATOM   4419  O  O    . MET A 1 23 ? -6.009  -6.098  2.307   1.00 0.00 ? 23  MET A O    7  
ATOM   4420  C  CB   . MET A 1 23 ? -3.621  -6.028  0.428   1.00 0.00 ? 23  MET A CB   7  
ATOM   4421  C  CG   . MET A 1 23 ? -4.339  -7.295  -0.008  1.00 0.00 ? 23  MET A CG   7  
ATOM   4422  S  SD   . MET A 1 23 ? -4.962  -7.194  -1.697  1.00 0.00 ? 23  MET A SD   7  
ATOM   4423  C  CE   . MET A 1 23 ? -3.931  -8.411  -2.512  1.00 0.00 ? 23  MET A CE   7  
ATOM   4424  H  H    . MET A 1 23 ? -3.535  -7.880  2.280   1.00 0.00 ? 23  MET A H    7  
ATOM   4425  H  HA   . MET A 1 23 ? -2.942  -5.025  2.192   1.00 0.00 ? 23  MET A HA   7  
ATOM   4426  H  HB2  . MET A 1 23 ? -4.086  -5.188  -0.066  1.00 0.00 ? 23  MET A HB2  7  
ATOM   4427  H  HB3  . MET A 1 23 ? -2.591  -6.098  0.110   1.00 0.00 ? 23  MET A HB3  7  
ATOM   4428  H  HG2  . MET A 1 23 ? -3.651  -8.125  0.057   1.00 0.00 ? 23  MET A HG2  7  
ATOM   4429  H  HG3  . MET A 1 23 ? -5.171  -7.468  0.658   1.00 0.00 ? 23  MET A HG3  7  
ATOM   4430  H  HE1  . MET A 1 23 ? -3.010  -7.946  -2.831  1.00 0.00 ? 23  MET A HE1  7  
ATOM   4431  H  HE2  . MET A 1 23 ? -3.710  -9.214  -1.824  1.00 0.00 ? 23  MET A HE2  7  
ATOM   4432  H  HE3  . MET A 1 23 ? -4.453  -8.807  -3.371  1.00 0.00 ? 23  MET A HE3  7  
ATOM   4433  N  N    . SER A 1 24 ? -5.146  -4.075  2.782   1.00 0.00 ? 24  SER A N    7  
ATOM   4434  C  CA   . SER A 1 24 ? -6.419  -3.513  3.217   1.00 0.00 ? 24  SER A CA   7  
ATOM   4435  C  C    . SER A 1 24 ? -7.342  -3.273  2.027   1.00 0.00 ? 24  SER A C    7  
ATOM   4436  O  O    . SER A 1 24 ? -6.972  -3.522  0.879   1.00 0.00 ? 24  SER A O    7  
ATOM   4437  C  CB   . SER A 1 24 ? -6.190  -2.202  3.972   1.00 0.00 ? 24  SER A CB   7  
ATOM   4438  O  OG   . SER A 1 24 ? -7.408  -1.687  4.482   1.00 0.00 ? 24  SER A OG   7  
ATOM   4439  H  H    . SER A 1 24 ? -4.343  -3.514  2.803   1.00 0.00 ? 24  SER A H    7  
ATOM   4440  H  HA   . SER A 1 24 ? -6.886  -4.224  3.883   1.00 0.00 ? 24  SER A HA   7  
ATOM   4441  H  HB2  . SER A 1 24 ? -5.514  -2.376  4.795   1.00 0.00 ? 24  SER A HB2  7  
ATOM   4442  H  HB3  . SER A 1 24 ? -5.758  -1.474  3.300   1.00 0.00 ? 24  SER A HB3  7  
ATOM   4443  H  HG   . SER A 1 24 ? -7.658  -2.177  5.269   1.00 0.00 ? 24  SER A HG   7  
ATOM   4444  N  N    . VAL A 1 25 ? -8.547  -2.787  2.309   1.00 0.00 ? 25  VAL A N    7  
ATOM   4445  C  CA   . VAL A 1 25 ? -9.525  -2.512  1.263   1.00 0.00 ? 25  VAL A CA   7  
ATOM   4446  C  C    . VAL A 1 25 ? -9.212  -1.202  0.550   1.00 0.00 ? 25  VAL A C    7  
ATOM   4447  O  O    . VAL A 1 25 ? -9.642  -0.981  -0.582  1.00 0.00 ? 25  VAL A O    7  
ATOM   4448  C  CB   . VAL A 1 25 ? -10.954 -2.446  1.833   1.00 0.00 ? 25  VAL A CB   7  
ATOM   4449  C  CG1  . VAL A 1 25 ? -11.950 -2.097  0.738   1.00 0.00 ? 25  VAL A CG1  7  
ATOM   4450  C  CG2  . VAL A 1 25 ? -11.322 -3.761  2.502   1.00 0.00 ? 25  VAL A CG2  7  
ATOM   4451  H  H    . VAL A 1 25 ? -8.784  -2.609  3.243   1.00 0.00 ? 25  VAL A H    7  
ATOM   4452  H  HA   . VAL A 1 25 ? -9.483  -3.320  0.546   1.00 0.00 ? 25  VAL A HA   7  
ATOM   4453  H  HB   . VAL A 1 25 ? -10.986 -1.666  2.580   1.00 0.00 ? 25  VAL A HB   7  
ATOM   4454  H  HG11 . VAL A 1 25 ? -11.844 -1.055  0.474   1.00 0.00 ? 25  VAL A HG11 7  
ATOM   4455  H  HG12 . VAL A 1 25 ? -11.761 -2.711  -0.130  1.00 0.00 ? 25  VAL A HG12 7  
ATOM   4456  H  HG13 . VAL A 1 25 ? -12.954 -2.277  1.095   1.00 0.00 ? 25  VAL A HG13 7  
ATOM   4457  H  HG21 . VAL A 1 25 ? -12.360 -3.987  2.306   1.00 0.00 ? 25  VAL A HG21 7  
ATOM   4458  H  HG22 . VAL A 1 25 ? -10.701 -4.551  2.107   1.00 0.00 ? 25  VAL A HG22 7  
ATOM   4459  H  HG23 . VAL A 1 25 ? -11.166 -3.680  3.568   1.00 0.00 ? 25  VAL A HG23 7  
ATOM   4460  N  N    . ASN A 1 26 ? -8.460  -0.335  1.219   1.00 0.00 ? 26  ASN A N    7  
ATOM   4461  C  CA   . ASN A 1 26 ? -8.089  0.956   0.650   1.00 0.00 ? 26  ASN A CA   7  
ATOM   4462  C  C    . ASN A 1 26 ? -6.607  0.986   0.290   1.00 0.00 ? 26  ASN A C    7  
ATOM   4463  O  O    . ASN A 1 26 ? -6.114  1.959   -0.282  1.00 0.00 ? 26  ASN A O    7  
ATOM   4464  C  CB   . ASN A 1 26 ? -8.409  2.082   1.634   1.00 0.00 ? 26  ASN A CB   7  
ATOM   4465  C  CG   . ASN A 1 26 ? -8.472  3.439   0.959   1.00 0.00 ? 26  ASN A CG   7  
ATOM   4466  O  OD1  . ASN A 1 26 ? -9.438  3.756   0.266   1.00 0.00 ? 26  ASN A OD1  7  
ATOM   4467  N  ND2  . ASN A 1 26 ? -7.437  4.247   1.160   1.00 0.00 ? 26  ASN A ND2  7  
ATOM   4468  H  H    . ASN A 1 26 ? -8.147  -0.568  2.118   1.00 0.00 ? 26  ASN A H    7  
ATOM   4469  H  HA   . ASN A 1 26 ? -8.669  1.100   -0.250  1.00 0.00 ? 26  ASN A HA   7  
ATOM   4470  H  HB2  . ASN A 1 26 ? -9.367  1.887   2.096   1.00 0.00 ? 26  ASN A HB2  7  
ATOM   4471  H  HB3  . ASN A 1 26 ? -7.646  2.114   2.397   1.00 0.00 ? 26  ASN A HB3  7  
ATOM   4472  H  HD21 . ASN A 1 26 ? -6.702  3.928   1.724   1.00 0.00 ? 26  ASN A HD21 7  
ATOM   4473  H  HD22 . ASN A 1 26 ? -7.452  5.131   0.736   1.00 0.00 ? 26  ASN A HD22 7  
ATOM   4474  N  N    . THR A 1 27 ? -5.899  -0.088  0.628   1.00 0.00 ? 27  THR A N    7  
ATOM   4475  C  CA   . THR A 1 27 ? -4.474  -0.185  0.342   1.00 0.00 ? 27  THR A CA   7  
ATOM   4476  C  C    . THR A 1 27 ? -4.206  -1.172  -0.789  1.00 0.00 ? 27  THR A C    7  
ATOM   4477  O  O    . THR A 1 27 ? -3.158  -1.124  -1.431  1.00 0.00 ? 27  THR A O    7  
ATOM   4478  C  CB   . THR A 1 27 ? -3.679  -0.621  1.587   1.00 0.00 ? 27  THR A CB   7  
ATOM   4479  O  OG1  . THR A 1 27 ? -4.015  -1.968  1.936   1.00 0.00 ? 27  THR A OG1  7  
ATOM   4480  C  CG2  . THR A 1 27 ? -3.968  0.300   2.763   1.00 0.00 ? 27  THR A CG2  7  
ATOM   4481  H  H    . THR A 1 27 ? -6.348  -0.832  1.082   1.00 0.00 ? 27  THR A H    7  
ATOM   4482  H  HA   . THR A 1 27 ? -4.126  0.793   0.042   1.00 0.00 ? 27  THR A HA   7  
ATOM   4483  H  HB   . THR A 1 27 ? -2.624  -0.568  1.359   1.00 0.00 ? 27  THR A HB   7  
ATOM   4484  H  HG1  . THR A 1 27 ? -3.712  -2.563  1.246   1.00 0.00 ? 27  THR A HG1  7  
ATOM   4485  H  HG21 . THR A 1 27 ? -4.129  -0.291  3.652   1.00 0.00 ? 27  THR A HG21 7  
ATOM   4486  H  HG22 . THR A 1 27 ? -4.852  0.884   2.554   1.00 0.00 ? 27  THR A HG22 7  
ATOM   4487  H  HG23 . THR A 1 27 ? -3.128  0.961   2.917   1.00 0.00 ? 27  THR A HG23 7  
ATOM   4488  N  N    . GLN A 1 28 ? -5.161  -2.066  -1.026  1.00 0.00 ? 28  GLN A N    7  
ATOM   4489  C  CA   . GLN A 1 28 ? -5.026  -3.065  -2.080  1.00 0.00 ? 28  GLN A CA   7  
ATOM   4490  C  C    . GLN A 1 28 ? -4.721  -2.404  -3.420  1.00 0.00 ? 28  GLN A C    7  
ATOM   4491  O  O    . GLN A 1 28 ? -5.104  -1.264  -3.679  1.00 0.00 ? 28  GLN A O    7  
ATOM   4492  C  CB   . GLN A 1 28 ? -6.305  -3.898  -2.188  1.00 0.00 ? 28  GLN A CB   7  
ATOM   4493  C  CG   . GLN A 1 28 ? -7.448  -3.171  -2.878  1.00 0.00 ? 28  GLN A CG   7  
ATOM   4494  C  CD   . GLN A 1 28 ? -8.577  -4.101  -3.273  1.00 0.00 ? 28  GLN A CD   7  
ATOM   4495  O  OE1  . GLN A 1 28 ? -8.768  -4.399  -4.453  1.00 0.00 ? 28  GLN A OE1  7  
ATOM   4496  N  NE2  . GLN A 1 28 ? -9.334  -4.567  -2.286  1.00 0.00 ? 28  GLN A NE2  7  
ATOM   4497  H  H    . GLN A 1 28 ? -5.973  -2.054  -0.480  1.00 0.00 ? 28  GLN A H    7  
ATOM   4498  H  HA   . GLN A 1 28 ? -4.205  -3.715  -1.818  1.00 0.00 ? 28  GLN A HA   7  
ATOM   4499  H  HB2  . GLN A 1 28 ? -6.089  -4.796  -2.747  1.00 0.00 ? 28  GLN A HB2  7  
ATOM   4500  H  HB3  . GLN A 1 28 ? -6.628  -4.170  -1.194  1.00 0.00 ? 28  GLN A HB3  7  
ATOM   4501  H  HG2  . GLN A 1 28 ? -7.839  -2.421  -2.206  1.00 0.00 ? 28  GLN A HG2  7  
ATOM   4502  H  HG3  . GLN A 1 28 ? -7.067  -2.691  -3.768  1.00 0.00 ? 28  GLN A HG3  7  
ATOM   4503  H  HE21 . GLN A 1 28 ? -9.124  -4.286  -1.370  1.00 0.00 ? 28  GLN A HE21 7  
ATOM   4504  H  HE22 . GLN A 1 28 ? -10.072 -5.170  -2.513  1.00 0.00 ? 28  GLN A HE22 7  
ATOM   4505  N  N    . PRO A 1 29 ? -4.013  -3.136  -4.294  1.00 0.00 ? 29  PRO A N    7  
ATOM   4506  C  CA   . PRO A 1 29 ? -3.551  -4.495  -3.996  1.00 0.00 ? 29  PRO A CA   7  
ATOM   4507  C  C    . PRO A 1 29 ? -2.452  -4.515  -2.939  1.00 0.00 ? 29  PRO A C    7  
ATOM   4508  O  O    . PRO A 1 29 ? -2.142  -5.563  -2.370  1.00 0.00 ? 29  PRO A O    7  
ATOM   4509  C  CB   . PRO A 1 29 ? -3.009  -4.988  -5.340  1.00 0.00 ? 29  PRO A CB   7  
ATOM   4510  C  CG   . PRO A 1 29 ? -2.629  -3.748  -6.073  1.00 0.00 ? 29  PRO A CG   7  
ATOM   4511  C  CD   . PRO A 1 29 ? -3.610  -2.694  -5.639  1.00 0.00 ? 29  PRO A CD   7  
ATOM   4512  H  HA   . PRO A 1 29 ? -4.365  -5.131  -3.679  1.00 0.00 ? 29  PRO A HA   7  
ATOM   4513  H  HB2  . PRO A 1 29 ? -2.154  -5.627  -5.173  1.00 0.00 ? 29  PRO A HB2  7  
ATOM   4514  H  HB3  . PRO A 1 29 ? -3.778  -5.536  -5.863  1.00 0.00 ? 29  PRO A HB3  7  
ATOM   4515  H  HG2  . PRO A 1 29 ? -1.624  -3.458  -5.808  1.00 0.00 ? 29  PRO A HG2  7  
ATOM   4516  H  HG3  . PRO A 1 29 ? -2.705  -3.914  -7.138  1.00 0.00 ? 29  PRO A HG3  7  
ATOM   4517  H  HD2  . PRO A 1 29 ? -3.131  -1.727  -5.599  1.00 0.00 ? 29  PRO A HD2  7  
ATOM   4518  H  HD3  . PRO A 1 29 ? -4.458  -2.669  -6.307  1.00 0.00 ? 29  PRO A HD3  7  
ATOM   4519  N  N    . LEU A 1 30 ? -1.866  -3.352  -2.680  1.00 0.00 ? 30  LEU A N    7  
ATOM   4520  C  CA   . LEU A 1 30 ? -0.801  -3.235  -1.690  1.00 0.00 ? 30  LEU A CA   7  
ATOM   4521  C  C    . LEU A 1 30 ? -1.375  -3.148  -0.279  1.00 0.00 ? 30  LEU A C    7  
ATOM   4522  O  O    . LEU A 1 30 ? -2.590  -3.065  -0.096  1.00 0.00 ? 30  LEU A O    7  
ATOM   4523  C  CB   . LEU A 1 30 ? 0.060   -2.004  -1.980  1.00 0.00 ? 30  LEU A CB   7  
ATOM   4524  C  CG   . LEU A 1 30 ? 0.965   -2.092  -3.209  1.00 0.00 ? 30  LEU A CG   7  
ATOM   4525  C  CD1  . LEU A 1 30 ? 1.563   -0.731  -3.530  1.00 0.00 ? 30  LEU A CD1  7  
ATOM   4526  C  CD2  . LEU A 1 30 ? 2.065   -3.121  -2.988  1.00 0.00 ? 30  LEU A CD2  7  
ATOM   4527  H  H    . LEU A 1 30 ? -2.155  -2.551  -3.165  1.00 0.00 ? 30  LEU A H    7  
ATOM   4528  H  HA   . LEU A 1 30 ? -0.185  -4.120  -1.760  1.00 0.00 ? 30  LEU A HA   7  
ATOM   4529  H  HB2  . LEU A 1 30 ? -0.603  -1.163  -2.117  1.00 0.00 ? 30  LEU A HB2  7  
ATOM   4530  H  HB3  . LEU A 1 30 ? 0.687   -1.829  -1.117  1.00 0.00 ? 30  LEU A HB3  7  
ATOM   4531  H  HG   . LEU A 1 30 ? 0.377   -2.407  -4.059  1.00 0.00 ? 30  LEU A HG   7  
ATOM   4532  H  HD11 . LEU A 1 30 ? 1.058   0.029   -2.953  1.00 0.00 ? 30  LEU A HD11 7  
ATOM   4533  H  HD12 . LEU A 1 30 ? 1.441   -0.524  -4.583  1.00 0.00 ? 30  LEU A HD12 7  
ATOM   4534  H  HD13 . LEU A 1 30 ? 2.614   -0.733  -3.283  1.00 0.00 ? 30  LEU A HD13 7  
ATOM   4535  H  HD21 . LEU A 1 30 ? 2.852   -2.967  -3.711  1.00 0.00 ? 30  LEU A HD21 7  
ATOM   4536  H  HD22 . LEU A 1 30 ? 1.656   -4.114  -3.106  1.00 0.00 ? 30  LEU A HD22 7  
ATOM   4537  H  HD23 . LEU A 1 30 ? 2.465   -3.012  -1.991  1.00 0.00 ? 30  LEU A HD23 7  
ATOM   4538  N  N    . CYS A 1 31 ? -0.494  -3.165  0.715   1.00 0.00 ? 31  CYS A N    7  
ATOM   4539  C  CA   . CYS A 1 31 ? -0.912  -3.086  2.109   1.00 0.00 ? 31  CYS A CA   7  
ATOM   4540  C  C    . CYS A 1 31 ? -0.639  -1.698  2.681   1.00 0.00 ? 31  CYS A C    7  
ATOM   4541  O  O    . CYS A 1 31 ? -0.053  -0.844  2.014   1.00 0.00 ? 31  CYS A O    7  
ATOM   4542  C  CB   . CYS A 1 31 ? -0.186  -4.144  2.942   1.00 0.00 ? 31  CYS A CB   7  
ATOM   4543  S  SG   . CYS A 1 31 ? 1.523   -3.698  3.385   1.00 0.00 ? 31  CYS A SG   7  
ATOM   4544  H  H    . CYS A 1 31 ? 0.462   -3.233  0.506   1.00 0.00 ? 31  CYS A H    7  
ATOM   4545  H  HA   . CYS A 1 31 ? -1.974  -3.275  2.149   1.00 0.00 ? 31  CYS A HA   7  
ATOM   4546  H  HB2  . CYS A 1 31 ? -0.732  -4.305  3.861   1.00 0.00 ? 31  CYS A HB2  7  
ATOM   4547  H  HB3  . CYS A 1 31 ? -0.151  -5.068  2.384   1.00 0.00 ? 31  CYS A HB3  7  
ATOM   4548  N  N    . HIS A 1 32 ? -1.067  -1.480  3.921   1.00 0.00 ? 32  HIS A N    7  
ATOM   4549  C  CA   . HIS A 1 32 ? -0.868  -0.196  4.583   1.00 0.00 ? 32  HIS A CA   7  
ATOM   4550  C  C    . HIS A 1 32 ? 0.583   0.261   4.459   1.00 0.00 ? 32  HIS A C    7  
ATOM   4551  O  O    . HIS A 1 32 ? 0.859   1.347   3.950   1.00 0.00 ? 32  HIS A O    7  
ATOM   4552  C  CB   . HIS A 1 32 ? -1.259  -0.293  6.058   1.00 0.00 ? 32  HIS A CB   7  
ATOM   4553  C  CG   . HIS A 1 32 ? -1.724  1.006   6.641   1.00 0.00 ? 32  HIS A CG   7  
ATOM   4554  N  ND1  . HIS A 1 32 ? -2.960  1.167   7.231   1.00 0.00 ? 32  HIS A ND1  7  
ATOM   4555  C  CD2  . HIS A 1 32 ? -1.109  2.209   6.725   1.00 0.00 ? 32  HIS A CD2  7  
ATOM   4556  C  CE1  . HIS A 1 32 ? -3.086  2.413   7.650   1.00 0.00 ? 32  HIS A CE1  7  
ATOM   4557  N  NE2  . HIS A 1 32 ? -1.977  3.066   7.356   1.00 0.00 ? 32  HIS A NE2  7  
ATOM   4558  H  H    . HIS A 1 32 ? -1.527  -2.199  4.401   1.00 0.00 ? 32  HIS A H    7  
ATOM   4559  H  HA   . HIS A 1 32 ? -1.503  0.530   4.098   1.00 0.00 ? 32  HIS A HA   7  
ATOM   4560  H  HB2  . HIS A 1 32 ? -2.060  -1.009  6.165   1.00 0.00 ? 32  HIS A HB2  7  
ATOM   4561  H  HB3  . HIS A 1 32 ? -0.405  -0.627  6.630   1.00 0.00 ? 32  HIS A HB3  7  
ATOM   4562  H  HD1  . HIS A 1 32 ? -3.643  0.472   7.326   1.00 0.00 ? 32  HIS A HD1  7  
ATOM   4563  H  HD2  . HIS A 1 32 ? -0.120  2.451   6.363   1.00 0.00 ? 32  HIS A HD2  7  
ATOM   4564  H  HE1  . HIS A 1 32 ? -3.949  2.828   8.149   1.00 0.00 ? 32  HIS A HE1  7  
ATOM   4565  N  N    . GLU A 1 33 ? 1.504   -0.575  4.927   1.00 0.00 ? 33  GLU A N    7  
ATOM   4566  C  CA   . GLU A 1 33 ? 2.925   -0.255  4.869   1.00 0.00 ? 33  GLU A CA   7  
ATOM   4567  C  C    . GLU A 1 33 ? 3.345   0.103   3.446   1.00 0.00 ? 33  GLU A C    7  
ATOM   4568  O  O    . GLU A 1 33 ? 3.686   1.250   3.157   1.00 0.00 ? 33  GLU A O    7  
ATOM   4569  C  CB   . GLU A 1 33 ? 3.757   -1.435  5.376   1.00 0.00 ? 33  GLU A CB   7  
ATOM   4570  C  CG   . GLU A 1 33 ? 5.227   -1.103  5.575   1.00 0.00 ? 33  GLU A CG   7  
ATOM   4571  C  CD   . GLU A 1 33 ? 6.047   -2.309  5.989   1.00 0.00 ? 33  GLU A CD   7  
ATOM   4572  O  OE1  . GLU A 1 33 ? 5.747   -3.423  5.511   1.00 0.00 ? 33  GLU A OE1  7  
ATOM   4573  O  OE2  . GLU A 1 33 ? 6.989   -2.139  6.791   1.00 0.00 ? 33  GLU A OE2  7  
ATOM   4574  H  H    . GLU A 1 33 ? 1.221   -1.426  5.322   1.00 0.00 ? 33  GLU A H    7  
ATOM   4575  H  HA   . GLU A 1 33 ? 3.100   0.597   5.508   1.00 0.00 ? 33  GLU A HA   7  
ATOM   4576  H  HB2  . GLU A 1 33 ? 3.353   -1.765  6.322   1.00 0.00 ? 33  GLU A HB2  7  
ATOM   4577  H  HB3  . GLU A 1 33 ? 3.686   -2.243  4.663   1.00 0.00 ? 33  GLU A HB3  7  
ATOM   4578  H  HG2  . GLU A 1 33 ? 5.624   -0.718  4.648   1.00 0.00 ? 33  GLU A HG2  7  
ATOM   4579  H  HG3  . GLU A 1 33 ? 5.312   -0.348  6.343   1.00 0.00 ? 33  GLU A HG3  7  
ATOM   4580  N  N    . CYS A 1 34 ? 3.318   -0.888  2.561   1.00 0.00 ? 34  CYS A N    7  
ATOM   4581  C  CA   . CYS A 1 34 ? 3.695   -0.680  1.168   1.00 0.00 ? 34  CYS A CA   7  
ATOM   4582  C  C    . CYS A 1 34 ? 2.981   0.536   0.587   1.00 0.00 ? 34  CYS A C    7  
ATOM   4583  O  O    . CYS A 1 34 ? 3.615   1.525   0.219   1.00 0.00 ? 34  CYS A O    7  
ATOM   4584  C  CB   . CYS A 1 34 ? 3.369   -1.923  0.339   1.00 0.00 ? 34  CYS A CB   7  
ATOM   4585  S  SG   . CYS A 1 34 ? 4.288   -3.414  0.839   1.00 0.00 ? 34  CYS A SG   7  
ATOM   4586  H  H    . CYS A 1 34 ? 3.037   -1.782  2.852   1.00 0.00 ? 34  CYS A H    7  
ATOM   4587  H  HA   . CYS A 1 34 ? 4.760   -0.506  1.136   1.00 0.00 ? 34  CYS A HA   7  
ATOM   4588  H  HB2  . CYS A 1 34 ? 2.315   -2.142  0.432   1.00 0.00 ? 34  CYS A HB2  7  
ATOM   4589  H  HB3  . CYS A 1 34 ? 3.600   -1.726  -0.698  1.00 0.00 ? 34  CYS A HB3  7  
ATOM   4590  N  N    . SER A 1 35 ? 1.656   0.455   0.506   1.00 0.00 ? 35  SER A N    7  
ATOM   4591  C  CA   . SER A 1 35 ? 0.855   1.546   -0.034  1.00 0.00 ? 35  SER A CA   7  
ATOM   4592  C  C    . SER A 1 35 ? 1.399   2.897   0.422   1.00 0.00 ? 35  SER A C    7  
ATOM   4593  O  O    . SER A 1 35 ? 1.390   3.868   -0.334  1.00 0.00 ? 35  SER A O    7  
ATOM   4594  C  CB   . SER A 1 35 ? -0.605  1.399   0.400   1.00 0.00 ? 35  SER A CB   7  
ATOM   4595  O  OG   . SER A 1 35 ? -1.467  2.130   -0.454  1.00 0.00 ? 35  SER A OG   7  
ATOM   4596  H  H    . SER A 1 35 ? 1.208   -0.361  0.815   1.00 0.00 ? 35  SER A H    7  
ATOM   4597  H  HA   . SER A 1 35 ? 0.908   1.495   -1.111  1.00 0.00 ? 35  SER A HA   7  
ATOM   4598  H  HB2  . SER A 1 35 ? -0.884  0.357   0.367   1.00 0.00 ? 35  SER A HB2  7  
ATOM   4599  H  HB3  . SER A 1 35 ? -0.716  1.770   1.409   1.00 0.00 ? 35  SER A HB3  7  
ATOM   4600  H  HG   . SER A 1 35 ? -2.339  1.729   -0.448  1.00 0.00 ? 35  SER A HG   7  
ATOM   4601  N  N    . GLU A 1 36 ? 1.872   2.949   1.663   1.00 0.00 ? 36  GLU A N    7  
ATOM   4602  C  CA   . GLU A 1 36 ? 2.420   4.180   2.220   1.00 0.00 ? 36  GLU A CA   7  
ATOM   4603  C  C    . GLU A 1 36 ? 3.842   4.418   1.721   1.00 0.00 ? 36  GLU A C    7  
ATOM   4604  O  O    . GLU A 1 36 ? 4.219   5.546   1.403   1.00 0.00 ? 36  GLU A O    7  
ATOM   4605  C  CB   . GLU A 1 36 ? 2.407   4.124   3.749   1.00 0.00 ? 36  GLU A CB   7  
ATOM   4606  C  CG   . GLU A 1 36 ? 3.331   5.138   4.403   1.00 0.00 ? 36  GLU A CG   7  
ATOM   4607  C  CD   . GLU A 1 36 ? 2.742   6.535   4.427   1.00 0.00 ? 36  GLU A CD   7  
ATOM   4608  O  OE1  . GLU A 1 36 ? 1.828   6.778   5.244   1.00 0.00 ? 36  GLU A OE1  7  
ATOM   4609  O  OE2  . GLU A 1 36 ? 3.192   7.384   3.631   1.00 0.00 ? 36  GLU A OE2  7  
ATOM   4610  H  H    . GLU A 1 36 ? 1.852   2.141   2.217   1.00 0.00 ? 36  GLU A H    7  
ATOM   4611  H  HA   . GLU A 1 36 ? 1.795   4.998   1.894   1.00 0.00 ? 36  GLU A HA   7  
ATOM   4612  H  HB2  . GLU A 1 36 ? 1.401   4.309   4.096   1.00 0.00 ? 36  GLU A HB2  7  
ATOM   4613  H  HB3  . GLU A 1 36 ? 2.711   3.137   4.063   1.00 0.00 ? 36  GLU A HB3  7  
ATOM   4614  H  HG2  . GLU A 1 36 ? 3.524   4.827   5.419   1.00 0.00 ? 36  GLU A HG2  7  
ATOM   4615  H  HG3  . GLU A 1 36 ? 4.261   5.165   3.854   1.00 0.00 ? 36  GLU A HG3  7  
ATOM   4616  N  N    . ARG A 1 37 ? 4.626   3.348   1.655   1.00 0.00 ? 37  ARG A N    7  
ATOM   4617  C  CA   . ARG A 1 37 ? 6.007   3.439   1.196   1.00 0.00 ? 37  ARG A CA   7  
ATOM   4618  C  C    . ARG A 1 37 ? 6.090   4.183   -0.133  1.00 0.00 ? 37  ARG A C    7  
ATOM   4619  O  O    . ARG A 1 37 ? 6.991   4.995   -0.347  1.00 0.00 ? 37  ARG A O    7  
ATOM   4620  C  CB   . ARG A 1 37 ? 6.612   2.042   1.050   1.00 0.00 ? 37  ARG A CB   7  
ATOM   4621  C  CG   . ARG A 1 37 ? 6.731   1.289   2.365   1.00 0.00 ? 37  ARG A CG   7  
ATOM   4622  C  CD   . ARG A 1 37 ? 8.063   1.563   3.046   1.00 0.00 ? 37  ARG A CD   7  
ATOM   4623  N  NE   . ARG A 1 37 ? 8.127   2.912   3.600   1.00 0.00 ? 37  ARG A NE   7  
ATOM   4624  C  CZ   . ARG A 1 37 ? 9.264   3.534   3.890   1.00 0.00 ? 37  ARG A CZ   7  
ATOM   4625  N  NH1  . ARG A 1 37 ? 10.426  2.931   3.680   1.00 0.00 ? 37  ARG A NH1  7  
ATOM   4626  N  NH2  . ARG A 1 37 ? 9.241   4.763   4.392   1.00 0.00 ? 37  ARG A NH2  7  
ATOM   4627  H  H    . ARG A 1 37 ? 4.268   2.475   1.922   1.00 0.00 ? 37  ARG A H    7  
ATOM   4628  H  HA   . ARG A 1 37 ? 6.567   3.988   1.938   1.00 0.00 ? 37  ARG A HA   7  
ATOM   4629  H  HB2  . ARG A 1 37 ? 5.992   1.461   0.383   1.00 0.00 ? 37  ARG A HB2  7  
ATOM   4630  H  HB3  . ARG A 1 37 ? 7.599   2.133   0.622   1.00 0.00 ? 37  ARG A HB3  7  
ATOM   4631  H  HG2  . ARG A 1 37 ? 5.933   1.602   3.022   1.00 0.00 ? 37  ARG A HG2  7  
ATOM   4632  H  HG3  . ARG A 1 37 ? 6.646   0.230   2.171   1.00 0.00 ? 37  ARG A HG3  7  
ATOM   4633  H  HD2  . ARG A 1 37 ? 8.197   0.849   3.845   1.00 0.00 ? 37  ARG A HD2  7  
ATOM   4634  H  HD3  . ARG A 1 37 ? 8.854   1.443   2.320   1.00 0.00 ? 37  ARG A HD3  7  
ATOM   4635  H  HE   . ARG A 1 37 ? 7.280   3.377   3.763   1.00 0.00 ? 37  ARG A HE   7  
ATOM   4636  H  HH11 . ARG A 1 37 ? 10.447  2.006   3.302   1.00 0.00 ? 37  ARG A HH11 7  
ATOM   4637  H  HH12 . ARG A 1 37 ? 11.281  3.402   3.899   1.00 0.00 ? 37  ARG A HH12 7  
ATOM   4638  H  HH21 . ARG A 1 37 ? 8.367   5.221   4.551   1.00 0.00 ? 37  ARG A HH21 7  
ATOM   4639  H  HH22 . ARG A 1 37 ? 10.097  5.230   4.611   1.00 0.00 ? 37  ARG A HH22 7  
ATOM   4640  N  N    . ARG A 1 38 ? 5.145   3.900   -1.024  1.00 0.00 ? 38  ARG A N    7  
ATOM   4641  C  CA   . ARG A 1 38 ? 5.113   4.540   -2.333  1.00 0.00 ? 38  ARG A CA   7  
ATOM   4642  C  C    . ARG A 1 38 ? 4.518   5.942   -2.238  1.00 0.00 ? 38  ARG A C    7  
ATOM   4643  O  O    . ARG A 1 38 ? 5.060   6.895   -2.797  1.00 0.00 ? 38  ARG A O    7  
ATOM   4644  C  CB   . ARG A 1 38 ? 4.301   3.696   -3.317  1.00 0.00 ? 38  ARG A CB   7  
ATOM   4645  C  CG   . ARG A 1 38 ? 4.708   3.893   -4.769  1.00 0.00 ? 38  ARG A CG   7  
ATOM   4646  C  CD   . ARG A 1 38 ? 4.472   2.634   -5.589  1.00 0.00 ? 38  ARG A CD   7  
ATOM   4647  N  NE   . ARG A 1 38 ? 5.506   1.629   -5.359  1.00 0.00 ? 38  ARG A NE   7  
ATOM   4648  C  CZ   . ARG A 1 38 ? 5.762   0.633   -6.200  1.00 0.00 ? 38  ARG A CZ   7  
ATOM   4649  N  NH1  . ARG A 1 38 ? 5.063   0.510   -7.320  1.00 0.00 ? 38  ARG A NH1  7  
ATOM   4650  N  NH2  . ARG A 1 38 ? 6.720   -0.242  -5.921  1.00 0.00 ? 38  ARG A NH2  7  
ATOM   4651  H  H    . ARG A 1 38 ? 4.454   3.244   -0.795  1.00 0.00 ? 38  ARG A H    7  
ATOM   4652  H  HA   . ARG A 1 38 ? 6.129   4.616   -2.691  1.00 0.00 ? 38  ARG A HA   7  
ATOM   4653  H  HB2  . ARG A 1 38 ? 4.429   2.652   -3.069  1.00 0.00 ? 38  ARG A HB2  7  
ATOM   4654  H  HB3  . ARG A 1 38 ? 3.258   3.956   -3.220  1.00 0.00 ? 38  ARG A HB3  7  
ATOM   4655  H  HG2  . ARG A 1 38 ? 4.125   4.698   -5.190  1.00 0.00 ? 38  ARG A HG2  7  
ATOM   4656  H  HG3  . ARG A 1 38 ? 5.757   4.146   -4.807  1.00 0.00 ? 38  ARG A HG3  7  
ATOM   4657  H  HD2  . ARG A 1 38 ? 3.513   2.219   -5.318  1.00 0.00 ? 38  ARG A HD2  7  
ATOM   4658  H  HD3  . ARG A 1 38 ? 4.466   2.899   -6.636  1.00 0.00 ? 38  ARG A HD3  7  
ATOM   4659  H  HE   . ARG A 1 38 ? 6.035   1.701   -4.538  1.00 0.00 ? 38  ARG A HE   7  
ATOM   4660  H  HH11 . ARG A 1 38 ? 4.342   1.168   -7.533  1.00 0.00 ? 38  ARG A HH11 7  
ATOM   4661  H  HH12 . ARG A 1 38 ? 5.259   -0.241  -7.951  1.00 0.00 ? 38  ARG A HH12 7  
ATOM   4662  H  HH21 . ARG A 1 38 ? 7.249   -0.153  -5.078  1.00 0.00 ? 38  ARG A HH21 7  
ATOM   4663  H  HH22 . ARG A 1 38 ? 6.912   -0.992  -6.554  1.00 0.00 ? 38  ARG A HH22 7  
ATOM   4664  N  N    . GLN A 1 39 ? 3.401   6.058   -1.527  1.00 0.00 ? 39  GLN A N    7  
ATOM   4665  C  CA   . GLN A 1 39 ? 2.732   7.343   -1.360  1.00 0.00 ? 39  GLN A CA   7  
ATOM   4666  C  C    . GLN A 1 39 ? 3.746   8.457   -1.122  1.00 0.00 ? 39  GLN A C    7  
ATOM   4667  O  O    . GLN A 1 39 ? 3.833   9.409   -1.898  1.00 0.00 ? 39  GLN A O    7  
ATOM   4668  C  CB   . GLN A 1 39 ? 1.743   7.280   -0.196  1.00 0.00 ? 39  GLN A CB   7  
ATOM   4669  C  CG   . GLN A 1 39 ? 0.345   6.845   -0.607  1.00 0.00 ? 39  GLN A CG   7  
ATOM   4670  C  CD   . GLN A 1 39 ? -0.665  6.990   0.514   1.00 0.00 ? 39  GLN A CD   7  
ATOM   4671  O  OE1  . GLN A 1 39 ? -0.878  6.063   1.297   1.00 0.00 ? 39  GLN A OE1  7  
ATOM   4672  N  NE2  . GLN A 1 39 ? -1.294  8.156   0.597   1.00 0.00 ? 39  GLN A NE2  7  
ATOM   4673  H  H    . GLN A 1 39 ? 3.017   5.262   -1.106  1.00 0.00 ? 39  GLN A H    7  
ATOM   4674  H  HA   . GLN A 1 39 ? 2.190   7.555   -2.270  1.00 0.00 ? 39  GLN A HA   7  
ATOM   4675  H  HB2  . GLN A 1 39 ? 2.113   6.580   0.538   1.00 0.00 ? 39  GLN A HB2  7  
ATOM   4676  H  HB3  . GLN A 1 39 ? 1.673   8.259   0.256   1.00 0.00 ? 39  GLN A HB3  7  
ATOM   4677  H  HG2  . GLN A 1 39 ? 0.024   7.451   -1.441  1.00 0.00 ? 39  GLN A HG2  7  
ATOM   4678  H  HG3  . GLN A 1 39 ? 0.380   5.808   -0.910  1.00 0.00 ? 39  GLN A HG3  7  
ATOM   4679  H  HE21 . GLN A 1 39 ? -1.074  8.848   -0.062  1.00 0.00 ? 39  GLN A HE21 7  
ATOM   4680  H  HE22 . GLN A 1 39 ? -1.952  8.277   1.312   1.00 0.00 ? 39  GLN A HE22 7  
ATOM   4681  N  N    . LYS A 1 40 ? 4.511   8.333   -0.043  1.00 0.00 ? 40  LYS A N    7  
ATOM   4682  C  CA   . LYS A 1 40 ? 5.521   9.328   0.299   1.00 0.00 ? 40  LYS A CA   7  
ATOM   4683  C  C    . LYS A 1 40 ? 6.171   9.897   -0.958  1.00 0.00 ? 40  LYS A C    7  
ATOM   4684  O  O    . LYS A 1 40 ? 6.247   11.112  -1.134  1.00 0.00 ? 40  LYS A O    7  
ATOM   4685  C  CB   . LYS A 1 40 ? 6.589   8.711   1.204   1.00 0.00 ? 40  LYS A CB   7  
ATOM   4686  C  CG   . LYS A 1 40 ? 7.609   9.715   1.713   1.00 0.00 ? 40  LYS A CG   7  
ATOM   4687  C  CD   . LYS A 1 40 ? 8.786   9.025   2.380   1.00 0.00 ? 40  LYS A CD   7  
ATOM   4688  C  CE   . LYS A 1 40 ? 9.894   10.011  2.716   1.00 0.00 ? 40  LYS A CE   7  
ATOM   4689  N  NZ   . LYS A 1 40 ? 10.943  9.396   3.575   1.00 0.00 ? 40  LYS A NZ   7  
ATOM   4690  H  H    . LYS A 1 40 ? 4.395   7.551   0.538   1.00 0.00 ? 40  LYS A H    7  
ATOM   4691  H  HA   . LYS A 1 40 ? 5.030   10.130  0.830   1.00 0.00 ? 40  LYS A HA   7  
ATOM   4692  H  HB2  . LYS A 1 40 ? 6.104   8.259   2.057   1.00 0.00 ? 40  LYS A HB2  7  
ATOM   4693  H  HB3  . LYS A 1 40 ? 7.113   7.945   0.652   1.00 0.00 ? 40  LYS A HB3  7  
ATOM   4694  H  HG2  . LYS A 1 40 ? 7.973   10.298  0.880   1.00 0.00 ? 40  LYS A HG2  7  
ATOM   4695  H  HG3  . LYS A 1 40 ? 7.132   10.368  2.430   1.00 0.00 ? 40  LYS A HG3  7  
ATOM   4696  H  HD2  . LYS A 1 40 ? 8.448   8.557   3.293   1.00 0.00 ? 40  LYS A HD2  7  
ATOM   4697  H  HD3  . LYS A 1 40 ? 9.177   8.271   1.711   1.00 0.00 ? 40  LYS A HD3  7  
ATOM   4698  H  HE2  . LYS A 1 40 ? 10.347  10.351  1.797   1.00 0.00 ? 40  LYS A HE2  7  
ATOM   4699  H  HE3  . LYS A 1 40 ? 9.462   10.853  3.237   1.00 0.00 ? 40  LYS A HE3  7  
ATOM   4700  H  HZ1  . LYS A 1 40 ? 10.616  9.347   4.561   1.00 0.00 ? 40  LYS A HZ1  7  
ATOM   4701  H  HZ2  . LYS A 1 40 ? 11.814  9.964   3.538   1.00 0.00 ? 40  LYS A HZ2  7  
ATOM   4702  H  HZ3  . LYS A 1 40 ? 11.157  8.434   3.244   1.00 0.00 ? 40  LYS A HZ3  7  
ATOM   4703  N  N    . ASN A 1 41 ? 6.638   9.010   -1.831  1.00 0.00 ? 41  ASN A N    7  
ATOM   4704  C  CA   . ASN A 1 41 ? 7.282   9.424   -3.072  1.00 0.00 ? 41  ASN A CA   7  
ATOM   4705  C  C    . ASN A 1 41 ? 6.242   9.796   -4.126  1.00 0.00 ? 41  ASN A C    7  
ATOM   4706  O  O    . ASN A 1 41 ? 5.365   8.998   -4.453  1.00 0.00 ? 41  ASN A O    7  
ATOM   4707  C  CB   . ASN A 1 41 ? 8.183   8.307   -3.601  1.00 0.00 ? 41  ASN A CB   7  
ATOM   4708  C  CG   . ASN A 1 41 ? 9.202   8.813   -4.604  1.00 0.00 ? 41  ASN A CG   7  
ATOM   4709  O  OD1  . ASN A 1 41 ? 9.188   9.984   -4.984  1.00 0.00 ? 41  ASN A OD1  7  
ATOM   4710  N  ND2  . ASN A 1 41 ? 10.093  7.929   -5.039  1.00 0.00 ? 41  ASN A ND2  7  
ATOM   4711  H  H    . ASN A 1 41 ? 6.549   8.054   -1.635  1.00 0.00 ? 41  ASN A H    7  
ATOM   4712  H  HA   . ASN A 1 41 ? 7.887   10.292  -2.858  1.00 0.00 ? 41  ASN A HA   7  
ATOM   4713  H  HB2  . ASN A 1 41 ? 8.714   7.859   -2.774  1.00 0.00 ? 41  ASN A HB2  7  
ATOM   4714  H  HB3  . ASN A 1 41 ? 7.574   7.557   -4.081  1.00 0.00 ? 41  ASN A HB3  7  
ATOM   4715  H  HD21 . ASN A 1 41 ? 10.044  7.013   -4.693  1.00 0.00 ? 41  ASN A HD21 7  
ATOM   4716  H  HD22 . ASN A 1 41 ? 10.764  8.229   -5.687  1.00 0.00 ? 41  ASN A HD22 7  
ATOM   4717  N  N    . GLN A 1 42 ? 6.350   11.012  -4.652  1.00 0.00 ? 42  GLN A N    7  
ATOM   4718  C  CA   . GLN A 1 42 ? 5.419   11.489  -5.668  1.00 0.00 ? 42  GLN A CA   7  
ATOM   4719  C  C    . GLN A 1 42 ? 5.752   10.894  -7.032  1.00 0.00 ? 42  GLN A C    7  
ATOM   4720  O  O    . GLN A 1 42 ? 6.900   10.930  -7.473  1.00 0.00 ? 42  GLN A O    7  
ATOM   4721  C  CB   . GLN A 1 42 ? 5.451   13.016  -5.742  1.00 0.00 ? 42  GLN A CB   7  
ATOM   4722  C  CG   . GLN A 1 42 ? 4.578   13.694  -4.699  1.00 0.00 ? 42  GLN A CG   7  
ATOM   4723  C  CD   . GLN A 1 42 ? 4.709   13.062  -3.327  1.00 0.00 ? 42  GLN A CD   7  
ATOM   4724  O  OE1  . GLN A 1 42 ? 5.482   13.525  -2.488  1.00 0.00 ? 42  GLN A OE1  7  
ATOM   4725  N  NE2  . GLN A 1 42 ? 3.952   11.996  -3.092  1.00 0.00 ? 42  GLN A NE2  7  
ATOM   4726  H  H    . GLN A 1 42 ? 7.071   11.601  -4.349  1.00 0.00 ? 42  GLN A H    7  
ATOM   4727  H  HA   . GLN A 1 42 ? 4.427   11.172  -5.383  1.00 0.00 ? 42  GLN A HA   7  
ATOM   4728  H  HB2  . GLN A 1 42 ? 6.468   13.350  -5.602  1.00 0.00 ? 42  GLN A HB2  7  
ATOM   4729  H  HB3  . GLN A 1 42 ? 5.111   13.324  -6.720  1.00 0.00 ? 42  GLN A HB3  7  
ATOM   4730  H  HG2  . GLN A 1 42 ? 4.866   14.733  -4.627  1.00 0.00 ? 42  GLN A HG2  7  
ATOM   4731  H  HG3  . GLN A 1 42 ? 3.547   13.628  -5.013  1.00 0.00 ? 42  GLN A HG3  7  
ATOM   4732  H  HE21 . GLN A 1 42 ? 3.361   11.682  -3.808  1.00 0.00 ? 42  GLN A HE21 7  
ATOM   4733  H  HE22 . GLN A 1 42 ? 4.018   11.567  -2.214  1.00 0.00 ? 42  GLN A HE22 7  
ATOM   4734  N  N    . ASN A 1 43 ? 4.739   10.347  -7.697  1.00 0.00 ? 43  ASN A N    7  
ATOM   4735  C  CA   . ASN A 1 43 ? 4.924   9.744   -9.012  1.00 0.00 ? 43  ASN A CA   7  
ATOM   4736  C  C    . ASN A 1 43 ? 4.299   10.610  -10.101 1.00 0.00 ? 43  ASN A C    7  
ATOM   4737  O  O    . ASN A 1 43 ? 4.243   10.217  -11.266 1.00 0.00 ? 43  ASN A O    7  
ATOM   4738  C  CB   . ASN A 1 43 ? 4.311   8.343   -9.044  1.00 0.00 ? 43  ASN A CB   7  
ATOM   4739  C  CG   . ASN A 1 43 ? 5.207   7.304   -8.398  1.00 0.00 ? 43  ASN A CG   7  
ATOM   4740  O  OD1  . ASN A 1 43 ? 4.930   6.827   -7.297  1.00 0.00 ? 43  ASN A OD1  7  
ATOM   4741  N  ND2  . ASN A 1 43 ? 6.288   6.948   -9.081  1.00 0.00 ? 43  ASN A ND2  7  
ATOM   4742  H  H    . ASN A 1 43 ? 3.846   10.349  -7.294  1.00 0.00 ? 43  ASN A H    7  
ATOM   4743  H  HA   . ASN A 1 43 ? 5.986   9.667   -9.194  1.00 0.00 ? 43  ASN A HA   7  
ATOM   4744  H  HB2  . ASN A 1 43 ? 3.369   8.357   -8.515  1.00 0.00 ? 43  ASN A HB2  7  
ATOM   4745  H  HB3  . ASN A 1 43 ? 4.138   8.055   -10.070 1.00 0.00 ? 43  ASN A HB3  7  
ATOM   4746  H  HD21 . ASN A 1 43 ? 6.445   7.370   -9.952  1.00 0.00 ? 43  ASN A HD21 7  
ATOM   4747  H  HD22 . ASN A 1 43 ? 6.885   6.278   -8.687  1.00 0.00 ? 43  ASN A HD22 7  
ATOM   4748  N  N    . SER A 1 44 ? 3.832   11.793  -9.713  1.00 0.00 ? 44  SER A N    7  
ATOM   4749  C  CA   . SER A 1 44 ? 3.208   12.714  -10.655 1.00 0.00 ? 44  SER A CA   7  
ATOM   4750  C  C    . SER A 1 44 ? 4.085   12.906  -11.889 1.00 0.00 ? 44  SER A C    7  
ATOM   4751  O  O    . SER A 1 44 ? 3.627   12.752  -13.020 1.00 0.00 ? 44  SER A O    7  
ATOM   4752  C  CB   . SER A 1 44 ? 2.948   14.065  -9.985  1.00 0.00 ? 44  SER A CB   7  
ATOM   4753  O  OG   . SER A 1 44 ? 4.142   14.602  -9.442  1.00 0.00 ? 44  SER A OG   7  
ATOM   4754  H  H    . SER A 1 44 ? 3.906   12.050  -8.770  1.00 0.00 ? 44  SER A H    7  
ATOM   4755  H  HA   . SER A 1 44 ? 2.265   12.287  -10.962 1.00 0.00 ? 44  SER A HA   7  
ATOM   4756  H  HB2  . SER A 1 44 ? 2.555   14.756  -10.714 1.00 0.00 ? 44  SER A HB2  7  
ATOM   4757  H  HB3  . SER A 1 44 ? 2.230   13.935  -9.188  1.00 0.00 ? 44  SER A HB3  7  
ATOM   4758  H  HG   . SER A 1 44 ? 4.624   15.069  -10.129 1.00 0.00 ? 44  SER A HG   7  
ATOM   4759  N  N    . GLY A 1 45 ? 5.350   13.245  -11.661 1.00 0.00 ? 45  GLY A N    7  
ATOM   4760  C  CA   . GLY A 1 45 ? 6.272   13.453  -12.762 1.00 0.00 ? 45  GLY A CA   7  
ATOM   4761  C  C    . GLY A 1 45 ? 6.604   12.166  -13.492 1.00 0.00 ? 45  GLY A C    7  
ATOM   4762  O  O    . GLY A 1 45 ? 5.883   11.734  -14.391 1.00 0.00 ? 45  GLY A O    7  
ATOM   4763  H  H    . GLY A 1 45 ? 5.660   13.354  -10.737 1.00 0.00 ? 45  GLY A H    7  
ATOM   4764  H  HA2  . GLY A 1 45 ? 5.831   14.148  -13.461 1.00 0.00 ? 45  GLY A HA2  7  
ATOM   4765  H  HA3  . GLY A 1 45 ? 7.186   13.879  -12.375 1.00 0.00 ? 45  GLY A HA3  7  
ATOM   4766  N  N    . PRO A 1 46 ? 7.721   11.532  -13.104 1.00 0.00 ? 46  PRO A N    7  
ATOM   4767  C  CA   . PRO A 1 46 ? 8.172   10.279  -13.716 1.00 0.00 ? 46  PRO A CA   7  
ATOM   4768  C  C    . PRO A 1 46 ? 7.266   9.104   -13.366 1.00 0.00 ? 46  PRO A C    7  
ATOM   4769  O  O    . PRO A 1 46 ? 7.375   8.524   -12.286 1.00 0.00 ? 46  PRO A O    7  
ATOM   4770  C  CB   . PRO A 1 46 ? 9.567   10.076  -13.120 1.00 0.00 ? 46  PRO A CB   7  
ATOM   4771  C  CG   . PRO A 1 46 ? 9.536   10.811  -11.824 1.00 0.00 ? 46  PRO A CG   7  
ATOM   4772  C  CD   . PRO A 1 46 ? 8.628   11.990  -12.039 1.00 0.00 ? 46  PRO A CD   7  
ATOM   4773  H  HA   . PRO A 1 46 ? 8.247   10.367  -14.790 1.00 0.00 ? 46  PRO A HA   7  
ATOM   4774  H  HB2  . PRO A 1 46 ? 9.748   9.020   -12.972 1.00 0.00 ? 46  PRO A HB2  7  
ATOM   4775  H  HB3  . PRO A 1 46 ? 10.311  10.484  -13.787 1.00 0.00 ? 46  PRO A HB3  7  
ATOM   4776  H  HG2  . PRO A 1 46 ? 9.143   10.171  -11.048 1.00 0.00 ? 46  PRO A HG2  7  
ATOM   4777  H  HG3  . PRO A 1 46 ? 10.530  11.145  -11.568 1.00 0.00 ? 46  PRO A HG3  7  
ATOM   4778  H  HD2  . PRO A 1 46 ? 8.080   12.214  -11.136 1.00 0.00 ? 46  PRO A HD2  7  
ATOM   4779  H  HD3  . PRO A 1 46 ? 9.197   12.850  -12.361 1.00 0.00 ? 46  PRO A HD3  7  
ATOM   4780  N  N    . SER A 1 47 ? 6.372   8.757   -14.286 1.00 0.00 ? 47  SER A N    7  
ATOM   4781  C  CA   . SER A 1 47 ? 5.445   7.652   -14.073 1.00 0.00 ? 47  SER A CA   7  
ATOM   4782  C  C    . SER A 1 47 ? 6.120   6.313   -14.359 1.00 0.00 ? 47  SER A C    7  
ATOM   4783  O  O    . SER A 1 47 ? 6.769   6.141   -15.390 1.00 0.00 ? 47  SER A O    7  
ATOM   4784  C  CB   . SER A 1 47 ? 4.211   7.814   -14.963 1.00 0.00 ? 47  SER A CB   7  
ATOM   4785  O  OG   . SER A 1 47 ? 4.579   7.940   -16.326 1.00 0.00 ? 47  SER A OG   7  
ATOM   4786  H  H    . SER A 1 47 ? 6.334   9.257   -15.128 1.00 0.00 ? 47  SER A H    7  
ATOM   4787  H  HA   . SER A 1 47 ? 5.137   7.673   -13.038 1.00 0.00 ? 47  SER A HA   7  
ATOM   4788  H  HB2  . SER A 1 47 ? 3.574   6.950   -14.853 1.00 0.00 ? 47  SER A HB2  7  
ATOM   4789  H  HB3  . SER A 1 47 ? 3.670   8.701   -14.665 1.00 0.00 ? 47  SER A HB3  7  
ATOM   4790  H  HG   . SER A 1 47 ? 3.917   7.514   -16.876 1.00 0.00 ? 47  SER A HG   7  
ATOM   4791  N  N    . SER A 1 48 ? 5.960   5.369   -13.437 1.00 0.00 ? 48  SER A N    7  
ATOM   4792  C  CA   . SER A 1 48 ? 6.557   4.046   -13.587 1.00 0.00 ? 48  SER A CA   7  
ATOM   4793  C  C    . SER A 1 48 ? 5.689   3.156   -14.472 1.00 0.00 ? 48  SER A C    7  
ATOM   4794  O  O    . SER A 1 48 ? 6.188   2.476   -15.367 1.00 0.00 ? 48  SER A O    7  
ATOM   4795  C  CB   . SER A 1 48 ? 6.748   3.392   -12.218 1.00 0.00 ? 48  SER A CB   7  
ATOM   4796  O  OG   . SER A 1 48 ? 5.501   3.158   -11.585 1.00 0.00 ? 48  SER A OG   7  
ATOM   4797  H  H    . SER A 1 48 ? 5.431   5.567   -12.636 1.00 0.00 ? 48  SER A H    7  
ATOM   4798  H  HA   . SER A 1 48 ? 7.522   4.169   -14.056 1.00 0.00 ? 48  SER A HA   7  
ATOM   4799  H  HB2  . SER A 1 48 ? 7.258   2.449   -12.340 1.00 0.00 ? 48  SER A HB2  7  
ATOM   4800  H  HB3  . SER A 1 48 ? 7.340   4.043   -11.590 1.00 0.00 ? 48  SER A HB3  7  
ATOM   4801  H  HG   . SER A 1 48 ? 5.609   2.495   -10.900 1.00 0.00 ? 48  SER A HG   7  
ATOM   4802  N  N    . GLY A 1 49 ? 4.385   3.168   -14.214 1.00 0.00 ? 49  GLY A N    7  
ATOM   4803  C  CA   . GLY A 1 49 ? 3.467   2.358   -14.994 1.00 0.00 ? 49  GLY A CA   7  
ATOM   4804  C  C    . GLY A 1 49 ? 2.258   1.916   -14.194 1.00 0.00 ? 49  GLY A C    7  
ATOM   4805  O  O    . GLY A 1 49 ? 2.429   1.361   -13.110 1.00 0.00 ? 49  GLY A O    7  
ATOM   4806  H  H    . GLY A 1 49 ? 4.042   3.730   -13.488 1.00 0.00 ? 49  GLY A H    7  
ATOM   4807  H  HA2  . GLY A 1 49 ? 3.132   2.932   -15.845 1.00 0.00 ? 49  GLY A HA2  7  
ATOM   4808  H  HA3  . GLY A 1 49 ? 3.990   1.481   -15.348 1.00 0.00 ? 49  GLY A HA3  7  
HETATM 4809  ZN ZN   . ZN  B 2 .  ? 2.793   -4.811  1.891   1.00 0.00 ? 201 ZN  A ZN   7  
ATOM   4810  N  N    . GLY A 1 1  ? -27.934 1.016   4.632   1.00 0.00 ? 1   GLY A N    8  
ATOM   4811  C  CA   . GLY A 1 1  ? -28.622 2.284   4.792   1.00 0.00 ? 1   GLY A CA   8  
ATOM   4812  C  C    . GLY A 1 1  ? -27.713 3.472   4.541   1.00 0.00 ? 1   GLY A C    8  
ATOM   4813  O  O    . GLY A 1 1  ? -28.106 4.434   3.881   1.00 0.00 ? 1   GLY A O    8  
ATOM   4814  H  H1   . GLY A 1 1  ? -27.895 0.590   3.750   1.00 0.00 ? 1   GLY A H1   8  
ATOM   4815  H  HA2  . GLY A 1 1  ? -29.448 2.323   4.097   1.00 0.00 ? 1   GLY A HA2  8  
ATOM   4816  H  HA3  . GLY A 1 1  ? -29.007 2.347   5.799   1.00 0.00 ? 1   GLY A HA3  8  
ATOM   4817  N  N    . SER A 1 2  ? -26.496 3.406   5.070   1.00 0.00 ? 2   SER A N    8  
ATOM   4818  C  CA   . SER A 1 2  ? -25.531 4.486   4.905   1.00 0.00 ? 2   SER A CA   8  
ATOM   4819  C  C    . SER A 1 2  ? -24.149 3.934   4.570   1.00 0.00 ? 2   SER A C    8  
ATOM   4820  O  O    . SER A 1 2  ? -23.797 2.824   4.971   1.00 0.00 ? 2   SER A O    8  
ATOM   4821  C  CB   . SER A 1 2  ? -25.459 5.333   6.177   1.00 0.00 ? 2   SER A CB   8  
ATOM   4822  O  OG   . SER A 1 2  ? -25.014 4.561   7.279   1.00 0.00 ? 2   SER A OG   8  
ATOM   4823  H  H    . SER A 1 2  ? -26.242 2.612   5.587   1.00 0.00 ? 2   SER A H    8  
ATOM   4824  H  HA   . SER A 1 2  ? -25.865 5.107   4.088   1.00 0.00 ? 2   SER A HA   8  
ATOM   4825  H  HB2  . SER A 1 2  ? -24.771 6.150   6.025   1.00 0.00 ? 2   SER A HB2  8  
ATOM   4826  H  HB3  . SER A 1 2  ? -26.440 5.726   6.401   1.00 0.00 ? 2   SER A HB3  8  
ATOM   4827  H  HG   . SER A 1 2  ? -25.767 4.308   7.818   1.00 0.00 ? 2   SER A HG   8  
ATOM   4828  N  N    . SER A 1 3  ? -23.369 4.717   3.831   1.00 0.00 ? 3   SER A N    8  
ATOM   4829  C  CA   . SER A 1 3  ? -22.026 4.306   3.437   1.00 0.00 ? 3   SER A CA   8  
ATOM   4830  C  C    . SER A 1 3  ? -20.984 4.853   4.408   1.00 0.00 ? 3   SER A C    8  
ATOM   4831  O  O    . SER A 1 3  ? -21.033 6.019   4.795   1.00 0.00 ? 3   SER A O    8  
ATOM   4832  C  CB   . SER A 1 3  ? -21.719 4.785   2.017   1.00 0.00 ? 3   SER A CB   8  
ATOM   4833  O  OG   . SER A 1 3  ? -22.207 3.868   1.053   1.00 0.00 ? 3   SER A OG   8  
ATOM   4834  H  H    . SER A 1 3  ? -23.706 5.590   3.541   1.00 0.00 ? 3   SER A H    8  
ATOM   4835  H  HA   . SER A 1 3  ? -21.990 3.227   3.459   1.00 0.00 ? 3   SER A HA   8  
ATOM   4836  H  HB2  . SER A 1 3  ? -22.188 5.744   1.854   1.00 0.00 ? 3   SER A HB2  8  
ATOM   4837  H  HB3  . SER A 1 3  ? -20.650 4.882   1.897   1.00 0.00 ? 3   SER A HB3  8  
ATOM   4838  H  HG   . SER A 1 3  ? -22.926 4.272   0.562   1.00 0.00 ? 3   SER A HG   8  
ATOM   4839  N  N    . GLY A 1 4  ? -20.041 4.000   4.797   1.00 0.00 ? 4   GLY A N    8  
ATOM   4840  C  CA   . GLY A 1 4  ? -19.000 4.415   5.718   1.00 0.00 ? 4   GLY A CA   8  
ATOM   4841  C  C    . GLY A 1 4  ? -17.619 4.361   5.096   1.00 0.00 ? 4   GLY A C    8  
ATOM   4842  O  O    . GLY A 1 4  ? -17.474 4.037   3.917   1.00 0.00 ? 4   GLY A O    8  
ATOM   4843  H  H    . GLY A 1 4  ? -20.053 3.081   4.455   1.00 0.00 ? 4   GLY A H    8  
ATOM   4844  H  HA2  . GLY A 1 4  ? -19.200 5.427   6.038   1.00 0.00 ? 4   GLY A HA2  8  
ATOM   4845  H  HA3  . GLY A 1 4  ? -19.019 3.765   6.581   1.00 0.00 ? 4   GLY A HA3  8  
ATOM   4846  N  N    . SER A 1 5  ? -16.601 4.681   5.889   1.00 0.00 ? 5   SER A N    8  
ATOM   4847  C  CA   . SER A 1 5  ? -15.225 4.672   5.407   1.00 0.00 ? 5   SER A CA   8  
ATOM   4848  C  C    . SER A 1 5  ? -14.667 3.253   5.381   1.00 0.00 ? 5   SER A C    8  
ATOM   4849  O  O    . SER A 1 5  ? -14.832 2.492   6.335   1.00 0.00 ? 5   SER A O    8  
ATOM   4850  C  CB   . SER A 1 5  ? -14.348 5.562   6.290   1.00 0.00 ? 5   SER A CB   8  
ATOM   4851  O  OG   . SER A 1 5  ? -12.996 5.527   5.866   1.00 0.00 ? 5   SER A OG   8  
ATOM   4852  H  H    . SER A 1 5  ? -16.781 4.930   6.820   1.00 0.00 ? 5   SER A H    8  
ATOM   4853  H  HA   . SER A 1 5  ? -15.224 5.066   4.401   1.00 0.00 ? 5   SER A HA   8  
ATOM   4854  H  HB2  . SER A 1 5  ? -14.703 6.579   6.238   1.00 0.00 ? 5   SER A HB2  8  
ATOM   4855  H  HB3  . SER A 1 5  ? -14.401 5.214   7.312   1.00 0.00 ? 5   SER A HB3  8  
ATOM   4856  H  HG   . SER A 1 5  ? -12.886 4.843   5.202   1.00 0.00 ? 5   SER A HG   8  
ATOM   4857  N  N    . SER A 1 6  ? -14.005 2.904   4.282   1.00 0.00 ? 6   SER A N    8  
ATOM   4858  C  CA   . SER A 1 6  ? -13.425 1.574   4.129   1.00 0.00 ? 6   SER A CA   8  
ATOM   4859  C  C    . SER A 1 6  ? -11.940 1.587   4.478   1.00 0.00 ? 6   SER A C    8  
ATOM   4860  O  O    . SER A 1 6  ? -11.357 2.641   4.725   1.00 0.00 ? 6   SER A O    8  
ATOM   4861  C  CB   . SER A 1 6  ? -13.621 1.071   2.698   1.00 0.00 ? 6   SER A CB   8  
ATOM   4862  O  OG   . SER A 1 6  ? -12.790 1.776   1.792   1.00 0.00 ? 6   SER A OG   8  
ATOM   4863  H  H    . SER A 1 6  ? -13.907 3.555   3.556   1.00 0.00 ? 6   SER A H    8  
ATOM   4864  H  HA   . SER A 1 6  ? -13.937 0.909   4.809   1.00 0.00 ? 6   SER A HA   8  
ATOM   4865  H  HB2  . SER A 1 6  ? -13.375 0.022   2.651   1.00 0.00 ? 6   SER A HB2  8  
ATOM   4866  H  HB3  . SER A 1 6  ? -14.652 1.213   2.407   1.00 0.00 ? 6   SER A HB3  8  
ATOM   4867  H  HG   . SER A 1 6  ? -12.560 1.204   1.056   1.00 0.00 ? 6   SER A HG   8  
ATOM   4868  N  N    . GLY A 1 7  ? -11.333 0.404   4.495   1.00 0.00 ? 7   GLY A N    8  
ATOM   4869  C  CA   . GLY A 1 7  ? -9.921  0.299   4.814   1.00 0.00 ? 7   GLY A CA   8  
ATOM   4870  C  C    . GLY A 1 7  ? -9.650  -0.698  5.923   1.00 0.00 ? 7   GLY A C    8  
ATOM   4871  O  O    . GLY A 1 7  ? -9.090  -0.346  6.961   1.00 0.00 ? 7   GLY A O    8  
ATOM   4872  H  H    . GLY A 1 7  ? -11.848 -0.405  4.289   1.00 0.00 ? 7   GLY A H    8  
ATOM   4873  H  HA2  . GLY A 1 7  ? -9.385  -0.008  3.929   1.00 0.00 ? 7   GLY A HA2  8  
ATOM   4874  H  HA3  . GLY A 1 7  ? -9.561  1.269   5.123   1.00 0.00 ? 7   GLY A HA3  8  
ATOM   4875  N  N    . SER A 1 8  ? -10.049 -1.947  5.704   1.00 0.00 ? 8   SER A N    8  
ATOM   4876  C  CA   . SER A 1 8  ? -9.850  -2.998  6.695   1.00 0.00 ? 8   SER A CA   8  
ATOM   4877  C  C    . SER A 1 8  ? -9.055  -4.159  6.105   1.00 0.00 ? 8   SER A C    8  
ATOM   4878  O  O    . SER A 1 8  ? -9.316  -4.599  4.985   1.00 0.00 ? 8   SER A O    8  
ATOM   4879  C  CB   . SER A 1 8  ? -11.199 -3.500  7.214   1.00 0.00 ? 8   SER A CB   8  
ATOM   4880  O  OG   . SER A 1 8  ? -11.025 -4.449  8.252   1.00 0.00 ? 8   SER A OG   8  
ATOM   4881  H  H    . SER A 1 8  ? -10.489 -2.166  4.856   1.00 0.00 ? 8   SER A H    8  
ATOM   4882  H  HA   . SER A 1 8  ? -9.292  -2.576  7.518   1.00 0.00 ? 8   SER A HA   8  
ATOM   4883  H  HB2  . SER A 1 8  ? -11.768 -2.667  7.597   1.00 0.00 ? 8   SER A HB2  8  
ATOM   4884  H  HB3  . SER A 1 8  ? -11.742 -3.966  6.404   1.00 0.00 ? 8   SER A HB3  8  
ATOM   4885  H  HG   . SER A 1 8  ? -10.307 -4.169  8.825   1.00 0.00 ? 8   SER A HG   8  
ATOM   4886  N  N    . LEU A 1 9  ? -8.085  -4.650  6.867   1.00 0.00 ? 9   LEU A N    8  
ATOM   4887  C  CA   . LEU A 1 9  ? -7.250  -5.761  6.421   1.00 0.00 ? 9   LEU A CA   8  
ATOM   4888  C  C    . LEU A 1 9  ? -8.106  -6.946  5.987   1.00 0.00 ? 9   LEU A C    8  
ATOM   4889  O  O    . LEU A 1 9  ? -8.902  -7.468  6.768   1.00 0.00 ? 9   LEU A O    8  
ATOM   4890  C  CB   . LEU A 1 9  ? -6.296  -6.188  7.538   1.00 0.00 ? 9   LEU A CB   8  
ATOM   4891  C  CG   . LEU A 1 9  ? -5.354  -5.106  8.068   1.00 0.00 ? 9   LEU A CG   8  
ATOM   4892  C  CD1  . LEU A 1 9  ? -4.696  -5.558  9.362   1.00 0.00 ? 9   LEU A CD1  8  
ATOM   4893  C  CD2  . LEU A 1 9  ? -4.302  -4.758  7.025   1.00 0.00 ? 9   LEU A CD2  8  
ATOM   4894  H  H    . LEU A 1 9  ? -7.925  -4.258  7.751   1.00 0.00 ? 9   LEU A H    8  
ATOM   4895  H  HA   . LEU A 1 9  ? -6.671  -5.421  5.575   1.00 0.00 ? 9   LEU A HA   8  
ATOM   4896  H  HB2  . LEU A 1 9  ? -6.893  -6.540  8.366   1.00 0.00 ? 9   LEU A HB2  8  
ATOM   4897  H  HB3  . LEU A 1 9  ? -5.690  -7.000  7.162   1.00 0.00 ? 9   LEU A HB3  8  
ATOM   4898  H  HG   . LEU A 1 9  ? -5.926  -4.212  8.279   1.00 0.00 ? 9   LEU A HG   8  
ATOM   4899  H  HD11 . LEU A 1 9  ? -4.367  -6.581  9.260   1.00 0.00 ? 9   LEU A HD11 8  
ATOM   4900  H  HD12 . LEU A 1 9  ? -5.407  -5.487  10.171  1.00 0.00 ? 9   LEU A HD12 8  
ATOM   4901  H  HD13 . LEU A 1 9  ? -3.846  -4.925  9.573   1.00 0.00 ? 9   LEU A HD13 8  
ATOM   4902  H  HD21 . LEU A 1 9  ? -3.324  -4.779  7.480   1.00 0.00 ? 9   LEU A HD21 8  
ATOM   4903  H  HD22 . LEU A 1 9  ? -4.497  -3.770  6.634   1.00 0.00 ? 9   LEU A HD22 8  
ATOM   4904  H  HD23 . LEU A 1 9  ? -4.342  -5.477  6.220   1.00 0.00 ? 9   LEU A HD23 8  
ATOM   4905  N  N    . MET A 1 10 ? -7.936  -7.366  4.738   1.00 0.00 ? 10  MET A N    8  
ATOM   4906  C  CA   . MET A 1 10 ? -8.692  -8.492  4.201   1.00 0.00 ? 10  MET A CA   8  
ATOM   4907  C  C    . MET A 1 10 ? -7.950  -9.805  4.435   1.00 0.00 ? 10  MET A C    8  
ATOM   4908  O  O    . MET A 1 10 ? -6.842  -9.815  4.971   1.00 0.00 ? 10  MET A O    8  
ATOM   4909  C  CB   . MET A 1 10 ? -8.947  -8.296  2.706   1.00 0.00 ? 10  MET A CB   8  
ATOM   4910  C  CG   . MET A 1 10 ? -9.932  -7.181  2.398   1.00 0.00 ? 10  MET A CG   8  
ATOM   4911  S  SD   . MET A 1 10 ? -11.640 -7.755  2.354   1.00 0.00 ? 10  MET A SD   8  
ATOM   4912  C  CE   . MET A 1 10 ? -11.785 -8.256  0.640   1.00 0.00 ? 10  MET A CE   8  
ATOM   4913  H  H    . MET A 1 10 ? -7.287  -6.909  4.163   1.00 0.00 ? 10  MET A H    8  
ATOM   4914  H  HA   . MET A 1 10 ? -9.639  -8.531  4.717   1.00 0.00 ? 10  MET A HA   8  
ATOM   4915  H  HB2  . MET A 1 10 ? -8.010  -8.065  2.220   1.00 0.00 ? 10  MET A HB2  8  
ATOM   4916  H  HB3  . MET A 1 10 ? -9.338  -9.215  2.295   1.00 0.00 ? 10  MET A HB3  8  
ATOM   4917  H  HG2  . MET A 1 10 ? -9.843  -6.419  3.159   1.00 0.00 ? 10  MET A HG2  8  
ATOM   4918  H  HG3  . MET A 1 10 ? -9.684  -6.756  1.436   1.00 0.00 ? 10  MET A HG3  8  
ATOM   4919  H  HE1  . MET A 1 10 ? -11.161 -9.119  0.464   1.00 0.00 ? 10  MET A HE1  8  
ATOM   4920  H  HE2  . MET A 1 10 ? -12.814 -8.505  0.424   1.00 0.00 ? 10  MET A HE2  8  
ATOM   4921  H  HE3  . MET A 1 10 ? -11.469 -7.445  0.001   1.00 0.00 ? 10  MET A HE3  8  
ATOM   4922  N  N    . ASP A 1 11 ? -8.569  -10.908 4.031   1.00 0.00 ? 11  ASP A N    8  
ATOM   4923  C  CA   . ASP A 1 11 ? -7.968  -12.226 4.196   1.00 0.00 ? 11  ASP A CA   8  
ATOM   4924  C  C    . ASP A 1 11 ? -6.968  -12.511 3.079   1.00 0.00 ? 11  ASP A C    8  
ATOM   4925  O  O    . ASP A 1 11 ? -6.538  -13.649 2.892   1.00 0.00 ? 11  ASP A O    8  
ATOM   4926  C  CB   . ASP A 1 11 ? -9.051  -13.306 4.215   1.00 0.00 ? 11  ASP A CB   8  
ATOM   4927  C  CG   . ASP A 1 11 ? -8.632  -14.532 5.004   1.00 0.00 ? 11  ASP A CG   8  
ATOM   4928  O  OD1  . ASP A 1 11 ? -7.472  -14.967 4.852   1.00 0.00 ? 11  ASP A OD1  8  
ATOM   4929  O  OD2  . ASP A 1 11 ? -9.466  -15.056 5.772   1.00 0.00 ? 11  ASP A OD2  8  
ATOM   4930  H  H    . ASP A 1 11 ? -9.452  -10.835 3.610   1.00 0.00 ? 11  ASP A H    8  
ATOM   4931  H  HA   . ASP A 1 11 ? -7.445  -12.237 5.141   1.00 0.00 ? 11  ASP A HA   8  
ATOM   4932  H  HB2  . ASP A 1 11 ? -9.946  -12.901 4.664   1.00 0.00 ? 11  ASP A HB2  8  
ATOM   4933  H  HB3  . ASP A 1 11 ? -9.266  -13.609 3.201   1.00 0.00 ? 11  ASP A HB3  8  
ATOM   4934  N  N    . VAL A 1 12 ? -6.602  -11.469 2.339   1.00 0.00 ? 12  VAL A N    8  
ATOM   4935  C  CA   . VAL A 1 12 ? -5.653  -11.607 1.241   1.00 0.00 ? 12  VAL A CA   8  
ATOM   4936  C  C    . VAL A 1 12 ? -4.319  -10.955 1.583   1.00 0.00 ? 12  VAL A C    8  
ATOM   4937  O  O    . VAL A 1 12 ? -4.268  -9.793  1.987   1.00 0.00 ? 12  VAL A O    8  
ATOM   4938  C  CB   . VAL A 1 12 ? -6.201  -10.981 -0.056  1.00 0.00 ? 12  VAL A CB   8  
ATOM   4939  C  CG1  . VAL A 1 12 ? -6.484  -9.500  0.144   1.00 0.00 ? 12  VAL A CG1  8  
ATOM   4940  C  CG2  . VAL A 1 12 ? -5.226  -11.196 -1.203  1.00 0.00 ? 12  VAL A CG2  8  
ATOM   4941  H  H    . VAL A 1 12 ? -6.979  -10.587 2.537   1.00 0.00 ? 12  VAL A H    8  
ATOM   4942  H  HA   . VAL A 1 12 ? -5.494  -12.661 1.067   1.00 0.00 ? 12  VAL A HA   8  
ATOM   4943  H  HB   . VAL A 1 12 ? -7.130  -11.472 -0.304  1.00 0.00 ? 12  VAL A HB   8  
ATOM   4944  H  HG11 . VAL A 1 12 ? -5.691  -8.919  -0.303  1.00 0.00 ? 12  VAL A HG11 8  
ATOM   4945  H  HG12 . VAL A 1 12 ? -7.425  -9.247  -0.322  1.00 0.00 ? 12  VAL A HG12 8  
ATOM   4946  H  HG13 . VAL A 1 12 ? -6.536  -9.283  1.201   1.00 0.00 ? 12  VAL A HG13 8  
ATOM   4947  H  HG21 . VAL A 1 12 ? -4.435  -11.859 -0.885  1.00 0.00 ? 12  VAL A HG21 8  
ATOM   4948  H  HG22 . VAL A 1 12 ? -5.748  -11.633 -2.041  1.00 0.00 ? 12  VAL A HG22 8  
ATOM   4949  H  HG23 . VAL A 1 12 ? -4.802  -10.247 -1.499  1.00 0.00 ? 12  VAL A HG23 8  
ATOM   4950  N  N    . LYS A 1 13 ? -3.238  -11.710 1.418   1.00 0.00 ? 13  LYS A N    8  
ATOM   4951  C  CA   . LYS A 1 13 ? -1.900  -11.207 1.707   1.00 0.00 ? 13  LYS A CA   8  
ATOM   4952  C  C    . LYS A 1 13 ? -1.552  -10.034 0.796   1.00 0.00 ? 13  LYS A C    8  
ATOM   4953  O  O    . LYS A 1 13 ? -2.071  -9.922  -0.315  1.00 0.00 ? 13  LYS A O    8  
ATOM   4954  C  CB   . LYS A 1 13 ? -0.866  -12.322 1.539   1.00 0.00 ? 13  LYS A CB   8  
ATOM   4955  C  CG   . LYS A 1 13 ? -0.776  -13.254 2.735   1.00 0.00 ? 13  LYS A CG   8  
ATOM   4956  C  CD   . LYS A 1 13 ? -1.881  -14.296 2.714   1.00 0.00 ? 13  LYS A CD   8  
ATOM   4957  C  CE   . LYS A 1 13 ? -1.627  -15.356 1.652   1.00 0.00 ? 13  LYS A CE   8  
ATOM   4958  N  NZ   . LYS A 1 13 ? -2.527  -16.531 1.815   1.00 0.00 ? 13  LYS A NZ   8  
ATOM   4959  H  H    . LYS A 1 13 ? -3.343  -12.629 1.093   1.00 0.00 ? 13  LYS A H    8  
ATOM   4960  H  HA   . LYS A 1 13 ? -1.888  -10.867 2.732   1.00 0.00 ? 13  LYS A HA   8  
ATOM   4961  H  HB2  . LYS A 1 13 ? -1.125  -12.909 0.670   1.00 0.00 ? 13  LYS A HB2  8  
ATOM   4962  H  HB3  . LYS A 1 13 ? 0.105   -11.874 1.384   1.00 0.00 ? 13  LYS A HB3  8  
ATOM   4963  H  HG2  . LYS A 1 13 ? 0.179   -13.757 2.717   1.00 0.00 ? 13  LYS A HG2  8  
ATOM   4964  H  HG3  . LYS A 1 13 ? -0.861  -12.671 3.641   1.00 0.00 ? 13  LYS A HG3  8  
ATOM   4965  H  HD2  . LYS A 1 13 ? -1.931  -14.776 3.680   1.00 0.00 ? 13  LYS A HD2  8  
ATOM   4966  H  HD3  . LYS A 1 13 ? -2.822  -13.807 2.504   1.00 0.00 ? 13  LYS A HD3  8  
ATOM   4967  H  HE2  . LYS A 1 13 ? -1.792  -14.919 0.679   1.00 0.00 ? 13  LYS A HE2  8  
ATOM   4968  H  HE3  . LYS A 1 13 ? -0.601  -15.685 1.730   1.00 0.00 ? 13  LYS A HE3  8  
ATOM   4969  H  HZ1  . LYS A 1 13 ? -3.095  -16.429 2.680   1.00 0.00 ? 13  LYS A HZ1  8  
ATOM   4970  H  HZ2  . LYS A 1 13 ? -1.966  -17.404 1.882   1.00 0.00 ? 13  LYS A HZ2  8  
ATOM   4971  H  HZ3  . LYS A 1 13 ? -3.168  -16.606 0.999   1.00 0.00 ? 13  LYS A HZ3  8  
ATOM   4972  N  N    . CYS A 1 14 ? -0.669  -9.162  1.273   1.00 0.00 ? 14  CYS A N    8  
ATOM   4973  C  CA   . CYS A 1 14 ? -0.250  -7.999  0.502   1.00 0.00 ? 14  CYS A CA   8  
ATOM   4974  C  C    . CYS A 1 14 ? 0.236   -8.411  -0.885  1.00 0.00 ? 14  CYS A C    8  
ATOM   4975  O  O    . CYS A 1 14 ? 0.863   -9.457  -1.048  1.00 0.00 ? 14  CYS A O    8  
ATOM   4976  C  CB   . CYS A 1 14 ? 0.858   -7.244  1.239   1.00 0.00 ? 14  CYS A CB   8  
ATOM   4977  S  SG   . CYS A 1 14 ? 1.619   -5.904  0.267   1.00 0.00 ? 14  CYS A SG   8  
ATOM   4978  H  H    . CYS A 1 14 ? -0.290  -9.306  2.166   1.00 0.00 ? 14  CYS A H    8  
ATOM   4979  H  HA   . CYS A 1 14 ? -1.104  -7.348  0.391   1.00 0.00 ? 14  CYS A HA   8  
ATOM   4980  H  HB2  . CYS A 1 14 ? 0.449   -6.806  2.137   1.00 0.00 ? 14  CYS A HB2  8  
ATOM   4981  H  HB3  . CYS A 1 14 ? 1.640   -7.940  1.508   1.00 0.00 ? 14  CYS A HB3  8  
ATOM   4982  N  N    . GLU A 1 15 ? -0.059  -7.581  -1.881  1.00 0.00 ? 15  GLU A N    8  
ATOM   4983  C  CA   . GLU A 1 15 ? 0.347   -7.860  -3.253  1.00 0.00 ? 15  GLU A CA   8  
ATOM   4984  C  C    . GLU A 1 15 ? 1.713   -8.539  -3.288  1.00 0.00 ? 15  GLU A C    8  
ATOM   4985  O  O    . GLU A 1 15 ? 1.851   -9.658  -3.785  1.00 0.00 ? 15  GLU A O    8  
ATOM   4986  C  CB   . GLU A 1 15 ? 0.387   -6.566  -4.069  1.00 0.00 ? 15  GLU A CB   8  
ATOM   4987  C  CG   . GLU A 1 15 ? 0.753   -6.779  -5.529  1.00 0.00 ? 15  GLU A CG   8  
ATOM   4988  C  CD   . GLU A 1 15 ? 0.329   -5.621  -6.411  1.00 0.00 ? 15  GLU A CD   8  
ATOM   4989  O  OE1  . GLU A 1 15 ? 0.590   -4.460  -6.032  1.00 0.00 ? 15  GLU A OE1  8  
ATOM   4990  O  OE2  . GLU A 1 15 ? -0.263  -5.876  -7.481  1.00 0.00 ? 15  GLU A OE2  8  
ATOM   4991  H  H    . GLU A 1 15 ? -0.562  -6.762  -1.688  1.00 0.00 ? 15  GLU A H    8  
ATOM   4992  H  HA   . GLU A 1 15 ? -0.384  -8.525  -3.686  1.00 0.00 ? 15  GLU A HA   8  
ATOM   4993  H  HB2  . GLU A 1 15 ? -0.585  -6.098  -4.027  1.00 0.00 ? 15  GLU A HB2  8  
ATOM   4994  H  HB3  . GLU A 1 15 ? 1.117   -5.901  -3.631  1.00 0.00 ? 15  GLU A HB3  8  
ATOM   4995  H  HG2  . GLU A 1 15 ? 1.823   -6.897  -5.605  1.00 0.00 ? 15  GLU A HG2  8  
ATOM   4996  H  HG3  . GLU A 1 15 ? 0.267   -7.677  -5.881  1.00 0.00 ? 15  GLU A HG3  8  
ATOM   4997  N  N    . THR A 1 16 ? 2.722   -7.855  -2.758  1.00 0.00 ? 16  THR A N    8  
ATOM   4998  C  CA   . THR A 1 16 ? 4.077   -8.390  -2.730  1.00 0.00 ? 16  THR A CA   8  
ATOM   4999  C  C    . THR A 1 16 ? 4.122   -9.738  -2.019  1.00 0.00 ? 16  THR A C    8  
ATOM   5000  O  O    . THR A 1 16 ? 3.711   -9.872  -0.866  1.00 0.00 ? 16  THR A O    8  
ATOM   5001  C  CB   . THR A 1 16 ? 5.050   -7.421  -2.032  1.00 0.00 ? 16  THR A CB   8  
ATOM   5002  O  OG1  . THR A 1 16 ? 5.097   -6.178  -2.741  1.00 0.00 ? 16  THR A OG1  8  
ATOM   5003  C  CG2  . THR A 1 16 ? 6.446   -8.019  -1.953  1.00 0.00 ? 16  THR A CG2  8  
ATOM   5004  H  H    . THR A 1 16 ? 2.549   -6.968  -2.378  1.00 0.00 ? 16  THR A H    8  
ATOM   5005  H  HA   . THR A 1 16 ? 4.405   -8.522  -3.752  1.00 0.00 ? 16  THR A HA   8  
ATOM   5006  H  HB   . THR A 1 16 ? 4.694   -7.240  -1.027  1.00 0.00 ? 16  THR A HB   8  
ATOM   5007  H  HG1  . THR A 1 16 ? 4.657   -5.498  -2.225  1.00 0.00 ? 16  THR A HG1  8  
ATOM   5008  H  HG21 . THR A 1 16 ? 7.167   -7.296  -2.303  1.00 0.00 ? 16  THR A HG21 8  
ATOM   5009  H  HG22 . THR A 1 16 ? 6.494   -8.904  -2.570  1.00 0.00 ? 16  THR A HG22 8  
ATOM   5010  H  HG23 . THR A 1 16 ? 6.668   -8.282  -0.929  1.00 0.00 ? 16  THR A HG23 8  
ATOM   5011  N  N    . PRO A 1 17 ? 4.633   -10.761 -2.720  1.00 0.00 ? 17  PRO A N    8  
ATOM   5012  C  CA   . PRO A 1 17 ? 4.744   -12.117 -2.173  1.00 0.00 ? 17  PRO A CA   8  
ATOM   5013  C  C    . PRO A 1 17 ? 5.798   -12.214 -1.075  1.00 0.00 ? 17  PRO A C    8  
ATOM   5014  O  O    . PRO A 1 17 ? 6.036   -13.288 -0.524  1.00 0.00 ? 17  PRO A O    8  
ATOM   5015  C  CB   . PRO A 1 17 ? 5.157   -12.955 -3.386  1.00 0.00 ? 17  PRO A CB   8  
ATOM   5016  C  CG   . PRO A 1 17 ? 5.835   -11.992 -4.299  1.00 0.00 ? 17  PRO A CG   8  
ATOM   5017  C  CD   . PRO A 1 17 ? 5.142   -10.673 -4.098  1.00 0.00 ? 17  PRO A CD   8  
ATOM   5018  H  HA   . PRO A 1 17 ? 3.797   -12.471 -1.794  1.00 0.00 ? 17  PRO A HA   8  
ATOM   5019  H  HB2  . PRO A 1 17 ? 5.828   -13.742 -3.071  1.00 0.00 ? 17  PRO A HB2  8  
ATOM   5020  H  HB3  . PRO A 1 17 ? 4.280   -13.384 -3.847  1.00 0.00 ? 17  PRO A HB3  8  
ATOM   5021  H  HG2  . PRO A 1 17 ? 6.879   -11.911 -4.037  1.00 0.00 ? 17  PRO A HG2  8  
ATOM   5022  H  HG3  . PRO A 1 17 ? 5.728   -12.320 -5.322  1.00 0.00 ? 17  PRO A HG3  8  
ATOM   5023  H  HD2  . PRO A 1 17 ? 5.844   -9.859  -4.199  1.00 0.00 ? 17  PRO A HD2  8  
ATOM   5024  H  HD3  . PRO A 1 17 ? 4.330   -10.563 -4.802  1.00 0.00 ? 17  PRO A HD3  8  
ATOM   5025  N  N    . ASN A 1 18 ? 6.425   -11.086 -0.761  1.00 0.00 ? 18  ASN A N    8  
ATOM   5026  C  CA   . ASN A 1 18 ? 7.454   -11.045 0.272   1.00 0.00 ? 18  ASN A CA   8  
ATOM   5027  C  C    . ASN A 1 18 ? 6.943   -10.330 1.520   1.00 0.00 ? 18  ASN A C    8  
ATOM   5028  O  O    . ASN A 1 18 ? 7.431   -10.564 2.626   1.00 0.00 ? 18  ASN A O    8  
ATOM   5029  C  CB   . ASN A 1 18 ? 8.707   -10.343 -0.255  1.00 0.00 ? 18  ASN A CB   8  
ATOM   5030  C  CG   . ASN A 1 18 ? 9.800   -10.248 0.793   1.00 0.00 ? 18  ASN A CG   8  
ATOM   5031  O  OD1  . ASN A 1 18 ? 9.934   -11.124 1.647   1.00 0.00 ? 18  ASN A OD1  8  
ATOM   5032  N  ND2  . ASN A 1 18 ? 10.586  -9.179  0.732   1.00 0.00 ? 18  ASN A ND2  8  
ATOM   5033  H  H    . ASN A 1 18 ? 6.192   -10.261 -1.236  1.00 0.00 ? 18  ASN A H    8  
ATOM   5034  H  HA   . ASN A 1 18 ? 7.704   -12.062 0.531   1.00 0.00 ? 18  ASN A HA   8  
ATOM   5035  H  HB2  . ASN A 1 18 ? 9.093   -10.895 -1.099  1.00 0.00 ? 18  ASN A HB2  8  
ATOM   5036  H  HB3  . ASN A 1 18 ? 8.448   -9.344  -0.570  1.00 0.00 ? 18  ASN A HB3  8  
ATOM   5037  H  HD21 . ASN A 1 18 ? 10.420  -8.521  0.025   1.00 0.00 ? 18  ASN A HD21 8  
ATOM   5038  H  HD22 . ASN A 1 18 ? 11.301  -9.093  1.397   1.00 0.00 ? 18  ASN A HD22 8  
ATOM   5039  N  N    . CYS A 1 19 ? 5.958   -9.458  1.334   1.00 0.00 ? 19  CYS A N    8  
ATOM   5040  C  CA   . CYS A 1 19 ? 5.380   -8.709  2.443   1.00 0.00 ? 19  CYS A CA   8  
ATOM   5041  C  C    . CYS A 1 19 ? 4.515   -9.612  3.318   1.00 0.00 ? 19  CYS A C    8  
ATOM   5042  O  O    . CYS A 1 19 ? 3.459   -10.092 2.905   1.00 0.00 ? 19  CYS A O    8  
ATOM   5043  C  CB   . CYS A 1 19 ? 4.545   -7.540  1.916   1.00 0.00 ? 19  CYS A CB   8  
ATOM   5044  S  SG   . CYS A 1 19 ? 4.074   -6.328  3.192   1.00 0.00 ? 19  CYS A SG   8  
ATOM   5045  H  H    . CYS A 1 19 ? 5.610   -9.315  0.428   1.00 0.00 ? 19  CYS A H    8  
ATOM   5046  H  HA   . CYS A 1 19 ? 6.191   -8.320  3.039   1.00 0.00 ? 19  CYS A HA   8  
ATOM   5047  H  HB2  . CYS A 1 19 ? 5.111   -7.016  1.159   1.00 0.00 ? 19  CYS A HB2  8  
ATOM   5048  H  HB3  . CYS A 1 19 ? 3.637   -7.925  1.476   1.00 0.00 ? 19  CYS A HB3  8  
ATOM   5049  N  N    . PRO A 1 20 ? 4.973   -9.850  4.556   1.00 0.00 ? 20  PRO A N    8  
ATOM   5050  C  CA   . PRO A 1 20 ? 4.257   -10.695 5.516   1.00 0.00 ? 20  PRO A CA   8  
ATOM   5051  C  C    . PRO A 1 20 ? 2.968   -10.048 6.010   1.00 0.00 ? 20  PRO A C    8  
ATOM   5052  O  O    . PRO A 1 20 ? 2.252   -10.617 6.834   1.00 0.00 ? 20  PRO A O    8  
ATOM   5053  C  CB   . PRO A 1 20 ? 5.254   -10.849 6.667   1.00 0.00 ? 20  PRO A CB   8  
ATOM   5054  C  CG   . PRO A 1 20 ? 6.123   -9.642  6.578   1.00 0.00 ? 20  PRO A CG   8  
ATOM   5055  C  CD   . PRO A 1 20 ? 6.224   -9.311  5.115   1.00 0.00 ? 20  PRO A CD   8  
ATOM   5056  H  HA   . PRO A 1 20 ? 4.033   -11.667 5.099   1.00 0.00 ? 20  PRO A HA   8  
ATOM   5057  H  HB2  . PRO A 1 20 ? 4.720   -10.884 7.606   1.00 0.00 ? 20  PRO A HB2  8  
ATOM   5058  H  HB3  . PRO A 1 20 ? 5.824   -11.756 6.535   1.00 0.00 ? 20  PRO A HB3  8  
ATOM   5059  H  HG2  . PRO A 1 20 ? 5.671   -8.824  7.118   1.00 0.00 ? 20  PRO A HG2  8  
ATOM   5060  H  HG3  . PRO A 1 20 ? 7.100   -9.864  6.980   1.00 0.00 ? 20  PRO A HG3  8  
ATOM   5061  H  HD2  . PRO A 1 20 ? 6.281   -8.242  4.973   1.00 0.00 ? 20  PRO A HD2  8  
ATOM   5062  H  HD3  . PRO A 1 20 ? 7.082   -9.797  4.676   1.00 0.00 ? 20  PRO A HD3  8  
ATOM   5063  N  N    . PHE A 1 21 ? 2.677   -8.855  5.502   1.00 0.00 ? 21  PHE A N    8  
ATOM   5064  C  CA   . PHE A 1 21 ? 1.474   -8.129  5.892   1.00 0.00 ? 21  PHE A CA   8  
ATOM   5065  C  C    . PHE A 1 21 ? 0.392   -8.256  4.824   1.00 0.00 ? 21  PHE A C    8  
ATOM   5066  O  O    . PHE A 1 21 ? 0.687   -8.452  3.645   1.00 0.00 ? 21  PHE A O    8  
ATOM   5067  C  CB   . PHE A 1 21 ? 1.799   -6.653  6.133   1.00 0.00 ? 21  PHE A CB   8  
ATOM   5068  C  CG   . PHE A 1 21 ? 2.693   -6.422  7.317   1.00 0.00 ? 21  PHE A CG   8  
ATOM   5069  C  CD1  . PHE A 1 21 ? 2.204   -6.549  8.607   1.00 0.00 ? 21  PHE A CD1  8  
ATOM   5070  C  CD2  . PHE A 1 21 ? 4.023   -6.077  7.140   1.00 0.00 ? 21  PHE A CD2  8  
ATOM   5071  C  CE1  . PHE A 1 21 ? 3.024   -6.336  9.699   1.00 0.00 ? 21  PHE A CE1  8  
ATOM   5072  C  CE2  . PHE A 1 21 ? 4.848   -5.864  8.228   1.00 0.00 ? 21  PHE A CE2  8  
ATOM   5073  C  CZ   . PHE A 1 21 ? 4.348   -5.992  9.509   1.00 0.00 ? 21  PHE A CZ   8  
ATOM   5074  H  H    . PHE A 1 21 ? 3.288   -8.452  4.848   1.00 0.00 ? 21  PHE A H    8  
ATOM   5075  H  HA   . PHE A 1 21 ? 1.110   -8.563  6.810   1.00 0.00 ? 21  PHE A HA   8  
ATOM   5076  H  HB2  . PHE A 1 21 ? 2.294   -6.254  5.261   1.00 0.00 ? 21  PHE A HB2  8  
ATOM   5077  H  HB3  . PHE A 1 21 ? 0.879   -6.113  6.299   1.00 0.00 ? 21  PHE A HB3  8  
ATOM   5078  H  HD1  . PHE A 1 21 ? 1.167   -6.817  8.757   1.00 0.00 ? 21  PHE A HD1  8  
ATOM   5079  H  HD2  . PHE A 1 21 ? 4.416   -5.974  6.139   1.00 0.00 ? 21  PHE A HD2  8  
ATOM   5080  H  HE1  . PHE A 1 21 ? 2.629   -6.438  10.699  1.00 0.00 ? 21  PHE A HE1  8  
ATOM   5081  H  HE2  . PHE A 1 21 ? 5.883   -5.595  8.077   1.00 0.00 ? 21  PHE A HE2  8  
ATOM   5082  H  HZ   . PHE A 1 21 ? 4.991   -5.827  10.361  1.00 0.00 ? 21  PHE A HZ   8  
ATOM   5083  N  N    . PHE A 1 22 ? -0.863  -8.143  5.246   1.00 0.00 ? 22  PHE A N    8  
ATOM   5084  C  CA   . PHE A 1 22 ? -1.991  -8.247  4.327   1.00 0.00 ? 22  PHE A CA   8  
ATOM   5085  C  C    . PHE A 1 22 ? -2.350  -6.880  3.751   1.00 0.00 ? 22  PHE A C    8  
ATOM   5086  O  O    . PHE A 1 22 ? -1.979  -5.845  4.303   1.00 0.00 ? 22  PHE A O    8  
ATOM   5087  C  CB   . PHE A 1 22 ? -3.204  -8.846  5.041   1.00 0.00 ? 22  PHE A CB   8  
ATOM   5088  C  CG   . PHE A 1 22 ? -2.964  -10.230 5.574   1.00 0.00 ? 22  PHE A CG   8  
ATOM   5089  C  CD1  . PHE A 1 22 ? -2.384  -10.416 6.819   1.00 0.00 ? 22  PHE A CD1  8  
ATOM   5090  C  CD2  . PHE A 1 22 ? -3.317  -11.344 4.830   1.00 0.00 ? 22  PHE A CD2  8  
ATOM   5091  C  CE1  . PHE A 1 22 ? -2.161  -11.688 7.312   1.00 0.00 ? 22  PHE A CE1  8  
ATOM   5092  C  CE2  . PHE A 1 22 ? -3.097  -12.618 5.319   1.00 0.00 ? 22  PHE A CE2  8  
ATOM   5093  C  CZ   . PHE A 1 22 ? -2.517  -12.790 6.561   1.00 0.00 ? 22  PHE A CZ   8  
ATOM   5094  H  H    . PHE A 1 22 ? -1.035  -7.988  6.199   1.00 0.00 ? 22  PHE A H    8  
ATOM   5095  H  HA   . PHE A 1 22 ? -1.700  -8.900  3.519   1.00 0.00 ? 22  PHE A HA   8  
ATOM   5096  H  HB2  . PHE A 1 22 ? -3.473  -8.213  5.873   1.00 0.00 ? 22  PHE A HB2  8  
ATOM   5097  H  HB3  . PHE A 1 22 ? -4.032  -8.895  4.349   1.00 0.00 ? 22  PHE A HB3  8  
ATOM   5098  H  HD1  . PHE A 1 22 ? -2.104  -9.553  7.407   1.00 0.00 ? 22  PHE A HD1  8  
ATOM   5099  H  HD2  . PHE A 1 22 ? -3.769  -11.211 3.859   1.00 0.00 ? 22  PHE A HD2  8  
ATOM   5100  H  HE1  . PHE A 1 22 ? -1.707  -11.818 8.283   1.00 0.00 ? 22  PHE A HE1  8  
ATOM   5101  H  HE2  . PHE A 1 22 ? -3.376  -13.479 4.729   1.00 0.00 ? 22  PHE A HE2  8  
ATOM   5102  H  HZ   . PHE A 1 22 ? -2.345  -13.784 6.945   1.00 0.00 ? 22  PHE A HZ   8  
ATOM   5103  N  N    . MET A 1 23 ? -3.073  -6.887  2.636   1.00 0.00 ? 23  MET A N    8  
ATOM   5104  C  CA   . MET A 1 23 ? -3.483  -5.648  1.984   1.00 0.00 ? 23  MET A CA   8  
ATOM   5105  C  C    . MET A 1 23 ? -4.874  -5.226  2.444   1.00 0.00 ? 23  MET A C    8  
ATOM   5106  O  O    . MET A 1 23 ? -5.816  -6.019  2.412   1.00 0.00 ? 23  MET A O    8  
ATOM   5107  C  CB   . MET A 1 23 ? -3.464  -5.817  0.463   1.00 0.00 ? 23  MET A CB   8  
ATOM   5108  C  CG   . MET A 1 23 ? -4.178  -7.070  -0.018  1.00 0.00 ? 23  MET A CG   8  
ATOM   5109  S  SD   . MET A 1 23 ? -4.816  -6.905  -1.696  1.00 0.00 ? 23  MET A SD   8  
ATOM   5110  C  CE   . MET A 1 23 ? -3.887  -8.183  -2.539  1.00 0.00 ? 23  MET A CE   8  
ATOM   5111  H  H    . MET A 1 23 ? -3.339  -7.744  2.242   1.00 0.00 ? 23  MET A H    8  
ATOM   5112  H  HA   . MET A 1 23 ? -2.776  -4.880  2.260   1.00 0.00 ? 23  MET A HA   8  
ATOM   5113  H  HB2  . MET A 1 23 ? -3.943  -4.961  0.012   1.00 0.00 ? 23  MET A HB2  8  
ATOM   5114  H  HB3  . MET A 1 23 ? -2.439  -5.864  0.130   1.00 0.00 ? 23  MET A HB3  8  
ATOM   5115  H  HG2  . MET A 1 23 ? -3.484  -7.897  0.008   1.00 0.00 ? 23  MET A HG2  8  
ATOM   5116  H  HG3  . MET A 1 23 ? -5.004  -7.275  0.648   1.00 0.00 ? 23  MET A HG3  8  
ATOM   5117  H  HE1  . MET A 1 23 ? -4.566  -8.822  -3.084  1.00 0.00 ? 23  MET A HE1  8  
ATOM   5118  H  HE2  . MET A 1 23 ? -3.190  -7.728  -3.227  1.00 0.00 ? 23  MET A HE2  8  
ATOM   5119  H  HE3  . MET A 1 23 ? -3.344  -8.771  -1.813  1.00 0.00 ? 23  MET A HE3  8  
ATOM   5120  N  N    . SER A 1 24 ? -4.997  -3.974  2.872   1.00 0.00 ? 24  SER A N    8  
ATOM   5121  C  CA   . SER A 1 24 ? -6.273  -3.448  3.342   1.00 0.00 ? 24  SER A CA   8  
ATOM   5122  C  C    . SER A 1 24 ? -7.229  -3.218  2.176   1.00 0.00 ? 24  SER A C    8  
ATOM   5123  O  O    . SER A 1 24 ? -6.865  -3.402  1.014   1.00 0.00 ? 24  SER A O    8  
ATOM   5124  C  CB   . SER A 1 24 ? -6.059  -2.141  4.107   1.00 0.00 ? 24  SER A CB   8  
ATOM   5125  O  OG   . SER A 1 24 ? -7.048  -1.968  5.108   1.00 0.00 ? 24  SER A OG   8  
ATOM   5126  H  H    . SER A 1 24 ? -4.209  -3.390  2.873   1.00 0.00 ? 24  SER A H    8  
ATOM   5127  H  HA   . SER A 1 24 ? -6.707  -4.179  4.009   1.00 0.00 ? 24  SER A HA   8  
ATOM   5128  H  HB2  . SER A 1 24 ? -5.088  -2.156  4.577   1.00 0.00 ? 24  SER A HB2  8  
ATOM   5129  H  HB3  . SER A 1 24 ? -6.113  -1.311  3.418   1.00 0.00 ? 24  SER A HB3  8  
ATOM   5130  H  HG   . SER A 1 24 ? -7.534  -1.158  4.942   1.00 0.00 ? 24  SER A HG   8  
ATOM   5131  N  N    . VAL A 1 25 ? -8.454  -2.813  2.494   1.00 0.00 ? 25  VAL A N    8  
ATOM   5132  C  CA   . VAL A 1 25 ? -9.464  -2.555  1.474   1.00 0.00 ? 25  VAL A CA   8  
ATOM   5133  C  C    . VAL A 1 25 ? -9.206  -1.229  0.768   1.00 0.00 ? 25  VAL A C    8  
ATOM   5134  O  O    . VAL A 1 25 ? -9.637  -1.023  -0.365  1.00 0.00 ? 25  VAL A O    8  
ATOM   5135  C  CB   . VAL A 1 25 ? -10.880 -2.536  2.078   1.00 0.00 ? 25  VAL A CB   8  
ATOM   5136  C  CG1  . VAL A 1 25 ? -11.916 -2.252  1.001   1.00 0.00 ? 25  VAL A CG1  8  
ATOM   5137  C  CG2  . VAL A 1 25 ? -11.177 -3.853  2.780   1.00 0.00 ? 25  VAL A CG2  8  
ATOM   5138  H  H    . VAL A 1 25 ? -8.685  -2.684  3.438   1.00 0.00 ? 25  VAL A H    8  
ATOM   5139  H  HA   . VAL A 1 25 ? -9.415  -3.354  0.747   1.00 0.00 ? 25  VAL A HA   8  
ATOM   5140  H  HB   . VAL A 1 25 ? -10.927 -1.744  2.810   1.00 0.00 ? 25  VAL A HB   8  
ATOM   5141  H  HG11 . VAL A 1 25 ? -11.930 -3.066  0.291   1.00 0.00 ? 25  VAL A HG11 8  
ATOM   5142  H  HG12 . VAL A 1 25 ? -12.891 -2.153  1.456   1.00 0.00 ? 25  VAL A HG12 8  
ATOM   5143  H  HG13 . VAL A 1 25 ? -11.662 -1.334  0.491   1.00 0.00 ? 25  VAL A HG13 8  
ATOM   5144  H  HG21 . VAL A 1 25 ? -12.158 -4.201  2.493   1.00 0.00 ? 25  VAL A HG21 8  
ATOM   5145  H  HG22 . VAL A 1 25 ? -10.437 -4.586  2.497   1.00 0.00 ? 25  VAL A HG22 8  
ATOM   5146  H  HG23 . VAL A 1 25 ? -11.146 -3.705  3.850   1.00 0.00 ? 25  VAL A HG23 8  
ATOM   5147  N  N    . ASN A 1 26 ? -8.499  -0.331  1.447   1.00 0.00 ? 26  ASN A N    8  
ATOM   5148  C  CA   . ASN A 1 26 ? -8.183  0.977   0.886   1.00 0.00 ? 26  ASN A CA   8  
ATOM   5149  C  C    . ASN A 1 26 ? -6.712  1.058   0.490   1.00 0.00 ? 26  ASN A C    8  
ATOM   5150  O  O    . ASN A 1 26 ? -6.251  2.077   -0.027  1.00 0.00 ? 26  ASN A O    8  
ATOM   5151  C  CB   . ASN A 1 26 ? -8.514  2.081   1.893   1.00 0.00 ? 26  ASN A CB   8  
ATOM   5152  C  CG   . ASN A 1 26 ? -7.563  2.089   3.074   1.00 0.00 ? 26  ASN A CG   8  
ATOM   5153  O  OD1  . ASN A 1 26 ? -7.207  1.037   3.606   1.00 0.00 ? 26  ASN A OD1  8  
ATOM   5154  N  ND2  . ASN A 1 26 ? -7.148  3.279   3.491   1.00 0.00 ? 26  ASN A ND2  8  
ATOM   5155  H  H    . ASN A 1 26 ? -8.182  -0.554  2.348   1.00 0.00 ? 26  ASN A H    8  
ATOM   5156  H  HA   . ASN A 1 26 ? -8.790  1.114   0.003   1.00 0.00 ? 26  ASN A HA   8  
ATOM   5157  H  HB2  . ASN A 1 26 ? -8.452  3.040   1.399   1.00 0.00 ? 26  ASN A HB2  8  
ATOM   5158  H  HB3  . ASN A 1 26 ? -9.518  1.935   2.262   1.00 0.00 ? 26  ASN A HB3  8  
ATOM   5159  H  HD21 . ASN A 1 26 ? -7.474  4.075   3.020   1.00 0.00 ? 26  ASN A HD21 8  
ATOM   5160  H  HD22 . ASN A 1 26 ? -6.533  3.313   4.253   1.00 0.00 ? 26  ASN A HD22 8  
ATOM   5161  N  N    . THR A 1 27 ? -5.978  -0.023  0.734   1.00 0.00 ? 27  THR A N    8  
ATOM   5162  C  CA   . THR A 1 27 ? -4.560  -0.075  0.405   1.00 0.00 ? 27  THR A CA   8  
ATOM   5163  C  C    . THR A 1 27 ? -4.293  -1.064  -0.724  1.00 0.00 ? 27  THR A C    8  
ATOM   5164  O  O    . THR A 1 27 ? -3.266  -0.989  -1.397  1.00 0.00 ? 27  THR A O    8  
ATOM   5165  C  CB   . THR A 1 27 ? -3.712  -0.470  1.629   1.00 0.00 ? 27  THR A CB   8  
ATOM   5166  O  OG1  . THR A 1 27 ? -3.952  -1.840  1.969   1.00 0.00 ? 27  THR A OG1  8  
ATOM   5167  C  CG2  . THR A 1 27 ? -4.036  0.419   2.820   1.00 0.00 ? 27  THR A CG2  8  
ATOM   5168  H  H    . THR A 1 27 ? -6.402  -0.804  1.148   1.00 0.00 ? 27  THR A H    8  
ATOM   5169  H  HA   . THR A 1 27 ? -4.255  0.912   0.085   1.00 0.00 ? 27  THR A HA   8  
ATOM   5170  H  HB   . THR A 1 27 ? -2.668  -0.346  1.379   1.00 0.00 ? 27  THR A HB   8  
ATOM   5171  H  HG1  . THR A 1 27 ? -3.816  -2.391  1.195   1.00 0.00 ? 27  THR A HG1  8  
ATOM   5172  H  HG21 . THR A 1 27 ? -3.592  0.001   3.711   1.00 0.00 ? 27  THR A HG21 8  
ATOM   5173  H  HG22 . THR A 1 27 ? -5.107  0.477   2.946   1.00 0.00 ? 27  THR A HG22 8  
ATOM   5174  H  HG23 . THR A 1 27 ? -3.639  1.408   2.650   1.00 0.00 ? 27  THR A HG23 8  
ATOM   5175  N  N    . GLN A 1 28 ? -5.226  -1.989  -0.926  1.00 0.00 ? 28  GLN A N    8  
ATOM   5176  C  CA   . GLN A 1 28 ? -5.090  -2.994  -1.974  1.00 0.00 ? 28  GLN A CA   8  
ATOM   5177  C  C    . GLN A 1 28 ? -4.790  -2.340  -3.319  1.00 0.00 ? 28  GLN A C    8  
ATOM   5178  O  O    . GLN A 1 28 ? -5.176  -1.201  -3.583  1.00 0.00 ? 28  GLN A O    8  
ATOM   5179  C  CB   . GLN A 1 28 ? -6.366  -3.832  -2.075  1.00 0.00 ? 28  GLN A CB   8  
ATOM   5180  C  CG   . GLN A 1 28 ? -7.505  -3.123  -2.791  1.00 0.00 ? 28  GLN A CG   8  
ATOM   5181  C  CD   . GLN A 1 28 ? -8.675  -4.042  -3.079  1.00 0.00 ? 28  GLN A CD   8  
ATOM   5182  O  OE1  . GLN A 1 28 ? -8.739  -4.673  -4.135  1.00 0.00 ? 28  GLN A OE1  8  
ATOM   5183  N  NE2  . GLN A 1 28 ? -9.610  -4.123  -2.139  1.00 0.00 ? 28  GLN A NE2  8  
ATOM   5184  H  H    . GLN A 1 28 ? -6.022  -1.998  -0.356  1.00 0.00 ? 28  GLN A H    8  
ATOM   5185  H  HA   . GLN A 1 28 ? -4.266  -3.639  -1.710  1.00 0.00 ? 28  GLN A HA   8  
ATOM   5186  H  HB2  . GLN A 1 28 ? -6.143  -4.742  -2.611  1.00 0.00 ? 28  GLN A HB2  8  
ATOM   5187  H  HB3  . GLN A 1 28 ? -6.697  -4.083  -1.078  1.00 0.00 ? 28  GLN A HB3  8  
ATOM   5188  H  HG2  . GLN A 1 28 ? -7.851  -2.309  -2.171  1.00 0.00 ? 28  GLN A HG2  8  
ATOM   5189  H  HG3  . GLN A 1 28 ? -7.135  -2.730  -3.726  1.00 0.00 ? 28  GLN A HG3  8  
ATOM   5190  H  HE21 . GLN A 1 28 ? -9.493  -3.591  -1.324  1.00 0.00 ? 28  GLN A HE21 8  
ATOM   5191  H  HE22 . GLN A 1 28 ? -10.377 -4.709  -2.299  1.00 0.00 ? 28  GLN A HE22 8  
ATOM   5192  N  N    . PRO A 1 29 ? -4.083  -3.075  -4.190  1.00 0.00 ? 29  PRO A N    8  
ATOM   5193  C  CA   . PRO A 1 29 ? -3.617  -4.431  -3.886  1.00 0.00 ? 29  PRO A CA   8  
ATOM   5194  C  C    . PRO A 1 29 ? -2.515  -4.443  -2.833  1.00 0.00 ? 29  PRO A C    8  
ATOM   5195  O  O    . PRO A 1 29 ? -2.271  -5.463  -2.186  1.00 0.00 ? 29  PRO A O    8  
ATOM   5196  C  CB   . PRO A 1 29 ? -3.078  -4.930  -5.229  1.00 0.00 ? 29  PRO A CB   8  
ATOM   5197  C  CG   . PRO A 1 29 ? -2.703  -3.693  -5.970  1.00 0.00 ? 29  PRO A CG   8  
ATOM   5198  C  CD   . PRO A 1 29 ? -3.684  -2.639  -5.539  1.00 0.00 ? 29  PRO A CD   8  
ATOM   5199  H  HA   . PRO A 1 29 ? -4.429  -5.067  -3.564  1.00 0.00 ? 29  PRO A HA   8  
ATOM   5200  H  HB2  . PRO A 1 29 ? -2.220  -5.567  -5.062  1.00 0.00 ? 29  PRO A HB2  8  
ATOM   5201  H  HB3  . PRO A 1 29 ? -3.847  -5.482  -5.748  1.00 0.00 ? 29  PRO A HB3  8  
ATOM   5202  H  HG2  . PRO A 1 29 ? -1.697  -3.399  -5.709  1.00 0.00 ? 29  PRO A HG2  8  
ATOM   5203  H  HG3  . PRO A 1 29 ? -2.781  -3.865  -7.034  1.00 0.00 ? 29  PRO A HG3  8  
ATOM   5204  H  HD2  . PRO A 1 29 ? -3.207  -1.670  -5.506  1.00 0.00 ? 29  PRO A HD2  8  
ATOM   5205  H  HD3  . PRO A 1 29 ? -4.534  -2.620  -6.204  1.00 0.00 ? 29  PRO A HD3  8  
ATOM   5206  N  N    . LEU A 1 30 ? -1.853  -3.304  -2.663  1.00 0.00 ? 30  LEU A N    8  
ATOM   5207  C  CA   . LEU A 1 30 ? -0.776  -3.183  -1.686  1.00 0.00 ? 30  LEU A CA   8  
ATOM   5208  C  C    . LEU A 1 30 ? -1.335  -3.040  -0.274  1.00 0.00 ? 30  LEU A C    8  
ATOM   5209  O  O    . LEU A 1 30 ? -2.546  -2.917  -0.084  1.00 0.00 ? 30  LEU A O    8  
ATOM   5210  C  CB   . LEU A 1 30 ? 0.110   -1.981  -2.020  1.00 0.00 ? 30  LEU A CB   8  
ATOM   5211  C  CG   . LEU A 1 30 ? 0.957   -2.103  -3.287  1.00 0.00 ? 30  LEU A CG   8  
ATOM   5212  C  CD1  . LEU A 1 30 ? 1.713   -0.810  -3.551  1.00 0.00 ? 30  LEU A CD1  8  
ATOM   5213  C  CD2  . LEU A 1 30 ? 1.922   -3.274  -3.173  1.00 0.00 ? 30  LEU A CD2  8  
ATOM   5214  H  H    . LEU A 1 30 ? -2.092  -2.526  -3.207  1.00 0.00 ? 30  LEU A H    8  
ATOM   5215  H  HA   . LEU A 1 30 ? -0.181  -4.083  -1.736  1.00 0.00 ? 30  LEU A HA   8  
ATOM   5216  H  HB2  . LEU A 1 30 ? -0.531  -1.120  -2.132  1.00 0.00 ? 30  LEU A HB2  8  
ATOM   5217  H  HB3  . LEU A 1 30 ? 0.780   -1.824  -1.187  1.00 0.00 ? 30  LEU A HB3  8  
ATOM   5218  H  HG   . LEU A 1 30 ? 0.306   -2.287  -4.132  1.00 0.00 ? 30  LEU A HG   8  
ATOM   5219  H  HD11 . LEU A 1 30 ? 2.536   -1.005  -4.221  1.00 0.00 ? 30  LEU A HD11 8  
ATOM   5220  H  HD12 . LEU A 1 30 ? 2.092   -0.419  -2.619  1.00 0.00 ? 30  LEU A HD12 8  
ATOM   5221  H  HD13 . LEU A 1 30 ? 1.045   -0.088  -3.999  1.00 0.00 ? 30  LEU A HD13 8  
ATOM   5222  H  HD21 . LEU A 1 30 ? 1.747   -3.965  -3.983  1.00 0.00 ? 30  LEU A HD21 8  
ATOM   5223  H  HD22 . LEU A 1 30 ? 1.767   -3.777  -2.230  1.00 0.00 ? 30  LEU A HD22 8  
ATOM   5224  H  HD23 . LEU A 1 30 ? 2.938   -2.909  -3.223  1.00 0.00 ? 30  LEU A HD23 8  
ATOM   5225  N  N    . CYS A 1 31 ? -0.446  -3.056  0.713   1.00 0.00 ? 31  CYS A N    8  
ATOM   5226  C  CA   . CYS A 1 31 ? -0.849  -2.926  2.108   1.00 0.00 ? 31  CYS A CA   8  
ATOM   5227  C  C    . CYS A 1 31 ? -0.518  -1.536  2.643   1.00 0.00 ? 31  CYS A C    8  
ATOM   5228  O  O    . CYS A 1 31 ? 0.058   -0.708  1.937   1.00 0.00 ? 31  CYS A O    8  
ATOM   5229  C  CB   . CYS A 1 31 ? -0.158  -3.991  2.961   1.00 0.00 ? 31  CYS A CB   8  
ATOM   5230  S  SG   . CYS A 1 31 ? 1.578   -3.613  3.361   1.00 0.00 ? 31  CYS A SG   8  
ATOM   5231  H  H    . CYS A 1 31 ? 0.506   -3.157  0.498   1.00 0.00 ? 31  CYS A H    8  
ATOM   5232  H  HA   . CYS A 1 31 ? -1.917  -3.073  2.160   1.00 0.00 ? 31  CYS A HA   8  
ATOM   5233  H  HB2  . CYS A 1 31 ? -0.694  -4.097  3.894   1.00 0.00 ? 31  CYS A HB2  8  
ATOM   5234  H  HB3  . CYS A 1 31 ? -0.177  -4.933  2.433   1.00 0.00 ? 31  CYS A HB3  8  
ATOM   5235  N  N    . HIS A 1 32 ? -0.886  -1.287  3.896   1.00 0.00 ? 32  HIS A N    8  
ATOM   5236  C  CA   . HIS A 1 32 ? -0.627  0.002   4.527   1.00 0.00 ? 32  HIS A CA   8  
ATOM   5237  C  C    . HIS A 1 32 ? 0.841   0.393   4.381   1.00 0.00 ? 32  HIS A C    8  
ATOM   5238  O  O    . HIS A 1 32 ? 1.157   1.484   3.906   1.00 0.00 ? 32  HIS A O    8  
ATOM   5239  C  CB   . HIS A 1 32 ? -1.009  -0.045  6.007   1.00 0.00 ? 32  HIS A CB   8  
ATOM   5240  C  CG   . HIS A 1 32 ? -1.461  1.276   6.550   1.00 0.00 ? 32  HIS A CG   8  
ATOM   5241  N  ND1  . HIS A 1 32 ? -2.622  1.433   7.277   1.00 0.00 ? 32  HIS A ND1  8  
ATOM   5242  C  CD2  . HIS A 1 32 ? -0.899  2.505   6.472   1.00 0.00 ? 32  HIS A CD2  8  
ATOM   5243  C  CE1  . HIS A 1 32 ? -2.756  2.702   7.620   1.00 0.00 ? 32  HIS A CE1  8  
ATOM   5244  N  NE2  . HIS A 1 32 ? -1.723  3.373   7.144   1.00 0.00 ? 32  HIS A NE2  8  
ATOM   5245  H  H    . HIS A 1 32 ? -1.341  -1.987  4.408   1.00 0.00 ? 32  HIS A H    8  
ATOM   5246  H  HA   . HIS A 1 32 ? -1.235  0.743   4.030   1.00 0.00 ? 32  HIS A HA   8  
ATOM   5247  H  HB2  . HIS A 1 32 ? -1.815  -0.751  6.141   1.00 0.00 ? 32  HIS A HB2  8  
ATOM   5248  H  HB3  . HIS A 1 32 ? -0.154  -0.367  6.583   1.00 0.00 ? 32  HIS A HB3  8  
ATOM   5249  H  HD1  . HIS A 1 32 ? -3.255  0.721   7.506   1.00 0.00 ? 32  HIS A HD1  8  
ATOM   5250  H  HD2  . HIS A 1 32 ? 0.026   2.757   5.972   1.00 0.00 ? 32  HIS A HD2  8  
ATOM   5251  H  HE1  . HIS A 1 32 ? -3.571  3.120   8.193   1.00 0.00 ? 32  HIS A HE1  8  
ATOM   5252  N  N    . GLU A 1 33 ? 1.731   -0.503  4.794   1.00 0.00 ? 33  GLU A N    8  
ATOM   5253  C  CA   . GLU A 1 33 ? 3.165   -0.249  4.710   1.00 0.00 ? 33  GLU A CA   8  
ATOM   5254  C  C    . GLU A 1 33 ? 3.567   0.133   3.288   1.00 0.00 ? 33  GLU A C    8  
ATOM   5255  O  O    . GLU A 1 33 ? 3.956   1.272   3.026   1.00 0.00 ? 33  GLU A O    8  
ATOM   5256  C  CB   . GLU A 1 33 ? 3.951   -1.483  5.160   1.00 0.00 ? 33  GLU A CB   8  
ATOM   5257  C  CG   . GLU A 1 33 ? 5.452   -1.258  5.224   1.00 0.00 ? 33  GLU A CG   8  
ATOM   5258  C  CD   . GLU A 1 33 ? 6.231   -2.552  5.362   1.00 0.00 ? 33  GLU A CD   8  
ATOM   5259  O  OE1  . GLU A 1 33 ? 5.862   -3.540  4.694   1.00 0.00 ? 33  GLU A OE1  8  
ATOM   5260  O  OE2  . GLU A 1 33 ? 7.209   -2.575  6.138   1.00 0.00 ? 33  GLU A OE2  8  
ATOM   5261  H  H    . GLU A 1 33 ? 1.417   -1.354  5.164   1.00 0.00 ? 33  GLU A H    8  
ATOM   5262  H  HA   . GLU A 1 33 ? 3.395   0.573   5.370   1.00 0.00 ? 33  GLU A HA   8  
ATOM   5263  H  HB2  . GLU A 1 33 ? 3.609   -1.774  6.142   1.00 0.00 ? 33  GLU A HB2  8  
ATOM   5264  H  HB3  . GLU A 1 33 ? 3.758   -2.289  4.468   1.00 0.00 ? 33  GLU A HB3  8  
ATOM   5265  H  HG2  . GLU A 1 33 ? 5.768   -0.761  4.319   1.00 0.00 ? 33  GLU A HG2  8  
ATOM   5266  H  HG3  . GLU A 1 33 ? 5.673   -0.629  6.074   1.00 0.00 ? 33  GLU A HG3  8  
ATOM   5267  N  N    . CYS A 1 34 ? 3.471   -0.827  2.374   1.00 0.00 ? 34  CYS A N    8  
ATOM   5268  C  CA   . CYS A 1 34 ? 3.826   -0.593  0.980   1.00 0.00 ? 34  CYS A CA   8  
ATOM   5269  C  C    . CYS A 1 34 ? 3.066   0.606   0.418   1.00 0.00 ? 34  CYS A C    8  
ATOM   5270  O  O    . CYS A 1 34 ? 3.665   1.612   0.041   1.00 0.00 ? 34  CYS A O    8  
ATOM   5271  C  CB   . CYS A 1 34 ? 3.529   -1.837  0.141   1.00 0.00 ? 34  CYS A CB   8  
ATOM   5272  S  SG   . CYS A 1 34 ? 4.279   -3.366  0.787   1.00 0.00 ? 34  CYS A SG   8  
ATOM   5273  H  H    . CYS A 1 34 ? 3.155   -1.715  2.644   1.00 0.00 ? 34  CYS A H    8  
ATOM   5274  H  HA   . CYS A 1 34 ? 4.884   -0.385  0.936   1.00 0.00 ? 34  CYS A HA   8  
ATOM   5275  H  HB2  . CYS A 1 34 ? 2.460   -1.988  0.101   1.00 0.00 ? 34  CYS A HB2  8  
ATOM   5276  H  HB3  . CYS A 1 34 ? 3.902   -1.685  -0.861  1.00 0.00 ? 34  CYS A HB3  8  
ATOM   5277  N  N    . SER A 1 35 ? 1.743   0.489   0.368   1.00 0.00 ? 35  SER A N    8  
ATOM   5278  C  CA   . SER A 1 35 ? 0.900   1.561   -0.150  1.00 0.00 ? 35  SER A CA   8  
ATOM   5279  C  C    . SER A 1 35 ? 1.402   2.922   0.322   1.00 0.00 ? 35  SER A C    8  
ATOM   5280  O  O    . SER A 1 35 ? 1.410   3.890   -0.438  1.00 0.00 ? 35  SER A O    8  
ATOM   5281  C  CB   . SER A 1 35 ? -0.550  1.357   0.292   1.00 0.00 ? 35  SER A CB   8  
ATOM   5282  O  OG   . SER A 1 35 ? -1.431  2.177   -0.456  1.00 0.00 ? 35  SER A OG   8  
ATOM   5283  H  H    . SER A 1 35 ? 1.324   -0.339  0.684   1.00 0.00 ? 35  SER A H    8  
ATOM   5284  H  HA   . SER A 1 35 ? 0.947   1.528   -1.228  1.00 0.00 ? 35  SER A HA   8  
ATOM   5285  H  HB2  . SER A 1 35 ? -0.827  0.324   0.145   1.00 0.00 ? 35  SER A HB2  8  
ATOM   5286  H  HB3  . SER A 1 35 ? -0.643  1.610   1.338   1.00 0.00 ? 35  SER A HB3  8  
ATOM   5287  H  HG   . SER A 1 35 ? -1.626  1.755   -1.296  1.00 0.00 ? 35  SER A HG   8  
ATOM   5288  N  N    . GLU A 1 36 ? 1.819   2.987   1.583   1.00 0.00 ? 36  GLU A N    8  
ATOM   5289  C  CA   . GLU A 1 36 ? 2.321   4.230   2.158   1.00 0.00 ? 36  GLU A CA   8  
ATOM   5290  C  C    . GLU A 1 36 ? 3.758   4.491   1.717   1.00 0.00 ? 36  GLU A C    8  
ATOM   5291  O  O    . GLU A 1 36 ? 4.171   5.640   1.558   1.00 0.00 ? 36  GLU A O    8  
ATOM   5292  C  CB   . GLU A 1 36 ? 2.245   4.179   3.685   1.00 0.00 ? 36  GLU A CB   8  
ATOM   5293  C  CG   . GLU A 1 36 ? 3.112   5.220   4.373   1.00 0.00 ? 36  GLU A CG   8  
ATOM   5294  C  CD   . GLU A 1 36 ? 2.478   6.597   4.377   1.00 0.00 ? 36  GLU A CD   8  
ATOM   5295  O  OE1  . GLU A 1 36 ? 1.924   6.999   3.332   1.00 0.00 ? 36  GLU A OE1  8  
ATOM   5296  O  OE2  . GLU A 1 36 ? 2.534   7.272   5.426   1.00 0.00 ? 36  GLU A OE2  8  
ATOM   5297  H  H    . GLU A 1 36 ? 1.788   2.181   2.139   1.00 0.00 ? 36  GLU A H    8  
ATOM   5298  H  HA   . GLU A 1 36 ? 1.696   5.036   1.803   1.00 0.00 ? 36  GLU A HA   8  
ATOM   5299  H  HB2  . GLU A 1 36 ? 1.221   4.336   3.988   1.00 0.00 ? 36  GLU A HB2  8  
ATOM   5300  H  HB3  . GLU A 1 36 ? 2.563   3.201   4.016   1.00 0.00 ? 36  GLU A HB3  8  
ATOM   5301  H  HG2  . GLU A 1 36 ? 3.278   4.914   5.395   1.00 0.00 ? 36  GLU A HG2  8  
ATOM   5302  H  HG3  . GLU A 1 36 ? 4.060   5.278   3.857   1.00 0.00 ? 36  GLU A HG3  8  
ATOM   5303  N  N    . ARG A 1 37 ? 4.516   3.417   1.522   1.00 0.00 ? 37  ARG A N    8  
ATOM   5304  C  CA   . ARG A 1 37 ? 5.907   3.530   1.102   1.00 0.00 ? 37  ARG A CA   8  
ATOM   5305  C  C    . ARG A 1 37 ? 6.004   4.082   -0.317  1.00 0.00 ? 37  ARG A C    8  
ATOM   5306  O  O    . ARG A 1 37 ? 6.869   4.905   -0.616  1.00 0.00 ? 37  ARG A O    8  
ATOM   5307  C  CB   . ARG A 1 37 ? 6.597   2.166   1.178   1.00 0.00 ? 37  ARG A CB   8  
ATOM   5308  C  CG   . ARG A 1 37 ? 7.985   2.150   0.558   1.00 0.00 ? 37  ARG A CG   8  
ATOM   5309  C  CD   . ARG A 1 37 ? 8.352   0.765   0.050   1.00 0.00 ? 37  ARG A CD   8  
ATOM   5310  N  NE   . ARG A 1 37 ? 8.525   -0.190  1.141   1.00 0.00 ? 37  ARG A NE   8  
ATOM   5311  C  CZ   . ARG A 1 37 ? 8.428   -1.506  0.988   1.00 0.00 ? 37  ARG A CZ   8  
ATOM   5312  N  NH1  . ARG A 1 37 ? 8.160   -2.021  -0.204  1.00 0.00 ? 37  ARG A NH1  8  
ATOM   5313  N  NH2  . ARG A 1 37 ? 8.599   -2.311  2.029   1.00 0.00 ? 37  ARG A NH2  8  
ATOM   5314  H  H    . ARG A 1 37 ? 4.130   2.527   1.665   1.00 0.00 ? 37  ARG A H    8  
ATOM   5315  H  HA   . ARG A 1 37 ? 6.403   4.212   1.776   1.00 0.00 ? 37  ARG A HA   8  
ATOM   5316  H  HB2  . ARG A 1 37 ? 6.687   1.878   2.215   1.00 0.00 ? 37  ARG A HB2  8  
ATOM   5317  H  HB3  . ARG A 1 37 ? 5.988   1.439   0.662   1.00 0.00 ? 37  ARG A HB3  8  
ATOM   5318  H  HG2  . ARG A 1 37 ? 8.007   2.843   -0.271  1.00 0.00 ? 37  ARG A HG2  8  
ATOM   5319  H  HG3  . ARG A 1 37 ? 8.705   2.454   1.303   1.00 0.00 ? 37  ARG A HG3  8  
ATOM   5320  H  HD2  . ARG A 1 37 ? 7.565   0.414   -0.601  1.00 0.00 ? 37  ARG A HD2  8  
ATOM   5321  H  HD3  . ARG A 1 37 ? 9.275   0.833   -0.507  1.00 0.00 ? 37  ARG A HD3  8  
ATOM   5322  H  HE   . ARG A 1 37 ? 8.724   0.168   2.031   1.00 0.00 ? 37  ARG A HE   8  
ATOM   5323  H  HH11 . ARG A 1 37 ? 8.032   -1.417  -0.991  1.00 0.00 ? 37  ARG A HH11 8  
ATOM   5324  H  HH12 . ARG A 1 37 ? 8.089   -3.012  -0.317  1.00 0.00 ? 37  ARG A HH12 8  
ATOM   5325  H  HH21 . ARG A 1 37 ? 8.801   -1.927  2.930   1.00 0.00 ? 37  ARG A HH21 8  
ATOM   5326  H  HH22 . ARG A 1 37 ? 8.525   -3.301  1.913   1.00 0.00 ? 37  ARG A HH22 8  
ATOM   5327  N  N    . ARG A 1 38 ? 5.110   3.624   -1.187  1.00 0.00 ? 38  ARG A N    8  
ATOM   5328  C  CA   . ARG A 1 38 ? 5.095   4.071   -2.575  1.00 0.00 ? 38  ARG A CA   8  
ATOM   5329  C  C    . ARG A 1 38 ? 4.901   5.582   -2.657  1.00 0.00 ? 38  ARG A C    8  
ATOM   5330  O  O    . ARG A 1 38 ? 5.536   6.255   -3.469  1.00 0.00 ? 38  ARG A O    8  
ATOM   5331  C  CB   . ARG A 1 38 ? 3.984   3.360   -3.350  1.00 0.00 ? 38  ARG A CB   8  
ATOM   5332  C  CG   . ARG A 1 38 ? 4.179   3.390   -4.857  1.00 0.00 ? 38  ARG A CG   8  
ATOM   5333  C  CD   . ARG A 1 38 ? 3.565   2.168   -5.522  1.00 0.00 ? 38  ARG A CD   8  
ATOM   5334  N  NE   . ARG A 1 38 ? 4.451   1.008   -5.461  1.00 0.00 ? 38  ARG A NE   8  
ATOM   5335  C  CZ   . ARG A 1 38 ? 4.168   -0.164  -6.019  1.00 0.00 ? 38  ARG A CZ   8  
ATOM   5336  N  NH1  . ARG A 1 38 ? 3.029   -0.330  -6.677  1.00 0.00 ? 38  ARG A NH1  8  
ATOM   5337  N  NH2  . ARG A 1 38 ? 5.025   -1.172  -5.920  1.00 0.00 ? 38  ARG A NH2  8  
ATOM   5338  H  H    . ARG A 1 38 ? 4.444   2.969   -0.889  1.00 0.00 ? 38  ARG A H    8  
ATOM   5339  H  HA   . ARG A 1 38 ? 6.048   3.817   -3.015  1.00 0.00 ? 38  ARG A HA   8  
ATOM   5340  H  HB2  . ARG A 1 38 ? 3.945   2.328   -3.035  1.00 0.00 ? 38  ARG A HB2  8  
ATOM   5341  H  HB3  . ARG A 1 38 ? 3.042   3.834   -3.121  1.00 0.00 ? 38  ARG A HB3  8  
ATOM   5342  H  HG2  . ARG A 1 38 ? 3.707   4.276   -5.254  1.00 0.00 ? 38  ARG A HG2  8  
ATOM   5343  H  HG3  . ARG A 1 38 ? 5.236   3.414   -5.074  1.00 0.00 ? 38  ARG A HG3  8  
ATOM   5344  H  HD2  . ARG A 1 38 ? 2.639   1.928   -5.021  1.00 0.00 ? 38  ARG A HD2  8  
ATOM   5345  H  HD3  . ARG A 1 38 ? 3.363   2.401   -6.557  1.00 0.00 ? 38  ARG A HD3  8  
ATOM   5346  H  HE   . ARG A 1 38 ? 5.298   1.109   -4.979  1.00 0.00 ? 38  ARG A HE   8  
ATOM   5347  H  HH11 . ARG A 1 38 ? 2.381   0.428   -6.754  1.00 0.00 ? 38  ARG A HH11 8  
ATOM   5348  H  HH12 . ARG A 1 38 ? 2.818   -1.213  -7.097  1.00 0.00 ? 38  ARG A HH12 8  
ATOM   5349  H  HH21 . ARG A 1 38 ? 5.884   -1.050  -5.424  1.00 0.00 ? 38  ARG A HH21 8  
ATOM   5350  H  HH22 . ARG A 1 38 ? 4.811   -2.053  -6.340  1.00 0.00 ? 38  ARG A HH22 8  
ATOM   5351  N  N    . GLN A 1 39 ? 4.020   6.107   -1.812  1.00 0.00 ? 39  GLN A N    8  
ATOM   5352  C  CA   . GLN A 1 39 ? 3.742   7.538   -1.791  1.00 0.00 ? 39  GLN A CA   8  
ATOM   5353  C  C    . GLN A 1 39 ? 4.840   8.295   -1.051  1.00 0.00 ? 39  GLN A C    8  
ATOM   5354  O  O    . GLN A 1 39 ? 5.278   9.360   -1.487  1.00 0.00 ? 39  GLN A O    8  
ATOM   5355  C  CB   . GLN A 1 39 ? 2.388   7.806   -1.132  1.00 0.00 ? 39  GLN A CB   8  
ATOM   5356  C  CG   . GLN A 1 39 ? 2.188   9.256   -0.719  1.00 0.00 ? 39  GLN A CG   8  
ATOM   5357  C  CD   . GLN A 1 39 ? 2.153   10.201  -1.904  1.00 0.00 ? 39  GLN A CD   8  
ATOM   5358  O  OE1  . GLN A 1 39 ? 2.869   10.009  -2.887  1.00 0.00 ? 39  GLN A OE1  8  
ATOM   5359  N  NE2  . GLN A 1 39 ? 1.316   11.228  -1.818  1.00 0.00 ? 39  GLN A NE2  8  
ATOM   5360  H  H    . GLN A 1 39 ? 3.546   5.519   -1.189  1.00 0.00 ? 39  GLN A H    8  
ATOM   5361  H  HA   . GLN A 1 39 ? 3.709   7.885   -2.813  1.00 0.00 ? 39  GLN A HA   8  
ATOM   5362  H  HB2  . GLN A 1 39 ? 1.604   7.541   -1.826  1.00 0.00 ? 39  GLN A HB2  8  
ATOM   5363  H  HB3  . GLN A 1 39 ? 2.301   7.189   -0.250  1.00 0.00 ? 39  GLN A HB3  8  
ATOM   5364  H  HG2  . GLN A 1 39 ? 1.254   9.339   -0.184  1.00 0.00 ? 39  GLN A HG2  8  
ATOM   5365  H  HG3  . GLN A 1 39 ? 3.001   9.546   -0.070  1.00 0.00 ? 39  GLN A HG3  8  
ATOM   5366  H  HE21 . GLN A 1 39 ? 0.776   11.318  -1.003  1.00 0.00 ? 39  GLN A HE21 8  
ATOM   5367  H  HE22 . GLN A 1 39 ? 1.273   11.855  -2.568  1.00 0.00 ? 39  GLN A HE22 8  
ATOM   5368  N  N    . LYS A 1 40 ? 5.280   7.739   0.073   1.00 0.00 ? 40  LYS A N    8  
ATOM   5369  C  CA   . LYS A 1 40 ? 6.328   8.360   0.875   1.00 0.00 ? 40  LYS A CA   8  
ATOM   5370  C  C    . LYS A 1 40 ? 7.559   8.658   0.025   1.00 0.00 ? 40  LYS A C    8  
ATOM   5371  O  O    . LYS A 1 40 ? 8.152   9.731   0.130   1.00 0.00 ? 40  LYS A O    8  
ATOM   5372  C  CB   . LYS A 1 40 ? 6.710   7.451   2.044   1.00 0.00 ? 40  LYS A CB   8  
ATOM   5373  C  CG   . LYS A 1 40 ? 7.259   8.202   3.245   1.00 0.00 ? 40  LYS A CG   8  
ATOM   5374  C  CD   . LYS A 1 40 ? 7.059   7.419   4.532   1.00 0.00 ? 40  LYS A CD   8  
ATOM   5375  C  CE   . LYS A 1 40 ? 8.225   6.479   4.799   1.00 0.00 ? 40  LYS A CE   8  
ATOM   5376  N  NZ   . LYS A 1 40 ? 8.262   5.351   3.828   1.00 0.00 ? 40  LYS A NZ   8  
ATOM   5377  H  H    . LYS A 1 40 ? 4.892   6.889   0.370   1.00 0.00 ? 40  LYS A H    8  
ATOM   5378  H  HA   . LYS A 1 40 ? 5.940   9.290   1.264   1.00 0.00 ? 40  LYS A HA   8  
ATOM   5379  H  HB2  . LYS A 1 40 ? 5.835   6.902   2.359   1.00 0.00 ? 40  LYS A HB2  8  
ATOM   5380  H  HB3  . LYS A 1 40 ? 7.462   6.751   1.709   1.00 0.00 ? 40  LYS A HB3  8  
ATOM   5381  H  HG2  . LYS A 1 40 ? 8.316   8.371   3.100   1.00 0.00 ? 40  LYS A HG2  8  
ATOM   5382  H  HG3  . LYS A 1 40 ? 6.749   9.151   3.328   1.00 0.00 ? 40  LYS A HG3  8  
ATOM   5383  H  HD2  . LYS A 1 40 ? 6.975   8.112   5.355   1.00 0.00 ? 40  LYS A HD2  8  
ATOM   5384  H  HD3  . LYS A 1 40 ? 6.151   6.839   4.452   1.00 0.00 ? 40  LYS A HD3  8  
ATOM   5385  H  HE2  . LYS A 1 40 ? 9.145   7.037   4.724   1.00 0.00 ? 40  LYS A HE2  8  
ATOM   5386  H  HE3  . LYS A 1 40 ? 8.126   6.080   5.798   1.00 0.00 ? 40  LYS A HE3  8  
ATOM   5387  H  HZ1  . LYS A 1 40 ? 7.435   5.394   3.198   1.00 0.00 ? 40  LYS A HZ1  8  
ATOM   5388  H  HZ2  . LYS A 1 40 ? 8.251   4.443   4.335   1.00 0.00 ? 40  LYS A HZ2  8  
ATOM   5389  H  HZ3  . LYS A 1 40 ? 9.126   5.403   3.252   1.00 0.00 ? 40  LYS A HZ3  8  
ATOM   5390  N  N    . ASN A 1 41 ? 7.937   7.702   -0.817  1.00 0.00 ? 41  ASN A N    8  
ATOM   5391  C  CA   . ASN A 1 41 ? 9.097   7.863   -1.686  1.00 0.00 ? 41  ASN A CA   8  
ATOM   5392  C  C    . ASN A 1 41 ? 8.677   8.345   -3.071  1.00 0.00 ? 41  ASN A C    8  
ATOM   5393  O  O    . ASN A 1 41 ? 7.487   8.467   -3.362  1.00 0.00 ? 41  ASN A O    8  
ATOM   5394  C  CB   . ASN A 1 41 ? 9.860   6.542   -1.803  1.00 0.00 ? 41  ASN A CB   8  
ATOM   5395  C  CG   . ASN A 1 41 ? 10.824  6.328   -0.652  1.00 0.00 ? 41  ASN A CG   8  
ATOM   5396  O  OD1  . ASN A 1 41 ? 11.749  7.114   -0.447  1.00 0.00 ? 41  ASN A OD1  8  
ATOM   5397  N  ND2  . ASN A 1 41 ? 10.611  5.258   0.106   1.00 0.00 ? 41  ASN A ND2  8  
ATOM   5398  H  H    . ASN A 1 41 ? 7.423   6.868   -0.856  1.00 0.00 ? 41  ASN A H    8  
ATOM   5399  H  HA   . ASN A 1 41 ? 9.744   8.604   -1.241  1.00 0.00 ? 41  ASN A HA   8  
ATOM   5400  H  HB2  . ASN A 1 41 ? 9.153   5.725   -1.812  1.00 0.00 ? 41  ASN A HB2  8  
ATOM   5401  H  HB3  . ASN A 1 41 ? 10.422  6.537   -2.725  1.00 0.00 ? 41  ASN A HB3  8  
ATOM   5402  H  HD21 . ASN A 1 41 ? 9.855   4.675   -0.116  1.00 0.00 ? 41  ASN A HD21 8  
ATOM   5403  H  HD22 . ASN A 1 41 ? 11.219  5.096   0.857   1.00 0.00 ? 41  ASN A HD22 8  
ATOM   5404  N  N    . GLN A 1 42 ? 9.662   8.616   -3.922  1.00 0.00 ? 42  GLN A N    8  
ATOM   5405  C  CA   . GLN A 1 42 ? 9.394   9.084   -5.276  1.00 0.00 ? 42  GLN A CA   8  
ATOM   5406  C  C    . GLN A 1 42 ? 8.890   7.945   -6.156  1.00 0.00 ? 42  GLN A C    8  
ATOM   5407  O  O    . GLN A 1 42 ? 9.487   6.870   -6.198  1.00 0.00 ? 42  GLN A O    8  
ATOM   5408  C  CB   . GLN A 1 42 ? 10.656  9.696   -5.886  1.00 0.00 ? 42  GLN A CB   8  
ATOM   5409  C  CG   . GLN A 1 42 ? 11.683  8.663   -6.322  1.00 0.00 ? 42  GLN A CG   8  
ATOM   5410  C  CD   . GLN A 1 42 ? 12.075  7.721   -5.202  1.00 0.00 ? 42  GLN A CD   8  
ATOM   5411  O  OE1  . GLN A 1 42 ? 11.792  6.523   -5.255  1.00 0.00 ? 42  GLN A OE1  8  
ATOM   5412  N  NE2  . GLN A 1 42 ? 12.730  8.257   -4.179  1.00 0.00 ? 42  GLN A NE2  8  
ATOM   5413  H  H    . GLN A 1 42 ? 10.590  8.499   -3.631  1.00 0.00 ? 42  GLN A H    8  
ATOM   5414  H  HA   . GLN A 1 42 ? 8.628   9.843   -5.219  1.00 0.00 ? 42  GLN A HA   8  
ATOM   5415  H  HB2  . GLN A 1 42 ? 10.377  10.282  -6.749  1.00 0.00 ? 42  GLN A HB2  8  
ATOM   5416  H  HB3  . GLN A 1 42 ? 11.117  10.344  -5.155  1.00 0.00 ? 42  GLN A HB3  8  
ATOM   5417  H  HG2  . GLN A 1 42 ? 11.269  8.082   -7.132  1.00 0.00 ? 42  GLN A HG2  8  
ATOM   5418  H  HG3  . GLN A 1 42 ? 12.568  9.178   -6.666  1.00 0.00 ? 42  GLN A HG3  8  
ATOM   5419  H  HE21 . GLN A 1 42 ? 12.920  9.218   -4.204  1.00 0.00 ? 42  GLN A HE21 8  
ATOM   5420  H  HE22 . GLN A 1 42 ? 12.995  7.671   -3.440  1.00 0.00 ? 42  GLN A HE22 8  
ATOM   5421  N  N    . ASN A 1 43 ? 7.788   8.188   -6.859  1.00 0.00 ? 43  ASN A N    8  
ATOM   5422  C  CA   . ASN A 1 43 ? 7.204   7.182   -7.738  1.00 0.00 ? 43  ASN A CA   8  
ATOM   5423  C  C    . ASN A 1 43 ? 7.896   7.180   -9.097  1.00 0.00 ? 43  ASN A C    8  
ATOM   5424  O  O    . ASN A 1 43 ? 8.509   6.188   -9.492  1.00 0.00 ? 43  ASN A O    8  
ATOM   5425  C  CB   . ASN A 1 43 ? 5.706   7.438   -7.915  1.00 0.00 ? 43  ASN A CB   8  
ATOM   5426  C  CG   . ASN A 1 43 ? 5.127   6.686   -9.098  1.00 0.00 ? 43  ASN A CG   8  
ATOM   5427  O  OD1  . ASN A 1 43 ? 4.757   7.285   -10.108 1.00 0.00 ? 43  ASN A OD1  8  
ATOM   5428  N  ND2  . ASN A 1 43 ? 5.047   5.366   -8.978  1.00 0.00 ? 43  ASN A ND2  8  
ATOM   5429  H  H    . ASN A 1 43 ? 7.358   9.065   -6.784  1.00 0.00 ? 43  ASN A H    8  
ATOM   5430  H  HA   . ASN A 1 43 ? 7.343   6.217   -7.274  1.00 0.00 ? 43  ASN A HA   8  
ATOM   5431  H  HB2  . ASN A 1 43 ? 5.185   7.123   -7.023  1.00 0.00 ? 43  ASN A HB2  8  
ATOM   5432  H  HB3  . ASN A 1 43 ? 5.543   8.494   -8.069  1.00 0.00 ? 43  ASN A HB3  8  
ATOM   5433  H  HD21 . ASN A 1 43 ? 5.362   4.956   -8.144  1.00 0.00 ? 43  ASN A HD21 8  
ATOM   5434  H  HD22 . ASN A 1 43 ? 4.678   4.854   -9.728  1.00 0.00 ? 43  ASN A HD22 8  
ATOM   5435  N  N    . SER A 1 44 ? 7.794   8.297   -9.809  1.00 0.00 ? 44  SER A N    8  
ATOM   5436  C  CA   . SER A 1 44 ? 8.407   8.424   -11.126 1.00 0.00 ? 44  SER A CA   8  
ATOM   5437  C  C    . SER A 1 44 ? 9.922   8.555   -11.010 1.00 0.00 ? 44  SER A C    8  
ATOM   5438  O  O    . SER A 1 44 ? 10.671  7.775   -11.596 1.00 0.00 ? 44  SER A O    8  
ATOM   5439  C  CB   . SER A 1 44 ? 7.833   9.635   -11.865 1.00 0.00 ? 44  SER A CB   8  
ATOM   5440  O  OG   . SER A 1 44 ? 6.428   9.524   -12.012 1.00 0.00 ? 44  SER A OG   8  
ATOM   5441  H  H    . SER A 1 44 ? 7.292   9.054   -9.440  1.00 0.00 ? 44  SER A H    8  
ATOM   5442  H  HA   . SER A 1 44 ? 8.177   7.529   -11.686 1.00 0.00 ? 44  SER A HA   8  
ATOM   5443  H  HB2  . SER A 1 44 ? 8.055   10.532  -11.307 1.00 0.00 ? 44  SER A HB2  8  
ATOM   5444  H  HB3  . SER A 1 44 ? 8.282   9.700   -12.846 1.00 0.00 ? 44  SER A HB3  8  
ATOM   5445  H  HG   . SER A 1 44 ? 6.178   8.597   -12.016 1.00 0.00 ? 44  SER A HG   8  
ATOM   5446  N  N    . GLY A 1 45 ? 10.367  9.550   -10.248 1.00 0.00 ? 45  GLY A N    8  
ATOM   5447  C  CA   . GLY A 1 45 ? 11.790  9.767   -10.067 1.00 0.00 ? 45  GLY A CA   8  
ATOM   5448  C  C    . GLY A 1 45 ? 12.194  11.206  -10.323 1.00 0.00 ? 45  GLY A C    8  
ATOM   5449  O  O    . GLY A 1 45 ? 11.581  11.912  -11.123 1.00 0.00 ? 45  GLY A O    8  
ATOM   5450  H  H    . GLY A 1 45 ? 9.723   10.141  -9.804  1.00 0.00 ? 45  GLY A H    8  
ATOM   5451  H  HA2  . GLY A 1 45 ? 12.058  9.503   -9.055  1.00 0.00 ? 45  GLY A HA2  8  
ATOM   5452  H  HA3  . GLY A 1 45 ? 12.330  9.128   -10.751 1.00 0.00 ? 45  GLY A HA3  8  
ATOM   5453  N  N    . PRO A 1 46 ? 13.249  11.660  -9.630  1.00 0.00 ? 46  PRO A N    8  
ATOM   5454  C  CA   . PRO A 1 46 ? 13.757  13.029  -9.768  1.00 0.00 ? 46  PRO A CA   8  
ATOM   5455  C  C    . PRO A 1 46 ? 14.418  13.267  -11.121 1.00 0.00 ? 46  PRO A C    8  
ATOM   5456  O  O    . PRO A 1 46 ? 15.466  12.694  -11.421 1.00 0.00 ? 46  PRO A O    8  
ATOM   5457  C  CB   . PRO A 1 46 ? 14.787  13.140  -8.642  1.00 0.00 ? 46  PRO A CB   8  
ATOM   5458  C  CG   . PRO A 1 46 ? 15.228  11.739  -8.392  1.00 0.00 ? 46  PRO A CG   8  
ATOM   5459  C  CD   . PRO A 1 46 ? 14.027  10.873  -8.659  1.00 0.00 ? 46  PRO A CD   8  
ATOM   5460  H  HA   . PRO A 1 46 ? 12.975  13.759  -9.617  1.00 0.00 ? 46  PRO A HA   8  
ATOM   5461  H  HB2  . PRO A 1 46 ? 15.611  13.762  -8.964  1.00 0.00 ? 46  PRO A HB2  8  
ATOM   5462  H  HB3  . PRO A 1 46 ? 14.324  13.570  -7.767  1.00 0.00 ? 46  PRO A HB3  8  
ATOM   5463  H  HG2  . PRO A 1 46 ? 16.033  11.481  -9.063  1.00 0.00 ? 46  PRO A HG2  8  
ATOM   5464  H  HG3  . PRO A 1 46 ? 15.545  11.632  -7.365  1.00 0.00 ? 46  PRO A HG3  8  
ATOM   5465  H  HD2  . PRO A 1 46 ? 14.331  9.928   -9.083  1.00 0.00 ? 46  PRO A HD2  8  
ATOM   5466  H  HD3  . PRO A 1 46 ? 13.464  10.718  -7.750  1.00 0.00 ? 46  PRO A HD3  8  
ATOM   5467  N  N    . SER A 1 47 ? 13.801  14.118  -11.935 1.00 0.00 ? 47  SER A N    8  
ATOM   5468  C  CA   . SER A 1 47 ? 14.328  14.430  -13.258 1.00 0.00 ? 47  SER A CA   8  
ATOM   5469  C  C    . SER A 1 47 ? 15.125  15.730  -13.232 1.00 0.00 ? 47  SER A C    8  
ATOM   5470  O  O    . SER A 1 47 ? 14.801  16.656  -12.488 1.00 0.00 ? 47  SER A O    8  
ATOM   5471  C  CB   . SER A 1 47 ? 13.188  14.537  -14.273 1.00 0.00 ? 47  SER A CB   8  
ATOM   5472  O  OG   . SER A 1 47 ? 13.678  14.456  -15.600 1.00 0.00 ? 47  SER A OG   8  
ATOM   5473  H  H    . SER A 1 47 ? 12.969  14.543  -11.639 1.00 0.00 ? 47  SER A H    8  
ATOM   5474  H  HA   . SER A 1 47 ? 14.985  13.624  -13.551 1.00 0.00 ? 47  SER A HA   8  
ATOM   5475  H  HB2  . SER A 1 47 ? 12.488  13.732  -14.110 1.00 0.00 ? 47  SER A HB2  8  
ATOM   5476  H  HB3  . SER A 1 47 ? 12.685  15.484  -14.145 1.00 0.00 ? 47  SER A HB3  8  
ATOM   5477  H  HG   . SER A 1 47 ? 14.450  13.885  -15.622 1.00 0.00 ? 47  SER A HG   8  
ATOM   5478  N  N    . SER A 1 48 ? 16.171  15.793  -14.050 1.00 0.00 ? 48  SER A N    8  
ATOM   5479  C  CA   . SER A 1 48 ? 17.018  16.978  -14.119 1.00 0.00 ? 48  SER A CA   8  
ATOM   5480  C  C    . SER A 1 48 ? 16.173  18.244  -14.214 1.00 0.00 ? 48  SER A C    8  
ATOM   5481  O  O    . SER A 1 48 ? 16.420  19.223  -13.510 1.00 0.00 ? 48  SER A O    8  
ATOM   5482  C  CB   . SER A 1 48 ? 17.960  16.888  -15.322 1.00 0.00 ? 48  SER A CB   8  
ATOM   5483  O  OG   . SER A 1 48 ? 19.070  16.054  -15.038 1.00 0.00 ? 48  SER A OG   8  
ATOM   5484  H  H    . SER A 1 48 ? 16.379  15.022  -14.619 1.00 0.00 ? 48  SER A H    8  
ATOM   5485  H  HA   . SER A 1 48 ? 17.606  17.018  -13.214 1.00 0.00 ? 48  SER A HA   8  
ATOM   5486  H  HB2  . SER A 1 48 ? 17.425  16.480  -16.165 1.00 0.00 ? 48  SER A HB2  8  
ATOM   5487  H  HB3  . SER A 1 48 ? 18.320  17.876  -15.567 1.00 0.00 ? 48  SER A HB3  8  
ATOM   5488  H  HG   . SER A 1 48 ? 19.238  16.054  -14.093 1.00 0.00 ? 48  SER A HG   8  
ATOM   5489  N  N    . GLY A 1 49 ? 15.175  18.218  -15.092 1.00 0.00 ? 49  GLY A N    8  
ATOM   5490  C  CA   . GLY A 1 49 ? 14.308  19.369  -15.264 1.00 0.00 ? 49  GLY A CA   8  
ATOM   5491  C  C    . GLY A 1 49 ? 15.028  20.548  -15.888 1.00 0.00 ? 49  GLY A C    8  
ATOM   5492  O  O    . GLY A 1 49 ? 14.491  21.156  -16.814 1.00 0.00 ? 49  GLY A O    8  
ATOM   5493  H  H    . GLY A 1 49 ? 15.026  17.410  -15.627 1.00 0.00 ? 49  GLY A H    8  
ATOM   5494  H  HA2  . GLY A 1 49 ? 13.479  19.090  -15.897 1.00 0.00 ? 49  GLY A HA2  8  
ATOM   5495  H  HA3  . GLY A 1 49 ? 13.926  19.666  -14.298 1.00 0.00 ? 49  GLY A HA3  8  
HETATM 5496  ZN ZN   . ZN  B 2 .  ? 2.859   -4.779  1.910   1.00 0.00 ? 201 ZN  A ZN   8  
ATOM   5497  N  N    . GLY A 1 1  ? -12.949 19.516  2.411   1.00 0.00 ? 1   GLY A N    9  
ATOM   5498  C  CA   . GLY A 1 1  ? -14.041 18.636  2.036   1.00 0.00 ? 1   GLY A CA   9  
ATOM   5499  C  C    . GLY A 1 1  ? -13.555 17.293  1.527   1.00 0.00 ? 1   GLY A C    9  
ATOM   5500  O  O    . GLY A 1 1  ? -13.279 17.135  0.338   1.00 0.00 ? 1   GLY A O    9  
ATOM   5501  H  H1   . GLY A 1 1  ? -12.040 19.327  2.096   1.00 0.00 ? 1   GLY A H1   9  
ATOM   5502  H  HA2  . GLY A 1 1  ? -14.672 18.476  2.897   1.00 0.00 ? 1   GLY A HA2  9  
ATOM   5503  H  HA3  . GLY A 1 1  ? -14.622 19.113  1.260   1.00 0.00 ? 1   GLY A HA3  9  
ATOM   5504  N  N    . SER A 1 2  ? -13.449 16.323  2.430   1.00 0.00 ? 2   SER A N    9  
ATOM   5505  C  CA   . SER A 1 2  ? -12.987 14.989  2.067   1.00 0.00 ? 2   SER A CA   9  
ATOM   5506  C  C    . SER A 1 2  ? -13.861 13.918  2.713   1.00 0.00 ? 2   SER A C    9  
ATOM   5507  O  O    . SER A 1 2  ? -14.575 14.183  3.680   1.00 0.00 ? 2   SER A O    9  
ATOM   5508  C  CB   . SER A 1 2  ? -11.530 14.797  2.491   1.00 0.00 ? 2   SER A CB   9  
ATOM   5509  O  OG   . SER A 1 2  ? -10.647 15.434  1.582   1.00 0.00 ? 2   SER A OG   9  
ATOM   5510  H  H    . SER A 1 2  ? -13.684 16.511  3.363   1.00 0.00 ? 2   SER A H    9  
ATOM   5511  H  HA   . SER A 1 2  ? -13.057 14.894  0.994   1.00 0.00 ? 2   SER A HA   9  
ATOM   5512  H  HB2  . SER A 1 2  ? -11.384 15.222  3.472   1.00 0.00 ? 2   SER A HB2  9  
ATOM   5513  H  HB3  . SER A 1 2  ? -11.301 13.742  2.517   1.00 0.00 ? 2   SER A HB3  9  
ATOM   5514  H  HG   . SER A 1 2  ? -9.888  15.775  2.060   1.00 0.00 ? 2   SER A HG   9  
ATOM   5515  N  N    . SER A 1 3  ? -13.798 12.705  2.172   1.00 0.00 ? 3   SER A N    9  
ATOM   5516  C  CA   . SER A 1 3  ? -14.586 11.594  2.692   1.00 0.00 ? 3   SER A CA   9  
ATOM   5517  C  C    . SER A 1 3  ? -14.266 11.343  4.162   1.00 0.00 ? 3   SER A C    9  
ATOM   5518  O  O    . SER A 1 3  ? -13.381 11.978  4.734   1.00 0.00 ? 3   SER A O    9  
ATOM   5519  C  CB   . SER A 1 3  ? -14.319 10.327  1.876   1.00 0.00 ? 3   SER A CB   9  
ATOM   5520  O  OG   . SER A 1 3  ? -12.936 10.021  1.848   1.00 0.00 ? 3   SER A OG   9  
ATOM   5521  H  H    . SER A 1 3  ? -13.210 12.556  1.402   1.00 0.00 ? 3   SER A H    9  
ATOM   5522  H  HA   . SER A 1 3  ? -15.629 11.857  2.602   1.00 0.00 ? 3   SER A HA   9  
ATOM   5523  H  HB2  . SER A 1 3  ? -14.850 9.498   2.320   1.00 0.00 ? 3   SER A HB2  9  
ATOM   5524  H  HB3  . SER A 1 3  ? -14.664 10.475  0.863   1.00 0.00 ? 3   SER A HB3  9  
ATOM   5525  H  HG   . SER A 1 3  ? -12.819 9.083   1.680   1.00 0.00 ? 3   SER A HG   9  
ATOM   5526  N  N    . GLY A 1 4  ? -14.995 10.411  4.769   1.00 0.00 ? 4   GLY A N    9  
ATOM   5527  C  CA   . GLY A 1 4  ? -14.776 10.091  6.167   1.00 0.00 ? 4   GLY A CA   9  
ATOM   5528  C  C    . GLY A 1 4  ? -14.902 8.608   6.450   1.00 0.00 ? 4   GLY A C    9  
ATOM   5529  O  O    . GLY A 1 4  ? -15.733 8.191   7.258   1.00 0.00 ? 4   GLY A O    9  
ATOM   5530  H  H    . GLY A 1 4  ? -15.688 9.937   4.263   1.00 0.00 ? 4   GLY A H    9  
ATOM   5531  H  HA2  . GLY A 1 4  ? -13.786 10.418  6.449   1.00 0.00 ? 4   GLY A HA2  9  
ATOM   5532  H  HA3  . GLY A 1 4  ? -15.502 10.623  6.765   1.00 0.00 ? 4   GLY A HA3  9  
ATOM   5533  N  N    . SER A 1 5  ? -14.078 7.807   5.782   1.00 0.00 ? 5   SER A N    9  
ATOM   5534  C  CA   . SER A 1 5  ? -14.105 6.360   5.961   1.00 0.00 ? 5   SER A CA   9  
ATOM   5535  C  C    . SER A 1 5  ? -12.706 5.821   6.239   1.00 0.00 ? 5   SER A C    9  
ATOM   5536  O  O    . SER A 1 5  ? -11.708 6.505   6.013   1.00 0.00 ? 5   SER A O    9  
ATOM   5537  C  CB   . SER A 1 5  ? -14.688 5.682   4.720   1.00 0.00 ? 5   SER A CB   9  
ATOM   5538  O  OG   . SER A 1 5  ? -14.856 4.291   4.930   1.00 0.00 ? 5   SER A OG   9  
ATOM   5539  H  H    . SER A 1 5  ? -13.438 8.199   5.151   1.00 0.00 ? 5   SER A H    9  
ATOM   5540  H  HA   . SER A 1 5  ? -14.737 6.143   6.809   1.00 0.00 ? 5   SER A HA   9  
ATOM   5541  H  HB2  . SER A 1 5  ? -15.649 6.118   4.492   1.00 0.00 ? 5   SER A HB2  9  
ATOM   5542  H  HB3  . SER A 1 5  ? -14.019 5.830   3.885   1.00 0.00 ? 5   SER A HB3  9  
ATOM   5543  H  HG   . SER A 1 5  ? -14.591 3.813   4.141   1.00 0.00 ? 5   SER A HG   9  
ATOM   5544  N  N    . SER A 1 6  ? -12.640 4.588   6.732   1.00 0.00 ? 6   SER A N    9  
ATOM   5545  C  CA   . SER A 1 6  ? -11.364 3.956   7.046   1.00 0.00 ? 6   SER A CA   9  
ATOM   5546  C  C    . SER A 1 6  ? -11.187 2.666   6.251   1.00 0.00 ? 6   SER A C    9  
ATOM   5547  O  O    . SER A 1 6  ? -12.083 2.244   5.522   1.00 0.00 ? 6   SER A O    9  
ATOM   5548  C  CB   . SER A 1 6  ? -11.270 3.663   8.544   1.00 0.00 ? 6   SER A CB   9  
ATOM   5549  O  OG   . SER A 1 6  ? -12.290 2.768   8.954   1.00 0.00 ? 6   SER A OG   9  
ATOM   5550  H  H    . SER A 1 6  ? -13.471 4.092   6.891   1.00 0.00 ? 6   SER A H    9  
ATOM   5551  H  HA   . SER A 1 6  ? -10.578 4.644   6.772   1.00 0.00 ? 6   SER A HA   9  
ATOM   5552  H  HB2  . SER A 1 6  ? -10.310 3.221   8.763   1.00 0.00 ? 6   SER A HB2  9  
ATOM   5553  H  HB3  . SER A 1 6  ? -11.375 4.587   9.096   1.00 0.00 ? 6   SER A HB3  9  
ATOM   5554  H  HG   . SER A 1 6  ? -12.548 2.968   9.856   1.00 0.00 ? 6   SER A HG   9  
ATOM   5555  N  N    . GLY A 1 7  ? -10.022 2.042   6.399   1.00 0.00 ? 7   GLY A N    9  
ATOM   5556  C  CA   . GLY A 1 7  ? -9.746  0.806   5.690   1.00 0.00 ? 7   GLY A CA   9  
ATOM   5557  C  C    . GLY A 1 7  ? -9.772  -0.404  6.603   1.00 0.00 ? 7   GLY A C    9  
ATOM   5558  O  O    . GLY A 1 7  ? -9.721  -0.269  7.826   1.00 0.00 ? 7   GLY A O    9  
ATOM   5559  H  H    . GLY A 1 7  ? -9.343  2.425   6.995   1.00 0.00 ? 7   GLY A H    9  
ATOM   5560  H  HA2  . GLY A 1 7  ? -10.487 0.676   4.916   1.00 0.00 ? 7   GLY A HA2  9  
ATOM   5561  H  HA3  . GLY A 1 7  ? -8.770  0.877   5.233   1.00 0.00 ? 7   GLY A HA3  9  
ATOM   5562  N  N    . SER A 1 8  ? -9.854  -1.590  6.009   1.00 0.00 ? 8   SER A N    9  
ATOM   5563  C  CA   . SER A 1 8  ? -9.892  -2.829  6.777   1.00 0.00 ? 8   SER A CA   9  
ATOM   5564  C  C    . SER A 1 8  ? -8.933  -3.860  6.192   1.00 0.00 ? 8   SER A C    9  
ATOM   5565  O  O    . SER A 1 8  ? -8.772  -3.956  4.974   1.00 0.00 ? 8   SER A O    9  
ATOM   5566  C  CB   . SER A 1 8  ? -11.313 -3.394  6.802   1.00 0.00 ? 8   SER A CB   9  
ATOM   5567  O  OG   . SER A 1 8  ? -11.508 -4.236  7.925   1.00 0.00 ? 8   SER A OG   9  
ATOM   5568  H  H    . SER A 1 8  ? -9.891  -1.632  5.030   1.00 0.00 ? 8   SER A H    9  
ATOM   5569  H  HA   . SER A 1 8  ? -9.586  -2.602  7.787   1.00 0.00 ? 8   SER A HA   9  
ATOM   5570  H  HB2  . SER A 1 8  ? -12.021 -2.580  6.851   1.00 0.00 ? 8   SER A HB2  9  
ATOM   5571  H  HB3  . SER A 1 8  ? -11.486 -3.967  5.903   1.00 0.00 ? 8   SER A HB3  9  
ATOM   5572  H  HG   . SER A 1 8  ? -11.552 -3.702  8.722   1.00 0.00 ? 8   SER A HG   9  
ATOM   5573  N  N    . LEU A 1 9  ? -8.297  -4.631  7.067   1.00 0.00 ? 9   LEU A N    9  
ATOM   5574  C  CA   . LEU A 1 9  ? -7.353  -5.657  6.639   1.00 0.00 ? 9   LEU A CA   9  
ATOM   5575  C  C    . LEU A 1 9  ? -8.081  -6.836  6.002   1.00 0.00 ? 9   LEU A C    9  
ATOM   5576  O  O    . LEU A 1 9  ? -8.816  -7.560  6.673   1.00 0.00 ? 9   LEU A O    9  
ATOM   5577  C  CB   . LEU A 1 9  ? -6.520  -6.140  7.829   1.00 0.00 ? 9   LEU A CB   9  
ATOM   5578  C  CG   . LEU A 1 9  ? -5.460  -5.166  8.345   1.00 0.00 ? 9   LEU A CG   9  
ATOM   5579  C  CD1  . LEU A 1 9  ? -4.927  -5.624  9.694   1.00 0.00 ? 9   LEU A CD1  9  
ATOM   5580  C  CD2  . LEU A 1 9  ? -4.326  -5.030  7.339   1.00 0.00 ? 9   LEU A CD2  9  
ATOM   5581  H  H    . LEU A 1 9  ? -8.466  -4.508  8.024   1.00 0.00 ? 9   LEU A H    9  
ATOM   5582  H  HA   . LEU A 1 9  ? -6.695  -5.216  5.905   1.00 0.00 ? 9   LEU A HA   9  
ATOM   5583  H  HB2  . LEU A 1 9  ? -7.197  -6.352  8.642   1.00 0.00 ? 9   LEU A HB2  9  
ATOM   5584  H  HB3  . LEU A 1 9  ? -6.019  -7.050  7.532   1.00 0.00 ? 9   LEU A HB3  9  
ATOM   5585  H  HG   . LEU A 1 9  ? -5.909  -4.192  8.477   1.00 0.00 ? 9   LEU A HG   9  
ATOM   5586  H  HD11 . LEU A 1 9  ? -4.233  -4.889  10.074  1.00 0.00 ? 9   LEU A HD11 9  
ATOM   5587  H  HD12 . LEU A 1 9  ? -4.421  -6.571  9.578   1.00 0.00 ? 9   LEU A HD12 9  
ATOM   5588  H  HD13 . LEU A 1 9  ? -5.748  -5.736  10.386  1.00 0.00 ? 9   LEU A HD13 9  
ATOM   5589  H  HD21 . LEU A 1 9  ? -4.077  -3.987  7.216   1.00 0.00 ? 9   LEU A HD21 9  
ATOM   5590  H  HD22 . LEU A 1 9  ? -4.636  -5.441  6.390   1.00 0.00 ? 9   LEU A HD22 9  
ATOM   5591  H  HD23 . LEU A 1 9  ? -3.460  -5.568  7.698   1.00 0.00 ? 9   LEU A HD23 9  
ATOM   5592  N  N    . MET A 1 10 ? -7.870  -7.023  4.704   1.00 0.00 ? 10  MET A N    9  
ATOM   5593  C  CA   . MET A 1 10 ? -8.504  -8.117  3.977   1.00 0.00 ? 10  MET A CA   9  
ATOM   5594  C  C    . MET A 1 10 ? -7.889  -9.457  4.366   1.00 0.00 ? 10  MET A C    9  
ATOM   5595  O  O    . MET A 1 10 ? -6.895  -9.508  5.091   1.00 0.00 ? 10  MET A O    9  
ATOM   5596  C  CB   . MET A 1 10 ? -8.371  -7.900  2.468   1.00 0.00 ? 10  MET A CB   9  
ATOM   5597  C  CG   . MET A 1 10 ? -8.939  -6.573  1.992   1.00 0.00 ? 10  MET A CG   9  
ATOM   5598  S  SD   . MET A 1 10 ? -9.426  -6.609  0.257   1.00 0.00 ? 10  MET A SD   9  
ATOM   5599  C  CE   . MET A 1 10 ? -11.134 -7.130  0.396   1.00 0.00 ? 10  MET A CE   9  
ATOM   5600  H  H    . MET A 1 10 ? -7.273  -6.413  4.222   1.00 0.00 ? 10  MET A H    9  
ATOM   5601  H  HA   . MET A 1 10 ? -9.551  -8.125  4.239   1.00 0.00 ? 10  MET A HA   9  
ATOM   5602  H  HB2  . MET A 1 10 ? -7.325  -7.936  2.203   1.00 0.00 ? 10  MET A HB2  9  
ATOM   5603  H  HB3  . MET A 1 10 ? -8.891  -8.695  1.954   1.00 0.00 ? 10  MET A HB3  9  
ATOM   5604  H  HG2  . MET A 1 10 ? -9.806  -6.332  2.589   1.00 0.00 ? 10  MET A HG2  9  
ATOM   5605  H  HG3  . MET A 1 10 ? -8.188  -5.808  2.126   1.00 0.00 ? 10  MET A HG3  9  
ATOM   5606  H  HE1  . MET A 1 10 ? -11.626 -7.009  -0.559  1.00 0.00 ? 10  MET A HE1  9  
ATOM   5607  H  HE2  . MET A 1 10 ? -11.171 -8.169  0.690   1.00 0.00 ? 10  MET A HE2  9  
ATOM   5608  H  HE3  . MET A 1 10 ? -11.635 -6.527  1.138   1.00 0.00 ? 10  MET A HE3  9  
ATOM   5609  N  N    . ASP A 1 11 ? -8.486  -10.540 3.881   1.00 0.00 ? 11  ASP A N    9  
ATOM   5610  C  CA   . ASP A 1 11 ? -7.996  -11.882 4.178   1.00 0.00 ? 11  ASP A CA   9  
ATOM   5611  C  C    . ASP A 1 11 ? -6.991  -12.338 3.125   1.00 0.00 ? 11  ASP A C    9  
ATOM   5612  O  O    . ASP A 1 11 ? -6.688  -13.526 3.015   1.00 0.00 ? 11  ASP A O    9  
ATOM   5613  C  CB   . ASP A 1 11 ? -9.161  -12.869 4.251   1.00 0.00 ? 11  ASP A CB   9  
ATOM   5614  C  CG   . ASP A 1 11 ? -10.073 -12.603 5.432   1.00 0.00 ? 11  ASP A CG   9  
ATOM   5615  O  OD1  . ASP A 1 11 ? -9.567  -12.559 6.573   1.00 0.00 ? 11  ASP A OD1  9  
ATOM   5616  O  OD2  . ASP A 1 11 ? -11.292 -12.439 5.216   1.00 0.00 ? 11  ASP A OD2  9  
ATOM   5617  H  H    . ASP A 1 11 ? -9.275  -10.436 3.309   1.00 0.00 ? 11  ASP A H    9  
ATOM   5618  H  HA   . ASP A 1 11 ? -7.503  -11.849 5.138   1.00 0.00 ? 11  ASP A HA   9  
ATOM   5619  H  HB2  . ASP A 1 11 ? -9.746  -12.794 3.345   1.00 0.00 ? 11  ASP A HB2  9  
ATOM   5620  H  HB3  . ASP A 1 11 ? -8.770  -13.872 4.339   1.00 0.00 ? 11  ASP A HB3  9  
ATOM   5621  N  N    . VAL A 1 12 ? -6.478  -11.386 2.352   1.00 0.00 ? 12  VAL A N    9  
ATOM   5622  C  CA   . VAL A 1 12 ? -5.507  -11.691 1.307   1.00 0.00 ? 12  VAL A CA   9  
ATOM   5623  C  C    . VAL A 1 12 ? -4.166  -11.024 1.593   1.00 0.00 ? 12  VAL A C    9  
ATOM   5624  O  O    . VAL A 1 12 ? -4.108  -9.851  1.961   1.00 0.00 ? 12  VAL A O    9  
ATOM   5625  C  CB   . VAL A 1 12 ? -6.009  -11.236 -0.076  1.00 0.00 ? 12  VAL A CB   9  
ATOM   5626  C  CG1  . VAL A 1 12 ? -6.244  -9.733  -0.091  1.00 0.00 ? 12  VAL A CG1  9  
ATOM   5627  C  CG2  . VAL A 1 12 ? -5.022  -11.641 -1.160  1.00 0.00 ? 12  VAL A CG2  9  
ATOM   5628  H  H    . VAL A 1 12 ? -6.758  -10.457 2.487   1.00 0.00 ? 12  VAL A H    9  
ATOM   5629  H  HA   . VAL A 1 12 ? -5.368  -12.762 1.282   1.00 0.00 ? 12  VAL A HA   9  
ATOM   5630  H  HB   . VAL A 1 12 ? -6.951  -11.727 -0.274  1.00 0.00 ? 12  VAL A HB   9  
ATOM   5631  H  HG11 . VAL A 1 12 ? -7.011  -9.496  -0.815  1.00 0.00 ? 12  VAL A HG11 9  
ATOM   5632  H  HG12 . VAL A 1 12 ? -6.560  -9.408  0.889   1.00 0.00 ? 12  VAL A HG12 9  
ATOM   5633  H  HG13 . VAL A 1 12 ? -5.328  -9.228  -0.361  1.00 0.00 ? 12  VAL A HG13 9  
ATOM   5634  H  HG21 . VAL A 1 12 ? -4.018  -11.606 -0.765  1.00 0.00 ? 12  VAL A HG21 9  
ATOM   5635  H  HG22 . VAL A 1 12 ? -5.245  -12.644 -1.493  1.00 0.00 ? 12  VAL A HG22 9  
ATOM   5636  H  HG23 . VAL A 1 12 ? -5.104  -10.959 -1.995  1.00 0.00 ? 12  VAL A HG23 9  
ATOM   5637  N  N    . LYS A 1 13 ? -3.087  -11.781 1.420   1.00 0.00 ? 13  LYS A N    9  
ATOM   5638  C  CA   . LYS A 1 13 ? -1.744  -11.265 1.657   1.00 0.00 ? 13  LYS A CA   9  
ATOM   5639  C  C    . LYS A 1 13 ? -1.432  -10.107 0.715   1.00 0.00 ? 13  LYS A C    9  
ATOM   5640  O  O    . LYS A 1 13 ? -1.958  -10.038 -0.396  1.00 0.00 ? 13  LYS A O    9  
ATOM   5641  C  CB   . LYS A 1 13 ? -0.709  -12.377 1.476   1.00 0.00 ? 13  LYS A CB   9  
ATOM   5642  C  CG   . LYS A 1 13 ? -0.557  -13.272 2.694   1.00 0.00 ? 13  LYS A CG   9  
ATOM   5643  C  CD   . LYS A 1 13 ? -1.729  -14.230 2.831   1.00 0.00 ? 13  LYS A CD   9  
ATOM   5644  C  CE   . LYS A 1 13 ? -1.652  -15.354 1.809   1.00 0.00 ? 13  LYS A CE   9  
ATOM   5645  N  NZ   . LYS A 1 13 ? -2.829  -16.263 1.895   1.00 0.00 ? 13  LYS A NZ   9  
ATOM   5646  H  H    . LYS A 1 13 ? -3.197  -12.710 1.125   1.00 0.00 ? 13  LYS A H    9  
ATOM   5647  H  HA   . LYS A 1 13 ? -1.701  -10.907 2.675   1.00 0.00 ? 13  LYS A HA   9  
ATOM   5648  H  HB2  . LYS A 1 13 ? -1.002  -12.992 0.638   1.00 0.00 ? 13  LYS A HB2  9  
ATOM   5649  H  HB3  . LYS A 1 13 ? 0.251   -11.928 1.264   1.00 0.00 ? 13  LYS A HB3  9  
ATOM   5650  H  HG2  . LYS A 1 13 ? 0.353   -13.845 2.598   1.00 0.00 ? 13  LYS A HG2  9  
ATOM   5651  H  HG3  . LYS A 1 13 ? -0.504  -12.654 3.579   1.00 0.00 ? 13  LYS A HG3  9  
ATOM   5652  H  HD2  . LYS A 1 13 ? -1.718  -14.658 3.822   1.00 0.00 ? 13  LYS A HD2  9  
ATOM   5653  H  HD3  . LYS A 1 13 ? -2.649  -13.683 2.683   1.00 0.00 ? 13  LYS A HD3  9  
ATOM   5654  H  HE2  . LYS A 1 13 ? -1.613  -14.922 0.821   1.00 0.00 ? 13  LYS A HE2  9  
ATOM   5655  H  HE3  . LYS A 1 13 ? -0.753  -15.925 1.989   1.00 0.00 ? 13  LYS A HE3  9  
ATOM   5656  H  HZ1  . LYS A 1 13 ? -3.635  -15.853 1.382   1.00 0.00 ? 13  LYS A HZ1  9  
ATOM   5657  H  HZ2  . LYS A 1 13 ? -3.099  -16.404 2.890   1.00 0.00 ? 13  LYS A HZ2  9  
ATOM   5658  H  HZ3  . LYS A 1 13 ? -2.598  -17.186 1.477   1.00 0.00 ? 13  LYS A HZ3  9  
ATOM   5659  N  N    . CYS A 1 14 ? -0.572  -9.199  1.164   1.00 0.00 ? 14  CYS A N    9  
ATOM   5660  C  CA   . CYS A 1 14 ? -0.188  -8.044  0.361   1.00 0.00 ? 14  CYS A CA   9  
ATOM   5661  C  C    . CYS A 1 14 ? 0.342   -8.481  -1.001  1.00 0.00 ? 14  CYS A C    9  
ATOM   5662  O  O    . CYS A 1 14 ? 1.122   -9.428  -1.100  1.00 0.00 ? 14  CYS A O    9  
ATOM   5663  C  CB   . CYS A 1 14 ? 0.872   -7.218  1.092   1.00 0.00 ? 14  CYS A CB   9  
ATOM   5664  S  SG   . CYS A 1 14 ? 1.516   -5.814  0.127   1.00 0.00 ? 14  CYS A SG   9  
ATOM   5665  H  H    . CYS A 1 14 ? -0.185  -9.309  2.059   1.00 0.00 ? 14  CYS A H    9  
ATOM   5666  H  HA   . CYS A 1 14 ? -1.068  -7.436  0.214   1.00 0.00 ? 14  CYS A HA   9  
ATOM   5667  H  HB2  . CYS A 1 14 ? 0.444   -6.822  2.002   1.00 0.00 ? 14  CYS A HB2  9  
ATOM   5668  H  HB3  . CYS A 1 14 ? 1.706   -7.857  1.341   1.00 0.00 ? 14  CYS A HB3  9  
ATOM   5669  N  N    . GLU A 1 15 ? -0.088  -7.784  -2.049  1.00 0.00 ? 15  GLU A N    9  
ATOM   5670  C  CA   . GLU A 1 15 ? 0.343   -8.101  -3.405  1.00 0.00 ? 15  GLU A CA   9  
ATOM   5671  C  C    . GLU A 1 15 ? 1.783   -8.604  -3.415  1.00 0.00 ? 15  GLU A C    9  
ATOM   5672  O  O    . GLU A 1 15 ? 2.067   -9.702  -3.896  1.00 0.00 ? 15  GLU A O    9  
ATOM   5673  C  CB   . GLU A 1 15 ? 0.215   -6.870  -4.305  1.00 0.00 ? 15  GLU A CB   9  
ATOM   5674  C  CG   . GLU A 1 15 ? 0.678   -7.109  -5.732  1.00 0.00 ? 15  GLU A CG   9  
ATOM   5675  C  CD   . GLU A 1 15 ? -0.359  -7.832  -6.569  1.00 0.00 ? 15  GLU A CD   9  
ATOM   5676  O  OE1  . GLU A 1 15 ? -0.730  -8.967  -6.203  1.00 0.00 ? 15  GLU A OE1  9  
ATOM   5677  O  OE2  . GLU A 1 15 ? -0.800  -7.263  -7.590  1.00 0.00 ? 15  GLU A OE2  9  
ATOM   5678  H  H    . GLU A 1 15 ? -0.710  -7.041  -1.906  1.00 0.00 ? 15  GLU A H    9  
ATOM   5679  H  HA   . GLU A 1 15 ? -0.300  -8.881  -3.784  1.00 0.00 ? 15  GLU A HA   9  
ATOM   5680  H  HB2  . GLU A 1 15 ? -0.820  -6.564  -4.331  1.00 0.00 ? 15  GLU A HB2  9  
ATOM   5681  H  HB3  . GLU A 1 15 ? 0.807   -6.070  -3.886  1.00 0.00 ? 15  GLU A HB3  9  
ATOM   5682  H  HG2  . GLU A 1 15 ? 0.889   -6.156  -6.193  1.00 0.00 ? 15  GLU A HG2  9  
ATOM   5683  H  HG3  . GLU A 1 15 ? 1.580   -7.704  -5.710  1.00 0.00 ? 15  GLU A HG3  9  
ATOM   5684  N  N    . THR A 1 16 ? 2.691   -7.793  -2.880  1.00 0.00 ? 16  THR A N    9  
ATOM   5685  C  CA   . THR A 1 16 ? 4.102   -8.154  -2.828  1.00 0.00 ? 16  THR A CA   9  
ATOM   5686  C  C    . THR A 1 16 ? 4.295   -9.531  -2.203  1.00 0.00 ? 16  THR A C    9  
ATOM   5687  O  O    . THR A 1 16 ? 3.859   -9.797  -1.083  1.00 0.00 ? 16  THR A O    9  
ATOM   5688  C  CB   . THR A 1 16 ? 4.917   -7.120  -2.027  1.00 0.00 ? 16  THR A CB   9  
ATOM   5689  O  OG1  . THR A 1 16 ? 4.871   -5.847  -2.681  1.00 0.00 ? 16  THR A OG1  9  
ATOM   5690  C  CG2  . THR A 1 16 ? 6.363   -7.568  -1.879  1.00 0.00 ? 16  THR A CG2  9  
ATOM   5691  H  H    . THR A 1 16 ? 2.403   -6.931  -2.513  1.00 0.00 ? 16  THR A H    9  
ATOM   5692  H  HA   . THR A 1 16 ? 4.479   -8.172  -3.840  1.00 0.00 ? 16  THR A HA   9  
ATOM   5693  H  HB   . THR A 1 16 ? 4.482   -7.026  -1.042  1.00 0.00 ? 16  THR A HB   9  
ATOM   5694  H  HG1  . THR A 1 16 ? 4.414   -5.216  -2.121  1.00 0.00 ? 16  THR A HG1  9  
ATOM   5695  H  HG21 . THR A 1 16 ? 6.511   -7.987  -0.895  1.00 0.00 ? 16  THR A HG21 9  
ATOM   5696  H  HG22 . THR A 1 16 ? 7.018   -6.720  -2.011  1.00 0.00 ? 16  THR A HG22 9  
ATOM   5697  H  HG23 . THR A 1 16 ? 6.586   -8.316  -2.625  1.00 0.00 ? 16  THR A HG23 9  
ATOM   5698  N  N    . PRO A 1 17 ? 4.965   -10.428 -2.942  1.00 0.00 ? 17  PRO A N    9  
ATOM   5699  C  CA   . PRO A 1 17 ? 5.232   -11.793 -2.479  1.00 0.00 ? 17  PRO A CA   9  
ATOM   5700  C  C    . PRO A 1 17 ? 6.244   -11.831 -1.338  1.00 0.00 ? 17  PRO A C    9  
ATOM   5701  O  O    . PRO A 1 17 ? 6.485   -12.881 -0.745  1.00 0.00 ? 17  PRO A O    9  
ATOM   5702  C  CB   . PRO A 1 17 ? 5.800   -12.484 -3.721  1.00 0.00 ? 17  PRO A CB   9  
ATOM   5703  C  CG   . PRO A 1 17 ? 6.382   -11.380 -4.535  1.00 0.00 ? 17  PRO A CG   9  
ATOM   5704  C  CD   . PRO A 1 17 ? 5.513   -10.179 -4.285  1.00 0.00 ? 17  PRO A CD   9  
ATOM   5705  H  HA   . PRO A 1 17 ? 4.325   -12.292 -2.170  1.00 0.00 ? 17  PRO A HA   9  
ATOM   5706  H  HB2  . PRO A 1 17 ? 6.556   -13.198 -3.425  1.00 0.00 ? 17  PRO A HB2  9  
ATOM   5707  H  HB3  . PRO A 1 17 ? 5.007   -12.989 -4.251  1.00 0.00 ? 17  PRO A HB3  9  
ATOM   5708  H  HG2  . PRO A 1 17 ? 7.395   -11.184 -4.217  1.00 0.00 ? 17  PRO A HG2  9  
ATOM   5709  H  HG3  . PRO A 1 17 ? 6.361   -11.646 -5.582  1.00 0.00 ? 17  PRO A HG3  9  
ATOM   5710  H  HD2  . PRO A 1 17 ? 6.105   -9.276  -4.299  1.00 0.00 ? 17  PRO A HD2  9  
ATOM   5711  H  HD3  . PRO A 1 17 ? 4.723   -10.125 -5.020  1.00 0.00 ? 17  PRO A HD3  9  
ATOM   5712  N  N    . ASN A 1 18 ? 6.831   -10.677 -1.036  1.00 0.00 ? 18  ASN A N    9  
ATOM   5713  C  CA   . ASN A 1 18 ? 7.818   -10.579 0.034   1.00 0.00 ? 18  ASN A CA   9  
ATOM   5714  C  C    . ASN A 1 18 ? 7.231   -9.871  1.251   1.00 0.00 ? 18  ASN A C    9  
ATOM   5715  O  O    . ASN A 1 18 ? 7.876   -9.771  2.295   1.00 0.00 ? 18  ASN A O    9  
ATOM   5716  C  CB   . ASN A 1 18 ? 9.060   -9.832  -0.456  1.00 0.00 ? 18  ASN A CB   9  
ATOM   5717  C  CG   . ASN A 1 18 ? 9.658   -10.458 -1.701  1.00 0.00 ? 18  ASN A CG   9  
ATOM   5718  O  OD1  . ASN A 1 18 ? 9.133   -10.299 -2.803  1.00 0.00 ? 18  ASN A OD1  9  
ATOM   5719  N  ND2  . ASN A 1 18 ? 10.763  -11.175 -1.529  1.00 0.00 ? 18  ASN A ND2  9  
ATOM   5720  H  H    . ASN A 1 18 ? 6.597   -9.874  -1.545  1.00 0.00 ? 18  ASN A H    9  
ATOM   5721  H  HA   . ASN A 1 18 ? 8.100   -11.582 0.316   1.00 0.00 ? 18  ASN A HA   9  
ATOM   5722  H  HB2  . ASN A 1 18 ? 8.791   -8.811  -0.684  1.00 0.00 ? 18  ASN A HB2  9  
ATOM   5723  H  HB3  . ASN A 1 18 ? 9.807   -9.838  0.323   1.00 0.00 ? 18  ASN A HB3  9  
ATOM   5724  H  HD21 . ASN A 1 18 ? 11.125  -11.259 -0.622  1.00 0.00 ? 18  ASN A HD21 9  
ATOM   5725  H  HD22 . ASN A 1 18 ? 11.171  -11.590 -2.317  1.00 0.00 ? 18  ASN A HD22 9  
ATOM   5726  N  N    . CYS A 1 19 ? 6.004   -9.382  1.109   1.00 0.00 ? 19  CYS A N    9  
ATOM   5727  C  CA   . CYS A 1 19 ? 5.328   -8.683  2.196   1.00 0.00 ? 19  CYS A CA   9  
ATOM   5728  C  C    . CYS A 1 19 ? 4.346   -9.607  2.910   1.00 0.00 ? 19  CYS A C    9  
ATOM   5729  O  O    . CYS A 1 19 ? 3.273   -9.928  2.398   1.00 0.00 ? 19  CYS A O    9  
ATOM   5730  C  CB   . CYS A 1 19 ? 4.592   -7.454  1.660   1.00 0.00 ? 19  CYS A CB   9  
ATOM   5731  S  SG   . CYS A 1 19 ? 4.101   -6.262  2.947   1.00 0.00 ? 19  CYS A SG   9  
ATOM   5732  H  H    . CYS A 1 19 ? 5.540   -9.493  0.252   1.00 0.00 ? 19  CYS A H    9  
ATOM   5733  H  HA   . CYS A 1 19 ? 6.079   -8.362  2.902   1.00 0.00 ? 19  CYS A HA   9  
ATOM   5734  H  HB2  . CYS A 1 19 ? 5.232   -6.936  0.961   1.00 0.00 ? 19  CYS A HB2  9  
ATOM   5735  H  HB3  . CYS A 1 19 ? 3.696   -7.775  1.149   1.00 0.00 ? 19  CYS A HB3  9  
ATOM   5736  N  N    . PRO A 1 20 ? 4.720   -10.047 4.120   1.00 0.00 ? 20  PRO A N    9  
ATOM   5737  C  CA   . PRO A 1 20 ? 3.886   -10.939 4.931   1.00 0.00 ? 20  PRO A CA   9  
ATOM   5738  C  C    . PRO A 1 20 ? 2.638   -10.244 5.461   1.00 0.00 ? 20  PRO A C    9  
ATOM   5739  O  O    . PRO A 1 20 ? 1.735   -10.888 5.995   1.00 0.00 ? 20  PRO A O    9  
ATOM   5740  C  CB   . PRO A 1 20 ? 4.810   -11.335 6.086   1.00 0.00 ? 20  PRO A CB   9  
ATOM   5741  C  CG   . PRO A 1 20 ? 5.785   -10.214 6.192   1.00 0.00 ? 20  PRO A CG   9  
ATOM   5742  C  CD   . PRO A 1 20 ? 5.986   -9.706  4.792   1.00 0.00 ? 20  PRO A CD   9  
ATOM   5743  H  HA   . PRO A 1 20 ? 3.598   -11.822 4.380   1.00 0.00 ? 20  PRO A HA   9  
ATOM   5744  H  HB2  . PRO A 1 20 ? 4.230   -11.443 6.992   1.00 0.00 ? 20  PRO A HB2  9  
ATOM   5745  H  HB3  . PRO A 1 20 ? 5.303   -12.267 5.855   1.00 0.00 ? 20  PRO A HB3  9  
ATOM   5746  H  HG2  . PRO A 1 20 ? 5.382   -9.435  6.820   1.00 0.00 ? 20  PRO A HG2  9  
ATOM   5747  H  HG3  . PRO A 1 20 ? 6.719   -10.578 6.596   1.00 0.00 ? 20  PRO A HG3  9  
ATOM   5748  H  HD2  . PRO A 1 20 ? 6.144   -8.637  4.797   1.00 0.00 ? 20  PRO A HD2  9  
ATOM   5749  H  HD3  . PRO A 1 20 ? 6.818   -10.209 4.323   1.00 0.00 ? 20  PRO A HD3  9  
ATOM   5750  N  N    . PHE A 1 21 ? 2.592   -8.924  5.311   1.00 0.00 ? 21  PHE A N    9  
ATOM   5751  C  CA   . PHE A 1 21 ? 1.454   -8.140  5.776   1.00 0.00 ? 21  PHE A CA   9  
ATOM   5752  C  C    . PHE A 1 21 ? 0.290   -8.236  4.793   1.00 0.00 ? 21  PHE A C    9  
ATOM   5753  O  O    . PHE A 1 21 ? 0.492   -8.346  3.583   1.00 0.00 ? 21  PHE A O    9  
ATOM   5754  C  CB   . PHE A 1 21 ? 1.858   -6.677  5.964   1.00 0.00 ? 21  PHE A CB   9  
ATOM   5755  C  CG   . PHE A 1 21 ? 2.789   -6.456  7.122   1.00 0.00 ? 21  PHE A CG   9  
ATOM   5756  C  CD1  . PHE A 1 21 ? 4.161   -6.552  6.952   1.00 0.00 ? 21  PHE A CD1  9  
ATOM   5757  C  CD2  . PHE A 1 21 ? 2.293   -6.152  8.379   1.00 0.00 ? 21  PHE A CD2  9  
ATOM   5758  C  CE1  . PHE A 1 21 ? 5.020   -6.351  8.015   1.00 0.00 ? 21  PHE A CE1  9  
ATOM   5759  C  CE2  . PHE A 1 21 ? 3.148   -5.949  9.446   1.00 0.00 ? 21  PHE A CE2  9  
ATOM   5760  C  CZ   . PHE A 1 21 ? 4.513   -6.048  9.264   1.00 0.00 ? 21  PHE A CZ   9  
ATOM   5761  H  H    . PHE A 1 21 ? 3.343   -8.466  4.877   1.00 0.00 ? 21  PHE A H    9  
ATOM   5762  H  HA   . PHE A 1 21 ? 1.140   -8.544  6.726   1.00 0.00 ? 21  PHE A HA   9  
ATOM   5763  H  HB2  . PHE A 1 21 ? 2.353   -6.329  5.070   1.00 0.00 ? 21  PHE A HB2  9  
ATOM   5764  H  HB3  . PHE A 1 21 ? 0.971   -6.085  6.133   1.00 0.00 ? 21  PHE A HB3  9  
ATOM   5765  H  HD1  . PHE A 1 21 ? 4.559   -6.788  5.976   1.00 0.00 ? 21  PHE A HD1  9  
ATOM   5766  H  HD2  . PHE A 1 21 ? 1.225   -6.075  8.523   1.00 0.00 ? 21  PHE A HD2  9  
ATOM   5767  H  HE1  . PHE A 1 21 ? 6.088   -6.428  7.870   1.00 0.00 ? 21  PHE A HE1  9  
ATOM   5768  H  HE2  . PHE A 1 21 ? 2.747   -5.712  10.421  1.00 0.00 ? 21  PHE A HE2  9  
ATOM   5769  H  HZ   . PHE A 1 21 ? 5.182   -5.890  10.097  1.00 0.00 ? 21  PHE A HZ   9  
ATOM   5770  N  N    . PHE A 1 22 ? -0.928  -8.194  5.322   1.00 0.00 ? 22  PHE A N    9  
ATOM   5771  C  CA   . PHE A 1 22 ? -2.125  -8.277  4.492   1.00 0.00 ? 22  PHE A CA   9  
ATOM   5772  C  C    . PHE A 1 22 ? -2.453  -6.922  3.873   1.00 0.00 ? 22  PHE A C    9  
ATOM   5773  O  O    . PHE A 1 22 ? -2.102  -5.877  4.420   1.00 0.00 ? 22  PHE A O    9  
ATOM   5774  C  CB   . PHE A 1 22 ? -3.312  -8.772  5.321   1.00 0.00 ? 22  PHE A CB   9  
ATOM   5775  C  CG   . PHE A 1 22 ? -3.156  -10.185 5.807   1.00 0.00 ? 22  PHE A CG   9  
ATOM   5776  C  CD1  . PHE A 1 22 ? -3.345  -11.253 4.944   1.00 0.00 ? 22  PHE A CD1  9  
ATOM   5777  C  CD2  . PHE A 1 22 ? -2.820  -10.445 7.126   1.00 0.00 ? 22  PHE A CD2  9  
ATOM   5778  C  CE1  . PHE A 1 22 ? -3.203  -12.554 5.389   1.00 0.00 ? 22  PHE A CE1  9  
ATOM   5779  C  CE2  . PHE A 1 22 ? -2.676  -11.744 7.576   1.00 0.00 ? 22  PHE A CE2  9  
ATOM   5780  C  CZ   . PHE A 1 22 ? -2.867  -12.800 6.706   1.00 0.00 ? 22  PHE A CZ   9  
ATOM   5781  H  H    . PHE A 1 22 ? -1.025  -8.105  6.293   1.00 0.00 ? 22  PHE A H    9  
ATOM   5782  H  HA   . PHE A 1 22 ? -1.930  -8.984  3.701   1.00 0.00 ? 22  PHE A HA   9  
ATOM   5783  H  HB2  . PHE A 1 22 ? -3.429  -8.136  6.185   1.00 0.00 ? 22  PHE A HB2  9  
ATOM   5784  H  HB3  . PHE A 1 22 ? -4.207  -8.724  4.719   1.00 0.00 ? 22  PHE A HB3  9  
ATOM   5785  H  HD1  . PHE A 1 22 ? -3.606  -11.063 3.914   1.00 0.00 ? 22  PHE A HD1  9  
ATOM   5786  H  HD2  . PHE A 1 22 ? -2.670  -9.620  7.807   1.00 0.00 ? 22  PHE A HD2  9  
ATOM   5787  H  HE1  . PHE A 1 22 ? -3.352  -13.378 4.707   1.00 0.00 ? 22  PHE A HE1  9  
ATOM   5788  H  HE2  . PHE A 1 22 ? -2.413  -11.932 8.606   1.00 0.00 ? 22  PHE A HE2  9  
ATOM   5789  H  HZ   . PHE A 1 22 ? -2.755  -13.815 7.056   1.00 0.00 ? 22  PHE A HZ   9  
ATOM   5790  N  N    . MET A 1 23 ? -3.127  -6.949  2.728   1.00 0.00 ? 23  MET A N    9  
ATOM   5791  C  CA   . MET A 1 23 ? -3.503  -5.723  2.034   1.00 0.00 ? 23  MET A CA   9  
ATOM   5792  C  C    . MET A 1 23 ? -4.913  -5.289  2.422   1.00 0.00 ? 23  MET A C    9  
ATOM   5793  O  O    . MET A 1 23 ? -5.874  -6.036  2.241   1.00 0.00 ? 23  MET A O    9  
ATOM   5794  C  CB   . MET A 1 23 ? -3.417  -5.922  0.519   1.00 0.00 ? 23  MET A CB   9  
ATOM   5795  C  CG   . MET A 1 23 ? -4.051  -7.217  0.040   1.00 0.00 ? 23  MET A CG   9  
ATOM   5796  S  SD   . MET A 1 23 ? -4.498  -7.167  -1.706  1.00 0.00 ? 23  MET A SD   9  
ATOM   5797  C  CE   . MET A 1 23 ? -3.431  -8.445  -2.366  1.00 0.00 ? 23  MET A CE   9  
ATOM   5798  H  H    . MET A 1 23 ? -3.378  -7.813  2.341   1.00 0.00 ? 23  MET A H    9  
ATOM   5799  H  HA   . MET A 1 23 ? -2.808  -4.950  2.326   1.00 0.00 ? 23  MET A HA   9  
ATOM   5800  H  HB2  . MET A 1 23 ? -3.917  -5.099  0.031   1.00 0.00 ? 23  MET A HB2  9  
ATOM   5801  H  HB3  . MET A 1 23 ? -2.377  -5.925  0.227   1.00 0.00 ? 23  MET A HB3  9  
ATOM   5802  H  HG2  . MET A 1 23 ? -3.350  -8.024  0.193   1.00 0.00 ? 23  MET A HG2  9  
ATOM   5803  H  HG3  . MET A 1 23 ? -4.942  -7.402  0.621   1.00 0.00 ? 23  MET A HG3  9  
ATOM   5804  H  HE1  . MET A 1 23 ? -3.684  -8.625  -3.401  1.00 0.00 ? 23  MET A HE1  9  
ATOM   5805  H  HE2  . MET A 1 23 ? -2.402  -8.126  -2.297  1.00 0.00 ? 23  MET A HE2  9  
ATOM   5806  H  HE3  . MET A 1 23 ? -3.565  -9.354  -1.799  1.00 0.00 ? 23  MET A HE3  9  
ATOM   5807  N  N    . SER A 1 24 ? -5.028  -4.077  2.957   1.00 0.00 ? 24  SER A N    9  
ATOM   5808  C  CA   . SER A 1 24 ? -6.321  -3.546  3.374   1.00 0.00 ? 24  SER A CA   9  
ATOM   5809  C  C    . SER A 1 24 ? -7.190  -3.219  2.164   1.00 0.00 ? 24  SER A C    9  
ATOM   5810  O  O    . SER A 1 24 ? -6.765  -3.375  1.019   1.00 0.00 ? 24  SER A O    9  
ATOM   5811  C  CB   . SER A 1 24 ? -6.128  -2.294  4.232   1.00 0.00 ? 24  SER A CB   9  
ATOM   5812  O  OG   . SER A 1 24 ? -5.964  -2.631  5.598   1.00 0.00 ? 24  SER A OG   9  
ATOM   5813  H  H    . SER A 1 24 ? -4.224  -3.529  3.076   1.00 0.00 ? 24  SER A H    9  
ATOM   5814  H  HA   . SER A 1 24 ? -6.815  -4.303  3.964   1.00 0.00 ? 24  SER A HA   9  
ATOM   5815  H  HB2  . SER A 1 24 ? -5.250  -1.763  3.897   1.00 0.00 ? 24  SER A HB2  9  
ATOM   5816  H  HB3  . SER A 1 24 ? -6.995  -1.656  4.132   1.00 0.00 ? 24  SER A HB3  9  
ATOM   5817  H  HG   . SER A 1 24 ? -5.034  -2.791  5.779   1.00 0.00 ? 24  SER A HG   9  
ATOM   5818  N  N    . VAL A 1 25 ? -8.411  -2.764  2.427   1.00 0.00 ? 25  VAL A N    9  
ATOM   5819  C  CA   . VAL A 1 25 ? -9.342  -2.414  1.360   1.00 0.00 ? 25  VAL A CA   9  
ATOM   5820  C  C    . VAL A 1 25 ? -8.974  -1.077  0.727   1.00 0.00 ? 25  VAL A C    9  
ATOM   5821  O  O    . VAL A 1 25 ? -9.292  -0.819  -0.433  1.00 0.00 ? 25  VAL A O    9  
ATOM   5822  C  CB   . VAL A 1 25 ? -10.790 -2.341  1.880   1.00 0.00 ? 25  VAL A CB   9  
ATOM   5823  C  CG1  . VAL A 1 25 ? -11.741 -1.951  0.759   1.00 0.00 ? 25  VAL A CG1  9  
ATOM   5824  C  CG2  . VAL A 1 25 ? -11.200 -3.669  2.500   1.00 0.00 ? 25  VAL A CG2  9  
ATOM   5825  H  H    . VAL A 1 25 ? -8.693  -2.661  3.359   1.00 0.00 ? 25  VAL A H    9  
ATOM   5826  H  HA   . VAL A 1 25 ? -9.291  -3.185  0.605   1.00 0.00 ? 25  VAL A HA   9  
ATOM   5827  H  HB   . VAL A 1 25 ? -10.839 -1.580  2.645   1.00 0.00 ? 25  VAL A HB   9  
ATOM   5828  H  HG11 . VAL A 1 25 ? -11.195 -1.889  -0.170  1.00 0.00 ? 25  VAL A HG11 9  
ATOM   5829  H  HG12 . VAL A 1 25 ? -12.520 -2.694  0.673   1.00 0.00 ? 25  VAL A HG12 9  
ATOM   5830  H  HG13 . VAL A 1 25 ? -12.183 -0.990  0.981   1.00 0.00 ? 25  VAL A HG13 9  
ATOM   5831  H  HG21 . VAL A 1 25 ? -10.975 -3.658  3.556   1.00 0.00 ? 25  VAL A HG21 9  
ATOM   5832  H  HG22 . VAL A 1 25 ? -12.260 -3.819  2.359   1.00 0.00 ? 25  VAL A HG22 9  
ATOM   5833  H  HG23 . VAL A 1 25 ? -10.656 -4.472  2.025   1.00 0.00 ? 25  VAL A HG23 9  
ATOM   5834  N  N    . ASN A 1 26 ? -8.300  -0.229  1.498   1.00 0.00 ? 26  ASN A N    9  
ATOM   5835  C  CA   . ASN A 1 26 ? -7.888  1.083   1.012   1.00 0.00 ? 26  ASN A CA   9  
ATOM   5836  C  C    . ASN A 1 26 ? -6.410  1.083   0.632   1.00 0.00 ? 26  ASN A C    9  
ATOM   5837  O  O    . ASN A 1 26 ? -5.860  2.109   0.230   1.00 0.00 ? 26  ASN A O    9  
ATOM   5838  C  CB   . ASN A 1 26 ? -8.152  2.150   2.076   1.00 0.00 ? 26  ASN A CB   9  
ATOM   5839  C  CG   . ASN A 1 26 ? -6.991  2.308   3.038   1.00 0.00 ? 26  ASN A CG   9  
ATOM   5840  O  OD1  . ASN A 1 26 ? -6.264  3.300   2.994   1.00 0.00 ? 26  ASN A OD1  9  
ATOM   5841  N  ND2  . ASN A 1 26 ? -6.811  1.326   3.914   1.00 0.00 ? 26  ASN A ND2  9  
ATOM   5842  H  H    . ASN A 1 26 ? -8.075  -0.491  2.415   1.00 0.00 ? 26  ASN A H    9  
ATOM   5843  H  HA   . ASN A 1 26 ? -8.473  1.310   0.134   1.00 0.00 ? 26  ASN A HA   9  
ATOM   5844  H  HB2  . ASN A 1 26 ? -8.323  3.100   1.590   1.00 0.00 ? 26  ASN A HB2  9  
ATOM   5845  H  HB3  . ASN A 1 26 ? -9.030  1.877   2.641   1.00 0.00 ? 26  ASN A HB3  9  
ATOM   5846  H  HD21 . ASN A 1 26 ? -7.429  0.566   3.891   1.00 0.00 ? 26  ASN A HD21 9  
ATOM   5847  H  HD22 . ASN A 1 26 ? -6.068  1.403   4.548   1.00 0.00 ? 26  ASN A HD22 9  
ATOM   5848  N  N    . THR A 1 27 ? -5.771  -0.076  0.762   1.00 0.00 ? 27  THR A N    9  
ATOM   5849  C  CA   . THR A 1 27 ? -4.358  -0.210  0.434   1.00 0.00 ? 27  THR A CA   9  
ATOM   5850  C  C    . THR A 1 27 ? -4.152  -1.177  -0.727  1.00 0.00 ? 27  THR A C    9  
ATOM   5851  O  O    . THR A 1 27 ? -3.160  -1.091  -1.449  1.00 0.00 ? 27  THR A O    9  
ATOM   5852  C  CB   . THR A 1 27 ? -3.544  -0.701  1.646   1.00 0.00 ? 27  THR A CB   9  
ATOM   5853  O  OG1  . THR A 1 27 ? -3.975  -2.012  2.027   1.00 0.00 ? 27  THR A OG1  9  
ATOM   5854  C  CG2  . THR A 1 27 ? -3.697  0.251   2.822   1.00 0.00 ? 27  THR A CG2  9  
ATOM   5855  H  H    . THR A 1 27 ? -6.264  -0.858  1.088   1.00 0.00 ? 27  THR A H    9  
ATOM   5856  H  HA   . THR A 1 27 ? -3.987  0.763   0.148   1.00 0.00 ? 27  THR A HA   9  
ATOM   5857  H  HB   . THR A 1 27 ? -2.500  -0.741  1.367   1.00 0.00 ? 27  THR A HB   9  
ATOM   5858  H  HG1  . THR A 1 27 ? -4.160  -2.530  1.240   1.00 0.00 ? 27  THR A HG1  9  
ATOM   5859  H  HG21 . THR A 1 27 ? -3.515  -0.283  3.743   1.00 0.00 ? 27  THR A HG21 9  
ATOM   5860  H  HG22 . THR A 1 27 ? -4.700  0.653   2.832   1.00 0.00 ? 27  THR A HG22 9  
ATOM   5861  H  HG23 . THR A 1 27 ? -2.986  1.058   2.727   1.00 0.00 ? 27  THR A HG23 9  
ATOM   5862  N  N    . GLN A 1 28 ? -5.097  -2.096  -0.900  1.00 0.00 ? 28  GLN A N    9  
ATOM   5863  C  CA   . GLN A 1 28 ? -5.018  -3.079  -1.974  1.00 0.00 ? 28  GLN A CA   9  
ATOM   5864  C  C    . GLN A 1 28 ? -4.785  -2.398  -3.319  1.00 0.00 ? 28  GLN A C    9  
ATOM   5865  O  O    . GLN A 1 28 ? -5.178  -1.253  -3.539  1.00 0.00 ? 28  GLN A O    9  
ATOM   5866  C  CB   . GLN A 1 28 ? -6.300  -3.912  -2.026  1.00 0.00 ? 28  GLN A CB   9  
ATOM   5867  C  CG   . GLN A 1 28 ? -7.465  -3.195  -2.691  1.00 0.00 ? 28  GLN A CG   9  
ATOM   5868  C  CD   . GLN A 1 28 ? -8.704  -4.063  -2.791  1.00 0.00 ? 28  GLN A CD   9  
ATOM   5869  O  OE1  . GLN A 1 28 ? -8.660  -5.168  -3.333  1.00 0.00 ? 28  GLN A OE1  9  
ATOM   5870  N  NE2  . GLN A 1 28 ? -9.818  -3.567  -2.267  1.00 0.00 ? 28  GLN A NE2  9  
ATOM   5871  H  H    . GLN A 1 28 ? -5.864  -2.114  -0.291  1.00 0.00 ? 28  GLN A H    9  
ATOM   5872  H  HA   . GLN A 1 28 ? -4.184  -3.732  -1.765  1.00 0.00 ? 28  GLN A HA   9  
ATOM   5873  H  HB2  . GLN A 1 28 ? -6.103  -4.820  -2.576  1.00 0.00 ? 28  GLN A HB2  9  
ATOM   5874  H  HB3  . GLN A 1 28 ? -6.591  -4.167  -1.018  1.00 0.00 ? 28  GLN A HB3  9  
ATOM   5875  H  HG2  . GLN A 1 28 ? -7.707  -2.315  -2.113  1.00 0.00 ? 28  GLN A HG2  9  
ATOM   5876  H  HG3  . GLN A 1 28 ? -7.168  -2.900  -3.686  1.00 0.00 ? 28  GLN A HG3  9  
ATOM   5877  H  HE21 . GLN A 1 28 ? -9.779  -2.679  -1.852  1.00 0.00 ? 28  GLN A HE21 9  
ATOM   5878  H  HE22 . GLN A 1 28 ? -10.634 -4.106  -2.318  1.00 0.00 ? 28  GLN A HE22 9  
ATOM   5879  N  N    . PRO A 1 29 ? -4.128  -3.118  -4.240  1.00 0.00 ? 29  PRO A N    9  
ATOM   5880  C  CA   . PRO A 1 29 ? -3.655  -4.483  -3.990  1.00 0.00 ? 29  PRO A CA   9  
ATOM   5881  C  C    . PRO A 1 29 ? -2.499  -4.521  -2.995  1.00 0.00 ? 29  PRO A C    9  
ATOM   5882  O  O    . PRO A 1 29 ? -2.054  -5.595  -2.586  1.00 0.00 ? 29  PRO A O    9  
ATOM   5883  C  CB   . PRO A 1 29 ? -3.189  -4.956  -5.369  1.00 0.00 ? 29  PRO A CB   9  
ATOM   5884  C  CG   . PRO A 1 29 ? -2.846  -3.705  -6.102  1.00 0.00 ? 29  PRO A CG   9  
ATOM   5885  C  CD   . PRO A 1 29 ? -3.798  -2.656  -5.599  1.00 0.00 ? 29  PRO A CD   9  
ATOM   5886  H  HA   . PRO A 1 29 ? -4.452  -5.121  -3.638  1.00 0.00 ? 29  PRO A HA   9  
ATOM   5887  H  HB2  . PRO A 1 29 ? -2.327  -5.599  -5.259  1.00 0.00 ? 29  PRO A HB2  9  
ATOM   5888  H  HB3  . PRO A 1 29 ? -3.987  -5.494  -5.857  1.00 0.00 ? 29  PRO A HB3  9  
ATOM   5889  H  HG2  . PRO A 1 29 ? -1.827  -3.421  -5.888  1.00 0.00 ? 29  PRO A HG2  9  
ATOM   5890  H  HG3  . PRO A 1 29 ? -2.981  -3.854  -7.164  1.00 0.00 ? 29  PRO A HG3  9  
ATOM   5891  H  HD2  . PRO A 1 29 ? -3.315  -1.690  -5.571  1.00 0.00 ? 29  PRO A HD2  9  
ATOM   5892  H  HD3  . PRO A 1 29 ? -4.682  -2.619  -6.219  1.00 0.00 ? 29  PRO A HD3  9  
ATOM   5893  N  N    . LEU A 1 30 ? -2.018  -3.345  -2.609  1.00 0.00 ? 30  LEU A N    9  
ATOM   5894  C  CA   . LEU A 1 30 ? -0.914  -3.244  -1.661  1.00 0.00 ? 30  LEU A CA   9  
ATOM   5895  C  C    . LEU A 1 30 ? -1.432  -3.137  -0.230  1.00 0.00 ? 30  LEU A C    9  
ATOM   5896  O  O    . LEU A 1 30 ? -2.641  -3.104  0.003   1.00 0.00 ? 30  LEU A O    9  
ATOM   5897  C  CB   . LEU A 1 30 ? -0.041  -2.033  -1.991  1.00 0.00 ? 30  LEU A CB   9  
ATOM   5898  C  CG   . LEU A 1 30 ? 0.791   -2.134  -3.270  1.00 0.00 ? 30  LEU A CG   9  
ATOM   5899  C  CD1  . LEU A 1 30 ? 1.402   -0.786  -3.618  1.00 0.00 ? 30  LEU A CD1  9  
ATOM   5900  C  CD2  . LEU A 1 30 ? 1.877   -3.190  -3.118  1.00 0.00 ? 30  LEU A CD2  9  
ATOM   5901  H  H    . LEU A 1 30 ? -2.414  -2.525  -2.969  1.00 0.00 ? 30  LEU A H    9  
ATOM   5902  H  HA   . LEU A 1 30 ? -0.319  -4.141  -1.748  1.00 0.00 ? 30  LEU A HA   9  
ATOM   5903  H  HB2  . LEU A 1 30 ? -0.688  -1.175  -2.085  1.00 0.00 ? 30  LEU A HB2  9  
ATOM   5904  H  HB3  . LEU A 1 30 ? 0.639   -1.880  -1.164  1.00 0.00 ? 30  LEU A HB3  9  
ATOM   5905  H  HG   . LEU A 1 30 ? 0.148   -2.429  -4.088  1.00 0.00 ? 30  LEU A HG   9  
ATOM   5906  H  HD11 . LEU A 1 30 ? 1.915   -0.856  -4.565  1.00 0.00 ? 30  LEU A HD11 9  
ATOM   5907  H  HD12 . LEU A 1 30 ? 2.105   -0.500  -2.849  1.00 0.00 ? 30  LEU A HD12 9  
ATOM   5908  H  HD13 . LEU A 1 30 ? 0.621   -0.043  -3.684  1.00 0.00 ? 30  LEU A HD13 9  
ATOM   5909  H  HD21 . LEU A 1 30 ? 2.585   -3.098  -3.928  1.00 0.00 ? 30  LEU A HD21 9  
ATOM   5910  H  HD22 . LEU A 1 30 ? 1.428   -4.172  -3.142  1.00 0.00 ? 30  LEU A HD22 9  
ATOM   5911  H  HD23 . LEU A 1 30 ? 2.386   -3.050  -2.176  1.00 0.00 ? 30  LEU A HD23 9  
ATOM   5912  N  N    . CYS A 1 31 ? -0.510  -3.080  0.725   1.00 0.00 ? 31  CYS A N    9  
ATOM   5913  C  CA   . CYS A 1 31 ? -0.873  -2.974  2.133   1.00 0.00 ? 31  CYS A CA   9  
ATOM   5914  C  C    . CYS A 1 31 ? -0.571  -1.577  2.669   1.00 0.00 ? 31  CYS A C    9  
ATOM   5915  O  O    . CYS A 1 31 ? -0.053  -0.723  1.949   1.00 0.00 ? 31  CYS A O    9  
ATOM   5916  C  CB   . CYS A 1 31 ? -0.120  -4.021  2.956   1.00 0.00 ? 31  CYS A CB   9  
ATOM   5917  S  SG   . CYS A 1 31 ? 1.623   -3.602  3.276   1.00 0.00 ? 31  CYS A SG   9  
ATOM   5918  H  H    . CYS A 1 31 ? 0.438   -3.111  0.477   1.00 0.00 ? 31  CYS A H    9  
ATOM   5919  H  HA   . CYS A 1 31 ? -1.934  -3.157  2.218   1.00 0.00 ? 31  CYS A HA   9  
ATOM   5920  H  HB2  . CYS A 1 31 ? -0.610  -4.138  3.912   1.00 0.00 ? 31  CYS A HB2  9  
ATOM   5921  H  HB3  . CYS A 1 31 ? -0.141  -4.964  2.430   1.00 0.00 ? 31  CYS A HB3  9  
ATOM   5922  N  N    . HIS A 1 32 ? -0.899  -1.352  3.937   1.00 0.00 ? 32  HIS A N    9  
ATOM   5923  C  CA   . HIS A 1 32 ? -0.663  -0.060  4.570   1.00 0.00 ? 32  HIS A CA   9  
ATOM   5924  C  C    . HIS A 1 32 ? 0.800   0.352   4.434   1.00 0.00 ? 32  HIS A C    9  
ATOM   5925  O  O    . HIS A 1 32 ? 1.103   1.505   4.130   1.00 0.00 ? 32  HIS A O    9  
ATOM   5926  C  CB   . HIS A 1 32 ? -1.054  -0.112  6.047   1.00 0.00 ? 32  HIS A CB   9  
ATOM   5927  C  CG   . HIS A 1 32 ? -1.486  1.211   6.600   1.00 0.00 ? 32  HIS A CG   9  
ATOM   5928  N  ND1  . HIS A 1 32 ? -2.483  1.344   7.543   1.00 0.00 ? 32  HIS A ND1  9  
ATOM   5929  C  CD2  . HIS A 1 32 ? -1.048  2.465   6.339   1.00 0.00 ? 32  HIS A CD2  9  
ATOM   5930  C  CE1  . HIS A 1 32 ? -2.641  2.622   7.836   1.00 0.00 ? 32  HIS A CE1  9  
ATOM   5931  N  NE2  . HIS A 1 32 ? -1.782  3.324   7.119   1.00 0.00 ? 32  HIS A NE2  9  
ATOM   5932  H  H    . HIS A 1 32 ? -1.310  -2.073  4.460   1.00 0.00 ? 32  HIS A H    9  
ATOM   5933  H  HA   . HIS A 1 32 ? -1.278  0.672   4.070   1.00 0.00 ? 32  HIS A HA   9  
ATOM   5934  H  HB2  . HIS A 1 32 ? -1.873  -0.806  6.171   1.00 0.00 ? 32  HIS A HB2  9  
ATOM   5935  H  HB3  . HIS A 1 32 ? -0.208  -0.455  6.626   1.00 0.00 ? 32  HIS A HB3  9  
ATOM   5936  H  HD1  . HIS A 1 32 ? -3.000  0.611   7.937   1.00 0.00 ? 32  HIS A HD1  9  
ATOM   5937  H  HD2  . HIS A 1 32 ? -0.266  2.740   5.645   1.00 0.00 ? 32  HIS A HD2  9  
ATOM   5938  H  HE1  . HIS A 1 32 ? -3.352  3.026   8.542   1.00 0.00 ? 32  HIS A HE1  9  
ATOM   5939  N  N    . GLU A 1 33 ? 1.701   -0.598  4.662   1.00 0.00 ? 33  GLU A N    9  
ATOM   5940  C  CA   . GLU A 1 33 ? 3.132   -0.332  4.566   1.00 0.00 ? 33  GLU A CA   9  
ATOM   5941  C  C    . GLU A 1 33 ? 3.510   0.106   3.154   1.00 0.00 ? 33  GLU A C    9  
ATOM   5942  O  O    . GLU A 1 33 ? 3.889   1.256   2.929   1.00 0.00 ? 33  GLU A O    9  
ATOM   5943  C  CB   . GLU A 1 33 ? 3.932   -1.576  4.958   1.00 0.00 ? 33  GLU A CB   9  
ATOM   5944  C  CG   . GLU A 1 33 ? 5.282   -1.261  5.579   1.00 0.00 ? 33  GLU A CG   9  
ATOM   5945  C  CD   . GLU A 1 33 ? 6.260   -2.414  5.465   1.00 0.00 ? 33  GLU A CD   9  
ATOM   5946  O  OE1  . GLU A 1 33 ? 6.025   -3.456  6.112   1.00 0.00 ? 33  GLU A OE1  9  
ATOM   5947  O  OE2  . GLU A 1 33 ? 7.260   -2.274  4.731   1.00 0.00 ? 33  GLU A OE2  9  
ATOM   5948  H  H    . GLU A 1 33 ? 1.397   -1.498  4.901   1.00 0.00 ? 33  GLU A H    9  
ATOM   5949  H  HA   . GLU A 1 33 ? 3.367   0.467   5.253   1.00 0.00 ? 33  GLU A HA   9  
ATOM   5950  H  HB2  . GLU A 1 33 ? 3.357   -2.150  5.669   1.00 0.00 ? 33  GLU A HB2  9  
ATOM   5951  H  HB3  . GLU A 1 33 ? 4.097   -2.175  4.075   1.00 0.00 ? 33  GLU A HB3  9  
ATOM   5952  H  HG2  . GLU A 1 33 ? 5.703   -0.402  5.078   1.00 0.00 ? 33  GLU A HG2  9  
ATOM   5953  H  HG3  . GLU A 1 33 ? 5.139   -1.031  6.625   1.00 0.00 ? 33  GLU A HG3  9  
ATOM   5954  N  N    . CYS A 1 34 ? 3.405   -0.819  2.206   1.00 0.00 ? 34  CYS A N    9  
ATOM   5955  C  CA   . CYS A 1 34 ? 3.736   -0.531  0.816   1.00 0.00 ? 34  CYS A CA   9  
ATOM   5956  C  C    . CYS A 1 34 ? 2.965   0.686   0.314   1.00 0.00 ? 34  CYS A C    9  
ATOM   5957  O  O    . CYS A 1 34 ? 3.556   1.654   -0.165  1.00 0.00 ? 34  CYS A O    9  
ATOM   5958  C  CB   . CYS A 1 34 ? 3.428   -1.743  -0.065  1.00 0.00 ? 34  CYS A CB   9  
ATOM   5959  S  SG   . CYS A 1 34 ? 4.194   -3.294  0.509   1.00 0.00 ? 34  CYS A SG   9  
ATOM   5960  H  H    . CYS A 1 34 ? 3.097   -1.719  2.447   1.00 0.00 ? 34  CYS A H    9  
ATOM   5961  H  HA   . CYS A 1 34 ? 4.793   -0.319  0.764   1.00 0.00 ? 34  CYS A HA   9  
ATOM   5962  H  HB2  . CYS A 1 34 ? 2.359   -1.896  -0.092  1.00 0.00 ? 34  CYS A HB2  9  
ATOM   5963  H  HB3  . CYS A 1 34 ? 3.785   -1.551  -1.066  1.00 0.00 ? 34  CYS A HB3  9  
ATOM   5964  N  N    . SER A 1 35 ? 1.642   0.629   0.427   1.00 0.00 ? 35  SER A N    9  
ATOM   5965  C  CA   . SER A 1 35 ? 0.789   1.724   -0.019  1.00 0.00 ? 35  SER A CA   9  
ATOM   5966  C  C    . SER A 1 35 ? 1.260   3.052   0.566   1.00 0.00 ? 35  SER A C    9  
ATOM   5967  O  O    . SER A 1 35 ? 1.111   4.104   -0.055  1.00 0.00 ? 35  SER A O    9  
ATOM   5968  C  CB   . SER A 1 35 ? -0.664  1.464   0.384   1.00 0.00 ? 35  SER A CB   9  
ATOM   5969  O  OG   . SER A 1 35 ? -1.553  2.281   -0.357  1.00 0.00 ? 35  SER A OG   9  
ATOM   5970  H  H    . SER A 1 35 ? 1.230   -0.170  0.817   1.00 0.00 ? 35  SER A H    9  
ATOM   5971  H  HA   . SER A 1 35 ? 0.851   1.776   -1.095  1.00 0.00 ? 35  SER A HA   9  
ATOM   5972  H  HB2  . SER A 1 35 ? -0.906  0.429   0.198   1.00 0.00 ? 35  SER A HB2  9  
ATOM   5973  H  HB3  . SER A 1 35 ? -0.787  1.679   1.436   1.00 0.00 ? 35  SER A HB3  9  
ATOM   5974  H  HG   . SER A 1 35 ? -1.250  3.192   -0.329  1.00 0.00 ? 35  SER A HG   9  
ATOM   5975  N  N    . GLU A 1 36 ? 1.830   2.995   1.766   1.00 0.00 ? 36  GLU A N    9  
ATOM   5976  C  CA   . GLU A 1 36 ? 2.322   4.193   2.436   1.00 0.00 ? 36  GLU A CA   9  
ATOM   5977  C  C    . GLU A 1 36 ? 3.666   4.626   1.857   1.00 0.00 ? 36  GLU A C    9  
ATOM   5978  O  O    . GLU A 1 36 ? 3.819   5.757   1.395   1.00 0.00 ? 36  GLU A O    9  
ATOM   5979  C  CB   . GLU A 1 36 ? 2.458   3.944   3.939   1.00 0.00 ? 36  GLU A CB   9  
ATOM   5980  C  CG   . GLU A 1 36 ? 3.299   4.988   4.655   1.00 0.00 ? 36  GLU A CG   9  
ATOM   5981  C  CD   . GLU A 1 36 ? 2.496   6.209   5.058   1.00 0.00 ? 36  GLU A CD   9  
ATOM   5982  O  OE1  . GLU A 1 36 ? 2.377   7.140   4.234   1.00 0.00 ? 36  GLU A OE1  9  
ATOM   5983  O  OE2  . GLU A 1 36 ? 1.985   6.233   6.197   1.00 0.00 ? 36  GLU A OE2  9  
ATOM   5984  H  H    . GLU A 1 36 ? 1.920   2.126   2.211   1.00 0.00 ? 36  GLU A H    9  
ATOM   5985  H  HA   . GLU A 1 36 ? 1.603   4.982   2.275   1.00 0.00 ? 36  GLU A HA   9  
ATOM   5986  H  HB2  . GLU A 1 36 ? 1.473   3.940   4.382   1.00 0.00 ? 36  GLU A HB2  9  
ATOM   5987  H  HB3  . GLU A 1 36 ? 2.916   2.978   4.092   1.00 0.00 ? 36  GLU A HB3  9  
ATOM   5988  H  HG2  . GLU A 1 36 ? 3.721   4.544   5.545   1.00 0.00 ? 36  GLU A HG2  9  
ATOM   5989  H  HG3  . GLU A 1 36 ? 4.098   5.301   3.998   1.00 0.00 ? 36  GLU A HG3  9  
ATOM   5990  N  N    . ARG A 1 37 ? 4.636   3.718   1.886   1.00 0.00 ? 37  ARG A N    9  
ATOM   5991  C  CA   . ARG A 1 37 ? 5.968   4.006   1.367   1.00 0.00 ? 37  ARG A CA   9  
ATOM   5992  C  C    . ARG A 1 37 ? 5.897   4.465   -0.087  1.00 0.00 ? 37  ARG A C    9  
ATOM   5993  O  O    . ARG A 1 37 ? 6.688   5.301   -0.524  1.00 0.00 ? 37  ARG A O    9  
ATOM   5994  C  CB   . ARG A 1 37 ? 6.861   2.770   1.479   1.00 0.00 ? 37  ARG A CB   9  
ATOM   5995  C  CG   . ARG A 1 37 ? 6.736   1.819   0.299   1.00 0.00 ? 37  ARG A CG   9  
ATOM   5996  C  CD   . ARG A 1 37 ? 7.647   0.612   0.458   1.00 0.00 ? 37  ARG A CD   9  
ATOM   5997  N  NE   . ARG A 1 37 ? 8.964   0.838   -0.130  1.00 0.00 ? 37  ARG A NE   9  
ATOM   5998  C  CZ   . ARG A 1 37 ? 10.057  0.179   0.238   1.00 0.00 ? 37  ARG A CZ   9  
ATOM   5999  N  NH1  . ARG A 1 37 ? 9.990   -0.743  1.188   1.00 0.00 ? 37  ARG A NH1  9  
ATOM   6000  N  NH2  . ARG A 1 37 ? 11.220  0.442   -0.345  1.00 0.00 ? 37  ARG A NH2  9  
ATOM   6001  H  H    . ARG A 1 37 ? 4.453   2.834   2.267   1.00 0.00 ? 37  ARG A H    9  
ATOM   6002  H  HA   . ARG A 1 37 ? 6.392   4.801   1.962   1.00 0.00 ? 37  ARG A HA   9  
ATOM   6003  H  HB2  . ARG A 1 37 ? 7.891   3.088   1.548   1.00 0.00 ? 37  ARG A HB2  9  
ATOM   6004  H  HB3  . ARG A 1 37 ? 6.598   2.231   2.377   1.00 0.00 ? 37  ARG A HB3  9  
ATOM   6005  H  HG2  . ARG A 1 37 ? 5.714   1.478   0.230   1.00 0.00 ? 37  ARG A HG2  9  
ATOM   6006  H  HG3  . ARG A 1 37 ? 7.004   2.345   -0.605  1.00 0.00 ? 37  ARG A HG3  9  
ATOM   6007  H  HD2  . ARG A 1 37 ? 7.765   0.402   1.511   1.00 0.00 ? 37  ARG A HD2  9  
ATOM   6008  H  HD3  . ARG A 1 37 ? 7.186   -0.236  -0.028  1.00 0.00 ? 37  ARG A HD3  9  
ATOM   6009  H  HE   . ARG A 1 37 ? 9.036   1.516   -0.834  1.00 0.00 ? 37  ARG A HE   9  
ATOM   6010  H  HH11 . ARG A 1 37 ? 9.115   -0.944  1.628   1.00 0.00 ? 37  ARG A HH11 9  
ATOM   6011  H  HH12 . ARG A 1 37 ? 10.814  -1.239  1.463   1.00 0.00 ? 37  ARG A HH12 9  
ATOM   6012  H  HH21 . ARG A 1 37 ? 11.274  1.136   -1.061  1.00 0.00 ? 37  ARG A HH21 9  
ATOM   6013  H  HH22 . ARG A 1 37 ? 12.041  -0.055  -0.067  1.00 0.00 ? 37  ARG A HH22 9  
ATOM   6014  N  N    . ARG A 1 38 ? 4.943   3.913   -0.830  1.00 0.00 ? 38  ARG A N    9  
ATOM   6015  C  CA   . ARG A 1 38 ? 4.770   4.264   -2.235  1.00 0.00 ? 38  ARG A CA   9  
ATOM   6016  C  C    . ARG A 1 38 ? 4.255   5.693   -2.378  1.00 0.00 ? 38  ARG A C    9  
ATOM   6017  O  O    . ARG A 1 38 ? 4.820   6.494   -3.122  1.00 0.00 ? 38  ARG A O    9  
ATOM   6018  C  CB   . ARG A 1 38 ? 3.802   3.291   -2.910  1.00 0.00 ? 38  ARG A CB   9  
ATOM   6019  C  CG   . ARG A 1 38 ? 4.482   2.071   -3.508  1.00 0.00 ? 38  ARG A CG   9  
ATOM   6020  C  CD   . ARG A 1 38 ? 4.898   2.315   -4.950  1.00 0.00 ? 38  ARG A CD   9  
ATOM   6021  N  NE   . ARG A 1 38 ? 3.765   2.698   -5.789  1.00 0.00 ? 38  ARG A NE   9  
ATOM   6022  C  CZ   . ARG A 1 38 ? 3.887   3.378   -6.923  1.00 0.00 ? 38  ARG A CZ   9  
ATOM   6023  N  NH1  . ARG A 1 38 ? 5.086   3.747   -7.353  1.00 0.00 ? 38  ARG A NH1  9  
ATOM   6024  N  NH2  . ARG A 1 38 ? 2.809   3.689   -7.631  1.00 0.00 ? 38  ARG A NH2  9  
ATOM   6025  H  H    . ARG A 1 38 ? 4.343   3.253   -0.425  1.00 0.00 ? 38  ARG A H    9  
ATOM   6026  H  HA   . ARG A 1 38 ? 5.734   4.191   -2.716  1.00 0.00 ? 38  ARG A HA   9  
ATOM   6027  H  HB2  . ARG A 1 38 ? 3.082   2.952   -2.179  1.00 0.00 ? 38  ARG A HB2  9  
ATOM   6028  H  HB3  . ARG A 1 38 ? 3.282   3.810   -3.701  1.00 0.00 ? 38  ARG A HB3  9  
ATOM   6029  H  HG2  . ARG A 1 38 ? 5.362   1.839   -2.926  1.00 0.00 ? 38  ARG A HG2  9  
ATOM   6030  H  HG3  . ARG A 1 38 ? 3.798   1.236   -3.476  1.00 0.00 ? 38  ARG A HG3  9  
ATOM   6031  H  HD2  . ARG A 1 38 ? 5.632   3.107   -4.970  1.00 0.00 ? 38  ARG A HD2  9  
ATOM   6032  H  HD3  . ARG A 1 38 ? 5.335   1.409   -5.343  1.00 0.00 ? 38  ARG A HD3  9  
ATOM   6033  H  HE   . ARG A 1 38 ? 2.870   2.434   -5.490  1.00 0.00 ? 38  ARG A HE   9  
ATOM   6034  H  HH11 . ARG A 1 38 ? 5.900   3.514   -6.822  1.00 0.00 ? 38  ARG A HH11 9  
ATOM   6035  H  HH12 . ARG A 1 38 ? 5.175   4.258   -8.208  1.00 0.00 ? 38  ARG A HH12 9  
ATOM   6036  H  HH21 . ARG A 1 38 ? 1.903   3.411   -7.310  1.00 0.00 ? 38  ARG A HH21 9  
ATOM   6037  H  HH22 . ARG A 1 38 ? 2.901   4.200   -8.484  1.00 0.00 ? 38  ARG A HH22 9  
ATOM   6038  N  N    . GLN A 1 39 ? 3.179   6.003   -1.662  1.00 0.00 ? 39  GLN A N    9  
ATOM   6039  C  CA   . GLN A 1 39 ? 2.587   7.335   -1.711  1.00 0.00 ? 39  GLN A CA   9  
ATOM   6040  C  C    . GLN A 1 39 ? 3.668   8.411   -1.733  1.00 0.00 ? 39  GLN A C    9  
ATOM   6041  O  O    . GLN A 1 39 ? 3.614   9.346   -2.532  1.00 0.00 ? 39  GLN A O    9  
ATOM   6042  C  CB   . GLN A 1 39 ? 1.661   7.549   -0.513  1.00 0.00 ? 39  GLN A CB   9  
ATOM   6043  C  CG   . GLN A 1 39 ? 0.235   7.085   -0.755  1.00 0.00 ? 39  GLN A CG   9  
ATOM   6044  C  CD   . GLN A 1 39 ? -0.365  7.674   -2.017  1.00 0.00 ? 39  GLN A CD   9  
ATOM   6045  O  OE1  . GLN A 1 39 ? -1.001  8.727   -1.982  1.00 0.00 ? 39  GLN A OE1  9  
ATOM   6046  N  NE2  . GLN A 1 39 ? -0.163  6.996   -3.141  1.00 0.00 ? 39  GLN A NE2  9  
ATOM   6047  H  H    . GLN A 1 39 ? 2.774   5.321   -1.088  1.00 0.00 ? 39  GLN A H    9  
ATOM   6048  H  HA   . GLN A 1 39 ? 2.008   7.407   -2.619  1.00 0.00 ? 39  GLN A HA   9  
ATOM   6049  H  HB2  . GLN A 1 39 ? 2.056   7.006   0.333   1.00 0.00 ? 39  GLN A HB2  9  
ATOM   6050  H  HB3  . GLN A 1 39 ? 1.638   8.603   -0.275  1.00 0.00 ? 39  GLN A HB3  9  
ATOM   6051  H  HG2  . GLN A 1 39 ? 0.230   6.008   -0.842  1.00 0.00 ? 39  GLN A HG2  9  
ATOM   6052  H  HG3  . GLN A 1 39 ? -0.374  7.379   0.087   1.00 0.00 ? 39  GLN A HG3  9  
ATOM   6053  H  HE21 . GLN A 1 39 ? 0.353   6.163   -3.093  1.00 0.00 ? 39  GLN A HE21 9  
ATOM   6054  H  HE22 . GLN A 1 39 ? -0.540  7.353   -3.971  1.00 0.00 ? 39  GLN A HE22 9  
ATOM   6055  N  N    . LYS A 1 40 ? 4.651   8.272   -0.849  1.00 0.00 ? 40  LYS A N    9  
ATOM   6056  C  CA   . LYS A 1 40 ? 5.746   9.231   -0.766  1.00 0.00 ? 40  LYS A CA   9  
ATOM   6057  C  C    . LYS A 1 40 ? 6.137   9.732   -2.152  1.00 0.00 ? 40  LYS A C    9  
ATOM   6058  O  O    . LYS A 1 40 ? 6.318   10.931  -2.361  1.00 0.00 ? 40  LYS A O    9  
ATOM   6059  C  CB   . LYS A 1 40 ? 6.958   8.594   -0.082  1.00 0.00 ? 40  LYS A CB   9  
ATOM   6060  C  CG   . LYS A 1 40 ? 7.986   9.603   0.399   1.00 0.00 ? 40  LYS A CG   9  
ATOM   6061  C  CD   . LYS A 1 40 ? 7.641   10.134  1.781   1.00 0.00 ? 40  LYS A CD   9  
ATOM   6062  C  CE   . LYS A 1 40 ? 6.819   11.411  1.699   1.00 0.00 ? 40  LYS A CE   9  
ATOM   6063  N  NZ   . LYS A 1 40 ? 6.831   12.162  2.984   1.00 0.00 ? 40  LYS A NZ   9  
ATOM   6064  H  H    . LYS A 1 40 ? 4.640   7.505   -0.238  1.00 0.00 ? 40  LYS A H    9  
ATOM   6065  H  HA   . LYS A 1 40 ? 5.410   10.069  -0.175  1.00 0.00 ? 40  LYS A HA   9  
ATOM   6066  H  HB2  . LYS A 1 40 ? 6.618   8.024   0.770   1.00 0.00 ? 40  LYS A HB2  9  
ATOM   6067  H  HB3  . LYS A 1 40 ? 7.441   7.926   -0.781  1.00 0.00 ? 40  LYS A HB3  9  
ATOM   6068  H  HG2  . LYS A 1 40 ? 8.954   9.127   0.440   1.00 0.00 ? 40  LYS A HG2  9  
ATOM   6069  H  HG3  . LYS A 1 40 ? 8.018   10.430  -0.296  1.00 0.00 ? 40  LYS A HG3  9  
ATOM   6070  H  HD2  . LYS A 1 40 ? 7.072   9.386   2.313   1.00 0.00 ? 40  LYS A HD2  9  
ATOM   6071  H  HD3  . LYS A 1 40 ? 8.557   10.339  2.317   1.00 0.00 ? 40  LYS A HD3  9  
ATOM   6072  H  HE2  . LYS A 1 40 ? 7.229   12.038  0.922   1.00 0.00 ? 40  LYS A HE2  9  
ATOM   6073  H  HE3  . LYS A 1 40 ? 5.800   11.152  1.452   1.00 0.00 ? 40  LYS A HE3  9  
ATOM   6074  H  HZ1  . LYS A 1 40 ? 6.703   13.178  2.806   1.00 0.00 ? 40  LYS A HZ1  9  
ATOM   6075  H  HZ2  . LYS A 1 40 ? 7.738   12.018  3.474   1.00 0.00 ? 40  LYS A HZ2  9  
ATOM   6076  H  HZ3  . LYS A 1 40 ? 6.062   11.829  3.600   1.00 0.00 ? 40  LYS A HZ3  9  
ATOM   6077  N  N    . ASN A 1 41 ? 6.265   8.806   -3.097  1.00 0.00 ? 41  ASN A N    9  
ATOM   6078  C  CA   . ASN A 1 41 ? 6.633   9.155   -4.465  1.00 0.00 ? 41  ASN A CA   9  
ATOM   6079  C  C    . ASN A 1 41 ? 5.892   10.407  -4.925  1.00 0.00 ? 41  ASN A C    9  
ATOM   6080  O  O    . ASN A 1 41 ? 6.490   11.320  -5.494  1.00 0.00 ? 41  ASN A O    9  
ATOM   6081  C  CB   . ASN A 1 41 ? 6.328   7.992   -5.410  1.00 0.00 ? 41  ASN A CB   9  
ATOM   6082  C  CG   . ASN A 1 41 ? 6.731   8.289   -6.841  1.00 0.00 ? 41  ASN A CG   9  
ATOM   6083  O  OD1  . ASN A 1 41 ? 7.702   9.004   -7.089  1.00 0.00 ? 41  ASN A OD1  9  
ATOM   6084  N  ND2  . ASN A 1 41 ? 5.985   7.739   -7.792  1.00 0.00 ? 41  ASN A ND2  9  
ATOM   6085  H  H    . ASN A 1 41 ? 6.108   7.866   -2.870  1.00 0.00 ? 41  ASN A H    9  
ATOM   6086  H  HA   . ASN A 1 41 ? 7.694   9.353   -4.482  1.00 0.00 ? 41  ASN A HA   9  
ATOM   6087  H  HB2  . ASN A 1 41 ? 6.867   7.116   -5.079  1.00 0.00 ? 41  ASN A HB2  9  
ATOM   6088  H  HB3  . ASN A 1 41 ? 5.268   7.786   -5.389  1.00 0.00 ? 41  ASN A HB3  9  
ATOM   6089  H  HD21 . ASN A 1 41 ? 5.227   7.180   -7.521  1.00 0.00 ? 41  ASN A HD21 9  
ATOM   6090  H  HD22 . ASN A 1 41 ? 6.224   7.914   -8.727  1.00 0.00 ? 41  ASN A HD22 9  
ATOM   6091  N  N    . GLN A 1 42 ? 4.587   10.442  -4.674  1.00 0.00 ? 42  GLN A N    9  
ATOM   6092  C  CA   . GLN A 1 42 ? 3.765   11.581  -5.063  1.00 0.00 ? 42  GLN A CA   9  
ATOM   6093  C  C    . GLN A 1 42 ? 3.758   11.756  -6.578  1.00 0.00 ? 42  GLN A C    9  
ATOM   6094  O  O    . GLN A 1 42 ? 3.891   12.869  -7.085  1.00 0.00 ? 42  GLN A O    9  
ATOM   6095  C  CB   . GLN A 1 42 ? 4.276   12.858  -4.393  1.00 0.00 ? 42  GLN A CB   9  
ATOM   6096  C  CG   . GLN A 1 42 ? 3.184   13.881  -4.122  1.00 0.00 ? 42  GLN A CG   9  
ATOM   6097  C  CD   . GLN A 1 42 ? 2.518   14.374  -5.391  1.00 0.00 ? 42  GLN A CD   9  
ATOM   6098  O  OE1  . GLN A 1 42 ? 3.018   15.282  -6.056  1.00 0.00 ? 42  GLN A OE1  9  
ATOM   6099  N  NE2  . GLN A 1 42 ? 1.383   13.776  -5.735  1.00 0.00 ? 42  GLN A NE2  9  
ATOM   6100  H  H    . GLN A 1 42 ? 4.168   9.683   -4.218  1.00 0.00 ? 42  GLN A H    9  
ATOM   6101  H  HA   . GLN A 1 42 ? 2.756   11.390  -4.731  1.00 0.00 ? 42  GLN A HA   9  
ATOM   6102  H  HB2  . GLN A 1 42 ? 4.737   12.597  -3.452  1.00 0.00 ? 42  GLN A HB2  9  
ATOM   6103  H  HB3  . GLN A 1 42 ? 5.016   13.315  -5.033  1.00 0.00 ? 42  GLN A HB3  9  
ATOM   6104  H  HG2  . GLN A 1 42 ? 2.433   13.428  -3.492  1.00 0.00 ? 42  GLN A HG2  9  
ATOM   6105  H  HG3  . GLN A 1 42 ? 3.621   14.726  -3.610  1.00 0.00 ? 42  GLN A HG3  9  
ATOM   6106  H  HE21 . GLN A 1 42 ? 1.043   13.061  -5.156  1.00 0.00 ? 42  GLN A HE21 9  
ATOM   6107  H  HE22 . GLN A 1 42 ? 0.931   14.075  -6.550  1.00 0.00 ? 42  GLN A HE22 9  
ATOM   6108  N  N    . ASN A 1 43 ? 3.602   10.648  -7.296  1.00 0.00 ? 43  ASN A N    9  
ATOM   6109  C  CA   . ASN A 1 43 ? 3.579   10.679  -8.754  1.00 0.00 ? 43  ASN A CA   9  
ATOM   6110  C  C    . ASN A 1 43 ? 2.528   11.661  -9.261  1.00 0.00 ? 43  ASN A C    9  
ATOM   6111  O  O    . ASN A 1 43 ? 2.803   12.486  -10.132 1.00 0.00 ? 43  ASN A O    9  
ATOM   6112  C  CB   . ASN A 1 43 ? 3.297   9.281   -9.310  1.00 0.00 ? 43  ASN A CB   9  
ATOM   6113  C  CG   . ASN A 1 43 ? 2.115   8.617   -8.631  1.00 0.00 ? 43  ASN A CG   9  
ATOM   6114  O  OD1  . ASN A 1 43 ? 0.967   9.015   -8.829  1.00 0.00 ? 43  ASN A OD1  9  
ATOM   6115  N  ND2  . ASN A 1 43 ? 2.391   7.598   -7.825  1.00 0.00 ? 43  ASN A ND2  9  
ATOM   6116  H  H    . ASN A 1 43 ? 3.501   9.789   -6.834  1.00 0.00 ? 43  ASN A H    9  
ATOM   6117  H  HA   . ASN A 1 43 ? 4.551   11.002  -9.094  1.00 0.00 ? 43  ASN A HA   9  
ATOM   6118  H  HB2  . ASN A 1 43 ? 3.085   9.357   -10.366 1.00 0.00 ? 43  ASN A HB2  9  
ATOM   6119  H  HB3  . ASN A 1 43 ? 4.168   8.660   -9.165  1.00 0.00 ? 43  ASN A HB3  9  
ATOM   6120  H  HD21 . ASN A 1 43 ? 3.329   7.336   -7.715  1.00 0.00 ? 43  ASN A HD21 9  
ATOM   6121  H  HD22 . ASN A 1 43 ? 1.646   7.150   -7.374  1.00 0.00 ? 43  ASN A HD22 9  
ATOM   6122  N  N    . SER A 1 44 ? 1.323   11.567  -8.708  1.00 0.00 ? 44  SER A N    9  
ATOM   6123  C  CA   . SER A 1 44 ? 0.229   12.446  -9.106  1.00 0.00 ? 44  SER A CA   9  
ATOM   6124  C  C    . SER A 1 44 ? -0.538  12.945  -7.885  1.00 0.00 ? 44  SER A C    9  
ATOM   6125  O  O    . SER A 1 44 ? -0.958  12.159  -7.037  1.00 0.00 ? 44  SER A O    9  
ATOM   6126  C  CB   . SER A 1 44 ? -0.722  11.714  -10.055 1.00 0.00 ? 44  SER A CB   9  
ATOM   6127  O  OG   . SER A 1 44 ? -0.232  11.737  -11.385 1.00 0.00 ? 44  SER A OG   9  
ATOM   6128  H  H    . SER A 1 44 ? 1.165   10.889  -8.018  1.00 0.00 ? 44  SER A H    9  
ATOM   6129  H  HA   . SER A 1 44 ? 0.655   13.294  -9.620  1.00 0.00 ? 44  SER A HA   9  
ATOM   6130  H  HB2  . SER A 1 44 ? -0.821  10.686  -9.739  1.00 0.00 ? 44  SER A HB2  9  
ATOM   6131  H  HB3  . SER A 1 44 ? -1.689  12.193  -10.031 1.00 0.00 ? 44  SER A HB3  9  
ATOM   6132  H  HG   . SER A 1 44 ? 0.434   11.054  -11.493 1.00 0.00 ? 44  SER A HG   9  
ATOM   6133  N  N    . GLY A 1 45 ? -0.717  14.260  -7.803  1.00 0.00 ? 45  GLY A N    9  
ATOM   6134  C  CA   . GLY A 1 45 ? -1.433  14.843  -6.684  1.00 0.00 ? 45  GLY A CA   9  
ATOM   6135  C  C    . GLY A 1 45 ? -2.885  14.412  -6.636  1.00 0.00 ? 45  GLY A C    9  
ATOM   6136  O  O    . GLY A 1 45 ? -3.315  13.705  -5.723  1.00 0.00 ? 45  GLY A O    9  
ATOM   6137  H  H    . GLY A 1 45 ? -0.360  14.839  -8.509  1.00 0.00 ? 45  GLY A H    9  
ATOM   6138  H  HA2  . GLY A 1 45 ? -0.949  14.545  -5.766  1.00 0.00 ? 45  GLY A HA2  9  
ATOM   6139  H  HA3  . GLY A 1 45 ? -1.392  15.920  -6.767  1.00 0.00 ? 45  GLY A HA3  9  
ATOM   6140  N  N    . PRO A 1 46 ? -3.668  14.842  -7.636  1.00 0.00 ? 46  PRO A N    9  
ATOM   6141  C  CA   . PRO A 1 46 ? -5.092  14.508  -7.726  1.00 0.00 ? 46  PRO A CA   9  
ATOM   6142  C  C    . PRO A 1 46 ? -5.324  13.036  -8.048  1.00 0.00 ? 46  PRO A C    9  
ATOM   6143  O  O    . PRO A 1 46 ? -5.434  12.655  -9.213  1.00 0.00 ? 46  PRO A O    9  
ATOM   6144  C  CB   . PRO A 1 46 ? -5.592  15.391  -8.873  1.00 0.00 ? 46  PRO A CB   9  
ATOM   6145  C  CG   . PRO A 1 46 ? -4.385  15.643  -9.710  1.00 0.00 ? 46  PRO A CG   9  
ATOM   6146  C  CD   . PRO A 1 46 ? -3.222  15.687  -8.757  1.00 0.00 ? 46  PRO A CD   9  
ATOM   6147  H  HA   . PRO A 1 46 ? -5.618  14.764  -6.818  1.00 0.00 ? 46  PRO A HA   9  
ATOM   6148  H  HB2  . PRO A 1 46 ? -6.356  14.865  -9.429  1.00 0.00 ? 46  PRO A HB2  9  
ATOM   6149  H  HB3  . PRO A 1 46 ? -5.995  16.310  -8.476  1.00 0.00 ? 46  PRO A HB3  9  
ATOM   6150  H  HG2  . PRO A 1 46 ? -4.257  14.841  -10.421 1.00 0.00 ? 46  PRO A HG2  9  
ATOM   6151  H  HG3  . PRO A 1 46 ? -4.485  16.589  -10.222 1.00 0.00 ? 46  PRO A HG3  9  
ATOM   6152  H  HD2  . PRO A 1 46 ? -2.338  15.276  -9.222  1.00 0.00 ? 46  PRO A HD2  9  
ATOM   6153  H  HD3  . PRO A 1 46 ? -3.042  16.699  -8.428  1.00 0.00 ? 46  PRO A HD3  9  
ATOM   6154  N  N    . SER A 1 47 ? -5.397  12.212  -7.007  1.00 0.00 ? 47  SER A N    9  
ATOM   6155  C  CA   . SER A 1 47 ? -5.612  10.780  -7.179  1.00 0.00 ? 47  SER A CA   9  
ATOM   6156  C  C    . SER A 1 47 ? -7.099  10.445  -7.132  1.00 0.00 ? 47  SER A C    9  
ATOM   6157  O  O    . SER A 1 47 ? -7.633  9.811   -8.043  1.00 0.00 ? 47  SER A O    9  
ATOM   6158  C  CB   . SER A 1 47 ? -4.867  9.997   -6.096  1.00 0.00 ? 47  SER A CB   9  
ATOM   6159  O  OG   . SER A 1 47 ? -5.241  10.435  -4.802  1.00 0.00 ? 47  SER A OG   9  
ATOM   6160  H  H    . SER A 1 47 ? -5.301  12.576  -6.102  1.00 0.00 ? 47  SER A H    9  
ATOM   6161  H  HA   . SER A 1 47 ? -5.222  10.500  -8.146  1.00 0.00 ? 47  SER A HA   9  
ATOM   6162  H  HB2  . SER A 1 47 ? -5.100  8.947   -6.190  1.00 0.00 ? 47  SER A HB2  9  
ATOM   6163  H  HB3  . SER A 1 47 ? -3.803  10.142  -6.219  1.00 0.00 ? 47  SER A HB3  9  
ATOM   6164  H  HG   . SER A 1 47 ? -4.790  11.258  -4.599  1.00 0.00 ? 47  SER A HG   9  
ATOM   6165  N  N    . SER A 1 48 ? -7.763  10.875  -6.064  1.00 0.00 ? 48  SER A N    9  
ATOM   6166  C  CA   . SER A 1 48 ? -9.189  10.618  -5.895  1.00 0.00 ? 48  SER A CA   9  
ATOM   6167  C  C    . SER A 1 48 ? -9.934  11.900  -5.538  1.00 0.00 ? 48  SER A C    9  
ATOM   6168  O  O    . SER A 1 48 ? -9.575  12.597  -4.590  1.00 0.00 ? 48  SER A O    9  
ATOM   6169  C  CB   . SER A 1 48 ? -9.413  9.565   -4.808  1.00 0.00 ? 48  SER A CB   9  
ATOM   6170  O  OG   . SER A 1 48 ? -10.776 9.182   -4.742  1.00 0.00 ? 48  SER A OG   9  
ATOM   6171  H  H    . SER A 1 48 ? -7.282  11.375  -5.372  1.00 0.00 ? 48  SER A H    9  
ATOM   6172  H  HA   . SER A 1 48 ? -9.571  10.242  -6.832  1.00 0.00 ? 48  SER A HA   9  
ATOM   6173  H  HB2  . SER A 1 48 ? -8.816  8.692   -5.026  1.00 0.00 ? 48  SER A HB2  9  
ATOM   6174  H  HB3  . SER A 1 48 ? -9.119  9.972   -3.851  1.00 0.00 ? 48  SER A HB3  9  
ATOM   6175  H  HG   . SER A 1 48 ? -11.138 9.133   -5.630  1.00 0.00 ? 48  SER A HG   9  
ATOM   6176  N  N    . GLY A 1 49 ? -10.975 12.206  -6.307  1.00 0.00 ? 49  GLY A N    9  
ATOM   6177  C  CA   . GLY A 1 49 ? -11.754 13.404  -6.057  1.00 0.00 ? 49  GLY A CA   9  
ATOM   6178  C  C    . GLY A 1 49 ? -12.309 13.452  -4.647  1.00 0.00 ? 49  GLY A C    9  
ATOM   6179  O  O    . GLY A 1 49 ? -12.593 12.398  -4.080  1.00 0.00 ? 49  GLY A O    9  
ATOM   6180  H  H    . GLY A 1 49 ? -11.215 11.614  -7.050  1.00 0.00 ? 49  GLY A H    9  
ATOM   6181  H  HA2  . GLY A 1 49 ? -11.127 14.269  -6.216  1.00 0.00 ? 49  GLY A HA2  9  
ATOM   6182  H  HA3  . GLY A 1 49 ? -12.577 13.436  -6.756  1.00 0.00 ? 49  GLY A HA3  9  
HETATM 6183  ZN ZN   . ZN  B 2 .  ? 2.887   -4.717  1.677   1.00 0.00 ? 201 ZN  A ZN   9  
ATOM   6184  N  N    . GLY A 1 1  ? -8.158  5.984   23.853  1.00 0.00 ? 1   GLY A N    10 
ATOM   6185  C  CA   . GLY A 1 1  ? -8.841  5.735   22.596  1.00 0.00 ? 1   GLY A CA   10 
ATOM   6186  C  C    . GLY A 1 1  ? -7.947  5.965   21.395  1.00 0.00 ? 1   GLY A C    10 
ATOM   6187  O  O    . GLY A 1 1  ? -6.779  6.325   21.541  1.00 0.00 ? 1   GLY A O    10 
ATOM   6188  H  H1   . GLY A 1 1  ? -8.275  6.843   24.309  1.00 0.00 ? 1   GLY A H1   10 
ATOM   6189  H  HA2  . GLY A 1 1  ? -9.187  4.712   22.584  1.00 0.00 ? 1   GLY A HA2  10 
ATOM   6190  H  HA3  . GLY A 1 1  ? -9.694  6.393   22.527  1.00 0.00 ? 1   GLY A HA3  10 
ATOM   6191  N  N    . SER A 1 2  ? -8.495  5.756   20.202  1.00 0.00 ? 2   SER A N    10 
ATOM   6192  C  CA   . SER A 1 2  ? -7.737  5.938   18.970  1.00 0.00 ? 2   SER A CA   10 
ATOM   6193  C  C    . SER A 1 2  ? -8.670  6.203   17.792  1.00 0.00 ? 2   SER A C    10 
ATOM   6194  O  O    . SER A 1 2  ? -9.785  5.684   17.740  1.00 0.00 ? 2   SER A O    10 
ATOM   6195  C  CB   . SER A 1 2  ? -6.878  4.704   18.687  1.00 0.00 ? 2   SER A CB   10 
ATOM   6196  O  OG   . SER A 1 2  ? -7.682  3.600   18.308  1.00 0.00 ? 2   SER A OG   10 
ATOM   6197  H  H    . SER A 1 2  ? -9.431  5.470   20.150  1.00 0.00 ? 2   SER A H    10 
ATOM   6198  H  HA   . SER A 1 2  ? -7.091  6.793   19.101  1.00 0.00 ? 2   SER A HA   10 
ATOM   6199  H  HB2  . SER A 1 2  ? -6.189  4.924   17.886  1.00 0.00 ? 2   SER A HB2  10 
ATOM   6200  H  HB3  . SER A 1 2  ? -6.325  4.442   19.577  1.00 0.00 ? 2   SER A HB3  10 
ATOM   6201  H  HG   . SER A 1 2  ? -7.118  2.865   18.054  1.00 0.00 ? 2   SER A HG   10 
ATOM   6202  N  N    . SER A 1 3  ? -8.205  7.015   16.848  1.00 0.00 ? 3   SER A N    10 
ATOM   6203  C  CA   . SER A 1 3  ? -8.999  7.354   15.672  1.00 0.00 ? 3   SER A CA   10 
ATOM   6204  C  C    . SER A 1 3  ? -8.329  6.842   14.400  1.00 0.00 ? 3   SER A C    10 
ATOM   6205  O  O    . SER A 1 3  ? -7.156  7.114   14.150  1.00 0.00 ? 3   SER A O    10 
ATOM   6206  C  CB   . SER A 1 3  ? -9.198  8.868   15.583  1.00 0.00 ? 3   SER A CB   10 
ATOM   6207  O  OG   . SER A 1 3  ? -8.025  9.510   15.114  1.00 0.00 ? 3   SER A OG   10 
ATOM   6208  H  H    . SER A 1 3  ? -7.308  7.398   16.946  1.00 0.00 ? 3   SER A H    10 
ATOM   6209  H  HA   . SER A 1 3  ? -9.962  6.878   15.774  1.00 0.00 ? 3   SER A HA   10 
ATOM   6210  H  HB2  . SER A 1 3  ? -10.008 9.083   14.904  1.00 0.00 ? 3   SER A HB2  10 
ATOM   6211  H  HB3  . SER A 1 3  ? -9.438  9.254   16.563  1.00 0.00 ? 3   SER A HB3  10 
ATOM   6212  H  HG   . SER A 1 3  ? -7.312  9.373   15.741  1.00 0.00 ? 3   SER A HG   10 
ATOM   6213  N  N    . GLY A 1 4  ? -9.086  6.098   13.599  1.00 0.00 ? 4   GLY A N    10 
ATOM   6214  C  CA   . GLY A 1 4  ? -8.551  5.560   12.362  1.00 0.00 ? 4   GLY A CA   10 
ATOM   6215  C  C    . GLY A 1 4  ? -9.610  5.410   11.288  1.00 0.00 ? 4   GLY A C    10 
ATOM   6216  O  O    . GLY A 1 4  ? -9.846  6.332   10.507  1.00 0.00 ? 4   GLY A O    10 
ATOM   6217  H  H    . GLY A 1 4  ? -10.016 5.914   13.849  1.00 0.00 ? 4   GLY A H    10 
ATOM   6218  H  HA2  . GLY A 1 4  ? -7.776  6.219   12.000  1.00 0.00 ? 4   GLY A HA2  10 
ATOM   6219  H  HA3  . GLY A 1 4  ? -8.119  4.590   12.562  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   6220  N  N    . SER A 1 5  ? -10.249 4.245   11.247  1.00 0.00 ? 5   SER A N    10 
ATOM   6221  C  CA   . SER A 1 5  ? -11.285 3.976   10.257  1.00 0.00 ? 5   SER A CA   10 
ATOM   6222  C  C    . SER A 1 5  ? -10.764 4.222   8.845   1.00 0.00 ? 5   SER A C    10 
ATOM   6223  O  O    . SER A 1 5  ? -11.462 4.788   8.003   1.00 0.00 ? 5   SER A O    10 
ATOM   6224  C  CB   . SER A 1 5  ? -12.511 4.852   10.520  1.00 0.00 ? 5   SER A CB   10 
ATOM   6225  O  OG   . SER A 1 5  ? -13.256 4.370   11.625  1.00 0.00 ? 5   SER A OG   10 
ATOM   6226  H  H    . SER A 1 5  ? -10.016 3.550   11.897  1.00 0.00 ? 5   SER A H    10 
ATOM   6227  H  HA   . SER A 1 5  ? -11.569 2.938   10.348  1.00 0.00 ? 5   SER A HA   10 
ATOM   6228  H  HB2  . SER A 1 5  ? -12.191 5.862   10.731  1.00 0.00 ? 5   SER A HB2  10 
ATOM   6229  H  HB3  . SER A 1 5  ? -13.146 4.851   9.646   1.00 0.00 ? 5   SER A HB3  10 
ATOM   6230  H  HG   . SER A 1 5  ? -14.176 4.626   11.528  1.00 0.00 ? 5   SER A HG   10 
ATOM   6231  N  N    . SER A 1 6  ? -9.532  3.793   8.592   1.00 0.00 ? 6   SER A N    10 
ATOM   6232  C  CA   . SER A 1 6  ? -8.914  3.969   7.283   1.00 0.00 ? 6   SER A CA   10 
ATOM   6233  C  C    . SER A 1 6  ? -9.243  2.796   6.365   1.00 0.00 ? 6   SER A C    10 
ATOM   6234  O  O    . SER A 1 6  ? -9.820  2.975   5.293   1.00 0.00 ? 6   SER A O    10 
ATOM   6235  C  CB   . SER A 1 6  ? -7.397  4.109   7.426   1.00 0.00 ? 6   SER A CB   10 
ATOM   6236  O  OG   . SER A 1 6  ? -7.032  5.453   7.688   1.00 0.00 ? 6   SER A OG   10 
ATOM   6237  H  H    . SER A 1 6  ? -9.025  3.348   9.304   1.00 0.00 ? 6   SER A H    10 
ATOM   6238  H  HA   . SER A 1 6  ? -9.311  4.874   6.848   1.00 0.00 ? 6   SER A HA   10 
ATOM   6239  H  HB2  . SER A 1 6  ? -7.056  3.491   8.243   1.00 0.00 ? 6   SER A HB2  10 
ATOM   6240  H  HB3  . SER A 1 6  ? -6.921  3.791   6.510   1.00 0.00 ? 6   SER A HB3  10 
ATOM   6241  H  HG   . SER A 1 6  ? -7.272  5.681   8.590   1.00 0.00 ? 6   SER A HG   10 
ATOM   6242  N  N    . GLY A 1 7  ? -8.870  1.594   6.793   1.00 0.00 ? 7   GLY A N    10 
ATOM   6243  C  CA   . GLY A 1 7  ? -9.133  0.408   5.999   1.00 0.00 ? 7   GLY A CA   10 
ATOM   6244  C  C    . GLY A 1 7  ? -9.100  -0.862  6.825   1.00 0.00 ? 7   GLY A C    10 
ATOM   6245  O  O    . GLY A 1 7  ? -8.539  -0.884  7.920   1.00 0.00 ? 7   GLY A O    10 
ATOM   6246  H  H    . GLY A 1 7  ? -8.412  1.511   7.656   1.00 0.00 ? 7   GLY A H    10 
ATOM   6247  H  HA2  . GLY A 1 7  ? -10.106 0.503   5.541   1.00 0.00 ? 7   GLY A HA2  10 
ATOM   6248  H  HA3  . GLY A 1 7  ? -8.386  0.337   5.221   1.00 0.00 ? 7   GLY A HA3  10 
ATOM   6249  N  N    . SER A 1 8  ? -9.705  -1.923  6.300   1.00 0.00 ? 8   SER A N    10 
ATOM   6250  C  CA   . SER A 1 8  ? -9.748  -3.202  6.999   1.00 0.00 ? 8   SER A CA   10 
ATOM   6251  C  C    . SER A 1 8  ? -8.884  -4.240  6.287   1.00 0.00 ? 8   SER A C    10 
ATOM   6252  O  O    . SER A 1 8  ? -9.092  -4.535  5.109   1.00 0.00 ? 8   SER A O    10 
ATOM   6253  C  CB   . SER A 1 8  ? -11.189 -3.704  7.099   1.00 0.00 ? 8   SER A CB   10 
ATOM   6254  O  OG   . SER A 1 8  ? -11.978 -2.835  7.893   1.00 0.00 ? 8   SER A OG   10 
ATOM   6255  H  H    . SER A 1 8  ? -10.134 -1.843  5.422   1.00 0.00 ? 8   SER A H    10 
ATOM   6256  H  HA   . SER A 1 8  ? -9.358  -3.049  7.994   1.00 0.00 ? 8   SER A HA   10 
ATOM   6257  H  HB2  . SER A 1 8  ? -11.619 -3.758  6.110   1.00 0.00 ? 8   SER A HB2  10 
ATOM   6258  H  HB3  . SER A 1 8  ? -11.195 -4.687  7.548   1.00 0.00 ? 8   SER A HB3  10 
ATOM   6259  H  HG   . SER A 1 8  ? -12.333 -3.319  8.642   1.00 0.00 ? 8   SER A HG   10 
ATOM   6260  N  N    . LEU A 1 9  ? -7.915  -4.790  7.010   1.00 0.00 ? 9   LEU A N    10 
ATOM   6261  C  CA   . LEU A 1 9  ? -7.019  -5.795  6.449   1.00 0.00 ? 9   LEU A CA   10 
ATOM   6262  C  C    . LEU A 1 9  ? -7.803  -6.998  5.936   1.00 0.00 ? 9   LEU A C    10 
ATOM   6263  O  O    . LEU A 1 9  ? -8.355  -7.771  6.718   1.00 0.00 ? 9   LEU A O    10 
ATOM   6264  C  CB   . LEU A 1 9  ? -6.003  -6.244  7.500   1.00 0.00 ? 9   LEU A CB   10 
ATOM   6265  C  CG   . LEU A 1 9  ? -4.954  -5.208  7.907   1.00 0.00 ? 9   LEU A CG   10 
ATOM   6266  C  CD1  . LEU A 1 9  ? -4.227  -5.651  9.167   1.00 0.00 ? 9   LEU A CD1  10 
ATOM   6267  C  CD2  . LEU A 1 9  ? -3.967  -4.976  6.772   1.00 0.00 ? 9   LEU A CD2  10 
ATOM   6268  H  H    . LEU A 1 9  ? -7.799  -4.514  7.942   1.00 0.00 ? 9   LEU A H    10 
ATOM   6269  H  HA   . LEU A 1 9  ? -6.492  -5.344  5.621   1.00 0.00 ? 9   LEU A HA   10 
ATOM   6270  H  HB2  . LEU A 1 9  ? -6.549  -6.527  8.387   1.00 0.00 ? 9   LEU A HB2  10 
ATOM   6271  H  HB3  . LEU A 1 9  ? -5.483  -7.107  7.109   1.00 0.00 ? 9   LEU A HB3  10 
ATOM   6272  H  HG   . LEU A 1 9  ? -5.448  -4.270  8.119   1.00 0.00 ? 9   LEU A HG   10 
ATOM   6273  H  HD11 . LEU A 1 9  ? -4.759  -6.474  9.619   1.00 0.00 ? 9   LEU A HD11 10 
ATOM   6274  H  HD12 . LEU A 1 9  ? -4.179  -4.827  9.863   1.00 0.00 ? 9   LEU A HD12 10 
ATOM   6275  H  HD13 . LEU A 1 9  ? -3.225  -5.965  8.913   1.00 0.00 ? 9   LEU A HD13 10 
ATOM   6276  H  HD21 . LEU A 1 9  ? -4.367  -4.241  6.091   1.00 0.00 ? 9   LEU A HD21 10 
ATOM   6277  H  HD22 . LEU A 1 9  ? -3.801  -5.904  6.245   1.00 0.00 ? 9   LEU A HD22 10 
ATOM   6278  H  HD23 . LEU A 1 9  ? -3.030  -4.621  7.178   1.00 0.00 ? 9   LEU A HD23 10 
ATOM   6279  N  N    . MET A 1 10 ? -7.846  -7.151  4.616   1.00 0.00 ? 10  MET A N    10 
ATOM   6280  C  CA   . MET A 1 10 ? -8.560  -8.263  3.999   1.00 0.00 ? 10  MET A CA   10 
ATOM   6281  C  C    . MET A 1 10 ? -7.915  -9.595  4.369   1.00 0.00 ? 10  MET A C    10 
ATOM   6282  O  O    . MET A 1 10 ? -6.865  -9.630  5.011   1.00 0.00 ? 10  MET A O    10 
ATOM   6283  C  CB   . MET A 1 10 ? -8.584  -8.100  2.478   1.00 0.00 ? 10  MET A CB   10 
ATOM   6284  C  CG   . MET A 1 10 ? -9.610  -7.090  1.991   1.00 0.00 ? 10  MET A CG   10 
ATOM   6285  S  SD   . MET A 1 10 ? -11.240 -7.821  1.743   1.00 0.00 ? 10  MET A SD   10 
ATOM   6286  C  CE   . MET A 1 10 ? -11.207 -8.131  -0.021  1.00 0.00 ? 10  MET A CE   10 
ATOM   6287  H  H    . MET A 1 10 ? -7.386  -6.502  4.044   1.00 0.00 ? 10  MET A H    10 
ATOM   6288  H  HA   . MET A 1 10 ? -9.574  -8.252  4.369   1.00 0.00 ? 10  MET A HA   10 
ATOM   6289  H  HB2  . MET A 1 10 ? -7.608  -7.777  2.147   1.00 0.00 ? 10  MET A HB2  10 
ATOM   6290  H  HB3  . MET A 1 10 ? -8.810  -9.055  2.028   1.00 0.00 ? 10  MET A HB3  10 
ATOM   6291  H  HG2  . MET A 1 10 ? -9.694  -6.300  2.722   1.00 0.00 ? 10  MET A HG2  10 
ATOM   6292  H  HG3  . MET A 1 10 ? -9.270  -6.675  1.054   1.00 0.00 ? 10  MET A HG3  10 
ATOM   6293  H  HE1  . MET A 1 10 ? -11.648 -7.294  -0.541  1.00 0.00 ? 10  MET A HE1  10 
ATOM   6294  H  HE2  . MET A 1 10 ? -10.185 -8.259  -0.345  1.00 0.00 ? 10  MET A HE2  10 
ATOM   6295  H  HE3  . MET A 1 10 ? -11.769 -9.027  -0.239  1.00 0.00 ? 10  MET A HE3  10 
ATOM   6296  N  N    . ASP A 1 11 ? -8.551  -10.688 3.961   1.00 0.00 ? 11  ASP A N    10 
ATOM   6297  C  CA   . ASP A 1 11 ? -8.039  -12.023 4.250   1.00 0.00 ? 11  ASP A CA   10 
ATOM   6298  C  C    . ASP A 1 11 ? -6.979  -12.430 3.231   1.00 0.00 ? 11  ASP A C    10 
ATOM   6299  O  O    . ASP A 1 11 ? -6.505  -13.566 3.233   1.00 0.00 ? 11  ASP A O    10 
ATOM   6300  C  CB   . ASP A 1 11 ? -9.181  -13.041 4.251   1.00 0.00 ? 11  ASP A CB   10 
ATOM   6301  C  CG   . ASP A 1 11 ? -9.701  -13.328 2.856   1.00 0.00 ? 11  ASP A CG   10 
ATOM   6302  O  OD1  . ASP A 1 11 ? -10.403 -12.462 2.295   1.00 0.00 ? 11  ASP A OD1  10 
ATOM   6303  O  OD2  . ASP A 1 11 ? -9.408  -14.420 2.326   1.00 0.00 ? 11  ASP A OD2  10 
ATOM   6304  H  H    . ASP A 1 11 ? -9.384  -10.595 3.453   1.00 0.00 ? 11  ASP A H    10 
ATOM   6305  H  HA   . ASP A 1 11 ? -7.588  -12.000 5.230   1.00 0.00 ? 11  ASP A HA   10 
ATOM   6306  H  HB2  . ASP A 1 11 ? -8.828  -13.967 4.681   1.00 0.00 ? 11  ASP A HB2  10 
ATOM   6307  H  HB3  . ASP A 1 11 ? -9.995  -12.658 4.848   1.00 0.00 ? 11  ASP A HB3  10 
ATOM   6308  N  N    . VAL A 1 12 ? -6.611  -11.495 2.361   1.00 0.00 ? 12  VAL A N    10 
ATOM   6309  C  CA   . VAL A 1 12 ? -5.607  -11.756 1.337   1.00 0.00 ? 12  VAL A CA   10 
ATOM   6310  C  C    . VAL A 1 12 ? -4.285  -11.077 1.677   1.00 0.00 ? 12  VAL A C    10 
ATOM   6311  O  O    . VAL A 1 12 ? -4.258  -9.921  2.099   1.00 0.00 ? 12  VAL A O    10 
ATOM   6312  C  CB   . VAL A 1 12 ? -6.079  -11.272 -0.047  1.00 0.00 ? 12  VAL A CB   10 
ATOM   6313  C  CG1  . VAL A 1 12 ? -6.245  -9.760  -0.056  1.00 0.00 ? 12  VAL A CG1  10 
ATOM   6314  C  CG2  . VAL A 1 12 ? -5.103  -11.715 -1.127  1.00 0.00 ? 12  VAL A CG2  10 
ATOM   6315  H  H    . VAL A 1 12 ? -7.025  -10.607 2.410   1.00 0.00 ? 12  VAL A H    10 
ATOM   6316  H  HA   . VAL A 1 12 ? -5.451  -12.824 1.287   1.00 0.00 ? 12  VAL A HA   10 
ATOM   6317  H  HB   . VAL A 1 12 ? -7.040  -11.718 -0.255  1.00 0.00 ? 12  VAL A HB   10 
ATOM   6318  H  HG11 . VAL A 1 12 ? -6.951  -9.471  0.709   1.00 0.00 ? 12  VAL A HG11 10 
ATOM   6319  H  HG12 . VAL A 1 12 ? -5.291  -9.291  0.137   1.00 0.00 ? 12  VAL A HG12 10 
ATOM   6320  H  HG13 . VAL A 1 12 ? -6.612  -9.444  -1.022  1.00 0.00 ? 12  VAL A HG13 10 
ATOM   6321  H  HG21 . VAL A 1 12 ? -4.356  -12.363 -0.694  1.00 0.00 ? 12  VAL A HG21 10 
ATOM   6322  H  HG22 . VAL A 1 12 ? -5.639  -12.248 -1.898  1.00 0.00 ? 12  VAL A HG22 10 
ATOM   6323  H  HG23 . VAL A 1 12 ? -4.622  -10.848 -1.557  1.00 0.00 ? 12  VAL A HG23 10 
ATOM   6324  N  N    . LYS A 1 13 ? -3.189  -11.804 1.491   1.00 0.00 ? 13  LYS A N    10 
ATOM   6325  C  CA   . LYS A 1 13 ? -1.861  -11.273 1.776   1.00 0.00 ? 13  LYS A CA   10 
ATOM   6326  C  C    . LYS A 1 13 ? -1.526  -10.114 0.843   1.00 0.00 ? 13  LYS A C    10 
ATOM   6327  O  O    . LYS A 1 13 ? -2.028  -10.042 -0.279  1.00 0.00 ? 13  LYS A O    10 
ATOM   6328  C  CB   . LYS A 1 13 ? -0.808  -12.374 1.637   1.00 0.00 ? 13  LYS A CB   10 
ATOM   6329  C  CG   . LYS A 1 13 ? -0.730  -13.298 2.840   1.00 0.00 ? 13  LYS A CG   10 
ATOM   6330  C  CD   . LYS A 1 13 ? -1.743  -14.426 2.743   1.00 0.00 ? 13  LYS A CD   10 
ATOM   6331  C  CE   . LYS A 1 13 ? -1.290  -15.500 1.766   1.00 0.00 ? 13  LYS A CE   10 
ATOM   6332  N  NZ   . LYS A 1 13 ? -2.283  -16.604 1.655   1.00 0.00 ? 13  LYS A NZ   10 
ATOM   6333  H  H    . LYS A 1 13 ? -3.274  -12.720 1.152   1.00 0.00 ? 13  LYS A H    10 
ATOM   6334  H  HA   . LYS A 1 13 ? -1.859  -10.912 2.794   1.00 0.00 ? 13  LYS A HA   10 
ATOM   6335  H  HB2  . LYS A 1 13 ? -1.040  -12.970 0.766   1.00 0.00 ? 13  LYS A HB2  10 
ATOM   6336  H  HB3  . LYS A 1 13 ? 0.160   -11.915 1.499   1.00 0.00 ? 13  LYS A HB3  10 
ATOM   6337  H  HG2  . LYS A 1 13 ? 0.261   -13.723 2.893   1.00 0.00 ? 13  LYS A HG2  10 
ATOM   6338  H  HG3  . LYS A 1 13 ? -0.927  -12.725 3.735   1.00 0.00 ? 13  LYS A HG3  10 
ATOM   6339  H  HD2  . LYS A 1 13 ? -1.867  -14.872 3.719   1.00 0.00 ? 13  LYS A HD2  10 
ATOM   6340  H  HD3  . LYS A 1 13 ? -2.688  -14.022 2.407   1.00 0.00 ? 13  LYS A HD3  10 
ATOM   6341  H  HE2  . LYS A 1 13 ? -1.153  -15.051 0.795   1.00 0.00 ? 13  LYS A HE2  10 
ATOM   6342  H  HE3  . LYS A 1 13 ? -0.350  -15.907 2.110   1.00 0.00 ? 13  LYS A HE3  10 
ATOM   6343  H  HZ1  . LYS A 1 13 ? -1.827  -17.459 1.278   1.00 0.00 ? 13  LYS A HZ1  10 
ATOM   6344  H  HZ2  . LYS A 1 13 ? -3.056  -16.325 1.016   1.00 0.00 ? 13  LYS A HZ2  10 
ATOM   6345  H  HZ3  . LYS A 1 13 ? -2.684  -16.821 2.590   1.00 0.00 ? 13  LYS A HZ3  10 
ATOM   6346  N  N    . CYS A 1 14 ? -0.675  -9.208  1.313   1.00 0.00 ? 14  CYS A N    10 
ATOM   6347  C  CA   . CYS A 1 14 ? -0.272  -8.053  0.521   1.00 0.00 ? 14  CYS A CA   10 
ATOM   6348  C  C    . CYS A 1 14 ? 0.236   -8.485  -0.852  1.00 0.00 ? 14  CYS A C    10 
ATOM   6349  O  O    . CYS A 1 14 ? 0.930   -9.493  -0.978  1.00 0.00 ? 14  CYS A O    10 
ATOM   6350  C  CB   . CYS A 1 14 ? 0.813   -7.260  1.252   1.00 0.00 ? 14  CYS A CB   10 
ATOM   6351  S  SG   . CYS A 1 14 ? 1.536   -5.907  0.269   1.00 0.00 ? 14  CYS A SG   10 
ATOM   6352  H  H    . CYS A 1 14 ? -0.308  -9.320  2.216   1.00 0.00 ? 14  CYS A H    10 
ATOM   6353  H  HA   . CYS A 1 14 ? -1.138  -7.423  0.389   1.00 0.00 ? 14  CYS A HA   10 
ATOM   6354  H  HB2  . CYS A 1 14 ? 0.390   -6.826  2.146   1.00 0.00 ? 14  CYS A HB2  10 
ATOM   6355  H  HB3  . CYS A 1 14 ? 1.614   -7.931  1.528   1.00 0.00 ? 14  CYS A HB3  10 
ATOM   6356  N  N    . GLU A 1 15 ? -0.116  -7.714  -1.876  1.00 0.00 ? 15  GLU A N    10 
ATOM   6357  C  CA   . GLU A 1 15 ? 0.304   -8.018  -3.239  1.00 0.00 ? 15  GLU A CA   10 
ATOM   6358  C  C    . GLU A 1 15 ? 1.694   -8.648  -3.253  1.00 0.00 ? 15  GLU A C    10 
ATOM   6359  O  O    . GLU A 1 15 ? 1.862   -9.802  -3.649  1.00 0.00 ? 15  GLU A O    10 
ATOM   6360  C  CB   . GLU A 1 15 ? 0.300   -6.748  -4.093  1.00 0.00 ? 15  GLU A CB   10 
ATOM   6361  C  CG   . GLU A 1 15 ? 0.618   -6.998  -5.557  1.00 0.00 ? 15  GLU A CG   10 
ATOM   6362  C  CD   . GLU A 1 15 ? -0.249  -8.084  -6.165  1.00 0.00 ? 15  GLU A CD   10 
ATOM   6363  O  OE1  . GLU A 1 15 ? -1.442  -8.163  -5.805  1.00 0.00 ? 15  GLU A OE1  10 
ATOM   6364  O  OE2  . GLU A 1 15 ? 0.267   -8.855  -7.002  1.00 0.00 ? 15  GLU A OE2  10 
ATOM   6365  H  H    . GLU A 1 15 ? -0.671  -6.923  -1.712  1.00 0.00 ? 15  GLU A H    10 
ATOM   6366  H  HA   . GLU A 1 15 ? -0.401  -8.722  -3.654  1.00 0.00 ? 15  GLU A HA   10 
ATOM   6367  H  HB2  . GLU A 1 15 ? -0.676  -6.290  -4.030  1.00 0.00 ? 15  GLU A HB2  10 
ATOM   6368  H  HB3  . GLU A 1 15 ? 1.036   -6.062  -3.699  1.00 0.00 ? 15  GLU A HB3  10 
ATOM   6369  H  HG2  . GLU A 1 15 ? 0.460   -6.083  -6.108  1.00 0.00 ? 15  GLU A HG2  10 
ATOM   6370  H  HG3  . GLU A 1 15 ? 1.653   -7.294  -5.643  1.00 0.00 ? 15  GLU A HG3  10 
ATOM   6371  N  N    . THR A 1 16 ? 2.689   -7.882  -2.817  1.00 0.00 ? 16  THR A N    10 
ATOM   6372  C  CA   . THR A 1 16 ? 4.065   -8.363  -2.780  1.00 0.00 ? 16  THR A CA   10 
ATOM   6373  C  C    . THR A 1 16 ? 4.164   -9.686  -2.029  1.00 0.00 ? 16  THR A C    10 
ATOM   6374  O  O    . THR A 1 16 ? 3.768   -9.800  -0.869  1.00 0.00 ? 16  THR A O    10 
ATOM   6375  C  CB   . THR A 1 16 ? 5.001   -7.336  -2.115  1.00 0.00 ? 16  THR A CB   10 
ATOM   6376  O  OG1  . THR A 1 16 ? 5.024   -6.126  -2.881  1.00 0.00 ? 16  THR A OG1  10 
ATOM   6377  C  CG2  . THR A 1 16 ? 6.412   -7.891  -1.993  1.00 0.00 ? 16  THR A CG2  10 
ATOM   6378  H  H    . THR A 1 16 ? 2.492   -6.971  -2.515  1.00 0.00 ? 16  THR A H    10 
ATOM   6379  H  HA   . THR A 1 16 ? 4.393   -8.512  -3.798  1.00 0.00 ? 16  THR A HA   10 
ATOM   6380  H  HB   . THR A 1 16 ? 4.628   -7.120  -1.125  1.00 0.00 ? 16  THR A HB   10 
ATOM   6381  H  HG1  . THR A 1 16 ? 4.334   -5.537  -2.568  1.00 0.00 ? 16  THR A HG1  10 
ATOM   6382  H  HG21 . THR A 1 16 ? 7.122   -7.140  -2.303  1.00 0.00 ? 16  THR A HG21 10 
ATOM   6383  H  HG22 . THR A 1 16 ? 6.513   -8.763  -2.622  1.00 0.00 ? 16  THR A HG22 10 
ATOM   6384  H  HG23 . THR A 1 16 ? 6.603   -8.165  -0.966  1.00 0.00 ? 16  THR A HG23 10 
ATOM   6385  N  N    . PRO A 1 17 ? 4.707   -10.710 -2.704  1.00 0.00 ? 17  PRO A N    10 
ATOM   6386  C  CA   . PRO A 1 17 ? 4.873   -12.044 -2.118  1.00 0.00 ? 17  PRO A CA   10 
ATOM   6387  C  C    . PRO A 1 17 ? 5.938   -12.070 -1.027  1.00 0.00 ? 17  PRO A C    10 
ATOM   6388  O  O    . PRO A 1 17 ? 6.197   -13.111 -0.425  1.00 0.00 ? 17  PRO A O    10 
ATOM   6389  C  CB   . PRO A 1 17 ? 5.306   -12.903 -3.309  1.00 0.00 ? 17  PRO A CB   10 
ATOM   6390  C  CG   . PRO A 1 17 ? 5.941   -11.944 -4.256  1.00 0.00 ? 17  PRO A CG   10 
ATOM   6391  C  CD   . PRO A 1 17 ? 5.201   -10.646 -4.089  1.00 0.00 ? 17  PRO A CD   10 
ATOM   6392  H  HA   . PRO A 1 17 ? 3.942   -12.421 -1.720  1.00 0.00 ? 17  PRO A HA   10 
ATOM   6393  H  HB2  . PRO A 1 17 ? 6.007   -13.655 -2.977  1.00 0.00 ? 17  PRO A HB2  10 
ATOM   6394  H  HB3  . PRO A 1 17 ? 4.441   -13.378 -3.748  1.00 0.00 ? 17  PRO A HB3  10 
ATOM   6395  H  HG2  . PRO A 1 17 ? 6.983   -11.817 -4.007  1.00 0.00 ? 17  PRO A HG2  10 
ATOM   6396  H  HG3  . PRO A 1 17 ? 5.837   -12.306 -5.269  1.00 0.00 ? 17  PRO A HG3  10 
ATOM   6397  H  HD2  . PRO A 1 17 ? 5.872   -9.810  -4.221  1.00 0.00 ? 17  PRO A HD2  10 
ATOM   6398  H  HD3  . PRO A 1 17 ? 4.380   -10.587 -4.788  1.00 0.00 ? 17  PRO A HD3  10 
ATOM   6399  N  N    . ASN A 1 18 ? 6.552   -10.918 -0.778  1.00 0.00 ? 18  ASN A N    10 
ATOM   6400  C  CA   . ASN A 1 18 ? 7.589   -10.809 0.241   1.00 0.00 ? 18  ASN A CA   10 
ATOM   6401  C  C    . ASN A 1 18 ? 7.058   -10.103 1.484   1.00 0.00 ? 18  ASN A C    10 
ATOM   6402  O  O    . ASN A 1 18 ? 7.596   -10.265 2.581   1.00 0.00 ? 18  ASN A O    10 
ATOM   6403  C  CB   . ASN A 1 18 ? 8.799   -10.053 -0.312  1.00 0.00 ? 18  ASN A CB   10 
ATOM   6404  C  CG   . ASN A 1 18 ? 9.805   -9.704  0.767   1.00 0.00 ? 18  ASN A CG   10 
ATOM   6405  O  OD1  . ASN A 1 18 ? 9.911   -8.550  1.183   1.00 0.00 ? 18  ASN A OD1  10 
ATOM   6406  N  ND2  . ASN A 1 18 ? 10.550  -10.703 1.227   1.00 0.00 ? 18  ASN A ND2  10 
ATOM   6407  H  H    . ASN A 1 18 ? 6.301   -10.122 -1.292  1.00 0.00 ? 18  ASN A H    10 
ATOM   6408  H  HA   . ASN A 1 18 ? 7.894   -11.809 0.511   1.00 0.00 ? 18  ASN A HA   10 
ATOM   6409  H  HB2  . ASN A 1 18 ? 9.292   -10.666 -1.052  1.00 0.00 ? 18  ASN A HB2  10 
ATOM   6410  H  HB3  . ASN A 1 18 ? 8.463   -9.137  -0.775  1.00 0.00 ? 18  ASN A HB3  10 
ATOM   6411  H  HD21 . ASN A 1 18 ? 10.411  -11.596 0.849   1.00 0.00 ? 18  ASN A HD21 10 
ATOM   6412  H  HD22 . ASN A 1 18 ? 11.208  -10.505 1.925   1.00 0.00 ? 18  ASN A HD22 10 
ATOM   6413  N  N    . CYS A 1 19 ? 6.000   -9.320  1.307   1.00 0.00 ? 19  CYS A N    10 
ATOM   6414  C  CA   . CYS A 1 19 ? 5.395   -8.589  2.414   1.00 0.00 ? 19  CYS A CA   10 
ATOM   6415  C  C    . CYS A 1 19 ? 4.555   -9.518  3.285   1.00 0.00 ? 19  CYS A C    10 
ATOM   6416  O  O    . CYS A 1 19 ? 3.511   -10.022 2.872   1.00 0.00 ? 19  CYS A O    10 
ATOM   6417  C  CB   . CYS A 1 19 ? 4.526   -7.446  1.883   1.00 0.00 ? 19  CYS A CB   10 
ATOM   6418  S  SG   . CYS A 1 19 ? 4.080   -6.206  3.140   1.00 0.00 ? 19  CYS A SG   10 
ATOM   6419  H  H    . CYS A 1 19 ? 5.615   -9.231  0.409   1.00 0.00 ? 19  CYS A H    10 
ATOM   6420  H  HA   . CYS A 1 19 ? 6.191   -8.175  3.013   1.00 0.00 ? 19  CYS A HA   10 
ATOM   6421  H  HB2  . CYS A 1 19 ? 5.059   -6.936  1.094   1.00 0.00 ? 19  CYS A HB2  10 
ATOM   6422  H  HB3  . CYS A 1 19 ? 3.610   -7.856  1.485   1.00 0.00 ? 19  CYS A HB3  10 
ATOM   6423  N  N    . PRO A 1 20 ? 5.021   -9.751  4.521   1.00 0.00 ? 20  PRO A N    10 
ATOM   6424  C  CA   . PRO A 1 20 ? 4.329   -10.620 5.478   1.00 0.00 ? 20  PRO A CA   10 
ATOM   6425  C  C    . PRO A 1 20 ? 3.026   -10.007 5.979   1.00 0.00 ? 20  PRO A C    10 
ATOM   6426  O  O    . PRO A 1 20 ? 2.345   -10.581 6.829   1.00 0.00 ? 20  PRO A O    10 
ATOM   6427  C  CB   . PRO A 1 20 ? 5.333   -10.754 6.626   1.00 0.00 ? 20  PRO A CB   10 
ATOM   6428  C  CG   . PRO A 1 20 ? 6.171   -9.525  6.542   1.00 0.00 ? 20  PRO A CG   10 
ATOM   6429  C  CD   . PRO A 1 20 ? 6.260   -9.184  5.080   1.00 0.00 ? 20  PRO A CD   10 
ATOM   6430  H  HA   . PRO A 1 20 ? 4.129   -11.594 5.056   1.00 0.00 ? 20  PRO A HA   10 
ATOM   6431  H  HB2  . PRO A 1 20 ? 4.803   -10.809 7.566   1.00 0.00 ? 20  PRO A HB2  10 
ATOM   6432  H  HB3  . PRO A 1 20 ? 5.925   -11.646 6.488   1.00 0.00 ? 20  PRO A HB3  10 
ATOM   6433  H  HG2  . PRO A 1 20 ? 5.700   -8.722  7.087   1.00 0.00 ? 20  PRO A HG2  10 
ATOM   6434  H  HG3  . PRO A 1 20 ? 7.155   -9.725  6.941   1.00 0.00 ? 20  PRO A HG3  10 
ATOM   6435  H  HD2  . PRO A 1 20 ? 6.290   -8.113  4.944   1.00 0.00 ? 20  PRO A HD2  10 
ATOM   6436  H  HD3  . PRO A 1 20 ? 7.130   -9.646  4.637   1.00 0.00 ? 20  PRO A HD3  10 
ATOM   6437  N  N    . PHE A 1 21 ? 2.683   -8.839  5.447   1.00 0.00 ? 21  PHE A N    10 
ATOM   6438  C  CA   . PHE A 1 21 ? 1.461   -8.148  5.840   1.00 0.00 ? 21  PHE A CA   10 
ATOM   6439  C  C    . PHE A 1 21 ? 0.383   -8.297  4.771   1.00 0.00 ? 21  PHE A C    10 
ATOM   6440  O  O    . PHE A 1 21 ? 0.682   -8.534  3.600   1.00 0.00 ? 21  PHE A O    10 
ATOM   6441  C  CB   . PHE A 1 21 ? 1.745   -6.666  6.090   1.00 0.00 ? 21  PHE A CB   10 
ATOM   6442  C  CG   . PHE A 1 21 ? 2.599   -6.415  7.300   1.00 0.00 ? 21  PHE A CG   10 
ATOM   6443  C  CD1  . PHE A 1 21 ? 2.065   -6.512  8.574   1.00 0.00 ? 21  PHE A CD1  10 
ATOM   6444  C  CD2  . PHE A 1 21 ? 3.937   -6.081  7.162   1.00 0.00 ? 21  PHE A CD2  10 
ATOM   6445  C  CE1  . PHE A 1 21 ? 2.848   -6.282  9.690   1.00 0.00 ? 21  PHE A CE1  10 
ATOM   6446  C  CE2  . PHE A 1 21 ? 4.726   -5.851  8.274   1.00 0.00 ? 21  PHE A CE2  10 
ATOM   6447  C  CZ   . PHE A 1 21 ? 4.180   -5.950  9.539   1.00 0.00 ? 21  PHE A CZ   10 
ATOM   6448  H  H    . PHE A 1 21 ? 3.267   -8.431  4.773   1.00 0.00 ? 21  PHE A H    10 
ATOM   6449  H  HA   . PHE A 1 21 ? 1.107   -8.597  6.756   1.00 0.00 ? 21  PHE A HA   10 
ATOM   6450  H  HB2  . PHE A 1 21 ? 2.257   -6.255  5.233   1.00 0.00 ? 21  PHE A HB2  10 
ATOM   6451  H  HB3  . PHE A 1 21 ? 0.809   -6.145  6.229   1.00 0.00 ? 21  PHE A HB3  10 
ATOM   6452  H  HD1  . PHE A 1 21 ? 1.022   -6.771  8.693   1.00 0.00 ? 21  PHE A HD1  10 
ATOM   6453  H  HD2  . PHE A 1 21 ? 4.365   -6.002  6.174   1.00 0.00 ? 21  PHE A HD2  10 
ATOM   6454  H  HE1  . PHE A 1 21 ? 2.418   -6.360  10.677  1.00 0.00 ? 21  PHE A HE1  10 
ATOM   6455  H  HE2  . PHE A 1 21 ? 5.767   -5.591  8.154   1.00 0.00 ? 21  PHE A HE2  10 
ATOM   6456  H  HZ   . PHE A 1 21 ? 4.794   -5.770  10.409  1.00 0.00 ? 21  PHE A HZ   10 
ATOM   6457  N  N    . PHE A 1 22 ? -0.873  -8.158  5.182   1.00 0.00 ? 22  PHE A N    10 
ATOM   6458  C  CA   . PHE A 1 22 ? -1.997  -8.279  4.260   1.00 0.00 ? 22  PHE A CA   10 
ATOM   6459  C  C    . PHE A 1 22 ? -2.370  -6.920  3.677   1.00 0.00 ? 22  PHE A C    10 
ATOM   6460  O  O    . PHE A 1 22 ? -2.025  -5.878  4.233   1.00 0.00 ? 22  PHE A O    10 
ATOM   6461  C  CB   . PHE A 1 22 ? -3.205  -8.890  4.973   1.00 0.00 ? 22  PHE A CB   10 
ATOM   6462  C  CG   . PHE A 1 22 ? -2.934  -10.247 5.556   1.00 0.00 ? 22  PHE A CG   10 
ATOM   6463  C  CD1  . PHE A 1 22 ? -2.234  -10.378 6.745   1.00 0.00 ? 22  PHE A CD1  10 
ATOM   6464  C  CD2  . PHE A 1 22 ? -3.379  -11.392 4.916   1.00 0.00 ? 22  PHE A CD2  10 
ATOM   6465  C  CE1  . PHE A 1 22 ? -1.983  -11.625 7.285   1.00 0.00 ? 22  PHE A CE1  10 
ATOM   6466  C  CE2  . PHE A 1 22 ? -3.132  -12.642 5.451   1.00 0.00 ? 22  PHE A CE2  10 
ATOM   6467  C  CZ   . PHE A 1 22 ? -2.432  -12.759 6.636   1.00 0.00 ? 22  PHE A CZ   10 
ATOM   6468  H  H    . PHE A 1 22 ? -1.049  -7.970  6.128   1.00 0.00 ? 22  PHE A H    10 
ATOM   6469  H  HA   . PHE A 1 22 ? -1.696  -8.932  3.456   1.00 0.00 ? 22  PHE A HA   10 
ATOM   6470  H  HB2  . PHE A 1 22 ? -3.507  -8.237  5.779   1.00 0.00 ? 22  PHE A HB2  10 
ATOM   6471  H  HB3  . PHE A 1 22 ? -4.018  -8.986  4.270   1.00 0.00 ? 22  PHE A HB3  10 
ATOM   6472  H  HD1  . PHE A 1 22 ? -1.882  -9.491  7.253   1.00 0.00 ? 22  PHE A HD1  10 
ATOM   6473  H  HD2  . PHE A 1 22 ? -3.926  -11.303 3.989   1.00 0.00 ? 22  PHE A HD2  10 
ATOM   6474  H  HE1  . PHE A 1 22 ? -1.436  -11.713 8.211   1.00 0.00 ? 22  PHE A HE1  10 
ATOM   6475  H  HE2  . PHE A 1 22 ? -3.483  -13.527 4.942   1.00 0.00 ? 22  PHE A HE2  10 
ATOM   6476  H  HZ   . PHE A 1 22 ? -2.237  -13.735 7.056   1.00 0.00 ? 22  PHE A HZ   10 
ATOM   6477  N  N    . MET A 1 23 ? -3.077  -6.939  2.551   1.00 0.00 ? 23  MET A N    10 
ATOM   6478  C  CA   . MET A 1 23 ? -3.498  -5.709  1.892   1.00 0.00 ? 23  MET A CA   10 
ATOM   6479  C  C    . MET A 1 23 ? -4.882  -5.281  2.371   1.00 0.00 ? 23  MET A C    10 
ATOM   6480  O  O    . MET A 1 23 ? -5.832  -6.064  2.332   1.00 0.00 ? 23  MET A O    10 
ATOM   6481  C  CB   . MET A 1 23 ? -3.506  -5.895  0.374   1.00 0.00 ? 23  MET A CB   10 
ATOM   6482  C  CG   . MET A 1 23 ? -4.229  -7.153  -0.081  1.00 0.00 ? 23  MET A CG   10 
ATOM   6483  S  SD   . MET A 1 23 ? -4.958  -6.981  -1.721  1.00 0.00 ? 23  MET A SD   10 
ATOM   6484  C  CE   . MET A 1 23 ? -4.381  -8.483  -2.507  1.00 0.00 ? 23  MET A CE   10 
ATOM   6485  H  H    . MET A 1 23 ? -3.323  -7.801  2.155   1.00 0.00 ? 23  MET A H    10 
ATOM   6486  H  HA   . MET A 1 23 ? -2.788  -4.937  2.147   1.00 0.00 ? 23  MET A HA   10 
ATOM   6487  H  HB2  . MET A 1 23 ? -3.991  -5.043  -0.079  1.00 0.00 ? 23  MET A HB2  10 
ATOM   6488  H  HB3  . MET A 1 23 ? -2.486  -5.947  0.024   1.00 0.00 ? 23  MET A HB3  10 
ATOM   6489  H  HG2  . MET A 1 23 ? -3.524  -7.970  -0.100  1.00 0.00 ? 23  MET A HG2  10 
ATOM   6490  H  HG3  . MET A 1 23 ? -5.014  -7.374  0.627   1.00 0.00 ? 23  MET A HG3  10 
ATOM   6491  H  HE1  . MET A 1 23 ? -3.665  -8.973  -1.864  1.00 0.00 ? 23  MET A HE1  10 
ATOM   6492  H  HE2  . MET A 1 23 ? -5.218  -9.142  -2.683  1.00 0.00 ? 23  MET A HE2  10 
ATOM   6493  H  HE3  . MET A 1 23 ? -3.912  -8.238  -3.448  1.00 0.00 ? 23  MET A HE3  10 
ATOM   6494  N  N    . SER A 1 24 ? -4.989  -4.036  2.822   1.00 0.00 ? 24  SER A N    10 
ATOM   6495  C  CA   . SER A 1 24 ? -6.256  -3.506  3.312   1.00 0.00 ? 24  SER A CA   10 
ATOM   6496  C  C    . SER A 1 24 ? -7.216  -3.237  2.157   1.00 0.00 ? 24  SER A C    10 
ATOM   6497  O  O    . SER A 1 24 ? -6.874  -3.437  0.991   1.00 0.00 ? 24  SER A O    10 
ATOM   6498  C  CB   . SER A 1 24 ? -6.023  -2.220  4.107   1.00 0.00 ? 24  SER A CB   10 
ATOM   6499  O  OG   . SER A 1 24 ? -7.230  -1.748  4.679   1.00 0.00 ? 24  SER A OG   10 
ATOM   6500  H  H    . SER A 1 24 ? -4.196  -3.460  2.828   1.00 0.00 ? 24  SER A H    10 
ATOM   6501  H  HA   . SER A 1 24 ? -6.696  -4.247  3.963   1.00 0.00 ? 24  SER A HA   10 
ATOM   6502  H  HB2  . SER A 1 24 ? -5.315  -2.412  4.898   1.00 0.00 ? 24  SER A HB2  10 
ATOM   6503  H  HB3  . SER A 1 24 ? -5.629  -1.460  3.448   1.00 0.00 ? 24  SER A HB3  10 
ATOM   6504  H  HG   . SER A 1 24 ? -7.062  -1.440  5.573   1.00 0.00 ? 24  SER A HG   10 
ATOM   6505  N  N    . VAL A 1 25 ? -8.419  -2.781  2.489   1.00 0.00 ? 25  VAL A N    10 
ATOM   6506  C  CA   . VAL A 1 25 ? -9.429  -2.482  1.480   1.00 0.00 ? 25  VAL A CA   10 
ATOM   6507  C  C    . VAL A 1 25 ? -9.149  -1.145  0.802   1.00 0.00 ? 25  VAL A C    10 
ATOM   6508  O  O    . VAL A 1 25 ? -9.636  -0.882  -0.297  1.00 0.00 ? 25  VAL A O    10 
ATOM   6509  C  CB   . VAL A 1 25 ? -10.842 -2.449  2.093   1.00 0.00 ? 25  VAL A CB   10 
ATOM   6510  C  CG1  . VAL A 1 25 ? -11.868 -2.039  1.048   1.00 0.00 ? 25  VAL A CG1  10 
ATOM   6511  C  CG2  . VAL A 1 25 ? -11.192 -3.801  2.696   1.00 0.00 ? 25  VAL A CG2  10 
ATOM   6512  H  H    . VAL A 1 25 ? -8.633  -2.641  3.435   1.00 0.00 ? 25  VAL A H    10 
ATOM   6513  H  HA   . VAL A 1 25 ? -9.400  -3.265  0.737   1.00 0.00 ? 25  VAL A HA   10 
ATOM   6514  H  HB   . VAL A 1 25 ? -10.852 -1.712  2.883   1.00 0.00 ? 25  VAL A HB   10 
ATOM   6515  H  HG11 . VAL A 1 25 ? -11.479 -2.247  0.062   1.00 0.00 ? 25  VAL A HG11 10 
ATOM   6516  H  HG12 . VAL A 1 25 ? -12.780 -2.597  1.201   1.00 0.00 ? 25  VAL A HG12 10 
ATOM   6517  H  HG13 . VAL A 1 25 ? -12.072 -0.983  1.138   1.00 0.00 ? 25  VAL A HG13 10 
ATOM   6518  H  HG21 . VAL A 1 25 ? -12.244 -3.998  2.552   1.00 0.00 ? 25  VAL A HG21 10 
ATOM   6519  H  HG22 . VAL A 1 25 ? -10.611 -4.571  2.211   1.00 0.00 ? 25  VAL A HG22 10 
ATOM   6520  H  HG23 . VAL A 1 25 ? -10.969 -3.793  3.753   1.00 0.00 ? 25  VAL A HG23 10 
ATOM   6521  N  N    . ASN A 1 26 ? -8.362  -0.304  1.465   1.00 0.00 ? 26  ASN A N    10 
ATOM   6522  C  CA   . ASN A 1 26 ? -8.018  1.006   0.927   1.00 0.00 ? 26  ASN A CA   10 
ATOM   6523  C  C    . ASN A 1 26 ? -6.557  1.048   0.490   1.00 0.00 ? 26  ASN A C    10 
ATOM   6524  O  O    . ASN A 1 26 ? -6.098  2.030   -0.094  1.00 0.00 ? 26  ASN A O    10 
ATOM   6525  C  CB   . ASN A 1 26 ? -8.281  2.095   1.969   1.00 0.00 ? 26  ASN A CB   10 
ATOM   6526  C  CG   . ASN A 1 26 ? -8.425  3.470   1.346   1.00 0.00 ? 26  ASN A CG   10 
ATOM   6527  O  OD1  . ASN A 1 26 ? -9.374  3.733   0.608   1.00 0.00 ? 26  ASN A OD1  10 
ATOM   6528  N  ND2  . ASN A 1 26 ? -7.479  4.354   1.641   1.00 0.00 ? 26  ASN A ND2  10 
ATOM   6529  H  H    . ASN A 1 26 ? -8.005  -0.571  2.338   1.00 0.00 ? 26  ASN A H    10 
ATOM   6530  H  HA   . ASN A 1 26 ? -8.644  1.186   0.066   1.00 0.00 ? 26  ASN A HA   10 
ATOM   6531  H  HB2  . ASN A 1 26 ? -9.194  1.864   2.499   1.00 0.00 ? 26  ASN A HB2  10 
ATOM   6532  H  HB3  . ASN A 1 26 ? -7.460  2.121   2.669   1.00 0.00 ? 26  ASN A HB3  10 
ATOM   6533  H  HD21 . ASN A 1 26 ? -6.752  4.075   2.235   1.00 0.00 ? 26  ASN A HD21 10 
ATOM   6534  H  HD22 . ASN A 1 26 ? -7.548  5.251   1.252   1.00 0.00 ? 26  ASN A HD22 10 
ATOM   6535  N  N    . THR A 1 27 ? -5.828  -0.027  0.776   1.00 0.00 ? 27  THR A N    10 
ATOM   6536  C  CA   . THR A 1 27 ? -4.419  -0.114  0.413   1.00 0.00 ? 27  THR A CA   10 
ATOM   6537  C  C    . THR A 1 27 ? -4.207  -1.091  -0.737  1.00 0.00 ? 27  THR A C    10 
ATOM   6538  O  O    . THR A 1 27 ? -3.181  -1.051  -1.416  1.00 0.00 ? 27  THR A O    10 
ATOM   6539  C  CB   . THR A 1 27 ? -3.557  -0.555  1.611   1.00 0.00 ? 27  THR A CB   10 
ATOM   6540  O  OG1  . THR A 1 27 ? -3.897  -1.892  1.994   1.00 0.00 ? 27  THR A OG1  10 
ATOM   6541  C  CG2  . THR A 1 27 ? -3.755  0.382   2.794   1.00 0.00 ? 27  THR A CG2  10 
ATOM   6542  H  H    . THR A 1 27 ? -6.250  -0.779  1.242   1.00 0.00 ? 27  THR A H    10 
ATOM   6543  H  HA   . THR A 1 27 ? -4.093  0.868   0.104   1.00 0.00 ? 27  THR A HA   10 
ATOM   6544  H  HB   . THR A 1 27 ? -2.518  -0.525  1.318   1.00 0.00 ? 27  THR A HB   10 
ATOM   6545  H  HG1  . THR A 1 27 ? -4.168  -2.388  1.218   1.00 0.00 ? 27  THR A HG1  10 
ATOM   6546  H  HG21 . THR A 1 27 ? -3.680  -0.179  3.713   1.00 0.00 ? 27  THR A HG21 10 
ATOM   6547  H  HG22 . THR A 1 27 ? -4.731  0.840   2.731   1.00 0.00 ? 27  THR A HG22 10 
ATOM   6548  H  HG23 . THR A 1 27 ? -2.995  1.148   2.777   1.00 0.00 ? 27  THR A HG23 10 
ATOM   6549  N  N    . GLN A 1 28 ? -5.183  -1.967  -0.952  1.00 0.00 ? 28  GLN A N    10 
ATOM   6550  C  CA   . GLN A 1 28 ? -5.101  -2.955  -2.021  1.00 0.00 ? 28  GLN A CA   10 
ATOM   6551  C  C    . GLN A 1 28 ? -4.790  -2.287  -3.356  1.00 0.00 ? 28  GLN A C    10 
ATOM   6552  O  O    . GLN A 1 28 ? -5.133  -1.128  -3.593  1.00 0.00 ? 28  GLN A O    10 
ATOM   6553  C  CB   . GLN A 1 28 ? -6.412  -3.738  -2.122  1.00 0.00 ? 28  GLN A CB   10 
ATOM   6554  C  CG   . GLN A 1 28 ? -7.533  -2.963  -2.796  1.00 0.00 ? 28  GLN A CG   10 
ATOM   6555  C  CD   . GLN A 1 28 ? -8.758  -3.818  -3.057  1.00 0.00 ? 28  GLN A CD   10 
ATOM   6556  O  OE1  . GLN A 1 28 ? -8.882  -4.440  -4.112  1.00 0.00 ? 28  GLN A OE1  10 
ATOM   6557  N  NE2  . GLN A 1 28 ? -9.672  -3.852  -2.094  1.00 0.00 ? 28  GLN A NE2  10 
ATOM   6558  H  H    . GLN A 1 28 ? -5.976  -1.950  -0.377  1.00 0.00 ? 28  GLN A H    10 
ATOM   6559  H  HA   . GLN A 1 28 ? -4.302  -3.639  -1.780  1.00 0.00 ? 28  GLN A HA   10 
ATOM   6560  H  HB2  . GLN A 1 28 ? -6.235  -4.640  -2.688  1.00 0.00 ? 28  GLN A HB2  10 
ATOM   6561  H  HB3  . GLN A 1 28 ? -6.735  -4.004  -1.127  1.00 0.00 ? 28  GLN A HB3  10 
ATOM   6562  H  HG2  . GLN A 1 28 ? -7.817  -2.139  -2.159  1.00 0.00 ? 28  GLN A HG2  10 
ATOM   6563  H  HG3  . GLN A 1 28 ? -7.172  -2.580  -3.739  1.00 0.00 ? 28  GLN A HG3  10 
ATOM   6564  H  HE21 . GLN A 1 28 ? -9.506  -3.329  -1.281  1.00 0.00 ? 28  GLN A HE21 10 
ATOM   6565  H  HE22 . GLN A 1 28 ? -10.474 -4.395  -2.236  1.00 0.00 ? 28  GLN A HE22 10 
ATOM   6566  N  N    . PRO A 1 29 ? -4.125  -3.032  -4.251  1.00 0.00 ? 29  PRO A N    10 
ATOM   6567  C  CA   . PRO A 1 29 ? -3.711  -4.412  -3.980  1.00 0.00 ? 29  PRO A CA   10 
ATOM   6568  C  C    . PRO A 1 29 ? -2.598  -4.490  -2.940  1.00 0.00 ? 29  PRO A C    10 
ATOM   6569  O  O    . PRO A 1 29 ? -2.319  -5.557  -2.393  1.00 0.00 ? 29  PRO A O    10 
ATOM   6570  C  CB   . PRO A 1 29 ? -3.208  -4.905  -5.339  1.00 0.00 ? 29  PRO A CB   10 
ATOM   6571  C  CG   . PRO A 1 29 ? -2.792  -3.669  -6.060  1.00 0.00 ? 29  PRO A CG   10 
ATOM   6572  C  CD   . PRO A 1 29 ? -3.724  -2.585  -5.596  1.00 0.00 ? 29  PRO A CD   10 
ATOM   6573  H  HA   . PRO A 1 29 ? -4.544  -5.020  -3.660  1.00 0.00 ? 29  PRO A HA   10 
ATOM   6574  H  HB2  . PRO A 1 29 ? -2.375  -5.579  -5.195  1.00 0.00 ? 29  PRO A HB2  10 
ATOM   6575  H  HB3  . PRO A 1 29 ? -4.005  -5.415  -5.858  1.00 0.00 ? 29  PRO A HB3  10 
ATOM   6576  H  HG2  . PRO A 1 29 ? -1.772  -3.422  -5.806  1.00 0.00 ? 29  PRO A HG2  10 
ATOM   6577  H  HG3  . PRO A 1 29 ? -2.889  -3.816  -7.125  1.00 0.00 ? 29  PRO A HG3  10 
ATOM   6578  H  HD2  . PRO A 1 29 ? -3.208  -1.638  -5.549  1.00 0.00 ? 29  PRO A HD2  10 
ATOM   6579  H  HD3  . PRO A 1 29 ? -4.581  -2.518  -6.250  1.00 0.00 ? 29  PRO A HD3  10 
ATOM   6580  N  N    . LEU A 1 30 ? -1.965  -3.353  -2.672  1.00 0.00 ? 30  LEU A N    10 
ATOM   6581  C  CA   . LEU A 1 30 ? -0.881  -3.292  -1.697  1.00 0.00 ? 30  LEU A CA   10 
ATOM   6582  C  C    . LEU A 1 30 ? -1.430  -3.120  -0.284  1.00 0.00 ? 30  LEU A C    10 
ATOM   6583  O  O    . LEU A 1 30 ? -2.639  -2.998  -0.086  1.00 0.00 ? 30  LEU A O    10 
ATOM   6584  C  CB   . LEU A 1 30 ? 0.069   -2.141  -2.032  1.00 0.00 ? 30  LEU A CB   10 
ATOM   6585  C  CG   . LEU A 1 30 ? 0.952   -2.336  -3.264  1.00 0.00 ? 30  LEU A CG   10 
ATOM   6586  C  CD1  . LEU A 1 30 ? 1.609   -1.024  -3.663  1.00 0.00 ? 30  LEU A CD1  10 
ATOM   6587  C  CD2  . LEU A 1 30 ? 2.005   -3.404  -3.002  1.00 0.00 ? 30  LEU A CD2  10 
ATOM   6588  H  H    . LEU A 1 30 ? -2.231  -2.535  -3.140  1.00 0.00 ? 30  LEU A H    10 
ATOM   6589  H  HA   . LEU A 1 30 ? -0.337  -4.223  -1.748  1.00 0.00 ? 30  LEU A HA   10 
ATOM   6590  H  HB2  . LEU A 1 30 ? -0.528  -1.255  -2.190  1.00 0.00 ? 30  LEU A HB2  10 
ATOM   6591  H  HB3  . LEU A 1 30 ? 0.716   -1.989  -1.180  1.00 0.00 ? 30  LEU A HB3  10 
ATOM   6592  H  HG   . LEU A 1 30 ? 0.338   -2.667  -4.091  1.00 0.00 ? 30  LEU A HG   10 
ATOM   6593  H  HD11 . LEU A 1 30 ? 1.217   -0.225  -3.053  1.00 0.00 ? 30  LEU A HD11 10 
ATOM   6594  H  HD12 . LEU A 1 30 ? 1.401   -0.819  -4.703  1.00 0.00 ? 30  LEU A HD12 10 
ATOM   6595  H  HD13 . LEU A 1 30 ? 2.677   -1.098  -3.519  1.00 0.00 ? 30  LEU A HD13 10 
ATOM   6596  H  HD21 . LEU A 1 30 ? 2.774   -3.001  -2.361  1.00 0.00 ? 30  LEU A HD21 10 
ATOM   6597  H  HD22 . LEU A 1 30 ? 2.442   -3.715  -3.939  1.00 0.00 ? 30  LEU A HD22 10 
ATOM   6598  H  HD23 . LEU A 1 30 ? 1.543   -4.254  -2.520  1.00 0.00 ? 30  LEU A HD23 10 
ATOM   6599  N  N    . CYS A 1 31 ? -0.532  -3.107  0.696   1.00 0.00 ? 31  CYS A N    10 
ATOM   6600  C  CA   . CYS A 1 31 ? -0.925  -2.948  2.091   1.00 0.00 ? 31  CYS A CA   10 
ATOM   6601  C  C    . CYS A 1 31 ? -0.580  -1.550  2.597   1.00 0.00 ? 31  CYS A C    10 
ATOM   6602  O  O    . CYS A 1 31 ? 0.001   -0.741  1.872   1.00 0.00 ? 31  CYS A O    10 
ATOM   6603  C  CB   . CYS A 1 31 ? -0.235  -4.001  2.960   1.00 0.00 ? 31  CYS A CB   10 
ATOM   6604  S  SG   . CYS A 1 31 ? 1.499   -3.614  3.363   1.00 0.00 ? 31  CYS A SG   10 
ATOM   6605  H  H    . CYS A 1 31 ? 0.418   -3.208  0.476   1.00 0.00 ? 31  CYS A H    10 
ATOM   6606  H  HA   . CYS A 1 31 ? -1.994  -3.086  2.153   1.00 0.00 ? 31  CYS A HA   10 
ATOM   6607  H  HB2  . CYS A 1 31 ? -0.774  -4.097  3.892   1.00 0.00 ? 31  CYS A HB2  10 
ATOM   6608  H  HB3  . CYS A 1 31 ? -0.250  -4.949  2.443   1.00 0.00 ? 31  CYS A HB3  10 
ATOM   6609  N  N    . HIS A 1 32 ? -0.941  -1.273  3.846   1.00 0.00 ? 32  HIS A N    10 
ATOM   6610  C  CA   . HIS A 1 32 ? -0.668  0.027   4.449   1.00 0.00 ? 32  HIS A CA   10 
ATOM   6611  C  C    . HIS A 1 32 ? 0.816   0.368   4.359   1.00 0.00 ? 32  HIS A C    10 
ATOM   6612  O  O    . HIS A 1 32 ? 1.187   1.452   3.910   1.00 0.00 ? 32  HIS A O    10 
ATOM   6613  C  CB   . HIS A 1 32 ? -1.118  0.038   5.910   1.00 0.00 ? 32  HIS A CB   10 
ATOM   6614  C  CG   . HIS A 1 32 ? -1.555  1.388   6.392   1.00 0.00 ? 32  HIS A CG   10 
ATOM   6615  N  ND1  . HIS A 1 32 ? -2.491  1.564   7.389   1.00 0.00 ? 32  HIS A ND1  10 
ATOM   6616  C  CD2  . HIS A 1 32 ? -1.176  2.630   6.010   1.00 0.00 ? 32  HIS A CD2  10 
ATOM   6617  C  CE1  . HIS A 1 32 ? -2.671  2.856   7.597   1.00 0.00 ? 32  HIS A CE1  10 
ATOM   6618  N  NE2  . HIS A 1 32 ? -1.884  3.525   6.774   1.00 0.00 ? 32  HIS A NE2  10 
ATOM   6619  H  H    . HIS A 1 32 ? -1.400  -1.958  4.373   1.00 0.00 ? 32  HIS A H    10 
ATOM   6620  H  HA   . HIS A 1 32 ? -1.229  0.770   3.903   1.00 0.00 ? 32  HIS A HA   10 
ATOM   6621  H  HB2  . HIS A 1 32 ? -1.950  -0.641  6.030   1.00 0.00 ? 32  HIS A HB2  10 
ATOM   6622  H  HB3  . HIS A 1 32 ? -0.300  -0.289  6.535   1.00 0.00 ? 32  HIS A HB3  10 
ATOM   6623  H  HD1  . HIS A 1 32 ? -2.956  0.849   7.870   1.00 0.00 ? 32  HIS A HD1  10 
ATOM   6624  H  HD2  . HIS A 1 32 ? -0.451  2.873   5.245   1.00 0.00 ? 32  HIS A HD2  10 
ATOM   6625  H  HE1  . HIS A 1 32 ? -3.345  3.293   8.319   1.00 0.00 ? 32  HIS A HE1  10 
ATOM   6626  N  N    . GLU A 1 33 ? 1.660   -0.565  4.789   1.00 0.00 ? 33  GLU A N    10 
ATOM   6627  C  CA   . GLU A 1 33 ? 3.103   -0.361  4.758   1.00 0.00 ? 33  GLU A CA   10 
ATOM   6628  C  C    . GLU A 1 33 ? 3.565   0.050   3.362   1.00 0.00 ? 33  GLU A C    10 
ATOM   6629  O  O    . GLU A 1 33 ? 4.156   1.114   3.180   1.00 0.00 ? 33  GLU A O    10 
ATOM   6630  C  CB   . GLU A 1 33 ? 3.830   -1.635  5.192   1.00 0.00 ? 33  GLU A CB   10 
ATOM   6631  C  CG   . GLU A 1 33 ? 5.291   -1.412  5.546   1.00 0.00 ? 33  GLU A CG   10 
ATOM   6632  C  CD   . GLU A 1 33 ? 5.791   -2.382  6.599   1.00 0.00 ? 33  GLU A CD   10 
ATOM   6633  O  OE1  . GLU A 1 33 ? 4.976   -2.815  7.441   1.00 0.00 ? 33  GLU A OE1  10 
ATOM   6634  O  OE2  . GLU A 1 33 ? 6.996   -2.708  6.582   1.00 0.00 ? 33  GLU A OE2  10 
ATOM   6635  H  H    . GLU A 1 33 ? 1.303   -1.409  5.136   1.00 0.00 ? 33  GLU A H    10 
ATOM   6636  H  HA   . GLU A 1 33 ? 3.342   0.432   5.450   1.00 0.00 ? 33  GLU A HA   10 
ATOM   6637  H  HB2  . GLU A 1 33 ? 3.330   -2.044  6.058   1.00 0.00 ? 33  GLU A HB2  10 
ATOM   6638  H  HB3  . GLU A 1 33 ? 3.782   -2.355  4.388   1.00 0.00 ? 33  GLU A HB3  10 
ATOM   6639  H  HG2  . GLU A 1 33 ? 5.887   -1.535  4.654   1.00 0.00 ? 33  GLU A HG2  10 
ATOM   6640  H  HG3  . GLU A 1 33 ? 5.408   -0.406  5.920   1.00 0.00 ? 33  GLU A HG3  10 
ATOM   6641  N  N    . CYS A 1 34 ? 3.290   -0.803  2.380   1.00 0.00 ? 34  CYS A N    10 
ATOM   6642  C  CA   . CYS A 1 34 ? 3.677   -0.531  1.001   1.00 0.00 ? 34  CYS A CA   10 
ATOM   6643  C  C    . CYS A 1 34 ? 2.984   0.725   0.479   1.00 0.00 ? 34  CYS A C    10 
ATOM   6644  O  O    . CYS A 1 34 ? 3.635   1.724   0.174   1.00 0.00 ? 34  CYS A O    10 
ATOM   6645  C  CB   . CYS A 1 34 ? 3.333   -1.725  0.108   1.00 0.00 ? 34  CYS A CB   10 
ATOM   6646  S  SG   . CYS A 1 34 ? 4.110   -3.289  0.626   1.00 0.00 ? 34  CYS A SG   10 
ATOM   6647  H  H    . CYS A 1 34 ? 2.816   -1.636  2.588   1.00 0.00 ? 34  CYS A H    10 
ATOM   6648  H  HA   . CYS A 1 34 ? 4.744   -0.373  0.980   1.00 0.00 ? 34  CYS A HA   10 
ATOM   6649  H  HB2  . CYS A 1 34 ? 2.263   -1.873  0.115   1.00 0.00 ? 34  CYS A HB2  10 
ATOM   6650  H  HB3  . CYS A 1 34 ? 3.656   -1.515  -0.901  1.00 0.00 ? 34  CYS A HB3  10 
ATOM   6651  N  N    . SER A 1 35 ? 1.660   0.665   0.379   1.00 0.00 ? 35  SER A N    10 
ATOM   6652  C  CA   . SER A 1 35 ? 0.879   1.796   -0.109  1.00 0.00 ? 35  SER A CA   10 
ATOM   6653  C  C    . SER A 1 35 ? 1.452   3.114   0.403   1.00 0.00 ? 35  SER A C    10 
ATOM   6654  O  O    . SER A 1 35 ? 1.554   4.088   -0.341  1.00 0.00 ? 35  SER A O    10 
ATOM   6655  C  CB   . SER A 1 35 ? -0.582  1.659   0.326   1.00 0.00 ? 35  SER A CB   10 
ATOM   6656  O  OG   . SER A 1 35 ? -1.283  2.878   0.150   1.00 0.00 ? 35  SER A OG   10 
ATOM   6657  H  H    . SER A 1 35 ? 1.198   -0.160  0.638   1.00 0.00 ? 35  SER A H    10 
ATOM   6658  H  HA   . SER A 1 35 ? 0.926   1.790   -1.187  1.00 0.00 ? 35  SER A HA   10 
ATOM   6659  H  HB2  . SER A 1 35 ? -1.061  0.894   -0.266  1.00 0.00 ? 35  SER A HB2  10 
ATOM   6660  H  HB3  . SER A 1 35 ? -0.620  1.382   1.370   1.00 0.00 ? 35  SER A HB3  10 
ATOM   6661  H  HG   . SER A 1 35 ? -1.996  2.932   0.790   1.00 0.00 ? 35  SER A HG   10 
ATOM   6662  N  N    . GLU A 1 36 ? 1.824   3.134   1.679   1.00 0.00 ? 36  GLU A N    10 
ATOM   6663  C  CA   . GLU A 1 36 ? 2.386   4.332   2.291   1.00 0.00 ? 36  GLU A CA   10 
ATOM   6664  C  C    . GLU A 1 36 ? 3.847   4.515   1.889   1.00 0.00 ? 36  GLU A C    10 
ATOM   6665  O  O    . GLU A 1 36 ? 4.293   5.630   1.619   1.00 0.00 ? 36  GLU A O    10 
ATOM   6666  C  CB   . GLU A 1 36 ? 2.271   4.256   3.815   1.00 0.00 ? 36  GLU A CB   10 
ATOM   6667  C  CG   . GLU A 1 36 ? 3.173   5.238   4.543   1.00 0.00 ? 36  GLU A CG   10 
ATOM   6668  C  CD   . GLU A 1 36 ? 2.608   6.645   4.563   1.00 0.00 ? 36  GLU A CD   10 
ATOM   6669  O  OE1  . GLU A 1 36 ? 1.985   7.048   3.559   1.00 0.00 ? 36  GLU A OE1  10 
ATOM   6670  O  OE2  . GLU A 1 36 ? 2.790   7.342   5.583   1.00 0.00 ? 36  GLU A OE2  10 
ATOM   6671  H  H    . GLU A 1 36 ? 1.718   2.325   2.221   1.00 0.00 ? 36  GLU A H    10 
ATOM   6672  H  HA   . GLU A 1 36 ? 1.820   5.181   1.939   1.00 0.00 ? 36  GLU A HA   10 
ATOM   6673  H  HB2  . GLU A 1 36 ? 1.249   4.459   4.097   1.00 0.00 ? 36  GLU A HB2  10 
ATOM   6674  H  HB3  . GLU A 1 36 ? 2.531   3.257   4.133   1.00 0.00 ? 36  GLU A HB3  10 
ATOM   6675  H  HG2  . GLU A 1 36 ? 3.299   4.903   5.562   1.00 0.00 ? 36  GLU A HG2  10 
ATOM   6676  H  HG3  . GLU A 1 36 ? 4.134   5.258   4.051   1.00 0.00 ? 36  GLU A HG3  10 
ATOM   6677  N  N    . ARG A 1 37 ? 4.586   3.411   1.851   1.00 0.00 ? 37  ARG A N    10 
ATOM   6678  C  CA   . ARG A 1 37 ? 5.997   3.448   1.484   1.00 0.00 ? 37  ARG A CA   10 
ATOM   6679  C  C    . ARG A 1 37 ? 6.183   4.079   0.107   1.00 0.00 ? 37  ARG A C    10 
ATOM   6680  O  O    . ARG A 1 37 ? 7.051   4.931   -0.084  1.00 0.00 ? 37  ARG A O    10 
ATOM   6681  C  CB   . ARG A 1 37 ? 6.586   2.037   1.494   1.00 0.00 ? 37  ARG A CB   10 
ATOM   6682  C  CG   . ARG A 1 37 ? 7.995   1.960   0.928   1.00 0.00 ? 37  ARG A CG   10 
ATOM   6683  C  CD   . ARG A 1 37 ? 8.266   0.607   0.291   1.00 0.00 ? 37  ARG A CD   10 
ATOM   6684  N  NE   . ARG A 1 37 ? 9.417   0.646   -0.608  1.00 0.00 ? 37  ARG A NE   10 
ATOM   6685  C  CZ   . ARG A 1 37 ? 9.594   -0.203  -1.614  1.00 0.00 ? 37  ARG A CZ   10 
ATOM   6686  N  NH1  . ARG A 1 37 ? 8.699   -1.153  -1.848  1.00 0.00 ? 37  ARG A NH1  10 
ATOM   6687  N  NH2  . ARG A 1 37 ? 10.667  -0.103  -2.387  1.00 0.00 ? 37  ARG A NH2  10 
ATOM   6688  H  H    . ARG A 1 37 ? 4.174   2.551   2.076   1.00 0.00 ? 37  ARG A H    10 
ATOM   6689  H  HA   . ARG A 1 37 ? 6.514   4.050   2.215   1.00 0.00 ? 37  ARG A HA   10 
ATOM   6690  H  HB2  . ARG A 1 37 ? 6.611   1.677   2.512   1.00 0.00 ? 37  ARG A HB2  10 
ATOM   6691  H  HB3  . ARG A 1 37 ? 5.950   1.390   0.908   1.00 0.00 ? 37  ARG A HB3  10 
ATOM   6692  H  HG2  . ARG A 1 37 ? 8.114   2.729   0.179   1.00 0.00 ? 37  ARG A HG2  10 
ATOM   6693  H  HG3  . ARG A 1 37 ? 8.702   2.121   1.728   1.00 0.00 ? 37  ARG A HG3  10 
ATOM   6694  H  HD2  . ARG A 1 37 ? 8.457   -0.113  1.072   1.00 0.00 ? 37  ARG A HD2  10 
ATOM   6695  H  HD3  . ARG A 1 37 ? 7.394   0.307   -0.270  1.00 0.00 ? 37  ARG A HD3  10 
ATOM   6696  H  HE   . ARG A 1 37 ? 10.091  1.341   -0.452  1.00 0.00 ? 37  ARG A HE   10 
ATOM   6697  H  HH11 . ARG A 1 37 ? 7.889   -1.230  -1.267  1.00 0.00 ? 37  ARG A HH11 10 
ATOM   6698  H  HH12 . ARG A 1 37 ? 8.834   -1.791  -2.607  1.00 0.00 ? 37  ARG A HH12 10 
ATOM   6699  H  HH21 . ARG A 1 37 ? 11.344  0.612   -2.214  1.00 0.00 ? 37  ARG A HH21 10 
ATOM   6700  H  HH22 . ARG A 1 37 ? 10.799  -0.743  -3.144  1.00 0.00 ? 37  ARG A HH22 10 
ATOM   6701  N  N    . ARG A 1 38 ? 5.364   3.653   -0.849  1.00 0.00 ? 38  ARG A N    10 
ATOM   6702  C  CA   . ARG A 1 38 ? 5.440   4.174   -2.209  1.00 0.00 ? 38  ARG A CA   10 
ATOM   6703  C  C    . ARG A 1 38 ? 4.940   5.615   -2.267  1.00 0.00 ? 38  ARG A C    10 
ATOM   6704  O  O    . ARG A 1 38 ? 5.555   6.469   -2.904  1.00 0.00 ? 38  ARG A O    10 
ATOM   6705  C  CB   . ARG A 1 38 ? 4.621   3.300   -3.160  1.00 0.00 ? 38  ARG A CB   10 
ATOM   6706  C  CG   . ARG A 1 38 ? 5.169   3.262   -4.577  1.00 0.00 ? 38  ARG A CG   10 
ATOM   6707  C  CD   . ARG A 1 38 ? 4.591   2.098   -5.367  1.00 0.00 ? 38  ARG A CD   10 
ATOM   6708  N  NE   . ARG A 1 38 ? 4.855   2.223   -6.798  1.00 0.00 ? 38  ARG A NE   10 
ATOM   6709  C  CZ   . ARG A 1 38 ? 4.097   2.933   -7.626  1.00 0.00 ? 38  ARG A CZ   10 
ATOM   6710  N  NH1  . ARG A 1 38 ? 3.033   3.578   -7.168  1.00 0.00 ? 38  ARG A NH1  10 
ATOM   6711  N  NH2  . ARG A 1 38 ? 4.403   2.999   -8.916  1.00 0.00 ? 38  ARG A NH2  10 
ATOM   6712  H  H    . ARG A 1 38 ? 4.693   2.972   -0.636  1.00 0.00 ? 38  ARG A H    10 
ATOM   6713  H  HA   . ARG A 1 38 ? 6.475   4.152   -2.515  1.00 0.00 ? 38  ARG A HA   10 
ATOM   6714  H  HB2  . ARG A 1 38 ? 4.604   2.290   -2.777  1.00 0.00 ? 38  ARG A HB2  10 
ATOM   6715  H  HB3  . ARG A 1 38 ? 3.611   3.679   -3.198  1.00 0.00 ? 38  ARG A HB3  10 
ATOM   6716  H  HG2  . ARG A 1 38 ? 4.913   4.184   -5.077  1.00 0.00 ? 38  ARG A HG2  10 
ATOM   6717  H  HG3  . ARG A 1 38 ? 6.243   3.159   -4.535  1.00 0.00 ? 38  ARG A HG3  10 
ATOM   6718  H  HD2  . ARG A 1 38 ? 5.033   1.181   -5.008  1.00 0.00 ? 38  ARG A HD2  10 
ATOM   6719  H  HD3  . ARG A 1 38 ? 3.523   2.069   -5.209  1.00 0.00 ? 38  ARG A HD3  10 
ATOM   6720  H  HE   . ARG A 1 38 ? 5.636   1.755   -7.158  1.00 0.00 ? 38  ARG A HE   10 
ATOM   6721  H  HH11 . ARG A 1 38 ? 2.801   3.532   -6.197  1.00 0.00 ? 38  ARG A HH11 10 
ATOM   6722  H  HH12 . ARG A 1 38 ? 2.465   4.113   -7.794  1.00 0.00 ? 38  ARG A HH12 10 
ATOM   6723  H  HH21 . ARG A 1 38 ? 5.204   2.514   -9.265  1.00 0.00 ? 38  ARG A HH21 10 
ATOM   6724  H  HH22 . ARG A 1 38 ? 3.831   3.533   -9.538  1.00 0.00 ? 38  ARG A HH22 10 
ATOM   6725  N  N    . GLN A 1 39 ? 3.821   5.875   -1.599  1.00 0.00 ? 39  GLN A N    10 
ATOM   6726  C  CA   . GLN A 1 39 ? 3.238   7.211   -1.577  1.00 0.00 ? 39  GLN A CA   10 
ATOM   6727  C  C    . GLN A 1 39 ? 4.313   8.271   -1.362  1.00 0.00 ? 39  GLN A C    10 
ATOM   6728  O  O    . GLN A 1 39 ? 4.429   9.220   -2.137  1.00 0.00 ? 39  GLN A O    10 
ATOM   6729  C  CB   . GLN A 1 39 ? 2.180   7.311   -0.477  1.00 0.00 ? 39  GLN A CB   10 
ATOM   6730  C  CG   . GLN A 1 39 ? 1.128   8.376   -0.739  1.00 0.00 ? 39  GLN A CG   10 
ATOM   6731  C  CD   . GLN A 1 39 ? 1.670   9.783   -0.580  1.00 0.00 ? 39  GLN A CD   10 
ATOM   6732  O  OE1  . GLN A 1 39 ? 2.330   10.311  -1.476  1.00 0.00 ? 39  GLN A OE1  10 
ATOM   6733  N  NE2  . GLN A 1 39 ? 1.393   10.399  0.563   1.00 0.00 ? 39  GLN A NE2  10 
ATOM   6734  H  H    . GLN A 1 39 ? 3.376   5.151   -1.111  1.00 0.00 ? 39  GLN A H    10 
ATOM   6735  H  HA   . GLN A 1 39 ? 2.767   7.383   -2.533  1.00 0.00 ? 39  GLN A HA   10 
ATOM   6736  H  HB2  . GLN A 1 39 ? 1.681   6.358   -0.386  1.00 0.00 ? 39  GLN A HB2  10 
ATOM   6737  H  HB3  . GLN A 1 39 ? 2.670   7.542   0.457   1.00 0.00 ? 39  GLN A HB3  10 
ATOM   6738  H  HG2  . GLN A 1 39 ? 0.760   8.261   -1.748  1.00 0.00 ? 39  GLN A HG2  10 
ATOM   6739  H  HG3  . GLN A 1 39 ? 0.314   8.239   -0.043  1.00 0.00 ? 39  GLN A HG3  10 
ATOM   6740  H  HE21 . GLN A 1 39 ? 0.862   9.916   1.231   1.00 0.00 ? 39  GLN A HE21 10 
ATOM   6741  H  HE22 . GLN A 1 39 ? 1.731   11.309  0.692   1.00 0.00 ? 39  GLN A HE22 10 
ATOM   6742  N  N    . LYS A 1 40 ? 5.100   8.102   -0.304  1.00 0.00 ? 40  LYS A N    10 
ATOM   6743  C  CA   . LYS A 1 40 ? 6.168   9.043   0.013   1.00 0.00 ? 40  LYS A CA   10 
ATOM   6744  C  C    . LYS A 1 40 ? 7.040   9.309   -1.209  1.00 0.00 ? 40  LYS A C    10 
ATOM   6745  O  O    . LYS A 1 40 ? 7.271   10.460  -1.579  1.00 0.00 ? 40  LYS A O    10 
ATOM   6746  C  CB   . LYS A 1 40 ? 7.027   8.502   1.158   1.00 0.00 ? 40  LYS A CB   10 
ATOM   6747  C  CG   . LYS A 1 40 ? 7.865   9.567   1.845   1.00 0.00 ? 40  LYS A CG   10 
ATOM   6748  C  CD   . LYS A 1 40 ? 9.145   9.850   1.078   1.00 0.00 ? 40  LYS A CD   10 
ATOM   6749  C  CE   . LYS A 1 40 ? 10.250  10.343  2.000   1.00 0.00 ? 40  LYS A CE   10 
ATOM   6750  N  NZ   . LYS A 1 40 ? 11.535  10.535  1.273   1.00 0.00 ? 40  LYS A NZ   10 
ATOM   6751  H  H    . LYS A 1 40 ? 4.959   7.325   0.277   1.00 0.00 ? 40  LYS A H    10 
ATOM   6752  H  HA   . LYS A 1 40 ? 5.711   9.970   0.324   1.00 0.00 ? 40  LYS A HA   10 
ATOM   6753  H  HB2  . LYS A 1 40 ? 6.381   8.051   1.896   1.00 0.00 ? 40  LYS A HB2  10 
ATOM   6754  H  HB3  . LYS A 1 40 ? 7.694   7.747   0.766   1.00 0.00 ? 40  LYS A HB3  10 
ATOM   6755  H  HG2  . LYS A 1 40 ? 7.289   10.478  1.911   1.00 0.00 ? 40  LYS A HG2  10 
ATOM   6756  H  HG3  . LYS A 1 40 ? 8.119   9.227   2.839   1.00 0.00 ? 40  LYS A HG3  10 
ATOM   6757  H  HD2  . LYS A 1 40 ? 9.474   8.942   0.595   1.00 0.00 ? 40  LYS A HD2  10 
ATOM   6758  H  HD3  . LYS A 1 40 ? 8.948   10.606  0.331   1.00 0.00 ? 40  LYS A HD3  10 
ATOM   6759  H  HE2  . LYS A 1 40 ? 9.947   11.284  2.432   1.00 0.00 ? 40  LYS A HE2  10 
ATOM   6760  H  HE3  . LYS A 1 40 ? 10.396  9.617   2.786   1.00 0.00 ? 40  LYS A HE3  10 
ATOM   6761  H  HZ1  . LYS A 1 40 ? 12.169  9.730   1.448   1.00 0.00 ? 40  LYS A HZ1  10 
ATOM   6762  H  HZ2  . LYS A 1 40 ? 12.002  11.407  1.596   1.00 0.00 ? 40  LYS A HZ2  10 
ATOM   6763  H  HZ3  . LYS A 1 40 ? 11.360  10.609  0.250   1.00 0.00 ? 40  LYS A HZ3  10 
ATOM   6764  N  N    . ASN A 1 41 ? 7.519   8.238   -1.833  1.00 0.00 ? 41  ASN A N    10 
ATOM   6765  C  CA   . ASN A 1 41 ? 8.365   8.357   -3.015  1.00 0.00 ? 41  ASN A CA   10 
ATOM   6766  C  C    . ASN A 1 41 ? 7.567   8.883   -4.205  1.00 0.00 ? 41  ASN A C    10 
ATOM   6767  O  O    . ASN A 1 41 ? 6.503   8.359   -4.530  1.00 0.00 ? 41  ASN A O    10 
ATOM   6768  C  CB   . ASN A 1 41 ? 8.986   7.003   -3.363  1.00 0.00 ? 41  ASN A CB   10 
ATOM   6769  C  CG   . ASN A 1 41 ? 9.347   6.891   -4.831  1.00 0.00 ? 41  ASN A CG   10 
ATOM   6770  O  OD1  . ASN A 1 41 ? 8.487   6.641   -5.676  1.00 0.00 ? 41  ASN A OD1  10 
ATOM   6771  N  ND2  . ASN A 1 41 ? 10.625  7.077   -5.142  1.00 0.00 ? 41  ASN A ND2  10 
ATOM   6772  H  H    . ASN A 1 41 ? 7.300   7.347   -1.491  1.00 0.00 ? 41  ASN A H    10 
ATOM   6773  H  HA   . ASN A 1 41 ? 9.155   9.058   -2.789  1.00 0.00 ? 41  ASN A HA   10 
ATOM   6774  H  HB2  . ASN A 1 41 ? 9.885   6.865   -2.779  1.00 0.00 ? 41  ASN A HB2  10 
ATOM   6775  H  HB3  . ASN A 1 41 ? 8.283   6.219   -3.123  1.00 0.00 ? 41  ASN A HB3  10 
ATOM   6776  H  HD21 . ASN A 1 41 ? 11.254  7.273   -4.416  1.00 0.00 ? 41  ASN A HD21 10 
ATOM   6777  H  HD22 . ASN A 1 41 ? 10.886  7.011   -6.084  1.00 0.00 ? 41  ASN A HD22 10 
ATOM   6778  N  N    . GLN A 1 42 ? 8.090   9.922   -4.848  1.00 0.00 ? 42  GLN A N    10 
ATOM   6779  C  CA   . GLN A 1 42 ? 7.426   10.519  -6.001  1.00 0.00 ? 42  GLN A CA   10 
ATOM   6780  C  C    . GLN A 1 42 ? 7.256   9.497   -7.121  1.00 0.00 ? 42  GLN A C    10 
ATOM   6781  O  O    . GLN A 1 42 ? 8.099   8.620   -7.307  1.00 0.00 ? 42  GLN A O    10 
ATOM   6782  C  CB   . GLN A 1 42 ? 8.223   11.721  -6.509  1.00 0.00 ? 42  GLN A CB   10 
ATOM   6783  C  CG   . GLN A 1 42 ? 9.532   11.343  -7.183  1.00 0.00 ? 42  GLN A CG   10 
ATOM   6784  C  CD   . GLN A 1 42 ? 9.993   12.381  -8.188  1.00 0.00 ? 42  GLN A CD   10 
ATOM   6785  O  OE1  . GLN A 1 42 ? 10.211  13.543  -7.842  1.00 0.00 ? 42  GLN A OE1  10 
ATOM   6786  N  NE2  . GLN A 1 42 ? 10.144  11.966  -9.440  1.00 0.00 ? 42  GLN A NE2  10 
ATOM   6787  H  H    . GLN A 1 42 ? 8.942   10.296  -4.541  1.00 0.00 ? 42  GLN A H    10 
ATOM   6788  H  HA   . GLN A 1 42 ? 6.450   10.853  -5.685  1.00 0.00 ? 42  GLN A HA   10 
ATOM   6789  H  HB2  . GLN A 1 42 ? 7.620   12.263  -7.222  1.00 0.00 ? 42  GLN A HB2  10 
ATOM   6790  H  HB3  . GLN A 1 42 ? 8.447   12.368  -5.674  1.00 0.00 ? 42  GLN A HB3  10 
ATOM   6791  H  HG2  . GLN A 1 42 ? 10.295  11.236  -6.425  1.00 0.00 ? 42  GLN A HG2  10 
ATOM   6792  H  HG3  . GLN A 1 42 ? 9.400   10.401  -7.694  1.00 0.00 ? 42  GLN A HG3  10 
ATOM   6793  H  HE21 . GLN A 1 42 ? 9.950   11.026  -9.643  1.00 0.00 ? 42  GLN A HE21 10 
ATOM   6794  H  HE22 . GLN A 1 42 ? 10.439  12.616  -10.110 1.00 0.00 ? 42  GLN A HE22 10 
ATOM   6795  N  N    . ASN A 1 43 ? 6.161   9.617   -7.863  1.00 0.00 ? 43  ASN A N    10 
ATOM   6796  C  CA   . ASN A 1 43 ? 5.880   8.703   -8.964  1.00 0.00 ? 43  ASN A CA   10 
ATOM   6797  C  C    . ASN A 1 43 ? 4.762   9.245   -9.850  1.00 0.00 ? 43  ASN A C    10 
ATOM   6798  O  O    . ASN A 1 43 ? 4.045   10.169  -9.467  1.00 0.00 ? 43  ASN A O    10 
ATOM   6799  C  CB   . ASN A 1 43 ? 5.494   7.324   -8.424  1.00 0.00 ? 43  ASN A CB   10 
ATOM   6800  C  CG   . ASN A 1 43 ? 5.435   6.272   -9.515  1.00 0.00 ? 43  ASN A CG   10 
ATOM   6801  O  OD1  . ASN A 1 43 ? 4.438   6.155   -10.227 1.00 0.00 ? 43  ASN A OD1  10 
ATOM   6802  N  ND2  . ASN A 1 43 ? 6.506   5.499   -9.649  1.00 0.00 ? 43  ASN A ND2  10 
ATOM   6803  H  H    . ASN A 1 43 ? 5.526   10.337  -7.666  1.00 0.00 ? 43  ASN A H    10 
ATOM   6804  H  HA   . ASN A 1 43 ? 6.778   8.609   -9.555  1.00 0.00 ? 43  ASN A HA   10 
ATOM   6805  H  HB2  . ASN A 1 43 ? 6.225   7.014   -7.691  1.00 0.00 ? 43  ASN A HB2  10 
ATOM   6806  H  HB3  . ASN A 1 43 ? 4.524   7.386   -7.955  1.00 0.00 ? 43  ASN A HB3  10 
ATOM   6807  H  HD21 . ASN A 1 43 ? 7.264   5.648   -9.046  1.00 0.00 ? 43  ASN A HD21 10 
ATOM   6808  H  HD22 . ASN A 1 43 ? 6.495   4.810   -10.347 1.00 0.00 ? 43  ASN A HD22 10 
ATOM   6809  N  N    . SER A 1 44 ? 4.620   8.663   -11.037 1.00 0.00 ? 44  SER A N    10 
ATOM   6810  C  CA   . SER A 1 44 ? 3.592   9.089   -11.979 1.00 0.00 ? 44  SER A CA   10 
ATOM   6811  C  C    . SER A 1 44 ? 2.209   9.034   -11.336 1.00 0.00 ? 44  SER A C    10 
ATOM   6812  O  O    . SER A 1 44 ? 1.789   7.995   -10.828 1.00 0.00 ? 44  SER A O    10 
ATOM   6813  C  CB   . SER A 1 44 ? 3.620   8.210   -13.230 1.00 0.00 ? 44  SER A CB   10 
ATOM   6814  O  OG   . SER A 1 44 ? 2.816   8.760   -14.259 1.00 0.00 ? 44  SER A OG   10 
ATOM   6815  H  H    . SER A 1 44 ? 5.222   7.931   -11.285 1.00 0.00 ? 44  SER A H    10 
ATOM   6816  H  HA   . SER A 1 44 ? 3.804   10.110  -12.261 1.00 0.00 ? 44  SER A HA   10 
ATOM   6817  H  HB2  . SER A 1 44 ? 4.635   8.129   -13.588 1.00 0.00 ? 44  SER A HB2  10 
ATOM   6818  H  HB3  . SER A 1 44 ? 3.246   7.226   -12.984 1.00 0.00 ? 44  SER A HB3  10 
ATOM   6819  H  HG   . SER A 1 44 ? 2.562   9.655   -14.023 1.00 0.00 ? 44  SER A HG   10 
ATOM   6820  N  N    . GLY A 1 45 ? 1.506   10.162  -11.362 1.00 0.00 ? 45  GLY A N    10 
ATOM   6821  C  CA   . GLY A 1 45 ? 0.178   10.222  -10.779 1.00 0.00 ? 45  GLY A CA   10 
ATOM   6822  C  C    . GLY A 1 45 ? -0.181  11.613  -10.296 1.00 0.00 ? 45  GLY A C    10 
ATOM   6823  O  O    . GLY A 1 45 ? 0.367   12.615  -10.758 1.00 0.00 ? 45  GLY A O    10 
ATOM   6824  H  H    . GLY A 1 45 ? 1.891   10.960  -11.781 1.00 0.00 ? 45  GLY A H    10 
ATOM   6825  H  HA2  . GLY A 1 45 ? -0.543  9.913   -11.521 1.00 0.00 ? 45  GLY A HA2  10 
ATOM   6826  H  HA3  . GLY A 1 45 ? 0.134   9.541   -9.942  1.00 0.00 ? 45  GLY A HA3  10 
ATOM   6827  N  N    . PRO A 1 46 ? -1.124  11.689  -9.345  1.00 0.00 ? 46  PRO A N    10 
ATOM   6828  C  CA   . PRO A 1 46 ? -1.577  12.963  -8.779  1.00 0.00 ? 46  PRO A CA   10 
ATOM   6829  C  C    . PRO A 1 46 ? -0.511  13.625  -7.912  1.00 0.00 ? 46  PRO A C    10 
ATOM   6830  O  O    . PRO A 1 46 ? -0.336  13.269  -6.747  1.00 0.00 ? 46  PRO A O    10 
ATOM   6831  C  CB   . PRO A 1 46 ? -2.785  12.564  -7.929  1.00 0.00 ? 46  PRO A CB   10 
ATOM   6832  C  CG   . PRO A 1 46 ? -2.545  11.136  -7.576  1.00 0.00 ? 46  PRO A CG   10 
ATOM   6833  C  CD   . PRO A 1 46 ? -1.819  10.536  -8.748  1.00 0.00 ? 46  PRO A CD   10 
ATOM   6834  H  HA   . PRO A 1 46 ? -1.890  13.651  -9.551  1.00 0.00 ? 46  PRO A HA   10 
ATOM   6835  H  HB2  . PRO A 1 46 ? -2.830  13.187  -7.047  1.00 0.00 ? 46  PRO A HB2  10 
ATOM   6836  H  HB3  . PRO A 1 46 ? -3.691  12.680  -8.505  1.00 0.00 ? 46  PRO A HB3  10 
ATOM   6837  H  HG2  . PRO A 1 46 ? -1.936  11.075  -6.687  1.00 0.00 ? 46  PRO A HG2  10 
ATOM   6838  H  HG3  . PRO A 1 46 ? -3.488  10.633  -7.422  1.00 0.00 ? 46  PRO A HG3  10 
ATOM   6839  H  HD2  . PRO A 1 46 ? -1.113  9.791   -8.414  1.00 0.00 ? 46  PRO A HD2  10 
ATOM   6840  H  HD3  . PRO A 1 46 ? -2.522  10.107  -9.447  1.00 0.00 ? 46  PRO A HD3  10 
ATOM   6841  N  N    . SER A 1 47 ? 0.199   14.589  -8.489  1.00 0.00 ? 47  SER A N    10 
ATOM   6842  C  CA   . SER A 1 47 ? 1.251   15.298  -7.770  1.00 0.00 ? 47  SER A CA   10 
ATOM   6843  C  C    . SER A 1 47 ? 0.667   16.432  -6.932  1.00 0.00 ? 47  SER A C    10 
ATOM   6844  O  O    . SER A 1 47 ? 1.396   17.291  -6.435  1.00 0.00 ? 47  SER A O    10 
ATOM   6845  C  CB   . SER A 1 47 ? 2.284   15.854  -8.751  1.00 0.00 ? 47  SER A CB   10 
ATOM   6846  O  OG   . SER A 1 47 ? 1.741   16.915  -9.517  1.00 0.00 ? 47  SER A OG   10 
ATOM   6847  H  H    . SER A 1 47 ? 0.013   14.827  -9.421  1.00 0.00 ? 47  SER A H    10 
ATOM   6848  H  HA   . SER A 1 47 ? 1.735   14.593  -7.111  1.00 0.00 ? 47  SER A HA   10 
ATOM   6849  H  HB2  . SER A 1 47 ? 3.137   16.222  -8.202  1.00 0.00 ? 47  SER A HB2  10 
ATOM   6850  H  HB3  . SER A 1 47 ? 2.599   15.067  -9.421  1.00 0.00 ? 47  SER A HB3  10 
ATOM   6851  H  HG   . SER A 1 47 ? 0.816   16.737  -9.701  1.00 0.00 ? 47  SER A HG   10 
ATOM   6852  N  N    . SER A 1 48 ? -0.654  16.428  -6.781  1.00 0.00 ? 48  SER A N    10 
ATOM   6853  C  CA   . SER A 1 48 ? -1.338  17.458  -6.008  1.00 0.00 ? 48  SER A CA   10 
ATOM   6854  C  C    . SER A 1 48 ? -2.204  16.833  -4.918  1.00 0.00 ? 48  SER A C    10 
ATOM   6855  O  O    . SER A 1 48 ? -3.128  16.074  -5.203  1.00 0.00 ? 48  SER A O    10 
ATOM   6856  C  CB   . SER A 1 48 ? -2.201  18.326  -6.926  1.00 0.00 ? 48  SER A CB   10 
ATOM   6857  O  OG   . SER A 1 48 ? -3.260  17.574  -7.491  1.00 0.00 ? 48  SER A OG   10 
ATOM   6858  H  H    . SER A 1 48 ? -1.181  15.717  -7.202  1.00 0.00 ? 48  SER A H    10 
ATOM   6859  H  HA   . SER A 1 48 ? -0.586  18.078  -5.543  1.00 0.00 ? 48  SER A HA   10 
ATOM   6860  H  HB2  . SER A 1 48 ? -2.618  19.142  -6.356  1.00 0.00 ? 48  SER A HB2  10 
ATOM   6861  H  HB3  . SER A 1 48 ? -1.588  18.720  -7.724  1.00 0.00 ? 48  SER A HB3  10 
ATOM   6862  H  HG   . SER A 1 48 ? -3.983  18.162  -7.722  1.00 0.00 ? 48  SER A HG   10 
ATOM   6863  N  N    . GLY A 1 49 ? -1.896  17.161  -3.666  1.00 0.00 ? 49  GLY A N    10 
ATOM   6864  C  CA   . GLY A 1 49 ? -2.654  16.624  -2.551  1.00 0.00 ? 49  GLY A CA   10 
ATOM   6865  C  C    . GLY A 1 49 ? -1.774  15.925  -1.534  1.00 0.00 ? 49  GLY A C    10 
ATOM   6866  O  O    . GLY A 1 49 ? -2.121  14.831  -1.093  1.00 0.00 ? 49  GLY A O    10 
ATOM   6867  H  H    . GLY A 1 49 ? -1.148  17.771  -3.499  1.00 0.00 ? 49  GLY A H    10 
ATOM   6868  H  HA2  . GLY A 1 49 ? -3.178  17.432  -2.064  1.00 0.00 ? 49  GLY A HA2  10 
ATOM   6869  H  HA3  . GLY A 1 49 ? -3.377  15.916  -2.930  1.00 0.00 ? 49  GLY A HA3  10 
HETATM 6870  ZN ZN   . ZN  B 2 .  ? 2.778   -4.718  1.870   1.00 0.00 ? 201 ZN  A ZN   10 
ATOM   6871  N  N    . GLY A 1 1  ? -24.479 8.055   9.348   1.00 0.00 ? 1   GLY A N    11 
ATOM   6872  C  CA   . GLY A 1 1  ? -23.147 8.161   9.913   1.00 0.00 ? 1   GLY A CA   11 
ATOM   6873  C  C    . GLY A 1 1  ? -22.388 6.850   9.860   1.00 0.00 ? 1   GLY A C    11 
ATOM   6874  O  O    . GLY A 1 1  ? -22.985 5.776   9.936   1.00 0.00 ? 1   GLY A O    11 
ATOM   6875  H  H1   . GLY A 1 1  ? -24.832 7.177   9.092   1.00 0.00 ? 1   GLY A H1   11 
ATOM   6876  H  HA2  . GLY A 1 1  ? -22.594 8.909   9.364   1.00 0.00 ? 1   GLY A HA2  11 
ATOM   6877  H  HA3  . GLY A 1 1  ? -23.230 8.474   10.944  1.00 0.00 ? 1   GLY A HA3  11 
ATOM   6878  N  N    . SER A 1 2  ? -21.069 6.937   9.726   1.00 0.00 ? 2   SER A N    11 
ATOM   6879  C  CA   . SER A 1 2  ? -20.227 5.748   9.657   1.00 0.00 ? 2   SER A CA   11 
ATOM   6880  C  C    . SER A 1 2  ? -19.043 5.864   10.611  1.00 0.00 ? 2   SER A C    11 
ATOM   6881  O  O    . SER A 1 2  ? -18.342 6.876   10.628  1.00 0.00 ? 2   SER A O    11 
ATOM   6882  C  CB   . SER A 1 2  ? -19.727 5.535   8.227   1.00 0.00 ? 2   SER A CB   11 
ATOM   6883  O  OG   . SER A 1 2  ? -20.799 5.562   7.301   1.00 0.00 ? 2   SER A OG   11 
ATOM   6884  H  H    . SER A 1 2  ? -20.651 7.823   9.671   1.00 0.00 ? 2   SER A H    11 
ATOM   6885  H  HA   . SER A 1 2  ? -20.828 4.900   9.949   1.00 0.00 ? 2   SER A HA   11 
ATOM   6886  H  HB2  . SER A 1 2  ? -19.028 6.317   7.972   1.00 0.00 ? 2   SER A HB2  11 
ATOM   6887  H  HB3  . SER A 1 2  ? -19.233 4.576   8.160   1.00 0.00 ? 2   SER A HB3  11 
ATOM   6888  H  HG   . SER A 1 2  ? -20.453 5.502   6.408   1.00 0.00 ? 2   SER A HG   11 
ATOM   6889  N  N    . SER A 1 3  ? -18.825 4.820   11.404  1.00 0.00 ? 3   SER A N    11 
ATOM   6890  C  CA   . SER A 1 3  ? -17.728 4.805   12.364  1.00 0.00 ? 3   SER A CA   11 
ATOM   6891  C  C    . SER A 1 3  ? -16.433 5.289   11.717  1.00 0.00 ? 3   SER A C    11 
ATOM   6892  O  O    . SER A 1 3  ? -15.810 6.241   12.184  1.00 0.00 ? 3   SER A O    11 
ATOM   6893  C  CB   . SER A 1 3  ? -17.534 3.396   12.927  1.00 0.00 ? 3   SER A CB   11 
ATOM   6894  O  OG   . SER A 1 3  ? -18.732 2.910   13.508  1.00 0.00 ? 3   SER A OG   11 
ATOM   6895  H  H    . SER A 1 3  ? -19.418 4.042   11.343  1.00 0.00 ? 3   SER A H    11 
ATOM   6896  H  HA   . SER A 1 3  ? -17.985 5.475   13.171  1.00 0.00 ? 3   SER A HA   11 
ATOM   6897  H  HB2  . SER A 1 3  ? -17.238 2.730   12.131  1.00 0.00 ? 3   SER A HB2  11 
ATOM   6898  H  HB3  . SER A 1 3  ? -16.764 3.417   13.685  1.00 0.00 ? 3   SER A HB3  11 
ATOM   6899  H  HG   . SER A 1 3  ? -19.234 2.425   12.848  1.00 0.00 ? 3   SER A HG   11 
ATOM   6900  N  N    . GLY A 1 4  ? -16.034 4.623   10.637  1.00 0.00 ? 4   GLY A N    11 
ATOM   6901  C  CA   . GLY A 1 4  ? -14.816 4.999   9.943   1.00 0.00 ? 4   GLY A CA   11 
ATOM   6902  C  C    . GLY A 1 4  ? -13.900 3.816   9.700   1.00 0.00 ? 4   GLY A C    11 
ATOM   6903  O  O    . GLY A 1 4  ? -12.928 3.614   10.428  1.00 0.00 ? 4   GLY A O    11 
ATOM   6904  H  H    . GLY A 1 4  ? -16.571 3.872   10.310  1.00 0.00 ? 4   GLY A H    11 
ATOM   6905  H  HA2  . GLY A 1 4  ? -15.078 5.440   8.993   1.00 0.00 ? 4   GLY A HA2  11 
ATOM   6906  H  HA3  . GLY A 1 4  ? -14.289 5.731   10.536  1.00 0.00 ? 4   GLY A HA3  11 
ATOM   6907  N  N    . SER A 1 5  ? -14.209 3.031   8.673   1.00 0.00 ? 5   SER A N    11 
ATOM   6908  C  CA   . SER A 1 5  ? -13.409 1.858   8.338   1.00 0.00 ? 5   SER A CA   11 
ATOM   6909  C  C    . SER A 1 5  ? -11.963 2.251   8.054   1.00 0.00 ? 5   SER A C    11 
ATOM   6910  O  O    . SER A 1 5  ? -11.036 1.753   8.693   1.00 0.00 ? 5   SER A O    11 
ATOM   6911  C  CB   . SER A 1 5  ? -14.002 1.139   7.125   1.00 0.00 ? 5   SER A CB   11 
ATOM   6912  O  OG   . SER A 1 5  ? -14.997 0.210   7.520   1.00 0.00 ? 5   SER A OG   11 
ATOM   6913  H  H    . SER A 1 5  ? -14.996 3.244   8.129   1.00 0.00 ? 5   SER A H    11 
ATOM   6914  H  HA   . SER A 1 5  ? -13.429 1.191   9.187   1.00 0.00 ? 5   SER A HA   11 
ATOM   6915  H  HB2  . SER A 1 5  ? -14.448 1.865   6.462   1.00 0.00 ? 5   SER A HB2  11 
ATOM   6916  H  HB3  . SER A 1 5  ? -13.217 0.610   6.605   1.00 0.00 ? 5   SER A HB3  11 
ATOM   6917  H  HG   . SER A 1 5  ? -15.653 0.129   6.824   1.00 0.00 ? 5   SER A HG   11 
ATOM   6918  N  N    . SER A 1 6  ? -11.778 3.147   7.090   1.00 0.00 ? 6   SER A N    11 
ATOM   6919  C  CA   . SER A 1 6  ? -10.445 3.605   6.717   1.00 0.00 ? 6   SER A CA   11 
ATOM   6920  C  C    . SER A 1 6  ? -9.582  2.438   6.246   1.00 0.00 ? 6   SER A C    11 
ATOM   6921  O  O    . SER A 1 6  ? -8.398  2.356   6.571   1.00 0.00 ? 6   SER A O    11 
ATOM   6922  C  CB   . SER A 1 6  ? -9.774  4.306   7.899   1.00 0.00 ? 6   SER A CB   11 
ATOM   6923  O  OG   . SER A 1 6  ? -10.614 5.310   8.441   1.00 0.00 ? 6   SER A OG   11 
ATOM   6924  H  H    . SER A 1 6  ? -12.557 3.507   6.617   1.00 0.00 ? 6   SER A H    11 
ATOM   6925  H  HA   . SER A 1 6  ? -10.551 4.309   5.905   1.00 0.00 ? 6   SER A HA   11 
ATOM   6926  H  HB2  . SER A 1 6  ? -9.557  3.581   8.669   1.00 0.00 ? 6   SER A HB2  11 
ATOM   6927  H  HB3  . SER A 1 6  ? -8.853  4.764   7.567   1.00 0.00 ? 6   SER A HB3  11 
ATOM   6928  H  HG   . SER A 1 6  ? -10.480 5.363   9.390   1.00 0.00 ? 6   SER A HG   11 
ATOM   6929  N  N    . GLY A 1 7  ? -10.185 1.536   5.479   1.00 0.00 ? 7   GLY A N    11 
ATOM   6930  C  CA   . GLY A 1 7  ? -9.458  0.385   4.975   1.00 0.00 ? 7   GLY A CA   11 
ATOM   6931  C  C    . GLY A 1 7  ? -9.319  -0.712  6.012   1.00 0.00 ? 7   GLY A C    11 
ATOM   6932  O  O    . GLY A 1 7  ? -8.630  -0.542  7.017   1.00 0.00 ? 7   GLY A O    11 
ATOM   6933  H  H    . GLY A 1 7  ? -11.132 1.652   5.252   1.00 0.00 ? 7   GLY A H    11 
ATOM   6934  H  HA2  . GLY A 1 7  ? -9.981  -0.010  4.117   1.00 0.00 ? 7   GLY A HA2  11 
ATOM   6935  H  HA3  . GLY A 1 7  ? -8.472  0.702   4.670   1.00 0.00 ? 7   GLY A HA3  11 
ATOM   6936  N  N    . SER A 1 8  ? -9.978  -1.841  5.769   1.00 0.00 ? 8   SER A N    11 
ATOM   6937  C  CA   . SER A 1 8  ? -9.929  -2.968  6.693   1.00 0.00 ? 8   SER A CA   11 
ATOM   6938  C  C    . SER A 1 8  ? -9.019  -4.069  6.159   1.00 0.00 ? 8   SER A C    11 
ATOM   6939  O  O    . SER A 1 8  ? -9.220  -4.576  5.054   1.00 0.00 ? 8   SER A O    11 
ATOM   6940  C  CB   . SER A 1 8  ? -11.336 -3.523  6.928   1.00 0.00 ? 8   SER A CB   11 
ATOM   6941  O  OG   . SER A 1 8  ? -11.323 -4.546  7.909   1.00 0.00 ? 8   SER A OG   11 
ATOM   6942  H  H    . SER A 1 8  ? -10.511 -1.916  4.950   1.00 0.00 ? 8   SER A H    11 
ATOM   6943  H  HA   . SER A 1 8  ? -9.531  -2.611  7.631   1.00 0.00 ? 8   SER A HA   11 
ATOM   6944  H  HB2  . SER A 1 8  ? -11.982 -2.727  7.265   1.00 0.00 ? 8   SER A HB2  11 
ATOM   6945  H  HB3  . SER A 1 8  ? -11.718 -3.931  6.004   1.00 0.00 ? 8   SER A HB3  11 
ATOM   6946  H  HG   . SER A 1 8  ? -10.744 -4.290  8.631   1.00 0.00 ? 8   SER A HG   11 
ATOM   6947  N  N    . LEU A 1 9  ? -8.017  -4.436  6.950   1.00 0.00 ? 9   LEU A N    11 
ATOM   6948  C  CA   . LEU A 1 9  ? -7.074  -5.477  6.559   1.00 0.00 ? 9   LEU A CA   11 
ATOM   6949  C  C    . LEU A 1 9  ? -7.805  -6.766  6.195   1.00 0.00 ? 9   LEU A C    11 
ATOM   6950  O  O    . LEU A 1 9  ? -8.284  -7.487  7.070   1.00 0.00 ? 9   LEU A O    11 
ATOM   6951  C  CB   . LEU A 1 9  ? -6.079  -5.744  7.690   1.00 0.00 ? 9   LEU A CB   11 
ATOM   6952  C  CG   . LEU A 1 9  ? -5.097  -4.613  8.000   1.00 0.00 ? 9   LEU A CG   11 
ATOM   6953  C  CD1  . LEU A 1 9  ? -4.317  -4.918  9.270   1.00 0.00 ? 9   LEU A CD1  11 
ATOM   6954  C  CD2  . LEU A 1 9  ? -4.150  -4.393  6.830   1.00 0.00 ? 9   LEU A CD2  11 
ATOM   6955  H  H    . LEU A 1 9  ? -7.908  -3.996  7.819   1.00 0.00 ? 9   LEU A H    11 
ATOM   6956  H  HA   . LEU A 1 9  ? -6.535  -5.127  5.691   1.00 0.00 ? 9   LEU A HA   11 
ATOM   6957  H  HB2  . LEU A 1 9  ? -6.644  -5.946  8.586   1.00 0.00 ? 9   LEU A HB2  11 
ATOM   6958  H  HB3  . LEU A 1 9  ? -5.504  -6.619  7.423   1.00 0.00 ? 9   LEU A HB3  11 
ATOM   6959  H  HG   . LEU A 1 9  ? -5.651  -3.698  8.161   1.00 0.00 ? 9   LEU A HG   11 
ATOM   6960  H  HD11 . LEU A 1 9  ? -3.544  -4.176  9.404   1.00 0.00 ? 9   LEU A HD11 11 
ATOM   6961  H  HD12 . LEU A 1 9  ? -3.868  -5.896  9.190   1.00 0.00 ? 9   LEU A HD12 11 
ATOM   6962  H  HD13 . LEU A 1 9  ? -4.987  -4.898  10.117  1.00 0.00 ? 9   LEU A HD13 11 
ATOM   6963  H  HD21 . LEU A 1 9  ? -3.587  -3.485  6.989   1.00 0.00 ? 9   LEU A HD21 11 
ATOM   6964  H  HD22 . LEU A 1 9  ? -4.721  -4.308  5.917   1.00 0.00 ? 9   LEU A HD22 11 
ATOM   6965  H  HD23 . LEU A 1 9  ? -3.471  -5.230  6.754   1.00 0.00 ? 9   LEU A HD23 11 
ATOM   6966  N  N    . MET A 1 10 ? -7.886  -7.049  4.899   1.00 0.00 ? 10  MET A N    11 
ATOM   6967  C  CA   . MET A 1 10 ? -8.556  -8.253  4.421   1.00 0.00 ? 10  MET A CA   11 
ATOM   6968  C  C    . MET A 1 10 ? -7.687  -9.486  4.649   1.00 0.00 ? 10  MET A C    11 
ATOM   6969  O  O    . MET A 1 10 ? -6.548  -9.378  5.103   1.00 0.00 ? 10  MET A O    11 
ATOM   6970  C  CB   . MET A 1 10 ? -8.891  -8.119  2.934   1.00 0.00 ? 10  MET A CB   11 
ATOM   6971  C  CG   . MET A 1 10 ? -9.660  -6.852  2.596   1.00 0.00 ? 10  MET A CG   11 
ATOM   6972  S  SD   . MET A 1 10 ? -10.751 -7.060  1.176   1.00 0.00 ? 10  MET A SD   11 
ATOM   6973  C  CE   . MET A 1 10 ? -12.355 -6.857  1.948   1.00 0.00 ? 10  MET A CE   11 
ATOM   6974  H  H    . MET A 1 10 ? -7.485  -6.435  4.249   1.00 0.00 ? 10  MET A H    11 
ATOM   6975  H  HA   . MET A 1 10 ? -9.473  -8.365  4.979   1.00 0.00 ? 10  MET A HA   11 
ATOM   6976  H  HB2  . MET A 1 10 ? -7.971  -8.117  2.369   1.00 0.00 ? 10  MET A HB2  11 
ATOM   6977  H  HB3  . MET A 1 10 ? -9.488  -8.967  2.634   1.00 0.00 ? 10  MET A HB3  11 
ATOM   6978  H  HG2  . MET A 1 10 ? -10.257 -6.570  3.451   1.00 0.00 ? 10  MET A HG2  11 
ATOM   6979  H  HG3  . MET A 1 10 ? -8.953  -6.066  2.378   1.00 0.00 ? 10  MET A HG3  11 
ATOM   6980  H  HE1  . MET A 1 10 ? -12.659 -7.791  2.396   1.00 0.00 ? 10  MET A HE1  11 
ATOM   6981  H  HE2  . MET A 1 10 ? -12.293 -6.095  2.711   1.00 0.00 ? 10  MET A HE2  11 
ATOM   6982  H  HE3  . MET A 1 10 ? -13.078 -6.562  1.202   1.00 0.00 ? 10  MET A HE3  11 
ATOM   6983  N  N    . ASP A 1 11 ? -8.233  -10.655 4.333   1.00 0.00 ? 11  ASP A N    11 
ATOM   6984  C  CA   . ASP A 1 11 ? -7.507  -11.908 4.503   1.00 0.00 ? 11  ASP A CA   11 
ATOM   6985  C  C    . ASP A 1 11 ? -6.637  -12.202 3.284   1.00 0.00 ? 11  ASP A C    11 
ATOM   6986  O  O    . ASP A 1 11 ? -6.129  -13.312 3.125   1.00 0.00 ? 11  ASP A O    11 
ATOM   6987  C  CB   . ASP A 1 11 ? -8.485  -13.061 4.737   1.00 0.00 ? 11  ASP A CB   11 
ATOM   6988  C  CG   . ASP A 1 11 ? -9.275  -12.898 6.020   1.00 0.00 ? 11  ASP A CG   11 
ATOM   6989  O  OD1  . ASP A 1 11 ? -10.108 -11.969 6.091   1.00 0.00 ? 11  ASP A OD1  11 
ATOM   6990  O  OD2  . ASP A 1 11 ? -9.062  -13.699 6.954   1.00 0.00 ? 11  ASP A OD2  11 
ATOM   6991  H  H    . ASP A 1 11 ? -9.145  -10.675 3.975   1.00 0.00 ? 11  ASP A H    11 
ATOM   6992  H  HA   . ASP A 1 11 ? -6.870  -11.808 5.368   1.00 0.00 ? 11  ASP A HA   11 
ATOM   6993  H  HB2  . ASP A 1 11 ? -9.180  -13.108 3.911   1.00 0.00 ? 11  ASP A HB2  11 
ATOM   6994  H  HB3  . ASP A 1 11 ? -7.933  -13.987 4.790   1.00 0.00 ? 11  ASP A HB3  11 
ATOM   6995  N  N    . VAL A 1 12 ? -6.471  -11.200 2.427   1.00 0.00 ? 12  VAL A N    11 
ATOM   6996  C  CA   . VAL A 1 12 ? -5.663  -11.351 1.223   1.00 0.00 ? 12  VAL A CA   11 
ATOM   6997  C  C    . VAL A 1 12 ? -4.247  -10.831 1.442   1.00 0.00 ? 12  VAL A C    11 
ATOM   6998  O  O    . VAL A 1 12 ? -4.048  -9.666  1.789   1.00 0.00 ? 12  VAL A O    11 
ATOM   6999  C  CB   . VAL A 1 12 ? -6.291  -10.609 0.028   1.00 0.00 ? 12  VAL A CB   11 
ATOM   7000  C  CG1  . VAL A 1 12 ? -5.535  -10.922 -1.254  1.00 0.00 ? 12  VAL A CG1  11 
ATOM   7001  C  CG2  . VAL A 1 12 ? -7.762  -10.970 -0.109  1.00 0.00 ? 12  VAL A CG2  11 
ATOM   7002  H  H    . VAL A 1 12 ? -6.901  -10.339 2.609   1.00 0.00 ? 12  VAL A H    11 
ATOM   7003  H  HA   . VAL A 1 12 ? -5.616  -12.403 0.981   1.00 0.00 ? 12  VAL A HA   11 
ATOM   7004  H  HB   . VAL A 1 12 ? -6.219  -9.547  0.212   1.00 0.00 ? 12  VAL A HB   11 
ATOM   7005  H  HG11 . VAL A 1 12 ? -4.567  -10.443 -1.226  1.00 0.00 ? 12  VAL A HG11 11 
ATOM   7006  H  HG12 . VAL A 1 12 ? -5.406  -11.991 -1.344  1.00 0.00 ? 12  VAL A HG12 11 
ATOM   7007  H  HG13 . VAL A 1 12 ? -6.095  -10.554 -2.101  1.00 0.00 ? 12  VAL A HG13 11 
ATOM   7008  H  HG21 . VAL A 1 12 ? -7.971  -11.859 0.469   1.00 0.00 ? 12  VAL A HG21 11 
ATOM   7009  H  HG22 . VAL A 1 12 ? -8.368  -10.154 0.254   1.00 0.00 ? 12  VAL A HG22 11 
ATOM   7010  H  HG23 . VAL A 1 12 ? -7.993  -11.155 -1.148  1.00 0.00 ? 12  VAL A HG23 11 
ATOM   7011  N  N    . LYS A 1 13 ? -3.264  -11.701 1.238   1.00 0.00 ? 13  LYS A N    11 
ATOM   7012  C  CA   . LYS A 1 13 ? -1.865  -11.331 1.411   1.00 0.00 ? 13  LYS A CA   11 
ATOM   7013  C  C    . LYS A 1 13 ? -1.506  -10.134 0.537   1.00 0.00 ? 13  LYS A C    11 
ATOM   7014  O  O    . LYS A 1 13 ? -2.013  -9.991  -0.577  1.00 0.00 ? 13  LYS A O    11 
ATOM   7015  C  CB   . LYS A 1 13 ? -0.956  -12.515 1.071   1.00 0.00 ? 13  LYS A CB   11 
ATOM   7016  C  CG   . LYS A 1 13 ? -0.754  -13.478 2.228   1.00 0.00 ? 13  LYS A CG   11 
ATOM   7017  C  CD   . LYS A 1 13 ? -1.863  -14.514 2.291   1.00 0.00 ? 13  LYS A CD   11 
ATOM   7018  C  CE   . LYS A 1 13 ? -1.603  -15.669 1.335   1.00 0.00 ? 13  LYS A CE   11 
ATOM   7019  N  NZ   . LYS A 1 13 ? -2.666  -16.708 1.419   1.00 0.00 ? 13  LYS A NZ   11 
ATOM   7020  H  H    . LYS A 1 13 ? -3.486  -12.616 0.962   1.00 0.00 ? 13  LYS A H    11 
ATOM   7021  H  HA   . LYS A 1 13 ? -1.718  -11.062 2.446   1.00 0.00 ? 13  LYS A HA   11 
ATOM   7022  H  HB2  . LYS A 1 13 ? -1.391  -13.061 0.247   1.00 0.00 ? 13  LYS A HB2  11 
ATOM   7023  H  HB3  . LYS A 1 13 ? 0.011   -12.137 0.771   1.00 0.00 ? 13  LYS A HB3  11 
ATOM   7024  H  HG2  . LYS A 1 13 ? 0.191   -13.985 2.100   1.00 0.00 ? 13  LYS A HG2  11 
ATOM   7025  H  HG3  . LYS A 1 13 ? -0.742  -12.919 3.152   1.00 0.00 ? 13  LYS A HG3  11 
ATOM   7026  H  HD2  . LYS A 1 13 ? -1.925  -14.902 3.297   1.00 0.00 ? 13  LYS A HD2  11 
ATOM   7027  H  HD3  . LYS A 1 13 ? -2.799  -14.043 2.027   1.00 0.00 ? 13  LYS A HD3  11 
ATOM   7028  H  HE2  . LYS A 1 13 ? -1.567  -15.283 0.328   1.00 0.00 ? 13  LYS A HE2  11 
ATOM   7029  H  HE3  . LYS A 1 13 ? -0.652  -16.117 1.583   1.00 0.00 ? 13  LYS A HE3  11 
ATOM   7030  H  HZ1  . LYS A 1 13 ? -3.593  -16.291 1.199   1.00 0.00 ? 13  LYS A HZ1  11 
ATOM   7031  H  HZ2  . LYS A 1 13 ? -2.697  -17.111 2.377   1.00 0.00 ? 13  LYS A HZ2  11 
ATOM   7032  H  HZ3  . LYS A 1 13 ? -2.473  -17.472 0.741   1.00 0.00 ? 13  LYS A HZ3  11 
ATOM   7033  N  N    . CYS A 1 14 ? -0.629  -9.276  1.047   1.00 0.00 ? 14  CYS A N    11 
ATOM   7034  C  CA   . CYS A 1 14 ? -0.202  -8.091  0.312   1.00 0.00 ? 14  CYS A CA   11 
ATOM   7035  C  C    . CYS A 1 14 ? 0.282   -8.463  -1.086  1.00 0.00 ? 14  CYS A C    11 
ATOM   7036  O  O    . CYS A 1 14 ? 0.941   -9.485  -1.274  1.00 0.00 ? 14  CYS A O    11 
ATOM   7037  C  CB   . CYS A 1 14 ? 0.912   -7.368  1.073   1.00 0.00 ? 14  CYS A CB   11 
ATOM   7038  S  SG   . CYS A 1 14 ? 1.715   -6.035  0.126   1.00 0.00 ? 14  CYS A SG   11 
ATOM   7039  H  H    . CYS A 1 14 ? -0.260  -9.443  1.940   1.00 0.00 ? 14  CYS A H    11 
ATOM   7040  H  HA   . CYS A 1 14 ? -1.051  -7.432  0.223   1.00 0.00 ? 14  CYS A HA   11 
ATOM   7041  H  HB2  . CYS A 1 14 ? 0.498   -6.930  1.970   1.00 0.00 ? 14  CYS A HB2  11 
ATOM   7042  H  HB3  . CYS A 1 14 ? 1.674   -8.083  1.346   1.00 0.00 ? 14  CYS A HB3  11 
ATOM   7043  N  N    . GLU A 1 15 ? -0.051  -7.626  -2.064  1.00 0.00 ? 15  GLU A N    11 
ATOM   7044  C  CA   . GLU A 1 15 ? 0.349   -7.868  -3.445  1.00 0.00 ? 15  GLU A CA   11 
ATOM   7045  C  C    . GLU A 1 15 ? 1.721   -8.532  -3.506  1.00 0.00 ? 15  GLU A C    11 
ATOM   7046  O  O    . GLU A 1 15 ? 1.864   -9.645  -4.014  1.00 0.00 ? 15  GLU A O    11 
ATOM   7047  C  CB   . GLU A 1 15 ? 0.371   -6.555  -4.230  1.00 0.00 ? 15  GLU A CB   11 
ATOM   7048  C  CG   . GLU A 1 15 ? 0.860   -6.709  -5.661  1.00 0.00 ? 15  GLU A CG   11 
ATOM   7049  C  CD   . GLU A 1 15 ? 0.596   -5.476  -6.504  1.00 0.00 ? 15  GLU A CD   11 
ATOM   7050  O  OE1  . GLU A 1 15 ? 1.047   -4.380  -6.111  1.00 0.00 ? 15  GLU A OE1  11 
ATOM   7051  O  OE2  . GLU A 1 15 ? -0.063  -5.609  -7.557  1.00 0.00 ? 15  GLU A OE2  11 
ATOM   7052  H  H    . GLU A 1 15 ? -0.578  -6.828  -1.851  1.00 0.00 ? 15  GLU A H    11 
ATOM   7053  H  HA   . GLU A 1 15 ? -0.378  -8.530  -3.890  1.00 0.00 ? 15  GLU A HA   11 
ATOM   7054  H  HB2  . GLU A 1 15 ? -0.629  -6.147  -4.255  1.00 0.00 ? 15  GLU A HB2  11 
ATOM   7055  H  HB3  . GLU A 1 15 ? 1.021   -5.857  -3.723  1.00 0.00 ? 15  GLU A HB3  11 
ATOM   7056  H  HG2  . GLU A 1 15 ? 1.923   -6.895  -5.646  1.00 0.00 ? 15  GLU A HG2  11 
ATOM   7057  H  HG3  . GLU A 1 15 ? 0.355   -7.551  -6.111  1.00 0.00 ? 15  GLU A HG3  11 
ATOM   7058  N  N    . THR A 1 16 ? 2.730   -7.842  -2.984  1.00 0.00 ? 16  THR A N    11 
ATOM   7059  C  CA   . THR A 1 16 ? 4.091   -8.363  -2.980  1.00 0.00 ? 16  THR A CA   11 
ATOM   7060  C  C    . THR A 1 16 ? 4.150   -9.742  -2.334  1.00 0.00 ? 16  THR A C    11 
ATOM   7061  O  O    . THR A 1 16 ? 3.740   -9.937  -1.190  1.00 0.00 ? 16  THR A O    11 
ATOM   7062  C  CB   . THR A 1 16 ? 5.052   -7.418  -2.234  1.00 0.00 ? 16  THR A CB   11 
ATOM   7063  O  OG1  . THR A 1 16 ? 5.113   -6.153  -2.902  1.00 0.00 ? 16  THR A OG1  11 
ATOM   7064  C  CG2  . THR A 1 16 ? 6.447   -8.020  -2.149  1.00 0.00 ? 16  THR A CG2  11 
ATOM   7065  H  H    . THR A 1 16 ? 2.554   -6.961  -2.593  1.00 0.00 ? 16  THR A H    11 
ATOM   7066  H  HA   . THR A 1 16 ? 4.422   -8.441  -4.005  1.00 0.00 ? 16  THR A HA   11 
ATOM   7067  H  HB   . THR A 1 16 ? 4.679   -7.268  -1.230  1.00 0.00 ? 16  THR A HB   11 
ATOM   7068  H  HG1  . THR A 1 16 ? 4.950   -5.448  -2.271  1.00 0.00 ? 16  THR A HG1  11 
ATOM   7069  H  HG21 . THR A 1 16 ? 6.602   -8.430  -1.163  1.00 0.00 ? 16  THR A HG21 11 
ATOM   7070  H  HG22 . THR A 1 16 ? 7.182   -7.253  -2.339  1.00 0.00 ? 16  THR A HG22 11 
ATOM   7071  H  HG23 . THR A 1 16 ? 6.545   -8.804  -2.885  1.00 0.00 ? 16  THR A HG23 11 
ATOM   7072  N  N    . PRO A 1 17 ? 4.674   -10.725 -3.082  1.00 0.00 ? 17  PRO A N    11 
ATOM   7073  C  CA   . PRO A 1 17 ? 4.800   -12.104 -2.602  1.00 0.00 ? 17  PRO A CA   11 
ATOM   7074  C  C    . PRO A 1 17 ? 5.853   -12.243 -1.508  1.00 0.00 ? 17  PRO A C    11 
ATOM   7075  O  O    . PRO A 1 17 ? 6.089   -13.336 -0.996  1.00 0.00 ? 17  PRO A O    11 
ATOM   7076  C  CB   . PRO A 1 17 ? 5.223   -12.878 -3.853  1.00 0.00 ? 17  PRO A CB   11 
ATOM   7077  C  CG   . PRO A 1 17 ? 5.891   -11.865 -4.717  1.00 0.00 ? 17  PRO A CG   11 
ATOM   7078  C  CD   . PRO A 1 17 ? 5.183   -10.565 -4.455  1.00 0.00 ? 17  PRO A CD   11 
ATOM   7079  H  HA   . PRO A 1 17 ? 3.856   -12.487 -2.242  1.00 0.00 ? 17  PRO A HA   11 
ATOM   7080  H  HB2  . PRO A 1 17 ? 5.902   -13.672 -3.575  1.00 0.00 ? 17  PRO A HB2  11 
ATOM   7081  H  HB3  . PRO A 1 17 ? 4.351   -13.294 -4.335  1.00 0.00 ? 17  PRO A HB3  11 
ATOM   7082  H  HG2  . PRO A 1 17 ? 6.934   -11.785 -4.450  1.00 0.00 ? 17  PRO A HG2  11 
ATOM   7083  H  HG3  . PRO A 1 17 ? 5.789   -12.144 -5.755  1.00 0.00 ? 17  PRO A HG3  11 
ATOM   7084  H  HD2  . PRO A 1 17 ? 5.876   -9.739  -4.515  1.00 0.00 ? 17  PRO A HD2  11 
ATOM   7085  H  HD3  . PRO A 1 17 ? 4.370   -10.430 -5.153  1.00 0.00 ? 17  PRO A HD3  11 
ATOM   7086  N  N    . ASN A 1 18 ? 6.483   -11.127 -1.155  1.00 0.00 ? 18  ASN A N    11 
ATOM   7087  C  CA   . ASN A 1 18 ? 7.512   -11.125 -0.121  1.00 0.00 ? 18  ASN A CA   11 
ATOM   7088  C  C    . ASN A 1 18 ? 7.027   -10.395 1.128   1.00 0.00 ? 18  ASN A C    11 
ATOM   7089  O  O    . ASN A 1 18 ? 7.678   -10.429 2.172   1.00 0.00 ? 18  ASN A O    11 
ATOM   7090  C  CB   . ASN A 1 18 ? 8.790   -10.468 -0.646  1.00 0.00 ? 18  ASN A CB   11 
ATOM   7091  C  CG   . ASN A 1 18 ? 9.725   -11.465 -1.304  1.00 0.00 ? 18  ASN A CG   11 
ATOM   7092  O  OD1  . ASN A 1 18 ? 9.296   -12.307 -2.093  1.00 0.00 ? 18  ASN A OD1  11 
ATOM   7093  N  ND2  . ASN A 1 18 ? 11.009  -11.374 -0.981  1.00 0.00 ? 18  ASN A ND2  11 
ATOM   7094  H  H    . ASN A 1 18 ? 6.252   -10.286 -1.600  1.00 0.00 ? 18  ASN A H    11 
ATOM   7095  H  HA   . ASN A 1 18 ? 7.725   -12.152 0.136   1.00 0.00 ? 18  ASN A HA   11 
ATOM   7096  H  HB2  . ASN A 1 18 ? 8.528   -9.715  -1.374  1.00 0.00 ? 18  ASN A HB2  11 
ATOM   7097  H  HB3  . ASN A 1 18 ? 9.312   -10.002 0.176   1.00 0.00 ? 18  ASN A HB3  11 
ATOM   7098  H  HD21 . ASN A 1 18 ? 11.279  -10.679 -0.345  1.00 0.00 ? 18  ASN A HD21 11 
ATOM   7099  H  HD22 . ASN A 1 18 ? 11.636  -12.006 -1.393  1.00 0.00 ? 18  ASN A HD22 11 
ATOM   7100  N  N    . CYS A 1 19 ? 5.880   -9.735  1.012   1.00 0.00 ? 19  CYS A N    11 
ATOM   7101  C  CA   . CYS A 1 19 ? 5.306   -8.996  2.130   1.00 0.00 ? 19  CYS A CA   11 
ATOM   7102  C  C    . CYS A 1 19 ? 4.322   -9.865  2.909   1.00 0.00 ? 19  CYS A C    11 
ATOM   7103  O  O    . CYS A 1 19 ? 3.229   -10.182 2.440   1.00 0.00 ? 19  CYS A O    11 
ATOM   7104  C  CB   . CYS A 1 19 ? 4.602   -7.735  1.628   1.00 0.00 ? 19  CYS A CB   11 
ATOM   7105  S  SG   . CYS A 1 19 ? 4.250   -6.510  2.930   1.00 0.00 ? 19  CYS A SG   11 
ATOM   7106  H  H    . CYS A 1 19 ? 5.406   -9.745  0.153   1.00 0.00 ? 19  CYS A H    11 
ATOM   7107  H  HA   . CYS A 1 19 ? 6.113   -8.710  2.788   1.00 0.00 ? 19  CYS A HA   11 
ATOM   7108  H  HB2  . CYS A 1 19 ? 5.225   -7.255  0.887   1.00 0.00 ? 19  CYS A HB2  11 
ATOM   7109  H  HB3  . CYS A 1 19 ? 3.662   -8.013  1.175   1.00 0.00 ? 19  CYS A HB3  11 
ATOM   7110  N  N    . PRO A 1 20 ? 4.718   -10.261 4.128   1.00 0.00 ? 20  PRO A N    11 
ATOM   7111  C  CA   . PRO A 1 20 ? 3.887   -11.097 4.998   1.00 0.00 ? 20  PRO A CA   11 
ATOM   7112  C  C    . PRO A 1 20 ? 2.668   -10.350 5.529   1.00 0.00 ? 20  PRO A C    11 
ATOM   7113  O  O    . PRO A 1 20 ? 1.843   -10.917 6.245   1.00 0.00 ? 20  PRO A O    11 
ATOM   7114  C  CB   . PRO A 1 20 ? 4.831   -11.465 6.145   1.00 0.00 ? 20  PRO A CB   11 
ATOM   7115  C  CG   . PRO A 1 20 ? 5.834   -10.364 6.177   1.00 0.00 ? 20  PRO A CG   11 
ATOM   7116  C  CD   . PRO A 1 20 ? 6.009   -9.921  4.751   1.00 0.00 ? 20  PRO A CD   11 
ATOM   7117  H  HA   . PRO A 1 20 ? 3.564   -11.996 4.493   1.00 0.00 ? 20  PRO A HA   11 
ATOM   7118  H  HB2  . PRO A 1 20 ? 4.273   -11.519 7.070   1.00 0.00 ? 20  PRO A HB2  11 
ATOM   7119  H  HB3  . PRO A 1 20 ? 5.297   -12.417 5.942   1.00 0.00 ? 20  PRO A HB3  11 
ATOM   7120  H  HG2  . PRO A 1 20 ? 5.465   -9.548  6.781   1.00 0.00 ? 20  PRO A HG2  11 
ATOM   7121  H  HG3  . PRO A 1 20 ? 6.770   -10.732 6.572   1.00 0.00 ? 20  PRO A HG3  11 
ATOM   7122  H  HD2  . PRO A 1 20 ? 6.191   -8.858  4.705   1.00 0.00 ? 20  PRO A HD2  11 
ATOM   7123  H  HD3  . PRO A 1 20 ? 6.817   -10.465 4.283   1.00 0.00 ? 20  PRO A HD3  11 
ATOM   7124  N  N    . PHE A 1 21 ? 2.562   -9.074  5.173   1.00 0.00 ? 21  PHE A N    11 
ATOM   7125  C  CA   . PHE A 1 21 ? 1.444   -8.248  5.615   1.00 0.00 ? 21  PHE A CA   11 
ATOM   7126  C  C    . PHE A 1 21 ? 0.269   -8.361  4.648   1.00 0.00 ? 21  PHE A C    11 
ATOM   7127  O  O    . PHE A 1 21 ? 0.455   -8.559  3.447   1.00 0.00 ? 21  PHE A O    11 
ATOM   7128  C  CB   . PHE A 1 21 ? 1.879   -6.786  5.737   1.00 0.00 ? 21  PHE A CB   11 
ATOM   7129  C  CG   . PHE A 1 21 ? 2.830   -6.537  6.872   1.00 0.00 ? 21  PHE A CG   11 
ATOM   7130  C  CD1  . PHE A 1 21 ? 4.083   -7.129  6.886   1.00 0.00 ? 21  PHE A CD1  11 
ATOM   7131  C  CD2  . PHE A 1 21 ? 2.472   -5.710  7.925   1.00 0.00 ? 21  PHE A CD2  11 
ATOM   7132  C  CE1  . PHE A 1 21 ? 4.960   -6.901  7.930   1.00 0.00 ? 21  PHE A CE1  11 
ATOM   7133  C  CE2  . PHE A 1 21 ? 3.345   -5.479  8.971   1.00 0.00 ? 21  PHE A CE2  11 
ATOM   7134  C  CZ   . PHE A 1 21 ? 4.591   -6.074  8.973   1.00 0.00 ? 21  PHE A CZ   11 
ATOM   7135  H  H    . PHE A 1 21 ? 3.252   -8.678  4.600   1.00 0.00 ? 21  PHE A H    11 
ATOM   7136  H  HA   . PHE A 1 21 ? 1.133   -8.604  6.585   1.00 0.00 ? 21  PHE A HA   11 
ATOM   7137  H  HB2  . PHE A 1 21 ? 2.369   -6.486  4.823   1.00 0.00 ? 21  PHE A HB2  11 
ATOM   7138  H  HB3  . PHE A 1 21 ? 1.006   -6.170  5.892   1.00 0.00 ? 21  PHE A HB3  11 
ATOM   7139  H  HD1  . PHE A 1 21 ? 4.374   -7.775  6.071   1.00 0.00 ? 21  PHE A HD1  11 
ATOM   7140  H  HD2  . PHE A 1 21 ? 1.497   -5.243  7.924   1.00 0.00 ? 21  PHE A HD2  11 
ATOM   7141  H  HE1  . PHE A 1 21 ? 5.934   -7.368  7.929   1.00 0.00 ? 21  PHE A HE1  11 
ATOM   7142  H  HE2  . PHE A 1 21 ? 3.054   -4.831  9.785   1.00 0.00 ? 21  PHE A HE2  11 
ATOM   7143  H  HZ   . PHE A 1 21 ? 5.275   -5.896  9.790   1.00 0.00 ? 21  PHE A HZ   11 
ATOM   7144  N  N    . PHE A 1 22 ? -0.942  -8.235  5.181   1.00 0.00 ? 22  PHE A N    11 
ATOM   7145  C  CA   . PHE A 1 22 ? -2.149  -8.325  4.367   1.00 0.00 ? 22  PHE A CA   11 
ATOM   7146  C  C    . PHE A 1 22 ? -2.510  -6.965  3.778   1.00 0.00 ? 22  PHE A C    11 
ATOM   7147  O  O    . PHE A 1 22 ? -2.228  -5.925  4.372   1.00 0.00 ? 22  PHE A O    11 
ATOM   7148  C  CB   . PHE A 1 22 ? -3.315  -8.857  5.203   1.00 0.00 ? 22  PHE A CB   11 
ATOM   7149  C  CG   . PHE A 1 22 ? -3.134  -10.281 5.645   1.00 0.00 ? 22  PHE A CG   11 
ATOM   7150  C  CD1  . PHE A 1 22 ? -3.168  -11.316 4.725   1.00 0.00 ? 22  PHE A CD1  11 
ATOM   7151  C  CD2  . PHE A 1 22 ? -2.930  -10.585 6.982   1.00 0.00 ? 22  PHE A CD2  11 
ATOM   7152  C  CE1  . PHE A 1 22 ? -3.003  -12.628 5.130   1.00 0.00 ? 22  PHE A CE1  11 
ATOM   7153  C  CE2  . PHE A 1 22 ? -2.764  -11.894 7.393   1.00 0.00 ? 22  PHE A CE2  11 
ATOM   7154  C  CZ   . PHE A 1 22 ? -2.799  -12.916 6.465   1.00 0.00 ? 22  PHE A CZ   11 
ATOM   7155  H  H    . PHE A 1 22 ? -1.026  -8.079  6.145   1.00 0.00 ? 22  PHE A H    11 
ATOM   7156  H  HA   . PHE A 1 22 ? -1.952  -9.013  3.559   1.00 0.00 ? 22  PHE A HA   11 
ATOM   7157  H  HB2  . PHE A 1 22 ? -3.423  -8.247  6.086   1.00 0.00 ? 22  PHE A HB2  11 
ATOM   7158  H  HB3  . PHE A 1 22 ? -4.221  -8.802  4.619   1.00 0.00 ? 22  PHE A HB3  11 
ATOM   7159  H  HD1  . PHE A 1 22 ? -3.326  -11.092 3.680   1.00 0.00 ? 22  PHE A HD1  11 
ATOM   7160  H  HD2  . PHE A 1 22 ? -2.902  -9.785  7.709   1.00 0.00 ? 22  PHE A HD2  11 
ATOM   7161  H  HE1  . PHE A 1 22 ? -3.031  -13.425 4.403   1.00 0.00 ? 22  PHE A HE1  11 
ATOM   7162  H  HE2  . PHE A 1 22 ? -2.605  -12.116 8.437   1.00 0.00 ? 22  PHE A HE2  11 
ATOM   7163  H  HZ   . PHE A 1 22 ? -2.671  -13.940 6.784   1.00 0.00 ? 22  PHE A HZ   11 
ATOM   7164  N  N    . MET A 1 23 ? -3.135  -6.981  2.605   1.00 0.00 ? 23  MET A N    11 
ATOM   7165  C  CA   . MET A 1 23 ? -3.535  -5.750  1.935   1.00 0.00 ? 23  MET A CA   11 
ATOM   7166  C  C    . MET A 1 23 ? -4.945  -5.340  2.348   1.00 0.00 ? 23  MET A C    11 
ATOM   7167  O  O    . MET A 1 23 ? -5.887  -6.125  2.242   1.00 0.00 ? 23  MET A O    11 
ATOM   7168  C  CB   . MET A 1 23 ? -3.467  -5.924  0.417   1.00 0.00 ? 23  MET A CB   11 
ATOM   7169  C  CG   . MET A 1 23 ? -4.179  -7.169  -0.085  1.00 0.00 ? 23  MET A CG   11 
ATOM   7170  S  SD   . MET A 1 23 ? -4.821  -6.976  -1.759  1.00 0.00 ? 23  MET A SD   11 
ATOM   7171  C  CE   . MET A 1 23 ? -3.813  -8.161  -2.646  1.00 0.00 ? 23  MET A CE   11 
ATOM   7172  H  H    . MET A 1 23 ? -3.332  -7.842  2.180   1.00 0.00 ? 23  MET A H    11 
ATOM   7173  H  HA   . MET A 1 23 ? -2.846  -4.973  2.231   1.00 0.00 ? 23  MET A HA   11 
ATOM   7174  H  HB2  . MET A 1 23 ? -3.918  -5.063  -0.053  1.00 0.00 ? 23  MET A HB2  11 
ATOM   7175  H  HB3  . MET A 1 23 ? -2.430  -5.985  0.120   1.00 0.00 ? 23  MET A HB3  11 
ATOM   7176  H  HG2  . MET A 1 23 ? -3.484  -7.995  -0.075  1.00 0.00 ? 23  MET A HG2  11 
ATOM   7177  H  HG3  . MET A 1 23 ? -5.003  -7.387  0.579   1.00 0.00 ? 23  MET A HG3  11 
ATOM   7178  H  HE1  . MET A 1 23 ? -2.954  -7.659  -3.068  1.00 0.00 ? 23  MET A HE1  11 
ATOM   7179  H  HE2  . MET A 1 23 ? -3.482  -8.933  -1.967  1.00 0.00 ? 23  MET A HE2  11 
ATOM   7180  H  HE3  . MET A 1 23 ? -4.396  -8.606  -3.439  1.00 0.00 ? 23  MET A HE3  11 
ATOM   7181  N  N    . SER A 1 24 ? -5.083  -4.105  2.821   1.00 0.00 ? 24  SER A N    11 
ATOM   7182  C  CA   . SER A 1 24 ? -6.378  -3.592  3.254   1.00 0.00 ? 24  SER A CA   11 
ATOM   7183  C  C    . SER A 1 24 ? -7.276  -3.302  2.055   1.00 0.00 ? 24  SER A C    11 
ATOM   7184  O  O    . SER A 1 24 ? -6.874  -3.482  0.906   1.00 0.00 ? 24  SER A O    11 
ATOM   7185  C  CB   . SER A 1 24 ? -6.195  -2.323  4.088   1.00 0.00 ? 24  SER A CB   11 
ATOM   7186  O  OG   . SER A 1 24 ? -7.424  -1.902  4.654   1.00 0.00 ? 24  SER A OG   11 
ATOM   7187  H  H    . SER A 1 24 ? -4.295  -3.526  2.882   1.00 0.00 ? 24  SER A H    11 
ATOM   7188  H  HA   . SER A 1 24 ? -6.847  -4.350  3.865   1.00 0.00 ? 24  SER A HA   11 
ATOM   7189  H  HB2  . SER A 1 24 ? -5.493  -2.517  4.885   1.00 0.00 ? 24  SER A HB2  11 
ATOM   7190  H  HB3  . SER A 1 24 ? -5.813  -1.533  3.457   1.00 0.00 ? 24  SER A HB3  11 
ATOM   7191  H  HG   . SER A 1 24 ? -7.759  -1.146  4.166   1.00 0.00 ? 24  SER A HG   11 
ATOM   7192  N  N    . VAL A 1 25 ? -8.495  -2.851  2.333   1.00 0.00 ? 25  VAL A N    11 
ATOM   7193  C  CA   . VAL A 1 25 ? -9.451  -2.534  1.279   1.00 0.00 ? 25  VAL A CA   11 
ATOM   7194  C  C    . VAL A 1 25 ? -9.137  -1.186  0.639   1.00 0.00 ? 25  VAL A C    11 
ATOM   7195  O  O    . VAL A 1 25 ? -9.596  -0.889  -0.463  1.00 0.00 ? 25  VAL A O    11 
ATOM   7196  C  CB   . VAL A 1 25 ? -10.894 -2.510  1.818   1.00 0.00 ? 25  VAL A CB   11 
ATOM   7197  C  CG1  . VAL A 1 25 ? -11.878 -2.212  0.697   1.00 0.00 ? 25  VAL A CG1  11 
ATOM   7198  C  CG2  . VAL A 1 25 ? -11.230 -3.828  2.498   1.00 0.00 ? 25  VAL A CG2  11 
ATOM   7199  H  H    . VAL A 1 25 ? -8.758  -2.728  3.269   1.00 0.00 ? 25  VAL A H    11 
ATOM   7200  H  HA   . VAL A 1 25 ? -9.384  -3.304  0.524   1.00 0.00 ? 25  VAL A HA   11 
ATOM   7201  H  HB   . VAL A 1 25 ? -10.969 -1.721  2.552   1.00 0.00 ? 25  VAL A HB   11 
ATOM   7202  H  HG11 . VAL A 1 25 ? -12.887 -2.334  1.063   1.00 0.00 ? 25  VAL A HG11 11 
ATOM   7203  H  HG12 . VAL A 1 25 ? -11.738 -1.197  0.355   1.00 0.00 ? 25  VAL A HG12 11 
ATOM   7204  H  HG13 . VAL A 1 25 ? -11.708 -2.895  -0.122  1.00 0.00 ? 25  VAL A HG13 11 
ATOM   7205  H  HG21 . VAL A 1 25 ? -10.609 -4.612  2.092   1.00 0.00 ? 25  VAL A HG21 11 
ATOM   7206  H  HG22 . VAL A 1 25 ? -11.053 -3.740  3.559   1.00 0.00 ? 25  VAL A HG22 11 
ATOM   7207  H  HG23 . VAL A 1 25 ? -12.270 -4.068  2.325   1.00 0.00 ? 25  VAL A HG23 11 
ATOM   7208  N  N    . ASN A 1 26 ? -8.350  -0.375  1.338   1.00 0.00 ? 26  ASN A N    11 
ATOM   7209  C  CA   . ASN A 1 26 ? -7.973  0.943   0.838   1.00 0.00 ? 26  ASN A CA   11 
ATOM   7210  C  C    . ASN A 1 26 ? -6.503  0.970   0.432   1.00 0.00 ? 26  ASN A C    11 
ATOM   7211  O  O    . ASN A 1 26 ? -6.024  1.949   -0.142  1.00 0.00 ? 26  ASN A O    11 
ATOM   7212  C  CB   . ASN A 1 26 ? -8.241  2.010   1.901   1.00 0.00 ? 26  ASN A CB   11 
ATOM   7213  C  CG   . ASN A 1 26 ? -8.304  3.407   1.314   1.00 0.00 ? 26  ASN A CG   11 
ATOM   7214  O  OD1  . ASN A 1 26 ? -8.997  3.646   0.325   1.00 0.00 ? 26  ASN A OD1  11 
ATOM   7215  N  ND2  . ASN A 1 26 ? -7.579  4.338   1.923   1.00 0.00 ? 26  ASN A ND2  11 
ATOM   7216  H  H    . ASN A 1 26 ? -8.015  -0.668  2.211   1.00 0.00 ? 26  ASN A H    11 
ATOM   7217  H  HA   . ASN A 1 26 ? -8.579  1.153   -0.031  1.00 0.00 ? 26  ASN A HA   11 
ATOM   7218  H  HB2  . ASN A 1 26 ? -9.184  1.800   2.383   1.00 0.00 ? 26  ASN A HB2  11 
ATOM   7219  H  HB3  . ASN A 1 26 ? -7.451  1.983   2.636   1.00 0.00 ? 26  ASN A HB3  11 
ATOM   7220  H  HD21 . ASN A 1 26 ? -7.051  4.075   2.706   1.00 0.00 ? 26  ASN A HD21 11 
ATOM   7221  H  HD22 . ASN A 1 26 ? -7.602  5.250   1.565   1.00 0.00 ? 26  ASN A HD22 11 
ATOM   7222  N  N    . THR A 1 27 ? -5.791  -0.111  0.733   1.00 0.00 ? 27  THR A N    11 
ATOM   7223  C  CA   . THR A 1 27 ? -4.376  -0.212  0.400   1.00 0.00 ? 27  THR A CA   11 
ATOM   7224  C  C    . THR A 1 27 ? -4.150  -1.174  -0.760  1.00 0.00 ? 27  THR A C    11 
ATOM   7225  O  O    . THR A 1 27 ? -3.128  -1.110  -1.442  1.00 0.00 ? 27  THR A O    11 
ATOM   7226  C  CB   . THR A 1 27 ? -3.546  -0.681  1.610   1.00 0.00 ? 27  THR A CB   11 
ATOM   7227  O  OG1  . THR A 1 27 ? -3.916  -2.016  1.970   1.00 0.00 ? 27  THR A OG1  11 
ATOM   7228  C  CG2  . THR A 1 27 ? -3.752  0.246   2.799   1.00 0.00 ? 27  THR A CG2  11 
ATOM   7229  H  H    . THR A 1 27 ? -6.229  -0.859  1.190   1.00 0.00 ? 27  THR A H    11 
ATOM   7230  H  HA   . THR A 1 27 ? -4.030  0.771   0.112   1.00 0.00 ? 27  THR A HA   11 
ATOM   7231  H  HB   . THR A 1 27 ? -2.500  -0.666  1.338   1.00 0.00 ? 27  THR A HB   11 
ATOM   7232  H  HG1  . THR A 1 27 ? -3.720  -2.610  1.241   1.00 0.00 ? 27  THR A HG1  11 
ATOM   7233  H  HG21 . THR A 1 27 ? -3.263  -0.170  3.667   1.00 0.00 ? 27  THR A HG21 11 
ATOM   7234  H  HG22 . THR A 1 27 ? -4.809  0.349   2.996   1.00 0.00 ? 27  THR A HG22 11 
ATOM   7235  H  HG23 . THR A 1 27 ? -3.330  1.215   2.578   1.00 0.00 ? 27  THR A HG23 11 
ATOM   7236  N  N    . GLN A 1 28 ? -5.112  -2.065  -0.979  1.00 0.00 ? 28  GLN A N    11 
ATOM   7237  C  CA   . GLN A 1 28 ? -5.017  -3.042  -2.058  1.00 0.00 ? 28  GLN A CA   11 
ATOM   7238  C  C    . GLN A 1 28 ? -4.722  -2.356  -3.388  1.00 0.00 ? 28  GLN A C    11 
ATOM   7239  O  O    . GLN A 1 28 ? -5.084  -1.201  -3.613  1.00 0.00 ? 28  GLN A O    11 
ATOM   7240  C  CB   . GLN A 1 28 ? -6.314  -3.846  -2.162  1.00 0.00 ? 28  GLN A CB   11 
ATOM   7241  C  CG   . GLN A 1 28 ? -7.460  -3.073  -2.794  1.00 0.00 ? 28  GLN A CG   11 
ATOM   7242  C  CD   . GLN A 1 28 ? -8.641  -3.959  -3.139  1.00 0.00 ? 28  GLN A CD   11 
ATOM   7243  O  OE1  . GLN A 1 28 ? -9.022  -4.080  -4.304  1.00 0.00 ? 28  GLN A OE1  11 
ATOM   7244  N  NE2  . GLN A 1 28 ? -9.228  -4.586  -2.126  1.00 0.00 ? 28  GLN A NE2  11 
ATOM   7245  H  H    . GLN A 1 28 ? -5.903  -2.067  -0.401  1.00 0.00 ? 28  GLN A H    11 
ATOM   7246  H  HA   . GLN A 1 28 ? -4.205  -3.714  -1.826  1.00 0.00 ? 28  GLN A HA   11 
ATOM   7247  H  HB2  . GLN A 1 28 ? -6.130  -4.728  -2.757  1.00 0.00 ? 28  GLN A HB2  11 
ATOM   7248  H  HB3  . GLN A 1 28 ? -6.617  -4.148  -1.170  1.00 0.00 ? 28  GLN A HB3  11 
ATOM   7249  H  HG2  . GLN A 1 28 ? -7.791  -2.313  -2.102  1.00 0.00 ? 28  GLN A HG2  11 
ATOM   7250  H  HG3  . GLN A 1 28 ? -7.104  -2.604  -3.699  1.00 0.00 ? 28  GLN A HG3  11 
ATOM   7251  H  HE21 . GLN A 1 28 ? -8.871  -4.441  -1.224  1.00 0.00 ? 28  GLN A HE21 11 
ATOM   7252  H  HE22 . GLN A 1 28 ? -9.993  -5.164  -2.320  1.00 0.00 ? 28  GLN A HE22 11 
ATOM   7253  N  N    . PRO A 1 29 ? -4.048  -3.083  -4.292  1.00 0.00 ? 29  PRO A N    11 
ATOM   7254  C  CA   . PRO A 1 29 ? -3.611  -4.458  -4.035  1.00 0.00 ? 29  PRO A CA   11 
ATOM   7255  C  C    . PRO A 1 29 ? -2.493  -4.527  -3.000  1.00 0.00 ? 29  PRO A C    11 
ATOM   7256  O  O    . PRO A 1 29 ? -2.177  -5.600  -2.484  1.00 0.00 ? 29  PRO A O    11 
ATOM   7257  C  CB   . PRO A 1 29 ? -3.106  -4.930  -5.400  1.00 0.00 ? 29  PRO A CB   11 
ATOM   7258  C  CG   . PRO A 1 29 ? -2.712  -3.682  -6.111  1.00 0.00 ? 29  PRO A CG   11 
ATOM   7259  C  CD   . PRO A 1 29 ? -3.660  -2.617  -5.634  1.00 0.00 ? 29  PRO A CD   11 
ATOM   7260  H  HA   . PRO A 1 29 ? -4.433  -5.083  -3.717  1.00 0.00 ? 29  PRO A HA   11 
ATOM   7261  H  HB2  . PRO A 1 29 ? -2.262  -5.592  -5.266  1.00 0.00 ? 29  PRO A HB2  11 
ATOM   7262  H  HB3  . PRO A 1 29 ? -3.897  -5.448  -5.921  1.00 0.00 ? 29  PRO A HB3  11 
ATOM   7263  H  HG2  . PRO A 1 29 ? -1.696  -3.420  -5.859  1.00 0.00 ? 29  PRO A HG2  11 
ATOM   7264  H  HG3  . PRO A 1 29 ? -2.811  -3.820  -7.178  1.00 0.00 ? 29  PRO A HG3  11 
ATOM   7265  H  HD2  . PRO A 1 29 ? -3.159  -1.662  -5.580  1.00 0.00 ? 29  PRO A HD2  11 
ATOM   7266  H  HD3  . PRO A 1 29 ? -4.520  -2.558  -6.284  1.00 0.00 ? 29  PRO A HD3  11 
ATOM   7267  N  N    . LEU A 1 30 ? -1.897  -3.378  -2.702  1.00 0.00 ? 30  LEU A N    11 
ATOM   7268  C  CA   . LEU A 1 30 ? -0.814  -3.308  -1.728  1.00 0.00 ? 30  LEU A CA   11 
ATOM   7269  C  C    . LEU A 1 30 ? -1.363  -3.188  -0.310  1.00 0.00 ? 30  LEU A C    11 
ATOM   7270  O  O    . LEU A 1 30 ? -2.572  -3.068  -0.109  1.00 0.00 ? 30  LEU A O    11 
ATOM   7271  C  CB   . LEU A 1 30 ? 0.100   -2.120  -2.035  1.00 0.00 ? 30  LEU A CB   11 
ATOM   7272  C  CG   . LEU A 1 30 ? 1.017   -2.276  -3.249  1.00 0.00 ? 30  LEU A CG   11 
ATOM   7273  C  CD1  . LEU A 1 30 ? 1.714   -0.961  -3.563  1.00 0.00 ? 30  LEU A CD1  11 
ATOM   7274  C  CD2  . LEU A 1 30 ? 2.037   -3.379  -3.010  1.00 0.00 ? 30  LEU A CD2  11 
ATOM   7275  H  H    . LEU A 1 30 ? -2.192  -2.557  -3.146  1.00 0.00 ? 30  LEU A H    11 
ATOM   7276  H  HA   . LEU A 1 30 ? -0.241  -4.221  -1.803  1.00 0.00 ? 30  LEU A HA   11 
ATOM   7277  H  HB2  . LEU A 1 30 ? -0.526  -1.257  -2.202  1.00 0.00 ? 30  LEU A HB2  11 
ATOM   7278  H  HB3  . LEU A 1 30 ? 0.723   -1.950  -1.169  1.00 0.00 ? 30  LEU A HB3  11 
ATOM   7279  H  HG   . LEU A 1 30 ? 0.421   -2.550  -4.109  1.00 0.00 ? 30  LEU A HG   11 
ATOM   7280  H  HD11 . LEU A 1 30 ? 1.333   -0.564  -4.491  1.00 0.00 ? 30  LEU A HD11 11 
ATOM   7281  H  HD12 . LEU A 1 30 ? 2.777   -1.130  -3.652  1.00 0.00 ? 30  LEU A HD12 11 
ATOM   7282  H  HD13 . LEU A 1 30 ? 1.529   -0.256  -2.765  1.00 0.00 ? 30  LEU A HD13 11 
ATOM   7283  H  HD21 . LEU A 1 30 ? 1.746   -3.957  -2.145  1.00 0.00 ? 30  LEU A HD21 11 
ATOM   7284  H  HD22 . LEU A 1 30 ? 3.008   -2.940  -2.839  1.00 0.00 ? 30  LEU A HD22 11 
ATOM   7285  H  HD23 . LEU A 1 30 ? 2.080   -4.023  -3.876  1.00 0.00 ? 30  LEU A HD23 11 
ATOM   7286  N  N    . CYS A 1 31 ? -0.467  -3.219  0.671   1.00 0.00 ? 31  CYS A N    11 
ATOM   7287  C  CA   . CYS A 1 31 ? -0.861  -3.111  2.071   1.00 0.00 ? 31  CYS A CA   11 
ATOM   7288  C  C    . CYS A 1 31 ? -0.450  -1.760  2.649   1.00 0.00 ? 31  CYS A C    11 
ATOM   7289  O  O    . CYS A 1 31 ? 0.544   -1.168  2.228   1.00 0.00 ? 31  CYS A O    11 
ATOM   7290  C  CB   . CYS A 1 31 ? -0.230  -4.241  2.888   1.00 0.00 ? 31  CYS A CB   11 
ATOM   7291  S  SG   . CYS A 1 31 ? 1.553   -4.029  3.197   1.00 0.00 ? 31  CYS A SG   11 
ATOM   7292  H  H    . CYS A 1 31 ? 0.483   -3.317  0.448   1.00 0.00 ? 31  CYS A H    11 
ATOM   7293  H  HA   . CYS A 1 31 ? -1.935  -3.199  2.121   1.00 0.00 ? 31  CYS A HA   11 
ATOM   7294  H  HB2  . CYS A 1 31 ? -0.724  -4.300  3.847   1.00 0.00 ? 31  CYS A HB2  11 
ATOM   7295  H  HB3  . CYS A 1 31 ? -0.364  -5.174  2.361   1.00 0.00 ? 31  CYS A HB3  11 
ATOM   7296  N  N    . HIS A 1 32 ? -1.223  -1.278  3.617   1.00 0.00 ? 32  HIS A N    11 
ATOM   7297  C  CA   . HIS A 1 32 ? -0.940  0.003   4.255   1.00 0.00 ? 32  HIS A CA   11 
ATOM   7298  C  C    . HIS A 1 32 ? 0.565   0.232   4.370   1.00 0.00 ? 32  HIS A C    11 
ATOM   7299  O  O    . HIS A 1 32 ? 1.068   1.297   4.014   1.00 0.00 ? 32  HIS A O    11 
ATOM   7300  C  CB   . HIS A 1 32 ? -1.583  0.061   5.640   1.00 0.00 ? 32  HIS A CB   11 
ATOM   7301  C  CG   . HIS A 1 32 ? -0.940  -0.853  6.638   1.00 0.00 ? 32  HIS A CG   11 
ATOM   7302  N  ND1  . HIS A 1 32 ? -0.396  -0.408  7.824   1.00 0.00 ? 32  HIS A ND1  11 
ATOM   7303  C  CD2  . HIS A 1 32 ? -0.758  -2.194  6.621   1.00 0.00 ? 32  HIS A CD2  11 
ATOM   7304  C  CE1  . HIS A 1 32 ? 0.095   -1.436  8.493   1.00 0.00 ? 32  HIS A CE1  11 
ATOM   7305  N  NE2  . HIS A 1 32 ? -0.113  -2.532  7.785   1.00 0.00 ? 32  HIS A NE2  11 
ATOM   7306  H  H    . HIS A 1 32 ? -2.001  -1.796  3.910   1.00 0.00 ? 32  HIS A H    11 
ATOM   7307  H  HA   . HIS A 1 32 ? -1.363  0.781   3.638   1.00 0.00 ? 32  HIS A HA   11 
ATOM   7308  H  HB2  . HIS A 1 32 ? -1.513  1.069   6.021   1.00 0.00 ? 32  HIS A HB2  11 
ATOM   7309  H  HB3  . HIS A 1 32 ? -2.625  -0.216  5.558   1.00 0.00 ? 32  HIS A HB3  11 
ATOM   7310  H  HD1  . HIS A 1 32 ? -0.372  0.522   8.129   1.00 0.00 ? 32  HIS A HD1  11 
ATOM   7311  H  HD2  . HIS A 1 32 ? -1.063  -2.873  5.838   1.00 0.00 ? 32  HIS A HD2  11 
ATOM   7312  H  HE1  . HIS A 1 32 ? 0.582   -1.390  9.456   1.00 0.00 ? 32  HIS A HE1  11 
ATOM   7313  N  N    . GLU A 1 33 ? 1.275   -0.774  4.869   1.00 0.00 ? 33  GLU A N    11 
ATOM   7314  C  CA   . GLU A 1 33 ? 2.721   -0.681  5.032   1.00 0.00 ? 33  GLU A CA   11 
ATOM   7315  C  C    . GLU A 1 33 ? 3.394   -0.304  3.715   1.00 0.00 ? 33  GLU A C    11 
ATOM   7316  O  O    . GLU A 1 33 ? 4.301   0.529   3.684   1.00 0.00 ? 33  GLU A O    11 
ATOM   7317  C  CB   . GLU A 1 33 ? 3.286   -2.007  5.544   1.00 0.00 ? 33  GLU A CB   11 
ATOM   7318  C  CG   . GLU A 1 33 ? 3.368   -2.089  7.059   1.00 0.00 ? 33  GLU A CG   11 
ATOM   7319  C  CD   . GLU A 1 33 ? 4.490   -1.244  7.629   1.00 0.00 ? 33  GLU A CD   11 
ATOM   7320  O  OE1  . GLU A 1 33 ? 4.459   -0.010  7.441   1.00 0.00 ? 33  GLU A OE1  11 
ATOM   7321  O  OE2  . GLU A 1 33 ? 5.401   -1.817  8.264   1.00 0.00 ? 33  GLU A OE2  11 
ATOM   7322  H  H    . GLU A 1 33 ? 0.816   -1.598  5.135   1.00 0.00 ? 33  GLU A H    11 
ATOM   7323  H  HA   . GLU A 1 33 ? 2.924   0.091   5.759   1.00 0.00 ? 33  GLU A HA   11 
ATOM   7324  H  HB2  . GLU A 1 33 ? 2.656   -2.812  5.194   1.00 0.00 ? 33  GLU A HB2  11 
ATOM   7325  H  HB3  . GLU A 1 33 ? 4.280   -2.140  5.143   1.00 0.00 ? 33  GLU A HB3  11 
ATOM   7326  H  HG2  . GLU A 1 33 ? 2.433   -1.747  7.477   1.00 0.00 ? 33  GLU A HG2  11 
ATOM   7327  H  HG3  . GLU A 1 33 ? 3.533   -3.118  7.343   1.00 0.00 ? 33  GLU A HG3  11 
ATOM   7328  N  N    . CYS A 1 34 ? 2.943   -0.923  2.629   1.00 0.00 ? 34  CYS A N    11 
ATOM   7329  C  CA   . CYS A 1 34 ? 3.500   -0.655  1.309   1.00 0.00 ? 34  CYS A CA   11 
ATOM   7330  C  C    . CYS A 1 34 ? 2.909   0.622   0.718   1.00 0.00 ? 34  CYS A C    11 
ATOM   7331  O  O    . CYS A 1 34 ? 3.635   1.558   0.384   1.00 0.00 ? 34  CYS A O    11 
ATOM   7332  C  CB   . CYS A 1 34 ? 3.235   -1.834  0.371   1.00 0.00 ? 34  CYS A CB   11 
ATOM   7333  S  SG   . CYS A 1 34 ? 4.191   -3.332  0.773   1.00 0.00 ? 34  CYS A SG   11 
ATOM   7334  H  H    . CYS A 1 34 ? 2.217   -1.577  2.717   1.00 0.00 ? 34  CYS A H    11 
ATOM   7335  H  HA   . CYS A 1 34 ? 4.566   -0.525  1.418   1.00 0.00 ? 34  CYS A HA   11 
ATOM   7336  H  HB2  . CYS A 1 34 ? 2.187   -2.092  0.417   1.00 0.00 ? 34  CYS A HB2  11 
ATOM   7337  H  HB3  . CYS A 1 34 ? 3.485   -1.545  -0.639  1.00 0.00 ? 34  CYS A HB3  11 
ATOM   7338  N  N    . SER A 1 35 ? 1.586   0.652   0.592   1.00 0.00 ? 35  SER A N    11 
ATOM   7339  C  CA   . SER A 1 35 ? 0.896   1.811   0.038   1.00 0.00 ? 35  SER A CA   11 
ATOM   7340  C  C    . SER A 1 35 ? 1.628   3.101   0.397   1.00 0.00 ? 35  SER A C    11 
ATOM   7341  O  O    . SER A 1 35 ? 1.951   3.906   -0.476  1.00 0.00 ? 35  SER A O    11 
ATOM   7342  C  CB   . SER A 1 35 ? -0.543  1.869   0.553   1.00 0.00 ? 35  SER A CB   11 
ATOM   7343  O  OG   . SER A 1 35 ? -1.105  3.154   0.354   1.00 0.00 ? 35  SER A OG   11 
ATOM   7344  H  H    . SER A 1 35 ? 1.061   -0.126  0.876   1.00 0.00 ? 35  SER A H    11 
ATOM   7345  H  HA   . SER A 1 35 ? 0.882   1.706   -1.036  1.00 0.00 ? 35  SER A HA   11 
ATOM   7346  H  HB2  . SER A 1 35 ? -1.141  1.142   0.024   1.00 0.00 ? 35  SER A HB2  11 
ATOM   7347  H  HB3  . SER A 1 35 ? -0.554  1.644   1.609   1.00 0.00 ? 35  SER A HB3  11 
ATOM   7348  H  HG   . SER A 1 35 ? -1.415  3.232   -0.552  1.00 0.00 ? 35  SER A HG   11 
ATOM   7349  N  N    . GLU A 1 36 ? 1.887   3.288   1.687   1.00 0.00 ? 36  GLU A N    11 
ATOM   7350  C  CA   . GLU A 1 36 ? 2.580   4.480   2.161   1.00 0.00 ? 36  GLU A CA   11 
ATOM   7351  C  C    . GLU A 1 36 ? 3.914   4.657   1.441   1.00 0.00 ? 36  GLU A C    11 
ATOM   7352  O  O    . GLU A 1 36 ? 4.254   5.756   1.004   1.00 0.00 ? 36  GLU A O    11 
ATOM   7353  C  CB   . GLU A 1 36 ? 2.810   4.396   3.672   1.00 0.00 ? 36  GLU A CB   11 
ATOM   7354  C  CG   . GLU A 1 36 ? 3.606   3.174   4.099   1.00 0.00 ? 36  GLU A CG   11 
ATOM   7355  C  CD   . GLU A 1 36 ? 3.949   3.189   5.576   1.00 0.00 ? 36  GLU A CD   11 
ATOM   7356  O  OE1  . GLU A 1 36 ? 3.021   3.333   6.399   1.00 0.00 ? 36  GLU A OE1  11 
ATOM   7357  O  OE2  . GLU A 1 36 ? 5.145   3.056   5.909   1.00 0.00 ? 36  GLU A OE2  11 
ATOM   7358  H  H    . GLU A 1 36 ? 1.604   2.609   2.335   1.00 0.00 ? 36  GLU A H    11 
ATOM   7359  H  HA   . GLU A 1 36 ? 1.955   5.334   1.949   1.00 0.00 ? 36  GLU A HA   11 
ATOM   7360  H  HB2  . GLU A 1 36 ? 3.345   5.278   3.992   1.00 0.00 ? 36  GLU A HB2  11 
ATOM   7361  H  HB3  . GLU A 1 36 ? 1.852   4.367   4.168   1.00 0.00 ? 36  GLU A HB3  11 
ATOM   7362  H  HG2  . GLU A 1 36 ? 3.023   2.290   3.890   1.00 0.00 ? 36  GLU A HG2  11 
ATOM   7363  H  HG3  . GLU A 1 36 ? 4.524   3.141   3.531   1.00 0.00 ? 36  GLU A HG3  11 
ATOM   7364  N  N    . ARG A 1 37 ? 4.664   3.566   1.323   1.00 0.00 ? 37  ARG A N    11 
ATOM   7365  C  CA   . ARG A 1 37 ? 5.962   3.600   0.659   1.00 0.00 ? 37  ARG A CA   11 
ATOM   7366  C  C    . ARG A 1 37 ? 5.827   4.120   -0.770  1.00 0.00 ? 37  ARG A C    11 
ATOM   7367  O  O    . ARG A 1 37 ? 6.576   5.001   -1.193  1.00 0.00 ? 37  ARG A O    11 
ATOM   7368  C  CB   . ARG A 1 37 ? 6.589   2.205   0.648   1.00 0.00 ? 37  ARG A CB   11 
ATOM   7369  C  CG   . ARG A 1 37 ? 7.531   1.952   1.814   1.00 0.00 ? 37  ARG A CG   11 
ATOM   7370  C  CD   . ARG A 1 37 ? 6.808   1.297   2.981   1.00 0.00 ? 37  ARG A CD   11 
ATOM   7371  N  NE   . ARG A 1 37 ? 7.740   0.777   3.979   1.00 0.00 ? 37  ARG A NE   11 
ATOM   7372  C  CZ   . ARG A 1 37 ? 8.439   1.548   4.803   1.00 0.00 ? 37  ARG A CZ   11 
ATOM   7373  N  NH1  . ARG A 1 37 ? 8.314   2.867   4.750   1.00 0.00 ? 37  ARG A NH1  11 
ATOM   7374  N  NH2  . ARG A 1 37 ? 9.267   1.000   5.684   1.00 0.00 ? 37  ARG A NH2  11 
ATOM   7375  H  H    . ARG A 1 37 ? 4.339   2.719   1.693   1.00 0.00 ? 37  ARG A H    11 
ATOM   7376  H  HA   . ARG A 1 37 ? 6.602   4.269   1.214   1.00 0.00 ? 37  ARG A HA   11 
ATOM   7377  H  HB2  . ARG A 1 37 ? 5.801   1.468   0.684   1.00 0.00 ? 37  ARG A HB2  11 
ATOM   7378  H  HB3  . ARG A 1 37 ? 7.145   2.081   -0.269  1.00 0.00 ? 37  ARG A HB3  11 
ATOM   7379  H  HG2  . ARG A 1 37 ? 8.327   1.300   1.487   1.00 0.00 ? 37  ARG A HG2  11 
ATOM   7380  H  HG3  . ARG A 1 37 ? 7.945   2.894   2.141   1.00 0.00 ? 37  ARG A HG3  11 
ATOM   7381  H  HD2  . ARG A 1 37 ? 6.169   2.030   3.448   1.00 0.00 ? 37  ARG A HD2  11 
ATOM   7382  H  HD3  . ARG A 1 37 ? 6.208   0.483   2.604   1.00 0.00 ? 37  ARG A HD3  11 
ATOM   7383  H  HE   . ARG A 1 37 ? 7.848   -0.195  4.035   1.00 0.00 ? 37  ARG A HE   11 
ATOM   7384  H  HH11 . ARG A 1 37 ? 7.690   3.282   4.088   1.00 0.00 ? 37  ARG A HH11 11 
ATOM   7385  H  HH12 . ARG A 1 37 ? 8.841   3.445   5.373   1.00 0.00 ? 37  ARG A HH12 11 
ATOM   7386  H  HH21 . ARG A 1 37 ? 9.364   0.006   5.728   1.00 0.00 ? 37  ARG A HH21 11 
ATOM   7387  H  HH22 . ARG A 1 37 ? 9.793   1.581   6.304   1.00 0.00 ? 37  ARG A HH22 11 
ATOM   7388  N  N    . ARG A 1 38 ? 4.869   3.568   -1.507  1.00 0.00 ? 38  ARG A N    11 
ATOM   7389  C  CA   . ARG A 1 38 ? 4.638   3.975   -2.888  1.00 0.00 ? 38  ARG A CA   11 
ATOM   7390  C  C    . ARG A 1 38 ? 4.071   5.390   -2.950  1.00 0.00 ? 38  ARG A C    11 
ATOM   7391  O  O    . ARG A 1 38 ? 4.306   6.121   -3.911  1.00 0.00 ? 38  ARG A O    11 
ATOM   7392  C  CB   . ARG A 1 38 ? 3.681   3.000   -3.576  1.00 0.00 ? 38  ARG A CB   11 
ATOM   7393  C  CG   . ARG A 1 38 ? 3.799   2.998   -5.091  1.00 0.00 ? 38  ARG A CG   11 
ATOM   7394  C  CD   . ARG A 1 38 ? 4.810   1.967   -5.569  1.00 0.00 ? 38  ARG A CD   11 
ATOM   7395  N  NE   . ARG A 1 38 ? 5.420   2.347   -6.841  1.00 0.00 ? 38  ARG A NE   11 
ATOM   7396  C  CZ   . ARG A 1 38 ? 6.470   3.154   -6.940  1.00 0.00 ? 38  ARG A CZ   11 
ATOM   7397  N  NH1  . ARG A 1 38 ? 7.026   3.662   -5.849  1.00 0.00 ? 38  ARG A NH1  11 
ATOM   7398  N  NH2  . ARG A 1 38 ? 6.968   3.453   -8.133  1.00 0.00 ? 38  ARG A NH2  11 
ATOM   7399  H  H    . ARG A 1 38 ? 4.304   2.871   -1.113  1.00 0.00 ? 38  ARG A H    11 
ATOM   7400  H  HA   . ARG A 1 38 ? 5.587   3.958   -3.402  1.00 0.00 ? 38  ARG A HA   11 
ATOM   7401  H  HB2  . ARG A 1 38 ? 3.885   2.001   -3.219  1.00 0.00 ? 38  ARG A HB2  11 
ATOM   7402  H  HB3  . ARG A 1 38 ? 2.667   3.266   -3.316  1.00 0.00 ? 38  ARG A HB3  11 
ATOM   7403  H  HG2  . ARG A 1 38 ? 2.835   2.764   -5.518  1.00 0.00 ? 38  ARG A HG2  11 
ATOM   7404  H  HG3  . ARG A 1 38 ? 4.113   3.977   -5.420  1.00 0.00 ? 38  ARG A HG3  11 
ATOM   7405  H  HD2  . ARG A 1 38 ? 5.586   1.871   -4.824  1.00 0.00 ? 38  ARG A HD2  11 
ATOM   7406  H  HD3  . ARG A 1 38 ? 4.308   1.019   -5.690  1.00 0.00 ? 38  ARG A HD3  11 
ATOM   7407  H  HE   . ARG A 1 38 ? 5.025   1.983   -7.660  1.00 0.00 ? 38  ARG A HE   11 
ATOM   7408  H  HH11 . ARG A 1 38 ? 6.653   3.438   -4.948  1.00 0.00 ? 38  ARG A HH11 11 
ATOM   7409  H  HH12 . ARG A 1 38 ? 7.817   4.269   -5.926  1.00 0.00 ? 38  ARG A HH12 11 
ATOM   7410  H  HH21 . ARG A 1 38 ? 6.552   3.071   -8.958  1.00 0.00 ? 38  ARG A HH21 11 
ATOM   7411  H  HH22 . ARG A 1 38 ? 7.758   4.060   -8.207  1.00 0.00 ? 38  ARG A HH22 11 
ATOM   7412  N  N    . GLN A 1 39 ? 3.323   5.769   -1.918  1.00 0.00 ? 39  GLN A N    11 
ATOM   7413  C  CA   . GLN A 1 39 ? 2.721   7.095   -1.857  1.00 0.00 ? 39  GLN A CA   11 
ATOM   7414  C  C    . GLN A 1 39 ? 3.769   8.154   -1.530  1.00 0.00 ? 39  GLN A C    11 
ATOM   7415  O  O    . GLN A 1 39 ? 4.078   9.013   -2.355  1.00 0.00 ? 39  GLN A O    11 
ATOM   7416  C  CB   . GLN A 1 39 ? 1.606   7.125   -0.810  1.00 0.00 ? 39  GLN A CB   11 
ATOM   7417  C  CG   . GLN A 1 39 ? 1.289   8.521   -0.298  1.00 0.00 ? 39  GLN A CG   11 
ATOM   7418  C  CD   . GLN A 1 39 ? 0.365   8.506   0.903   1.00 0.00 ? 39  GLN A CD   11 
ATOM   7419  O  OE1  . GLN A 1 39 ? -0.597  7.737   0.952   1.00 0.00 ? 39  GLN A OE1  11 
ATOM   7420  N  NE2  . GLN A 1 39 ? 0.651   9.356   1.882   1.00 0.00 ? 39  GLN A NE2  11 
ATOM   7421  H  H    . GLN A 1 39 ? 3.172   5.141   -1.182  1.00 0.00 ? 39  GLN A H    11 
ATOM   7422  H  HA   . GLN A 1 39 ? 2.299   7.313   -2.826  1.00 0.00 ? 39  GLN A HA   11 
ATOM   7423  H  HB2  . GLN A 1 39 ? 0.708   6.712   -1.246  1.00 0.00 ? 39  GLN A HB2  11 
ATOM   7424  H  HB3  . GLN A 1 39 ? 1.901   6.515   0.031   1.00 0.00 ? 39  GLN A HB3  11 
ATOM   7425  H  HG2  . GLN A 1 39 ? 2.212   9.005   -0.016  1.00 0.00 ? 39  GLN A HG2  11 
ATOM   7426  H  HG3  . GLN A 1 39 ? 0.817   9.082   -1.091  1.00 0.00 ? 39  GLN A HG3  11 
ATOM   7427  H  HE21 . GLN A 1 39 ? 1.432   9.939   1.773   1.00 0.00 ? 39  GLN A HE21 11 
ATOM   7428  H  HE22 . GLN A 1 39 ? 0.070   9.369   2.669   1.00 0.00 ? 39  GLN A HE22 11 
ATOM   7429  N  N    . LYS A 1 40 ? 4.314   8.086   -0.320  1.00 0.00 ? 40  LYS A N    11 
ATOM   7430  C  CA   . LYS A 1 40 ? 5.329   9.037   0.117   1.00 0.00 ? 40  LYS A CA   11 
ATOM   7431  C  C    . LYS A 1 40 ? 6.267   9.398   -1.030  1.00 0.00 ? 40  LYS A C    11 
ATOM   7432  O  O    . LYS A 1 40 ? 6.639   10.558  -1.198  1.00 0.00 ? 40  LYS A O    11 
ATOM   7433  C  CB   . LYS A 1 40 ? 6.133   8.457   1.283   1.00 0.00 ? 40  LYS A CB   11 
ATOM   7434  C  CG   . LYS A 1 40 ? 6.985   7.259   0.899   1.00 0.00 ? 40  LYS A CG   11 
ATOM   7435  C  CD   . LYS A 1 40 ? 7.536   6.551   2.125   1.00 0.00 ? 40  LYS A CD   11 
ATOM   7436  C  CE   . LYS A 1 40 ? 8.852   5.852   1.819   1.00 0.00 ? 40  LYS A CE   11 
ATOM   7437  N  NZ   . LYS A 1 40 ? 9.930   6.822   1.482   1.00 0.00 ? 40  LYS A NZ   11 
ATOM   7438  H  H    . LYS A 1 40 ? 4.027   7.377   0.294   1.00 0.00 ? 40  LYS A H    11 
ATOM   7439  H  HA   . LYS A 1 40 ? 4.824   9.931   0.449   1.00 0.00 ? 40  LYS A HA   11 
ATOM   7440  H  HB2  . LYS A 1 40 ? 6.784   9.225   1.674   1.00 0.00 ? 40  LYS A HB2  11 
ATOM   7441  H  HB3  . LYS A 1 40 ? 5.447   8.149   2.060   1.00 0.00 ? 40  LYS A HB3  11 
ATOM   7442  H  HG2  . LYS A 1 40 ? 6.379   6.564   0.336   1.00 0.00 ? 40  LYS A HG2  11 
ATOM   7443  H  HG3  . LYS A 1 40 ? 7.810   7.598   0.288   1.00 0.00 ? 40  LYS A HG3  11 
ATOM   7444  H  HD2  . LYS A 1 40 ? 7.701   7.277   2.906   1.00 0.00 ? 40  LYS A HD2  11 
ATOM   7445  H  HD3  . LYS A 1 40 ? 6.818   5.816   2.459   1.00 0.00 ? 40  LYS A HD3  11 
ATOM   7446  H  HE2  . LYS A 1 40 ? 9.152   5.282   2.685   1.00 0.00 ? 40  LYS A HE2  11 
ATOM   7447  H  HE3  . LYS A 1 40 ? 8.705   5.185   0.983   1.00 0.00 ? 40  LYS A HE3  11 
ATOM   7448  H  HZ1  . LYS A 1 40 ? 10.409  6.535   0.605   1.00 0.00 ? 40  LYS A HZ1  11 
ATOM   7449  H  HZ2  . LYS A 1 40 ? 10.631  6.860   2.250   1.00 0.00 ? 40  LYS A HZ2  11 
ATOM   7450  H  HZ3  . LYS A 1 40 ? 9.528   7.772   1.349   1.00 0.00 ? 40  LYS A HZ3  11 
ATOM   7451  N  N    . ASN A 1 41 ? 6.644   8.396   -1.818  1.00 0.00 ? 41  ASN A N    11 
ATOM   7452  C  CA   . ASN A 1 41 ? 7.537   8.609   -2.951  1.00 0.00 ? 41  ASN A CA   11 
ATOM   7453  C  C    . ASN A 1 41 ? 7.245   9.943   -3.631  1.00 0.00 ? 41  ASN A C    11 
ATOM   7454  O  O    . ASN A 1 41 ? 8.103   10.824  -3.685  1.00 0.00 ? 41  ASN A O    11 
ATOM   7455  C  CB   . ASN A 1 41 ? 7.396   7.468   -3.960  1.00 0.00 ? 41  ASN A CB   11 
ATOM   7456  C  CG   . ASN A 1 41 ? 8.520   7.454   -4.978  1.00 0.00 ? 41  ASN A CG   11 
ATOM   7457  O  OD1  . ASN A 1 41 ? 8.823   8.474   -5.598  1.00 0.00 ? 41  ASN A OD1  11 
ATOM   7458  N  ND2  . ASN A 1 41 ? 9.144   6.295   -5.155  1.00 0.00 ? 41  ASN A ND2  11 
ATOM   7459  H  H    . ASN A 1 41 ? 6.313   7.492   -1.634  1.00 0.00 ? 41  ASN A H    11 
ATOM   7460  H  HA   . ASN A 1 41 ? 8.550   8.623   -2.576  1.00 0.00 ? 41  ASN A HA   11 
ATOM   7461  H  HB2  . ASN A 1 41 ? 7.404   6.525   -3.432  1.00 0.00 ? 41  ASN A HB2  11 
ATOM   7462  H  HB3  . ASN A 1 41 ? 6.459   7.573   -4.486  1.00 0.00 ? 41  ASN A HB3  11 
ATOM   7463  H  HD21 . ASN A 1 41 ? 8.849   5.525   -4.626  1.00 0.00 ? 41  ASN A HD21 11 
ATOM   7464  H  HD22 . ASN A 1 41 ? 9.875   6.259   -5.807  1.00 0.00 ? 41  ASN A HD22 11 
ATOM   7465  N  N    . GLN A 1 42 ? 6.029   10.084  -4.148  1.00 0.00 ? 42  GLN A N    11 
ATOM   7466  C  CA   . GLN A 1 42 ? 5.624   11.311  -4.824  1.00 0.00 ? 42  GLN A CA   11 
ATOM   7467  C  C    . GLN A 1 42 ? 5.697   12.504  -3.877  1.00 0.00 ? 42  GLN A C    11 
ATOM   7468  O  O    . GLN A 1 42 ? 5.169   12.461  -2.767  1.00 0.00 ? 42  GLN A O    11 
ATOM   7469  C  CB   . GLN A 1 42 ? 4.204   11.169  -5.376  1.00 0.00 ? 42  GLN A CB   11 
ATOM   7470  C  CG   . GLN A 1 42 ? 3.948   12.008  -6.617  1.00 0.00 ? 42  GLN A CG   11 
ATOM   7471  C  CD   . GLN A 1 42 ? 2.903   11.395  -7.530  1.00 0.00 ? 42  GLN A CD   11 
ATOM   7472  O  OE1  . GLN A 1 42 ? 1.966   10.743  -7.070  1.00 0.00 ? 42  GLN A OE1  11 
ATOM   7473  N  NE2  . GLN A 1 42 ? 3.060   11.602  -8.832  1.00 0.00 ? 42  GLN A NE2  11 
ATOM   7474  H  H    . GLN A 1 42 ? 5.389   9.346   -4.072  1.00 0.00 ? 42  GLN A H    11 
ATOM   7475  H  HA   . GLN A 1 42 ? 6.304   11.476  -5.645  1.00 0.00 ? 42  GLN A HA   11 
ATOM   7476  H  HB2  . GLN A 1 42 ? 4.029   10.133  -5.625  1.00 0.00 ? 42  GLN A HB2  11 
ATOM   7477  H  HB3  . GLN A 1 42 ? 3.502   11.471  -4.613  1.00 0.00 ? 42  GLN A HB3  11 
ATOM   7478  H  HG2  . GLN A 1 42 ? 3.606   12.985  -6.312  1.00 0.00 ? 42  GLN A HG2  11 
ATOM   7479  H  HG3  . GLN A 1 42 ? 4.872   12.106  -7.167  1.00 0.00 ? 42  GLN A HG3  11 
ATOM   7480  H  HE21 . GLN A 1 42 ? 3.831   12.131  -9.127  1.00 0.00 ? 42  GLN A HE21 11 
ATOM   7481  H  HE22 . GLN A 1 42 ? 2.400   11.217  -9.445  1.00 0.00 ? 42  GLN A HE22 11 
ATOM   7482  N  N    . ASN A 1 43 ? 6.357   13.568  -4.324  1.00 0.00 ? 43  ASN A N    11 
ATOM   7483  C  CA   . ASN A 1 43 ? 6.500   14.773  -3.516  1.00 0.00 ? 43  ASN A CA   11 
ATOM   7484  C  C    . ASN A 1 43 ? 5.576   15.878  -4.018  1.00 0.00 ? 43  ASN A C    11 
ATOM   7485  O  O    . ASN A 1 43 ? 5.841   16.505  -5.044  1.00 0.00 ? 43  ASN A O    11 
ATOM   7486  C  CB   . ASN A 1 43 ? 7.952   15.258  -3.538  1.00 0.00 ? 43  ASN A CB   11 
ATOM   7487  C  CG   . ASN A 1 43 ? 8.874   14.356  -2.741  1.00 0.00 ? 43  ASN A CG   11 
ATOM   7488  O  OD1  . ASN A 1 43 ? 9.513   13.459  -3.292  1.00 0.00 ? 43  ASN A OD1  11 
ATOM   7489  N  ND2  . ASN A 1 43 ? 8.948   14.590  -1.436  1.00 0.00 ? 43  ASN A ND2  11 
ATOM   7490  H  H    . ASN A 1 43 ? 6.757   13.542  -5.218  1.00 0.00 ? 43  ASN A H    11 
ATOM   7491  H  HA   . ASN A 1 43 ? 6.228   14.526  -2.501  1.00 0.00 ? 43  ASN A HA   11 
ATOM   7492  H  HB2  . ASN A 1 43 ? 8.300   15.283  -4.560  1.00 0.00 ? 43  ASN A HB2  11 
ATOM   7493  H  HB3  . ASN A 1 43 ? 8.000   16.252  -3.120  1.00 0.00 ? 43  ASN A HB3  11 
ATOM   7494  H  HD21 . ASN A 1 43 ? 8.411   15.322  -1.066  1.00 0.00 ? 43  ASN A HD21 11 
ATOM   7495  H  HD22 . ASN A 1 43 ? 9.538   14.023  -0.897  1.00 0.00 ? 43  ASN A HD22 11 
ATOM   7496  N  N    . SER A 1 44 ? 4.490   16.112  -3.288  1.00 0.00 ? 44  SER A N    11 
ATOM   7497  C  CA   . SER A 1 44 ? 3.525   17.139  -3.660  1.00 0.00 ? 44  SER A CA   11 
ATOM   7498  C  C    . SER A 1 44 ? 3.464   18.237  -2.603  1.00 0.00 ? 44  SER A C    11 
ATOM   7499  O  O    . SER A 1 44 ? 3.934   18.059  -1.480  1.00 0.00 ? 44  SER A O    11 
ATOM   7500  C  CB   . SER A 1 44 ? 2.138   16.520  -3.850  1.00 0.00 ? 44  SER A CB   11 
ATOM   7501  O  OG   . SER A 1 44 ? 1.307   17.362  -4.631  1.00 0.00 ? 44  SER A OG   11 
ATOM   7502  H  H    . SER A 1 44 ? 4.334   15.579  -2.480  1.00 0.00 ? 44  SER A H    11 
ATOM   7503  H  HA   . SER A 1 44 ? 3.847   17.573  -4.595  1.00 0.00 ? 44  SER A HA   11 
ATOM   7504  H  HB2  . SER A 1 44 ? 2.237   15.568  -4.349  1.00 0.00 ? 44  SER A HB2  11 
ATOM   7505  H  HB3  . SER A 1 44 ? 1.677   16.375  -2.884  1.00 0.00 ? 44  SER A HB3  11 
ATOM   7506  H  HG   . SER A 1 44 ? 1.852   17.922  -5.188  1.00 0.00 ? 44  SER A HG   11 
ATOM   7507  N  N    . GLY A 1 45 ? 2.881   19.373  -2.971  1.00 0.00 ? 45  GLY A N    11 
ATOM   7508  C  CA   . GLY A 1 45 ? 2.768   20.484  -2.044  1.00 0.00 ? 45  GLY A CA   11 
ATOM   7509  C  C    . GLY A 1 45 ? 2.440   20.033  -0.635  1.00 0.00 ? 45  GLY A C    11 
ATOM   7510  O  O    . GLY A 1 45 ? 1.619   19.140  -0.422  1.00 0.00 ? 45  GLY A O    11 
ATOM   7511  H  H    . GLY A 1 45 ? 2.523   19.458  -3.880  1.00 0.00 ? 45  GLY A H    11 
ATOM   7512  H  HA2  . GLY A 1 45 ? 3.704   21.023  -2.030  1.00 0.00 ? 45  GLY A HA2  11 
ATOM   7513  H  HA3  . GLY A 1 45 ? 1.989   21.148  -2.388  1.00 0.00 ? 45  GLY A HA3  11 
ATOM   7514  N  N    . PRO A 1 46 ? 3.091   20.656  0.358   1.00 0.00 ? 46  PRO A N    11 
ATOM   7515  C  CA   . PRO A 1 46 ? 2.881   20.329  1.771   1.00 0.00 ? 46  PRO A CA   11 
ATOM   7516  C  C    . PRO A 1 46 ? 1.507   20.763  2.268   1.00 0.00 ? 46  PRO A C    11 
ATOM   7517  O  O    . PRO A 1 46 ? 1.141   21.934  2.166   1.00 0.00 ? 46  PRO A O    11 
ATOM   7518  C  CB   . PRO A 1 46 ? 3.982   21.117  2.485   1.00 0.00 ? 46  PRO A CB   11 
ATOM   7519  C  CG   . PRO A 1 46 ? 4.288   22.253  1.571   1.00 0.00 ? 46  PRO A CG   11 
ATOM   7520  C  CD   . PRO A 1 46 ? 4.083   21.729  0.177   1.00 0.00 ? 46  PRO A CD   11 
ATOM   7521  H  HA   . PRO A 1 46 ? 3.013   19.273  1.957   1.00 0.00 ? 46  PRO A HA   11 
ATOM   7522  H  HB2  . PRO A 1 46 ? 3.616   21.465  3.441   1.00 0.00 ? 46  PRO A HB2  11 
ATOM   7523  H  HB3  . PRO A 1 46 ? 4.845   20.485  2.632   1.00 0.00 ? 46  PRO A HB3  11 
ATOM   7524  H  HG2  . PRO A 1 46 ? 3.615   23.073  1.767   1.00 0.00 ? 46  PRO A HG2  11 
ATOM   7525  H  HG3  . PRO A 1 46 ? 5.313   22.566  1.707   1.00 0.00 ? 46  PRO A HG3  11 
ATOM   7526  H  HD2  . PRO A 1 46 ? 3.697   22.507  -0.465  1.00 0.00 ? 46  PRO A HD2  11 
ATOM   7527  H  HD3  . PRO A 1 46 ? 5.008   21.336  -0.218  1.00 0.00 ? 46  PRO A HD3  11 
ATOM   7528  N  N    . SER A 1 47 ? 0.750   19.813  2.807   1.00 0.00 ? 47  SER A N    11 
ATOM   7529  C  CA   . SER A 1 47 ? -0.586  20.097  3.317   1.00 0.00 ? 47  SER A CA   11 
ATOM   7530  C  C    . SER A 1 47 ? -0.634  19.937  4.834   1.00 0.00 ? 47  SER A C    11 
ATOM   7531  O  O    . SER A 1 47 ? -0.607  18.821  5.353   1.00 0.00 ? 47  SER A O    11 
ATOM   7532  C  CB   . SER A 1 47 ? -1.613  19.171  2.663   1.00 0.00 ? 47  SER A CB   11 
ATOM   7533  O  OG   . SER A 1 47 ? -2.074  19.707  1.435   1.00 0.00 ? 47  SER A OG   11 
ATOM   7534  H  H    . SER A 1 47 ? 1.097   18.898  2.860   1.00 0.00 ? 47  SER A H    11 
ATOM   7535  H  HA   . SER A 1 47 ? -0.826  21.120  3.067   1.00 0.00 ? 47  SER A HA   11 
ATOM   7536  H  HB2  . SER A 1 47 ? -1.159  18.210  2.475   1.00 0.00 ? 47  SER A HB2  11 
ATOM   7537  H  HB3  . SER A 1 47 ? -2.457  19.047  3.327   1.00 0.00 ? 47  SER A HB3  11 
ATOM   7538  H  HG   . SER A 1 47 ? -2.155  20.660  1.512   1.00 0.00 ? 47  SER A HG   11 
ATOM   7539  N  N    . SER A 1 48 ? -0.705  21.061  5.539   1.00 0.00 ? 48  SER A N    11 
ATOM   7540  C  CA   . SER A 1 48 ? -0.753  21.048  6.997   1.00 0.00 ? 48  SER A CA   11 
ATOM   7541  C  C    . SER A 1 48 ? -2.006  20.333  7.493   1.00 0.00 ? 48  SER A C    11 
ATOM   7542  O  O    . SER A 1 48 ? -3.028  20.300  6.808   1.00 0.00 ? 48  SER A O    11 
ATOM   7543  C  CB   . SER A 1 48 ? -0.717  22.477  7.543   1.00 0.00 ? 48  SER A CB   11 
ATOM   7544  O  OG   . SER A 1 48 ? -0.330  22.492  8.906   1.00 0.00 ? 48  SER A OG   11 
ATOM   7545  H  H    . SER A 1 48 ? -0.723  21.921  5.068   1.00 0.00 ? 48  SER A H    11 
ATOM   7546  H  HA   . SER A 1 48 ? 0.116   20.514  7.352   1.00 0.00 ? 48  SER A HA   11 
ATOM   7547  H  HB2  . SER A 1 48 ? -0.008  23.059  6.974   1.00 0.00 ? 48  SER A HB2  11 
ATOM   7548  H  HB3  . SER A 1 48 ? -1.699  22.917  7.454   1.00 0.00 ? 48  SER A HB3  11 
ATOM   7549  H  HG   . SER A 1 48 ? -0.794  23.198  9.362   1.00 0.00 ? 48  SER A HG   11 
ATOM   7550  N  N    . GLY A 1 49 ? -1.919  19.761  8.690   1.00 0.00 ? 49  GLY A N    11 
ATOM   7551  C  CA   . GLY A 1 49 ? -3.051  19.054  9.258   1.00 0.00 ? 49  GLY A CA   11 
ATOM   7552  C  C    . GLY A 1 49 ? -2.934  17.550  9.102   1.00 0.00 ? 49  GLY A C    11 
ATOM   7553  O  O    . GLY A 1 49 ? -2.685  17.081  7.993   1.00 0.00 ? 49  GLY A O    11 
ATOM   7554  H  H    . GLY A 1 49 ? -1.078  19.819  9.191   1.00 0.00 ? 49  GLY A H    11 
ATOM   7555  H  HA2  . GLY A 1 49 ? -3.120  19.292  10.309  1.00 0.00 ? 49  GLY A HA2  11 
ATOM   7556  H  HA3  . GLY A 1 49 ? -3.953  19.385  8.764   1.00 0.00 ? 49  GLY A HA3  11 
HETATM 7557  ZN ZN   . ZN  B 2 .  ? 2.961   -4.966  1.714   1.00 0.00 ? 201 ZN  A ZN   11 
ATOM   7558  N  N    . GLY A 1 1  ? -17.348 17.221  5.889   1.00 0.00 ? 1   GLY A N    12 
ATOM   7559  C  CA   . GLY A 1 1  ? -16.981 15.885  6.321   1.00 0.00 ? 1   GLY A CA   12 
ATOM   7560  C  C    . GLY A 1 1  ? -16.007 15.216  5.371   1.00 0.00 ? 1   GLY A C    12 
ATOM   7561  O  O    . GLY A 1 1  ? -15.983 15.522  4.179   1.00 0.00 ? 1   GLY A O    12 
ATOM   7562  H  H1   . GLY A 1 1  ? -17.535 17.394  4.942   1.00 0.00 ? 1   GLY A H1   12 
ATOM   7563  H  HA2  . GLY A 1 1  ? -16.528 15.947  7.299   1.00 0.00 ? 1   GLY A HA2  12 
ATOM   7564  H  HA3  . GLY A 1 1  ? -17.874 15.282  6.386   1.00 0.00 ? 1   GLY A HA3  12 
ATOM   7565  N  N    . SER A 1 2  ? -15.202 14.300  5.900   1.00 0.00 ? 2   SER A N    12 
ATOM   7566  C  CA   . SER A 1 2  ? -14.218 13.590  5.092   1.00 0.00 ? 2   SER A CA   12 
ATOM   7567  C  C    . SER A 1 2  ? -14.591 12.117  4.953   1.00 0.00 ? 2   SER A C    12 
ATOM   7568  O  O    . SER A 1 2  ? -15.108 11.505  5.888   1.00 0.00 ? 2   SER A O    12 
ATOM   7569  C  CB   . SER A 1 2  ? -12.826 13.718  5.715   1.00 0.00 ? 2   SER A CB   12 
ATOM   7570  O  OG   . SER A 1 2  ? -12.778 13.096  6.987   1.00 0.00 ? 2   SER A OG   12 
ATOM   7571  H  H    . SER A 1 2  ? -15.269 14.100  6.857   1.00 0.00 ? 2   SER A H    12 
ATOM   7572  H  HA   . SER A 1 2  ? -14.207 14.040  4.111   1.00 0.00 ? 2   SER A HA   12 
ATOM   7573  H  HB2  . SER A 1 2  ? -12.101 13.247  5.070   1.00 0.00 ? 2   SER A HB2  12 
ATOM   7574  H  HB3  . SER A 1 2  ? -12.582 14.764  5.829   1.00 0.00 ? 2   SER A HB3  12 
ATOM   7575  H  HG   . SER A 1 2  ? -13.024 13.731  7.664   1.00 0.00 ? 2   SER A HG   12 
ATOM   7576  N  N    . SER A 1 3  ? -14.325 11.554  3.779   1.00 0.00 ? 3   SER A N    12 
ATOM   7577  C  CA   . SER A 1 3  ? -14.636 10.154  3.514   1.00 0.00 ? 3   SER A CA   12 
ATOM   7578  C  C    . SER A 1 3  ? -14.304 9.286   4.724   1.00 0.00 ? 3   SER A C    12 
ATOM   7579  O  O    . SER A 1 3  ? -15.157 8.561   5.234   1.00 0.00 ? 3   SER A O    12 
ATOM   7580  C  CB   . SER A 1 3  ? -13.861 9.660   2.291   1.00 0.00 ? 3   SER A CB   12 
ATOM   7581  O  OG   . SER A 1 3  ? -14.308 10.304  1.110   1.00 0.00 ? 3   SER A OG   12 
ATOM   7582  H  H    . SER A 1 3  ? -13.912 12.094  3.073   1.00 0.00 ? 3   SER A H    12 
ATOM   7583  H  HA   . SER A 1 3  ? -15.694 10.082  3.313   1.00 0.00 ? 3   SER A HA   12 
ATOM   7584  H  HB2  . SER A 1 3  ? -12.811 9.869   2.424   1.00 0.00 ? 3   SER A HB2  12 
ATOM   7585  H  HB3  . SER A 1 3  ? -14.006 8.595   2.183   1.00 0.00 ? 3   SER A HB3  12 
ATOM   7586  H  HG   . SER A 1 3  ? -14.218 11.254  1.210   1.00 0.00 ? 3   SER A HG   12 
ATOM   7587  N  N    . GLY A 1 4  ? -13.057 9.366   5.179   1.00 0.00 ? 4   GLY A N    12 
ATOM   7588  C  CA   . GLY A 1 4  ? -12.634 8.583   6.325   1.00 0.00 ? 4   GLY A CA   12 
ATOM   7589  C  C    . GLY A 1 4  ? -11.310 7.883   6.092   1.00 0.00 ? 4   GLY A C    12 
ATOM   7590  O  O    . GLY A 1 4  ? -10.477 7.799   6.994   1.00 0.00 ? 4   GLY A O    12 
ATOM   7591  H  H    . GLY A 1 4  ? -12.420 9.962   4.732   1.00 0.00 ? 4   GLY A H    12 
ATOM   7592  H  HA2  . GLY A 1 4  ? -12.538 9.238   7.178   1.00 0.00 ? 4   GLY A HA2  12 
ATOM   7593  H  HA3  . GLY A 1 4  ? -13.389 7.840   6.537   1.00 0.00 ? 4   GLY A HA3  12 
ATOM   7594  N  N    . SER A 1 5  ? -11.117 7.376   4.878   1.00 0.00 ? 5   SER A N    12 
ATOM   7595  C  CA   . SER A 1 5  ? -9.887  6.673   4.530   1.00 0.00 ? 5   SER A CA   12 
ATOM   7596  C  C    . SER A 1 5  ? -9.645  5.501   5.476   1.00 0.00 ? 5   SER A C    12 
ATOM   7597  O  O    . SER A 1 5  ? -8.511  5.232   5.872   1.00 0.00 ? 5   SER A O    12 
ATOM   7598  C  CB   . SER A 1 5  ? -8.696  7.633   4.575   1.00 0.00 ? 5   SER A CB   12 
ATOM   7599  O  OG   . SER A 1 5  ? -7.563  7.070   3.939   1.00 0.00 ? 5   SER A OG   12 
ATOM   7600  H  H    . SER A 1 5  ? -11.819 7.474   4.202   1.00 0.00 ? 5   SER A H    12 
ATOM   7601  H  HA   . SER A 1 5  ? -9.995  6.294   3.525   1.00 0.00 ? 5   SER A HA   12 
ATOM   7602  H  HB2  . SER A 1 5  ? -8.958  8.551   4.071   1.00 0.00 ? 5   SER A HB2  12 
ATOM   7603  H  HB3  . SER A 1 5  ? -8.448  7.846   5.605   1.00 0.00 ? 5   SER A HB3  12 
ATOM   7604  H  HG   . SER A 1 5  ? -7.579  6.116   4.042   1.00 0.00 ? 5   SER A HG   12 
ATOM   7605  N  N    . SER A 1 6  ? -10.720 4.806   5.834   1.00 0.00 ? 6   SER A N    12 
ATOM   7606  C  CA   . SER A 1 6  ? -10.627 3.664   6.736   1.00 0.00 ? 6   SER A CA   12 
ATOM   7607  C  C    . SER A 1 6  ? -10.679 2.352   5.959   1.00 0.00 ? 6   SER A C    12 
ATOM   7608  O  O    . SER A 1 6  ? -11.660 2.060   5.277   1.00 0.00 ? 6   SER A O    12 
ATOM   7609  C  CB   . SER A 1 6  ? -11.759 3.706   7.764   1.00 0.00 ? 6   SER A CB   12 
ATOM   7610  O  OG   . SER A 1 6  ? -13.024 3.613   7.134   1.00 0.00 ? 6   SER A OG   12 
ATOM   7611  H  H    . SER A 1 6  ? -11.597 5.070   5.485   1.00 0.00 ? 6   SER A H    12 
ATOM   7612  H  HA   . SER A 1 6  ? -9.680  3.726   7.252   1.00 0.00 ? 6   SER A HA   12 
ATOM   7613  H  HB2  . SER A 1 6  ? -11.650 2.879   8.449   1.00 0.00 ? 6   SER A HB2  12 
ATOM   7614  H  HB3  . SER A 1 6  ? -11.709 4.636   8.312   1.00 0.00 ? 6   SER A HB3  12 
ATOM   7615  H  HG   . SER A 1 6  ? -12.955 3.927   6.229   1.00 0.00 ? 6   SER A HG   12 
ATOM   7616  N  N    . GLY A 1 7  ? -9.613  1.565   6.067   1.00 0.00 ? 7   GLY A N    12 
ATOM   7617  C  CA   . GLY A 1 7  ? -9.556  0.293   5.370   1.00 0.00 ? 7   GLY A CA   12 
ATOM   7618  C  C    . GLY A 1 7  ? -9.601  -0.890  6.316   1.00 0.00 ? 7   GLY A C    12 
ATOM   7619  O  O    . GLY A 1 7  ? -9.253  -0.767  7.491   1.00 0.00 ? 7   GLY A O    12 
ATOM   7620  H  H    . GLY A 1 7  ? -8.859  1.850   6.625   1.00 0.00 ? 7   GLY A H    12 
ATOM   7621  H  HA2  . GLY A 1 7  ? -10.393 0.230   4.691   1.00 0.00 ? 7   GLY A HA2  12 
ATOM   7622  H  HA3  . GLY A 1 7  ? -8.639  0.249   4.800   1.00 0.00 ? 7   GLY A HA3  12 
ATOM   7623  N  N    . SER A 1 8  ? -10.033 -2.038  5.806   1.00 0.00 ? 8   SER A N    12 
ATOM   7624  C  CA   . SER A 1 8  ? -10.127 -3.247  6.615   1.00 0.00 ? 8   SER A CA   12 
ATOM   7625  C  C    . SER A 1 8  ? -9.213  -4.340  6.069   1.00 0.00 ? 8   SER A C    12 
ATOM   7626  O  O    . SER A 1 8  ? -9.339  -4.752  4.915   1.00 0.00 ? 8   SER A O    12 
ATOM   7627  C  CB   . SER A 1 8  ? -11.573 -3.748  6.655   1.00 0.00 ? 8   SER A CB   12 
ATOM   7628  O  OG   . SER A 1 8  ? -12.300 -3.123  7.698   1.00 0.00 ? 8   SER A OG   12 
ATOM   7629  H  H    . SER A 1 8  ? -10.296 -2.072  4.862   1.00 0.00 ? 8   SER A H    12 
ATOM   7630  H  HA   . SER A 1 8  ? -9.814  -3.000  7.618   1.00 0.00 ? 8   SER A HA   12 
ATOM   7631  H  HB2  . SER A 1 8  ? -12.054 -3.527  5.714   1.00 0.00 ? 8   SER A HB2  12 
ATOM   7632  H  HB3  . SER A 1 8  ? -11.576 -4.816  6.818   1.00 0.00 ? 8   SER A HB3  12 
ATOM   7633  H  HG   . SER A 1 8  ? -11.721 -2.531  8.183   1.00 0.00 ? 8   SER A HG   12 
ATOM   7634  N  N    . LEU A 1 9  ? -8.293  -4.806  6.906   1.00 0.00 ? 9   LEU A N    12 
ATOM   7635  C  CA   . LEU A 1 9  ? -7.357  -5.852  6.509   1.00 0.00 ? 9   LEU A CA   12 
ATOM   7636  C  C    . LEU A 1 9  ? -8.099  -7.088  6.014   1.00 0.00 ? 9   LEU A C    12 
ATOM   7637  O  O    . LEU A 1 9  ? -8.703  -7.818  6.799   1.00 0.00 ? 9   LEU A O    12 
ATOM   7638  C  CB   . LEU A 1 9  ? -6.449  -6.224  7.683   1.00 0.00 ? 9   LEU A CB   12 
ATOM   7639  C  CG   . LEU A 1 9  ? -5.461  -5.148  8.135   1.00 0.00 ? 9   LEU A CG   12 
ATOM   7640  C  CD1  . LEU A 1 9  ? -4.759  -5.572  9.416   1.00 0.00 ? 9   LEU A CD1  12 
ATOM   7641  C  CD2  . LEU A 1 9  ? -4.446  -4.862  7.038   1.00 0.00 ? 9   LEU A CD2  12 
ATOM   7642  H  H    . LEU A 1 9  ? -8.242  -4.439  7.813   1.00 0.00 ? 9   LEU A H    12 
ATOM   7643  H  HA   . LEU A 1 9  ? -6.750  -5.464  5.704   1.00 0.00 ? 9   LEU A HA   12 
ATOM   7644  H  HB2  . LEU A 1 9  ? -7.080  -6.467  8.524   1.00 0.00 ? 9   LEU A HB2  12 
ATOM   7645  H  HB3  . LEU A 1 9  ? -5.881  -7.097  7.397   1.00 0.00 ? 9   LEU A HB3  12 
ATOM   7646  H  HG   . LEU A 1 9  ? -6.002  -4.234  8.338   1.00 0.00 ? 9   LEU A HG   12 
ATOM   7647  H  HD11 . LEU A 1 9  ? -4.041  -4.818  9.699   1.00 0.00 ? 9   LEU A HD11 12 
ATOM   7648  H  HD12 . LEU A 1 9  ? -4.251  -6.511  9.254   1.00 0.00 ? 9   LEU A HD12 12 
ATOM   7649  H  HD13 . LEU A 1 9  ? -5.489  -5.689  10.204  1.00 0.00 ? 9   LEU A HD13 12 
ATOM   7650  H  HD21 . LEU A 1 9  ? -3.453  -4.851  7.461   1.00 0.00 ? 9   LEU A HD21 12 
ATOM   7651  H  HD22 . LEU A 1 9  ? -4.659  -3.900  6.594   1.00 0.00 ? 9   LEU A HD22 12 
ATOM   7652  H  HD23 . LEU A 1 9  ? -4.508  -5.630  6.281   1.00 0.00 ? 9   LEU A HD23 12 
ATOM   7653  N  N    . MET A 1 10 ? -8.048  -7.318  4.706   1.00 0.00 ? 10  MET A N    12 
ATOM   7654  C  CA   . MET A 1 10 ? -8.713  -8.469  4.106   1.00 0.00 ? 10  MET A CA   12 
ATOM   7655  C  C    . MET A 1 10 ? -7.959  -9.758  4.420   1.00 0.00 ? 10  MET A C    12 
ATOM   7656  O  O    . MET A 1 10 ? -6.915  -9.733  5.071   1.00 0.00 ? 10  MET A O    12 
ATOM   7657  C  CB   . MET A 1 10 ? -8.827  -8.288  2.591   1.00 0.00 ? 10  MET A CB   12 
ATOM   7658  C  CG   . MET A 1 10 ? -9.890  -7.283  2.178   1.00 0.00 ? 10  MET A CG   12 
ATOM   7659  S  SD   . MET A 1 10 ? -11.513 -8.037  1.963   1.00 0.00 ? 10  MET A SD   12 
ATOM   7660  C  CE   . MET A 1 10 ? -11.842 -7.650  0.245   1.00 0.00 ? 10  MET A CE   12 
ATOM   7661  H  H    . MET A 1 10 ? -7.551  -6.701  4.130   1.00 0.00 ? 10  MET A H    12 
ATOM   7662  H  HA   . MET A 1 10 ? -9.705  -8.535  4.527   1.00 0.00 ? 10  MET A HA   12 
ATOM   7663  H  HB2  . MET A 1 10 ? -7.876  -7.951  2.209   1.00 0.00 ? 10  MET A HB2  12 
ATOM   7664  H  HB3  . MET A 1 10 ? -9.070  -9.240  2.143   1.00 0.00 ? 10  MET A HB3  12 
ATOM   7665  H  HG2  . MET A 1 10 ? -9.962  -6.520  2.939   1.00 0.00 ? 10  MET A HG2  12 
ATOM   7666  H  HG3  . MET A 1 10 ? -9.592  -6.829  1.244   1.00 0.00 ? 10  MET A HG3  12 
ATOM   7667  H  HE1  . MET A 1 10 ? -12.621 -6.903  0.188   1.00 0.00 ? 10  MET A HE1  12 
ATOM   7668  H  HE2  . MET A 1 10 ? -10.944 -7.268  -0.216  1.00 0.00 ? 10  MET A HE2  12 
ATOM   7669  H  HE3  . MET A 1 10 ? -12.160 -8.544  -0.271  1.00 0.00 ? 10  MET A HE3  12 
ATOM   7670  N  N    . ASP A 1 11 ? -8.496  -10.880 3.955   1.00 0.00 ? 11  ASP A N    12 
ATOM   7671  C  CA   . ASP A 1 11 ? -7.873  -12.178 4.186   1.00 0.00 ? 11  ASP A CA   12 
ATOM   7672  C  C    . ASP A 1 11 ? -6.874  -12.506 3.080   1.00 0.00 ? 11  ASP A C    12 
ATOM   7673  O  O    . ASP A 1 11 ? -6.421  -13.644 2.956   1.00 0.00 ? 11  ASP A O    12 
ATOM   7674  C  CB   . ASP A 1 11 ? -8.939  -13.272 4.267   1.00 0.00 ? 11  ASP A CB   12 
ATOM   7675  C  CG   . ASP A 1 11 ? -9.630  -13.508 2.939   1.00 0.00 ? 11  ASP A CG   12 
ATOM   7676  O  OD1  . ASP A 1 11 ? -10.417 -12.635 2.517   1.00 0.00 ? 11  ASP A OD1  12 
ATOM   7677  O  OD2  . ASP A 1 11 ? -9.385  -14.565 2.321   1.00 0.00 ? 11  ASP A OD2  12 
ATOM   7678  H  H    . ASP A 1 11 ? -9.331  -10.835 3.443   1.00 0.00 ? 11  ASP A H    12 
ATOM   7679  H  HA   . ASP A 1 11 ? -7.346  -12.131 5.127   1.00 0.00 ? 11  ASP A HA   12 
ATOM   7680  H  HB2  . ASP A 1 11 ? -8.474  -14.196 4.579   1.00 0.00 ? 11  ASP A HB2  12 
ATOM   7681  H  HB3  . ASP A 1 11 ? -9.684  -12.986 4.995   1.00 0.00 ? 11  ASP A HB3  12 
ATOM   7682  N  N    . VAL A 1 12 ? -6.535  -11.501 2.279   1.00 0.00 ? 12  VAL A N    12 
ATOM   7683  C  CA   . VAL A 1 12 ? -5.590  -11.682 1.183   1.00 0.00 ? 12  VAL A CA   12 
ATOM   7684  C  C    . VAL A 1 12 ? -4.260  -11.003 1.488   1.00 0.00 ? 12  VAL A C    12 
ATOM   7685  O  O    . VAL A 1 12 ? -4.215  -9.817  1.816   1.00 0.00 ? 12  VAL A O    12 
ATOM   7686  C  CB   . VAL A 1 12 ? -6.149  -11.122 -0.139  1.00 0.00 ? 12  VAL A CB   12 
ATOM   7687  C  CG1  . VAL A 1 12 ? -6.354  -9.618  -0.037  1.00 0.00 ? 12  VAL A CG1  12 
ATOM   7688  C  CG2  . VAL A 1 12 ? -5.223  -11.466 -1.296  1.00 0.00 ? 12  VAL A CG2  12 
ATOM   7689  H  H    . VAL A 1 12 ? -6.930  -10.617 2.428   1.00 0.00 ? 12  VAL A H    12 
ATOM   7690  H  HA   . VAL A 1 12 ? -5.422  -12.742 1.059   1.00 0.00 ? 12  VAL A HA   12 
ATOM   7691  H  HB   . VAL A 1 12 ? -7.108  -11.582 -0.324  1.00 0.00 ? 12  VAL A HB   12 
ATOM   7692  H  HG11 . VAL A 1 12 ? -6.905  -9.272  -0.899  1.00 0.00 ? 12  VAL A HG11 12 
ATOM   7693  H  HG12 . VAL A 1 12 ? -6.908  -9.390  0.861   1.00 0.00 ? 12  VAL A HG12 12 
ATOM   7694  H  HG13 . VAL A 1 12 ? -5.393  -9.126  -0.004  1.00 0.00 ? 12  VAL A HG13 12 
ATOM   7695  H  HG21 . VAL A 1 12 ? -5.577  -12.360 -1.787  1.00 0.00 ? 12  VAL A HG21 12 
ATOM   7696  H  HG22 . VAL A 1 12 ? -5.210  -10.648 -2.000  1.00 0.00 ? 12  VAL A HG22 12 
ATOM   7697  H  HG23 . VAL A 1 12 ? -4.224  -11.634 -0.920  1.00 0.00 ? 12  VAL A HG23 12 
ATOM   7698  N  N    . LYS A 1 13 ? -3.175  -11.763 1.377   1.00 0.00 ? 13  LYS A N    12 
ATOM   7699  C  CA   . LYS A 1 13 ? -1.841  -11.236 1.638   1.00 0.00 ? 13  LYS A CA   12 
ATOM   7700  C  C    . LYS A 1 13 ? -1.535  -10.052 0.726   1.00 0.00 ? 13  LYS A C    12 
ATOM   7701  O  O    . LYS A 1 13 ? -2.070  -9.952  -0.379  1.00 0.00 ? 13  LYS A O    12 
ATOM   7702  C  CB   . LYS A 1 13 ? -0.790  -12.331 1.441   1.00 0.00 ? 13  LYS A CB   12 
ATOM   7703  C  CG   . LYS A 1 13 ? -0.567  -13.189 2.674   1.00 0.00 ? 13  LYS A CG   12 
ATOM   7704  C  CD   . LYS A 1 13 ? -1.570  -14.327 2.751   1.00 0.00 ? 13  LYS A CD   12 
ATOM   7705  C  CE   . LYS A 1 13 ? -1.173  -15.482 1.845   1.00 0.00 ? 13  LYS A CE   12 
ATOM   7706  N  NZ   . LYS A 1 13 ? -1.902  -16.734 2.191   1.00 0.00 ? 13  LYS A NZ   12 
ATOM   7707  H  H    . LYS A 1 13 ? -3.275  -12.702 1.111   1.00 0.00 ? 13  LYS A H    12 
ATOM   7708  H  HA   . LYS A 1 13 ? -1.812  -10.901 2.664   1.00 0.00 ? 13  LYS A HA   12 
ATOM   7709  H  HB2  . LYS A 1 13 ? -1.105  -12.974 0.632   1.00 0.00 ? 13  LYS A HB2  12 
ATOM   7710  H  HB3  . LYS A 1 13 ? 0.149   -11.867 1.176   1.00 0.00 ? 13  LYS A HB3  12 
ATOM   7711  H  HG2  . LYS A 1 13 ? 0.430   -13.604 2.637   1.00 0.00 ? 13  LYS A HG2  12 
ATOM   7712  H  HG3  . LYS A 1 13 ? -0.669  -12.570 3.555   1.00 0.00 ? 13  LYS A HG3  12 
ATOM   7713  H  HD2  . LYS A 1 13 ? -1.620  -14.683 3.769   1.00 0.00 ? 13  LYS A HD2  12 
ATOM   7714  H  HD3  . LYS A 1 13 ? -2.541  -13.960 2.448   1.00 0.00 ? 13  LYS A HD3  12 
ATOM   7715  H  HE2  . LYS A 1 13 ? -1.398  -15.216 0.824   1.00 0.00 ? 13  LYS A HE2  12 
ATOM   7716  H  HE3  . LYS A 1 13 ? -0.112  -15.654 1.947   1.00 0.00 ? 13  LYS A HE3  12 
ATOM   7717  H  HZ1  . LYS A 1 13 ? -1.850  -16.906 3.215   1.00 0.00 ? 13  LYS A HZ1  12 
ATOM   7718  H  HZ2  . LYS A 1 13 ? -1.479  -17.543 1.692   1.00 0.00 ? 13  LYS A HZ2  12 
ATOM   7719  H  HZ3  . LYS A 1 13 ? -2.901  -16.654 1.914   1.00 0.00 ? 13  LYS A HZ3  12 
ATOM   7720  N  N    . CYS A 1 14 ? -0.670  -9.158  1.193   1.00 0.00 ? 14  CYS A N    12 
ATOM   7721  C  CA   . CYS A 1 14 ? -0.292  -7.982  0.420   1.00 0.00 ? 14  CYS A CA   12 
ATOM   7722  C  C    . CYS A 1 14 ? 0.227   -8.382  -0.959  1.00 0.00 ? 14  CYS A C    12 
ATOM   7723  O  O    . CYS A 1 14 ? 0.885   -9.410  -1.110  1.00 0.00 ? 14  CYS A O    12 
ATOM   7724  C  CB   . CYS A 1 14 ? 0.775   -7.177  1.165   1.00 0.00 ? 14  CYS A CB   12 
ATOM   7725  S  SG   . CYS A 1 14 ? 1.381   -5.722  0.252   1.00 0.00 ? 14  CYS A SG   12 
ATOM   7726  H  H    . CYS A 1 14 ? -0.277  -9.293  2.082   1.00 0.00 ? 14  CYS A H    12 
ATOM   7727  H  HA   . CYS A 1 14 ? -1.172  -7.369  0.296   1.00 0.00 ? 14  CYS A HA   12 
ATOM   7728  H  HB2  . CYS A 1 14 ? 0.363   -6.829  2.101   1.00 0.00 ? 14  CYS A HB2  12 
ATOM   7729  H  HB3  . CYS A 1 14 ? 1.622   -7.816  1.366   1.00 0.00 ? 14  CYS A HB3  12 
ATOM   7730  N  N    . GLU A 1 15 ? -0.075  -7.560  -1.959  1.00 0.00 ? 15  GLU A N    12 
ATOM   7731  C  CA   . GLU A 1 15 ? 0.360   -7.829  -3.325  1.00 0.00 ? 15  GLU A CA   12 
ATOM   7732  C  C    . GLU A 1 15 ? 1.754   -8.450  -3.339  1.00 0.00 ? 15  GLU A C    12 
ATOM   7733  O  O    . GLU A 1 15 ? 1.944   -9.568  -3.818  1.00 0.00 ? 15  GLU A O    12 
ATOM   7734  C  CB   . GLU A 1 15 ? 0.356   -6.539  -4.148  1.00 0.00 ? 15  GLU A CB   12 
ATOM   7735  C  CG   . GLU A 1 15 ? 0.743   -6.744  -5.603  1.00 0.00 ? 15  GLU A CG   12 
ATOM   7736  C  CD   . GLU A 1 15 ? 2.243   -6.698  -5.820  1.00 0.00 ? 15  GLU A CD   12 
ATOM   7737  O  OE1  . GLU A 1 15 ? 2.941   -6.063  -5.003  1.00 0.00 ? 15  GLU A OE1  12 
ATOM   7738  O  OE2  . GLU A 1 15 ? 2.719   -7.298  -6.807  1.00 0.00 ? 15  GLU A OE2  12 
ATOM   7739  H  H    . GLU A 1 15 ? -0.604  -6.756  -1.775  1.00 0.00 ? 15  GLU A H    12 
ATOM   7740  H  HA   . GLU A 1 15 ? -0.336  -8.527  -3.764  1.00 0.00 ? 15  GLU A HA   12 
ATOM   7741  H  HB2  . GLU A 1 15 ? -0.634  -6.109  -4.117  1.00 0.00 ? 15  GLU A HB2  12 
ATOM   7742  H  HB3  . GLU A 1 15 ? 1.054   -5.843  -3.707  1.00 0.00 ? 15  GLU A HB3  12 
ATOM   7743  H  HG2  . GLU A 1 15 ? 0.377   -7.707  -5.927  1.00 0.00 ? 15  GLU A HG2  12 
ATOM   7744  H  HG3  . GLU A 1 15 ? 0.284   -5.968  -6.197  1.00 0.00 ? 15  GLU A HG3  12 
ATOM   7745  N  N    . THR A 1 16 ? 2.728   -7.715  -2.811  1.00 0.00 ? 16  THR A N    12 
ATOM   7746  C  CA   . THR A 1 16 ? 4.105   -8.191  -2.764  1.00 0.00 ? 16  THR A CA   12 
ATOM   7747  C  C    . THR A 1 16 ? 4.189   -9.568  -2.116  1.00 0.00 ? 16  THR A C    12 
ATOM   7748  O  O    . THR A 1 16 ? 3.750   -9.777  -0.985  1.00 0.00 ? 16  THR A O    12 
ATOM   7749  C  CB   . THR A 1 16 ? 5.011   -7.216  -1.989  1.00 0.00 ? 16  THR A CB   12 
ATOM   7750  O  OG1  . THR A 1 16 ? 5.055   -5.951  -2.659  1.00 0.00 ? 16  THR A OG1  12 
ATOM   7751  C  CG2  . THR A 1 16 ? 6.419   -7.775  -1.855  1.00 0.00 ? 16  THR A CG2  12 
ATOM   7752  H  H    . THR A 1 16 ? 2.515   -6.831  -2.445  1.00 0.00 ? 16  THR A H    12 
ATOM   7753  H  HA   . THR A 1 16 ? 4.470   -8.258  -3.779  1.00 0.00 ? 16  THR A HA   12 
ATOM   7754  H  HB   . THR A 1 16 ? 4.600   -7.076  -0.999  1.00 0.00 ? 16  THR A HB   12 
ATOM   7755  H  HG1  . THR A 1 16 ? 4.717   -5.267  -2.075  1.00 0.00 ? 16  THR A HG1  12 
ATOM   7756  H  HG21 . THR A 1 16 ? 6.567   -8.555  -2.586  1.00 0.00 ? 16  THR A HG21 12 
ATOM   7757  H  HG22 . THR A 1 16 ? 6.553   -8.181  -0.864  1.00 0.00 ? 16  THR A HG22 12 
ATOM   7758  H  HG23 . THR A 1 16 ? 7.137   -6.985  -2.022  1.00 0.00 ? 16  THR A HG23 12 
ATOM   7759  N  N    . PRO A 1 17 ? 4.767   -10.533 -2.848  1.00 0.00 ? 17  PRO A N    12 
ATOM   7760  C  CA   . PRO A 1 17 ? 4.922   -11.908 -2.363  1.00 0.00 ? 17  PRO A CA   12 
ATOM   7761  C  C    . PRO A 1 17 ? 5.945   -12.013 -1.237  1.00 0.00 ? 17  PRO A C    12 
ATOM   7762  O  O    . PRO A 1 17 ? 6.174   -13.092 -0.692  1.00 0.00 ? 17  PRO A O    12 
ATOM   7763  C  CB   . PRO A 1 17 ? 5.409   -12.667 -3.600  1.00 0.00 ? 17  PRO A CB   12 
ATOM   7764  C  CG   . PRO A 1 17 ? 6.070   -11.632 -4.444  1.00 0.00 ? 17  PRO A CG   12 
ATOM   7765  C  CD   . PRO A 1 17 ? 5.312   -10.356 -4.204  1.00 0.00 ? 17  PRO A CD   12 
ATOM   7766  H  HA   . PRO A 1 17 ? 3.981   -12.321 -2.032  1.00 0.00 ? 17  PRO A HA   12 
ATOM   7767  H  HB2  . PRO A 1 17 ? 6.105   -13.438 -3.301  1.00 0.00 ? 17  PRO A HB2  12 
ATOM   7768  H  HB3  . PRO A 1 17 ? 4.566   -13.111 -4.109  1.00 0.00 ? 17  PRO A HB3  12 
ATOM   7769  H  HG2  . PRO A 1 17 ? 7.101   -11.518 -4.144  1.00 0.00 ? 17  PRO A HG2  12 
ATOM   7770  H  HG3  . PRO A 1 17 ? 6.009   -11.914 -5.484  1.00 0.00 ? 17  PRO A HG3  12 
ATOM   7771  H  HD2  . PRO A 1 17 ? 5.980   -9.508  -4.243  1.00 0.00 ? 17  PRO A HD2  12 
ATOM   7772  H  HD3  . PRO A 1 17 ? 4.518   -10.247 -4.927  1.00 0.00 ? 17  PRO A HD3  12 
ATOM   7773  N  N    . ASN A 1 18 ? 6.558   -10.885 -0.893  1.00 0.00 ? 18  ASN A N    12 
ATOM   7774  C  CA   . ASN A 1 18 ? 7.558   -10.851 0.168   1.00 0.00 ? 18  ASN A CA   12 
ATOM   7775  C  C    . ASN A 1 18 ? 7.024   -10.115 1.394   1.00 0.00 ? 18  ASN A C    12 
ATOM   7776  O  O    . ASN A 1 18 ? 7.674   -10.074 2.439   1.00 0.00 ? 18  ASN A O    12 
ATOM   7777  C  CB   . ASN A 1 18 ? 8.837   -10.176 -0.329  1.00 0.00 ? 18  ASN A CB   12 
ATOM   7778  C  CG   . ASN A 1 18 ? 9.486   -10.936 -1.469  1.00 0.00 ? 18  ASN A CG   12 
ATOM   7779  O  OD1  . ASN A 1 18 ? 9.919   -12.077 -1.303  1.00 0.00 ? 18  ASN A OD1  12 
ATOM   7780  N  ND2  . ASN A 1 18 ? 9.557   -10.305 -2.636  1.00 0.00 ? 18  ASN A ND2  12 
ATOM   7781  H  H    . ASN A 1 18 ? 6.334   -10.055 -1.365  1.00 0.00 ? 18  ASN A H    12 
ATOM   7782  H  HA   . ASN A 1 18 ? 7.783   -11.870 0.444   1.00 0.00 ? 18  ASN A HA   12 
ATOM   7783  H  HB2  . ASN A 1 18 ? 8.601   -9.180  -0.674  1.00 0.00 ? 18  ASN A HB2  12 
ATOM   7784  H  HB3  . ASN A 1 18 ? 9.544   -10.112 0.485   1.00 0.00 ? 18  ASN A HB3  12 
ATOM   7785  H  HD21 . ASN A 1 18 ? 9.192   -9.397  -2.695  1.00 0.00 ? 18  ASN A HD21 12 
ATOM   7786  H  HD22 . ASN A 1 18 ? 9.971   -10.774 -3.390  1.00 0.00 ? 18  ASN A HD22 12 
ATOM   7787  N  N    . CYS A 1 19 ? 5.837   -9.535  1.259   1.00 0.00 ? 19  CYS A N    12 
ATOM   7788  C  CA   . CYS A 1 19 ? 5.214   -8.800  2.353   1.00 0.00 ? 19  CYS A CA   12 
ATOM   7789  C  C    . CYS A 1 19 ? 4.264   -9.698  3.140   1.00 0.00 ? 19  CYS A C    12 
ATOM   7790  O  O    . CYS A 1 19 ? 3.209   -10.105 2.654   1.00 0.00 ? 19  CYS A O    12 
ATOM   7791  C  CB   . CYS A 1 19 ? 4.457   -7.585  1.815   1.00 0.00 ? 19  CYS A CB   12 
ATOM   7792  S  SG   . CYS A 1 19 ? 3.833   -6.464  3.108   1.00 0.00 ? 19  CYS A SG   12 
ATOM   7793  H  H    . CYS A 1 19 ? 5.366   -9.602  0.400   1.00 0.00 ? 19  CYS A H    12 
ATOM   7794  H  HA   . CYS A 1 19 ? 5.998   -8.461  3.013   1.00 0.00 ? 19  CYS A HA   12 
ATOM   7795  H  HB2  . CYS A 1 19 ? 5.114   -7.015  1.175   1.00 0.00 ? 19  CYS A HB2  12 
ATOM   7796  H  HB3  . CYS A 1 19 ? 3.609   -7.926  1.238   1.00 0.00 ? 19  CYS A HB3  12 
ATOM   7797  N  N    . PRO A 1 20 ? 4.646   -10.015 4.387   1.00 0.00 ? 20  PRO A N    12 
ATOM   7798  C  CA   . PRO A 1 20 ? 3.842   -10.867 5.268   1.00 0.00 ? 20  PRO A CA   12 
ATOM   7799  C  C    . PRO A 1 20 ? 2.562   -10.180 5.730   1.00 0.00 ? 20  PRO A C    12 
ATOM   7800  O  O    . PRO A 1 20 ? 1.642   -10.828 6.228   1.00 0.00 ? 20  PRO A O    12 
ATOM   7801  C  CB   . PRO A 1 20 ? 4.771   -11.123 6.458   1.00 0.00 ? 20  PRO A CB   12 
ATOM   7802  C  CG   . PRO A 1 20 ? 5.700   -9.958  6.470   1.00 0.00 ? 20  PRO A CG   12 
ATOM   7803  C  CD   . PRO A 1 20 ? 5.891   -9.565  5.031   1.00 0.00 ? 20  PRO A CD   12 
ATOM   7804  H  HA   . PRO A 1 20 ? 3.595   -11.806 4.794   1.00 0.00 ? 20  PRO A HA   12 
ATOM   7805  H  HB2  . PRO A 1 20 ? 4.189   -11.175 7.367   1.00 0.00 ? 20  PRO A HB2  12 
ATOM   7806  H  HB3  . PRO A 1 20 ? 5.304   -12.050 6.311   1.00 0.00 ? 20  PRO A HB3  12 
ATOM   7807  H  HG2  . PRO A 1 20 ? 5.260   -9.144  7.026   1.00 0.00 ? 20  PRO A HG2  12 
ATOM   7808  H  HG3  . PRO A 1 20 ? 6.644   -10.246 6.908   1.00 0.00 ? 20  PRO A HG3  12 
ATOM   7809  H  HD2  . PRO A 1 20 ? 6.006   -8.495  4.944   1.00 0.00 ? 20  PRO A HD2  12 
ATOM   7810  H  HD3  . PRO A 1 20 ? 6.747   -10.074 4.612   1.00 0.00 ? 20  PRO A HD3  12 
ATOM   7811  N  N    . PHE A 1 21 ? 2.510   -8.862  5.561   1.00 0.00 ? 21  PHE A N    12 
ATOM   7812  C  CA   . PHE A 1 21 ? 1.342   -8.086  5.961   1.00 0.00 ? 21  PHE A CA   12 
ATOM   7813  C  C    . PHE A 1 21 ? 0.238   -8.184  4.912   1.00 0.00 ? 21  PHE A C    12 
ATOM   7814  O  O    . PHE A 1 21 ? 0.511   -8.308  3.718   1.00 0.00 ? 21  PHE A O    12 
ATOM   7815  C  CB   . PHE A 1 21 ? 1.726   -6.622  6.179   1.00 0.00 ? 21  PHE A CB   12 
ATOM   7816  C  CG   . PHE A 1 21 ? 2.610   -6.405  7.375   1.00 0.00 ? 21  PHE A CG   12 
ATOM   7817  C  CD1  . PHE A 1 21 ? 2.148   -6.677  8.652   1.00 0.00 ? 21  PHE A CD1  12 
ATOM   7818  C  CD2  . PHE A 1 21 ? 3.902   -5.930  7.221   1.00 0.00 ? 21  PHE A CD2  12 
ATOM   7819  C  CE1  . PHE A 1 21 ? 2.958   -6.479  9.755   1.00 0.00 ? 21  PHE A CE1  12 
ATOM   7820  C  CE2  . PHE A 1 21 ? 4.717   -5.731  8.319   1.00 0.00 ? 21  PHE A CE2  12 
ATOM   7821  C  CZ   . PHE A 1 21 ? 4.244   -6.004  9.587   1.00 0.00 ? 21  PHE A CZ   12 
ATOM   7822  H  H    . PHE A 1 21 ? 3.275   -8.401  5.158   1.00 0.00 ? 21  PHE A H    12 
ATOM   7823  H  HA   . PHE A 1 21 ? 0.975   -8.496  6.890   1.00 0.00 ? 21  PHE A HA   12 
ATOM   7824  H  HB2  . PHE A 1 21 ? 2.254   -6.262  5.309   1.00 0.00 ? 21  PHE A HB2  12 
ATOM   7825  H  HB3  . PHE A 1 21 ? 0.829   -6.038  6.318   1.00 0.00 ? 21  PHE A HB3  12 
ATOM   7826  H  HD1  . PHE A 1 21 ? 1.141   -7.048  8.784   1.00 0.00 ? 21  PHE A HD1  12 
ATOM   7827  H  HD2  . PHE A 1 21 ? 4.273   -5.715  6.229   1.00 0.00 ? 21  PHE A HD2  12 
ATOM   7828  H  HE1  . PHE A 1 21 ? 2.585   -6.694  10.745  1.00 0.00 ? 21  PHE A HE1  12 
ATOM   7829  H  HE2  . PHE A 1 21 ? 5.722   -5.360  8.186   1.00 0.00 ? 21  PHE A HE2  12 
ATOM   7830  H  HZ   . PHE A 1 21 ? 4.879   -5.850  10.447  1.00 0.00 ? 21  PHE A HZ   12 
ATOM   7831  N  N    . PHE A 1 22 ? -1.009  -8.126  5.366   1.00 0.00 ? 22  PHE A N    12 
ATOM   7832  C  CA   . PHE A 1 22 ? -2.155  -8.209  4.468   1.00 0.00 ? 22  PHE A CA   12 
ATOM   7833  C  C    . PHE A 1 22 ? -2.473  -6.844  3.865   1.00 0.00 ? 22  PHE A C    12 
ATOM   7834  O  O    . PHE A 1 22 ? -2.059  -5.810  4.389   1.00 0.00 ? 22  PHE A O    12 
ATOM   7835  C  CB   . PHE A 1 22 ? -3.377  -8.747  5.214   1.00 0.00 ? 22  PHE A CB   12 
ATOM   7836  C  CG   . PHE A 1 22 ? -3.168  -10.113 5.801   1.00 0.00 ? 22  PHE A CG   12 
ATOM   7837  C  CD1  . PHE A 1 22 ? -3.247  -11.244 5.004   1.00 0.00 ? 22  PHE A CD1  12 
ATOM   7838  C  CD2  . PHE A 1 22 ? -2.892  -10.268 7.150   1.00 0.00 ? 22  PHE A CD2  12 
ATOM   7839  C  CE1  . PHE A 1 22 ? -3.056  -12.502 5.542   1.00 0.00 ? 22  PHE A CE1  12 
ATOM   7840  C  CE2  . PHE A 1 22 ? -2.699  -11.524 7.694   1.00 0.00 ? 22  PHE A CE2  12 
ATOM   7841  C  CZ   . PHE A 1 22 ? -2.780  -12.643 6.888   1.00 0.00 ? 22  PHE A CZ   12 
ATOM   7842  H  H    . PHE A 1 22 ? -1.163  -8.026  6.329   1.00 0.00 ? 22  PHE A H    12 
ATOM   7843  H  HA   . PHE A 1 22 ? -1.901  -8.891  3.671   1.00 0.00 ? 22  PHE A HA   12 
ATOM   7844  H  HB2  . PHE A 1 22 ? -3.622  -8.073  6.022   1.00 0.00 ? 22  PHE A HB2  12 
ATOM   7845  H  HB3  . PHE A 1 22 ? -4.211  -8.801  4.531   1.00 0.00 ? 22  PHE A HB3  12 
ATOM   7846  H  HD1  . PHE A 1 22 ? -3.461  -11.136 3.951   1.00 0.00 ? 22  PHE A HD1  12 
ATOM   7847  H  HD2  . PHE A 1 22 ? -2.828  -9.393  7.782   1.00 0.00 ? 22  PHE A HD2  12 
ATOM   7848  H  HE1  . PHE A 1 22 ? -3.119  -13.376 4.909   1.00 0.00 ? 22  PHE A HE1  12 
ATOM   7849  H  HE2  . PHE A 1 22 ? -2.484  -11.630 8.747   1.00 0.00 ? 22  PHE A HE2  12 
ATOM   7850  H  HZ   . PHE A 1 22 ? -2.631  -13.625 7.310   1.00 0.00 ? 22  PHE A HZ   12 
ATOM   7851  N  N    . MET A 1 23 ? -3.209  -6.850  2.758   1.00 0.00 ? 23  MET A N    12 
ATOM   7852  C  CA   . MET A 1 23 ? -3.584  -5.612  2.084   1.00 0.00 ? 23  MET A CA   12 
ATOM   7853  C  C    . MET A 1 23 ? -5.019  -5.221  2.422   1.00 0.00 ? 23  MET A C    12 
ATOM   7854  O  O    . MET A 1 23 ? -5.953  -5.987  2.185   1.00 0.00 ? 23  MET A O    12 
ATOM   7855  C  CB   . MET A 1 23 ? -3.428  -5.765  0.569   1.00 0.00 ? 23  MET A CB   12 
ATOM   7856  C  CG   . MET A 1 23 ? -4.026  -7.051  0.023   1.00 0.00 ? 23  MET A CG   12 
ATOM   7857  S  SD   . MET A 1 23 ? -4.441  -6.936  -1.728  1.00 0.00 ? 23  MET A SD   12 
ATOM   7858  C  CE   . MET A 1 23 ? -3.334  -8.162  -2.419  1.00 0.00 ? 23  MET A CE   12 
ATOM   7859  H  H    . MET A 1 23 ? -3.509  -7.706  2.387   1.00 0.00 ? 23  MET A H    12 
ATOM   7860  H  HA   . MET A 1 23 ? -2.920  -4.834  2.428   1.00 0.00 ? 23  MET A HA   12 
ATOM   7861  H  HB2  . MET A 1 23 ? -3.914  -4.932  0.084   1.00 0.00 ? 23  MET A HB2  12 
ATOM   7862  H  HB3  . MET A 1 23 ? -2.376  -5.750  0.324   1.00 0.00 ? 23  MET A HB3  12 
ATOM   7863  H  HG2  . MET A 1 23 ? -3.312  -7.850  0.157   1.00 0.00 ? 23  MET A HG2  12 
ATOM   7864  H  HG3  . MET A 1 23 ? -4.924  -7.277  0.578   1.00 0.00 ? 23  MET A HG3  12 
ATOM   7865  H  HE1  . MET A 1 23 ? -3.047  -7.865  -3.418  1.00 0.00 ? 23  MET A HE1  12 
ATOM   7866  H  HE2  . MET A 1 23 ? -2.453  -8.242  -1.800  1.00 0.00 ? 23  MET A HE2  12 
ATOM   7867  H  HE3  . MET A 1 23 ? -3.835  -9.118  -2.458  1.00 0.00 ? 23  MET A HE3  12 
ATOM   7868  N  N    . SER A 1 24 ? -5.186  -4.025  2.977   1.00 0.00 ? 24  SER A N    12 
ATOM   7869  C  CA   . SER A 1 24 ? -6.507  -3.535  3.352   1.00 0.00 ? 24  SER A CA   12 
ATOM   7870  C  C    . SER A 1 24 ? -7.337  -3.208  2.114   1.00 0.00 ? 24  SER A C    12 
ATOM   7871  O  O    . SER A 1 24 ? -6.864  -3.336  0.984   1.00 0.00 ? 24  SER A O    12 
ATOM   7872  C  CB   . SER A 1 24 ? -6.381  -2.294  4.238   1.00 0.00 ? 24  SER A CB   12 
ATOM   7873  O  OG   . SER A 1 24 ? -6.277  -2.651  5.605   1.00 0.00 ? 24  SER A OG   12 
ATOM   7874  H  H    . SER A 1 24 ? -4.402  -3.461  3.141   1.00 0.00 ? 24  SER A H    12 
ATOM   7875  H  HA   . SER A 1 24 ? -7.005  -4.315  3.909   1.00 0.00 ? 24  SER A HA   12 
ATOM   7876  H  HB2  . SER A 1 24 ? -5.499  -1.740  3.954   1.00 0.00 ? 24  SER A HB2  12 
ATOM   7877  H  HB3  . SER A 1 24 ? -7.255  -1.671  4.106   1.00 0.00 ? 24  SER A HB3  12 
ATOM   7878  H  HG   . SER A 1 24 ? -6.924  -2.159  6.115   1.00 0.00 ? 24  SER A HG   12 
ATOM   7879  N  N    . VAL A 1 25 ? -8.577  -2.785  2.335   1.00 0.00 ? 25  VAL A N    12 
ATOM   7880  C  CA   . VAL A 1 25 ? -9.474  -2.438  1.239   1.00 0.00 ? 25  VAL A CA   12 
ATOM   7881  C  C    . VAL A 1 25 ? -9.113  -1.083  0.641   1.00 0.00 ? 25  VAL A C    12 
ATOM   7882  O  O    . VAL A 1 25 ? -9.462  -0.783  -0.500  1.00 0.00 ? 25  VAL A O    12 
ATOM   7883  C  CB   . VAL A 1 25 ? -10.942 -2.408  1.702   1.00 0.00 ? 25  VAL A CB   12 
ATOM   7884  C  CG1  . VAL A 1 25 ? -11.866 -2.107  0.532   1.00 0.00 ? 25  VAL A CG1  12 
ATOM   7885  C  CG2  . VAL A 1 25 ? -11.318 -3.724  2.365   1.00 0.00 ? 25  VAL A CG2  12 
ATOM   7886  H  H    . VAL A 1 25 ? -8.897  -2.703  3.258   1.00 0.00 ? 25  VAL A H    12 
ATOM   7887  H  HA   . VAL A 1 25 ? -9.375  -3.196  0.474   1.00 0.00 ? 25  VAL A HA   12 
ATOM   7888  H  HB   . VAL A 1 25 ? -11.052 -1.618  2.431   1.00 0.00 ? 25  VAL A HB   12 
ATOM   7889  H  HG11 . VAL A 1 25 ? -12.343 -1.151  0.687   1.00 0.00 ? 25  VAL A HG11 12 
ATOM   7890  H  HG12 . VAL A 1 25 ? -11.292 -2.081  -0.383  1.00 0.00 ? 25  VAL A HG12 12 
ATOM   7891  H  HG13 . VAL A 1 25 ? -12.620 -2.878  0.462   1.00 0.00 ? 25  VAL A HG13 12 
ATOM   7892  H  HG21 . VAL A 1 25 ? -10.947 -3.737  3.378   1.00 0.00 ? 25  VAL A HG21 12 
ATOM   7893  H  HG22 . VAL A 1 25 ? -12.393 -3.828  2.374   1.00 0.00 ? 25  VAL A HG22 12 
ATOM   7894  H  HG23 . VAL A 1 25 ? -10.883 -4.544  1.812   1.00 0.00 ? 25  VAL A HG23 12 
ATOM   7895  N  N    . ASN A 1 26 ? -8.410  -0.267  1.421   1.00 0.00 ? 26  ASN A N    12 
ATOM   7896  C  CA   . ASN A 1 26 ? -8.001  1.058   0.968   1.00 0.00 ? 26  ASN A CA   12 
ATOM   7897  C  C    . ASN A 1 26 ? -6.519  1.075   0.605   1.00 0.00 ? 26  ASN A C    12 
ATOM   7898  O  O    . ASN A 1 26 ? -5.998  2.081   0.123   1.00 0.00 ? 26  ASN A O    12 
ATOM   7899  C  CB   . ASN A 1 26 ? -8.284  2.100   2.053   1.00 0.00 ? 26  ASN A CB   12 
ATOM   7900  C  CG   . ASN A 1 26 ? -7.212  2.124   3.125   1.00 0.00 ? 26  ASN A CG   12 
ATOM   7901  O  OD1  . ASN A 1 26 ? -6.882  1.094   3.712   1.00 0.00 ? 26  ASN A OD1  12 
ATOM   7902  N  ND2  . ASN A 1 26 ? -6.662  3.305   3.384   1.00 0.00 ? 26  ASN A ND2  12 
ATOM   7903  H  H    . ASN A 1 26 ? -8.161  -0.562  2.321   1.00 0.00 ? 26  ASN A H    12 
ATOM   7904  H  HA   . ASN A 1 26 ? -8.578  1.301   0.089   1.00 0.00 ? 26  ASN A HA   12 
ATOM   7905  H  HB2  . ASN A 1 26 ? -8.334  3.079   1.598   1.00 0.00 ? 26  ASN A HB2  12 
ATOM   7906  H  HB3  . ASN A 1 26 ? -9.231  1.875   2.521   1.00 0.00 ? 26  ASN A HB3  12 
ATOM   7907  H  HD21 . ASN A 1 26 ? -6.975  4.083   2.877   1.00 0.00 ? 26  ASN A HD21 12 
ATOM   7908  H  HD22 . ASN A 1 26 ? -5.966  3.350   4.072   1.00 0.00 ? 26  ASN A HD22 12 
ATOM   7909  N  N    . THR A 1 27 ? -5.845  -0.046  0.840   1.00 0.00 ? 27  THR A N    12 
ATOM   7910  C  CA   . THR A 1 27 ? -4.424  -0.160  0.538   1.00 0.00 ? 27  THR A CA   12 
ATOM   7911  C  C    . THR A 1 27 ? -4.183  -1.115  -0.626  1.00 0.00 ? 27  THR A C    12 
ATOM   7912  O  O    . THR A 1 27 ? -3.173  -1.018  -1.321  1.00 0.00 ? 27  THR A O    12 
ATOM   7913  C  CB   . THR A 1 27 ? -3.627  -0.650  1.762   1.00 0.00 ? 27  THR A CB   12 
ATOM   7914  O  OG1  . THR A 1 27 ? -4.056  -1.966  2.131   1.00 0.00 ? 27  THR A OG1  12 
ATOM   7915  C  CG2  . THR A 1 27 ? -3.809  0.296   2.940   1.00 0.00 ? 27  THR A CG2  12 
ATOM   7916  H  H    . THR A 1 27 ? -6.316  -0.814  1.225   1.00 0.00 ? 27  THR A H    12 
ATOM   7917  H  HA   . THR A 1 27 ? -4.060  0.820   0.267   1.00 0.00 ? 27  THR A HA   12 
ATOM   7918  H  HB   . THR A 1 27 ? -2.579  -0.681  1.502   1.00 0.00 ? 27  THR A HB   12 
ATOM   7919  H  HG1  . THR A 1 27 ? -3.674  -2.608  1.527   1.00 0.00 ? 27  THR A HG1  12 
ATOM   7920  H  HG21 . THR A 1 27 ? -3.338  -0.126  3.815   1.00 0.00 ? 27  THR A HG21 12 
ATOM   7921  H  HG22 . THR A 1 27 ? -4.862  0.436   3.130   1.00 0.00 ? 27  THR A HG22 12 
ATOM   7922  H  HG23 . THR A 1 27 ? -3.354  1.248   2.709   1.00 0.00 ? 27  THR A HG23 12 
ATOM   7923  N  N    . GLN A 1 28 ? -5.118  -2.038  -0.831  1.00 0.00 ? 28  GLN A N    12 
ATOM   7924  C  CA   . GLN A 1 28 ? -5.007  -3.010  -1.911  1.00 0.00 ? 28  GLN A CA   12 
ATOM   7925  C  C    . GLN A 1 28 ? -4.741  -2.317  -3.243  1.00 0.00 ? 28  GLN A C    12 
ATOM   7926  O  O    . GLN A 1 28 ? -5.132  -1.170  -3.462  1.00 0.00 ? 28  GLN A O    12 
ATOM   7927  C  CB   . GLN A 1 28 ? -6.283  -3.849  -2.005  1.00 0.00 ? 28  GLN A CB   12 
ATOM   7928  C  CG   . GLN A 1 28 ? -7.466  -3.093  -2.588  1.00 0.00 ? 28  GLN A CG   12 
ATOM   7929  C  CD   . GLN A 1 28 ? -8.668  -3.985  -2.826  1.00 0.00 ? 28  GLN A CD   12 
ATOM   7930  O  OE1  . GLN A 1 28 ? -9.172  -4.082  -3.945  1.00 0.00 ? 28  GLN A OE1  12 
ATOM   7931  N  NE2  . GLN A 1 28 ? -9.136  -4.643  -1.771  1.00 0.00 ? 28  GLN A NE2  12 
ATOM   7932  H  H    . GLN A 1 28 ? -5.901  -2.065  -0.242  1.00 0.00 ? 28  GLN A H    12 
ATOM   7933  H  HA   . GLN A 1 28 ? -4.175  -3.661  -1.687  1.00 0.00 ? 28  GLN A HA   12 
ATOM   7934  H  HB2  . GLN A 1 28 ? -6.090  -4.709  -2.628  1.00 0.00 ? 28  GLN A HB2  12 
ATOM   7935  H  HB3  . GLN A 1 28 ? -6.552  -4.185  -1.014  1.00 0.00 ? 28  GLN A HB3  12 
ATOM   7936  H  HG2  . GLN A 1 28 ? -7.750  -2.309  -1.902  1.00 0.00 ? 28  GLN A HG2  12 
ATOM   7937  H  HG3  . GLN A 1 28 ? -7.168  -2.656  -3.530  1.00 0.00 ? 28  GLN A HG3  12 
ATOM   7938  H  HE21 . GLN A 1 28 ? -8.685  -4.515  -0.910  1.00 0.00 ? 28  GLN A HE21 12 
ATOM   7939  H  HE22 . GLN A 1 28 ? -9.912  -5.226  -1.896  1.00 0.00 ? 28  GLN A HE22 12 
ATOM   7940  N  N    . PRO A 1 29 ? -4.061  -3.027  -4.156  1.00 0.00 ? 29  PRO A N    12 
ATOM   7941  C  CA   . PRO A 1 29 ? -3.591  -4.392  -3.906  1.00 0.00 ? 29  PRO A CA   12 
ATOM   7942  C  C    . PRO A 1 29 ? -2.461  -4.439  -2.884  1.00 0.00 ? 29  PRO A C    12 
ATOM   7943  O  O    . PRO A 1 29 ? -2.103  -5.508  -2.387  1.00 0.00 ? 29  PRO A O    12 
ATOM   7944  C  CB   . PRO A 1 29 ? -3.091  -4.852  -5.278  1.00 0.00 ? 29  PRO A CB   12 
ATOM   7945  C  CG   . PRO A 1 29 ? -2.733  -3.594  -5.991  1.00 0.00 ? 29  PRO A CG   12 
ATOM   7946  C  CD   . PRO A 1 29 ? -3.698  -2.550  -5.501  1.00 0.00 ? 29  PRO A CD   12 
ATOM   7947  H  HA   . PRO A 1 29 ? -4.396  -5.036  -3.581  1.00 0.00 ? 29  PRO A HA   12 
ATOM   7948  H  HB2  . PRO A 1 29 ? -2.231  -5.495  -5.154  1.00 0.00 ? 29  PRO A HB2  12 
ATOM   7949  H  HB3  . PRO A 1 29 ? -3.876  -5.386  -5.791  1.00 0.00 ? 29  PRO A HB3  12 
ATOM   7950  H  HG2  . PRO A 1 29 ? -1.720  -3.310  -5.749  1.00 0.00 ? 29  PRO A HG2  12 
ATOM   7951  H  HG3  . PRO A 1 29 ? -2.841  -3.732  -7.057  1.00 0.00 ? 29  PRO A HG3  12 
ATOM   7952  H  HD2  . PRO A 1 29 ? -3.218  -1.585  -5.451  1.00 0.00 ? 29  PRO A HD2  12 
ATOM   7953  H  HD3  . PRO A 1 29 ? -4.567  -2.509  -6.142  1.00 0.00 ? 29  PRO A HD3  12 
ATOM   7954  N  N    . LEU A 1 30 ? -1.902  -3.274  -2.573  1.00 0.00 ? 30  LEU A N    12 
ATOM   7955  C  CA   . LEU A 1 30 ? -0.812  -3.182  -1.609  1.00 0.00 ? 30  LEU A CA   12 
ATOM   7956  C  C    . LEU A 1 30 ? -1.351  -3.060  -0.187  1.00 0.00 ? 30  LEU A C    12 
ATOM   7957  O  O    . LEU A 1 30 ? -2.561  -2.967  0.024   1.00 0.00 ? 30  LEU A O    12 
ATOM   7958  C  CB   . LEU A 1 30 ? 0.081   -1.983  -1.932  1.00 0.00 ? 30  LEU A CB   12 
ATOM   7959  C  CG   . LEU A 1 30 ? 0.926   -2.098  -3.201  1.00 0.00 ? 30  LEU A CG   12 
ATOM   7960  C  CD1  . LEU A 1 30 ? 1.522   -0.749  -3.571  1.00 0.00 ? 30  LEU A CD1  12 
ATOM   7961  C  CD2  . LEU A 1 30 ? 2.024   -3.136  -3.019  1.00 0.00 ? 30  LEU A CD2  12 
ATOM   7962  H  H    . LEU A 1 30 ? -2.230  -2.457  -3.002  1.00 0.00 ? 30  LEU A H    12 
ATOM   7963  H  HA   . LEU A 1 30 ? -0.227  -4.087  -1.683  1.00 0.00 ? 30  LEU A HA   12 
ATOM   7964  H  HB2  . LEU A 1 30 ? -0.554  -1.116  -2.036  1.00 0.00 ? 30  LEU A HB2  12 
ATOM   7965  H  HB3  . LEU A 1 30 ? 0.753   -1.837  -1.098  1.00 0.00 ? 30  LEU A HB3  12 
ATOM   7966  H  HG   . LEU A 1 30 ? 0.295   -2.419  -4.019  1.00 0.00 ? 30  LEU A HG   12 
ATOM   7967  H  HD11 . LEU A 1 30 ? 2.291   -0.886  -4.315  1.00 0.00 ? 30  LEU A HD11 12 
ATOM   7968  H  HD12 . LEU A 1 30 ? 1.950   -0.292  -2.691  1.00 0.00 ? 30  LEU A HD12 12 
ATOM   7969  H  HD13 . LEU A 1 30 ? 0.747   -0.109  -3.967  1.00 0.00 ? 30  LEU A HD13 12 
ATOM   7970  H  HD21 . LEU A 1 30 ? 2.474   -3.356  -3.975  1.00 0.00 ? 30  LEU A HD21 12 
ATOM   7971  H  HD22 . LEU A 1 30 ? 1.600   -4.038  -2.603  1.00 0.00 ? 30  LEU A HD22 12 
ATOM   7972  H  HD23 . LEU A 1 30 ? 2.776   -2.749  -2.346  1.00 0.00 ? 30  LEU A HD23 12 
ATOM   7973  N  N    . CYS A 1 31 ? -0.446  -3.059  0.785   1.00 0.00 ? 31  CYS A N    12 
ATOM   7974  C  CA   . CYS A 1 31 ? -0.829  -2.946  2.188   1.00 0.00 ? 31  CYS A CA   12 
ATOM   7975  C  C    . CYS A 1 31 ? -0.538  -1.546  2.720   1.00 0.00 ? 31  CYS A C    12 
ATOM   7976  O  O    . CYS A 1 31 ? -0.021  -0.691  2.001   1.00 0.00 ? 31  CYS A O    12 
ATOM   7977  C  CB   . CYS A 1 31 ? -0.086  -3.988  3.026   1.00 0.00 ? 31  CYS A CB   12 
ATOM   7978  S  SG   . CYS A 1 31 ? 1.637   -3.539  3.414   1.00 0.00 ? 31  CYS A SG   12 
ATOM   7979  H  H    . CYS A 1 31 ? 0.505   -3.136  0.555   1.00 0.00 ? 31  CYS A H    12 
ATOM   7980  H  HA   . CYS A 1 31 ? -1.890  -3.131  2.258   1.00 0.00 ? 31  CYS A HA   12 
ATOM   7981  H  HB2  . CYS A 1 31 ? -0.607  -4.124  3.962   1.00 0.00 ? 31  CYS A HB2  12 
ATOM   7982  H  HB3  . CYS A 1 31 ? -0.069  -4.925  2.490   1.00 0.00 ? 31  CYS A HB3  12 
ATOM   7983  N  N    . HIS A 1 32 ? -0.873  -1.319  3.987   1.00 0.00 ? 32  HIS A N    12 
ATOM   7984  C  CA   . HIS A 1 32 ? -0.647  -0.024  4.617   1.00 0.00 ? 32  HIS A CA   12 
ATOM   7985  C  C    . HIS A 1 32 ? 0.816   0.392   4.494   1.00 0.00 ? 32  HIS A C    12 
ATOM   7986  O  O    . HIS A 1 32 ? 1.119   1.535   4.152   1.00 0.00 ? 32  HIS A O    12 
ATOM   7987  C  CB   . HIS A 1 32 ? -1.054  -0.071  6.090   1.00 0.00 ? 32  HIS A CB   12 
ATOM   7988  C  CG   . HIS A 1 32 ? -1.522  1.247   6.625   1.00 0.00 ? 32  HIS A CG   12 
ATOM   7989  N  ND1  . HIS A 1 32 ? -2.393  1.361   7.688   1.00 0.00 ? 32  HIS A ND1  12 
ATOM   7990  C  CD2  . HIS A 1 32 ? -1.233  2.512   6.239   1.00 0.00 ? 32  HIS A CD2  12 
ATOM   7991  C  CE1  . HIS A 1 32 ? -2.622  2.639   7.931   1.00 0.00 ? 32  HIS A CE1  12 
ATOM   7992  N  NE2  . HIS A 1 32 ? -1.929  3.358   7.066   1.00 0.00 ? 32  HIS A NE2  12 
ATOM   7993  H  H    . HIS A 1 32 ? -1.281  -2.041  4.509   1.00 0.00 ? 32  HIS A H    12 
ATOM   7994  H  HA   . HIS A 1 32 ? -1.259  0.704   4.107   1.00 0.00 ? 32  HIS A HA   12 
ATOM   7995  H  HB2  . HIS A 1 32 ? -1.858  -0.782  6.212   1.00 0.00 ? 32  HIS A HB2  12 
ATOM   7996  H  HB3  . HIS A 1 32 ? -0.207  -0.389  6.681   1.00 0.00 ? 32  HIS A HB3  12 
ATOM   7997  H  HD1  . HIS A 1 32 ? -2.787  0.616   8.188   1.00 0.00 ? 32  HIS A HD1  12 
ATOM   7998  H  HD2  . HIS A 1 32 ? -0.578  2.802   5.430   1.00 0.00 ? 32  HIS A HD2  12 
ATOM   7999  H  HE1  . HIS A 1 32 ? -3.265  3.030   8.705   1.00 0.00 ? 32  HIS A HE1  12 
ATOM   8000  N  N    . GLU A 1 33 ? 1.718   -0.543  4.777   1.00 0.00 ? 33  GLU A N    12 
ATOM   8001  C  CA   . GLU A 1 33 ? 3.148   -0.271  4.700   1.00 0.00 ? 33  GLU A CA   12 
ATOM   8002  C  C    . GLU A 1 33 ? 3.557   0.091   3.275   1.00 0.00 ? 33  GLU A C    12 
ATOM   8003  O  O    . GLU A 1 33 ? 3.910   1.236   2.990   1.00 0.00 ? 33  GLU A O    12 
ATOM   8004  C  CB   . GLU A 1 33 ? 3.947   -1.486  5.178   1.00 0.00 ? 33  GLU A CB   12 
ATOM   8005  C  CG   . GLU A 1 33 ? 3.888   -1.700  6.681   1.00 0.00 ? 33  GLU A CG   12 
ATOM   8006  C  CD   . GLU A 1 33 ? 4.127   -0.422  7.462   1.00 0.00 ? 33  GLU A CD   12 
ATOM   8007  O  OE1  . GLU A 1 33 ? 5.302   -0.118  7.756   1.00 0.00 ? 33  GLU A OE1  12 
ATOM   8008  O  OE2  . GLU A 1 33 ? 3.140   0.274   7.778   1.00 0.00 ? 33  GLU A OE2  12 
ATOM   8009  H  H    . GLU A 1 33 ? 1.414   -1.435  5.044   1.00 0.00 ? 33  GLU A H    12 
ATOM   8010  H  HA   . GLU A 1 33 ? 3.363   0.566   5.347   1.00 0.00 ? 33  GLU A HA   12 
ATOM   8011  H  HB2  . GLU A 1 33 ? 3.560   -2.370  4.693   1.00 0.00 ? 33  GLU A HB2  12 
ATOM   8012  H  HB3  . GLU A 1 33 ? 4.981   -1.355  4.894   1.00 0.00 ? 33  GLU A HB3  12 
ATOM   8013  H  HG2  . GLU A 1 33 ? 2.913   -2.084  6.939   1.00 0.00 ? 33  GLU A HG2  12 
ATOM   8014  H  HG3  . GLU A 1 33 ? 4.643   -2.420  6.959   1.00 0.00 ? 33  GLU A HG3  12 
ATOM   8015  N  N    . CYS A 1 34 ? 3.508   -0.892  2.383   1.00 0.00 ? 34  CYS A N    12 
ATOM   8016  C  CA   . CYS A 1 34 ? 3.873   -0.680  0.988   1.00 0.00 ? 34  CYS A CA   12 
ATOM   8017  C  C    . CYS A 1 34 ? 3.111   0.505   0.401   1.00 0.00 ? 34  CYS A C    12 
ATOM   8018  O  O    . CYS A 1 34 ? 3.708   1.427   -0.153  1.00 0.00 ? 34  CYS A O    12 
ATOM   8019  C  CB   . CYS A 1 34 ? 3.591   -1.940  0.167   1.00 0.00 ? 34  CYS A CB   12 
ATOM   8020  S  SG   . CYS A 1 34 ? 4.414   -3.438  0.798   1.00 0.00 ? 34  CYS A SG   12 
ATOM   8021  H  H    . CYS A 1 34 ? 3.218   -1.785  2.670   1.00 0.00 ? 34  CYS A H    12 
ATOM   8022  H  HA   . CYS A 1 34 ? 4.930   -0.466  0.951   1.00 0.00 ? 34  CYS A HA   12 
ATOM   8023  H  HB2  . CYS A 1 34 ? 2.527   -2.127  0.164   1.00 0.00 ? 34  CYS A HB2  12 
ATOM   8024  H  HB3  . CYS A 1 34 ? 3.926   -1.782  -0.847  1.00 0.00 ? 34  CYS A HB3  12 
ATOM   8025  N  N    . SER A 1 35 ? 1.788   0.471   0.526   1.00 0.00 ? 35  SER A N    12 
ATOM   8026  C  CA   . SER A 1 35 ? 0.943   1.539   0.005   1.00 0.00 ? 35  SER A CA   12 
ATOM   8027  C  C    . SER A 1 35 ? 1.628   2.895   0.153   1.00 0.00 ? 35  SER A C    12 
ATOM   8028  O  O    . SER A 1 35 ? 1.996   3.527   -0.836  1.00 0.00 ? 35  SER A O    12 
ATOM   8029  C  CB   . SER A 1 35 ? -0.403  1.553   0.731   1.00 0.00 ? 35  SER A CB   12 
ATOM   8030  O  OG   . SER A 1 35 ? -1.163  2.695   0.375   1.00 0.00 ? 35  SER A OG   12 
ATOM   8031  H  H    . SER A 1 35 ? 1.370   -0.292  0.978   1.00 0.00 ? 35  SER A H    12 
ATOM   8032  H  HA   . SER A 1 35 ? 0.775   1.347   -1.044  1.00 0.00 ? 35  SER A HA   12 
ATOM   8033  H  HB2  . SER A 1 35 ? -0.962  0.668   0.466   1.00 0.00 ? 35  SER A HB2  12 
ATOM   8034  H  HB3  . SER A 1 35 ? -0.234  1.567   1.798   1.00 0.00 ? 35  SER A HB3  12 
ATOM   8035  H  HG   . SER A 1 35 ? -1.300  3.244   1.151   1.00 0.00 ? 35  SER A HG   12 
ATOM   8036  N  N    . GLU A 1 36 ? 1.795   3.333   1.397   1.00 0.00 ? 36  GLU A N    12 
ATOM   8037  C  CA   . GLU A 1 36 ? 2.434   4.614   1.675   1.00 0.00 ? 36  GLU A CA   12 
ATOM   8038  C  C    . GLU A 1 36 ? 3.900   4.594   1.249   1.00 0.00 ? 36  GLU A C    12 
ATOM   8039  O  O    . GLU A 1 36 ? 4.404   5.562   0.679   1.00 0.00 ? 36  GLU A O    12 
ATOM   8040  C  CB   . GLU A 1 36 ? 2.329   4.949   3.164   1.00 0.00 ? 36  GLU A CB   12 
ATOM   8041  C  CG   . GLU A 1 36 ? 3.003   3.929   4.067   1.00 0.00 ? 36  GLU A CG   12 
ATOM   8042  C  CD   . GLU A 1 36 ? 4.513   4.070   4.081   1.00 0.00 ? 36  GLU A CD   12 
ATOM   8043  O  OE1  . GLU A 1 36 ? 5.001   5.198   4.300   1.00 0.00 ? 36  GLU A OE1  12 
ATOM   8044  O  OE2  . GLU A 1 36 ? 5.206   3.052   3.873   1.00 0.00 ? 36  GLU A OE2  12 
ATOM   8045  H  H    . GLU A 1 36 ? 1.480   2.784   2.145   1.00 0.00 ? 36  GLU A H    12 
ATOM   8046  H  HA   . GLU A 1 36 ? 1.917   5.373   1.108   1.00 0.00 ? 36  GLU A HA   12 
ATOM   8047  H  HB2  . GLU A 1 36 ? 2.788   5.911   3.338   1.00 0.00 ? 36  GLU A HB2  12 
ATOM   8048  H  HB3  . GLU A 1 36 ? 1.285   5.004   3.435   1.00 0.00 ? 36  GLU A HB3  12 
ATOM   8049  H  HG2  . GLU A 1 36 ? 2.635   4.059   5.073   1.00 0.00 ? 36  GLU A HG2  12 
ATOM   8050  H  HG3  . GLU A 1 36 ? 2.752   2.938   3.718   1.00 0.00 ? 36  GLU A HG3  12 
ATOM   8051  N  N    . ARG A 1 37 ? 4.576   3.486   1.530   1.00 0.00 ? 37  ARG A N    12 
ATOM   8052  C  CA   . ARG A 1 37 ? 5.984   3.340   1.178   1.00 0.00 ? 37  ARG A CA   12 
ATOM   8053  C  C    . ARG A 1 37 ? 6.254   3.886   -0.221  1.00 0.00 ? 37  ARG A C    12 
ATOM   8054  O  O    . ARG A 1 37 ? 7.224   4.612   -0.438  1.00 0.00 ? 37  ARG A O    12 
ATOM   8055  C  CB   . ARG A 1 37 ? 6.400   1.870   1.252   1.00 0.00 ? 37  ARG A CB   12 
ATOM   8056  C  CG   . ARG A 1 37 ? 7.897   1.668   1.425   1.00 0.00 ? 37  ARG A CG   12 
ATOM   8057  C  CD   . ARG A 1 37 ? 8.661   2.067   0.172   1.00 0.00 ? 37  ARG A CD   12 
ATOM   8058  N  NE   . ARG A 1 37 ? 9.998   1.479   0.136   1.00 0.00 ? 37  ARG A NE   12 
ATOM   8059  C  CZ   . ARG A 1 37 ? 10.228  0.192   -0.097  1.00 0.00 ? 37  ARG A CZ   12 
ATOM   8060  N  NH1  . ARG A 1 37 ? 9.217   -0.638  -0.315  1.00 0.00 ? 37  ARG A NH1  12 
ATOM   8061  N  NH2  . ARG A 1 37 ? 11.473  -0.268  -0.114  1.00 0.00 ? 37  ARG A NH2  12 
ATOM   8062  H  H    . ARG A 1 37 ? 4.119   2.748   1.985   1.00 0.00 ? 37  ARG A H    12 
ATOM   8063  H  HA   . ARG A 1 37 ? 6.564   3.905   1.891   1.00 0.00 ? 37  ARG A HA   12 
ATOM   8064  H  HB2  . ARG A 1 37 ? 5.898   1.407   2.088   1.00 0.00 ? 37  ARG A HB2  12 
ATOM   8065  H  HB3  . ARG A 1 37 ? 6.096   1.376   0.341   1.00 0.00 ? 37  ARG A HB3  12 
ATOM   8066  H  HG2  . ARG A 1 37 ? 8.239   2.276   2.250   1.00 0.00 ? 37  ARG A HG2  12 
ATOM   8067  H  HG3  . ARG A 1 37 ? 8.088   0.627   1.638   1.00 0.00 ? 37  ARG A HG3  12 
ATOM   8068  H  HD2  . ARG A 1 37 ? 8.108   1.732   -0.693  1.00 0.00 ? 37  ARG A HD2  12 
ATOM   8069  H  HD3  . ARG A 1 37 ? 8.750   3.142   0.148   1.00 0.00 ? 37  ARG A HD3  12 
ATOM   8070  H  HE   . ARG A 1 37 ? 10.759  2.074   0.294   1.00 0.00 ? 37  ARG A HE   12 
ATOM   8071  H  HH11 . ARG A 1 37 ? 8.278   -0.294  -0.304  1.00 0.00 ? 37  ARG A HH11 12 
ATOM   8072  H  HH12 . ARG A 1 37 ? 9.393   -1.606  -0.491  1.00 0.00 ? 37  ARG A HH12 12 
ATOM   8073  H  HH21 . ARG A 1 37 ? 12.238  0.354   0.050   1.00 0.00 ? 37  ARG A HH21 12 
ATOM   8074  H  HH22 . ARG A 1 37 ? 11.645  -1.237  -0.289  1.00 0.00 ? 37  ARG A HH22 12 
ATOM   8075  N  N    . ARG A 1 38 ? 5.389   3.533   -1.166  1.00 0.00 ? 38  ARG A N    12 
ATOM   8076  C  CA   . ARG A 1 38 ? 5.535   3.986   -2.544  1.00 0.00 ? 38  ARG A CA   12 
ATOM   8077  C  C    . ARG A 1 38 ? 5.395   5.503   -2.635  1.00 0.00 ? 38  ARG A C    12 
ATOM   8078  O  O    . ARG A 1 38 ? 6.314   6.195   -3.074  1.00 0.00 ? 38  ARG A O    12 
ATOM   8079  C  CB   . ARG A 1 38 ? 4.493   3.312   -3.438  1.00 0.00 ? 38  ARG A CB   12 
ATOM   8080  C  CG   . ARG A 1 38 ? 4.864   3.310   -4.912  1.00 0.00 ? 38  ARG A CG   12 
ATOM   8081  C  CD   . ARG A 1 38 ? 3.678   2.932   -5.785  1.00 0.00 ? 38  ARG A CD   12 
ATOM   8082  N  NE   . ARG A 1 38 ? 2.906   4.101   -6.196  1.00 0.00 ? 38  ARG A NE   12 
ATOM   8083  C  CZ   . ARG A 1 38 ? 3.235   4.876   -7.223  1.00 0.00 ? 38  ARG A CZ   12 
ATOM   8084  N  NH1  . ARG A 1 38 ? 4.318   4.607   -7.940  1.00 0.00 ? 38  ARG A NH1  12 
ATOM   8085  N  NH2  . ARG A 1 38 ? 2.481   5.922   -7.535  1.00 0.00 ? 38  ARG A NH2  12 
ATOM   8086  H  H    . ARG A 1 38 ? 4.635   2.952   -0.932  1.00 0.00 ? 38  ARG A H    12 
ATOM   8087  H  HA   . ARG A 1 38 ? 6.521   3.706   -2.883  1.00 0.00 ? 38  ARG A HA   12 
ATOM   8088  H  HB2  . ARG A 1 38 ? 4.370   2.288   -3.119  1.00 0.00 ? 38  ARG A HB2  12 
ATOM   8089  H  HB3  . ARG A 1 38 ? 3.552   3.831   -3.327  1.00 0.00 ? 38  ARG A HB3  12 
ATOM   8090  H  HG2  . ARG A 1 38 ? 5.201   4.298   -5.190  1.00 0.00 ? 38  ARG A HG2  12 
ATOM   8091  H  HG3  . ARG A 1 38 ? 5.660   2.599   -5.072  1.00 0.00 ? 38  ARG A HG3  12 
ATOM   8092  H  HD2  . ARG A 1 38 ? 4.044   2.426   -6.667  1.00 0.00 ? 38  ARG A HD2  12 
ATOM   8093  H  HD3  . ARG A 1 38 ? 3.037   2.265   -5.228  1.00 0.00 ? 38  ARG A HD3  12 
ATOM   8094  H  HE   . ARG A 1 38 ? 2.102   4.318   -5.680  1.00 0.00 ? 38  ARG A HE   12 
ATOM   8095  H  HH11 . ARG A 1 38 ? 4.887   3.819   -7.708  1.00 0.00 ? 38  ARG A HH11 12 
ATOM   8096  H  HH12 . ARG A 1 38 ? 4.563   5.192   -8.713  1.00 0.00 ? 38  ARG A HH12 12 
ATOM   8097  H  HH21 . ARG A 1 38 ? 1.665   6.128   -6.997  1.00 0.00 ? 38  ARG A HH21 12 
ATOM   8098  H  HH22 . ARG A 1 38 ? 2.731   6.505   -8.308  1.00 0.00 ? 38  ARG A HH22 12 
ATOM   8099  N  N    . GLN A 1 39 ? 4.240   6.011   -2.218  1.00 0.00 ? 39  GLN A N    12 
ATOM   8100  C  CA   . GLN A 1 39 ? 3.980   7.446   -2.254  1.00 0.00 ? 39  GLN A CA   12 
ATOM   8101  C  C    . GLN A 1 39 ? 5.190   8.231   -1.756  1.00 0.00 ? 39  GLN A C    12 
ATOM   8102  O  O    . GLN A 1 39 ? 5.570   9.244   -2.342  1.00 0.00 ? 39  GLN A O    12 
ATOM   8103  C  CB   . GLN A 1 39 ? 2.753   7.784   -1.406  1.00 0.00 ? 39  GLN A CB   12 
ATOM   8104  C  CG   . GLN A 1 39 ? 1.434   7.549   -2.123  1.00 0.00 ? 39  GLN A CG   12 
ATOM   8105  C  CD   . GLN A 1 39 ? 1.138   8.611   -3.164  1.00 0.00 ? 39  GLN A CD   12 
ATOM   8106  O  OE1  . GLN A 1 39 ? 2.040   9.093   -3.850  1.00 0.00 ? 39  GLN A OE1  12 
ATOM   8107  N  NE2  . GLN A 1 39 ? -0.131  8.983   -3.287  1.00 0.00 ? 39  GLN A NE2  12 
ATOM   8108  H  H    . GLN A 1 39 ? 3.547   5.408   -1.879  1.00 0.00 ? 39  GLN A H    12 
ATOM   8109  H  HA   . GLN A 1 39 ? 3.785   7.721   -3.279  1.00 0.00 ? 39  GLN A HA   12 
ATOM   8110  H  HB2  . GLN A 1 39 ? 2.767   7.175   -0.514  1.00 0.00 ? 39  GLN A HB2  12 
ATOM   8111  H  HB3  . GLN A 1 39 ? 2.803   8.825   -1.122  1.00 0.00 ? 39  GLN A HB3  12 
ATOM   8112  H  HG2  . GLN A 1 39 ? 1.472   6.588   -2.614  1.00 0.00 ? 39  GLN A HG2  12 
ATOM   8113  H  HG3  . GLN A 1 39 ? 0.638   7.549   -1.394  1.00 0.00 ? 39  GLN A HG3  12 
ATOM   8114  H  HE21 . GLN A 1 39 ? -0.796  8.557   -2.705  1.00 0.00 ? 39  GLN A HE21 12 
ATOM   8115  H  HE22 . GLN A 1 39 ? -0.350  9.668   -3.951  1.00 0.00 ? 39  GLN A HE22 12 
ATOM   8116  N  N    . LYS A 1 40 ? 5.791   7.756   -0.670  1.00 0.00 ? 40  LYS A N    12 
ATOM   8117  C  CA   . LYS A 1 40 ? 6.958   8.412   -0.093  1.00 0.00 ? 40  LYS A CA   12 
ATOM   8118  C  C    . LYS A 1 40 ? 7.966   8.781   -1.176  1.00 0.00 ? 40  LYS A C    12 
ATOM   8119  O  O    . LYS A 1 40 ? 8.448   9.912   -1.228  1.00 0.00 ? 40  LYS A O    12 
ATOM   8120  C  CB   . LYS A 1 40 ? 7.619   7.501   0.945   1.00 0.00 ? 40  LYS A CB   12 
ATOM   8121  C  CG   . LYS A 1 40 ? 8.945   8.031   1.462   1.00 0.00 ? 40  LYS A CG   12 
ATOM   8122  C  CD   . LYS A 1 40 ? 10.107  7.561   0.604   1.00 0.00 ? 40  LYS A CD   12 
ATOM   8123  C  CE   . LYS A 1 40 ? 11.392  7.463   1.411   1.00 0.00 ? 40  LYS A CE   12 
ATOM   8124  N  NZ   . LYS A 1 40 ? 12.059  8.786   1.555   1.00 0.00 ? 40  LYS A NZ   12 
ATOM   8125  H  H    . LYS A 1 40 ? 5.441   6.943   -0.247  1.00 0.00 ? 40  LYS A H    12 
ATOM   8126  H  HA   . LYS A 1 40 ? 6.624   9.315   0.395   1.00 0.00 ? 40  LYS A HA   12 
ATOM   8127  H  HB2  . LYS A 1 40 ? 6.949   7.386   1.784   1.00 0.00 ? 40  LYS A HB2  12 
ATOM   8128  H  HB3  . LYS A 1 40 ? 7.792   6.533   0.498   1.00 0.00 ? 40  LYS A HB3  12 
ATOM   8129  H  HG2  . LYS A 1 40 ? 8.919   9.111   1.454   1.00 0.00 ? 40  LYS A HG2  12 
ATOM   8130  H  HG3  . LYS A 1 40 ? 9.092   7.681   2.474   1.00 0.00 ? 40  LYS A HG3  12 
ATOM   8131  H  HD2  . LYS A 1 40 ? 9.874   6.587   0.200   1.00 0.00 ? 40  LYS A HD2  12 
ATOM   8132  H  HD3  . LYS A 1 40 ? 10.253  8.263   -0.205  1.00 0.00 ? 40  LYS A HD3  12 
ATOM   8133  H  HE2  . LYS A 1 40 ? 11.157  7.079   2.392   1.00 0.00 ? 40  LYS A HE2  12 
ATOM   8134  H  HE3  . LYS A 1 40 ? 12.065  6.782   0.910   1.00 0.00 ? 40  LYS A HE3  12 
ATOM   8135  H  HZ1  . LYS A 1 40 ? 12.485  8.871   2.500   1.00 0.00 ? 40  LYS A HZ1  12 
ATOM   8136  H  HZ2  . LYS A 1 40 ? 11.366  9.551   1.430   1.00 0.00 ? 40  LYS A HZ2  12 
ATOM   8137  H  HZ3  . LYS A 1 40 ? 12.806  8.890   0.839   1.00 0.00 ? 40  LYS A HZ3  12 
ATOM   8138  N  N    . ASN A 1 41 ? 8.278   7.821   -2.040  1.00 0.00 ? 41  ASN A N    12 
ATOM   8139  C  CA   . ASN A 1 41 ? 9.228   8.046   -3.123  1.00 0.00 ? 41  ASN A CA   12 
ATOM   8140  C  C    . ASN A 1 41 ? 8.746   9.161   -4.046  1.00 0.00 ? 41  ASN A C    12 
ATOM   8141  O  O    . ASN A 1 41 ? 7.593   9.585   -3.973  1.00 0.00 ? 41  ASN A O    12 
ATOM   8142  C  CB   . ASN A 1 41 ? 9.436   6.759   -3.924  1.00 0.00 ? 41  ASN A CB   12 
ATOM   8143  C  CG   . ASN A 1 41 ? 8.368   6.558   -4.981  1.00 0.00 ? 41  ASN A CG   12 
ATOM   8144  O  OD1  . ASN A 1 41 ? 7.341   7.238   -4.980  1.00 0.00 ? 41  ASN A OD1  12 
ATOM   8145  N  ND2  . ASN A 1 41 ? 8.605   5.619   -5.890  1.00 0.00 ? 41  ASN A ND2  12 
ATOM   8146  H  H    . ASN A 1 41 ? 7.860   6.939   -1.947  1.00 0.00 ? 41  ASN A H    12 
ATOM   8147  H  HA   . ASN A 1 41 ? 10.169  8.341   -2.683  1.00 0.00 ? 41  ASN A HA   12 
ATOM   8148  H  HB2  . ASN A 1 41 ? 10.397  6.799   -4.414  1.00 0.00 ? 41  ASN A HB2  12 
ATOM   8149  H  HB3  . ASN A 1 41 ? 9.414   5.916   -3.251  1.00 0.00 ? 41  ASN A HB3  12 
ATOM   8150  H  HD21 . ASN A 1 41 ? 9.444   5.116   -5.829  1.00 0.00 ? 41  ASN A HD21 12 
ATOM   8151  H  HD22 . ASN A 1 41 ? 7.931   5.468   -6.586  1.00 0.00 ? 41  ASN A HD22 12 
ATOM   8152  N  N    . GLN A 1 42 ? 9.637   9.629   -4.915  1.00 0.00 ? 42  GLN A N    12 
ATOM   8153  C  CA   . GLN A 1 42 ? 9.302   10.695  -5.852  1.00 0.00 ? 42  GLN A CA   12 
ATOM   8154  C  C    . GLN A 1 42 ? 8.234   10.235  -6.840  1.00 0.00 ? 42  GLN A C    12 
ATOM   8155  O  O    . GLN A 1 42 ? 7.837   9.070   -6.842  1.00 0.00 ? 42  GLN A O    12 
ATOM   8156  C  CB   . GLN A 1 42 ? 10.551  11.149  -6.609  1.00 0.00 ? 42  GLN A CB   12 
ATOM   8157  C  CG   . GLN A 1 42 ? 11.675  11.619  -5.700  1.00 0.00 ? 42  GLN A CG   12 
ATOM   8158  C  CD   . GLN A 1 42 ? 11.398  12.977  -5.085  1.00 0.00 ? 42  GLN A CD   12 
ATOM   8159  O  OE1  . GLN A 1 42 ? 10.822  13.856  -5.726  1.00 0.00 ? 42  GLN A OE1  12 
ATOM   8160  N  NE2  . GLN A 1 42 ? 11.808  13.155  -3.835  1.00 0.00 ? 42  GLN A NE2  12 
ATOM   8161  H  H    . GLN A 1 42 ? 10.540  9.250   -4.925  1.00 0.00 ? 42  GLN A H    12 
ATOM   8162  H  HA   . GLN A 1 42 ? 8.914   11.526  -5.284  1.00 0.00 ? 42  GLN A HA   12 
ATOM   8163  H  HB2  . GLN A 1 42 ? 10.918  10.324  -7.202  1.00 0.00 ? 42  GLN A HB2  12 
ATOM   8164  H  HB3  . GLN A 1 42 ? 10.283  11.963  -7.266  1.00 0.00 ? 42  GLN A HB3  12 
ATOM   8165  H  HG2  . GLN A 1 42 ? 11.803  10.901  -4.905  1.00 0.00 ? 42  GLN A HG2  12 
ATOM   8166  H  HG3  . GLN A 1 42 ? 12.586  11.681  -6.278  1.00 0.00 ? 42  GLN A HG3  12 
ATOM   8167  H  HE21 . GLN A 1 42 ? 12.261  12.411  -3.386  1.00 0.00 ? 42  GLN A HE21 12 
ATOM   8168  H  HE22 . GLN A 1 42 ? 11.643  14.023  -3.413  1.00 0.00 ? 42  GLN A HE22 12 
ATOM   8169  N  N    . ASN A 1 43 ? 7.773   11.158  -7.677  1.00 0.00 ? 43  ASN A N    12 
ATOM   8170  C  CA   . ASN A 1 43 ? 6.750   10.847  -8.669  1.00 0.00 ? 43  ASN A CA   12 
ATOM   8171  C  C    . ASN A 1 43 ? 7.006   11.602  -9.970  1.00 0.00 ? 43  ASN A C    12 
ATOM   8172  O  O    . ASN A 1 43 ? 7.613   12.673  -9.969  1.00 0.00 ? 43  ASN A O    12 
ATOM   8173  C  CB   . ASN A 1 43 ? 5.362   11.197  -8.129  1.00 0.00 ? 43  ASN A CB   12 
ATOM   8174  C  CG   . ASN A 1 43 ? 5.350   12.516  -7.380  1.00 0.00 ? 43  ASN A CG   12 
ATOM   8175  O  OD1  . ASN A 1 43 ? 5.023   13.560  -7.945  1.00 0.00 ? 43  ASN A OD1  12 
ATOM   8176  N  ND2  . ASN A 1 43 ? 5.707   12.474  -6.102  1.00 0.00 ? 43  ASN A ND2  12 
ATOM   8177  H  H    . ASN A 1 43 ? 8.128   12.070  -7.627  1.00 0.00 ? 43  ASN A H    12 
ATOM   8178  H  HA   . ASN A 1 43 ? 6.792   9.787   -8.867  1.00 0.00 ? 43  ASN A HA   12 
ATOM   8179  H  HB2  . ASN A 1 43 ? 4.668   11.267  -8.954  1.00 0.00 ? 43  ASN A HB2  12 
ATOM   8180  H  HB3  . ASN A 1 43 ? 5.037   10.419  -7.455  1.00 0.00 ? 43  ASN A HB3  12 
ATOM   8181  H  HD21 . ASN A 1 43 ? 5.955   11.607  -5.718  1.00 0.00 ? 43  ASN A HD21 12 
ATOM   8182  H  HD22 . ASN A 1 43 ? 5.707   13.313  -5.594  1.00 0.00 ? 43  ASN A HD22 12 
ATOM   8183  N  N    . SER A 1 44 ? 6.540   11.035  -11.079 1.00 0.00 ? 44  SER A N    12 
ATOM   8184  C  CA   . SER A 1 44 ? 6.722   11.652  -12.387 1.00 0.00 ? 44  SER A CA   12 
ATOM   8185  C  C    . SER A 1 44 ? 8.203   11.763  -12.735 1.00 0.00 ? 44  SER A C    12 
ATOM   8186  O  O    . SER A 1 44 ? 8.659   12.789  -13.238 1.00 0.00 ? 44  SER A O    12 
ATOM   8187  C  CB   . SER A 1 44 ? 6.075   13.038  -12.415 1.00 0.00 ? 44  SER A CB   12 
ATOM   8188  O  OG   . SER A 1 44 ? 4.723   12.961  -12.833 1.00 0.00 ? 44  SER A OG   12 
ATOM   8189  H  H    . SER A 1 44 ? 6.065   10.180  -11.014 1.00 0.00 ? 44  SER A H    12 
ATOM   8190  H  HA   . SER A 1 44 ? 6.238   11.024  -13.120 1.00 0.00 ? 44  SER A HA   12 
ATOM   8191  H  HB2  . SER A 1 44 ? 6.109   13.469  -11.426 1.00 0.00 ? 44  SER A HB2  12 
ATOM   8192  H  HB3  . SER A 1 44 ? 6.616   13.671  -13.103 1.00 0.00 ? 44  SER A HB3  12 
ATOM   8193  H  HG   . SER A 1 44 ? 4.380   12.084  -12.649 1.00 0.00 ? 44  SER A HG   12 
ATOM   8194  N  N    . GLY A 1 45 ? 8.950   10.697  -12.462 1.00 0.00 ? 45  GLY A N    12 
ATOM   8195  C  CA   . GLY A 1 45 ? 10.372  10.694  -12.751 1.00 0.00 ? 45  GLY A CA   12 
ATOM   8196  C  C    . GLY A 1 45 ? 10.741  9.699   -13.834 1.00 0.00 ? 45  GLY A C    12 
ATOM   8197  O  O    . GLY A 1 45 ? 10.460  9.901   -15.015 1.00 0.00 ? 45  GLY A O    12 
ATOM   8198  H  H    . GLY A 1 45 ? 8.532   9.907   -12.060 1.00 0.00 ? 45  GLY A H    12 
ATOM   8199  H  HA2  . GLY A 1 45 ? 10.665  11.683  -13.071 1.00 0.00 ? 45  GLY A HA2  12 
ATOM   8200  H  HA3  . GLY A 1 45 ? 10.911  10.444  -11.849 1.00 0.00 ? 45  GLY A HA3  12 
ATOM   8201  N  N    . PRO A 1 46 ? 11.388  8.595   -13.432 1.00 0.00 ? 46  PRO A N    12 
ATOM   8202  C  CA   . PRO A 1 46 ? 11.811  7.543   -14.361 1.00 0.00 ? 46  PRO A CA   12 
ATOM   8203  C  C    . PRO A 1 46 ? 10.631  6.763   -14.930 1.00 0.00 ? 46  PRO A C    12 
ATOM   8204  O  O    . PRO A 1 46 ? 10.532  6.564   -16.141 1.00 0.00 ? 46  PRO A O    12 
ATOM   8205  C  CB   . PRO A 1 46 ? 12.685  6.634   -13.493 1.00 0.00 ? 46  PRO A CB   12 
ATOM   8206  C  CG   . PRO A 1 46 ? 12.195  6.851   -12.103 1.00 0.00 ? 46  PRO A CG   12 
ATOM   8207  C  CD   . PRO A 1 46 ? 11.756  8.288   -12.039 1.00 0.00 ? 46  PRO A CD   12 
ATOM   8208  H  HA   . PRO A 1 46 ? 12.401  7.944   -15.172 1.00 0.00 ? 46  PRO A HA   12 
ATOM   8209  H  HB2  . PRO A 1 46 ? 12.556  5.606   -13.802 1.00 0.00 ? 46  PRO A HB2  12 
ATOM   8210  H  HB3  . PRO A 1 46 ? 13.721  6.919   -13.595 1.00 0.00 ? 46  PRO A HB3  12 
ATOM   8211  H  HG2  . PRO A 1 46 ? 11.362  6.195   -11.901 1.00 0.00 ? 46  PRO A HG2  12 
ATOM   8212  H  HG3  . PRO A 1 46 ? 12.995  6.672   -11.400 1.00 0.00 ? 46  PRO A HG3  12 
ATOM   8213  H  HD2  . PRO A 1 46 ? 10.904  8.394   -11.383 1.00 0.00 ? 46  PRO A HD2  12 
ATOM   8214  H  HD3  . PRO A 1 46 ? 12.569  8.917   -11.709 1.00 0.00 ? 46  PRO A HD3  12 
ATOM   8215  N  N    . SER A 1 47 ? 9.738   6.323   -14.049 1.00 0.00 ? 47  SER A N    12 
ATOM   8216  C  CA   . SER A 1 47 ? 8.566   5.562   -14.464 1.00 0.00 ? 47  SER A CA   12 
ATOM   8217  C  C    . SER A 1 47 ? 7.329   6.453   -14.515 1.00 0.00 ? 47  SER A C    12 
ATOM   8218  O  O    . SER A 1 47 ? 7.032   7.177   -13.564 1.00 0.00 ? 47  SER A O    12 
ATOM   8219  C  CB   . SER A 1 47 ? 8.326   4.392   -13.507 1.00 0.00 ? 47  SER A CB   12 
ATOM   8220  O  OG   . SER A 1 47 ? 9.450   3.529   -13.465 1.00 0.00 ? 47  SER A OG   12 
ATOM   8221  H  H    . SER A 1 47 ? 9.873   6.514   -13.097 1.00 0.00 ? 47  SER A H    12 
ATOM   8222  H  HA   . SER A 1 47 ? 8.756   5.173   -15.453 1.00 0.00 ? 47  SER A HA   12 
ATOM   8223  H  HB2  . SER A 1 47 ? 8.144   4.774   -12.514 1.00 0.00 ? 47  SER A HB2  12 
ATOM   8224  H  HB3  . SER A 1 47 ? 7.466   3.829   -13.840 1.00 0.00 ? 47  SER A HB3  12 
ATOM   8225  H  HG   . SER A 1 47 ? 10.044  3.742   -14.189 1.00 0.00 ? 47  SER A HG   12 
ATOM   8226  N  N    . SER A 1 48 ? 6.610   6.395   -15.632 1.00 0.00 ? 48  SER A N    12 
ATOM   8227  C  CA   . SER A 1 48 ? 5.407   7.200   -15.809 1.00 0.00 ? 48  SER A CA   12 
ATOM   8228  C  C    . SER A 1 48 ? 4.164   6.417   -15.397 1.00 0.00 ? 48  SER A C    12 
ATOM   8229  O  O    . SER A 1 48 ? 3.726   5.509   -16.102 1.00 0.00 ? 48  SER A O    12 
ATOM   8230  C  CB   . SER A 1 48 ? 5.280   7.650   -17.266 1.00 0.00 ? 48  SER A CB   12 
ATOM   8231  O  OG   . SER A 1 48 ? 5.024   6.548   -18.120 1.00 0.00 ? 48  SER A OG   12 
ATOM   8232  H  H    . SER A 1 48 ? 6.898   5.798   -16.354 1.00 0.00 ? 48  SER A H    12 
ATOM   8233  H  HA   . SER A 1 48 ? 5.495   8.072   -15.179 1.00 0.00 ? 48  SER A HA   12 
ATOM   8234  H  HB2  . SER A 1 48 ? 4.466   8.353   -17.353 1.00 0.00 ? 48  SER A HB2  12 
ATOM   8235  H  HB3  . SER A 1 48 ? 6.201   8.123   -17.575 1.00 0.00 ? 48  SER A HB3  12 
ATOM   8236  H  HG   . SER A 1 48 ? 5.000   6.848   -19.031 1.00 0.00 ? 48  SER A HG   12 
ATOM   8237  N  N    . GLY A 1 49 ? 3.601   6.777   -14.248 1.00 0.00 ? 49  GLY A N    12 
ATOM   8238  C  CA   . GLY A 1 49 ? 2.414   6.099   -13.759 1.00 0.00 ? 49  GLY A CA   12 
ATOM   8239  C  C    . GLY A 1 49 ? 2.210   6.287   -12.269 1.00 0.00 ? 49  GLY A C    12 
ATOM   8240  O  O    . GLY A 1 49 ? 3.194   6.347   -11.533 1.00 0.00 ? 49  GLY A O    12 
ATOM   8241  H  H    . GLY A 1 49 ? 3.994   7.508   -13.727 1.00 0.00 ? 49  GLY A H    12 
ATOM   8242  H  HA2  . GLY A 1 49 ? 1.551   6.485   -14.282 1.00 0.00 ? 49  GLY A HA2  12 
ATOM   8243  H  HA3  . GLY A 1 49 ? 2.505   5.043   -13.968 1.00 0.00 ? 49  GLY A HA3  12 
HETATM 8244  ZN ZN   . ZN  B 2 .  ? 2.837   -4.778  1.821   1.00 0.00 ? 201 ZN  A ZN   12 
ATOM   8245  N  N    . GLY A 1 1  ? -11.884 -3.577  19.844  1.00 0.00 ? 1   GLY A N    13 
ATOM   8246  C  CA   . GLY A 1 1  ? -12.414 -2.300  20.287  1.00 0.00 ? 1   GLY A CA   13 
ATOM   8247  C  C    . GLY A 1 1  ? -13.611 -1.854  19.471  1.00 0.00 ? 1   GLY A C    13 
ATOM   8248  O  O    . GLY A 1 1  ? -14.753 -2.150  19.819  1.00 0.00 ? 1   GLY A O    13 
ATOM   8249  H  H1   . GLY A 1 1  ? -11.063 -3.930  20.245  1.00 0.00 ? 1   GLY A H1   13 
ATOM   8250  H  HA2  . GLY A 1 1  ? -12.708 -2.385  21.322  1.00 0.00 ? 1   GLY A HA2  13 
ATOM   8251  H  HA3  . GLY A 1 1  ? -11.638 -1.553  20.204  1.00 0.00 ? 1   GLY A HA3  13 
ATOM   8252  N  N    . SER A 1 2  ? -13.349 -1.138  18.382  1.00 0.00 ? 2   SER A N    13 
ATOM   8253  C  CA   . SER A 1 2  ? -14.414 -0.646  17.517  1.00 0.00 ? 2   SER A CA   13 
ATOM   8254  C  C    . SER A 1 2  ? -14.472 -1.444  16.218  1.00 0.00 ? 2   SER A C    13 
ATOM   8255  O  O    . SER A 1 2  ? -13.444 -1.732  15.607  1.00 0.00 ? 2   SER A O    13 
ATOM   8256  C  CB   . SER A 1 2  ? -14.204 0.838   17.207  1.00 0.00 ? 2   SER A CB   13 
ATOM   8257  O  OG   . SER A 1 2  ? -14.027 1.587   18.397  1.00 0.00 ? 2   SER A OG   13 
ATOM   8258  H  H    . SER A 1 2  ? -12.417 -0.935  18.157  1.00 0.00 ? 2   SER A H    13 
ATOM   8259  H  HA   . SER A 1 2  ? -15.350 -0.766  18.042  1.00 0.00 ? 2   SER A HA   13 
ATOM   8260  H  HB2  . SER A 1 2  ? -13.326 0.953   16.590  1.00 0.00 ? 2   SER A HB2  13 
ATOM   8261  H  HB3  . SER A 1 2  ? -15.067 1.219   16.681  1.00 0.00 ? 2   SER A HB3  13 
ATOM   8262  H  HG   . SER A 1 2  ? -13.887 0.989   19.135  1.00 0.00 ? 2   SER A HG   13 
ATOM   8263  N  N    . SER A 1 3  ? -15.684 -1.799  15.803  1.00 0.00 ? 3   SER A N    13 
ATOM   8264  C  CA   . SER A 1 3  ? -15.878 -2.568  14.579  1.00 0.00 ? 3   SER A CA   13 
ATOM   8265  C  C    . SER A 1 3  ? -15.225 -1.870  13.390  1.00 0.00 ? 3   SER A C    13 
ATOM   8266  O  O    . SER A 1 3  ? -15.141 -0.644  13.344  1.00 0.00 ? 3   SER A O    13 
ATOM   8267  C  CB   . SER A 1 3  ? -17.371 -2.769  14.309  1.00 0.00 ? 3   SER A CB   13 
ATOM   8268  O  OG   . SER A 1 3  ? -18.030 -3.289  15.451  1.00 0.00 ? 3   SER A OG   13 
ATOM   8269  H  H    . SER A 1 3  ? -16.466 -1.539  16.334  1.00 0.00 ? 3   SER A H    13 
ATOM   8270  H  HA   . SER A 1 3  ? -15.413 -3.532  14.716  1.00 0.00 ? 3   SER A HA   13 
ATOM   8271  H  HB2  . SER A 1 3  ? -17.818 -1.822  14.050  1.00 0.00 ? 3   SER A HB2  13 
ATOM   8272  H  HB3  . SER A 1 3  ? -17.495 -3.462  13.490  1.00 0.00 ? 3   SER A HB3  13 
ATOM   8273  H  HG   . SER A 1 3  ? -18.939 -2.980  15.465  1.00 0.00 ? 3   SER A HG   13 
ATOM   8274  N  N    . GLY A 1 4  ? -14.762 -2.663  12.428  1.00 0.00 ? 4   GLY A N    13 
ATOM   8275  C  CA   . GLY A 1 4  ? -14.122 -2.105  11.251  1.00 0.00 ? 4   GLY A CA   13 
ATOM   8276  C  C    . GLY A 1 4  ? -14.960 -2.274  9.999   1.00 0.00 ? 4   GLY A C    13 
ATOM   8277  O  O    . GLY A 1 4  ? -14.975 -3.346  9.394   1.00 0.00 ? 4   GLY A O    13 
ATOM   8278  H  H    . GLY A 1 4  ? -14.857 -3.634  12.518  1.00 0.00 ? 4   GLY A H    13 
ATOM   8279  H  HA2  . GLY A 1 4  ? -13.946 -1.053  11.415  1.00 0.00 ? 4   GLY A HA2  13 
ATOM   8280  H  HA3  . GLY A 1 4  ? -13.173 -2.600  11.103  1.00 0.00 ? 4   GLY A HA3  13 
ATOM   8281  N  N    . SER A 1 5  ? -15.661 -1.214  9.611   1.00 0.00 ? 5   SER A N    13 
ATOM   8282  C  CA   . SER A 1 5  ? -16.511 -1.251  8.427   1.00 0.00 ? 5   SER A CA   13 
ATOM   8283  C  C    . SER A 1 5  ? -15.760 -0.735  7.203   1.00 0.00 ? 5   SER A C    13 
ATOM   8284  O  O    . SER A 1 5  ? -15.632 -1.434  6.198   1.00 0.00 ? 5   SER A O    13 
ATOM   8285  C  CB   . SER A 1 5  ? -17.774 -0.418  8.653   1.00 0.00 ? 5   SER A CB   13 
ATOM   8286  O  OG   . SER A 1 5  ? -18.685 -0.572  7.579   1.00 0.00 ? 5   SER A OG   13 
ATOM   8287  H  H    . SER A 1 5  ? -15.608 -0.387  10.136  1.00 0.00 ? 5   SER A H    13 
ATOM   8288  H  HA   . SER A 1 5  ? -16.794 -2.279  8.254   1.00 0.00 ? 5   SER A HA   13 
ATOM   8289  H  HB2  . SER A 1 5  ? -18.254 -0.738  9.565   1.00 0.00 ? 5   SER A HB2  13 
ATOM   8290  H  HB3  . SER A 1 5  ? -17.504 0.625   8.734   1.00 0.00 ? 5   SER A HB3  13 
ATOM   8291  H  HG   . SER A 1 5  ? -18.304 -1.152  6.915   1.00 0.00 ? 5   SER A HG   13 
ATOM   8292  N  N    . SER A 1 6  ? -15.265 0.495   7.296   1.00 0.00 ? 6   SER A N    13 
ATOM   8293  C  CA   . SER A 1 6  ? -14.529 1.109   6.196   1.00 0.00 ? 6   SER A CA   13 
ATOM   8294  C  C    . SER A 1 6  ? -13.024 1.009   6.426   1.00 0.00 ? 6   SER A C    13 
ATOM   8295  O  O    . SER A 1 6  ? -12.546 1.160   7.550   1.00 0.00 ? 6   SER A O    13 
ATOM   8296  C  CB   . SER A 1 6  ? -14.936 2.575   6.037   1.00 0.00 ? 6   SER A CB   13 
ATOM   8297  O  OG   . SER A 1 6  ? -16.189 2.688   5.384   1.00 0.00 ? 6   SER A OG   13 
ATOM   8298  H  H    . SER A 1 6  ? -15.400 1.003   8.123   1.00 0.00 ? 6   SER A H    13 
ATOM   8299  H  HA   . SER A 1 6  ? -14.779 0.574   5.292   1.00 0.00 ? 6   SER A HA   13 
ATOM   8300  H  HB2  . SER A 1 6  ? -15.010 3.033   7.012   1.00 0.00 ? 6   SER A HB2  13 
ATOM   8301  H  HB3  . SER A 1 6  ? -14.190 3.091   5.452   1.00 0.00 ? 6   SER A HB3  13 
ATOM   8302  H  HG   . SER A 1 6  ? -16.772 1.988   5.685   1.00 0.00 ? 6   SER A HG   13 
ATOM   8303  N  N    . GLY A 1 7  ? -12.283 0.753   5.353   1.00 0.00 ? 7   GLY A N    13 
ATOM   8304  C  CA   . GLY A 1 7  ? -10.840 0.637   5.457   1.00 0.00 ? 7   GLY A CA   13 
ATOM   8305  C  C    . GLY A 1 7  ? -10.415 -0.498  6.368   1.00 0.00 ? 7   GLY A C    13 
ATOM   8306  O  O    . GLY A 1 7  ? -9.620  -0.301  7.287   1.00 0.00 ? 7   GLY A O    13 
ATOM   8307  H  H    . GLY A 1 7  ? -12.720 0.642   4.482   1.00 0.00 ? 7   GLY A H    13 
ATOM   8308  H  HA2  . GLY A 1 7  ? -10.431 0.468   4.473   1.00 0.00 ? 7   GLY A HA2  13 
ATOM   8309  H  HA3  . GLY A 1 7  ? -10.444 1.563   5.847   1.00 0.00 ? 7   GLY A HA3  13 
ATOM   8310  N  N    . SER A 1 8  ? -10.946 -1.690  6.113   1.00 0.00 ? 8   SER A N    13 
ATOM   8311  C  CA   . SER A 1 8  ? -10.620 -2.860  6.920   1.00 0.00 ? 8   SER A CA   13 
ATOM   8312  C  C    . SER A 1 8  ? -9.579  -3.729  6.221   1.00 0.00 ? 8   SER A C    13 
ATOM   8313  O  O    . SER A 1 8  ? -9.370  -3.617  5.013   1.00 0.00 ? 8   SER A O    13 
ATOM   8314  C  CB   . SER A 1 8  ? -11.881 -3.679  7.200   1.00 0.00 ? 8   SER A CB   13 
ATOM   8315  O  OG   . SER A 1 8  ? -11.736 -4.452  8.380   1.00 0.00 ? 8   SER A OG   13 
ATOM   8316  H  H    . SER A 1 8  ? -11.573 -1.783  5.366   1.00 0.00 ? 8   SER A H    13 
ATOM   8317  H  HA   . SER A 1 8  ? -10.211 -2.512  7.857   1.00 0.00 ? 8   SER A HA   13 
ATOM   8318  H  HB2  . SER A 1 8  ? -12.721 -3.013  7.322   1.00 0.00 ? 8   SER A HB2  13 
ATOM   8319  H  HB3  . SER A 1 8  ? -12.067 -4.344  6.369   1.00 0.00 ? 8   SER A HB3  13 
ATOM   8320  H  HG   . SER A 1 8  ? -12.523 -4.986  8.511   1.00 0.00 ? 8   SER A HG   13 
ATOM   8321  N  N    . LEU A 1 9  ? -8.929  -4.596  6.990   1.00 0.00 ? 9   LEU A N    13 
ATOM   8322  C  CA   . LEU A 1 9  ? -7.909  -5.486  6.447   1.00 0.00 ? 9   LEU A CA   13 
ATOM   8323  C  C    . LEU A 1 9  ? -8.543  -6.731  5.835   1.00 0.00 ? 9   LEU A C    13 
ATOM   8324  O  O    . LEU A 1 9  ? -9.546  -7.240  6.336   1.00 0.00 ? 9   LEU A O    13 
ATOM   8325  C  CB   . LEU A 1 9  ? -6.920  -5.889  7.541   1.00 0.00 ? 9   LEU A CB   13 
ATOM   8326  C  CG   . LEU A 1 9  ? -6.155  -4.746  8.209   1.00 0.00 ? 9   LEU A CG   13 
ATOM   8327  C  CD1  . LEU A 1 9  ? -5.431  -5.242  9.451   1.00 0.00 ? 9   LEU A CD1  13 
ATOM   8328  C  CD2  . LEU A 1 9  ? -5.172  -4.119  7.231   1.00 0.00 ? 9   LEU A CD2  13 
ATOM   8329  H  H    . LEU A 1 9  ? -9.139  -4.639  7.946   1.00 0.00 ? 9   LEU A H    13 
ATOM   8330  H  HA   . LEU A 1 9  ? -7.380  -4.950  5.674   1.00 0.00 ? 9   LEU A HA   13 
ATOM   8331  H  HB2  . LEU A 1 9  ? -7.471  -6.411  8.309   1.00 0.00 ? 9   LEU A HB2  13 
ATOM   8332  H  HB3  . LEU A 1 9  ? -6.196  -6.561  7.101   1.00 0.00 ? 9   LEU A HB3  13 
ATOM   8333  H  HG   . LEU A 1 9  ? -6.857  -3.982  8.515   1.00 0.00 ? 9   LEU A HG   13 
ATOM   8334  H  HD11 . LEU A 1 9  ? -4.773  -4.468  9.817   1.00 0.00 ? 9   LEU A HD11 13 
ATOM   8335  H  HD12 . LEU A 1 9  ? -4.852  -6.120  9.204   1.00 0.00 ? 9   LEU A HD12 13 
ATOM   8336  H  HD13 . LEU A 1 9  ? -6.154  -5.491  10.214  1.00 0.00 ? 9   LEU A HD13 13 
ATOM   8337  H  HD21 . LEU A 1 9  ? -4.535  -4.888  6.818   1.00 0.00 ? 9   LEU A HD21 13 
ATOM   8338  H  HD22 . LEU A 1 9  ? -4.568  -3.389  7.747   1.00 0.00 ? 9   LEU A HD22 13 
ATOM   8339  H  HD23 . LEU A 1 9  ? -5.718  -3.636  6.433   1.00 0.00 ? 9   LEU A HD23 13 
ATOM   8340  N  N    . MET A 1 10 ? -7.951  -7.218  4.749   1.00 0.00 ? 10  MET A N    13 
ATOM   8341  C  CA   . MET A 1 10 ? -8.456  -8.406  4.071   1.00 0.00 ? 10  MET A CA   13 
ATOM   8342  C  C    . MET A 1 10 ? -7.638  -9.637  4.448   1.00 0.00 ? 10  MET A C    13 
ATOM   8343  O  O    . MET A 1 10 ? -6.505  -9.521  4.916   1.00 0.00 ? 10  MET A O    13 
ATOM   8344  C  CB   . MET A 1 10 ? -8.428  -8.205  2.555   1.00 0.00 ? 10  MET A CB   13 
ATOM   8345  C  CG   . MET A 1 10 ? -9.563  -7.337  2.036   1.00 0.00 ? 10  MET A CG   13 
ATOM   8346  S  SD   . MET A 1 10 ? -11.119 -8.237  1.898   1.00 0.00 ? 10  MET A SD   13 
ATOM   8347  C  CE   . MET A 1 10 ? -12.151 -7.009  1.101   1.00 0.00 ? 10  MET A CE   13 
ATOM   8348  H  H    . MET A 1 10 ? -7.155  -6.769  4.396   1.00 0.00 ? 10  MET A H    13 
ATOM   8349  H  HA   . MET A 1 10 ? -9.478  -8.558  4.386   1.00 0.00 ? 10  MET A HA   13 
ATOM   8350  H  HB2  . MET A 1 10 ? -7.493  -7.738  2.283   1.00 0.00 ? 10  MET A HB2  13 
ATOM   8351  H  HB3  . MET A 1 10 ? -8.493  -9.169  2.074   1.00 0.00 ? 10  MET A HB3  13 
ATOM   8352  H  HG2  . MET A 1 10 ? -9.702  -6.507  2.712   1.00 0.00 ? 10  MET A HG2  13 
ATOM   8353  H  HG3  . MET A 1 10 ? -9.292  -6.961  1.060   1.00 0.00 ? 10  MET A HG3  13 
ATOM   8354  H  HE1  . MET A 1 10 ? -11.526 -6.265  0.628   1.00 0.00 ? 10  MET A HE1  13 
ATOM   8355  H  HE2  . MET A 1 10 ? -12.769 -7.487  0.356   1.00 0.00 ? 10  MET A HE2  13 
ATOM   8356  H  HE3  . MET A 1 10 ? -12.780 -6.534  1.840   1.00 0.00 ? 10  MET A HE3  13 
ATOM   8357  N  N    . ASP A 1 11 ? -8.218  -10.814 4.241   1.00 0.00 ? 11  ASP A N    13 
ATOM   8358  C  CA   . ASP A 1 11 ? -7.541  -12.066 4.558   1.00 0.00 ? 11  ASP A CA   13 
ATOM   8359  C  C    . ASP A 1 11 ? -6.593  -12.472 3.434   1.00 0.00 ? 11  ASP A C    13 
ATOM   8360  O  O    . ASP A 1 11 ? -6.181  -13.628 3.342   1.00 0.00 ? 11  ASP A O    13 
ATOM   8361  C  CB   . ASP A 1 11 ? -8.565  -13.175 4.804   1.00 0.00 ? 11  ASP A CB   13 
ATOM   8362  C  CG   . ASP A 1 11 ? -9.153  -13.121 6.201   1.00 0.00 ? 11  ASP A CG   13 
ATOM   8363  O  OD1  . ASP A 1 11 ? -8.382  -12.909 7.160   1.00 0.00 ? 11  ASP A OD1  13 
ATOM   8364  O  OD2  . ASP A 1 11 ? -10.383 -13.292 6.334   1.00 0.00 ? 11  ASP A OD2  13 
ATOM   8365  H  H    . ASP A 1 11 ? -9.123  -10.841 3.865   1.00 0.00 ? 11  ASP A H    13 
ATOM   8366  H  HA   . ASP A 1 11 ? -6.966  -11.913 5.459   1.00 0.00 ? 11  ASP A HA   13 
ATOM   8367  H  HB2  . ASP A 1 11 ? -9.370  -13.078 4.091   1.00 0.00 ? 11  ASP A HB2  13 
ATOM   8368  H  HB3  . ASP A 1 11 ? -8.086  -14.134 4.671   1.00 0.00 ? 11  ASP A HB3  13 
ATOM   8369  N  N    . VAL A 1 12 ? -6.252  -11.512 2.579   1.00 0.00 ? 12  VAL A N    13 
ATOM   8370  C  CA   . VAL A 1 12 ? -5.353  -11.769 1.460   1.00 0.00 ? 12  VAL A CA   13 
ATOM   8371  C  C    . VAL A 1 12 ? -3.996  -11.114 1.685   1.00 0.00 ? 12  VAL A C    13 
ATOM   8372  O  O    . VAL A 1 12 ? -3.912  -9.929  2.010   1.00 0.00 ? 12  VAL A O    13 
ATOM   8373  C  CB   . VAL A 1 12 ? -5.946  -11.256 0.135   1.00 0.00 ? 12  VAL A CB   13 
ATOM   8374  C  CG1  . VAL A 1 12 ? -5.030  -11.601 -1.029  1.00 0.00 ? 12  VAL A CG1  13 
ATOM   8375  C  CG2  . VAL A 1 12 ? -7.338  -11.831 -0.084  1.00 0.00 ? 12  VAL A CG2  13 
ATOM   8376  H  H    . VAL A 1 12 ? -6.614  -10.610 2.704   1.00 0.00 ? 12  VAL A H    13 
ATOM   8377  H  HA   . VAL A 1 12 ? -5.217  -12.838 1.380   1.00 0.00 ? 12  VAL A HA   13 
ATOM   8378  H  HB   . VAL A 1 12 ? -6.029  -10.181 0.193   1.00 0.00 ? 12  VAL A HB   13 
ATOM   8379  H  HG11 . VAL A 1 12 ? -4.083  -11.096 -0.903  1.00 0.00 ? 12  VAL A HG11 13 
ATOM   8380  H  HG12 . VAL A 1 12 ? -4.869  -12.669 -1.057  1.00 0.00 ? 12  VAL A HG12 13 
ATOM   8381  H  HG13 . VAL A 1 12 ? -5.487  -11.281 -1.954  1.00 0.00 ? 12  VAL A HG13 13 
ATOM   8382  H  HG21 . VAL A 1 12 ? -7.502  -11.987 -1.140  1.00 0.00 ? 12  VAL A HG21 13 
ATOM   8383  H  HG22 . VAL A 1 12 ? -7.424  -12.772 0.438   1.00 0.00 ? 12  VAL A HG22 13 
ATOM   8384  H  HG23 . VAL A 1 12 ? -8.077  -11.140 0.296   1.00 0.00 ? 12  VAL A HG23 13 
ATOM   8385  N  N    . LYS A 1 13 ? -2.933  -11.891 1.508   1.00 0.00 ? 13  LYS A N    13 
ATOM   8386  C  CA   . LYS A 1 13 ? -1.577  -11.387 1.689   1.00 0.00 ? 13  LYS A CA   13 
ATOM   8387  C  C    . LYS A 1 13 ? -1.299  -10.221 0.746   1.00 0.00 ? 13  LYS A C    13 
ATOM   8388  O  O    . LYS A 1 13 ? -1.895  -10.121 -0.327  1.00 0.00 ? 13  LYS A O    13 
ATOM   8389  C  CB   . LYS A 1 13 ? -0.559  -12.504 1.449   1.00 0.00 ? 13  LYS A CB   13 
ATOM   8390  C  CG   . LYS A 1 13 ? -0.321  -13.383 2.665   1.00 0.00 ? 13  LYS A CG   13 
ATOM   8391  C  CD   . LYS A 1 13 ? -1.382  -14.464 2.788   1.00 0.00 ? 13  LYS A CD   13 
ATOM   8392  C  CE   . LYS A 1 13 ? -1.179  -15.564 1.758   1.00 0.00 ? 13  LYS A CE   13 
ATOM   8393  N  NZ   . LYS A 1 13 ? -2.292  -16.553 1.775   1.00 0.00 ? 13  LYS A NZ   13 
ATOM   8394  H  H    . LYS A 1 13 ? -3.064  -12.828 1.249   1.00 0.00 ? 13  LYS A H    13 
ATOM   8395  H  HA   . LYS A 1 13 ? -1.485  -11.041 2.707   1.00 0.00 ? 13  LYS A HA   13 
ATOM   8396  H  HB2  . LYS A 1 13 ? -0.912  -13.129 0.642   1.00 0.00 ? 13  LYS A HB2  13 
ATOM   8397  H  HB3  . LYS A 1 13 ? 0.384   -12.060 1.162   1.00 0.00 ? 13  LYS A HB3  13 
ATOM   8398  H  HG2  . LYS A 1 13 ? 0.647   -13.852 2.575   1.00 0.00 ? 13  LYS A HG2  13 
ATOM   8399  H  HG3  . LYS A 1 13 ? -0.343  -12.766 3.552   1.00 0.00 ? 13  LYS A HG3  13 
ATOM   8400  H  HD2  . LYS A 1 13 ? -1.330  -14.897 3.775   1.00 0.00 ? 13  LYS A HD2  13 
ATOM   8401  H  HD3  . LYS A 1 13 ? -2.356  -14.018 2.639   1.00 0.00 ? 13  LYS A HD3  13 
ATOM   8402  H  HE2  . LYS A 1 13 ? -1.122  -15.116 0.778   1.00 0.00 ? 13  LYS A HE2  13 
ATOM   8403  H  HE3  . LYS A 1 13 ? -0.252  -16.074 1.974   1.00 0.00 ? 13  LYS A HE3  13 
ATOM   8404  H  HZ1  . LYS A 1 13 ? -2.480  -16.862 2.750   1.00 0.00 ? 13  LYS A HZ1  13 
ATOM   8405  H  HZ2  . LYS A 1 13 ? -2.040  -17.384 1.202   1.00 0.00 ? 13  LYS A HZ2  13 
ATOM   8406  H  HZ3  . LYS A 1 13 ? -3.156  -16.126 1.385   1.00 0.00 ? 13  LYS A HZ3  13 
ATOM   8407  N  N    . CYS A 1 14 ? -0.391  -9.340  1.152   1.00 0.00 ? 14  CYS A N    13 
ATOM   8408  C  CA   . CYS A 1 14 ? -0.033  -8.181  0.343   1.00 0.00 ? 14  CYS A CA   13 
ATOM   8409  C  C    . CYS A 1 14 ? 0.473   -8.612  -1.030  1.00 0.00 ? 14  CYS A C    13 
ATOM   8410  O  O    . CYS A 1 14 ? 1.224   -9.579  -1.150  1.00 0.00 ? 14  CYS A O    13 
ATOM   8411  C  CB   . CYS A 1 14 ? 1.035   -7.347  1.054   1.00 0.00 ? 14  CYS A CB   13 
ATOM   8412  S  SG   . CYS A 1 14 ? 1.767   -6.039  0.019   1.00 0.00 ? 14  CYS A SG   13 
ATOM   8413  H  H    . CYS A 1 14 ? 0.051   -9.473  2.018   1.00 0.00 ? 14  CYS A H    13 
ATOM   8414  H  HA   . CYS A 1 14 ? -0.920  -7.580  0.214   1.00 0.00 ? 14  CYS A HA   13 
ATOM   8415  H  HB2  . CYS A 1 14 ? 0.593   -6.872  1.918   1.00 0.00 ? 14  CYS A HB2  13 
ATOM   8416  H  HB3  . CYS A 1 14 ? 1.834   -7.998  1.377   1.00 0.00 ? 14  CYS A HB3  13 
ATOM   8417  N  N    . GLU A 1 15 ? 0.055   -7.886  -2.063  1.00 0.00 ? 15  GLU A N    13 
ATOM   8418  C  CA   . GLU A 1 15 ? 0.466   -8.193  -3.428  1.00 0.00 ? 15  GLU A CA   13 
ATOM   8419  C  C    . GLU A 1 15 ? 1.894   -8.731  -3.458  1.00 0.00 ? 15  GLU A C    13 
ATOM   8420  O  O    . GLU A 1 15 ? 2.162   -9.781  -4.043  1.00 0.00 ? 15  GLU A O    13 
ATOM   8421  C  CB   . GLU A 1 15 ? 0.360   -6.947  -4.309  1.00 0.00 ? 15  GLU A CB   13 
ATOM   8422  C  CG   . GLU A 1 15 ? 0.960   -7.127  -5.693  1.00 0.00 ? 15  GLU A CG   13 
ATOM   8423  C  CD   . GLU A 1 15 ? 0.387   -8.325  -6.426  1.00 0.00 ? 15  GLU A CD   13 
ATOM   8424  O  OE1  . GLU A 1 15 ? -0.725  -8.765  -6.066  1.00 0.00 ? 15  GLU A OE1  13 
ATOM   8425  O  OE2  . GLU A 1 15 ? 1.050   -8.821  -7.361  1.00 0.00 ? 15  GLU A OE2  13 
ATOM   8426  H  H    . GLU A 1 15 ? -0.543  -7.127  -1.903  1.00 0.00 ? 15  GLU A H    13 
ATOM   8427  H  HA   . GLU A 1 15 ? -0.200  -8.952  -3.811  1.00 0.00 ? 15  GLU A HA   13 
ATOM   8428  H  HB2  . GLU A 1 15 ? -0.683  -6.688  -4.422  1.00 0.00 ? 15  GLU A HB2  13 
ATOM   8429  H  HB3  . GLU A 1 15 ? 0.873   -6.132  -3.821  1.00 0.00 ? 15  GLU A HB3  13 
ATOM   8430  H  HG2  . GLU A 1 15 ? 0.763   -6.240  -6.276  1.00 0.00 ? 15  GLU A HG2  13 
ATOM   8431  H  HG3  . GLU A 1 15 ? 2.027   -7.261  -5.594  1.00 0.00 ? 15  GLU A HG3  13 
ATOM   8432  N  N    . THR A 1 16 ? 2.808   -8.003  -2.825  1.00 0.00 ? 16  THR A N    13 
ATOM   8433  C  CA   . THR A 1 16 ? 4.208   -8.404  -2.780  1.00 0.00 ? 16  THR A CA   13 
ATOM   8434  C  C    . THR A 1 16 ? 4.363   -9.795  -2.174  1.00 0.00 ? 16  THR A C    13 
ATOM   8435  O  O    . THR A 1 16 ? 3.923   -10.063 -1.056  1.00 0.00 ? 16  THR A O    13 
ATOM   8436  C  CB   . THR A 1 16 ? 5.053   -7.406  -1.967  1.00 0.00 ? 16  THR A CB   13 
ATOM   8437  O  OG1  . THR A 1 16 ? 5.009   -6.113  -2.580  1.00 0.00 ? 16  THR A OG1  13 
ATOM   8438  C  CG2  . THR A 1 16 ? 6.496   -7.875  -1.865  1.00 0.00 ? 16  THR A CG2  13 
ATOM   8439  H  H    . THR A 1 16 ? 2.532   -7.176  -2.378  1.00 0.00 ? 16  THR A H    13 
ATOM   8440  H  HA   . THR A 1 16 ? 4.583   -8.420  -3.793  1.00 0.00 ? 16  THR A HA   13 
ATOM   8441  H  HB   . THR A 1 16 ? 4.641   -7.337  -0.970  1.00 0.00 ? 16  THR A HB   13 
ATOM   8442  H  HG1  . THR A 1 16 ? 4.575   -5.492  -1.990  1.00 0.00 ? 16  THR A HG1  13 
ATOM   8443  H  HG21 . THR A 1 16 ? 7.158   -7.060  -2.113  1.00 0.00 ? 16  THR A HG21 13 
ATOM   8444  H  HG22 . THR A 1 16 ? 6.659   -8.692  -2.552  1.00 0.00 ? 16  THR A HG22 13 
ATOM   8445  H  HG23 . THR A 1 16 ? 6.697   -8.207  -0.857  1.00 0.00 ? 16  THR A HG23 13 
ATOM   8446  N  N    . PRO A 1 17 ? 5.002   -10.701 -2.927  1.00 0.00 ? 17  PRO A N    13 
ATOM   8447  C  CA   . PRO A 1 17 ? 5.231   -12.080 -2.484  1.00 0.00 ? 17  PRO A CA   13 
ATOM   8448  C  C    . PRO A 1 17 ? 6.245   -12.163 -1.348  1.00 0.00 ? 17  PRO A C    13 
ATOM   8449  O  O    . PRO A 1 17 ? 6.542   -13.246 -0.847  1.00 0.00 ? 17  PRO A O    13 
ATOM   8450  C  CB   . PRO A 1 17 ? 5.773   -12.771 -3.737  1.00 0.00 ? 17  PRO A CB   13 
ATOM   8451  C  CG   . PRO A 1 17 ? 6.384   -11.674 -4.540  1.00 0.00 ? 17  PRO A CG   13 
ATOM   8452  C  CD   . PRO A 1 17 ? 5.553   -10.451 -4.270  1.00 0.00 ? 17  PRO A CD   13 
ATOM   8453  H  HA   . PRO A 1 17 ? 4.310   -12.556 -2.178  1.00 0.00 ? 17  PRO A HA   13 
ATOM   8454  H  HB2  . PRO A 1 17 ? 6.508   -13.511 -3.454  1.00 0.00 ? 17  PRO A HB2  13 
ATOM   8455  H  HB3  . PRO A 1 17 ? 4.963   -13.245 -4.270  1.00 0.00 ? 17  PRO A HB3  13 
ATOM   8456  H  HG2  . PRO A 1 17 ? 7.403   -11.512 -4.224  1.00 0.00 ? 17  PRO A HG2  13 
ATOM   8457  H  HG3  . PRO A 1 17 ? 6.351   -11.926 -5.589  1.00 0.00 ? 17  PRO A HG3  13 
ATOM   8458  H  HD2  . PRO A 1 17 ? 6.171   -9.566  -4.274  1.00 0.00 ? 17  PRO A HD2  13 
ATOM   8459  H  HD3  . PRO A 1 17 ? 4.761   -10.364 -5.000  1.00 0.00 ? 17  PRO A HD3  13 
ATOM   8460  N  N    . ASN A 1 18 ? 6.774   -11.011 -0.948  1.00 0.00 ? 18  ASN A N    13 
ATOM   8461  C  CA   . ASN A 1 18 ? 7.756   -10.954 0.129   1.00 0.00 ? 18  ASN A CA   13 
ATOM   8462  C  C    . ASN A 1 18 ? 7.199   -10.202 1.334   1.00 0.00 ? 18  ASN A C    13 
ATOM   8463  O  O    . ASN A 1 18 ? 7.765   -10.250 2.426   1.00 0.00 ? 18  ASN A O    13 
ATOM   8464  C  CB   . ASN A 1 18 ? 9.039   -10.280 -0.359  1.00 0.00 ? 18  ASN A CB   13 
ATOM   8465  C  CG   . ASN A 1 18 ? 9.518   -10.838 -1.685  1.00 0.00 ? 18  ASN A CG   13 
ATOM   8466  O  OD1  . ASN A 1 18 ? 9.236   -11.987 -2.025  1.00 0.00 ? 18  ASN A OD1  13 
ATOM   8467  N  ND2  . ASN A 1 18 ? 10.247  -10.025 -2.440  1.00 0.00 ? 18  ASN A ND2  13 
ATOM   8468  H  H    . ASN A 1 18 ? 6.497   -10.180 -1.387  1.00 0.00 ? 18  ASN A H    13 
ATOM   8469  H  HA   . ASN A 1 18 ? 7.982   -11.968 0.425   1.00 0.00 ? 18  ASN A HA   13 
ATOM   8470  H  HB2  . ASN A 1 18 ? 8.859   -9.222  -0.480  1.00 0.00 ? 18  ASN A HB2  13 
ATOM   8471  H  HB3  . ASN A 1 18 ? 9.818   -10.427 0.375   1.00 0.00 ? 18  ASN A HB3  13 
ATOM   8472  H  HD21 . ASN A 1 18 ? 10.433  -9.123  -2.105  1.00 0.00 ? 18  ASN A HD21 13 
ATOM   8473  H  HD22 . ASN A 1 18 ? 10.569  -10.361 -3.303  1.00 0.00 ? 18  ASN A HD22 13 
ATOM   8474  N  N    . CYS A 1 19 ? 6.085   -9.507  1.128   1.00 0.00 ? 19  CYS A N    13 
ATOM   8475  C  CA   . CYS A 1 19 ? 5.450   -8.745  2.196   1.00 0.00 ? 19  CYS A CA   13 
ATOM   8476  C  C    . CYS A 1 19 ? 4.449   -9.608  2.960   1.00 0.00 ? 19  CYS A C    13 
ATOM   8477  O  O    . CYS A 1 19 ? 3.395   -9.982  2.446   1.00 0.00 ? 19  CYS A O    13 
ATOM   8478  C  CB   . CYS A 1 19 ? 4.745   -7.514  1.622   1.00 0.00 ? 19  CYS A CB   13 
ATOM   8479  S  SG   . CYS A 1 19 ? 4.359   -6.234  2.859   1.00 0.00 ? 19  CYS A SG   13 
ATOM   8480  H  H    . CYS A 1 19 ? 5.679   -9.507  0.234   1.00 0.00 ? 19  CYS A H    13 
ATOM   8481  H  HA   . CYS A 1 19 ? 6.222   -8.422  2.877   1.00 0.00 ? 19  CYS A HA   13 
ATOM   8482  H  HB2  . CYS A 1 19 ? 5.378   -7.064  0.871   1.00 0.00 ? 19  CYS A HB2  13 
ATOM   8483  H  HB3  . CYS A 1 19 ? 3.816   -7.821  1.165   1.00 0.00 ? 19  CYS A HB3  13 
ATOM   8484  N  N    . PRO A 1 20 ? 4.786   -9.931  4.217   1.00 0.00 ? 20  PRO A N    13 
ATOM   8485  C  CA   . PRO A 1 20 ? 3.932   -10.752 5.079   1.00 0.00 ? 20  PRO A CA   13 
ATOM   8486  C  C    . PRO A 1 20 ? 2.663   -10.021 5.503   1.00 0.00 ? 20  PRO A C    13 
ATOM   8487  O  O    . PRO A 1 20 ? 1.780   -10.603 6.135   1.00 0.00 ? 20  PRO A O    13 
ATOM   8488  C  CB   . PRO A 1 20 ? 4.819   -11.033 6.295   1.00 0.00 ? 20  PRO A CB   13 
ATOM   8489  C  CG   . PRO A 1 20 ? 5.785   -9.899  6.328   1.00 0.00 ? 20  PRO A CG   13 
ATOM   8490  C  CD   . PRO A 1 20 ? 6.028   -9.519  4.894   1.00 0.00 ? 20  PRO A CD   13 
ATOM   8491  H  HA   . PRO A 1 20 ? 3.666   -11.684 4.602   1.00 0.00 ? 20  PRO A HA   13 
ATOM   8492  H  HB2  . PRO A 1 20 ? 4.211   -11.062 7.188   1.00 0.00 ? 20  PRO A HB2  13 
ATOM   8493  H  HB3  . PRO A 1 20 ? 5.324   -11.978 6.165   1.00 0.00 ? 20  PRO A HB3  13 
ATOM   8494  H  HG2  . PRO A 1 20 ? 5.357   -9.068  6.869   1.00 0.00 ? 20  PRO A HG2  13 
ATOM   8495  H  HG3  . PRO A 1 20 ? 6.706   -10.217 6.793   1.00 0.00 ? 20  PRO A HG3  13 
ATOM   8496  H  HD2  . PRO A 1 20 ? 6.180   -8.454  4.806   1.00 0.00 ? 20  PRO A HD2  13 
ATOM   8497  H  HD3  . PRO A 1 20 ? 6.877   -10.058 4.500   1.00 0.00 ? 20  PRO A HD3  13 
ATOM   8498  N  N    . PHE A 1 21 ? 2.577   -8.742  5.153   1.00 0.00 ? 21  PHE A N    13 
ATOM   8499  C  CA   . PHE A 1 21 ? 1.416   -7.930  5.498   1.00 0.00 ? 21  PHE A CA   13 
ATOM   8500  C  C    . PHE A 1 21 ? 0.194   -8.357  4.689   1.00 0.00 ? 21  PHE A C    13 
ATOM   8501  O  O    . PHE A 1 21 ? 0.295   -9.182  3.780   1.00 0.00 ? 21  PHE A O    13 
ATOM   8502  C  CB   . PHE A 1 21 ? 1.711   -6.449  5.253   1.00 0.00 ? 21  PHE A CB   13 
ATOM   8503  C  CG   . PHE A 1 21 ? 2.626   -5.843  6.278   1.00 0.00 ? 21  PHE A CG   13 
ATOM   8504  C  CD1  . PHE A 1 21 ? 3.880   -6.384  6.513   1.00 0.00 ? 21  PHE A CD1  13 
ATOM   8505  C  CD2  . PHE A 1 21 ? 2.233   -4.731  7.006   1.00 0.00 ? 21  PHE A CD2  13 
ATOM   8506  C  CE1  . PHE A 1 21 ? 4.723   -5.828  7.457   1.00 0.00 ? 21  PHE A CE1  13 
ATOM   8507  C  CE2  . PHE A 1 21 ? 3.072   -4.171  7.950   1.00 0.00 ? 21  PHE A CE2  13 
ATOM   8508  C  CZ   . PHE A 1 21 ? 4.319   -4.720  8.175   1.00 0.00 ? 21  PHE A CZ   13 
ATOM   8509  H  H    . PHE A 1 21 ? 3.313   -8.334  4.650   1.00 0.00 ? 21  PHE A H    13 
ATOM   8510  H  HA   . PHE A 1 21 ? 1.208   -8.079  6.546   1.00 0.00 ? 21  PHE A HA   13 
ATOM   8511  H  HB2  . PHE A 1 21 ? 2.177   -6.337  4.285   1.00 0.00 ? 21  PHE A HB2  13 
ATOM   8512  H  HB3  . PHE A 1 21 ? 0.783   -5.898  5.266   1.00 0.00 ? 21  PHE A HB3  13 
ATOM   8513  H  HD1  . PHE A 1 21 ? 4.197   -7.250  5.951   1.00 0.00 ? 21  PHE A HD1  13 
ATOM   8514  H  HD2  . PHE A 1 21 ? 1.256   -4.301  6.830   1.00 0.00 ? 21  PHE A HD2  13 
ATOM   8515  H  HE1  . PHE A 1 21 ? 5.698   -6.259  7.630   1.00 0.00 ? 21  PHE A HE1  13 
ATOM   8516  H  HE2  . PHE A 1 21 ? 2.753   -3.304  8.510   1.00 0.00 ? 21  PHE A HE2  13 
ATOM   8517  H  HZ   . PHE A 1 21 ? 4.976   -4.284  8.913   1.00 0.00 ? 21  PHE A HZ   13 
ATOM   8518  N  N    . PHE A 1 22 ? -0.959  -7.791  5.027   1.00 0.00 ? 22  PHE A N    13 
ATOM   8519  C  CA   . PHE A 1 22 ? -2.201  -8.113  4.335   1.00 0.00 ? 22  PHE A CA   13 
ATOM   8520  C  C    . PHE A 1 22 ? -2.716  -6.909  3.552   1.00 0.00 ? 22  PHE A C    13 
ATOM   8521  O  O    . PHE A 1 22 ? -2.441  -5.763  3.905   1.00 0.00 ? 22  PHE A O    13 
ATOM   8522  C  CB   . PHE A 1 22 ? -3.262  -8.577  5.335   1.00 0.00 ? 22  PHE A CB   13 
ATOM   8523  C  CG   . PHE A 1 22 ? -3.002  -9.947  5.894   1.00 0.00 ? 22  PHE A CG   13 
ATOM   8524  C  CD1  . PHE A 1 22 ? -3.221  -11.077 5.122   1.00 0.00 ? 22  PHE A CD1  13 
ATOM   8525  C  CD2  . PHE A 1 22 ? -2.538  -10.104 7.190   1.00 0.00 ? 22  PHE A CD2  13 
ATOM   8526  C  CE1  . PHE A 1 22 ? -2.983  -12.338 5.634   1.00 0.00 ? 22  PHE A CE1  13 
ATOM   8527  C  CE2  . PHE A 1 22 ? -2.297  -11.363 7.707   1.00 0.00 ? 22  PHE A CE2  13 
ATOM   8528  C  CZ   . PHE A 1 22 ? -2.519  -12.481 6.928   1.00 0.00 ? 22  PHE A CZ   13 
ATOM   8529  H  H    . PHE A 1 22 ? -0.976  -7.141  5.761   1.00 0.00 ? 22  PHE A H    13 
ATOM   8530  H  HA   . PHE A 1 22 ? -1.996  -8.916  3.643   1.00 0.00 ? 22  PHE A HA   13 
ATOM   8531  H  HB2  . PHE A 1 22 ? -3.295  -7.883  6.161   1.00 0.00 ? 22  PHE A HB2  13 
ATOM   8532  H  HB3  . PHE A 1 22 ? -4.225  -8.594  4.846   1.00 0.00 ? 22  PHE A HB3  13 
ATOM   8533  H  HD1  . PHE A 1 22 ? -3.582  -10.966 4.111   1.00 0.00 ? 22  PHE A HD1  13 
ATOM   8534  H  HD2  . PHE A 1 22 ? -2.364  -9.229  7.800   1.00 0.00 ? 22  PHE A HD2  13 
ATOM   8535  H  HE1  . PHE A 1 22 ? -3.157  -13.211 5.023   1.00 0.00 ? 22  PHE A HE1  13 
ATOM   8536  H  HE2  . PHE A 1 22 ? -1.935  -11.471 8.718   1.00 0.00 ? 22  PHE A HE2  13 
ATOM   8537  H  HZ   . PHE A 1 22 ? -2.333  -13.466 7.330   1.00 0.00 ? 22  PHE A HZ   13 
ATOM   8538  N  N    . MET A 1 23 ? -3.464  -7.179  2.487   1.00 0.00 ? 23  MET A N    13 
ATOM   8539  C  CA   . MET A 1 23 ? -4.018  -6.118  1.654   1.00 0.00 ? 23  MET A CA   13 
ATOM   8540  C  C    . MET A 1 23 ? -5.188  -5.433  2.352   1.00 0.00 ? 23  MET A C    13 
ATOM   8541  O  O    . MET A 1 23 ? -6.133  -6.091  2.789   1.00 0.00 ? 23  MET A O    13 
ATOM   8542  C  CB   . MET A 1 23 ? -4.472  -6.683  0.306   1.00 0.00 ? 23  MET A CB   13 
ATOM   8543  C  CG   . MET A 1 23 ? -3.483  -7.660  -0.308  1.00 0.00 ? 23  MET A CG   13 
ATOM   8544  S  SD   . MET A 1 23 ? -4.197  -8.614  -1.661  1.00 0.00 ? 23  MET A SD   13 
ATOM   8545  C  CE   . MET A 1 23 ? -3.101  -8.168  -3.005  1.00 0.00 ? 23  MET A CE   13 
ATOM   8546  H  H    . MET A 1 23 ? -3.649  -8.113  2.255   1.00 0.00 ? 23  MET A H    13 
ATOM   8547  H  HA   . MET A 1 23 ? -3.239  -5.389  1.484   1.00 0.00 ? 23  MET A HA   13 
ATOM   8548  H  HB2  . MET A 1 23 ? -5.413  -7.194  0.442   1.00 0.00 ? 23  MET A HB2  13 
ATOM   8549  H  HB3  . MET A 1 23 ? -4.612  -5.865  -0.385  1.00 0.00 ? 23  MET A HB3  13 
ATOM   8550  H  HG2  . MET A 1 23 ? -2.636  -7.106  -0.685  1.00 0.00 ? 23  MET A HG2  13 
ATOM   8551  H  HG3  . MET A 1 23 ? -3.150  -8.343  0.460   1.00 0.00 ? 23  MET A HG3  13 
ATOM   8552  H  HE1  . MET A 1 23 ? -3.604  -7.478  -3.666  1.00 0.00 ? 23  MET A HE1  13 
ATOM   8553  H  HE2  . MET A 1 23 ? -2.213  -7.701  -2.605  1.00 0.00 ? 23  MET A HE2  13 
ATOM   8554  H  HE3  . MET A 1 23 ? -2.825  -9.056  -3.554  1.00 0.00 ? 23  MET A HE3  13 
ATOM   8555  N  N    . SER A 1 24 ? -5.120  -4.110  2.453   1.00 0.00 ? 24  SER A N    13 
ATOM   8556  C  CA   . SER A 1 24 ? -6.172  -3.337  3.102   1.00 0.00 ? 24  SER A CA   13 
ATOM   8557  C  C    . SER A 1 24 ? -7.224  -2.893  2.089   1.00 0.00 ? 24  SER A C    13 
ATOM   8558  O  O    . SER A 1 24 ? -6.946  -2.787  0.895   1.00 0.00 ? 24  SER A O    13 
ATOM   8559  C  CB   . SER A 1 24 ? -5.578  -2.116  3.805   1.00 0.00 ? 24  SER A CB   13 
ATOM   8560  O  OG   . SER A 1 24 ? -6.356  -1.745  4.930   1.00 0.00 ? 24  SER A OG   13 
ATOM   8561  H  H    . SER A 1 24 ? -4.341  -3.642  2.084   1.00 0.00 ? 24  SER A H    13 
ATOM   8562  H  HA   . SER A 1 24 ? -6.643  -3.972  3.838   1.00 0.00 ? 24  SER A HA   13 
ATOM   8563  H  HB2  . SER A 1 24 ? -4.576  -2.346  4.136   1.00 0.00 ? 24  SER A HB2  13 
ATOM   8564  H  HB3  . SER A 1 24 ? -5.547  -1.285  3.114   1.00 0.00 ? 24  SER A HB3  13 
ATOM   8565  H  HG   . SER A 1 24 ? -5.811  -1.771  5.720   1.00 0.00 ? 24  SER A HG   13 
ATOM   8566  N  N    . VAL A 1 25 ? -8.433  -2.635  2.576   1.00 0.00 ? 25  VAL A N    13 
ATOM   8567  C  CA   . VAL A 1 25 ? -9.527  -2.201  1.715   1.00 0.00 ? 25  VAL A CA   13 
ATOM   8568  C  C    . VAL A 1 25 ? -9.281  -0.796  1.179   1.00 0.00 ? 25  VAL A C    13 
ATOM   8569  O  O    . VAL A 1 25 ? -9.972  -0.337  0.271   1.00 0.00 ? 25  VAL A O    13 
ATOM   8570  C  CB   . VAL A 1 25 ? -10.873 -2.225  2.464   1.00 0.00 ? 25  VAL A CB   13 
ATOM   8571  C  CG1  . VAL A 1 25 ? -11.990 -1.707  1.570   1.00 0.00 ? 25  VAL A CG1  13 
ATOM   8572  C  CG2  . VAL A 1 25 ? -11.183 -3.630  2.958   1.00 0.00 ? 25  VAL A CG2  13 
ATOM   8573  H  H    . VAL A 1 25 ? -8.593  -2.738  3.538   1.00 0.00 ? 25  VAL A H    13 
ATOM   8574  H  HA   . VAL A 1 25 ? -9.590  -2.888  0.883   1.00 0.00 ? 25  VAL A HA   13 
ATOM   8575  H  HB   . VAL A 1 25 ? -10.797 -1.573  3.321   1.00 0.00 ? 25  VAL A HB   13 
ATOM   8576  H  HG11 . VAL A 1 25 ? -11.863 -2.099  0.572   1.00 0.00 ? 25  VAL A HG11 13 
ATOM   8577  H  HG12 . VAL A 1 25 ? -12.944 -2.026  1.964   1.00 0.00 ? 25  VAL A HG12 13 
ATOM   8578  H  HG13 . VAL A 1 25 ? -11.955 -0.628  1.540   1.00 0.00 ? 25  VAL A HG13 13 
ATOM   8579  H  HG21 . VAL A 1 25 ? -10.296 -4.241  2.887   1.00 0.00 ? 25  VAL A HG21 13 
ATOM   8580  H  HG22 . VAL A 1 25 ? -11.509 -3.585  3.987   1.00 0.00 ? 25  VAL A HG22 13 
ATOM   8581  H  HG23 . VAL A 1 25 ? -11.966 -4.061  2.352   1.00 0.00 ? 25  VAL A HG23 13 
ATOM   8582  N  N    . ASN A 1 26 ? -8.289  -0.117  1.747   1.00 0.00 ? 26  ASN A N    13 
ATOM   8583  C  CA   . ASN A 1 26 ? -7.951  1.238   1.326   1.00 0.00 ? 26  ASN A CA   13 
ATOM   8584  C  C    . ASN A 1 26 ? -6.529  1.297   0.775   1.00 0.00 ? 26  ASN A C    13 
ATOM   8585  O  O    . ASN A 1 26 ? -6.092  2.327   0.262   1.00 0.00 ? 26  ASN A O    13 
ATOM   8586  C  CB   . ASN A 1 26 ? -8.096  2.210   2.499   1.00 0.00 ? 26  ASN A CB   13 
ATOM   8587  C  CG   . ASN A 1 26 ? -7.602  3.603   2.159   1.00 0.00 ? 26  ASN A CG   13 
ATOM   8588  O  OD1  . ASN A 1 26 ? -6.728  4.145   2.835   1.00 0.00 ? 26  ASN A OD1  13 
ATOM   8589  N  ND2  . ASN A 1 26 ? -8.163  4.189   1.108   1.00 0.00 ? 26  ASN A ND2  13 
ATOM   8590  H  H    . ASN A 1 26 ? -7.773  -0.537  2.467   1.00 0.00 ? 26  ASN A H    13 
ATOM   8591  H  HA   . ASN A 1 26 ? -8.639  1.524   0.546   1.00 0.00 ? 26  ASN A HA   13 
ATOM   8592  H  HB2  . ASN A 1 26 ? -9.138  2.276   2.777   1.00 0.00 ? 26  ASN A HB2  13 
ATOM   8593  H  HB3  . ASN A 1 26 ? -7.526  1.840   3.338   1.00 0.00 ? 26  ASN A HB3  13 
ATOM   8594  H  HD21 . ASN A 1 26 ? -8.853  3.697   0.616   1.00 0.00 ? 26  ASN A HD21 13 
ATOM   8595  H  HD22 . ASN A 1 26 ? -7.862  5.090   0.865   1.00 0.00 ? 26  ASN A HD22 13 
ATOM   8596  N  N    . THR A 1 27 ? -5.811  0.183   0.885   1.00 0.00 ? 27  THR A N    13 
ATOM   8597  C  CA   . THR A 1 27 ? -4.439  0.108   0.398   1.00 0.00 ? 27  THR A CA   13 
ATOM   8598  C  C    . THR A 1 27 ? -4.304  -0.933  -0.708  1.00 0.00 ? 27  THR A C    13 
ATOM   8599  O  O    . THR A 1 27 ? -3.300  -0.969  -1.418  1.00 0.00 ? 27  THR A O    13 
ATOM   8600  C  CB   . THR A 1 27 ? -3.458  -0.238  1.535   1.00 0.00 ? 27  THR A CB   13 
ATOM   8601  O  OG1  . THR A 1 27 ? -3.651  -1.594  1.953   1.00 0.00 ? 27  THR A OG1  13 
ATOM   8602  C  CG2  . THR A 1 27 ? -3.653  0.696   2.720   1.00 0.00 ? 27  THR A CG2  13 
ATOM   8603  H  H    . THR A 1 27 ? -6.215  -0.605  1.304   1.00 0.00 ? 27  THR A H    13 
ATOM   8604  H  HA   . THR A 1 27 ? -4.172  1.077   0.003   1.00 0.00 ? 27  THR A HA   13 
ATOM   8605  H  HB   . THR A 1 27 ? -2.449  -0.123  1.166   1.00 0.00 ? 27  THR A HB   13 
ATOM   8606  H  HG1  . THR A 1 27 ? -3.512  -2.182  1.207   1.00 0.00 ? 27  THR A HG1  13 
ATOM   8607  H  HG21 . THR A 1 27 ? -2.945  1.510   2.656   1.00 0.00 ? 27  THR A HG21 13 
ATOM   8608  H  HG22 . THR A 1 27 ? -3.492  0.151   3.638   1.00 0.00 ? 27  THR A HG22 13 
ATOM   8609  H  HG23 . THR A 1 27 ? -4.658  1.091   2.706   1.00 0.00 ? 27  THR A HG23 13 
ATOM   8610  N  N    . GLN A 1 28 ? -5.322  -1.776  -0.848  1.00 0.00 ? 28  GLN A N    13 
ATOM   8611  C  CA   . GLN A 1 28 ? -5.316  -2.817  -1.868  1.00 0.00 ? 28  GLN A CA   13 
ATOM   8612  C  C    . GLN A 1 28 ? -5.049  -2.225  -3.248  1.00 0.00 ? 28  GLN A C    13 
ATOM   8613  O  O    . GLN A 1 28 ? -5.372  -1.071  -3.529  1.00 0.00 ? 28  GLN A O    13 
ATOM   8614  C  CB   . GLN A 1 28 ? -6.649  -3.566  -1.871  1.00 0.00 ? 28  GLN A CB   13 
ATOM   8615  C  CG   . GLN A 1 28 ? -7.848  -2.673  -2.145  1.00 0.00 ? 28  GLN A CG   13 
ATOM   8616  C  CD   . GLN A 1 28 ? -9.112  -3.462  -2.425  1.00 0.00 ? 28  GLN A CD   13 
ATOM   8617  O  OE1  . GLN A 1 28 ? -9.152  -4.288  -3.337  1.00 0.00 ? 28  GLN A OE1  13 
ATOM   8618  N  NE2  . GLN A 1 28 ? -10.154 -3.210  -1.641  1.00 0.00 ? 28  GLN A NE2  13 
ATOM   8619  H  H    . GLN A 1 28 ? -6.094  -1.696  -0.251  1.00 0.00 ? 28  GLN A H    13 
ATOM   8620  H  HA   . GLN A 1 28 ? -4.524  -3.511  -1.629  1.00 0.00 ? 28  GLN A HA   13 
ATOM   8621  H  HB2  . GLN A 1 28 ? -6.617  -4.332  -2.631  1.00 0.00 ? 28  GLN A HB2  13 
ATOM   8622  H  HB3  . GLN A 1 28 ? -6.789  -4.033  -0.907  1.00 0.00 ? 28  GLN A HB3  13 
ATOM   8623  H  HG2  . GLN A 1 28 ? -8.019  -2.045  -1.282  1.00 0.00 ? 28  GLN A HG2  13 
ATOM   8624  H  HG3  . GLN A 1 28 ? -7.631  -2.053  -3.002  1.00 0.00 ? 28  GLN A HG3  13 
ATOM   8625  H  HE21 . GLN A 1 28 ? -10.049 -2.538  -0.935  1.00 0.00 ? 28  GLN A HE21 13 
ATOM   8626  H  HE22 . GLN A 1 28 ? -10.983 -3.705  -1.800  1.00 0.00 ? 28  GLN A HE22 13 
ATOM   8627  N  N    . PRO A 1 29 ? -4.444  -3.033  -4.132  1.00 0.00 ? 29  PRO A N    13 
ATOM   8628  C  CA   . PRO A 1 29 ? -4.054  -4.408  -3.810  1.00 0.00 ? 29  PRO A CA   13 
ATOM   8629  C  C    . PRO A 1 29 ? -2.897  -4.466  -2.818  1.00 0.00 ? 29  PRO A C    13 
ATOM   8630  O  O    . PRO A 1 29 ? -2.694  -5.476  -2.143  1.00 0.00 ? 29  PRO A O    13 
ATOM   8631  C  CB   . PRO A 1 29 ? -3.627  -4.982  -5.163  1.00 0.00 ? 29  PRO A CB   13 
ATOM   8632  C  CG   . PRO A 1 29 ? -3.212  -3.796  -5.964  1.00 0.00 ? 29  PRO A CG   13 
ATOM   8633  C  CD   . PRO A 1 29 ? -4.094  -2.664  -5.514  1.00 0.00 ? 29  PRO A CD   13 
ATOM   8634  H  HA   . PRO A 1 29 ? -4.887  -4.977  -3.423  1.00 0.00 ? 29  PRO A HA   13 
ATOM   8635  H  HB2  . PRO A 1 29 ? -2.806  -5.672  -5.022  1.00 0.00 ? 29  PRO A HB2  13 
ATOM   8636  H  HB3  . PRO A 1 29 ? -4.460  -5.495  -5.620  1.00 0.00 ? 29  PRO A HB3  13 
ATOM   8637  H  HG2  . PRO A 1 29 ? -2.176  -3.565  -5.768  1.00 0.00 ? 29  PRO A HG2  13 
ATOM   8638  H  HG3  . PRO A 1 29 ? -3.362  -3.993  -7.015  1.00 0.00 ? 29  PRO A HG3  13 
ATOM   8639  H  HD2  . PRO A 1 29 ? -3.552  -1.731  -5.539  1.00 0.00 ? 29  PRO A HD2  13 
ATOM   8640  H  HD3  . PRO A 1 29 ? -4.978  -2.606  -6.133  1.00 0.00 ? 29  PRO A HD3  13 
ATOM   8641  N  N    . LEU A 1 30 ? -2.142  -3.376  -2.734  1.00 0.00 ? 30  LEU A N    13 
ATOM   8642  C  CA   . LEU A 1 30 ? -1.004  -3.302  -1.823  1.00 0.00 ? 30  LEU A CA   13 
ATOM   8643  C  C    . LEU A 1 30 ? -1.472  -3.165  -0.378  1.00 0.00 ? 30  LEU A C    13 
ATOM   8644  O  O    . LEU A 1 30 ? -2.670  -3.065  -0.108  1.00 0.00 ? 30  LEU A O    13 
ATOM   8645  C  CB   . LEU A 1 30 ? -0.105  -2.122  -2.194  1.00 0.00 ? 30  LEU A CB   13 
ATOM   8646  C  CG   . LEU A 1 30 ? 0.875   -2.360  -3.343  1.00 0.00 ? 30  LEU A CG   13 
ATOM   8647  C  CD1  . LEU A 1 30 ? 1.528   -1.053  -3.768  1.00 0.00 ? 30  LEU A CD1  13 
ATOM   8648  C  CD2  . LEU A 1 30 ? 1.930   -3.380  -2.942  1.00 0.00 ? 30  LEU A CD2  13 
ATOM   8649  H  H    . LEU A 1 30 ? -2.353  -2.603  -3.297  1.00 0.00 ? 30  LEU A H    13 
ATOM   8650  H  HA   . LEU A 1 30 ? -0.441  -4.218  -1.921  1.00 0.00 ? 30  LEU A HA   13 
ATOM   8651  H  HB2  . LEU A 1 30 ? -0.741  -1.294  -2.468  1.00 0.00 ? 30  LEU A HB2  13 
ATOM   8652  H  HB3  . LEU A 1 30 ? 0.469   -1.856  -1.318  1.00 0.00 ? 30  LEU A HB3  13 
ATOM   8653  H  HG   . LEU A 1 30 ? 0.334   -2.753  -4.193  1.00 0.00 ? 30  LEU A HG   13 
ATOM   8654  H  HD11 . LEU A 1 30 ? 1.192   -0.788  -4.758  1.00 0.00 ? 30  LEU A HD11 13 
ATOM   8655  H  HD12 . LEU A 1 30 ? 2.601   -1.172  -3.771  1.00 0.00 ? 30  LEU A HD12 13 
ATOM   8656  H  HD13 . LEU A 1 30 ? 1.255   -0.272  -3.073  1.00 0.00 ? 30  LEU A HD13 13 
ATOM   8657  H  HD21 . LEU A 1 30 ? 2.124   -3.299  -1.882  1.00 0.00 ? 30  LEU A HD21 13 
ATOM   8658  H  HD22 . LEU A 1 30 ? 2.841   -3.189  -3.490  1.00 0.00 ? 30  LEU A HD22 13 
ATOM   8659  H  HD23 . LEU A 1 30 ? 1.575   -4.374  -3.169  1.00 0.00 ? 30  LEU A HD23 13 
ATOM   8660  N  N    . CYS A 1 31 ? -0.520  -3.159  0.549   1.00 0.00 ? 31  CYS A N    13 
ATOM   8661  C  CA   . CYS A 1 31 ? -0.833  -3.033  1.967   1.00 0.00 ? 31  CYS A CA   13 
ATOM   8662  C  C    . CYS A 1 31 ? -0.312  -1.710  2.523   1.00 0.00 ? 31  CYS A C    13 
ATOM   8663  O  O    . CYS A 1 31 ? 0.611   -1.112  1.970   1.00 0.00 ? 31  CYS A O    13 
ATOM   8664  C  CB   . CYS A 1 31 ? -0.230  -4.200  2.750   1.00 0.00 ? 31  CYS A CB   13 
ATOM   8665  S  SG   . CYS A 1 31 ? 1.520   -3.969  3.200   1.00 0.00 ? 31  CYS A SG   13 
ATOM   8666  H  H    . CYS A 1 31 ? 0.417   -3.242  0.272   1.00 0.00 ? 31  CYS A H    13 
ATOM   8667  H  HA   . CYS A 1 31 ? -1.907  -3.056  2.073   1.00 0.00 ? 31  CYS A HA   13 
ATOM   8668  H  HB2  . CYS A 1 31 ? -0.788  -4.337  3.665   1.00 0.00 ? 31  CYS A HB2  13 
ATOM   8669  H  HB3  . CYS A 1 31 ? -0.301  -5.098  2.154   1.00 0.00 ? 31  CYS A HB3  13 
ATOM   8670  N  N    . HIS A 1 32 ? -0.912  -1.259  3.621   1.00 0.00 ? 32  HIS A N    13 
ATOM   8671  C  CA   . HIS A 1 32 ? -0.508  -0.008  4.253   1.00 0.00 ? 32  HIS A CA   13 
ATOM   8672  C  C    . HIS A 1 32 ? 1.008   0.158   4.211   1.00 0.00 ? 32  HIS A C    13 
ATOM   8673  O  O    . HIS A 1 32 ? 1.525   1.051   3.541   1.00 0.00 ? 32  HIS A O    13 
ATOM   8674  C  CB   . HIS A 1 32 ? -0.998  0.037   5.701   1.00 0.00 ? 32  HIS A CB   13 
ATOM   8675  C  CG   . HIS A 1 32 ? -1.131  -1.315  6.331   1.00 0.00 ? 32  HIS A CG   13 
ATOM   8676  N  ND1  . HIS A 1 32 ? -1.832  -1.536  7.497   1.00 0.00 ? 32  HIS A ND1  13 
ATOM   8677  C  CD2  . HIS A 1 32 ? -0.649  -2.521  5.949   1.00 0.00 ? 32  HIS A CD2  13 
ATOM   8678  C  CE1  . HIS A 1 32 ? -1.775  -2.819  7.807   1.00 0.00 ? 32  HIS A CE1  13 
ATOM   8679  N  NE2  . HIS A 1 32 ? -1.063  -3.439  6.883   1.00 0.00 ? 32  HIS A NE2  13 
ATOM   8680  H  H    . HIS A 1 32 ? -1.642  -1.781  4.015   1.00 0.00 ? 32  HIS A H    13 
ATOM   8681  H  HA   . HIS A 1 32 ? -0.962  0.802   3.703   1.00 0.00 ? 32  HIS A HA   13 
ATOM   8682  H  HB2  . HIS A 1 32 ? -0.299  0.611   6.292   1.00 0.00 ? 32  HIS A HB2  13 
ATOM   8683  H  HB3  . HIS A 1 32 ? -1.966  0.516   5.732   1.00 0.00 ? 32  HIS A HB3  13 
ATOM   8684  H  HD1  . HIS A 1 32 ? -2.301  -0.854  8.021   1.00 0.00 ? 32  HIS A HD1  13 
ATOM   8685  H  HD2  . HIS A 1 32 ? -0.050  -2.724  5.073   1.00 0.00 ? 32  HIS A HD2  13 
ATOM   8686  H  HE1  . HIS A 1 32 ? -2.232  -3.283  8.668   1.00 0.00 ? 32  HIS A HE1  13 
ATOM   8687  N  N    . GLU A 1 33 ? 1.714   -0.709  4.930   1.00 0.00 ? 33  GLU A N    13 
ATOM   8688  C  CA   . GLU A 1 33 ? 3.170   -0.656  4.975   1.00 0.00 ? 33  GLU A CA   13 
ATOM   8689  C  C    . GLU A 1 33 ? 3.745   -0.318  3.603   1.00 0.00 ? 33  GLU A C    13 
ATOM   8690  O  O    . GLU A 1 33 ? 4.790   0.324   3.496   1.00 0.00 ? 33  GLU A O    13 
ATOM   8691  C  CB   . GLU A 1 33 ? 3.736   -1.992  5.463   1.00 0.00 ? 33  GLU A CB   13 
ATOM   8692  C  CG   . GLU A 1 33 ? 5.248   -2.091  5.345   1.00 0.00 ? 33  GLU A CG   13 
ATOM   8693  C  CD   . GLU A 1 33 ? 5.963   -1.610  6.593   1.00 0.00 ? 33  GLU A CD   13 
ATOM   8694  O  OE1  . GLU A 1 33 ? 5.699   -2.165  7.680   1.00 0.00 ? 33  GLU A OE1  13 
ATOM   8695  O  OE2  . GLU A 1 33 ? 6.787   -0.678  6.482   1.00 0.00 ? 33  GLU A OE2  13 
ATOM   8696  H  H    . GLU A 1 33 ? 1.244   -1.400  5.443   1.00 0.00 ? 33  GLU A H    13 
ATOM   8697  H  HA   . GLU A 1 33 ? 3.452   0.119   5.671   1.00 0.00 ? 33  GLU A HA   13 
ATOM   8698  H  HB2  . GLU A 1 33 ? 3.466   -2.127  6.500   1.00 0.00 ? 33  GLU A HB2  13 
ATOM   8699  H  HB3  . GLU A 1 33 ? 3.298   -2.788  4.880   1.00 0.00 ? 33  GLU A HB3  13 
ATOM   8700  H  HG2  . GLU A 1 33 ? 5.515   -3.123  5.171   1.00 0.00 ? 33  GLU A HG2  13 
ATOM   8701  H  HG3  . GLU A 1 33 ? 5.571   -1.490  4.508   1.00 0.00 ? 33  GLU A HG3  13 
ATOM   8702  N  N    . CYS A 1 34 ? 3.055   -0.756  2.555   1.00 0.00 ? 34  CYS A N    13 
ATOM   8703  C  CA   . CYS A 1 34 ? 3.496   -0.503  1.189   1.00 0.00 ? 34  CYS A CA   13 
ATOM   8704  C  C    . CYS A 1 34 ? 2.931   0.817   0.671   1.00 0.00 ? 34  CYS A C    13 
ATOM   8705  O  O    . CYS A 1 34 ? 3.674   1.765   0.415   1.00 0.00 ? 34  CYS A O    13 
ATOM   8706  C  CB   . CYS A 1 34 ? 3.066   -1.649  0.271   1.00 0.00 ? 34  CYS A CB   13 
ATOM   8707  S  SG   . CYS A 1 34 ? 3.998   -3.193  0.524   1.00 0.00 ? 34  CYS A SG   13 
ATOM   8708  H  H    . CYS A 1 34 ? 2.229   -1.264  2.704   1.00 0.00 ? 34  CYS A H    13 
ATOM   8709  H  HA   . CYS A 1 34 ? 4.574   -0.441  1.193   1.00 0.00 ? 34  CYS A HA   13 
ATOM   8710  H  HB2  . CYS A 1 34 ? 2.021   -1.864  0.442   1.00 0.00 ? 34  CYS A HB2  13 
ATOM   8711  H  HB3  . CYS A 1 34 ? 3.203   -1.347  -0.757  1.00 0.00 ? 34  CYS A HB3  13 
ATOM   8712  N  N    . SER A 1 35 ? 1.611   0.871   0.521   1.00 0.00 ? 35  SER A N    13 
ATOM   8713  C  CA   . SER A 1 35 ? 0.946   2.073   0.031   1.00 0.00 ? 35  SER A CA   13 
ATOM   8714  C  C    . SER A 1 35 ? 1.655   3.328   0.532   1.00 0.00 ? 35  SER A C    13 
ATOM   8715  O  O    . SER A 1 35 ? 1.703   4.344   -0.161  1.00 0.00 ? 35  SER A O    13 
ATOM   8716  C  CB   . SER A 1 35 ? -0.518  2.088   0.475   1.00 0.00 ? 35  SER A CB   13 
ATOM   8717  O  OG   . SER A 1 35 ? -1.027  3.410   0.507   1.00 0.00 ? 35  SER A OG   13 
ATOM   8718  H  H    . SER A 1 35 ? 1.073   0.083   0.742   1.00 0.00 ? 35  SER A H    13 
ATOM   8719  H  HA   . SER A 1 35 ? 0.986   2.057   -1.048  1.00 0.00 ? 35  SER A HA   13 
ATOM   8720  H  HB2  . SER A 1 35 ? -1.107  1.505   -0.217  1.00 0.00 ? 35  SER A HB2  13 
ATOM   8721  H  HB3  . SER A 1 35 ? -0.595  1.660   1.464   1.00 0.00 ? 35  SER A HB3  13 
ATOM   8722  H  HG   . SER A 1 35 ? -0.548  3.954   -0.122  1.00 0.00 ? 35  SER A HG   13 
ATOM   8723  N  N    . GLU A 1 36 ? 2.202   3.249   1.740   1.00 0.00 ? 36  GLU A N    13 
ATOM   8724  C  CA   . GLU A 1 36 ? 2.907   4.378   2.335   1.00 0.00 ? 36  GLU A CA   13 
ATOM   8725  C  C    . GLU A 1 36 ? 4.253   4.601   1.651   1.00 0.00 ? 36  GLU A C    13 
ATOM   8726  O  O    . GLU A 1 36 ? 4.603   5.727   1.299   1.00 0.00 ? 36  GLU A O    13 
ATOM   8727  C  CB   . GLU A 1 36 ? 3.116   4.147   3.833   1.00 0.00 ? 36  GLU A CB   13 
ATOM   8728  C  CG   . GLU A 1 36 ? 3.961   2.924   4.148   1.00 0.00 ? 36  GLU A CG   13 
ATOM   8729  C  CD   . GLU A 1 36 ? 4.186   2.739   5.636   1.00 0.00 ? 36  GLU A CD   13 
ATOM   8730  O  OE1  . GLU A 1 36 ? 3.268   3.059   6.419   1.00 0.00 ? 36  GLU A OE1  13 
ATOM   8731  O  OE2  . GLU A 1 36 ? 5.281   2.274   6.017   1.00 0.00 ? 36  GLU A OE2  13 
ATOM   8732  H  H    . GLU A 1 36 ? 2.129   2.411   2.244   1.00 0.00 ? 36  GLU A H    13 
ATOM   8733  H  HA   . GLU A 1 36 ? 2.297   5.259   2.198   1.00 0.00 ? 36  GLU A HA   13 
ATOM   8734  H  HB2  . GLU A 1 36 ? 3.602   5.014   4.255   1.00 0.00 ? 36  GLU A HB2  13 
ATOM   8735  H  HB3  . GLU A 1 36 ? 2.151   4.023   4.303   1.00 0.00 ? 36  GLU A HB3  13 
ATOM   8736  H  HG2  . GLU A 1 36 ? 3.460   2.048   3.763   1.00 0.00 ? 36  GLU A HG2  13 
ATOM   8737  H  HG3  . GLU A 1 36 ? 4.920   3.031   3.663   1.00 0.00 ? 36  GLU A HG3  13 
ATOM   8738  N  N    . ARG A 1 37 ? 5.002   3.519   1.467   1.00 0.00 ? 37  ARG A N    13 
ATOM   8739  C  CA   . ARG A 1 37 ? 6.310   3.595   0.827   1.00 0.00 ? 37  ARG A CA   13 
ATOM   8740  C  C    . ARG A 1 37 ? 6.171   3.928   -0.655  1.00 0.00 ? 37  ARG A C    13 
ATOM   8741  O  O    . ARG A 1 37 ? 7.002   4.638   -1.222  1.00 0.00 ? 37  ARG A O    13 
ATOM   8742  C  CB   . ARG A 1 37 ? 7.061   2.273   0.996   1.00 0.00 ? 37  ARG A CB   13 
ATOM   8743  C  CG   . ARG A 1 37 ? 6.751   1.254   -0.088  1.00 0.00 ? 37  ARG A CG   13 
ATOM   8744  C  CD   . ARG A 1 37 ? 7.597   0.000   0.068   1.00 0.00 ? 37  ARG A CD   13 
ATOM   8745  N  NE   . ARG A 1 37 ? 7.309   -0.987  -0.969  1.00 0.00 ? 37  ARG A NE   13 
ATOM   8746  C  CZ   . ARG A 1 37 ? 8.144   -1.965  -1.304  1.00 0.00 ? 37  ARG A CZ   13 
ATOM   8747  N  NH1  . ARG A 1 37 ? 9.310   -2.087  -0.686  1.00 0.00 ? 37  ARG A NH1  13 
ATOM   8748  N  NH2  . ARG A 1 37 ? 7.811   -2.825  -2.259  1.00 0.00 ? 37  ARG A NH2  13 
ATOM   8749  H  H    . ARG A 1 37 ? 4.668   2.648   1.769   1.00 0.00 ? 37  ARG A H    13 
ATOM   8750  H  HA   . ARG A 1 37 ? 6.870   4.381   1.310   1.00 0.00 ? 37  ARG A HA   13 
ATOM   8751  H  HB2  . ARG A 1 37 ? 8.123   2.471   0.979   1.00 0.00 ? 37  ARG A HB2  13 
ATOM   8752  H  HB3  . ARG A 1 37 ? 6.799   1.843   1.950   1.00 0.00 ? 37  ARG A HB3  13 
ATOM   8753  H  HG2  . ARG A 1 37 ? 5.708   0.981   -0.025  1.00 0.00 ? 37  ARG A HG2  13 
ATOM   8754  H  HG3  . ARG A 1 37 ? 6.952   1.695   -1.053  1.00 0.00 ? 37  ARG A HG3  13 
ATOM   8755  H  HD2  . ARG A 1 37 ? 8.639   0.275   0.011   1.00 0.00 ? 37  ARG A HD2  13 
ATOM   8756  H  HD3  . ARG A 1 37 ? 7.393   -0.438  1.034   1.00 0.00 ? 37  ARG A HD3  13 
ATOM   8757  H  HE   . ARG A 1 37 ? 6.453   -0.916  -1.439  1.00 0.00 ? 37  ARG A HE   13 
ATOM   8758  H  HH11 . ARG A 1 37 ? 9.563   -1.442  0.034   1.00 0.00 ? 37  ARG A HH11 13 
ATOM   8759  H  HH12 . ARG A 1 37 ? 9.936   -2.825  -0.940  1.00 0.00 ? 37  ARG A HH12 13 
ATOM   8760  H  HH21 . ARG A 1 37 ? 6.932   -2.736  -2.727  1.00 0.00 ? 37  ARG A HH21 13 
ATOM   8761  H  HH22 . ARG A 1 37 ? 8.439   -3.560  -2.511  1.00 0.00 ? 37  ARG A HH22 13 
ATOM   8762  N  N    . ARG A 1 38 ? 5.117   3.411   -1.277  1.00 0.00 ? 38  ARG A N    13 
ATOM   8763  C  CA   . ARG A 1 38 ? 4.871   3.652   -2.694  1.00 0.00 ? 38  ARG A CA   13 
ATOM   8764  C  C    . ARG A 1 38 ? 4.590   5.129   -2.953  1.00 0.00 ? 38  ARG A C    13 
ATOM   8765  O  O    . ARG A 1 38 ? 5.015   5.682   -3.967  1.00 0.00 ? 38  ARG A O    13 
ATOM   8766  C  CB   . ARG A 1 38 ? 3.693   2.805   -3.180  1.00 0.00 ? 38  ARG A CB   13 
ATOM   8767  C  CG   . ARG A 1 38 ? 3.279   3.103   -4.611  1.00 0.00 ? 38  ARG A CG   13 
ATOM   8768  C  CD   . ARG A 1 38 ? 2.463   1.965   -5.204  1.00 0.00 ? 38  ARG A CD   13 
ATOM   8769  N  NE   . ARG A 1 38 ? 3.307   0.857   -5.642  1.00 0.00 ? 38  ARG A NE   13 
ATOM   8770  C  CZ   . ARG A 1 38 ? 4.144   0.933   -6.671  1.00 0.00 ? 38  ARG A CZ   13 
ATOM   8771  N  NH1  . ARG A 1 38 ? 4.250   2.060   -7.362  1.00 0.00 ? 38  ARG A NH1  13 
ATOM   8772  N  NH2  . ARG A 1 38 ? 4.879   -0.118  -7.009  1.00 0.00 ? 38  ARG A NH2  13 
ATOM   8773  H  H    . ARG A 1 38 ? 4.490   2.852   -0.771  1.00 0.00 ? 38  ARG A H    13 
ATOM   8774  H  HA   . ARG A 1 38 ? 5.758   3.365   -3.238  1.00 0.00 ? 38  ARG A HA   13 
ATOM   8775  H  HB2  . ARG A 1 38 ? 3.965   1.761   -3.117  1.00 0.00 ? 38  ARG A HB2  13 
ATOM   8776  H  HB3  . ARG A 1 38 ? 2.845   2.987   -2.537  1.00 0.00 ? 38  ARG A HB3  13 
ATOM   8777  H  HG2  . ARG A 1 38 ? 2.682   4.003   -4.624  1.00 0.00 ? 38  ARG A HG2  13 
ATOM   8778  H  HG3  . ARG A 1 38 ? 4.166   3.248   -5.210  1.00 0.00 ? 38  ARG A HG3  13 
ATOM   8779  H  HD2  . ARG A 1 38 ? 1.774   1.605   -4.453  1.00 0.00 ? 38  ARG A HD2  13 
ATOM   8780  H  HD3  . ARG A 1 38 ? 1.908   2.340   -6.050  1.00 0.00 ? 38  ARG A HD3  13 
ATOM   8781  H  HE   . ARG A 1 38 ? 3.245   0.015   -5.146  1.00 0.00 ? 38  ARG A HE   13 
ATOM   8782  H  HH11 . ARG A 1 38 ? 3.698   2.854   -7.108  1.00 0.00 ? 38  ARG A HH11 13 
ATOM   8783  H  HH12 . ARG A 1 38 ? 4.882   2.115   -8.135  1.00 0.00 ? 38  ARG A HH12 13 
ATOM   8784  H  HH21 . ARG A 1 38 ? 4.803   -0.969  -6.490  1.00 0.00 ? 38  ARG A HH21 13 
ATOM   8785  H  HH22 . ARG A 1 38 ? 5.509   -0.060  -7.783  1.00 0.00 ? 38  ARG A HH22 13 
ATOM   8786  N  N    . GLN A 1 39 ? 3.872   5.760   -2.030  1.00 0.00 ? 39  GLN A N    13 
ATOM   8787  C  CA   . GLN A 1 39 ? 3.534   7.173   -2.160  1.00 0.00 ? 39  GLN A CA   13 
ATOM   8788  C  C    . GLN A 1 39 ? 4.736   8.053   -1.834  1.00 0.00 ? 39  GLN A C    13 
ATOM   8789  O  O    . GLN A 1 39 ? 5.005   9.036   -2.525  1.00 0.00 ? 39  GLN A O    13 
ATOM   8790  C  CB   . GLN A 1 39 ? 2.364   7.526   -1.239  1.00 0.00 ? 39  GLN A CB   13 
ATOM   8791  C  CG   . GLN A 1 39 ? 2.220   9.017   -0.983  1.00 0.00 ? 39  GLN A CG   13 
ATOM   8792  C  CD   . GLN A 1 39 ? 1.884   9.796   -2.240  1.00 0.00 ? 39  GLN A CD   13 
ATOM   8793  O  OE1  . GLN A 1 39 ? 1.047   9.375   -3.039  1.00 0.00 ? 39  GLN A OE1  13 
ATOM   8794  N  NE2  . GLN A 1 39 ? 2.537   10.937  -2.422  1.00 0.00 ? 39  GLN A NE2  13 
ATOM   8795  H  H    . GLN A 1 39 ? 3.562   5.265   -1.244  1.00 0.00 ? 39  GLN A H    13 
ATOM   8796  H  HA   . GLN A 1 39 ? 3.241   7.350   -3.183  1.00 0.00 ? 39  GLN A HA   13 
ATOM   8797  H  HB2  . GLN A 1 39 ? 1.449   7.169   -1.687  1.00 0.00 ? 39  GLN A HB2  13 
ATOM   8798  H  HB3  . GLN A 1 39 ? 2.508   7.032   -0.290  1.00 0.00 ? 39  GLN A HB3  13 
ATOM   8799  H  HG2  . GLN A 1 39 ? 1.432   9.171   -0.262  1.00 0.00 ? 39  GLN A HG2  13 
ATOM   8800  H  HG3  . GLN A 1 39 ? 3.151   9.392   -0.583  1.00 0.00 ? 39  GLN A HG3  13 
ATOM   8801  H  HE21 . GLN A 1 39 ? 3.192   11.209  -1.744  1.00 0.00 ? 39  GLN A HE21 13 
ATOM   8802  H  HE22 . GLN A 1 39 ? 2.340   11.460  -3.226  1.00 0.00 ? 39  GLN A HE22 13 
ATOM   8803  N  N    . LYS A 1 40 ? 5.457   7.693   -0.777  1.00 0.00 ? 40  LYS A N    13 
ATOM   8804  C  CA   . LYS A 1 40 ? 6.632   8.449   -0.359  1.00 0.00 ? 40  LYS A CA   13 
ATOM   8805  C  C    . LYS A 1 40 ? 7.454   8.888   -1.566  1.00 0.00 ? 40  LYS A C    13 
ATOM   8806  O  O    . LYS A 1 40 ? 7.951   10.013  -1.614  1.00 0.00 ? 40  LYS A O    13 
ATOM   8807  C  CB   . LYS A 1 40 ? 7.497   7.606   0.581   1.00 0.00 ? 40  LYS A CB   13 
ATOM   8808  C  CG   . LYS A 1 40 ? 8.837   8.243   0.908   1.00 0.00 ? 40  LYS A CG   13 
ATOM   8809  C  CD   . LYS A 1 40 ? 9.691   7.331   1.774   1.00 0.00 ? 40  LYS A CD   13 
ATOM   8810  C  CE   . LYS A 1 40 ? 10.565  6.418   0.929   1.00 0.00 ? 40  LYS A CE   13 
ATOM   8811  N  NZ   . LYS A 1 40 ? 9.851   5.169   0.543   1.00 0.00 ? 40  LYS A NZ   13 
ATOM   8812  H  H    . LYS A 1 40 ? 5.193   6.899   -0.266  1.00 0.00 ? 40  LYS A H    13 
ATOM   8813  H  HA   . LYS A 1 40 ? 6.292   9.327   0.169   1.00 0.00 ? 40  LYS A HA   13 
ATOM   8814  H  HB2  . LYS A 1 40 ? 6.960   7.453   1.505   1.00 0.00 ? 40  LYS A HB2  13 
ATOM   8815  H  HB3  . LYS A 1 40 ? 7.682   6.647   0.118   1.00 0.00 ? 40  LYS A HB3  13 
ATOM   8816  H  HG2  . LYS A 1 40 ? 9.365   8.444   -0.013  1.00 0.00 ? 40  LYS A HG2  13 
ATOM   8817  H  HG3  . LYS A 1 40 ? 8.665   9.170   1.437   1.00 0.00 ? 40  LYS A HG3  13 
ATOM   8818  H  HD2  . LYS A 1 40 ? 10.326  7.938   2.403   1.00 0.00 ? 40  LYS A HD2  13 
ATOM   8819  H  HD3  . LYS A 1 40 ? 9.043   6.726   2.392   1.00 0.00 ? 40  LYS A HD3  13 
ATOM   8820  H  HE2  . LYS A 1 40 ? 10.857  6.946   0.034   1.00 0.00 ? 40  LYS A HE2  13 
ATOM   8821  H  HE3  . LYS A 1 40 ? 11.446  6.157   1.497   1.00 0.00 ? 40  LYS A HE3  13 
ATOM   8822  H  HZ1  . LYS A 1 40 ? 8.893   5.165   0.947   1.00 0.00 ? 40  LYS A HZ1  13 
ATOM   8823  H  HZ2  . LYS A 1 40 ? 10.368  4.338   0.896   1.00 0.00 ? 40  LYS A HZ2  13 
ATOM   8824  H  HZ3  . LYS A 1 40 ? 9.779   5.104   -0.493  1.00 0.00 ? 40  LYS A HZ3  13 
ATOM   8825  N  N    . ASN A 1 41 ? 7.592   7.994   -2.540  1.00 0.00 ? 41  ASN A N    13 
ATOM   8826  C  CA   . ASN A 1 41 ? 8.353   8.292   -3.748  1.00 0.00 ? 41  ASN A CA   13 
ATOM   8827  C  C    . ASN A 1 41 ? 7.422   8.619   -4.911  1.00 0.00 ? 41  ASN A C    13 
ATOM   8828  O  O    . ASN A 1 41 ? 6.203   8.495   -4.796  1.00 0.00 ? 41  ASN A O    13 
ATOM   8829  C  CB   . ASN A 1 41 ? 9.249   7.107   -4.116  1.00 0.00 ? 41  ASN A CB   13 
ATOM   8830  C  CG   . ASN A 1 41 ? 10.363  7.498   -5.067  1.00 0.00 ? 41  ASN A CG   13 
ATOM   8831  O  OD1  . ASN A 1 41 ? 10.740  8.667   -5.152  1.00 0.00 ? 41  ASN A OD1  13 
ATOM   8832  N  ND2  . ASN A 1 41 ? 10.897  6.519   -5.788  1.00 0.00 ? 41  ASN A ND2  13 
ATOM   8833  H  H    . ASN A 1 41 ? 7.172   7.114   -2.445  1.00 0.00 ? 41  ASN A H    13 
ATOM   8834  H  HA   . ASN A 1 41 ? 8.974   9.151   -3.546  1.00 0.00 ? 41  ASN A HA   13 
ATOM   8835  H  HB2  . ASN A 1 41 ? 9.694   6.707   -3.216  1.00 0.00 ? 41  ASN A HB2  13 
ATOM   8836  H  HB3  . ASN A 1 41 ? 8.650   6.342   -4.587  1.00 0.00 ? 41  ASN A HB3  13 
ATOM   8837  H  HD21 . ASN A 1 41 ? 10.546  5.611   -5.668  1.00 0.00 ? 41  ASN A HD21 13 
ATOM   8838  H  HD22 . ASN A 1 41 ? 11.619  6.743   -6.410  1.00 0.00 ? 41  ASN A HD22 13 
ATOM   8839  N  N    . GLN A 1 42 ? 8.005   9.037   -6.030  1.00 0.00 ? 42  GLN A N    13 
ATOM   8840  C  CA   . GLN A 1 42 ? 7.227   9.383   -7.214  1.00 0.00 ? 42  GLN A CA   13 
ATOM   8841  C  C    . GLN A 1 42 ? 7.719   8.610   -8.433  1.00 0.00 ? 42  GLN A C    13 
ATOM   8842  O  O    . GLN A 1 42 ? 8.915   8.366   -8.584  1.00 0.00 ? 42  GLN A O    13 
ATOM   8843  C  CB   . GLN A 1 42 ? 7.307   10.886  -7.482  1.00 0.00 ? 42  GLN A CB   13 
ATOM   8844  C  CG   . GLN A 1 42 ? 8.679   11.350  -7.945  1.00 0.00 ? 42  GLN A CG   13 
ATOM   8845  C  CD   . GLN A 1 42 ? 8.645   12.722  -8.588  1.00 0.00 ? 42  GLN A CD   13 
ATOM   8846  O  OE1  . GLN A 1 42 ? 7.719   13.502  -8.365  1.00 0.00 ? 42  GLN A OE1  13 
ATOM   8847  N  NE2  . GLN A 1 42 ? 9.658   13.024  -9.392  1.00 0.00 ? 42  GLN A NE2  13 
ATOM   8848  H  H    . GLN A 1 42 ? 8.981   9.115   -6.060  1.00 0.00 ? 42  GLN A H    13 
ATOM   8849  H  HA   . GLN A 1 42 ? 6.199   9.114   -7.024  1.00 0.00 ? 42  GLN A HA   13 
ATOM   8850  H  HB2  . GLN A 1 42 ? 6.588   11.143  -8.245  1.00 0.00 ? 42  GLN A HB2  13 
ATOM   8851  H  HB3  . GLN A 1 42 ? 7.061   11.416  -6.573  1.00 0.00 ? 42  GLN A HB3  13 
ATOM   8852  H  HG2  . GLN A 1 42 ? 9.340   11.385  -7.092  1.00 0.00 ? 42  GLN A HG2  13 
ATOM   8853  H  HG3  . GLN A 1 42 ? 9.060   10.640  -8.665  1.00 0.00 ? 42  GLN A HG3  13 
ATOM   8854  H  HE21 . GLN A 1 42 ? 10.361  12.353  -9.524  1.00 0.00 ? 42  GLN A HE21 13 
ATOM   8855  H  HE22 . GLN A 1 42 ? 9.662   13.904  -9.821  1.00 0.00 ? 42  GLN A HE22 13 
ATOM   8856  N  N    . ASN A 1 43 ? 6.788   8.226   -9.300  1.00 0.00 ? 43  ASN A N    13 
ATOM   8857  C  CA   . ASN A 1 43 ? 7.127   7.480   -10.506 1.00 0.00 ? 43  ASN A CA   13 
ATOM   8858  C  C    . ASN A 1 43 ? 6.834   8.304   -11.757 1.00 0.00 ? 43  ASN A C    13 
ATOM   8859  O  O    . ASN A 1 43 ? 5.834   9.020   -11.820 1.00 0.00 ? 43  ASN A O    13 
ATOM   8860  C  CB   . ASN A 1 43 ? 6.346   6.165   -10.554 1.00 0.00 ? 43  ASN A CB   13 
ATOM   8861  C  CG   . ASN A 1 43 ? 6.888   5.136   -9.581  1.00 0.00 ? 43  ASN A CG   13 
ATOM   8862  O  OD1  . ASN A 1 43 ? 7.144   5.441   -8.416  1.00 0.00 ? 43  ASN A OD1  13 
ATOM   8863  N  ND2  . ASN A 1 43 ? 7.065   3.908   -10.057 1.00 0.00 ? 43  ASN A ND2  13 
ATOM   8864  H  H    . ASN A 1 43 ? 5.850   8.450   -9.125  1.00 0.00 ? 43  ASN A H    13 
ATOM   8865  H  HA   . ASN A 1 43 ? 8.183   7.260   -10.474 1.00 0.00 ? 43  ASN A HA   13 
ATOM   8866  H  HB2  . ASN A 1 43 ? 5.312   6.358   -10.305 1.00 0.00 ? 43  ASN A HB2  13 
ATOM   8867  H  HB3  . ASN A 1 43 ? 6.402   5.756   -11.551 1.00 0.00 ? 43  ASN A HB3  13 
ATOM   8868  H  HD21 . ASN A 1 43 ? 6.839   3.738   -10.995 1.00 0.00 ? 43  ASN A HD21 13 
ATOM   8869  H  HD22 . ASN A 1 43 ? 7.413   3.223   -9.449  1.00 0.00 ? 43  ASN A HD22 13 
ATOM   8870  N  N    . SER A 1 44 ? 7.712   8.197   -12.749 1.00 0.00 ? 44  SER A N    13 
ATOM   8871  C  CA   . SER A 1 44 ? 7.549   8.934   -13.996 1.00 0.00 ? 44  SER A CA   13 
ATOM   8872  C  C    . SER A 1 44 ? 6.449   8.316   -14.853 1.00 0.00 ? 44  SER A C    13 
ATOM   8873  O  O    . SER A 1 44 ? 5.631   9.024   -15.438 1.00 0.00 ? 44  SER A O    13 
ATOM   8874  C  CB   . SER A 1 44 ? 8.866   8.957   -14.775 1.00 0.00 ? 44  SER A CB   13 
ATOM   8875  O  OG   . SER A 1 44 ? 9.842   9.733   -14.103 1.00 0.00 ? 44  SER A OG   13 
ATOM   8876  H  H    . SER A 1 44 ? 8.489   7.610   -12.637 1.00 0.00 ? 44  SER A H    13 
ATOM   8877  H  HA   . SER A 1 44 ? 7.270   9.948   -13.748 1.00 0.00 ? 44  SER A HA   13 
ATOM   8878  H  HB2  . SER A 1 44 ? 9.236   7.949   -14.881 1.00 0.00 ? 44  SER A HB2  13 
ATOM   8879  H  HB3  . SER A 1 44 ? 8.695   9.383   -15.753 1.00 0.00 ? 44  SER A HB3  13 
ATOM   8880  H  HG   . SER A 1 44 ? 10.695  9.296   -14.160 1.00 0.00 ? 44  SER A HG   13 
ATOM   8881  N  N    . GLY A 1 45 ? 6.437   6.988   -14.922 1.00 0.00 ? 45  GLY A N    13 
ATOM   8882  C  CA   . GLY A 1 45 ? 5.434   6.295   -15.710 1.00 0.00 ? 45  GLY A CA   13 
ATOM   8883  C  C    . GLY A 1 45 ? 4.265   5.819   -14.870 1.00 0.00 ? 45  GLY A C    13 
ATOM   8884  O  O    . GLY A 1 45 ? 4.377   4.869   -14.095 1.00 0.00 ? 45  GLY A O    13 
ATOM   8885  H  H    . GLY A 1 45 ? 7.114   6.475   -14.434 1.00 0.00 ? 45  GLY A H    13 
ATOM   8886  H  HA2  . GLY A 1 45 ? 5.066   6.965   -16.473 1.00 0.00 ? 45  GLY A HA2  13 
ATOM   8887  H  HA3  . GLY A 1 45 ? 5.893   5.441   -16.185 1.00 0.00 ? 45  GLY A HA3  13 
ATOM   8888  N  N    . PRO A 1 46 ? 3.112   6.488   -15.019 1.00 0.00 ? 46  PRO A N    13 
ATOM   8889  C  CA   . PRO A 1 46 ? 1.896   6.145   -14.276 1.00 0.00 ? 46  PRO A CA   13 
ATOM   8890  C  C    . PRO A 1 46 ? 1.297   4.817   -14.725 1.00 0.00 ? 46  PRO A C    13 
ATOM   8891  O  O    . PRO A 1 46 ? 1.571   4.343   -15.828 1.00 0.00 ? 46  PRO A O    13 
ATOM   8892  C  CB   . PRO A 1 46 ? 0.945   7.299   -14.601 1.00 0.00 ? 46  PRO A CB   13 
ATOM   8893  C  CG   . PRO A 1 46 ? 1.415   7.819   -15.916 1.00 0.00 ? 46  PRO A CG   13 
ATOM   8894  C  CD   . PRO A 1 46 ? 2.907   7.630   -15.925 1.00 0.00 ? 46  PRO A CD   13 
ATOM   8895  H  HA   . PRO A 1 46 ? 2.077   6.115   -13.211 1.00 0.00 ? 46  PRO A HA   13 
ATOM   8896  H  HB2  . PRO A 1 46 ? -0.068  6.927   -14.663 1.00 0.00 ? 46  PRO A HB2  13 
ATOM   8897  H  HB3  . PRO A 1 46 ? 1.011   8.054   -13.832 1.00 0.00 ? 46  PRO A HB3  13 
ATOM   8898  H  HG2  . PRO A 1 46 ? 0.961   7.257   -16.717 1.00 0.00 ? 46  PRO A HG2  13 
ATOM   8899  H  HG3  . PRO A 1 46 ? 1.170   8.867   -16.005 1.00 0.00 ? 46  PRO A HG3  13 
ATOM   8900  H  HD2  . PRO A 1 46 ? 3.252   7.399   -16.922 1.00 0.00 ? 46  PRO A HD2  13 
ATOM   8901  H  HD3  . PRO A 1 46 ? 3.402   8.514   -15.549 1.00 0.00 ? 46  PRO A HD3  13 
ATOM   8902  N  N    . SER A 1 47 ? 0.477   4.222   -13.865 1.00 0.00 ? 47  SER A N    13 
ATOM   8903  C  CA   . SER A 1 47 ? -0.159  2.946   -14.173 1.00 0.00 ? 47  SER A CA   13 
ATOM   8904  C  C    . SER A 1 47 ? -1.619  3.148   -14.566 1.00 0.00 ? 47  SER A C    13 
ATOM   8905  O  O    . SER A 1 47 ? -2.225  4.170   -14.242 1.00 0.00 ? 47  SER A O    13 
ATOM   8906  C  CB   . SER A 1 47 ? -0.068  2.004   -12.971 1.00 0.00 ? 47  SER A CB   13 
ATOM   8907  O  OG   . SER A 1 47 ? -0.804  0.815   -13.198 1.00 0.00 ? 47  SER A OG   13 
ATOM   8908  H  H    . SER A 1 47 ? 0.298   4.650   -13.001 1.00 0.00 ? 47  SER A H    13 
ATOM   8909  H  HA   . SER A 1 47 ? 0.368   2.506   -15.006 1.00 0.00 ? 47  SER A HA   13 
ATOM   8910  H  HB2  . SER A 1 47 ? 0.966   1.746   -12.797 1.00 0.00 ? 47  SER A HB2  13 
ATOM   8911  H  HB3  . SER A 1 47 ? -0.467  2.499   -12.098 1.00 0.00 ? 47  SER A HB3  13 
ATOM   8912  H  HG   . SER A 1 47 ? -0.279  0.057   -12.931 1.00 0.00 ? 47  SER A HG   13 
ATOM   8913  N  N    . SER A 1 48 ? -2.178  2.166   -15.265 1.00 0.00 ? 48  SER A N    13 
ATOM   8914  C  CA   . SER A 1 48 ? -3.566  2.236   -15.707 1.00 0.00 ? 48  SER A CA   13 
ATOM   8915  C  C    . SER A 1 48 ? -4.514  2.294   -14.512 1.00 0.00 ? 48  SER A C    13 
ATOM   8916  O  O    . SER A 1 48 ? -5.403  3.142   -14.451 1.00 0.00 ? 48  SER A O    13 
ATOM   8917  C  CB   . SER A 1 48 ? -3.906  1.029   -16.583 1.00 0.00 ? 48  SER A CB   13 
ATOM   8918  O  OG   . SER A 1 48 ? -3.586  -0.185  -15.927 1.00 0.00 ? 48  SER A OG   13 
ATOM   8919  H  H    . SER A 1 48 ? -1.643  1.377   -15.492 1.00 0.00 ? 48  SER A H    13 
ATOM   8920  H  HA   . SER A 1 48 ? -3.684  3.138   -16.288 1.00 0.00 ? 48  SER A HA   13 
ATOM   8921  H  HB2  . SER A 1 48 ? -4.962  1.036   -16.807 1.00 0.00 ? 48  SER A HB2  13 
ATOM   8922  H  HB3  . SER A 1 48 ? -3.343  1.087   -17.504 1.00 0.00 ? 48  SER A HB3  13 
ATOM   8923  H  HG   . SER A 1 48 ? -3.670  -0.915  -16.545 1.00 0.00 ? 48  SER A HG   13 
ATOM   8924  N  N    . GLY A 1 49 ? -4.316  1.383   -13.563 1.00 0.00 ? 49  GLY A N    13 
ATOM   8925  C  CA   . GLY A 1 49 ? -5.160  1.347   -12.383 1.00 0.00 ? 49  GLY A CA   13 
ATOM   8926  C  C    . GLY A 1 49 ? -5.380  2.722   -11.785 1.00 0.00 ? 49  GLY A C    13 
ATOM   8927  O  O    . GLY A 1 49 ? -4.639  3.109   -10.883 1.00 0.00 ? 49  GLY A O    13 
ATOM   8928  H  H    . GLY A 1 49 ? -3.592  0.731   -13.666 1.00 0.00 ? 49  GLY A H    13 
ATOM   8929  H  HA2  . GLY A 1 49 ? -6.117  0.925   -12.651 1.00 0.00 ? 49  GLY A HA2  13 
ATOM   8930  H  HA3  . GLY A 1 49 ? -4.694  0.715   -11.641 1.00 0.00 ? 49  GLY A HA3  13 
HETATM 8931  ZN ZN   . ZN  B 2 .  ? 2.926   -4.814  1.659   1.00 0.00 ? 201 ZN  A ZN   13 
ATOM   8932  N  N    . GLY A 1 1  ? -13.805 8.129   11.692  1.00 0.00 ? 1   GLY A N    14 
ATOM   8933  C  CA   . GLY A 1 1  ? -14.414 9.366   12.144  1.00 0.00 ? 1   GLY A CA   14 
ATOM   8934  C  C    . GLY A 1 1  ? -14.184 10.512  11.179  1.00 0.00 ? 1   GLY A C    14 
ATOM   8935  O  O    . GLY A 1 1  ? -13.783 10.298  10.035  1.00 0.00 ? 1   GLY A O    14 
ATOM   8936  H  H1   . GLY A 1 1  ? -14.366 7.344   11.520  1.00 0.00 ? 1   GLY A H1   14 
ATOM   8937  H  HA2  . GLY A 1 1  ? -15.476 9.212   12.257  1.00 0.00 ? 1   GLY A HA2  14 
ATOM   8938  H  HA3  . GLY A 1 1  ? -13.994 9.630   13.104  1.00 0.00 ? 1   GLY A HA3  14 
ATOM   8939  N  N    . SER A 1 2  ? -14.441 11.732  11.640  1.00 0.00 ? 2   SER A N    14 
ATOM   8940  C  CA   . SER A 1 2  ? -14.265 12.917  10.807  1.00 0.00 ? 2   SER A CA   14 
ATOM   8941  C  C    . SER A 1 2  ? -13.077 12.746  9.865   1.00 0.00 ? 2   SER A C    14 
ATOM   8942  O  O    . SER A 1 2  ? -13.230 12.775  8.644   1.00 0.00 ? 2   SER A O    14 
ATOM   8943  C  CB   . SER A 1 2  ? -14.063 14.156  11.682  1.00 0.00 ? 2   SER A CB   14 
ATOM   8944  O  OG   . SER A 1 2  ? -15.280 14.556  12.287  1.00 0.00 ? 2   SER A OG   14 
ATOM   8945  H  H    . SER A 1 2  ? -14.758 11.838  12.561  1.00 0.00 ? 2   SER A H    14 
ATOM   8946  H  HA   . SER A 1 2  ? -15.161 13.044  10.218  1.00 0.00 ? 2   SER A HA   14 
ATOM   8947  H  HB2  . SER A 1 2  ? -13.346 13.933  12.457  1.00 0.00 ? 2   SER A HB2  14 
ATOM   8948  H  HB3  . SER A 1 2  ? -13.694 14.967  11.071  1.00 0.00 ? 2   SER A HB3  14 
ATOM   8949  H  HG   . SER A 1 2  ? -15.772 15.113  11.679  1.00 0.00 ? 2   SER A HG   14 
ATOM   8950  N  N    . SER A 1 3  ? -11.892 12.570  10.442  1.00 0.00 ? 3   SER A N    14 
ATOM   8951  C  CA   . SER A 1 3  ? -10.677 12.399  9.655   1.00 0.00 ? 3   SER A CA   14 
ATOM   8952  C  C    . SER A 1 3  ? -10.118 10.989  9.818   1.00 0.00 ? 3   SER A C    14 
ATOM   8953  O  O    . SER A 1 3  ? -10.022 10.472  10.930  1.00 0.00 ? 3   SER A O    14 
ATOM   8954  C  CB   . SER A 1 3  ? -9.625  13.428  10.073  1.00 0.00 ? 3   SER A CB   14 
ATOM   8955  O  OG   . SER A 1 3  ? -9.346  13.338  11.459  1.00 0.00 ? 3   SER A OG   14 
ATOM   8956  H  H    . SER A 1 3  ? -11.835 12.557  11.420  1.00 0.00 ? 3   SER A H    14 
ATOM   8957  H  HA   . SER A 1 3  ? -10.929 12.556  8.617   1.00 0.00 ? 3   SER A HA   14 
ATOM   8958  H  HB2  . SER A 1 3  ? -8.713  13.251  9.522   1.00 0.00 ? 3   SER A HB2  14 
ATOM   8959  H  HB3  . SER A 1 3  ? -9.990  14.421  9.855   1.00 0.00 ? 3   SER A HB3  14 
ATOM   8960  H  HG   . SER A 1 3  ? -8.708  14.014  11.702  1.00 0.00 ? 3   SER A HG   14 
ATOM   8961  N  N    . GLY A 1 4  ? -9.750  10.372  8.699   1.00 0.00 ? 4   GLY A N    14 
ATOM   8962  C  CA   . GLY A 1 4  ? -9.205  9.027   8.738   1.00 0.00 ? 4   GLY A CA   14 
ATOM   8963  C  C    . GLY A 1 4  ? -9.556  8.223   7.502   1.00 0.00 ? 4   GLY A C    14 
ATOM   8964  O  O    . GLY A 1 4  ? -8.705  7.990   6.643   1.00 0.00 ? 4   GLY A O    14 
ATOM   8965  H  H    . GLY A 1 4  ? -9.849  10.833  7.840   1.00 0.00 ? 4   GLY A H    14 
ATOM   8966  H  HA2  . GLY A 1 4  ? -8.130  9.088   8.823   1.00 0.00 ? 4   GLY A HA2  14 
ATOM   8967  H  HA3  . GLY A 1 4  ? -9.596  8.518   9.607   1.00 0.00 ? 4   GLY A HA3  14 
ATOM   8968  N  N    . SER A 1 5  ? -10.812 7.797   7.412   1.00 0.00 ? 5   SER A N    14 
ATOM   8969  C  CA   . SER A 1 5  ? -11.272 7.010   6.274   1.00 0.00 ? 5   SER A CA   14 
ATOM   8970  C  C    . SER A 1 5  ? -10.445 5.736   6.125   1.00 0.00 ? 5   SER A C    14 
ATOM   8971  O  O    . SER A 1 5  ? -10.102 5.332   5.014   1.00 0.00 ? 5   SER A O    14 
ATOM   8972  C  CB   . SER A 1 5  ? -11.192 7.836   4.989   1.00 0.00 ? 5   SER A CB   14 
ATOM   8973  O  OG   . SER A 1 5  ? -12.311 8.696   4.866   1.00 0.00 ? 5   SER A OG   14 
ATOM   8974  H  H    . SER A 1 5  ? -11.443 8.016   8.129   1.00 0.00 ? 5   SER A H    14 
ATOM   8975  H  HA   . SER A 1 5  ? -12.301 6.738   6.454   1.00 0.00 ? 5   SER A HA   14 
ATOM   8976  H  HB2  . SER A 1 5  ? -10.293 8.434   5.004   1.00 0.00 ? 5   SER A HB2  14 
ATOM   8977  H  HB3  . SER A 1 5  ? -11.168 7.171   4.138   1.00 0.00 ? 5   SER A HB3  14 
ATOM   8978  H  HG   . SER A 1 5  ? -12.065 9.471   4.354   1.00 0.00 ? 5   SER A HG   14 
ATOM   8979  N  N    . SER A 1 6  ? -10.129 5.108   7.253   1.00 0.00 ? 6   SER A N    14 
ATOM   8980  C  CA   . SER A 1 6  ? -9.339  3.882   7.250   1.00 0.00 ? 6   SER A CA   14 
ATOM   8981  C  C    . SER A 1 6  ? -10.149 2.716   6.692   1.00 0.00 ? 6   SER A C    14 
ATOM   8982  O  O    . SER A 1 6  ? -11.378 2.730   6.719   1.00 0.00 ? 6   SER A O    14 
ATOM   8983  C  CB   . SER A 1 6  ? -8.861  3.555   8.666   1.00 0.00 ? 6   SER A CB   14 
ATOM   8984  O  OG   . SER A 1 6  ? -7.681  2.771   8.638   1.00 0.00 ? 6   SER A OG   14 
ATOM   8985  H  H    . SER A 1 6  ? -10.432 5.480   8.108   1.00 0.00 ? 6   SER A H    14 
ATOM   8986  H  HA   . SER A 1 6  ? -8.479  4.044   6.617   1.00 0.00 ? 6   SER A HA   14 
ATOM   8987  H  HB2  . SER A 1 6  ? -8.657  4.473   9.196   1.00 0.00 ? 6   SER A HB2  14 
ATOM   8988  H  HB3  . SER A 1 6  ? -9.633  3.004   9.185   1.00 0.00 ? 6   SER A HB3  14 
ATOM   8989  H  HG   . SER A 1 6  ? -7.460  2.558   7.728   1.00 0.00 ? 6   SER A HG   14 
ATOM   8990  N  N    . GLY A 1 7  ? -9.448  1.706   6.184   1.00 0.00 ? 7   GLY A N    14 
ATOM   8991  C  CA   . GLY A 1 7  ? -10.117 0.545   5.626   1.00 0.00 ? 7   GLY A CA   14 
ATOM   8992  C  C    . GLY A 1 7  ? -9.928  -0.696  6.475   1.00 0.00 ? 7   GLY A C    14 
ATOM   8993  O  O    . GLY A 1 7  ? -9.309  -0.642  7.538   1.00 0.00 ? 7   GLY A O    14 
ATOM   8994  H  H    . GLY A 1 7  ? -8.469  1.750   6.189   1.00 0.00 ? 7   GLY A H    14 
ATOM   8995  H  HA2  . GLY A 1 7  ? -11.173 0.756   5.545   1.00 0.00 ? 7   GLY A HA2  14 
ATOM   8996  H  HA3  . GLY A 1 7  ? -9.721  0.356   4.639   1.00 0.00 ? 7   GLY A HA3  14 
ATOM   8997  N  N    . SER A 1 8  ? -10.464 -1.819  6.006   1.00 0.00 ? 8   SER A N    14 
ATOM   8998  C  CA   . SER A 1 8  ? -10.356 -3.079  6.732   1.00 0.00 ? 8   SER A CA   14 
ATOM   8999  C  C    . SER A 1 8  ? -9.273  -3.965  6.125   1.00 0.00 ? 8   SER A C    14 
ATOM   9000  O  O    . SER A 1 8  ? -9.001  -3.899  4.925   1.00 0.00 ? 8   SER A O    14 
ATOM   9001  C  CB   . SER A 1 8  ? -11.698 -3.814  6.722   1.00 0.00 ? 8   SER A CB   14 
ATOM   9002  O  OG   . SER A 1 8  ? -12.705 -3.046  7.358   1.00 0.00 ? 8   SER A OG   14 
ATOM   9003  H  H    . SER A 1 8  ? -10.946 -1.798  5.153   1.00 0.00 ? 8   SER A H    14 
ATOM   9004  H  HA   . SER A 1 8  ? -10.088 -2.851  7.753   1.00 0.00 ? 8   SER A HA   14 
ATOM   9005  H  HB2  . SER A 1 8  ? -11.995 -4.001  5.702   1.00 0.00 ? 8   SER A HB2  14 
ATOM   9006  H  HB3  . SER A 1 8  ? -11.594 -4.753  7.245   1.00 0.00 ? 8   SER A HB3  14 
ATOM   9007  H  HG   . SER A 1 8  ? -12.886 -2.260  6.836   1.00 0.00 ? 8   SER A HG   14 
ATOM   9008  N  N    . LEU A 1 9  ? -8.659  -4.794  6.961   1.00 0.00 ? 9   LEU A N    14 
ATOM   9009  C  CA   . LEU A 1 9  ? -7.605  -5.695  6.508   1.00 0.00 ? 9   LEU A CA   14 
ATOM   9010  C  C    . LEU A 1 9  ? -8.196  -6.964  5.902   1.00 0.00 ? 9   LEU A C    14 
ATOM   9011  O  O    . LEU A 1 9  ? -8.815  -7.767  6.600   1.00 0.00 ? 9   LEU A O    14 
ATOM   9012  C  CB   . LEU A 1 9  ? -6.680  -6.056  7.671   1.00 0.00 ? 9   LEU A CB   14 
ATOM   9013  C  CG   . LEU A 1 9  ? -5.879  -4.901  8.275   1.00 0.00 ? 9   LEU A CG   14 
ATOM   9014  C  CD1  . LEU A 1 9  ? -5.218  -5.332  9.575   1.00 0.00 ? 9   LEU A CD1  14 
ATOM   9015  C  CD2  . LEU A 1 9  ? -4.838  -4.399  7.285   1.00 0.00 ? 9   LEU A CD2  14 
ATOM   9016  H  H    . LEU A 1 9  ? -8.919  -4.802  7.905   1.00 0.00 ? 9   LEU A H    14 
ATOM   9017  H  HA   . LEU A 1 9  ? -7.033  -5.181  5.749   1.00 0.00 ? 9   LEU A HA   14 
ATOM   9018  H  HB2  . LEU A 1 9  ? -7.286  -6.483  8.455   1.00 0.00 ? 9   LEU A HB2  14 
ATOM   9019  H  HB3  . LEU A 1 9  ? -5.977  -6.797  7.317   1.00 0.00 ? 9   LEU A HB3  14 
ATOM   9020  H  HG   . LEU A 1 9  ? -6.551  -4.083  8.497   1.00 0.00 ? 9   LEU A HG   14 
ATOM   9021  H  HD11 . LEU A 1 9  ? -5.734  -4.880  10.408  1.00 0.00 ? 9   LEU A HD11 14 
ATOM   9022  H  HD12 . LEU A 1 9  ? -4.186  -5.014  9.576   1.00 0.00 ? 9   LEU A HD12 14 
ATOM   9023  H  HD13 . LEU A 1 9  ? -5.263  -6.407  9.662   1.00 0.00 ? 9   LEU A HD13 14 
ATOM   9024  H  HD21 . LEU A 1 9  ? -3.871  -4.367  7.765   1.00 0.00 ? 9   LEU A HD21 14 
ATOM   9025  H  HD22 . LEU A 1 9  ? -5.108  -3.409  6.950   1.00 0.00 ? 9   LEU A HD22 14 
ATOM   9026  H  HD23 . LEU A 1 9  ? -4.797  -5.067  6.436   1.00 0.00 ? 9   LEU A HD23 14 
ATOM   9027  N  N    . MET A 1 10 ? -7.999  -7.139  4.599   1.00 0.00 ? 10  MET A N    14 
ATOM   9028  C  CA   . MET A 1 10 ? -8.510  -8.313  3.900   1.00 0.00 ? 10  MET A CA   14 
ATOM   9029  C  C    . MET A 1 10 ? -7.757  -9.569  4.325   1.00 0.00 ? 10  MET A C    14 
ATOM   9030  O  O    . MET A 1 10 ? -6.678  -9.489  4.912   1.00 0.00 ? 10  MET A O    14 
ATOM   9031  C  CB   . MET A 1 10 ? -8.394  -8.122  2.387   1.00 0.00 ? 10  MET A CB   14 
ATOM   9032  C  CG   . MET A 1 10 ? -9.534  -7.314  1.787   1.00 0.00 ? 10  MET A CG   14 
ATOM   9033  S  SD   . MET A 1 10 ? -11.055 -8.269  1.629   1.00 0.00 ? 10  MET A SD   14 
ATOM   9034  C  CE   . MET A 1 10 ? -11.995 -7.227  0.516   1.00 0.00 ? 10  MET A CE   14 
ATOM   9035  H  H    . MET A 1 10 ? -7.498  -6.464  4.096   1.00 0.00 ? 10  MET A H    14 
ATOM   9036  H  HA   . MET A 1 10 ? -9.552  -8.426  4.161   1.00 0.00 ? 10  MET A HA   14 
ATOM   9037  H  HB2  . MET A 1 10 ? -7.467  -7.612  2.170   1.00 0.00 ? 10  MET A HB2  14 
ATOM   9038  H  HB3  . MET A 1 10 ? -8.382  -9.092  1.913   1.00 0.00 ? 10  MET A HB3  14 
ATOM   9039  H  HG2  . MET A 1 10 ? -9.726  -6.461  2.421   1.00 0.00 ? 10  MET A HG2  14 
ATOM   9040  H  HG3  . MET A 1 10 ? -9.236  -6.971  0.807   1.00 0.00 ? 10  MET A HG3  14 
ATOM   9041  H  HE1  . MET A 1 10 ? -11.994 -7.664  -0.472  1.00 0.00 ? 10  MET A HE1  14 
ATOM   9042  H  HE2  . MET A 1 10 ? -13.011 -7.145  0.872   1.00 0.00 ? 10  MET A HE2  14 
ATOM   9043  H  HE3  . MET A 1 10 ? -11.546 -6.246  0.477   1.00 0.00 ? 10  MET A HE3  14 
ATOM   9044  N  N    . ASP A 1 11 ? -8.333  -10.728 4.025   1.00 0.00 ? 11  ASP A N    14 
ATOM   9045  C  CA   . ASP A 1 11 ? -7.715  -12.002 4.375   1.00 0.00 ? 11  ASP A CA   14 
ATOM   9046  C  C    . ASP A 1 11 ? -6.710  -12.430 3.310   1.00 0.00 ? 11  ASP A C    14 
ATOM   9047  O  O    . ASP A 1 11 ? -6.329  -13.598 3.236   1.00 0.00 ? 11  ASP A O    14 
ATOM   9048  C  CB   . ASP A 1 11 ? -8.785  -13.081 4.548   1.00 0.00 ? 11  ASP A CB   14 
ATOM   9049  C  CG   . ASP A 1 11 ? -9.295  -13.169 5.973   1.00 0.00 ? 11  ASP A CG   14 
ATOM   9050  O  OD1  . ASP A 1 11 ? -9.205  -12.156 6.698   1.00 0.00 ? 11  ASP A OD1  14 
ATOM   9051  O  OD2  . ASP A 1 11 ? -9.785  -14.249 6.362   1.00 0.00 ? 11  ASP A OD2  14 
ATOM   9052  H  H    . ASP A 1 11 ? -9.194  -10.727 3.556   1.00 0.00 ? 11  ASP A H    14 
ATOM   9053  H  HA   . ASP A 1 11 ? -7.195  -11.872 5.312   1.00 0.00 ? 11  ASP A HA   14 
ATOM   9054  H  HB2  . ASP A 1 11 ? -9.620  -12.858 3.899   1.00 0.00 ? 11  ASP A HB2  14 
ATOM   9055  H  HB3  . ASP A 1 11 ? -8.368  -14.039 4.274   1.00 0.00 ? 11  ASP A HB3  14 
ATOM   9056  N  N    . VAL A 1 12 ? -6.286  -11.476 2.487   1.00 0.00 ? 12  VAL A N    14 
ATOM   9057  C  CA   . VAL A 1 12 ? -5.325  -11.754 1.426   1.00 0.00 ? 12  VAL A CA   14 
ATOM   9058  C  C    . VAL A 1 12 ? -3.979  -11.101 1.719   1.00 0.00 ? 12  VAL A C    14 
ATOM   9059  O  O    . VAL A 1 12 ? -3.917  -9.975  2.214   1.00 0.00 ? 12  VAL A O    14 
ATOM   9060  C  CB   . VAL A 1 12 ? -5.838  -11.258 0.061   1.00 0.00 ? 12  VAL A CB   14 
ATOM   9061  C  CG1  . VAL A 1 12 ? -4.904  -11.704 -1.054  1.00 0.00 ? 12  VAL A CG1  14 
ATOM   9062  C  CG2  . VAL A 1 12 ? -7.254  -11.755 -0.188  1.00 0.00 ? 12  VAL A CG2  14 
ATOM   9063  H  H    . VAL A 1 12 ? -6.626  -10.564 2.597   1.00 0.00 ? 12  VAL A H    14 
ATOM   9064  H  HA   . VAL A 1 12 ? -5.190  -12.825 1.370   1.00 0.00 ? 12  VAL A HA   14 
ATOM   9065  H  HB   . VAL A 1 12 ? -5.855  -10.178 0.076   1.00 0.00 ? 12  VAL A HB   14 
ATOM   9066  H  HG11 . VAL A 1 12 ? -4.277  -10.875 -1.350  1.00 0.00 ? 12  VAL A HG11 14 
ATOM   9067  H  HG12 . VAL A 1 12 ? -4.286  -12.517 -0.703  1.00 0.00 ? 12  VAL A HG12 14 
ATOM   9068  H  HG13 . VAL A 1 12 ? -5.487  -12.034 -1.901  1.00 0.00 ? 12  VAL A HG13 14 
ATOM   9069  H  HG21 . VAL A 1 12 ? -7.958  -10.970 0.046   1.00 0.00 ? 12  VAL A HG21 14 
ATOM   9070  H  HG22 . VAL A 1 12 ? -7.359  -12.036 -1.225  1.00 0.00 ? 12  VAL A HG22 14 
ATOM   9071  H  HG23 . VAL A 1 12 ? -7.451  -12.613 0.439   1.00 0.00 ? 12  VAL A HG23 14 
ATOM   9072  N  N    . LYS A 1 13 ? -2.902  -11.815 1.410   1.00 0.00 ? 13  LYS A N    14 
ATOM   9073  C  CA   . LYS A 1 13 ? -1.555  -11.305 1.638   1.00 0.00 ? 13  LYS A CA   14 
ATOM   9074  C  C    . LYS A 1 13 ? -1.250  -10.137 0.706   1.00 0.00 ? 13  LYS A C    14 
ATOM   9075  O  O    . LYS A 1 13 ? -1.871  -9.992  -0.348  1.00 0.00 ? 13  LYS A O    14 
ATOM   9076  C  CB   . LYS A 1 13 ? -0.525  -12.418 1.431   1.00 0.00 ? 13  LYS A CB   14 
ATOM   9077  C  CG   . LYS A 1 13 ? -0.335  -13.305 2.649   1.00 0.00 ? 13  LYS A CG   14 
ATOM   9078  C  CD   . LYS A 1 13 ? -1.491  -14.277 2.817   1.00 0.00 ? 13  LYS A CD   14 
ATOM   9079  C  CE   . LYS A 1 13 ? -1.440  -15.388 1.779   1.00 0.00 ? 13  LYS A CE   14 
ATOM   9080  N  NZ   . LYS A 1 13 ? -2.202  -16.590 2.216   1.00 0.00 ? 13  LYS A NZ   14 
ATOM   9081  H  H    . LYS A 1 13 ? -3.016  -12.707 1.018   1.00 0.00 ? 13  LYS A H    14 
ATOM   9082  H  HA   . LYS A 1 13 ? -1.499  -10.960 2.659   1.00 0.00 ? 13  LYS A HA   14 
ATOM   9083  H  HB2  . LYS A 1 13 ? -0.843  -13.039 0.606   1.00 0.00 ? 13  LYS A HB2  14 
ATOM   9084  H  HB3  . LYS A 1 13 ? 0.428   -11.970 1.186   1.00 0.00 ? 13  LYS A HB3  14 
ATOM   9085  H  HG2  . LYS A 1 13 ? 0.580   -13.867 2.535   1.00 0.00 ? 13  LYS A HG2  14 
ATOM   9086  H  HG3  . LYS A 1 13 ? -0.269  -12.682 3.530   1.00 0.00 ? 13  LYS A HG3  14 
ATOM   9087  H  HD2  . LYS A 1 13 ? -1.439  -14.718 3.802   1.00 0.00 ? 13  LYS A HD2  14 
ATOM   9088  H  HD3  . LYS A 1 13 ? -2.421  -13.738 2.710   1.00 0.00 ? 13  LYS A HD3  14 
ATOM   9089  H  HE2  . LYS A 1 13 ? -1.863  -15.020 0.857   1.00 0.00 ? 13  LYS A HE2  14 
ATOM   9090  H  HE3  . LYS A 1 13 ? -0.409  -15.665 1.617   1.00 0.00 ? 13  LYS A HE3  14 
ATOM   9091  H  HZ1  . LYS A 1 13 ? -2.032  -16.774 3.226   1.00 0.00 ? 13  LYS A HZ1  14 
ATOM   9092  H  HZ2  . LYS A 1 13 ? -1.903  -17.422 1.668   1.00 0.00 ? 13  LYS A HZ2  14 
ATOM   9093  H  HZ3  . LYS A 1 13 ? -3.221  -16.441 2.069   1.00 0.00 ? 13  LYS A HZ3  14 
ATOM   9094  N  N    . CYS A 1 14 ? -0.290  -9.307  1.099   1.00 0.00 ? 14  CYS A N    14 
ATOM   9095  C  CA   . CYS A 1 14 ? 0.098   -8.152  0.299   1.00 0.00 ? 14  CYS A CA   14 
ATOM   9096  C  C    . CYS A 1 14 ? 0.618   -8.587  -1.068  1.00 0.00 ? 14  CYS A C    14 
ATOM   9097  O  O    . CYS A 1 14 ? 1.260   -9.628  -1.196  1.00 0.00 ? 14  CYS A O    14 
ATOM   9098  C  CB   . CYS A 1 14 ? 1.169   -7.337  1.027   1.00 0.00 ? 14  CYS A CB   14 
ATOM   9099  S  SG   . CYS A 1 14 ? 1.929   -6.030  0.011   1.00 0.00 ? 14  CYS A SG   14 
ATOM   9100  H  H    . CYS A 1 14 ? 0.169   -9.475  1.949   1.00 0.00 ? 14  CYS A H    14 
ATOM   9101  H  HA   . CYS A 1 14 ? -0.777  -7.536  0.158   1.00 0.00 ? 14  CYS A HA   14 
ATOM   9102  H  HB2  . CYS A 1 14 ? 0.724   -6.863  1.891   1.00 0.00 ? 14  CYS A HB2  14 
ATOM   9103  H  HB3  . CYS A 1 14 ? 1.956   -8.000  1.353   1.00 0.00 ? 14  CYS A HB3  14 
ATOM   9104  N  N    . GLU A 1 15 ? 0.334   -7.781  -2.087  1.00 0.00 ? 15  GLU A N    14 
ATOM   9105  C  CA   . GLU A 1 15 ? 0.772   -8.083  -3.444  1.00 0.00 ? 15  GLU A CA   14 
ATOM   9106  C  C    . GLU A 1 15 ? 2.205   -8.608  -3.450  1.00 0.00 ? 15  GLU A C    14 
ATOM   9107  O  O    . GLU A 1 15 ? 2.484   -9.681  -3.986  1.00 0.00 ? 15  GLU A O    14 
ATOM   9108  C  CB   . GLU A 1 15 ? 0.671   -6.837  -4.327  1.00 0.00 ? 15  GLU A CB   14 
ATOM   9109  C  CG   . GLU A 1 15 ? 1.307   -7.007  -5.696  1.00 0.00 ? 15  GLU A CG   14 
ATOM   9110  C  CD   . GLU A 1 15 ? 1.472   -5.691  -6.430  1.00 0.00 ? 15  GLU A CD   14 
ATOM   9111  O  OE1  . GLU A 1 15 ? 0.682   -4.761  -6.164  1.00 0.00 ? 15  GLU A OE1  14 
ATOM   9112  O  OE2  . GLU A 1 15 ? 2.391   -5.591  -7.270  1.00 0.00 ? 15  GLU A OE2  14 
ATOM   9113  H  H    . GLU A 1 15 ? -0.182  -6.964  -1.922  1.00 0.00 ? 15  GLU A H    14 
ATOM   9114  H  HA   . GLU A 1 15 ? 0.120   -8.847  -3.841  1.00 0.00 ? 15  GLU A HA   14 
ATOM   9115  H  HB2  . GLU A 1 15 ? -0.372  -6.592  -4.464  1.00 0.00 ? 15  GLU A HB2  14 
ATOM   9116  H  HB3  . GLU A 1 15 ? 1.161   -6.016  -3.825  1.00 0.00 ? 15  GLU A HB3  14 
ATOM   9117  H  HG2  . GLU A 1 15 ? 2.280   -7.458  -5.573  1.00 0.00 ? 15  GLU A HG2  14 
ATOM   9118  H  HG3  . GLU A 1 15 ? 0.682   -7.658  -6.290  1.00 0.00 ? 15  GLU A HG3  14 
ATOM   9119  N  N    . THR A 1 16 ? 3.111   -7.843  -2.848  1.00 0.00 ? 16  THR A N    14 
ATOM   9120  C  CA   . THR A 1 16 ? 4.515   -8.229  -2.784  1.00 0.00 ? 16  THR A CA   14 
ATOM   9121  C  C    . THR A 1 16 ? 4.673   -9.642  -2.235  1.00 0.00 ? 16  THR A C    14 
ATOM   9122  O  O    . THR A 1 16 ? 4.174   -9.975  -1.160  1.00 0.00 ? 16  THR A O    14 
ATOM   9123  C  CB   . THR A 1 16 ? 5.326   -7.256  -1.908  1.00 0.00 ? 16  THR A CB   14 
ATOM   9124  O  OG1  . THR A 1 16 ? 4.981   -5.904  -2.229  1.00 0.00 ? 16  THR A OG1  14 
ATOM   9125  C  CG2  . THR A 1 16 ? 6.819   -7.465  -2.105  1.00 0.00 ? 16  THR A CG2  14 
ATOM   9126  H  H    . THR A 1 16 ? 2.827   -7.000  -2.439  1.00 0.00 ? 16  THR A H    14 
ATOM   9127  H  HA   . THR A 1 16 ? 4.916   -8.196  -3.787  1.00 0.00 ? 16  THR A HA   14 
ATOM   9128  H  HB   . THR A 1 16 ? 5.085   -7.444  -0.871  1.00 0.00 ? 16  THR A HB   14 
ATOM   9129  H  HG1  . THR A 1 16 ? 4.391   -5.555  -1.556  1.00 0.00 ? 16  THR A HG1  14 
ATOM   9130  H  HG21 . THR A 1 16 ? 7.333   -7.295  -1.171  1.00 0.00 ? 16  THR A HG21 14 
ATOM   9131  H  HG22 . THR A 1 16 ? 7.185   -6.771  -2.848  1.00 0.00 ? 16  THR A HG22 14 
ATOM   9132  H  HG23 . THR A 1 16 ? 7.000   -8.476  -2.437  1.00 0.00 ? 16  THR A HG23 14 
ATOM   9133  N  N    . PRO A 1 17 ? 5.384   -10.495 -2.988  1.00 0.00 ? 17  PRO A N    14 
ATOM   9134  C  CA   . PRO A 1 17 ? 5.625   -11.886 -2.595  1.00 0.00 ? 17  PRO A CA   14 
ATOM   9135  C  C    . PRO A 1 17 ? 6.570   -11.997 -1.403  1.00 0.00 ? 17  PRO A C    14 
ATOM   9136  O  O    . PRO A 1 17 ? 6.855   -13.094 -0.925  1.00 0.00 ? 17  PRO A O    14 
ATOM   9137  C  CB   . PRO A 1 17 ? 6.263   -12.502 -3.842  1.00 0.00 ? 17  PRO A CB   14 
ATOM   9138  C  CG   . PRO A 1 17 ? 6.890   -11.352 -4.553  1.00 0.00 ? 17  PRO A CG   14 
ATOM   9139  C  CD   . PRO A 1 17 ? 6.008   -10.166 -4.280  1.00 0.00 ? 17  PRO A CD   14 
ATOM   9140  H  HA   . PRO A 1 17 ? 4.702   -12.400 -2.370  1.00 0.00 ? 17  PRO A HA   14 
ATOM   9141  H  HB2  . PRO A 1 17 ? 7.001   -13.235 -3.548  1.00 0.00 ? 17  PRO A HB2  14 
ATOM   9142  H  HB3  . PRO A 1 17 ? 5.502   -12.971 -4.446  1.00 0.00 ? 17  PRO A HB3  14 
ATOM   9143  H  HG2  . PRO A 1 17 ? 7.883   -11.179 -4.167  1.00 0.00 ? 17  PRO A HG2  14 
ATOM   9144  H  HG3  . PRO A 1 17 ? 6.929   -11.554 -5.614  1.00 0.00 ? 17  PRO A HG3  14 
ATOM   9145  H  HD2  . PRO A 1 17 ? 6.599   -9.265  -4.205  1.00 0.00 ? 17  PRO A HD2  14 
ATOM   9146  H  HD3  . PRO A 1 17 ? 5.261   -10.065 -5.054  1.00 0.00 ? 17  PRO A HD3  14 
ATOM   9147  N  N    . ASN A 1 18 ? 7.052   -10.853 -0.928  1.00 0.00 ? 18  ASN A N    14 
ATOM   9148  C  CA   . ASN A 1 18 ? 7.965   -10.822 0.209   1.00 0.00 ? 18  ASN A CA   14 
ATOM   9149  C  C    . ASN A 1 18 ? 7.353   -10.056 1.378   1.00 0.00 ? 18  ASN A C    14 
ATOM   9150  O  O    . ASN A 1 18 ? 8.014   -9.810  2.387   1.00 0.00 ? 18  ASN A O    14 
ATOM   9151  C  CB   . ASN A 1 18 ? 9.294   -10.180 -0.196  1.00 0.00 ? 18  ASN A CB   14 
ATOM   9152  C  CG   . ASN A 1 18 ? 9.921   -10.858 -1.399  1.00 0.00 ? 18  ASN A CG   14 
ATOM   9153  O  OD1  . ASN A 1 18 ? 10.197  -12.058 -1.375  1.00 0.00 ? 18  ASN A OD1  14 
ATOM   9154  N  ND2  . ASN A 1 18 ? 10.150  -10.091 -2.458  1.00 0.00 ? 18  ASN A ND2  14 
ATOM   9155  H  H    . ASN A 1 18 ? 6.788   -10.009 -1.352  1.00 0.00 ? 18  ASN A H    14 
ATOM   9156  H  HA   . ASN A 1 18 ? 8.147   -11.841 0.516   1.00 0.00 ? 18  ASN A HA   14 
ATOM   9157  H  HB2  . ASN A 1 18 ? 9.126   -9.141  -0.440  1.00 0.00 ? 18  ASN A HB2  14 
ATOM   9158  H  HB3  . ASN A 1 18 ? 9.985   -10.243 0.631   1.00 0.00 ? 18  ASN A HB3  14 
ATOM   9159  H  HD21 . ASN A 1 18 ? 9.904   -9.144  -2.406  1.00 0.00 ? 18  ASN A HD21 14 
ATOM   9160  H  HD22 . ASN A 1 18 ? 10.554  -10.504 -3.250  1.00 0.00 ? 18  ASN A HD22 14 
ATOM   9161  N  N    . CYS A 1 19 ? 6.086   -9.683  1.235   1.00 0.00 ? 19  CYS A N    14 
ATOM   9162  C  CA   . CYS A 1 19 ? 5.383   -8.946  2.278   1.00 0.00 ? 19  CYS A CA   14 
ATOM   9163  C  C    . CYS A 1 19 ? 4.263   -9.789  2.879   1.00 0.00 ? 19  CYS A C    14 
ATOM   9164  O  O    . CYS A 1 19 ? 3.222   -10.016 2.261   1.00 0.00 ? 19  CYS A O    14 
ATOM   9165  C  CB   . CYS A 1 19 ? 4.810   -7.644  1.714   1.00 0.00 ? 19  CYS A CB   14 
ATOM   9166  S  SG   . CYS A 1 19 ? 4.345   -6.424  2.984   1.00 0.00 ? 19  CYS A SG   14 
ATOM   9167  H  H    . CYS A 1 19 ? 5.611   -9.909  0.407   1.00 0.00 ? 19  CYS A H    14 
ATOM   9168  H  HA   . CYS A 1 19 ? 6.095   -8.709  3.054   1.00 0.00 ? 19  CYS A HA   14 
ATOM   9169  H  HB2  . CYS A 1 19 ? 5.547   -7.184  1.071   1.00 0.00 ? 19  CYS A HB2  14 
ATOM   9170  H  HB3  . CYS A 1 19 ? 3.926   -7.870  1.135   1.00 0.00 ? 19  CYS A HB3  14 
ATOM   9171  N  N    . PRO A 1 20 ? 4.478   -10.265 4.115   1.00 0.00 ? 20  PRO A N    14 
ATOM   9172  C  CA   . PRO A 1 20 ? 3.498   -11.090 4.827   1.00 0.00 ? 20  PRO A CA   14 
ATOM   9173  C  C    . PRO A 1 20 ? 2.265   -10.296 5.243   1.00 0.00 ? 20  PRO A C    14 
ATOM   9174  O  O    . PRO A 1 20 ? 1.227   -10.870 5.575   1.00 0.00 ? 20  PRO A O    14 
ATOM   9175  C  CB   . PRO A 1 20 ? 4.267   -11.567 6.062   1.00 0.00 ? 20  PRO A CB   14 
ATOM   9176  C  CG   . PRO A 1 20 ? 5.316   -10.532 6.278   1.00 0.00 ? 20  PRO A CG   14 
ATOM   9177  C  CD   . PRO A 1 20 ? 5.695   -10.034 4.911   1.00 0.00 ? 20  PRO A CD   14 
ATOM   9178  H  HA   . PRO A 1 20 ? 3.194   -11.943 4.238   1.00 0.00 ? 20  PRO A HA   14 
ATOM   9179  H  HB2  . PRO A 1 20 ? 3.595   -11.632 6.905   1.00 0.00 ? 20  PRO A HB2  14 
ATOM   9180  H  HB3  . PRO A 1 20 ? 4.703   -12.536 5.867   1.00 0.00 ? 20  PRO A HB3  14 
ATOM   9181  H  HG2  . PRO A 1 20 ? 4.919   -9.725  6.875   1.00 0.00 ? 20  PRO A HG2  14 
ATOM   9182  H  HG3  . PRO A 1 20 ? 6.173   -10.974 6.766   1.00 0.00 ? 20  PRO A HG3  14 
ATOM   9183  H  HD2  . PRO A 1 20 ? 5.939   -8.983  4.946   1.00 0.00 ? 20  PRO A HD2  14 
ATOM   9184  H  HD3  . PRO A 1 20 ? 6.525   -10.603 4.519   1.00 0.00 ? 20  PRO A HD3  14 
ATOM   9185  N  N    . PHE A 1 21 ? 2.384   -8.972  5.221   1.00 0.00 ? 21  PHE A N    14 
ATOM   9186  C  CA   . PHE A 1 21 ? 1.278   -8.099  5.596   1.00 0.00 ? 21  PHE A CA   14 
ATOM   9187  C  C    . PHE A 1 21 ? 0.040   -8.397  4.755   1.00 0.00 ? 21  PHE A C    14 
ATOM   9188  O  O    . PHE A 1 21 ? 0.134   -8.994  3.682   1.00 0.00 ? 21  PHE A O    14 
ATOM   9189  C  CB   . PHE A 1 21 ? 1.680   -6.632  5.430   1.00 0.00 ? 21  PHE A CB   14 
ATOM   9190  C  CG   . PHE A 1 21 ? 2.488   -6.098  6.578   1.00 0.00 ? 21  PHE A CG   14 
ATOM   9191  C  CD1  . PHE A 1 21 ? 1.863   -5.544  7.684   1.00 0.00 ? 21  PHE A CD1  14 
ATOM   9192  C  CD2  . PHE A 1 21 ? 3.872   -6.151  6.552   1.00 0.00 ? 21  PHE A CD2  14 
ATOM   9193  C  CE1  . PHE A 1 21 ? 2.604   -5.052  8.742   1.00 0.00 ? 21  PHE A CE1  14 
ATOM   9194  C  CE2  . PHE A 1 21 ? 4.618   -5.662  7.608   1.00 0.00 ? 21  PHE A CE2  14 
ATOM   9195  C  CZ   . PHE A 1 21 ? 3.983   -5.110  8.703   1.00 0.00 ? 21  PHE A CZ   14 
ATOM   9196  H  H    . PHE A 1 21 ? 3.236   -8.574  4.947   1.00 0.00 ? 21  PHE A H    14 
ATOM   9197  H  HA   . PHE A 1 21 ? 1.047   -8.285  6.634   1.00 0.00 ? 21  PHE A HA   14 
ATOM   9198  H  HB2  . PHE A 1 21 ? 2.270   -6.527  4.533   1.00 0.00 ? 21  PHE A HB2  14 
ATOM   9199  H  HB3  . PHE A 1 21 ? 0.788   -6.030  5.342   1.00 0.00 ? 21  PHE A HB3  14 
ATOM   9200  H  HD1  . PHE A 1 21 ? 0.783   -5.497  7.715   1.00 0.00 ? 21  PHE A HD1  14 
ATOM   9201  H  HD2  . PHE A 1 21 ? 4.370   -6.581  5.695   1.00 0.00 ? 21  PHE A HD2  14 
ATOM   9202  H  HE1  . PHE A 1 21 ? 2.104   -4.622  9.597   1.00 0.00 ? 21  PHE A HE1  14 
ATOM   9203  H  HE2  . PHE A 1 21 ? 5.696   -5.708  7.575   1.00 0.00 ? 21  PHE A HE2  14 
ATOM   9204  H  HZ   . PHE A 1 21 ? 4.563   -4.727  9.529   1.00 0.00 ? 21  PHE A HZ   14 
ATOM   9205  N  N    . PHE A 1 22 ? -1.120  -7.979  5.251   1.00 0.00 ? 22  PHE A N    14 
ATOM   9206  C  CA   . PHE A 1 22 ? -2.377  -8.202  4.547   1.00 0.00 ? 22  PHE A CA   14 
ATOM   9207  C  C    . PHE A 1 22 ? -2.829  -6.935  3.826   1.00 0.00 ? 22  PHE A C    14 
ATOM   9208  O  O    . PHE A 1 22 ? -2.575  -5.822  4.286   1.00 0.00 ? 22  PHE A O    14 
ATOM   9209  C  CB   . PHE A 1 22 ? -3.460  -8.659  5.526   1.00 0.00 ? 22  PHE A CB   14 
ATOM   9210  C  CG   . PHE A 1 22 ? -3.184  -10.000 6.143   1.00 0.00 ? 22  PHE A CG   14 
ATOM   9211  C  CD1  . PHE A 1 22 ? -3.304  -11.160 5.394   1.00 0.00 ? 22  PHE A CD1  14 
ATOM   9212  C  CD2  . PHE A 1 22 ? -2.803  -10.101 7.471   1.00 0.00 ? 22  PHE A CD2  14 
ATOM   9213  C  CE1  . PHE A 1 22 ? -3.050  -12.395 5.960   1.00 0.00 ? 22  PHE A CE1  14 
ATOM   9214  C  CE2  . PHE A 1 22 ? -2.547  -11.334 8.042   1.00 0.00 ? 22  PHE A CE2  14 
ATOM   9215  C  CZ   . PHE A 1 22 ? -2.670  -12.482 7.285   1.00 0.00 ? 22  PHE A CZ   14 
ATOM   9216  H  H    . PHE A 1 22 ? -1.130  -7.509  6.111   1.00 0.00 ? 22  PHE A H    14 
ATOM   9217  H  HA   . PHE A 1 22 ? -2.214  -8.979  3.816   1.00 0.00 ? 22  PHE A HA   14 
ATOM   9218  H  HB2  . PHE A 1 22 ? -3.541  -7.937  6.325   1.00 0.00 ? 22  PHE A HB2  14 
ATOM   9219  H  HB3  . PHE A 1 22 ? -4.404  -8.720  5.005   1.00 0.00 ? 22  PHE A HB3  14 
ATOM   9220  H  HD1  . PHE A 1 22 ? -3.599  -11.093 4.357   1.00 0.00 ? 22  PHE A HD1  14 
ATOM   9221  H  HD2  . PHE A 1 22 ? -2.706  -9.203  8.065   1.00 0.00 ? 22  PHE A HD2  14 
ATOM   9222  H  HE1  . PHE A 1 22 ? -3.147  -13.292 5.365   1.00 0.00 ? 22  PHE A HE1  14 
ATOM   9223  H  HE2  . PHE A 1 22 ? -2.251  -11.398 9.078   1.00 0.00 ? 22  PHE A HE2  14 
ATOM   9224  H  HZ   . PHE A 1 22 ? -2.472  -13.446 7.729   1.00 0.00 ? 22  PHE A HZ   14 
ATOM   9225  N  N    . MET A 1 23 ? -3.500  -7.114  2.693   1.00 0.00 ? 23  MET A N    14 
ATOM   9226  C  CA   . MET A 1 23 ? -3.988  -5.985  1.908   1.00 0.00 ? 23  MET A CA   14 
ATOM   9227  C  C    . MET A 1 23 ? -5.186  -5.329  2.587   1.00 0.00 ? 23  MET A C    14 
ATOM   9228  O  O    . MET A 1 23 ? -6.052  -6.012  3.135   1.00 0.00 ? 23  MET A O    14 
ATOM   9229  C  CB   . MET A 1 23 ? -4.373  -6.444  0.500   1.00 0.00 ? 23  MET A CB   14 
ATOM   9230  C  CG   . MET A 1 23 ? -3.357  -7.383  -0.131  1.00 0.00 ? 23  MET A CG   14 
ATOM   9231  S  SD   . MET A 1 23 ? -4.034  -8.297  -1.531  1.00 0.00 ? 23  MET A SD   14 
ATOM   9232  C  CE   . MET A 1 23 ? -2.617  -8.337  -2.626  1.00 0.00 ? 23  MET A CE   14 
ATOM   9233  H  H    . MET A 1 23 ? -3.672  -8.025  2.377   1.00 0.00 ? 23  MET A H    14 
ATOM   9234  H  HA   . MET A 1 23 ? -3.190  -5.262  1.836   1.00 0.00 ? 23  MET A HA   14 
ATOM   9235  H  HB2  . MET A 1 23 ? -5.323  -6.955  0.548   1.00 0.00 ? 23  MET A HB2  14 
ATOM   9236  H  HB3  . MET A 1 23 ? -4.471  -5.576  -0.135  1.00 0.00 ? 23  MET A HB3  14 
ATOM   9237  H  HG2  . MET A 1 23 ? -2.514  -6.802  -0.474  1.00 0.00 ? 23  MET A HG2  14 
ATOM   9238  H  HG3  . MET A 1 23 ? -3.027  -8.088  0.617   1.00 0.00 ? 23  MET A HG3  14 
ATOM   9239  H  HE1  . MET A 1 23 ? -1.740  -8.635  -2.068  1.00 0.00 ? 23  MET A HE1  14 
ATOM   9240  H  HE2  . MET A 1 23 ? -2.796  -9.046  -3.421  1.00 0.00 ? 23  MET A HE2  14 
ATOM   9241  H  HE3  . MET A 1 23 ? -2.460  -7.355  -3.047  1.00 0.00 ? 23  MET A HE3  14 
ATOM   9242  N  N    . SER A 1 24 ? -5.230  -4.001  2.546   1.00 0.00 ? 24  SER A N    14 
ATOM   9243  C  CA   . SER A 1 24 ? -6.320  -3.253  3.161   1.00 0.00 ? 24  SER A CA   14 
ATOM   9244  C  C    . SER A 1 24 ? -7.307  -2.764  2.105   1.00 0.00 ? 24  SER A C    14 
ATOM   9245  O  O    . SER A 1 24 ? -6.964  -2.640  0.929   1.00 0.00 ? 24  SER A O    14 
ATOM   9246  C  CB   . SER A 1 24 ? -5.770  -2.064  3.950   1.00 0.00 ? 24  SER A CB   14 
ATOM   9247  O  OG   . SER A 1 24 ? -6.602  -1.755  5.054   1.00 0.00 ? 24  SER A OG   14 
ATOM   9248  H  H    . SER A 1 24 ? -4.510  -3.513  2.094   1.00 0.00 ? 24  SER A H    14 
ATOM   9249  H  HA   . SER A 1 24 ? -6.836  -3.916  3.839   1.00 0.00 ? 24  SER A HA   14 
ATOM   9250  H  HB2  . SER A 1 24 ? -4.782  -2.303  4.314   1.00 0.00 ? 24  SER A HB2  14 
ATOM   9251  H  HB3  . SER A 1 24 ? -5.715  -1.200  3.302   1.00 0.00 ? 24  SER A HB3  14 
ATOM   9252  H  HG   . SER A 1 24 ? -6.774  -2.553  5.559   1.00 0.00 ? 24  SER A HG   14 
ATOM   9253  N  N    . VAL A 1 25 ? -8.535  -2.489  2.533   1.00 0.00 ? 25  VAL A N    14 
ATOM   9254  C  CA   . VAL A 1 25 ? -9.572  -2.013  1.626   1.00 0.00 ? 25  VAL A CA   14 
ATOM   9255  C  C    . VAL A 1 25 ? -9.261  -0.607  1.125   1.00 0.00 ? 25  VAL A C    14 
ATOM   9256  O  O    . VAL A 1 25 ? -9.905  -0.110  0.202   1.00 0.00 ? 25  VAL A O    14 
ATOM   9257  C  CB   . VAL A 1 25 ? -10.954 -2.009  2.307   1.00 0.00 ? 25  VAL A CB   14 
ATOM   9258  C  CG1  . VAL A 1 25 ? -12.024 -1.527  1.339   1.00 0.00 ? 25  VAL A CG1  14 
ATOM   9259  C  CG2  . VAL A 1 25 ? -11.289 -3.394  2.839   1.00 0.00 ? 25  VAL A CG2  14 
ATOM   9260  H  H    . VAL A 1 25 ? -8.748  -2.608  3.482   1.00 0.00 ? 25  VAL A H    14 
ATOM   9261  H  HA   . VAL A 1 25 ? -9.612  -2.685  0.782   1.00 0.00 ? 25  VAL A HA   14 
ATOM   9262  H  HB   . VAL A 1 25 ? -10.920 -1.324  3.141   1.00 0.00 ? 25  VAL A HB   14 
ATOM   9263  H  HG11 . VAL A 1 25 ? -12.999 -1.664  1.784   1.00 0.00 ? 25  VAL A HG11 14 
ATOM   9264  H  HG12 . VAL A 1 25 ? -11.870 -0.480  1.123   1.00 0.00 ? 25  VAL A HG12 14 
ATOM   9265  H  HG13 . VAL A 1 25 ? -11.964 -2.097  0.424   1.00 0.00 ? 25  VAL A HG13 14 
ATOM   9266  H  HG21 . VAL A 1 25 ? -10.408 -4.016  2.804   1.00 0.00 ? 25  VAL A HG21 14 
ATOM   9267  H  HG22 . VAL A 1 25 ? -11.634 -3.313  3.859   1.00 0.00 ? 25  VAL A HG22 14 
ATOM   9268  H  HG23 . VAL A 1 25 ? -12.066 -3.836  2.231   1.00 0.00 ? 25  VAL A HG23 14 
ATOM   9269  N  N    . ASN A 1 26 ? -8.268  0.028   1.739   1.00 0.00 ? 26  ASN A N    14 
ATOM   9270  C  CA   . ASN A 1 26 ? -7.870  1.377   1.354   1.00 0.00 ? 26  ASN A CA   14 
ATOM   9271  C  C    . ASN A 1 26 ? -6.435  1.395   0.837   1.00 0.00 ? 26  ASN A C    14 
ATOM   9272  O  O    . ASN A 1 26 ? -5.998  2.367   0.219   1.00 0.00 ? 26  ASN A O    14 
ATOM   9273  C  CB   . ASN A 1 26 ? -8.007  2.330   2.544   1.00 0.00 ? 26  ASN A CB   14 
ATOM   9274  C  CG   . ASN A 1 26 ? -7.372  3.681   2.279   1.00 0.00 ? 26  ASN A CG   14 
ATOM   9275  O  OD1  . ASN A 1 26 ? -6.153  3.790   2.137   1.00 0.00 ? 26  ASN A OD1  14 
ATOM   9276  N  ND2  . ASN A 1 26 ? -8.196  4.719   2.210   1.00 0.00 ? 26  ASN A ND2  14 
ATOM   9277  H  H    . ASN A 1 26 ? -7.791  -0.421  2.468   1.00 0.00 ? 26  ASN A H    14 
ATOM   9278  H  HA   . ASN A 1 26 ? -8.530  1.705   0.565   1.00 0.00 ? 26  ASN A HA   14 
ATOM   9279  H  HB2  . ASN A 1 26 ? -9.055  2.482   2.757   1.00 0.00 ? 26  ASN A HB2  14 
ATOM   9280  H  HB3  . ASN A 1 26 ? -7.529  1.891   3.407   1.00 0.00 ? 26  ASN A HB3  14 
ATOM   9281  H  HD21 . ASN A 1 26 ? -9.156  4.558   2.333   1.00 0.00 ? 26  ASN A HD21 14 
ATOM   9282  H  HD22 . ASN A 1 26 ? -7.812  5.605   2.039   1.00 0.00 ? 26  ASN A HD22 14 
ATOM   9283  N  N    . THR A 1 27 ? -5.706  0.313   1.092   1.00 0.00 ? 27  THR A N    14 
ATOM   9284  C  CA   . THR A 1 27 ? -4.321  0.204   0.653   1.00 0.00 ? 27  THR A CA   14 
ATOM   9285  C  C    . THR A 1 27 ? -4.181  -0.807  -0.480  1.00 0.00 ? 27  THR A C    14 
ATOM   9286  O  O    . THR A 1 27 ? -3.154  -0.857  -1.155  1.00 0.00 ? 27  THR A O    14 
ATOM   9287  C  CB   . THR A 1 27 ? -3.395  -0.211  1.812   1.00 0.00 ? 27  THR A CB   14 
ATOM   9288  O  OG1  . THR A 1 27 ? -3.608  -1.588  2.141   1.00 0.00 ? 27  THR A OG1  14 
ATOM   9289  C  CG2  . THR A 1 27 ? -3.645  0.653   3.039   1.00 0.00 ? 27  THR A CG2  14 
ATOM   9290  H  H    . THR A 1 27 ? -6.111  -0.428  1.589   1.00 0.00 ? 27  THR A H    14 
ATOM   9291  H  HA   . THR A 1 27 ? -4.006  1.174   0.298   1.00 0.00 ? 27  THR A HA   14 
ATOM   9292  H  HB   . THR A 1 27 ? -2.370  -0.078  1.499   1.00 0.00 ? 27  THR A HB   14 
ATOM   9293  H  HG1  . THR A 1 27 ? -3.378  -2.136  1.387   1.00 0.00 ? 27  THR A HG1  14 
ATOM   9294  H  HG21 . THR A 1 27 ? -4.688  0.927   3.080   1.00 0.00 ? 27  THR A HG21 14 
ATOM   9295  H  HG22 . THR A 1 27 ? -3.040  1.546   2.980   1.00 0.00 ? 27  THR A HG22 14 
ATOM   9296  H  HG23 . THR A 1 27 ? -3.382  0.100   3.928   1.00 0.00 ? 27  THR A HG23 14 
ATOM   9297  N  N    . GLN A 1 28 ? -5.222  -1.609  -0.683  1.00 0.00 ? 28  GLN A N    14 
ATOM   9298  C  CA   . GLN A 1 28 ? -5.214  -2.618  -1.735  1.00 0.00 ? 28  GLN A CA   14 
ATOM   9299  C  C    . GLN A 1 28 ? -4.922  -1.987  -3.092  1.00 0.00 ? 28  GLN A C    14 
ATOM   9300  O  O    . GLN A 1 28 ? -5.212  -0.815  -3.335  1.00 0.00 ? 28  GLN A O    14 
ATOM   9301  C  CB   . GLN A 1 28 ? -6.556  -3.351  -1.778  1.00 0.00 ? 28  GLN A CB   14 
ATOM   9302  C  CG   . GLN A 1 28 ? -6.561  -4.657  -1.000  1.00 0.00 ? 28  GLN A CG   14 
ATOM   9303  C  CD   . GLN A 1 28 ? -7.943  -5.272  -0.901  1.00 0.00 ? 28  GLN A CD   14 
ATOM   9304  O  OE1  . GLN A 1 28 ? -8.301  -6.152  -1.685  1.00 0.00 ? 28  GLN A OE1  14 
ATOM   9305  N  NE2  . GLN A 1 28 ? -8.729  -4.811  0.065   1.00 0.00 ? 28  GLN A NE2  14 
ATOM   9306  H  H    . GLN A 1 28 ? -6.012  -1.520  -0.112  1.00 0.00 ? 28  GLN A H    14 
ATOM   9307  H  HA   . GLN A 1 28 ? -4.433  -3.328  -1.507  1.00 0.00 ? 28  GLN A HA   14 
ATOM   9308  H  HB2  . GLN A 1 28 ? -7.317  -2.707  -1.365  1.00 0.00 ? 28  GLN A HB2  14 
ATOM   9309  H  HB3  . GLN A 1 28 ? -6.800  -3.569  -2.807  1.00 0.00 ? 28  GLN A HB3  14 
ATOM   9310  H  HG2  . GLN A 1 28 ? -5.906  -5.359  -1.495  1.00 0.00 ? 28  GLN A HG2  14 
ATOM   9311  H  HG3  . GLN A 1 28 ? -6.195  -4.467  -0.002  1.00 0.00 ? 28  GLN A HG3  14 
ATOM   9312  H  HE21 . GLN A 1 28 ? -8.377  -4.108  0.651   1.00 0.00 ? 28  GLN A HE21 14 
ATOM   9313  H  HE22 . GLN A 1 28 ? -9.627  -5.190  0.151   1.00 0.00 ? 28  GLN A HE22 14 
ATOM   9314  N  N    . PRO A 1 29 ? -4.334  -2.780  -4.000  1.00 0.00 ? 29  PRO A N    14 
ATOM   9315  C  CA   . PRO A 1 29 ? -3.983  -4.176  -3.723  1.00 0.00 ? 29  PRO A CA   14 
ATOM   9316  C  C    . PRO A 1 29 ? -2.835  -4.299  -2.727  1.00 0.00 ? 29  PRO A C    14 
ATOM   9317  O  O    . PRO A 1 29 ? -2.677  -5.328  -2.070  1.00 0.00 ? 29  PRO A O    14 
ATOM   9318  C  CB   . PRO A 1 29 ? -3.563  -4.715  -5.092  1.00 0.00 ? 29  PRO A CB   14 
ATOM   9319  C  CG   . PRO A 1 29 ? -3.111  -3.515  -5.850  1.00 0.00 ? 29  PRO A CG   14 
ATOM   9320  C  CD   . PRO A 1 29 ? -3.965  -2.375  -5.367  1.00 0.00 ? 29  PRO A CD   14 
ATOM   9321  H  HA   . PRO A 1 29 ? -4.834  -4.734  -3.360  1.00 0.00 ? 29  PRO A HA   14 
ATOM   9322  H  HB2  . PRO A 1 29 ? -2.762  -5.431  -4.970  1.00 0.00 ? 29  PRO A HB2  14 
ATOM   9323  H  HB3  . PRO A 1 29 ? -4.407  -5.189  -5.571  1.00 0.00 ? 29  PRO A HB3  14 
ATOM   9324  H  HG2  . PRO A 1 29 ? -2.070  -3.319  -5.640  1.00 0.00 ? 29  PRO A HG2  14 
ATOM   9325  H  HG3  . PRO A 1 29 ? -3.259  -3.672  -6.908  1.00 0.00 ? 29  PRO A HG3  14 
ATOM   9326  H  HD2  . PRO A 1 29 ? -3.397  -1.456  -5.357  1.00 0.00 ? 29  PRO A HD2  14 
ATOM   9327  H  HD3  . PRO A 1 29 ? -4.842  -2.272  -5.988  1.00 0.00 ? 29  PRO A HD3  14 
ATOM   9328  N  N    . LEU A 1 30 ? -2.036  -3.243  -2.620  1.00 0.00 ? 30  LEU A N    14 
ATOM   9329  C  CA   . LEU A 1 30 ? -0.901  -3.232  -1.703  1.00 0.00 ? 30  LEU A CA   14 
ATOM   9330  C  C    . LEU A 1 30 ? -1.371  -3.109  -0.257  1.00 0.00 ? 30  LEU A C    14 
ATOM   9331  O  O    . LEU A 1 30 ? -2.562  -2.948  0.009   1.00 0.00 ? 30  LEU A O    14 
ATOM   9332  C  CB   . LEU A 1 30 ? 0.045   -2.079  -2.044  1.00 0.00 ? 30  LEU A CB   14 
ATOM   9333  C  CG   . LEU A 1 30 ? 0.886   -2.253  -3.309  1.00 0.00 ? 30  LEU A CG   14 
ATOM   9334  C  CD1  . LEU A 1 30 ? 1.511   -0.929  -3.720  1.00 0.00 ? 30  LEU A CD1  14 
ATOM   9335  C  CD2  . LEU A 1 30 ? 1.960   -3.309  -3.094  1.00 0.00 ? 30  LEU A CD2  14 
ATOM   9336  H  H    . LEU A 1 30 ? -2.212  -2.452  -3.169  1.00 0.00 ? 30  LEU A H    14 
ATOM   9337  H  HA   . LEU A 1 30 ? -0.373  -4.167  -1.819  1.00 0.00 ? 30  LEU A HA   14 
ATOM   9338  H  HB2  . LEU A 1 30 ? -0.551  -1.187  -2.163  1.00 0.00 ? 30  LEU A HB2  14 
ATOM   9339  H  HB3  . LEU A 1 30 ? 0.721   -1.950  -1.211  1.00 0.00 ? 30  LEU A HB3  14 
ATOM   9340  H  HG   . LEU A 1 30 ? 0.246   -2.584  -4.116  1.00 0.00 ? 30  LEU A HG   14 
ATOM   9341  H  HD11 . LEU A 1 30 ? 1.276   -0.726  -4.754  1.00 0.00 ? 30  LEU A HD11 14 
ATOM   9342  H  HD12 . LEU A 1 30 ? 2.583   -0.985  -3.599  1.00 0.00 ? 30  LEU A HD12 14 
ATOM   9343  H  HD13 . LEU A 1 30 ? 1.120   -0.138  -3.098  1.00 0.00 ? 30  LEU A HD13 14 
ATOM   9344  H  HD21 . LEU A 1 30 ? 1.494   -4.267  -2.918  1.00 0.00 ? 30  LEU A HD21 14 
ATOM   9345  H  HD22 . LEU A 1 30 ? 2.564   -3.039  -2.240  1.00 0.00 ? 30  LEU A HD22 14 
ATOM   9346  H  HD23 . LEU A 1 30 ? 2.586   -3.369  -3.973  1.00 0.00 ? 30  LEU A HD23 14 
ATOM   9347  N  N    . CYS A 1 31 ? -0.426  -3.182  0.675   1.00 0.00 ? 31  CYS A N    14 
ATOM   9348  C  CA   . CYS A 1 31 ? -0.742  -3.077  2.094   1.00 0.00 ? 31  CYS A CA   14 
ATOM   9349  C  C    . CYS A 1 31 ? -0.291  -1.730  2.653   1.00 0.00 ? 31  CYS A C    14 
ATOM   9350  O  O    . CYS A 1 31 ? 0.694   -1.153  2.193   1.00 0.00 ? 31  CYS A O    14 
ATOM   9351  C  CB   . CYS A 1 31 ? -0.075  -4.213  2.872   1.00 0.00 ? 31  CYS A CB   14 
ATOM   9352  S  SG   . CYS A 1 31 ? 1.689   -3.934  3.231   1.00 0.00 ? 31  CYS A SG   14 
ATOM   9353  H  H    . CYS A 1 31 ? 0.507   -3.310  0.401   1.00 0.00 ? 31  CYS A H    14 
ATOM   9354  H  HA   . CYS A 1 31 ? -1.812  -3.158  2.203   1.00 0.00 ? 31  CYS A HA   14 
ATOM   9355  H  HB2  . CYS A 1 31 ? -0.585  -4.341  3.816   1.00 0.00 ? 31  CYS A HB2  14 
ATOM   9356  H  HB3  . CYS A 1 31 ? -0.154  -5.126  2.300   1.00 0.00 ? 31  CYS A HB3  14 
ATOM   9357  N  N    . HIS A 1 32 ? -1.019  -1.236  3.649   1.00 0.00 ? 32  HIS A N    14 
ATOM   9358  C  CA   . HIS A 1 32 ? -0.694  0.043   4.273   1.00 0.00 ? 32  HIS A CA   14 
ATOM   9359  C  C    . HIS A 1 32 ? 0.812   0.287   4.258   1.00 0.00 ? 32  HIS A C    14 
ATOM   9360  O  O    . HIS A 1 32 ? 1.281   1.298   3.737   1.00 0.00 ? 32  HIS A O    14 
ATOM   9361  C  CB   . HIS A 1 32 ? -1.215  0.080   5.710   1.00 0.00 ? 32  HIS A CB   14 
ATOM   9362  C  CG   . HIS A 1 32 ? -1.345  -1.274  6.335   1.00 0.00 ? 32  HIS A CG   14 
ATOM   9363  N  ND1  . HIS A 1 32 ? -2.060  -1.503  7.492   1.00 0.00 ? 32  HIS A ND1  14 
ATOM   9364  C  CD2  . HIS A 1 32 ? -0.848  -2.475  5.958   1.00 0.00 ? 32  HIS A CD2  14 
ATOM   9365  C  CE1  . HIS A 1 32 ? -1.996  -2.786  7.799   1.00 0.00 ? 32  HIS A CE1  14 
ATOM   9366  N  NE2  . HIS A 1 32 ? -1.267  -3.399  6.884   1.00 0.00 ? 32  HIS A NE2  14 
ATOM   9367  H  H    . HIS A 1 32 ? -1.793  -1.742  3.973   1.00 0.00 ? 32  HIS A H    14 
ATOM   9368  H  HA   . HIS A 1 32 ? -1.178  0.821   3.703   1.00 0.00 ? 32  HIS A HA   14 
ATOM   9369  H  HB2  . HIS A 1 32 ? -0.536  0.661   6.316   1.00 0.00 ? 32  HIS A HB2  14 
ATOM   9370  H  HB3  . HIS A 1 32 ? -2.189  0.547   5.721   1.00 0.00 ? 32  HIS A HB3  14 
ATOM   9371  H  HD1  . HIS A 1 32 ? -2.542  -0.826  8.010   1.00 0.00 ? 32  HIS A HD1  14 
ATOM   9372  H  HD2  . HIS A 1 32 ? -0.235  -2.672  5.089   1.00 0.00 ? 32  HIS A HD2  14 
ATOM   9373  H  HE1  . HIS A 1 32 ? -2.461  -3.256  8.654   1.00 0.00 ? 32  HIS A HE1  14 
ATOM   9374  N  N    . GLU A 1 33 ? 1.564   -0.646  4.835   1.00 0.00 ? 33  GLU A N    14 
ATOM   9375  C  CA   . GLU A 1 33 ? 3.016   -0.530  4.889   1.00 0.00 ? 33  GLU A CA   14 
ATOM   9376  C  C    . GLU A 1 33 ? 3.584   -0.163  3.521   1.00 0.00 ? 33  GLU A C    14 
ATOM   9377  O  O    . GLU A 1 33 ? 4.363   0.782   3.392   1.00 0.00 ? 33  GLU A O    14 
ATOM   9378  C  CB   . GLU A 1 33 ? 3.637   -1.841  5.375   1.00 0.00 ? 33  GLU A CB   14 
ATOM   9379  C  CG   . GLU A 1 33 ? 3.824   -1.904  6.882   1.00 0.00 ? 33  GLU A CG   14 
ATOM   9380  C  CD   . GLU A 1 33 ? 5.024   -2.738  7.286   1.00 0.00 ? 33  GLU A CD   14 
ATOM   9381  O  OE1  . GLU A 1 33 ? 5.481   -3.558  6.462   1.00 0.00 ? 33  GLU A OE1  14 
ATOM   9382  O  OE2  . GLU A 1 33 ? 5.506   -2.573  8.426   1.00 0.00 ? 33  GLU A OE2  14 
ATOM   9383  H  H    . GLU A 1 33 ? 1.131   -1.430  5.233   1.00 0.00 ? 33  GLU A H    14 
ATOM   9384  H  HA   . GLU A 1 33 ? 3.260   0.254   5.589   1.00 0.00 ? 33  GLU A HA   14 
ATOM   9385  H  HB2  . GLU A 1 33 ? 2.999   -2.660  5.078   1.00 0.00 ? 33  GLU A HB2  14 
ATOM   9386  H  HB3  . GLU A 1 33 ? 4.603   -1.962  4.908   1.00 0.00 ? 33  GLU A HB3  14 
ATOM   9387  H  HG2  . GLU A 1 33 ? 3.961   -0.900  7.257   1.00 0.00 ? 33  GLU A HG2  14 
ATOM   9388  H  HG3  . GLU A 1 33 ? 2.939   -2.335  7.324   1.00 0.00 ? 33  GLU A HG3  14 
ATOM   9389  N  N    . CYS A 1 34 ? 3.188   -0.917  2.501   1.00 0.00 ? 34  CYS A N    14 
ATOM   9390  C  CA   . CYS A 1 34 ? 3.657   -0.673  1.142   1.00 0.00 ? 34  CYS A CA   14 
ATOM   9391  C  C    . CYS A 1 34 ? 2.921   0.508   0.516   1.00 0.00 ? 34  CYS A C    14 
ATOM   9392  O  O    . CYS A 1 34 ? 3.527   1.530   0.193   1.00 0.00 ? 34  CYS A O    14 
ATOM   9393  C  CB   . CYS A 1 34 ? 3.463   -1.923  0.281   1.00 0.00 ? 34  CYS A CB   14 
ATOM   9394  S  SG   . CYS A 1 34 ? 4.523   -3.326  0.757   1.00 0.00 ? 34  CYS A SG   14 
ATOM   9395  H  H    . CYS A 1 34 ? 2.565   -1.656  2.665   1.00 0.00 ? 34  CYS A H    14 
ATOM   9396  H  HA   . CYS A 1 34 ? 4.710   -0.440  1.191   1.00 0.00 ? 34  CYS A HA   14 
ATOM   9397  H  HB2  . CYS A 1 34 ? 2.435   -2.247  0.358   1.00 0.00 ? 34  CYS A HB2  14 
ATOM   9398  H  HB3  . CYS A 1 34 ? 3.681   -1.679  -0.748  1.00 0.00 ? 34  CYS A HB3  14 
ATOM   9399  N  N    . SER A 1 35 ? 1.611   0.361   0.349   1.00 0.00 ? 35  SER A N    14 
ATOM   9400  C  CA   . SER A 1 35 ? 0.792   1.413   -0.241  1.00 0.00 ? 35  SER A CA   14 
ATOM   9401  C  C    . SER A 1 35 ? 1.348   2.792   0.104   1.00 0.00 ? 35  SER A C    14 
ATOM   9402  O  O    . SER A 1 35 ? 1.320   3.707   -0.718  1.00 0.00 ? 35  SER A O    14 
ATOM   9403  C  CB   . SER A 1 35 ? -0.654  1.298   0.247   1.00 0.00 ? 35  SER A CB   14 
ATOM   9404  O  OG   . SER A 1 35 ? -0.754  1.613   1.624   1.00 0.00 ? 35  SER A OG   14 
ATOM   9405  H  H    . SER A 1 35 ? 1.185   -0.477  0.627   1.00 0.00 ? 35  SER A H    14 
ATOM   9406  H  HA   . SER A 1 35 ? 0.812   1.288   -1.313  1.00 0.00 ? 35  SER A HA   14 
ATOM   9407  H  HB2  . SER A 1 35 ? -1.275  1.980   -0.313  1.00 0.00 ? 35  SER A HB2  14 
ATOM   9408  H  HB3  . SER A 1 35 ? -1.002  0.286   0.095   1.00 0.00 ? 35  SER A HB3  14 
ATOM   9409  H  HG   . SER A 1 35 ? -0.101  2.280   1.849   1.00 0.00 ? 35  SER A HG   14 
ATOM   9410  N  N    . GLU A 1 36 ? 1.852   2.931   1.326   1.00 0.00 ? 36  GLU A N    14 
ATOM   9411  C  CA   . GLU A 1 36 ? 2.414   4.197   1.781   1.00 0.00 ? 36  GLU A CA   14 
ATOM   9412  C  C    . GLU A 1 36 ? 3.906   4.274   1.468   1.00 0.00 ? 36  GLU A C    14 
ATOM   9413  O  O    . GLU A 1 36 ? 4.406   5.310   1.029   1.00 0.00 ? 36  GLU A O    14 
ATOM   9414  C  CB   . GLU A 1 36 ? 2.187   4.371   3.284   1.00 0.00 ? 36  GLU A CB   14 
ATOM   9415  C  CG   . GLU A 1 36 ? 3.131   3.545   4.141   1.00 0.00 ? 36  GLU A CG   14 
ATOM   9416  C  CD   . GLU A 1 36 ? 2.762   3.578   5.612   1.00 0.00 ? 36  GLU A CD   14 
ATOM   9417  O  OE1  . GLU A 1 36 ? 1.579   3.831   5.921   1.00 0.00 ? 36  GLU A OE1  14 
ATOM   9418  O  OE2  . GLU A 1 36 ? 3.656   3.350   6.454   1.00 0.00 ? 36  GLU A OE2  14 
ATOM   9419  H  H    . GLU A 1 36 ? 1.846   2.164   1.936   1.00 0.00 ? 36  GLU A H    14 
ATOM   9420  H  HA   . GLU A 1 36 ? 1.907   4.992   1.255   1.00 0.00 ? 36  GLU A HA   14 
ATOM   9421  H  HB2  . GLU A 1 36 ? 2.321   5.413   3.538   1.00 0.00 ? 36  GLU A HB2  14 
ATOM   9422  H  HB3  . GLU A 1 36 ? 1.174   4.081   3.518   1.00 0.00 ? 36  GLU A HB3  14 
ATOM   9423  H  HG2  . GLU A 1 36 ? 3.102   2.521   3.802   1.00 0.00 ? 36  GLU A HG2  14 
ATOM   9424  H  HG3  . GLU A 1 36 ? 4.133   3.933   4.028   1.00 0.00 ? 36  GLU A HG3  14 
ATOM   9425  N  N    . ARG A 1 37 ? 4.610   3.171   1.699   1.00 0.00 ? 37  ARG A N    14 
ATOM   9426  C  CA   . ARG A 1 37 ? 6.044   3.113   1.444   1.00 0.00 ? 37  ARG A CA   14 
ATOM   9427  C  C    . ARG A 1 37 ? 6.365   3.583   0.028   1.00 0.00 ? 37  ARG A C    14 
ATOM   9428  O  O    . ARG A 1 37 ? 7.353   4.282   -0.196  1.00 0.00 ? 37  ARG A O    14 
ATOM   9429  C  CB   . ARG A 1 37 ? 6.563   1.689   1.649   1.00 0.00 ? 37  ARG A CB   14 
ATOM   9430  C  CG   . ARG A 1 37 ? 8.060   1.548   1.426   1.00 0.00 ? 37  ARG A CG   14 
ATOM   9431  C  CD   . ARG A 1 37 ? 8.441   0.115   1.090   1.00 0.00 ? 37  ARG A CD   14 
ATOM   9432  N  NE   . ARG A 1 37 ? 9.882   -0.040  0.903   1.00 0.00 ? 37  ARG A NE   14 
ATOM   9433  C  CZ   . ARG A 1 37 ? 10.518  -1.199  1.024   1.00 0.00 ? 37  ARG A CZ   14 
ATOM   9434  N  NH1  . ARG A 1 37 ? 9.845   -2.300  1.329   1.00 0.00 ? 37  ARG A NH1  14 
ATOM   9435  N  NH2  . ARG A 1 37 ? 11.831  -1.259  0.839   1.00 0.00 ? 37  ARG A NH2  14 
ATOM   9436  H  H    . ARG A 1 37 ? 4.155   2.377   2.049   1.00 0.00 ? 37  ARG A H    14 
ATOM   9437  H  HA   . ARG A 1 37 ? 6.533   3.769   2.148   1.00 0.00 ? 37  ARG A HA   14 
ATOM   9438  H  HB2  . ARG A 1 37 ? 6.341   1.379   2.659   1.00 0.00 ? 37  ARG A HB2  14 
ATOM   9439  H  HB3  . ARG A 1 37 ? 6.056   1.031   0.960   1.00 0.00 ? 37  ARG A HB3  14 
ATOM   9440  H  HG2  . ARG A 1 37 ? 8.355   2.188   0.608   1.00 0.00 ? 37  ARG A HG2  14 
ATOM   9441  H  HG3  . ARG A 1 37 ? 8.578   1.847   2.326   1.00 0.00 ? 37  ARG A HG3  14 
ATOM   9442  H  HD2  . ARG A 1 37 ? 8.122   -0.528  1.897   1.00 0.00 ? 37  ARG A HD2  14 
ATOM   9443  H  HD3  . ARG A 1 37 ? 7.937   -0.174  0.180   1.00 0.00 ? 37  ARG A HD3  14 
ATOM   9444  H  HE   . ARG A 1 37 ? 10.398  0.761   0.677   1.00 0.00 ? 37  ARG A HE   14 
ATOM   9445  H  HH11 . ARG A 1 37 ? 8.856   -2.258  1.468   1.00 0.00 ? 37  ARG A HH11 14 
ATOM   9446  H  HH12 . ARG A 1 37 ? 10.327  -3.172  1.418   1.00 0.00 ? 37  ARG A HH12 14 
ATOM   9447  H  HH21 . ARG A 1 37 ? 12.341  -0.431  0.608   1.00 0.00 ? 37  ARG A HH21 14 
ATOM   9448  H  HH22 . ARG A 1 37 ? 12.309  -2.132  0.930   1.00 0.00 ? 37  ARG A HH22 14 
ATOM   9449  N  N    . ARG A 1 38 ? 5.522   3.195   -0.924  1.00 0.00 ? 38  ARG A N    14 
ATOM   9450  C  CA   . ARG A 1 38 ? 5.716   3.576   -2.318  1.00 0.00 ? 38  ARG A CA   14 
ATOM   9451  C  C    . ARG A 1 38 ? 5.609   5.088   -2.488  1.00 0.00 ? 38  ARG A C    14 
ATOM   9452  O  O    . ARG A 1 38 ? 6.521   5.729   -3.009  1.00 0.00 ? 38  ARG A O    14 
ATOM   9453  C  CB   . ARG A 1 38 ? 4.686   2.877   -3.207  1.00 0.00 ? 38  ARG A CB   14 
ATOM   9454  C  CG   . ARG A 1 38 ? 4.992   2.984   -4.692  1.00 0.00 ? 38  ARG A CG   14 
ATOM   9455  C  CD   . ARG A 1 38 ? 4.237   1.935   -5.494  1.00 0.00 ? 38  ARG A CD   14 
ATOM   9456  N  NE   . ARG A 1 38 ? 4.562   1.994   -6.916  1.00 0.00 ? 38  ARG A NE   14 
ATOM   9457  C  CZ   . ARG A 1 38 ? 3.759   1.543   -7.873  1.00 0.00 ? 38  ARG A CZ   14 
ATOM   9458  N  NH1  . ARG A 1 38 ? 2.588   1.003   -7.561  1.00 0.00 ? 38  ARG A NH1  14 
ATOM   9459  N  NH2  . ARG A 1 38 ? 4.125   1.632   -9.145  1.00 0.00 ? 38  ARG A NH2  14 
ATOM   9460  H  H    . ARG A 1 38 ? 4.752   2.639   -0.683  1.00 0.00 ? 38  ARG A H    14 
ATOM   9461  H  HA   . ARG A 1 38 ? 6.706   3.261   -2.613  1.00 0.00 ? 38  ARG A HA   14 
ATOM   9462  H  HB2  . ARG A 1 38 ? 4.652   1.830   -2.944  1.00 0.00 ? 38  ARG A HB2  14 
ATOM   9463  H  HB3  . ARG A 1 38 ? 3.717   3.317   -3.029  1.00 0.00 ? 38  ARG A HB3  14 
ATOM   9464  H  HG2  . ARG A 1 38 ? 4.702   3.964   -5.041  1.00 0.00 ? 38  ARG A HG2  14 
ATOM   9465  H  HG3  . ARG A 1 38 ? 6.052   2.846   -4.843  1.00 0.00 ? 38  ARG A HG3  14 
ATOM   9466  H  HD2  . ARG A 1 38 ? 4.497   0.957   -5.115  1.00 0.00 ? 38  ARG A HD2  14 
ATOM   9467  H  HD3  . ARG A 1 38 ? 3.178   2.099   -5.368  1.00 0.00 ? 38  ARG A HD3  14 
ATOM   9468  H  HE   . ARG A 1 38 ? 5.422   2.389   -7.169  1.00 0.00 ? 38  ARG A HE   14 
ATOM   9469  H  HH11 . ARG A 1 38 ? 2.310   0.936   -6.603  1.00 0.00 ? 38  ARG A HH11 14 
ATOM   9470  H  HH12 . ARG A 1 38 ? 1.985   0.666   -8.283  1.00 0.00 ? 38  ARG A HH12 14 
ATOM   9471  H  HH21 . ARG A 1 38 ? 5.006   2.039   -9.384  1.00 0.00 ? 38  ARG A HH21 14 
ATOM   9472  H  HH22 . ARG A 1 38 ? 3.519   1.293   -9.864  1.00 0.00 ? 38  ARG A HH22 14 
ATOM   9473  N  N    . GLN A 1 39 ? 4.488   5.650   -2.047  1.00 0.00 ? 39  GLN A N    14 
ATOM   9474  C  CA   . GLN A 1 39 ? 4.262   7.087   -2.152  1.00 0.00 ? 39  GLN A CA   14 
ATOM   9475  C  C    . GLN A 1 39 ? 5.531   7.864   -1.820  1.00 0.00 ? 39  GLN A C    14 
ATOM   9476  O  O    . GLN A 1 39 ? 5.918   8.782   -2.544  1.00 0.00 ? 39  GLN A O    14 
ATOM   9477  C  CB   . GLN A 1 39 ? 3.128   7.516   -1.219  1.00 0.00 ? 39  GLN A CB   14 
ATOM   9478  C  CG   . GLN A 1 39 ? 1.744   7.348   -1.825  1.00 0.00 ? 39  GLN A CG   14 
ATOM   9479  C  CD   . GLN A 1 39 ? 0.636   7.724   -0.862  1.00 0.00 ? 39  GLN A CD   14 
ATOM   9480  O  OE1  . GLN A 1 39 ? 0.881   7.971   0.319   1.00 0.00 ? 39  GLN A OE1  14 
ATOM   9481  N  NE2  . GLN A 1 39 ? -0.594  7.769   -1.362  1.00 0.00 ? 39  GLN A NE2  14 
ATOM   9482  H  H    . GLN A 1 39 ? 3.798   5.086   -1.642  1.00 0.00 ? 39  GLN A H    14 
ATOM   9483  H  HA   . GLN A 1 39 ? 3.978   7.304   -3.171  1.00 0.00 ? 39  GLN A HA   14 
ATOM   9484  H  HB2  . GLN A 1 39 ? 3.177   6.924   -0.317  1.00 0.00 ? 39  GLN A HB2  14 
ATOM   9485  H  HB3  . GLN A 1 39 ? 3.262   8.557   -0.965  1.00 0.00 ? 39  GLN A HB3  14 
ATOM   9486  H  HG2  . GLN A 1 39 ? 1.669   7.977   -2.699  1.00 0.00 ? 39  GLN A HG2  14 
ATOM   9487  H  HG3  . GLN A 1 39 ? 1.615   6.315   -2.115  1.00 0.00 ? 39  GLN A HG3  14 
ATOM   9488  H  HE21 . GLN A 1 39 ? -0.714  7.558   -2.312  1.00 0.00 ? 39  GLN A HE21 14 
ATOM   9489  H  HE22 . GLN A 1 39 ? -1.329  8.008   -0.762  1.00 0.00 ? 39  GLN A HE22 14 
ATOM   9490  N  N    . LYS A 1 40 ? 6.177   7.491   -0.721  1.00 0.00 ? 40  LYS A N    14 
ATOM   9491  C  CA   . LYS A 1 40 ? 7.404   8.151   -0.292  1.00 0.00 ? 40  LYS A CA   14 
ATOM   9492  C  C    . LYS A 1 40 ? 8.395   8.261   -1.446  1.00 0.00 ? 40  LYS A C    14 
ATOM   9493  O  O    . LYS A 1 40 ? 8.814   9.358   -1.814  1.00 0.00 ? 40  LYS A O    14 
ATOM   9494  C  CB   . LYS A 1 40 ? 8.041   7.385   0.870   1.00 0.00 ? 40  LYS A CB   14 
ATOM   9495  C  CG   . LYS A 1 40 ? 8.907   8.252   1.768   1.00 0.00 ? 40  LYS A CG   14 
ATOM   9496  C  CD   . LYS A 1 40 ? 8.074   8.985   2.807   1.00 0.00 ? 40  LYS A CD   14 
ATOM   9497  C  CE   . LYS A 1 40 ? 8.867   9.235   4.080   1.00 0.00 ? 40  LYS A CE   14 
ATOM   9498  N  NZ   . LYS A 1 40 ? 9.901   10.290  3.892   1.00 0.00 ? 40  LYS A NZ   14 
ATOM   9499  H  H    . LYS A 1 40 ? 5.819   6.752   -0.184  1.00 0.00 ? 40  LYS A H    14 
ATOM   9500  H  HA   . LYS A 1 40 ? 7.146   9.145   0.042   1.00 0.00 ? 40  LYS A HA   14 
ATOM   9501  H  HB2  . LYS A 1 40 ? 7.256   6.951   1.472   1.00 0.00 ? 40  LYS A HB2  14 
ATOM   9502  H  HB3  . LYS A 1 40 ? 8.656   6.593   0.468   1.00 0.00 ? 40  LYS A HB3  14 
ATOM   9503  H  HG2  . LYS A 1 40 ? 9.624   7.624   2.275   1.00 0.00 ? 40  LYS A HG2  14 
ATOM   9504  H  HG3  . LYS A 1 40 ? 9.427   8.977   1.159   1.00 0.00 ? 40  LYS A HG3  14 
ATOM   9505  H  HD2  . LYS A 1 40 ? 7.760   9.934   2.399   1.00 0.00 ? 40  LYS A HD2  14 
ATOM   9506  H  HD3  . LYS A 1 40 ? 7.205   8.388   3.045   1.00 0.00 ? 40  LYS A HD3  14 
ATOM   9507  H  HE2  . LYS A 1 40 ? 8.185   9.545   4.858   1.00 0.00 ? 40  LYS A HE2  14 
ATOM   9508  H  HE3  . LYS A 1 40 ? 9.352   8.315   4.373   1.00 0.00 ? 40  LYS A HE3  14 
ATOM   9509  H  HZ1  . LYS A 1 40 ? 10.456  10.098  3.034   1.00 0.00 ? 40  LYS A HZ1  14 
ATOM   9510  H  HZ2  . LYS A 1 40 ? 10.543  10.310  4.710   1.00 0.00 ? 40  LYS A HZ2  14 
ATOM   9511  H  HZ3  . LYS A 1 40 ? 9.448   11.221  3.799   1.00 0.00 ? 40  LYS A HZ3  14 
ATOM   9512  N  N    . ASN A 1 41 ? 8.764   7.118   -2.014  1.00 0.00 ? 41  ASN A N    14 
ATOM   9513  C  CA   . ASN A 1 41 ? 9.705   7.086   -3.128  1.00 0.00 ? 41  ASN A CA   14 
ATOM   9514  C  C    . ASN A 1 41 ? 8.989   7.334   -4.452  1.00 0.00 ? 41  ASN A C    14 
ATOM   9515  O  O    . ASN A 1 41 ? 7.960   6.721   -4.736  1.00 0.00 ? 41  ASN A O    14 
ATOM   9516  C  CB   . ASN A 1 41 ? 10.430  5.740   -3.172  1.00 0.00 ? 41  ASN A CB   14 
ATOM   9517  C  CG   . ASN A 1 41 ? 11.285  5.504   -1.941  1.00 0.00 ? 41  ASN A CG   14 
ATOM   9518  O  OD1  . ASN A 1 41 ? 12.146  6.317   -1.604  1.00 0.00 ? 41  ASN A OD1  14 
ATOM   9519  N  ND2  . ASN A 1 41 ? 11.052  4.385   -1.265  1.00 0.00 ? 41  ASN A ND2  14 
ATOM   9520  H  H    . ASN A 1 41 ? 8.395   6.275   -1.676  1.00 0.00 ? 41  ASN A H    14 
ATOM   9521  H  HA   . ASN A 1 41 ? 10.430  7.871   -2.971  1.00 0.00 ? 41  ASN A HA   14 
ATOM   9522  H  HB2  . ASN A 1 41 ? 9.700   4.946   -3.236  1.00 0.00 ? 41  ASN A HB2  14 
ATOM   9523  H  HB3  . ASN A 1 41 ? 11.068  5.709   -4.042  1.00 0.00 ? 41  ASN A HB3  14 
ATOM   9524  H  HD21 . ASN A 1 41 ? 10.350  3.784   -1.592  1.00 0.00 ? 41  ASN A HD21 14 
ATOM   9525  H  HD22 . ASN A 1 41 ? 11.589  4.208   -0.465  1.00 0.00 ? 41  ASN A HD22 14 
ATOM   9526  N  N    . GLN A 1 42 ? 9.541   8.236   -5.257  1.00 0.00 ? 42  GLN A N    14 
ATOM   9527  C  CA   . GLN A 1 42 ? 8.955   8.564   -6.551  1.00 0.00 ? 42  GLN A CA   14 
ATOM   9528  C  C    . GLN A 1 42 ? 9.400   7.570   -7.619  1.00 0.00 ? 42  GLN A C    14 
ATOM   9529  O  O    . GLN A 1 42 ? 10.529  7.082   -7.594  1.00 0.00 ? 42  GLN A O    14 
ATOM   9530  C  CB   . GLN A 1 42 ? 9.345   9.984   -6.966  1.00 0.00 ? 42  GLN A CB   14 
ATOM   9531  C  CG   . GLN A 1 42 ? 8.445   11.059  -6.377  1.00 0.00 ? 42  GLN A CG   14 
ATOM   9532  C  CD   . GLN A 1 42 ? 7.142   11.209  -7.136  1.00 0.00 ? 42  GLN A CD   14 
ATOM   9533  O  OE1  . GLN A 1 42 ? 6.111   10.667  -6.736  1.00 0.00 ? 42  GLN A OE1  14 
ATOM   9534  N  NE2  . GLN A 1 42 ? 7.180   11.948  -8.238  1.00 0.00 ? 42  GLN A NE2  14 
ATOM   9535  H  H    . GLN A 1 42 ? 10.361  8.691   -4.974  1.00 0.00 ? 42  GLN A H    14 
ATOM   9536  H  HA   . GLN A 1 42 ? 7.882   8.510   -6.452  1.00 0.00 ? 42  GLN A HA   14 
ATOM   9537  H  HB2  . GLN A 1 42 ? 10.357  10.175  -6.643  1.00 0.00 ? 42  GLN A HB2  14 
ATOM   9538  H  HB3  . GLN A 1 42 ? 9.299   10.058  -8.042  1.00 0.00 ? 42  GLN A HB3  14 
ATOM   9539  H  HG2  . GLN A 1 42 ? 8.220   10.800  -5.353  1.00 0.00 ? 42  GLN A HG2  14 
ATOM   9540  H  HG3  . GLN A 1 42 ? 8.970   12.002  -6.401  1.00 0.00 ? 42  GLN A HG3  14 
ATOM   9541  H  HE21 . GLN A 1 42 ? 8.037   12.348  -8.497  1.00 0.00 ? 42  GLN A HE21 14 
ATOM   9542  H  HE22 . GLN A 1 42 ? 6.353   12.062  -8.749  1.00 0.00 ? 42  GLN A HE22 14 
ATOM   9543  N  N    . ASN A 1 43 ? 8.504   7.274   -8.555  1.00 0.00 ? 43  ASN A N    14 
ATOM   9544  C  CA   . ASN A 1 43 ? 8.805   6.337   -9.631  1.00 0.00 ? 43  ASN A CA   14 
ATOM   9545  C  C    . ASN A 1 43 ? 7.807   6.485   -10.776 1.00 0.00 ? 43  ASN A C    14 
ATOM   9546  O  O    . ASN A 1 43 ? 6.735   7.066   -10.607 1.00 0.00 ? 43  ASN A O    14 
ATOM   9547  C  CB   . ASN A 1 43 ? 8.785   4.900   -9.105  1.00 0.00 ? 43  ASN A CB   14 
ATOM   9548  C  CG   . ASN A 1 43 ? 9.613   3.960   -9.959  1.00 0.00 ? 43  ASN A CG   14 
ATOM   9549  O  OD1  . ASN A 1 43 ? 10.756  4.261   -10.304 1.00 0.00 ? 43  ASN A OD1  14 
ATOM   9550  N  ND2  . ASN A 1 43 ? 9.039   2.813   -10.304 1.00 0.00 ? 43  ASN A ND2  14 
ATOM   9551  H  H    . ASN A 1 43 ? 7.620   7.696   -8.522  1.00 0.00 ? 43  ASN A H    14 
ATOM   9552  H  HA   . ASN A 1 43 ? 9.794   6.562   -10.000 1.00 0.00 ? 43  ASN A HA   14 
ATOM   9553  H  HB2  . ASN A 1 43 ? 9.181   4.886   -8.100  1.00 0.00 ? 43  ASN A HB2  14 
ATOM   9554  H  HB3  . ASN A 1 43 ? 7.766   4.542   -9.091  1.00 0.00 ? 43  ASN A HB3  14 
ATOM   9555  H  HD21 . ASN A 1 43 ? 8.126   2.640   -9.992  1.00 0.00 ? 43  ASN A HD21 14 
ATOM   9556  H  HD22 . ASN A 1 43 ? 9.552   2.187   -10.855 1.00 0.00 ? 43  ASN A HD22 14 
ATOM   9557  N  N    . SER A 1 44 ? 8.168   5.955   -11.940 1.00 0.00 ? 44  SER A N    14 
ATOM   9558  C  CA   . SER A 1 44 ? 7.306   6.030   -13.114 1.00 0.00 ? 44  SER A CA   14 
ATOM   9559  C  C    . SER A 1 44 ? 7.001   7.482   -13.472 1.00 0.00 ? 44  SER A C    14 
ATOM   9560  O  O    . SER A 1 44 ? 5.857   7.837   -13.751 1.00 0.00 ? 44  SER A O    14 
ATOM   9561  C  CB   . SER A 1 44 ? 6.002   5.270   -12.865 1.00 0.00 ? 44  SER A CB   14 
ATOM   9562  O  OG   . SER A 1 44 ? 5.282   5.083   -14.072 1.00 0.00 ? 44  SER A OG   14 
ATOM   9563  H  H    . SER A 1 44 ? 9.035   5.504   -12.012 1.00 0.00 ? 44  SER A H    14 
ATOM   9564  H  HA   . SER A 1 44 ? 7.829   5.570   -13.939 1.00 0.00 ? 44  SER A HA   14 
ATOM   9565  H  HB2  . SER A 1 44 ? 6.227   4.303   -12.441 1.00 0.00 ? 44  SER A HB2  14 
ATOM   9566  H  HB3  . SER A 1 44 ? 5.387   5.831   -12.177 1.00 0.00 ? 44  SER A HB3  14 
ATOM   9567  H  HG   . SER A 1 44 ? 5.226   4.145   -14.269 1.00 0.00 ? 44  SER A HG   14 
ATOM   9568  N  N    . GLY A 1 45 ? 8.036   8.317   -13.462 1.00 0.00 ? 45  GLY A N    14 
ATOM   9569  C  CA   . GLY A 1 45 ? 7.860   9.720   -13.786 1.00 0.00 ? 45  GLY A CA   14 
ATOM   9570  C  C    . GLY A 1 45 ? 8.863   10.208  -14.813 1.00 0.00 ? 45  GLY A C    14 
ATOM   9571  O  O    . GLY A 1 45 ? 8.581   10.263  -16.010 1.00 0.00 ? 45  GLY A O    14 
ATOM   9572  H  H    . GLY A 1 45 ? 8.926   7.977   -13.232 1.00 0.00 ? 45  GLY A H    14 
ATOM   9573  H  HA2  . GLY A 1 45 ? 6.863   9.866   -14.174 1.00 0.00 ? 45  GLY A HA2  14 
ATOM   9574  H  HA3  . GLY A 1 45 ? 7.973   10.304  -12.884 1.00 0.00 ? 45  GLY A HA3  14 
ATOM   9575  N  N    . PRO A 1 46 ? 10.064  10.575  -14.344 1.00 0.00 ? 46  PRO A N    14 
ATOM   9576  C  CA   . PRO A 1 46 ? 11.136  11.069  -15.213 1.00 0.00 ? 46  PRO A CA   14 
ATOM   9577  C  C    . PRO A 1 46 ? 11.710  9.974   -16.105 1.00 0.00 ? 46  PRO A C    14 
ATOM   9578  O  O    . PRO A 1 46 ? 12.657  10.205  -16.857 1.00 0.00 ? 46  PRO A O    14 
ATOM   9579  C  CB   . PRO A 1 46 ? 12.195  11.563  -14.224 1.00 0.00 ? 46  PRO A CB   14 
ATOM   9580  C  CG   . PRO A 1 46 ? 11.953  10.775  -12.984 1.00 0.00 ? 46  PRO A CG   14 
ATOM   9581  C  CD   . PRO A 1 46 ? 10.469  10.536  -12.928 1.00 0.00 ? 46  PRO A CD   14 
ATOM   9582  H  HA   . PRO A 1 46 ? 10.802  11.893  -15.826 1.00 0.00 ? 46  PRO A HA   14 
ATOM   9583  H  HB2  . PRO A 1 46 ? 13.182  11.376  -14.626 1.00 0.00 ? 46  PRO A HB2  14 
ATOM   9584  H  HB3  . PRO A 1 46 ? 12.066  12.621  -14.051 1.00 0.00 ? 46  PRO A HB3  14 
ATOM   9585  H  HG2  . PRO A 1 46 ? 12.482  9.836   -13.036 1.00 0.00 ? 46  PRO A HG2  14 
ATOM   9586  H  HG3  . PRO A 1 46 ? 12.274  11.340  -12.122 1.00 0.00 ? 46  PRO A HG3  14 
ATOM   9587  H  HD2  . PRO A 1 46 ? 10.259  9.570   -12.494 1.00 0.00 ? 46  PRO A HD2  14 
ATOM   9588  H  HD3  . PRO A 1 46 ? 9.982   11.319  -12.367 1.00 0.00 ? 46  PRO A HD3  14 
ATOM   9589  N  N    . SER A 1 47 ? 11.130  8.781   -16.017 1.00 0.00 ? 47  SER A N    14 
ATOM   9590  C  CA   . SER A 1 47 ? 11.586  7.649   -16.815 1.00 0.00 ? 47  SER A CA   14 
ATOM   9591  C  C    . SER A 1 47 ? 11.018  7.715   -18.229 1.00 0.00 ? 47  SER A C    14 
ATOM   9592  O  O    . SER A 1 47 ? 9.845   8.036   -18.423 1.00 0.00 ? 47  SER A O    14 
ATOM   9593  C  CB   . SER A 1 47 ? 11.178  6.332   -16.150 1.00 0.00 ? 47  SER A CB   14 
ATOM   9594  O  OG   . SER A 1 47 ? 9.796   6.076   -16.333 1.00 0.00 ? 47  SER A OG   14 
ATOM   9595  H  H    . SER A 1 47 ? 10.379  8.659   -15.399 1.00 0.00 ? 47  SER A H    14 
ATOM   9596  H  HA   . SER A 1 47 ? 12.664  7.695   -16.870 1.00 0.00 ? 47  SER A HA   14 
ATOM   9597  H  HB2  . SER A 1 47 ? 11.743  5.522   -16.585 1.00 0.00 ? 47  SER A HB2  14 
ATOM   9598  H  HB3  . SER A 1 47 ? 11.385  6.388   -15.091 1.00 0.00 ? 47  SER A HB3  14 
ATOM   9599  H  HG   . SER A 1 47 ? 9.665   5.144   -16.520 1.00 0.00 ? 47  SER A HG   14 
ATOM   9600  N  N    . SER A 1 48 ? 11.858  7.410   -19.213 1.00 0.00 ? 48  SER A N    14 
ATOM   9601  C  CA   . SER A 1 48 ? 11.441  7.439   -20.610 1.00 0.00 ? 48  SER A CA   14 
ATOM   9602  C  C    . SER A 1 48 ? 10.312  6.444   -20.860 1.00 0.00 ? 48  SER A C    14 
ATOM   9603  O  O    . SER A 1 48 ? 10.429  5.261   -20.543 1.00 0.00 ? 48  SER A O    14 
ATOM   9604  C  CB   . SER A 1 48 ? 12.626  7.123   -21.524 1.00 0.00 ? 48  SER A CB   14 
ATOM   9605  O  OG   . SER A 1 48 ? 12.972  5.750   -21.455 1.00 0.00 ? 48  SER A OG   14 
ATOM   9606  H  H    . SER A 1 48 ? 12.780  7.162   -18.993 1.00 0.00 ? 48  SER A H    14 
ATOM   9607  H  HA   . SER A 1 48 ? 11.084  8.434   -20.829 1.00 0.00 ? 48  SER A HA   14 
ATOM   9608  H  HB2  . SER A 1 48 ? 12.366  7.366   -22.543 1.00 0.00 ? 48  SER A HB2  14 
ATOM   9609  H  HB3  . SER A 1 48 ? 13.479  7.713   -21.220 1.00 0.00 ? 48  SER A HB3  14 
ATOM   9610  H  HG   . SER A 1 48 ? 13.461  5.583   -20.646 1.00 0.00 ? 48  SER A HG   14 
ATOM   9611  N  N    . GLY A 1 49 ? 9.216   6.934   -21.433 1.00 0.00 ? 49  GLY A N    14 
ATOM   9612  C  CA   . GLY A 1 49 ? 8.081   6.076   -21.717 1.00 0.00 ? 49  GLY A CA   14 
ATOM   9613  C  C    . GLY A 1 49 ? 7.681   6.107   -23.179 1.00 0.00 ? 49  GLY A C    14 
ATOM   9614  O  O    . GLY A 1 49 ? 8.191   5.301   -23.956 1.00 0.00 ? 49  GLY A O    14 
ATOM   9615  H  H    . GLY A 1 49 ? 9.178   7.886   -21.664 1.00 0.00 ? 49  GLY A H    14 
ATOM   9616  H  HA2  . GLY A 1 49 ? 8.333   5.062   -21.445 1.00 0.00 ? 49  GLY A HA2  14 
ATOM   9617  H  HA3  . GLY A 1 49 ? 7.241   6.400   -21.119 1.00 0.00 ? 49  GLY A HA3  14 
HETATM 9618  ZN ZN   . ZN  B 2 .  ? 3.155   -4.885  1.661   1.00 0.00 ? 201 ZN  A ZN   14 
ATOM   9619  N  N    . GLY A 1 1  ? -20.125 2.978   13.115  1.00 0.00 ? 1   GLY A N    15 
ATOM   9620  C  CA   . GLY A 1 1  ? -18.855 2.767   12.445  1.00 0.00 ? 1   GLY A CA   15 
ATOM   9621  C  C    . GLY A 1 1  ? -18.880 3.223   10.999  1.00 0.00 ? 1   GLY A C    15 
ATOM   9622  O  O    . GLY A 1 1  ? -19.936 3.563   10.467  1.00 0.00 ? 1   GLY A O    15 
ATOM   9623  H  H1   . GLY A 1 1  ? -20.342 3.860   13.482  1.00 0.00 ? 1   GLY A H1   15 
ATOM   9624  H  HA2  . GLY A 1 1  ? -18.087 3.314   12.971  1.00 0.00 ? 1   GLY A HA2  15 
ATOM   9625  H  HA3  . GLY A 1 1  ? -18.616 1.714   12.474  1.00 0.00 ? 1   GLY A HA3  15 
ATOM   9626  N  N    . SER A 1 2  ? -17.713 3.231   10.363  1.00 0.00 ? 2   SER A N    15 
ATOM   9627  C  CA   . SER A 1 2  ? -17.604 3.654   8.972   1.00 0.00 ? 2   SER A CA   15 
ATOM   9628  C  C    . SER A 1 2  ? -16.549 2.834   8.236   1.00 0.00 ? 2   SER A C    15 
ATOM   9629  O  O    . SER A 1 2  ? -15.800 2.072   8.848   1.00 0.00 ? 2   SER A O    15 
ATOM   9630  C  CB   . SER A 1 2  ? -17.254 5.142   8.895   1.00 0.00 ? 2   SER A CB   15 
ATOM   9631  O  OG   . SER A 1 2  ? -17.618 5.687   7.639   1.00 0.00 ? 2   SER A OG   15 
ATOM   9632  H  H    . SER A 1 2  ? -16.905 2.948   10.842  1.00 0.00 ? 2   SER A H    15 
ATOM   9633  H  HA   . SER A 1 2  ? -18.562 3.493   8.500   1.00 0.00 ? 2   SER A HA   15 
ATOM   9634  H  HB2  . SER A 1 2  ? -17.783 5.674   9.671   1.00 0.00 ? 2   SER A HB2  15 
ATOM   9635  H  HB3  . SER A 1 2  ? -16.190 5.266   9.034   1.00 0.00 ? 2   SER A HB3  15 
ATOM   9636  H  HG   . SER A 1 2  ? -17.566 6.645   7.678   1.00 0.00 ? 2   SER A HG   15 
ATOM   9637  N  N    . SER A 1 3  ? -16.496 2.996   6.917   1.00 0.00 ? 3   SER A N    15 
ATOM   9638  C  CA   . SER A 1 3  ? -15.536 2.268   6.096   1.00 0.00 ? 3   SER A CA   15 
ATOM   9639  C  C    . SER A 1 3  ? -15.128 3.092   4.879   1.00 0.00 ? 3   SER A C    15 
ATOM   9640  O  O    . SER A 1 3  ? -15.904 3.903   4.375   1.00 0.00 ? 3   SER A O    15 
ATOM   9641  C  CB   . SER A 1 3  ? -16.129 0.931   5.645   1.00 0.00 ? 3   SER A CB   15 
ATOM   9642  O  OG   . SER A 1 3  ? -17.244 1.129   4.794   1.00 0.00 ? 3   SER A OG   15 
ATOM   9643  H  H    . SER A 1 3  ? -17.120 3.618   6.487   1.00 0.00 ? 3   SER A H    15 
ATOM   9644  H  HA   . SER A 1 3  ? -14.660 2.079   6.698   1.00 0.00 ? 3   SER A HA   15 
ATOM   9645  H  HB2  . SER A 1 3  ? -15.378 0.370   5.110   1.00 0.00 ? 3   SER A HB2  15 
ATOM   9646  H  HB3  . SER A 1 3  ? -16.447 0.371   6.512   1.00 0.00 ? 3   SER A HB3  15 
ATOM   9647  H  HG   . SER A 1 3  ? -17.457 0.306   4.348   1.00 0.00 ? 3   SER A HG   15 
ATOM   9648  N  N    . GLY A 1 4  ? -13.902 2.878   4.411   1.00 0.00 ? 4   GLY A N    15 
ATOM   9649  C  CA   . GLY A 1 4  ? -13.410 3.608   3.257   1.00 0.00 ? 4   GLY A CA   15 
ATOM   9650  C  C    . GLY A 1 4  ? -11.964 4.035   3.413   1.00 0.00 ? 4   GLY A C    15 
ATOM   9651  O  O    . GLY A 1 4  ? -11.053 3.214   3.305   1.00 0.00 ? 4   GLY A O    15 
ATOM   9652  H  H    . GLY A 1 4  ? -13.326 2.219   4.853   1.00 0.00 ? 4   GLY A H    15 
ATOM   9653  H  HA2  . GLY A 1 4  ? -13.497 2.979   2.383   1.00 0.00 ? 4   GLY A HA2  15 
ATOM   9654  H  HA3  . GLY A 1 4  ? -14.020 4.489   3.116   1.00 0.00 ? 4   GLY A HA3  15 
ATOM   9655  N  N    . SER A 1 5  ? -11.753 5.322   3.668   1.00 0.00 ? 5   SER A N    15 
ATOM   9656  C  CA   . SER A 1 5  ? -10.406 5.857   3.834   1.00 0.00 ? 5   SER A CA   15 
ATOM   9657  C  C    . SER A 1 5  ? -9.586  4.981   4.776   1.00 0.00 ? 5   SER A C    15 
ATOM   9658  O  O    . SER A 1 5  ? -8.449  4.619   4.472   1.00 0.00 ? 5   SER A O    15 
ATOM   9659  C  CB   . SER A 1 5  ? -10.467 7.288   4.373   1.00 0.00 ? 5   SER A CB   15 
ATOM   9660  O  OG   . SER A 1 5  ? -11.254 8.116   3.535   1.00 0.00 ? 5   SER A OG   15 
ATOM   9661  H  H    . SER A 1 5  ? -12.521 5.926   3.743   1.00 0.00 ? 5   SER A H    15 
ATOM   9662  H  HA   . SER A 1 5  ? -9.931  5.867   2.864   1.00 0.00 ? 5   SER A HA   15 
ATOM   9663  H  HB2  . SER A 1 5  ? -10.901 7.279   5.361   1.00 0.00 ? 5   SER A HB2  15 
ATOM   9664  H  HB3  . SER A 1 5  ? -9.466  7.693   4.423   1.00 0.00 ? 5   SER A HB3  15 
ATOM   9665  H  HG   . SER A 1 5  ? -12.172 7.840   3.584   1.00 0.00 ? 5   SER A HG   15 
ATOM   9666  N  N    . SER A 1 6  ? -10.171 4.643   5.920   1.00 0.00 ? 6   SER A N    15 
ATOM   9667  C  CA   . SER A 1 6  ? -9.494  3.812   6.909   1.00 0.00 ? 6   SER A CA   15 
ATOM   9668  C  C    . SER A 1 6  ? -9.134  2.451   6.320   1.00 0.00 ? 6   SER A C    15 
ATOM   9669  O  O    . SER A 1 6  ? -7.980  2.028   6.366   1.00 0.00 ? 6   SER A O    15 
ATOM   9670  C  CB   . SER A 1 6  ? -10.379 3.629   8.143   1.00 0.00 ? 6   SER A CB   15 
ATOM   9671  O  OG   . SER A 1 6  ? -9.785  2.733   9.067   1.00 0.00 ? 6   SER A OG   15 
ATOM   9672  H  H    . SER A 1 6  ? -11.080 4.962   6.104   1.00 0.00 ? 6   SER A H    15 
ATOM   9673  H  HA   . SER A 1 6  ? -8.585  4.317   7.199   1.00 0.00 ? 6   SER A HA   15 
ATOM   9674  H  HB2  . SER A 1 6  ? -10.520 4.583   8.627   1.00 0.00 ? 6   SER A HB2  15 
ATOM   9675  H  HB3  . SER A 1 6  ? -11.337 3.232   7.841   1.00 0.00 ? 6   SER A HB3  15 
ATOM   9676  H  HG   . SER A 1 6  ? -10.440 2.459   9.714   1.00 0.00 ? 6   SER A HG   15 
ATOM   9677  N  N    . GLY A 1 7  ? -10.133 1.770   5.767   1.00 0.00 ? 7   GLY A N    15 
ATOM   9678  C  CA   . GLY A 1 7  ? -9.903  0.464   5.177   1.00 0.00 ? 7   GLY A CA   15 
ATOM   9679  C  C    . GLY A 1 7  ? -9.870  -0.642  6.213   1.00 0.00 ? 7   GLY A C    15 
ATOM   9680  O  O    . GLY A 1 7  ? -9.761  -0.378  7.410   1.00 0.00 ? 7   GLY A O    15 
ATOM   9681  H  H    . GLY A 1 7  ? -11.034 2.157   5.759   1.00 0.00 ? 7   GLY A H    15 
ATOM   9682  H  HA2  . GLY A 1 7  ? -10.692 0.257   4.469   1.00 0.00 ? 7   GLY A HA2  15 
ATOM   9683  H  HA3  . GLY A 1 7  ? -8.958  0.480   4.654   1.00 0.00 ? 7   GLY A HA3  15 
ATOM   9684  N  N    . SER A 1 8  ? -9.968  -1.885  5.752   1.00 0.00 ? 8   SER A N    15 
ATOM   9685  C  CA   . SER A 1 8  ? -9.954  -3.036  6.648   1.00 0.00 ? 8   SER A CA   15 
ATOM   9686  C  C    . SER A 1 8  ? -9.103  -4.163  6.071   1.00 0.00 ? 8   SER A C    15 
ATOM   9687  O  O    . SER A 1 8  ? -9.369  -4.660  4.976   1.00 0.00 ? 8   SER A O    15 
ATOM   9688  C  CB   . SER A 1 8  ? -11.380 -3.533  6.895   1.00 0.00 ? 8   SER A CB   15 
ATOM   9689  O  OG   . SER A 1 8  ? -11.376 -4.829  7.467   1.00 0.00 ? 8   SER A OG   15 
ATOM   9690  H  H    . SER A 1 8  ? -10.053 -2.031  4.786   1.00 0.00 ? 8   SER A H    15 
ATOM   9691  H  HA   . SER A 1 8  ? -9.524  -2.720  7.586   1.00 0.00 ? 8   SER A HA   15 
ATOM   9692  H  HB2  . SER A 1 8  ? -11.882 -2.857  7.569   1.00 0.00 ? 8   SER A HB2  15 
ATOM   9693  H  HB3  . SER A 1 8  ? -11.913 -3.569  5.956   1.00 0.00 ? 8   SER A HB3  15 
ATOM   9694  H  HG   . SER A 1 8  ? -12.028 -5.377  7.025   1.00 0.00 ? 8   SER A HG   15 
ATOM   9695  N  N    . LEU A 1 9  ? -8.078  -4.562  6.816   1.00 0.00 ? 9   LEU A N    15 
ATOM   9696  C  CA   . LEU A 1 9  ? -7.186  -5.631  6.381   1.00 0.00 ? 9   LEU A CA   15 
ATOM   9697  C  C    . LEU A 1 9  ? -7.977  -6.879  6.000   1.00 0.00 ? 9   LEU A C    15 
ATOM   9698  O  O    . LEU A 1 9  ? -8.646  -7.482  6.839   1.00 0.00 ? 9   LEU A O    15 
ATOM   9699  C  CB   . LEU A 1 9  ? -6.183  -5.967  7.486   1.00 0.00 ? 9   LEU A CB   15 
ATOM   9700  C  CG   . LEU A 1 9  ? -5.195  -4.860  7.855   1.00 0.00 ? 9   LEU A CG   15 
ATOM   9701  C  CD1  . LEU A 1 9  ? -4.473  -5.198  9.150   1.00 0.00 ? 9   LEU A CD1  15 
ATOM   9702  C  CD2  . LEU A 1 9  ? -4.197  -4.638  6.728   1.00 0.00 ? 9   LEU A CD2  15 
ATOM   9703  H  H    . LEU A 1 9  ? -7.917  -4.129  7.680   1.00 0.00 ? 9   LEU A H    15 
ATOM   9704  H  HA   . LEU A 1 9  ? -6.649  -5.281  5.512   1.00 0.00 ? 9   LEU A HA   15 
ATOM   9705  H  HB2  . LEU A 1 9  ? -6.742  -6.220  8.374   1.00 0.00 ? 9   LEU A HB2  15 
ATOM   9706  H  HB3  . LEU A 1 9  ? -5.613  -6.827  7.164   1.00 0.00 ? 9   LEU A HB3  15 
ATOM   9707  H  HG   . LEU A 1 9  ? -5.739  -3.937  8.007   1.00 0.00 ? 9   LEU A HG   15 
ATOM   9708  H  HD11 . LEU A 1 9  ? -5.178  -5.192  9.967   1.00 0.00 ? 9   LEU A HD11 15 
ATOM   9709  H  HD12 . LEU A 1 9  ? -3.703  -4.464  9.334   1.00 0.00 ? 9   LEU A HD12 15 
ATOM   9710  H  HD13 . LEU A 1 9  ? -4.025  -6.177  9.067   1.00 0.00 ? 9   LEU A HD13 15 
ATOM   9711  H  HD21 . LEU A 1 9  ? -4.717  -4.283  5.851   1.00 0.00 ? 9   LEU A HD21 15 
ATOM   9712  H  HD22 . LEU A 1 9  ? -3.700  -5.570  6.499   1.00 0.00 ? 9   LEU A HD22 15 
ATOM   9713  H  HD23 . LEU A 1 9  ? -3.464  -3.906  7.034   1.00 0.00 ? 9   LEU A HD23 15 
ATOM   9714  N  N    . MET A 1 10 ? -7.893  -7.262  4.730   1.00 0.00 ? 10  MET A N    15 
ATOM   9715  C  CA   . MET A 1 10 ? -8.598  -8.440  4.239   1.00 0.00 ? 10  MET A CA   15 
ATOM   9716  C  C    . MET A 1 10 ? -7.843  -9.715  4.601   1.00 0.00 ? 10  MET A C    15 
ATOM   9717  O  O    . MET A 1 10 ? -6.744  -9.662  5.154   1.00 0.00 ? 10  MET A O    15 
ATOM   9718  C  CB   . MET A 1 10 ? -8.783  -8.355  2.723   1.00 0.00 ? 10  MET A CB   15 
ATOM   9719  C  CG   . MET A 1 10 ? -9.314  -7.012  2.250   1.00 0.00 ? 10  MET A CG   15 
ATOM   9720  S  SD   . MET A 1 10 ? -10.305 -7.146  0.750   1.00 0.00 ? 10  MET A SD   15 
ATOM   9721  C  CE   . MET A 1 10 ? -11.960 -7.029  1.426   1.00 0.00 ? 10  MET A CE   15 
ATOM   9722  H  H    . MET A 1 10 ? -7.344  -6.740  4.108   1.00 0.00 ? 10  MET A H    15 
ATOM   9723  H  HA   . MET A 1 10 ? -9.569  -8.465  4.711   1.00 0.00 ? 10  MET A HA   15 
ATOM   9724  H  HB2  . MET A 1 10 ? -7.830  -8.530  2.246   1.00 0.00 ? 10  MET A HB2  15 
ATOM   9725  H  HB3  . MET A 1 10 ? -9.478  -9.121  2.413   1.00 0.00 ? 10  MET A HB3  15 
ATOM   9726  H  HG2  . MET A 1 10 ? -9.926  -6.585  3.031   1.00 0.00 ? 10  MET A HG2  15 
ATOM   9727  H  HG3  . MET A 1 10 ? -8.476  -6.358  2.055   1.00 0.00 ? 10  MET A HG3  15 
ATOM   9728  H  HE1  . MET A 1 10 ? -12.501 -7.939  1.209   1.00 0.00 ? 10  MET A HE1  15 
ATOM   9729  H  HE2  . MET A 1 10 ? -11.903 -6.890  2.495   1.00 0.00 ? 10  MET A HE2  15 
ATOM   9730  H  HE3  . MET A 1 10 ? -12.472 -6.190  0.980   1.00 0.00 ? 10  MET A HE3  15 
ATOM   9731  N  N    . ASP A 1 11 ? -8.439  -10.860 4.286   1.00 0.00 ? 11  ASP A N    15 
ATOM   9732  C  CA   . ASP A 1 11 ? -7.822  -12.149 4.577   1.00 0.00 ? 11  ASP A CA   15 
ATOM   9733  C  C    . ASP A 1 11 ? -6.852  -12.549 3.469   1.00 0.00 ? 11  ASP A C    15 
ATOM   9734  O  O    . ASP A 1 11 ? -6.467  -13.713 3.358   1.00 0.00 ? 11  ASP A O    15 
ATOM   9735  C  CB   . ASP A 1 11 ? -8.895  -13.225 4.746   1.00 0.00 ? 11  ASP A CB   15 
ATOM   9736  C  CG   . ASP A 1 11 ? -9.740  -13.401 3.499   1.00 0.00 ? 11  ASP A CG   15 
ATOM   9737  O  OD1  . ASP A 1 11 ? -9.905  -12.416 2.750   1.00 0.00 ? 11  ASP A OD1  15 
ATOM   9738  O  OD2  . ASP A 1 11 ? -10.237 -14.525 3.273   1.00 0.00 ? 11  ASP A OD2  15 
ATOM   9739  H  H    . ASP A 1 11 ? -9.315  -10.837 3.846   1.00 0.00 ? 11  ASP A H    15 
ATOM   9740  H  HA   . ASP A 1 11 ? -7.273  -12.052 5.501   1.00 0.00 ? 11  ASP A HA   15 
ATOM   9741  H  HB2  . ASP A 1 11 ? -8.418  -14.168 4.971   1.00 0.00 ? 11  ASP A HB2  15 
ATOM   9742  H  HB3  . ASP A 1 11 ? -9.545  -12.951 5.564   1.00 0.00 ? 11  ASP A HB3  15 
ATOM   9743  N  N    . VAL A 1 12 ? -6.462  -11.577 2.651   1.00 0.00 ? 12  VAL A N    15 
ATOM   9744  C  CA   . VAL A 1 12 ? -5.537  -11.828 1.553   1.00 0.00 ? 12  VAL A CA   15 
ATOM   9745  C  C    . VAL A 1 12 ? -4.159  -11.248 1.851   1.00 0.00 ? 12  VAL A C    15 
ATOM   9746  O  O    . VAL A 1 12 ? -4.026  -10.298 2.623   1.00 0.00 ? 12  VAL A O    15 
ATOM   9747  C  CB   . VAL A 1 12 ? -6.058  -11.230 0.232   1.00 0.00 ? 12  VAL A CB   15 
ATOM   9748  C  CG1  . VAL A 1 12 ? -5.231  -11.727 -0.943  1.00 0.00 ? 12  VAL A CG1  15 
ATOM   9749  C  CG2  . VAL A 1 12 ? -7.529  -11.567 0.040   1.00 0.00 ? 12  VAL A CG2  15 
ATOM   9750  H  H    . VAL A 1 12 ? -6.803  -10.669 2.791   1.00 0.00 ? 12  VAL A H    15 
ATOM   9751  H  HA   . VAL A 1 12 ? -5.448  -12.897 1.428   1.00 0.00 ? 12  VAL A HA   15 
ATOM   9752  H  HB   . VAL A 1 12 ? -5.960  -10.155 0.284   1.00 0.00 ? 12  VAL A HB   15 
ATOM   9753  H  HG11 . VAL A 1 12 ? -4.764  -12.666 -0.683  1.00 0.00 ? 12  VAL A HG11 15 
ATOM   9754  H  HG12 . VAL A 1 12 ? -5.871  -11.867 -1.801  1.00 0.00 ? 12  VAL A HG12 15 
ATOM   9755  H  HG13 . VAL A 1 12 ? -4.467  -11.000 -1.178  1.00 0.00 ? 12  VAL A HG13 15 
ATOM   9756  H  HG21 . VAL A 1 12 ? -8.134  -10.720 0.328   1.00 0.00 ? 12  VAL A HG21 15 
ATOM   9757  H  HG22 . VAL A 1 12 ? -7.711  -11.802 -0.998  1.00 0.00 ? 12  VAL A HG22 15 
ATOM   9758  H  HG23 . VAL A 1 12 ? -7.787  -12.418 0.652   1.00 0.00 ? 12  VAL A HG23 15 
ATOM   9759  N  N    . LYS A 1 13 ? -3.134  -11.826 1.234   1.00 0.00 ? 13  LYS A N    15 
ATOM   9760  C  CA   . LYS A 1 13 ? -1.764  -11.367 1.431   1.00 0.00 ? 13  LYS A CA   15 
ATOM   9761  C  C    . LYS A 1 13 ? -1.463  -10.159 0.549   1.00 0.00 ? 13  LYS A C    15 
ATOM   9762  O  O    . LYS A 1 13 ? -1.967  -10.053 -0.569  1.00 0.00 ? 13  LYS A O    15 
ATOM   9763  C  CB   . LYS A 1 13 ? -0.777  -12.495 1.123   1.00 0.00 ? 13  LYS A CB   15 
ATOM   9764  C  CG   . LYS A 1 13 ? -0.450  -13.362 2.327   1.00 0.00 ? 13  LYS A CG   15 
ATOM   9765  C  CD   . LYS A 1 13 ? -1.427  -14.517 2.464   1.00 0.00 ? 13  LYS A CD   15 
ATOM   9766  C  CE   . LYS A 1 13 ? -2.825  -14.026 2.808   1.00 0.00 ? 13  LYS A CE   15 
ATOM   9767  N  NZ   . LYS A 1 13 ? -3.524  -14.952 3.742   1.00 0.00 ? 13  LYS A NZ   15 
ATOM   9768  H  H    . LYS A 1 13 ? -3.303  -12.580 0.630   1.00 0.00 ? 13  LYS A H    15 
ATOM   9769  H  HA   . LYS A 1 13 ? -1.656  -11.078 2.465   1.00 0.00 ? 13  LYS A HA   15 
ATOM   9770  H  HB2  . LYS A 1 13 ? -1.198  -13.126 0.355   1.00 0.00 ? 13  LYS A HB2  15 
ATOM   9771  H  HB3  . LYS A 1 13 ? 0.143   -12.062 0.757   1.00 0.00 ? 13  LYS A HB3  15 
ATOM   9772  H  HG2  . LYS A 1 13 ? 0.547   -13.761 2.212   1.00 0.00 ? 13  LYS A HG2  15 
ATOM   9773  H  HG3  . LYS A 1 13 ? -0.496  -12.755 3.219   1.00 0.00 ? 13  LYS A HG3  15 
ATOM   9774  H  HD2  . LYS A 1 13 ? -1.468  -15.056 1.529   1.00 0.00 ? 13  LYS A HD2  15 
ATOM   9775  H  HD3  . LYS A 1 13 ? -1.084  -15.177 3.248   1.00 0.00 ? 13  LYS A HD3  15 
ATOM   9776  H  HE2  . LYS A 1 13 ? -2.747  -13.053 3.271   1.00 0.00 ? 13  LYS A HE2  15 
ATOM   9777  H  HE3  . LYS A 1 13 ? -3.399  -13.946 1.897   1.00 0.00 ? 13  LYS A HE3  15 
ATOM   9778  H  HZ1  . LYS A 1 13 ? -3.230  -14.761 4.721   1.00 0.00 ? 13  LYS A HZ1  15 
ATOM   9779  H  HZ2  . LYS A 1 13 ? -3.292  -15.938 3.507   1.00 0.00 ? 13  LYS A HZ2  15 
ATOM   9780  H  HZ3  . LYS A 1 13 ? -4.553  -14.823 3.669   1.00 0.00 ? 13  LYS A HZ3  15 
ATOM   9781  N  N    . CYS A 1 14 ? -0.637  -9.251  1.059   1.00 0.00 ? 14  CYS A N    15 
ATOM   9782  C  CA   . CYS A 1 14 ? -0.268  -8.051  0.318   1.00 0.00 ? 14  CYS A CA   15 
ATOM   9783  C  C    . CYS A 1 14 ? 0.261   -8.409  -1.068  1.00 0.00 ? 14  CYS A C    15 
ATOM   9784  O  O    . CYS A 1 14 ? 0.962   -9.406  -1.237  1.00 0.00 ? 14  CYS A O    15 
ATOM   9785  C  CB   . CYS A 1 14 ? 0.787   -7.255  1.089   1.00 0.00 ? 14  CYS A CB   15 
ATOM   9786  S  SG   . CYS A 1 14 ? 1.453   -5.826  0.177   1.00 0.00 ? 14  CYS A SG   15 
ATOM   9787  H  H    . CYS A 1 14 ? -0.267  -9.391  1.957   1.00 0.00 ? 14  CYS A H    15 
ATOM   9788  H  HA   . CYS A 1 14 ? -1.153  -7.444  0.206   1.00 0.00 ? 14  CYS A HA   15 
ATOM   9789  H  HB2  . CYS A 1 14 ? 0.350   -6.885  2.005   1.00 0.00 ? 14  CYS A HB2  15 
ATOM   9790  H  HB3  . CYS A 1 14 ? 1.614   -7.907  1.330   1.00 0.00 ? 14  CYS A HB3  15 
ATOM   9791  N  N    . GLU A 1 15 ? -0.080  -7.587  -2.056  1.00 0.00 ? 15  GLU A N    15 
ATOM   9792  C  CA   . GLU A 1 15 ? 0.360   -7.818  -3.427  1.00 0.00 ? 15  GLU A CA   15 
ATOM   9793  C  C    . GLU A 1 15 ? 1.764   -8.417  -3.454  1.00 0.00 ? 15  GLU A C    15 
ATOM   9794  O  O    . GLU A 1 15 ? 1.994   -9.462  -4.063  1.00 0.00 ? 15  GLU A O    15 
ATOM   9795  C  CB   . GLU A 1 15 ? 0.337   -6.510  -4.220  1.00 0.00 ? 15  GLU A CB   15 
ATOM   9796  C  CG   . GLU A 1 15 ? 0.608   -6.693  -5.704  1.00 0.00 ? 15  GLU A CG   15 
ATOM   9797  C  CD   . GLU A 1 15 ? -0.252  -7.776  -6.325  1.00 0.00 ? 15  GLU A CD   15 
ATOM   9798  O  OE1  . GLU A 1 15 ? -1.387  -7.981  -5.846  1.00 0.00 ? 15  GLU A OE1  15 
ATOM   9799  O  OE2  . GLU A 1 15 ? 0.210   -8.419  -7.291  1.00 0.00 ? 15  GLU A OE2  15 
ATOM   9800  H  H    . GLU A 1 15 ? -0.641  -6.809  -1.858  1.00 0.00 ? 15  GLU A H    15 
ATOM   9801  H  HA   . GLU A 1 15 ? -0.325  -8.516  -3.882  1.00 0.00 ? 15  GLU A HA   15 
ATOM   9802  H  HB2  . GLU A 1 15 ? -0.634  -6.051  -4.106  1.00 0.00 ? 15  GLU A HB2  15 
ATOM   9803  H  HB3  . GLU A 1 15 ? 1.088   -5.846  -3.818  1.00 0.00 ? 15  GLU A HB3  15 
ATOM   9804  H  HG2  . GLU A 1 15 ? 0.409   -5.761  -6.211  1.00 0.00 ? 15  GLU A HG2  15 
ATOM   9805  H  HG3  . GLU A 1 15 ? 1.647   -6.958  -5.837  1.00 0.00 ? 15  GLU A HG3  15 
ATOM   9806  N  N    . THR A 1 16 ? 2.700   -7.747  -2.789  1.00 0.00 ? 16  THR A N    15 
ATOM   9807  C  CA   . THR A 1 16 ? 4.081   -8.210  -2.738  1.00 0.00 ? 16  THR A CA   15 
ATOM   9808  C  C    . THR A 1 16 ? 4.175   -9.587  -2.091  1.00 0.00 ? 16  THR A C    15 
ATOM   9809  O  O    . THR A 1 16 ? 3.751   -9.796  -0.954  1.00 0.00 ? 16  THR A O    15 
ATOM   9810  C  CB   . THR A 1 16 ? 4.975   -7.227  -1.959  1.00 0.00 ? 16  THR A CB   15 
ATOM   9811  O  OG1  . THR A 1 16 ? 4.999   -5.957  -2.620  1.00 0.00 ? 16  THR A OG1  15 
ATOM   9812  C  CG2  . THR A 1 16 ? 6.392   -7.767  -1.835  1.00 0.00 ? 16  THR A CG2  15 
ATOM   9813  H  H    . THR A 1 16 ? 2.455   -6.920  -2.324  1.00 0.00 ? 16  THR A H    15 
ATOM   9814  H  HA   . THR A 1 16 ? 4.449   -8.273  -3.752  1.00 0.00 ? 16  THR A HA   15 
ATOM   9815  H  HB   . THR A 1 16 ? 4.565   -7.100  -0.967  1.00 0.00 ? 16  THR A HB   15 
ATOM   9816  H  HG1  . THR A 1 16 ? 4.581   -5.298  -2.062  1.00 0.00 ? 16  THR A HG1  15 
ATOM   9817  H  HG21 . THR A 1 16 ? 6.564   -8.093  -0.820  1.00 0.00 ? 16  THR A HG21 15 
ATOM   9818  H  HG22 . THR A 1 16 ? 7.097   -6.989  -2.087  1.00 0.00 ? 16  THR A HG22 15 
ATOM   9819  H  HG23 . THR A 1 16 ? 6.520   -8.601  -2.508  1.00 0.00 ? 16  THR A HG23 15 
ATOM   9820  N  N    . PRO A 1 17 ? 4.744   -10.551 -2.830  1.00 0.00 ? 17  PRO A N    15 
ATOM   9821  C  CA   . PRO A 1 17 ? 4.907   -11.926 -2.347  1.00 0.00 ? 17  PRO A CA   15 
ATOM   9822  C  C    . PRO A 1 17 ? 5.946   -12.030 -1.235  1.00 0.00 ? 17  PRO A C    15 
ATOM   9823  O  O    . PRO A 1 17 ? 6.217   -13.116 -0.726  1.00 0.00 ? 17  PRO A O    15 
ATOM   9824  C  CB   . PRO A 1 17 ? 5.378   -12.685 -3.590  1.00 0.00 ? 17  PRO A CB   15 
ATOM   9825  C  CG   . PRO A 1 17 ? 6.027   -11.650 -4.443  1.00 0.00 ? 17  PRO A CG   15 
ATOM   9826  C  CD   . PRO A 1 17 ? 5.271   -10.374 -4.193  1.00 0.00 ? 17  PRO A CD   15 
ATOM   9827  H  HA   . PRO A 1 17 ? 3.971   -12.340 -2.003  1.00 0.00 ? 17  PRO A HA   15 
ATOM   9828  H  HB2  . PRO A 1 17 ? 6.078   -13.456 -3.301  1.00 0.00 ? 17  PRO A HB2  15 
ATOM   9829  H  HB3  . PRO A 1 17 ? 4.529   -13.130 -4.087  1.00 0.00 ? 17  PRO A HB3  15 
ATOM   9830  H  HG2  . PRO A 1 17 ? 7.061   -11.535 -4.158  1.00 0.00 ? 17  PRO A HG2  15 
ATOM   9831  H  HG3  . PRO A 1 17 ? 5.952   -11.932 -5.483  1.00 0.00 ? 17  PRO A HG3  15 
ATOM   9832  H  HD2  . PRO A 1 17 ? 5.937   -9.525  -4.242  1.00 0.00 ? 17  PRO A HD2  15 
ATOM   9833  H  HD3  . PRO A 1 17 ? 4.467   -10.266 -4.906  1.00 0.00 ? 17  PRO A HD3  15 
ATOM   9834  N  N    . ASN A 1 18 ? 6.523   -10.892 -0.862  1.00 0.00 ? 18  ASN A N    15 
ATOM   9835  C  CA   . ASN A 1 18 ? 7.532   -10.855 0.190   1.00 0.00 ? 18  ASN A CA   15 
ATOM   9836  C  C    . ASN A 1 18 ? 7.013   -10.107 1.415   1.00 0.00 ? 18  ASN A C    15 
ATOM   9837  O  O    . ASN A 1 18 ? 7.647   -10.109 2.471   1.00 0.00 ? 18  ASN A O    15 
ATOM   9838  C  CB   . ASN A 1 18 ? 8.811   -10.191 -0.324  1.00 0.00 ? 18  ASN A CB   15 
ATOM   9839  C  CG   . ASN A 1 18 ? 9.333   -10.843 -1.589  1.00 0.00 ? 18  ASN A CG   15 
ATOM   9840  O  OD1  . ASN A 1 18 ? 10.051  -11.842 -1.535  1.00 0.00 ? 18  ASN A OD1  15 
ATOM   9841  N  ND2  . ASN A 1 18 ? 8.973   -10.280 -2.737  1.00 0.00 ? 18  ASN A ND2  15 
ATOM   9842  H  H    . ASN A 1 18 ? 6.265   -10.057 -1.306  1.00 0.00 ? 18  ASN A H    15 
ATOM   9843  H  HA   . ASN A 1 18 ? 7.754   -11.873 0.472   1.00 0.00 ? 18  ASN A HA   15 
ATOM   9844  H  HB2  . ASN A 1 18 ? 8.609   -9.151  -0.535  1.00 0.00 ? 18  ASN A HB2  15 
ATOM   9845  H  HB3  . ASN A 1 18 ? 9.575   -10.258 0.436   1.00 0.00 ? 18  ASN A HB3  15 
ATOM   9846  H  HD21 . ASN A 1 18 ? 8.399   -9.486  -2.703  1.00 0.00 ? 18  ASN A HD21 15 
ATOM   9847  H  HD22 . ASN A 1 18 ? 9.296   -10.681 -3.570  1.00 0.00 ? 18  ASN A HD22 15 
ATOM   9848  N  N    . CYS A 1 19 ? 5.857   -9.469  1.266   1.00 0.00 ? 19  CYS A N    15 
ATOM   9849  C  CA   . CYS A 1 19 ? 5.253   -8.717  2.359   1.00 0.00 ? 19  CYS A CA   15 
ATOM   9850  C  C    . CYS A 1 19 ? 4.321   -9.604  3.179   1.00 0.00 ? 19  CYS A C    15 
ATOM   9851  O  O    . CYS A 1 19 ? 3.249   -10.007 2.727   1.00 0.00 ? 19  CYS A O    15 
ATOM   9852  C  CB   . CYS A 1 19 ? 4.480   -7.515  1.812   1.00 0.00 ? 19  CYS A CB   15 
ATOM   9853  S  SG   . CYS A 1 19 ? 3.911   -6.352  3.093   1.00 0.00 ? 19  CYS A SG   15 
ATOM   9854  H  H    . CYS A 1 19 ? 5.399   -9.505  0.400   1.00 0.00 ? 19  CYS A H    15 
ATOM   9855  H  HA   . CYS A 1 19 ? 6.047   -8.363  2.998   1.00 0.00 ? 19  CYS A HA   15 
ATOM   9856  H  HB2  . CYS A 1 19 ? 5.116   -6.968  1.131   1.00 0.00 ? 19  CYS A HB2  15 
ATOM   9857  H  HB3  . CYS A 1 19 ? 3.610   -7.869  1.278   1.00 0.00 ? 19  CYS A HB3  15 
ATOM   9858  N  N    . PRO A 1 20 ? 4.737   -9.916  4.415   1.00 0.00 ? 20  PRO A N    15 
ATOM   9859  C  CA   . PRO A 1 20 ? 3.955   -10.758 5.326   1.00 0.00 ? 20  PRO A CA   15 
ATOM   9860  C  C    . PRO A 1 20 ? 2.693   -10.059 5.821   1.00 0.00 ? 20  PRO A C    15 
ATOM   9861  O  O    . PRO A 1 20 ? 1.911   -10.632 6.580   1.00 0.00 ? 20  PRO A O    15 
ATOM   9862  C  CB   . PRO A 1 20 ? 4.917   -11.012 6.489   1.00 0.00 ? 20  PRO A CB   15 
ATOM   9863  C  CG   . PRO A 1 20 ? 5.853   -9.853  6.466   1.00 0.00 ? 20  PRO A CG   15 
ATOM   9864  C  CD   . PRO A 1 20 ? 6.004   -9.471  5.020   1.00 0.00 ? 20  PRO A CD   15 
ATOM   9865  H  HA   . PRO A 1 20 ? 3.687   -11.697 4.866   1.00 0.00 ? 20  PRO A HA   15 
ATOM   9866  H  HB2  . PRO A 1 20 ? 4.362   -11.055 7.416   1.00 0.00 ? 20  PRO A HB2  15 
ATOM   9867  H  HB3  . PRO A 1 20 ? 5.439   -11.944 6.332   1.00 0.00 ? 20  PRO A HB3  15 
ATOM   9868  H  HG2  . PRO A 1 20 ? 5.435   -9.033  7.030   1.00 0.00 ? 20  PRO A HG2  15 
ATOM   9869  H  HG3  . PRO A 1 20 ? 6.808   -10.145 6.878   1.00 0.00 ? 20  PRO A HG3  15 
ATOM   9870  H  HD2  . PRO A 1 20 ? 6.123   -8.402  4.923   1.00 0.00 ? 20  PRO A HD2  15 
ATOM   9871  H  HD3  . PRO A 1 20 ? 6.843   -9.987  4.579   1.00 0.00 ? 20  PRO A HD3  15 
ATOM   9872  N  N    . PHE A 1 21 ? 2.501   -8.817  5.387   1.00 0.00 ? 21  PHE A N    15 
ATOM   9873  C  CA   . PHE A 1 21 ? 1.334   -8.040  5.787   1.00 0.00 ? 21  PHE A CA   15 
ATOM   9874  C  C    . PHE A 1 21 ? 0.190   -8.225  4.794   1.00 0.00 ? 21  PHE A C    15 
ATOM   9875  O  O    . PHE A 1 21 ? 0.415   -8.494  3.614   1.00 0.00 ? 21  PHE A O    15 
ATOM   9876  C  CB   . PHE A 1 21 ? 1.695   -6.557  5.895   1.00 0.00 ? 21  PHE A CB   15 
ATOM   9877  C  CG   . PHE A 1 21 ? 2.705   -6.263  6.968   1.00 0.00 ? 21  PHE A CG   15 
ATOM   9878  C  CD1  . PHE A 1 21 ? 4.061   -6.286  6.685   1.00 0.00 ? 21  PHE A CD1  15 
ATOM   9879  C  CD2  . PHE A 1 21 ? 2.298   -5.962  8.257   1.00 0.00 ? 21  PHE A CD2  15 
ATOM   9880  C  CE1  . PHE A 1 21 ? 4.993   -6.016  7.670   1.00 0.00 ? 21  PHE A CE1  15 
ATOM   9881  C  CE2  . PHE A 1 21 ? 3.225   -5.691  9.247   1.00 0.00 ? 21  PHE A CE2  15 
ATOM   9882  C  CZ   . PHE A 1 21 ? 4.574   -5.717  8.952   1.00 0.00 ? 21  PHE A CZ   15 
ATOM   9883  H  H    . PHE A 1 21 ? 3.160   -8.415  4.783   1.00 0.00 ? 21  PHE A H    15 
ATOM   9884  H  HA   . PHE A 1 21 ? 1.016   -8.396  6.755   1.00 0.00 ? 21  PHE A HA   15 
ATOM   9885  H  HB2  . PHE A 1 21 ? 2.105   -6.224  4.954   1.00 0.00 ? 21  PHE A HB2  15 
ATOM   9886  H  HB3  . PHE A 1 21 ? 0.802   -5.992  6.114   1.00 0.00 ? 21  PHE A HB3  15 
ATOM   9887  H  HD1  . PHE A 1 21 ? 4.390   -6.518  5.683   1.00 0.00 ? 21  PHE A HD1  15 
ATOM   9888  H  HD2  . PHE A 1 21 ? 1.242   -5.942  8.489   1.00 0.00 ? 21  PHE A HD2  15 
ATOM   9889  H  HE1  . PHE A 1 21 ? 6.047   -6.037  7.438   1.00 0.00 ? 21  PHE A HE1  15 
ATOM   9890  H  HE2  . PHE A 1 21 ? 2.893   -5.458  10.248  1.00 0.00 ? 21  PHE A HE2  15 
ATOM   9891  H  HZ   . PHE A 1 21 ? 5.299   -5.507  9.724   1.00 0.00 ? 21  PHE A HZ   15 
ATOM   9892  N  N    . PHE A 1 22 ? -1.038  -8.080  5.281   1.00 0.00 ? 22  PHE A N    15 
ATOM   9893  C  CA   . PHE A 1 22 ? -2.218  -8.233  4.438   1.00 0.00 ? 22  PHE A CA   15 
ATOM   9894  C  C    . PHE A 1 22 ? -2.617  -6.899  3.814   1.00 0.00 ? 22  PHE A C    15 
ATOM   9895  O  O    . PHE A 1 22 ? -2.403  -5.839  4.402   1.00 0.00 ? 22  PHE A O    15 
ATOM   9896  C  CB   . PHE A 1 22 ? -3.383  -8.797  5.253   1.00 0.00 ? 22  PHE A CB   15 
ATOM   9897  C  CG   . PHE A 1 22 ? -3.146  -10.194 5.751   1.00 0.00 ? 22  PHE A CG   15 
ATOM   9898  C  CD1  . PHE A 1 22 ? -2.150  -10.454 6.678   1.00 0.00 ? 22  PHE A CD1  15 
ATOM   9899  C  CD2  . PHE A 1 22 ? -3.920  -11.248 5.291   1.00 0.00 ? 22  PHE A CD2  15 
ATOM   9900  C  CE1  . PHE A 1 22 ? -1.929  -11.739 7.138   1.00 0.00 ? 22  PHE A CE1  15 
ATOM   9901  C  CE2  . PHE A 1 22 ? -3.704  -12.535 5.748   1.00 0.00 ? 22  PHE A CE2  15 
ATOM   9902  C  CZ   . PHE A 1 22 ? -2.707  -12.780 6.672   1.00 0.00 ? 22  PHE A CZ   15 
ATOM   9903  H  H    . PHE A 1 22 ? -1.153  -7.866  6.231   1.00 0.00 ? 22  PHE A H    15 
ATOM   9904  H  HA   . PHE A 1 22 ? -1.972  -8.927  3.649   1.00 0.00 ? 22  PHE A HA   15 
ATOM   9905  H  HB2  . PHE A 1 22 ? -3.553  -8.164  6.111   1.00 0.00 ? 22  PHE A HB2  15 
ATOM   9906  H  HB3  . PHE A 1 22 ? -4.271  -8.808  4.638   1.00 0.00 ? 22  PHE A HB3  15 
ATOM   9907  H  HD1  . PHE A 1 22 ? -1.541  -9.639  7.043   1.00 0.00 ? 22  PHE A HD1  15 
ATOM   9908  H  HD2  . PHE A 1 22 ? -4.699  -11.058 4.568   1.00 0.00 ? 22  PHE A HD2  15 
ATOM   9909  H  HE1  . PHE A 1 22 ? -1.149  -11.927 7.860   1.00 0.00 ? 22  PHE A HE1  15 
ATOM   9910  H  HE2  . PHE A 1 22 ? -4.313  -13.347 5.382   1.00 0.00 ? 22  PHE A HE2  15 
ATOM   9911  H  HZ   . PHE A 1 22 ? -2.537  -13.784 7.031   1.00 0.00 ? 22  PHE A HZ   15 
ATOM   9912  N  N    . MET A 1 23 ? -3.197  -6.961  2.620   1.00 0.00 ? 23  MET A N    15 
ATOM   9913  C  CA   . MET A 1 23 ? -3.627  -5.758  1.917   1.00 0.00 ? 23  MET A CA   15 
ATOM   9914  C  C    . MET A 1 23 ? -4.972  -5.270  2.445   1.00 0.00 ? 23  MET A C    15 
ATOM   9915  O  O    . MET A 1 23 ? -5.898  -6.059  2.636   1.00 0.00 ? 23  MET A O    15 
ATOM   9916  C  CB   . MET A 1 23 ? -3.724  -6.028  0.414   1.00 0.00 ? 23  MET A CB   15 
ATOM   9917  C  CG   . MET A 1 23 ? -4.469  -7.308  0.073   1.00 0.00 ? 23  MET A CG   15 
ATOM   9918  S  SD   . MET A 1 23 ? -5.310  -7.219  -1.520  1.00 0.00 ? 23  MET A SD   15 
ATOM   9919  C  CE   . MET A 1 23 ? -4.528  -8.576  -2.391  1.00 0.00 ? 23  MET A CE   15 
ATOM   9920  H  H    . MET A 1 23 ? -3.341  -7.836  2.202   1.00 0.00 ? 23  MET A H    15 
ATOM   9921  H  HA   . MET A 1 23 ? -2.886  -4.992  2.089   1.00 0.00 ? 23  MET A HA   15 
ATOM   9922  H  HB2  . MET A 1 23 ? -4.237  -5.202  -0.056  1.00 0.00 ? 23  MET A HB2  15 
ATOM   9923  H  HB3  . MET A 1 23 ? -2.726  -6.099  0.007   1.00 0.00 ? 23  MET A HB3  15 
ATOM   9924  H  HG2  . MET A 1 23 ? -3.763  -8.124  0.046   1.00 0.00 ? 23  MET A HG2  15 
ATOM   9925  H  HG3  . MET A 1 23 ? -5.203  -7.496  0.843   1.00 0.00 ? 23  MET A HG3  15 
ATOM   9926  H  HE1  . MET A 1 23 ? -5.229  -9.393  -2.486  1.00 0.00 ? 23  MET A HE1  15 
ATOM   9927  H  HE2  . MET A 1 23 ? -4.225  -8.246  -3.373  1.00 0.00 ? 23  MET A HE2  15 
ATOM   9928  H  HE3  . MET A 1 23 ? -3.662  -8.906  -1.838  1.00 0.00 ? 23  MET A HE3  15 
ATOM   9929  N  N    . SER A 1 24 ? -5.072  -3.966  2.681   1.00 0.00 ? 24  SER A N    15 
ATOM   9930  C  CA   . SER A 1 24 ? -6.303  -3.374  3.192   1.00 0.00 ? 24  SER A CA   15 
ATOM   9931  C  C    . SER A 1 24 ? -7.295  -3.120  2.060   1.00 0.00 ? 24  SER A C    15 
ATOM   9932  O  O    . SER A 1 24 ? -6.981  -3.323  0.887   1.00 0.00 ? 24  SER A O    15 
ATOM   9933  C  CB   . SER A 1 24 ? -6.000  -2.064  3.922   1.00 0.00 ? 24  SER A CB   15 
ATOM   9934  O  OG   . SER A 1 24 ? -6.939  -1.827  4.956   1.00 0.00 ? 24  SER A OG   15 
ATOM   9935  H  H    . SER A 1 24 ? -4.299  -3.388  2.509   1.00 0.00 ? 24  SER A H    15 
ATOM   9936  H  HA   . SER A 1 24 ? -6.742  -4.072  3.889   1.00 0.00 ? 24  SER A HA   15 
ATOM   9937  H  HB2  . SER A 1 24 ? -5.012  -2.117  4.355   1.00 0.00 ? 24  SER A HB2  15 
ATOM   9938  H  HB3  . SER A 1 24 ? -6.041  -1.245  3.219   1.00 0.00 ? 24  SER A HB3  15 
ATOM   9939  H  HG   . SER A 1 24 ? -7.283  -2.665  5.275   1.00 0.00 ? 24  SER A HG   15 
ATOM   9940  N  N    . VAL A 1 25 ? -8.494  -2.675  2.421   1.00 0.00 ? 25  VAL A N    15 
ATOM   9941  C  CA   . VAL A 1 25 ? -9.532  -2.392  1.438   1.00 0.00 ? 25  VAL A CA   15 
ATOM   9942  C  C    . VAL A 1 25 ? -9.281  -1.059  0.742   1.00 0.00 ? 25  VAL A C    15 
ATOM   9943  O  O    . VAL A 1 25 ? -9.799  -0.808  -0.345  1.00 0.00 ? 25  VAL A O    15 
ATOM   9944  C  CB   . VAL A 1 25 ? -10.928 -2.365  2.087   1.00 0.00 ? 25  VAL A CB   15 
ATOM   9945  C  CG1  . VAL A 1 25 ? -11.999 -2.095  1.041   1.00 0.00 ? 25  VAL A CG1  15 
ATOM   9946  C  CG2  . VAL A 1 25 ? -11.202 -3.672  2.817   1.00 0.00 ? 25  VAL A CG2  15 
ATOM   9947  H  H    . VAL A 1 25 ? -8.685  -2.533  3.372   1.00 0.00 ? 25  VAL A H    15 
ATOM   9948  H  HA   . VAL A 1 25 ? -9.517  -3.181  0.700   1.00 0.00 ? 25  VAL A HA   15 
ATOM   9949  H  HB   . VAL A 1 25 ? -10.952 -1.562  2.810   1.00 0.00 ? 25  VAL A HB   15 
ATOM   9950  H  HG11 . VAL A 1 25 ? -11.734 -2.590  0.119   1.00 0.00 ? 25  VAL A HG11 15 
ATOM   9951  H  HG12 . VAL A 1 25 ? -12.949 -2.470  1.393   1.00 0.00 ? 25  VAL A HG12 15 
ATOM   9952  H  HG13 . VAL A 1 25 ? -12.073 -1.031  0.869   1.00 0.00 ? 25  VAL A HG13 15 
ATOM   9953  H  HG21 . VAL A 1 25 ? -10.931 -3.567  3.857   1.00 0.00 ? 25  VAL A HG21 15 
ATOM   9954  H  HG22 . VAL A 1 25 ? -12.251 -3.913  2.740   1.00 0.00 ? 25  VAL A HG22 15 
ATOM   9955  H  HG23 . VAL A 1 25 ? -10.617 -4.463  2.370   1.00 0.00 ? 25  VAL A HG23 15 
ATOM   9956  N  N    . ASN A 1 26 ? -8.483  -0.207  1.377   1.00 0.00 ? 26  ASN A N    15 
ATOM   9957  C  CA   . ASN A 1 26 ? -8.163  1.102   0.819   1.00 0.00 ? 26  ASN A CA   15 
ATOM   9958  C  C    . ASN A 1 26 ? -6.695  1.174   0.408   1.00 0.00 ? 26  ASN A C    15 
ATOM   9959  O  O    . ASN A 1 26 ? -6.218  2.211   -0.053  1.00 0.00 ? 26  ASN A O    15 
ATOM   9960  C  CB   . ASN A 1 26 ? -8.474  2.202   1.835   1.00 0.00 ? 26  ASN A CB   15 
ATOM   9961  C  CG   . ASN A 1 26 ? -8.083  3.579   1.333   1.00 0.00 ? 26  ASN A CG   15 
ATOM   9962  O  OD1  . ASN A 1 26 ? -7.506  4.379   2.070   1.00 0.00 ? 26  ASN A OD1  15 
ATOM   9963  N  ND2  . ASN A 1 26 ? -8.398  3.862   0.074   1.00 0.00 ? 26  ASN A ND2  15 
ATOM   9964  H  H    . ASN A 1 26 ? -8.100  -0.465  2.241   1.00 0.00 ? 26  ASN A H    15 
ATOM   9965  H  HA   . ASN A 1 26 ? -8.777  1.248   -0.057  1.00 0.00 ? 26  ASN A HA   15 
ATOM   9966  H  HB2  . ASN A 1 26 ? -9.535  2.203   2.041   1.00 0.00 ? 26  ASN A HB2  15 
ATOM   9967  H  HB3  . ASN A 1 26 ? -7.934  2.005   2.748   1.00 0.00 ? 26  ASN A HB3  15 
ATOM   9968  H  HD21 . ASN A 1 26 ? -8.858  3.175   -0.453  1.00 0.00 ? 26  ASN A HD21 15 
ATOM   9969  H  HD22 . ASN A 1 26 ? -8.156  4.744   -0.276  1.00 0.00 ? 26  ASN A HD22 15 
ATOM   9970  N  N    . THR A 1 27 ? -5.983  0.064   0.578   1.00 0.00 ? 27  THR A N    15 
ATOM   9971  C  CA   . THR A 1 27 ? -4.570  0.000   0.226   1.00 0.00 ? 27  THR A CA   15 
ATOM   9972  C  C    . THR A 1 27 ? -4.322  -1.034  -0.866  1.00 0.00 ? 27  THR A C    15 
ATOM   9973  O  O    . THR A 1 27 ? -3.267  -1.038  -1.500  1.00 0.00 ? 27  THR A O    15 
ATOM   9974  C  CB   . THR A 1 27 ? -3.701  -0.343  1.450   1.00 0.00 ? 27  THR A CB   15 
ATOM   9975  O  OG1  . THR A 1 27 ? -3.890  -1.715  1.816   1.00 0.00 ? 27  THR A OG1  15 
ATOM   9976  C  CG2  . THR A 1 27 ? -4.048  0.553   2.629   1.00 0.00 ? 27  THR A CG2  15 
ATOM   9977  H  H    . THR A 1 27 ? -6.420  -0.730  0.950   1.00 0.00 ? 27  THR A H    15 
ATOM   9978  H  HA   . THR A 1 27 ? -4.274  0.973   -0.138  1.00 0.00 ? 27  THR A HA   15 
ATOM   9979  H  HB   . THR A 1 27 ? -2.664  -0.187  1.192   1.00 0.00 ? 27  THR A HB   15 
ATOM   9980  H  HG1  . THR A 1 27 ? -3.764  -2.272  1.044   1.00 0.00 ? 27  THR A HG1  15 
ATOM   9981  H  HG21 . THR A 1 27 ? -3.981  -0.015  3.545   1.00 0.00 ? 27  THR A HG21 15 
ATOM   9982  H  HG22 . THR A 1 27 ? -5.054  0.928   2.513   1.00 0.00 ? 27  THR A HG22 15 
ATOM   9983  H  HG23 . THR A 1 27 ? -3.357  1.382   2.667   1.00 0.00 ? 27  THR A HG23 15 
ATOM   9984  N  N    . GLN A 1 28 ? -5.300  -1.908  -1.080  1.00 0.00 ? 28  GLN A N    15 
ATOM   9985  C  CA   . GLN A 1 28 ? -5.185  -2.947  -2.097  1.00 0.00 ? 28  GLN A CA   15 
ATOM   9986  C  C    . GLN A 1 28 ? -4.861  -2.343  -3.459  1.00 0.00 ? 28  GLN A C    15 
ATOM   9987  O  O    . GLN A 1 28 ? -5.220  -1.205  -3.762  1.00 0.00 ? 28  GLN A O    15 
ATOM   9988  C  CB   . GLN A 1 28 ? -6.482  -3.754  -2.180  1.00 0.00 ? 28  GLN A CB   15 
ATOM   9989  C  CG   . GLN A 1 28 ? -7.634  -2.991  -2.815  1.00 0.00 ? 28  GLN A CG   15 
ATOM   9990  C  CD   . GLN A 1 28 ? -8.807  -3.886  -3.159  1.00 0.00 ? 28  GLN A CD   15 
ATOM   9991  O  OE1  . GLN A 1 28 ? -8.746  -4.674  -4.104  1.00 0.00 ? 28  GLN A OE1  15 
ATOM   9992  N  NE2  . GLN A 1 28 ? -9.886  -3.771  -2.393  1.00 0.00 ? 28  GLN A NE2  15 
ATOM   9993  H  H    . GLN A 1 28 ? -6.116  -1.853  -0.543  1.00 0.00 ? 28  GLN A H    15 
ATOM   9994  H  HA   . GLN A 1 28 ? -4.380  -3.606  -1.808  1.00 0.00 ? 28  GLN A HA   15 
ATOM   9995  H  HB2  . GLN A 1 28 ? -6.302  -4.643  -2.764  1.00 0.00 ? 28  GLN A HB2  15 
ATOM   9996  H  HB3  . GLN A 1 28 ? -6.777  -4.042  -1.182  1.00 0.00 ? 28  GLN A HB3  15 
ATOM   9997  H  HG2  . GLN A 1 28 ? -7.971  -2.232  -2.124  1.00 0.00 ? 28  GLN A HG2  15 
ATOM   9998  H  HG3  . GLN A 1 28 ? -7.281  -2.520  -3.720  1.00 0.00 ? 28  GLN A HG3  15 
ATOM   9999  H  HE21 . GLN A 1 28 ? -9.863  -3.122  -1.658  1.00 0.00 ? 28  GLN A HE21 15 
ATOM   10000 H  HE22 . GLN A 1 28 ? -10.659 -4.337  -2.593  1.00 0.00 ? 28  GLN A HE22 15 
ATOM   10001 N  N    . PRO A 1 29 ? -4.164  -3.120  -4.301  1.00 0.00 ? 29  PRO A N    15 
ATOM   10002 C  CA   . PRO A 1 29 ? -3.730  -4.476  -3.951  1.00 0.00 ? 29  PRO A CA   15 
ATOM   10003 C  C    . PRO A 1 29 ? -2.636  -4.478  -2.888  1.00 0.00 ? 29  PRO A C    15 
ATOM   10004 O  O    . PRO A 1 29 ? -2.427  -5.478  -2.200  1.00 0.00 ? 29  PRO A O    15 
ATOM   10005 C  CB   . PRO A 1 29 ? -3.192  -5.029  -5.273  1.00 0.00 ? 29  PRO A CB   15 
ATOM   10006 C  CG   . PRO A 1 29 ? -2.784  -3.824  -6.049  1.00 0.00 ? 29  PRO A CG   15 
ATOM   10007 C  CD   . PRO A 1 29 ? -3.745  -2.735  -5.660  1.00 0.00 ? 29  PRO A CD   15 
ATOM   10008 H  HA   . PRO A 1 29 ? -4.557  -5.083  -3.615  1.00 0.00 ? 29  PRO A HA   15 
ATOM   10009 H  HB2  . PRO A 1 29 ? -2.350  -5.678  -5.078  1.00 0.00 ? 29  PRO A HB2  15 
ATOM   10010 H  HB3  . PRO A 1 29 ? -3.969  -5.580  -5.780  1.00 0.00 ? 29  PRO A HB3  15 
ATOM   10011 H  HG2  . PRO A 1 29 ? -1.775  -3.544  -5.790  1.00 0.00 ? 29  PRO A HG2  15 
ATOM   10012 H  HG3  . PRO A 1 29 ? -2.858  -4.028  -7.107  1.00 0.00 ? 29  PRO A HG3  15 
ATOM   10013 H  HD2  . PRO A 1 29 ? -3.248  -1.777  -5.653  1.00 0.00 ? 29  PRO A HD2  15 
ATOM   10014 H  HD3  . PRO A 1 29 ? -4.590  -2.719  -6.332  1.00 0.00 ? 29  PRO A HD3  15 
ATOM   10015 N  N    . LEU A 1 30 ? -1.941  -3.353  -2.759  1.00 0.00 ? 30  LEU A N    15 
ATOM   10016 C  CA   . LEU A 1 30 ? -0.868  -3.225  -1.779  1.00 0.00 ? 30  LEU A CA   15 
ATOM   10017 C  C    . LEU A 1 30 ? -1.433  -3.095  -0.368  1.00 0.00 ? 30  LEU A C    15 
ATOM   10018 O  O    . LEU A 1 30 ? -2.644  -2.974  -0.180  1.00 0.00 ? 30  LEU A O    15 
ATOM   10019 C  CB   . LEU A 1 30 ? 0.005   -2.012  -2.105  1.00 0.00 ? 30  LEU A CB   15 
ATOM   10020 C  CG   . LEU A 1 30 ? 1.032   -2.205  -3.221  1.00 0.00 ? 30  LEU A CG   15 
ATOM   10021 C  CD1  . LEU A 1 30 ? 1.634   -0.870  -3.630  1.00 0.00 ? 30  LEU A CD1  15 
ATOM   10022 C  CD2  . LEU A 1 30 ? 2.122   -3.172  -2.782  1.00 0.00 ? 30  LEU A CD2  15 
ATOM   10023 H  H    . LEU A 1 30 ? -2.154  -2.590  -3.336  1.00 0.00 ? 30  LEU A H    15 
ATOM   10024 H  HA   . LEU A 1 30 ? -0.264  -4.118  -1.831  1.00 0.00 ? 30  LEU A HA   15 
ATOM   10025 H  HB2  . LEU A 1 30 ? -0.648  -1.203  -2.393  1.00 0.00 ? 30  LEU A HB2  15 
ATOM   10026 H  HB3  . LEU A 1 30 ? 0.540   -1.739  -1.206  1.00 0.00 ? 30  LEU A HB3  15 
ATOM   10027 H  HG   . LEU A 1 30 ? 0.538   -2.627  -4.087  1.00 0.00 ? 30  LEU A HG   15 
ATOM   10028 H  HD11 . LEU A 1 30 ? 2.709   -0.957  -3.669  1.00 0.00 ? 30  LEU A HD11 15 
ATOM   10029 H  HD12 . LEU A 1 30 ? 1.359   -0.115  -2.907  1.00 0.00 ? 30  LEU A HD12 15 
ATOM   10030 H  HD13 . LEU A 1 30 ? 1.259   -0.589  -4.603  1.00 0.00 ? 30  LEU A HD13 15 
ATOM   10031 H  HD21 . LEU A 1 30 ? 2.974   -3.076  -3.438  1.00 0.00 ? 30  LEU A HD21 15 
ATOM   10032 H  HD22 . LEU A 1 30 ? 1.745   -4.183  -2.827  1.00 0.00 ? 30  LEU A HD22 15 
ATOM   10033 H  HD23 . LEU A 1 30 ? 2.419   -2.943  -1.769  1.00 0.00 ? 30  LEU A HD23 15 
ATOM   10034 N  N    . CYS A 1 31 ? -0.547  -3.118  0.623   1.00 0.00 ? 31  CYS A N    15 
ATOM   10035 C  CA   . CYS A 1 31 ? -0.955  -3.001  2.017   1.00 0.00 ? 31  CYS A CA   15 
ATOM   10036 C  C    . CYS A 1 31 ? -0.625  -1.616  2.566   1.00 0.00 ? 31  CYS A C    15 
ATOM   10037 O  O    . CYS A 1 31 ? -0.052  -0.779  1.867   1.00 0.00 ? 31  CYS A O    15 
ATOM   10038 C  CB   . CYS A 1 31 ? -0.268  -4.074  2.864   1.00 0.00 ? 31  CYS A CB   15 
ATOM   10039 S  SG   . CYS A 1 31 ? 1.438   -3.659  3.350   1.00 0.00 ? 31  CYS A SG   15 
ATOM   10040 H  H    . CYS A 1 31 ? 0.406   -3.216  0.410   1.00 0.00 ? 31  CYS A H    15 
ATOM   10041 H  HA   . CYS A 1 31 ? -2.024  -3.147  2.064   1.00 0.00 ? 31  CYS A HA   15 
ATOM   10042 H  HB2  . CYS A 1 31 ? -0.838  -4.228  3.768   1.00 0.00 ? 31  CYS A HB2  15 
ATOM   10043 H  HB3  . CYS A 1 31 ? -0.235  -4.997  2.304   1.00 0.00 ? 31  CYS A HB3  15 
ATOM   10044 N  N    . HIS A 1 32 ? -0.990  -1.381  3.823   1.00 0.00 ? 32  HIS A N    15 
ATOM   10045 C  CA   . HIS A 1 32 ? -0.732  -0.097  4.466   1.00 0.00 ? 32  HIS A CA   15 
ATOM   10046 C  C    . HIS A 1 32 ? 0.750   0.259   4.393   1.00 0.00 ? 32  HIS A C    15 
ATOM   10047 O  O    . HIS A 1 32 ? 1.115   1.339   3.929   1.00 0.00 ? 32  HIS A O    15 
ATOM   10048 C  CB   . HIS A 1 32 ? -1.187  -0.134  5.925   1.00 0.00 ? 32  HIS A CB   15 
ATOM   10049 C  CG   . HIS A 1 32 ? -0.433  0.807   6.813   1.00 0.00 ? 32  HIS A CG   15 
ATOM   10050 N  ND1  . HIS A 1 32 ? 0.105   0.431   8.025   1.00 0.00 ? 32  HIS A ND1  15 
ATOM   10051 C  CD2  . HIS A 1 32 ? -0.126  2.117   6.657   1.00 0.00 ? 32  HIS A CD2  15 
ATOM   10052 C  CE1  . HIS A 1 32 ? 0.709   1.468   8.578   1.00 0.00 ? 32  HIS A CE1  15 
ATOM   10053 N  NE2  . HIS A 1 32 ? 0.584   2.504   7.767   1.00 0.00 ? 32  HIS A NE2  15 
ATOM   10054 H  H    . HIS A 1 32 ? -1.443  -2.087  4.328   1.00 0.00 ? 32  HIS A H    15 
ATOM   10055 H  HA   . HIS A 1 32 ? -1.297  0.657   3.941   1.00 0.00 ? 32  HIS A HA   15 
ATOM   10056 H  HB2  . HIS A 1 32 ? -2.233  0.130   5.976   1.00 0.00 ? 32  HIS A HB2  15 
ATOM   10057 H  HB3  . HIS A 1 32 ? -1.054  -1.134  6.312   1.00 0.00 ? 32  HIS A HB3  15 
ATOM   10058 H  HD1  . HIS A 1 32 ? 0.051   -0.463  8.422   1.00 0.00 ? 32  HIS A HD1  15 
ATOM   10059 H  HD2  . HIS A 1 32 ? -0.390  2.742   5.815   1.00 0.00 ? 32  HIS A HD2  15 
ATOM   10060 H  HE1  . HIS A 1 32 ? 1.219   1.470   9.529   1.00 0.00 ? 32  HIS A HE1  15 
ATOM   10061 N  N    . GLU A 1 33 ? 1.597   -0.656  4.854   1.00 0.00 ? 33  GLU A N    15 
ATOM   10062 C  CA   . GLU A 1 33 ? 3.039   -0.436  4.841   1.00 0.00 ? 33  GLU A CA   15 
ATOM   10063 C  C    . GLU A 1 33 ? 3.514   -0.024  3.451   1.00 0.00 ? 33  GLU A C    15 
ATOM   10064 O  O    . GLU A 1 33 ? 3.992   1.094   3.251   1.00 0.00 ? 33  GLU A O    15 
ATOM   10065 C  CB   . GLU A 1 33 ? 3.774   -1.701  5.289   1.00 0.00 ? 33  GLU A CB   15 
ATOM   10066 C  CG   . GLU A 1 33 ? 5.284   -1.541  5.341   1.00 0.00 ? 33  GLU A CG   15 
ATOM   10067 C  CD   . GLU A 1 33 ? 5.961   -2.645  6.130   1.00 0.00 ? 33  GLU A CD   15 
ATOM   10068 O  OE1  . GLU A 1 33 ? 5.964   -3.799  5.654   1.00 0.00 ? 33  GLU A OE1  15 
ATOM   10069 O  OE2  . GLU A 1 33 ? 6.488   -2.353  7.225   1.00 0.00 ? 33  GLU A OE2  15 
ATOM   10070 H  H    . GLU A 1 33 ? 1.245   -1.497  5.211   1.00 0.00 ? 33  GLU A H    15 
ATOM   10071 H  HA   . GLU A 1 33 ? 3.259   0.362   5.534   1.00 0.00 ? 33  GLU A HA   15 
ATOM   10072 H  HB2  . GLU A 1 33 ? 3.427   -1.974  6.275   1.00 0.00 ? 33  GLU A HB2  15 
ATOM   10073 H  HB3  . GLU A 1 33 ? 3.541   -2.500  4.601   1.00 0.00 ? 33  GLU A HB3  15 
ATOM   10074 H  HG2  . GLU A 1 33 ? 5.670   -1.553  4.332   1.00 0.00 ? 33  GLU A HG2  15 
ATOM   10075 H  HG3  . GLU A 1 33 ? 5.517   -0.593  5.803   1.00 0.00 ? 33  GLU A HG3  15 
ATOM   10076 N  N    . CYS A 1 34 ? 3.380   -0.934  2.492   1.00 0.00 ? 34  CYS A N    15 
ATOM   10077 C  CA   . CYS A 1 34 ? 3.796   -0.668  1.120   1.00 0.00 ? 34  CYS A CA   15 
ATOM   10078 C  C    . CYS A 1 34 ? 3.161   0.618   0.599   1.00 0.00 ? 34  CYS A C    15 
ATOM   10079 O  O    . CYS A 1 34 ? 3.859   1.553   0.208   1.00 0.00 ? 34  CYS A O    15 
ATOM   10080 C  CB   . CYS A 1 34 ? 3.417   -1.840  0.214   1.00 0.00 ? 34  CYS A CB   15 
ATOM   10081 S  SG   . CYS A 1 34 ? 4.184   -3.424  0.686   1.00 0.00 ? 34  CYS A SG   15 
ATOM   10082 H  H    . CYS A 1 34 ? 2.992   -1.808  2.713   1.00 0.00 ? 34  CYS A H    15 
ATOM   10083 H  HA   . CYS A 1 34 ? 4.869   -0.553  1.115   1.00 0.00 ? 34  CYS A HA   15 
ATOM   10084 H  HB2  . CYS A 1 34 ? 2.345   -1.975  0.241   1.00 0.00 ? 34  CYS A HB2  15 
ATOM   10085 H  HB3  . CYS A 1 34 ? 3.720   -1.616  -0.798  1.00 0.00 ? 34  CYS A HB3  15 
ATOM   10086 N  N    . SER A 1 35 ? 1.832   0.657   0.598   1.00 0.00 ? 35  SER A N    15 
ATOM   10087 C  CA   . SER A 1 35 ? 1.102   1.827   0.123   1.00 0.00 ? 35  SER A CA   15 
ATOM   10088 C  C    . SER A 1 35 ? 1.842   3.112   0.481   1.00 0.00 ? 35  SER A C    15 
ATOM   10089 O  O    . SER A 1 35 ? 2.347   3.814   -0.394  1.00 0.00 ? 35  SER A O    15 
ATOM   10090 C  CB   . SER A 1 35 ? -0.306  1.853   0.719   1.00 0.00 ? 35  SER A CB   15 
ATOM   10091 O  OG   . SER A 1 35 ? -0.891  3.137   0.592   1.00 0.00 ? 35  SER A OG   15 
ATOM   10092 H  H    . SER A 1 35 ? 1.331   -0.120  0.923   1.00 0.00 ? 35  SER A H    15 
ATOM   10093 H  HA   . SER A 1 35 ? 1.028   1.756   -0.952  1.00 0.00 ? 35  SER A HA   15 
ATOM   10094 H  HB2  . SER A 1 35 ? -0.926  1.135   0.203   1.00 0.00 ? 35  SER A HB2  15 
ATOM   10095 H  HB3  . SER A 1 35 ? -0.255  1.596   1.767   1.00 0.00 ? 35  SER A HB3  15 
ATOM   10096 H  HG   . SER A 1 35 ? -1.707  3.069   0.090   1.00 0.00 ? 35  SER A HG   15 
ATOM   10097 N  N    . GLU A 1 36 ? 1.902   3.412   1.775   1.00 0.00 ? 36  GLU A N    15 
ATOM   10098 C  CA   . GLU A 1 36 ? 2.579   4.613   2.249   1.00 0.00 ? 36  GLU A CA   15 
ATOM   10099 C  C    . GLU A 1 36 ? 4.054   4.595   1.860   1.00 0.00 ? 36  GLU A C    15 
ATOM   10100 O  O    . GLU A 1 36 ? 4.614   5.617   1.461   1.00 0.00 ? 36  GLU A O    15 
ATOM   10101 C  CB   . GLU A 1 36 ? 2.442   4.736   3.768   1.00 0.00 ? 36  GLU A CB   15 
ATOM   10102 C  CG   . GLU A 1 36 ? 3.192   3.660   4.536   1.00 0.00 ? 36  GLU A CG   15 
ATOM   10103 C  CD   . GLU A 1 36 ? 3.007   3.778   6.036   1.00 0.00 ? 36  GLU A CD   15 
ATOM   10104 O  OE1  . GLU A 1 36 ? 2.681   4.887   6.509   1.00 0.00 ? 36  GLU A OE1  15 
ATOM   10105 O  OE2  . GLU A 1 36 ? 3.188   2.761   6.737   1.00 0.00 ? 36  GLU A OE2  15 
ATOM   10106 H  H    . GLU A 1 36 ? 1.480   2.813   2.425   1.00 0.00 ? 36  GLU A H    15 
ATOM   10107 H  HA   . GLU A 1 36 ? 2.107   5.466   1.784   1.00 0.00 ? 36  GLU A HA   15 
ATOM   10108 H  HB2  . GLU A 1 36 ? 2.822   5.700   4.075   1.00 0.00 ? 36  GLU A HB2  15 
ATOM   10109 H  HB3  . GLU A 1 36 ? 1.396   4.672   4.029   1.00 0.00 ? 36  GLU A HB3  15 
ATOM   10110 H  HG2  . GLU A 1 36 ? 2.832   2.693   4.219   1.00 0.00 ? 36  GLU A HG2  15 
ATOM   10111 H  HG3  . GLU A 1 36 ? 4.245   3.742   4.310   1.00 0.00 ? 36  GLU A HG3  15 
ATOM   10112 N  N    . ARG A 1 37 ? 4.678   3.428   1.980   1.00 0.00 ? 37  ARG A N    15 
ATOM   10113 C  CA   . ARG A 1 37 ? 6.088   3.277   1.643   1.00 0.00 ? 37  ARG A CA   15 
ATOM   10114 C  C    . ARG A 1 37 ? 6.359   3.745   0.216   1.00 0.00 ? 37  ARG A C    15 
ATOM   10115 O  O    . ARG A 1 37 ? 7.429   4.278   -0.081  1.00 0.00 ? 37  ARG A O    15 
ATOM   10116 C  CB   . ARG A 1 37 ? 6.519   1.817   1.803   1.00 0.00 ? 37  ARG A CB   15 
ATOM   10117 C  CG   . ARG A 1 37 ? 7.933   1.543   1.317   1.00 0.00 ? 37  ARG A CG   15 
ATOM   10118 C  CD   . ARG A 1 37 ? 8.098   0.099   0.869   1.00 0.00 ? 37  ARG A CD   15 
ATOM   10119 N  NE   . ARG A 1 37 ? 9.488   -0.342  0.943   1.00 0.00 ? 37  ARG A NE   15 
ATOM   10120 C  CZ   . ARG A 1 37 ? 10.440  0.087   0.122   1.00 0.00 ? 37  ARG A CZ   15 
ATOM   10121 N  NH1  . ARG A 1 37 ? 10.153  0.963   -0.831  1.00 0.00 ? 37  ARG A NH1  15 
ATOM   10122 N  NH2  . ARG A 1 37 ? 11.682  -0.361  0.253   1.00 0.00 ? 37  ARG A NH2  15 
ATOM   10123 H  H    . ARG A 1 37 ? 4.178   2.649   2.303   1.00 0.00 ? 37  ARG A H    15 
ATOM   10124 H  HA   . ARG A 1 37 ? 6.660   3.888   2.324   1.00 0.00 ? 37  ARG A HA   15 
ATOM   10125 H  HB2  . ARG A 1 37 ? 6.463   1.550   2.848   1.00 0.00 ? 37  ARG A HB2  15 
ATOM   10126 H  HB3  . ARG A 1 37 ? 5.841   1.191   1.242   1.00 0.00 ? 37  ARG A HB3  15 
ATOM   10127 H  HG2  . ARG A 1 37 ? 8.150   2.194   0.483   1.00 0.00 ? 37  ARG A HG2  15 
ATOM   10128 H  HG3  . ARG A 1 37 ? 8.625   1.743   2.121   1.00 0.00 ? 37  ARG A HG3  15 
ATOM   10129 H  HD2  . ARG A 1 37 ? 7.495   -0.532  1.505   1.00 0.00 ? 37  ARG A HD2  15 
ATOM   10130 H  HD3  . ARG A 1 37 ? 7.756   0.012   -0.152  1.00 0.00 ? 37  ARG A HD3  15 
ATOM   10131 H  HE   . ARG A 1 37 ? 9.722   -0.989  1.640   1.00 0.00 ? 37  ARG A HE   15 
ATOM   10132 H  HH11 . ARG A 1 37 ? 9.219   1.303   -0.931  1.00 0.00 ? 37  ARG A HH11 15 
ATOM   10133 H  HH12 . ARG A 1 37 ? 10.872  1.285   -1.447  1.00 0.00 ? 37  ARG A HH12 15 
ATOM   10134 H  HH21 . ARG A 1 37 ? 11.902  -1.021  0.971   1.00 0.00 ? 37  ARG A HH21 15 
ATOM   10135 H  HH22 . ARG A 1 37 ? 12.398  -0.038  -0.365  1.00 0.00 ? 37  ARG A HH22 15 
ATOM   10136 N  N    . ARG A 1 38 ? 5.384   3.540   -0.664  1.00 0.00 ? 38  ARG A N    15 
ATOM   10137 C  CA   . ARG A 1 38 ? 5.518   3.940   -2.060  1.00 0.00 ? 38  ARG A CA   15 
ATOM   10138 C  C    . ARG A 1 38 ? 5.151   5.409   -2.242  1.00 0.00 ? 38  ARG A C    15 
ATOM   10139 O  O    . ARG A 1 38 ? 6.008   6.239   -2.546  1.00 0.00 ? 38  ARG A O    15 
ATOM   10140 C  CB   . ARG A 1 38 ? 4.631   3.067   -2.949  1.00 0.00 ? 38  ARG A CB   15 
ATOM   10141 C  CG   . ARG A 1 38 ? 5.082   3.020   -4.400  1.00 0.00 ? 38  ARG A CG   15 
ATOM   10142 C  CD   . ARG A 1 38 ? 6.059   1.881   -4.644  1.00 0.00 ? 38  ARG A CD   15 
ATOM   10143 N  NE   . ARG A 1 38 ? 6.480   1.810   -6.041  1.00 0.00 ? 38  ARG A NE   15 
ATOM   10144 C  CZ   . ARG A 1 38 ? 5.730   1.295   -7.009  1.00 0.00 ? 38  ARG A CZ   15 
ATOM   10145 N  NH1  . ARG A 1 38 ? 4.528   0.809   -6.734  1.00 0.00 ? 38  ARG A NH1  15 
ATOM   10146 N  NH2  . ARG A 1 38 ? 6.183   1.266   -8.256  1.00 0.00 ? 38  ARG A NH2  15 
ATOM   10147 H  H    . ARG A 1 38 ? 4.555   3.110   -0.367  1.00 0.00 ? 38  ARG A H    15 
ATOM   10148 H  HA   . ARG A 1 38 ? 6.550   3.800   -2.347  1.00 0.00 ? 38  ARG A HA   15 
ATOM   10149 H  HB2  . ARG A 1 38 ? 4.634   2.058   -2.562  1.00 0.00 ? 38  ARG A HB2  15 
ATOM   10150 H  HB3  . ARG A 1 38 ? 3.623   3.452   -2.920  1.00 0.00 ? 38  ARG A HB3  15 
ATOM   10151 H  HG2  . ARG A 1 38 ? 4.217   2.880   -5.032  1.00 0.00 ? 38  ARG A HG2  15 
ATOM   10152 H  HG3  . ARG A 1 38 ? 5.563   3.955   -4.648  1.00 0.00 ? 38  ARG A HG3  15 
ATOM   10153 H  HD2  . ARG A 1 38 ? 6.929   2.031   -4.023  1.00 0.00 ? 38  ARG A HD2  15 
ATOM   10154 H  HD3  . ARG A 1 38 ? 5.581   0.951   -4.374  1.00 0.00 ? 38  ARG A HD3  15 
ATOM   10155 H  HE   . ARG A 1 38 ? 7.365   2.164   -6.266  1.00 0.00 ? 38  ARG A HE   15 
ATOM   10156 H  HH11 . ARG A 1 38 ? 4.184   0.830   -5.795  1.00 0.00 ? 38  ARG A HH11 15 
ATOM   10157 H  HH12 . ARG A 1 38 ? 3.965   0.422   -7.465  1.00 0.00 ? 38  ARG A HH12 15 
ATOM   10158 H  HH21 . ARG A 1 38 ? 7.089   1.632   -8.467  1.00 0.00 ? 38  ARG A HH21 15 
ATOM   10159 H  HH22 . ARG A 1 38 ? 5.618   0.878   -8.984  1.00 0.00 ? 38  ARG A HH22 15 
ATOM   10160 N  N    . GLN A 1 39 ? 3.873   5.722   -2.056  1.00 0.00 ? 39  GLN A N    15 
ATOM   10161 C  CA   . GLN A 1 39 ? 3.393   7.091   -2.202  1.00 0.00 ? 39  GLN A CA   15 
ATOM   10162 C  C    . GLN A 1 39 ? 4.415   8.087   -1.662  1.00 0.00 ? 39  GLN A C    15 
ATOM   10163 O  O    . GLN A 1 39 ? 4.659   9.132   -2.265  1.00 0.00 ? 39  GLN A O    15 
ATOM   10164 C  CB   . GLN A 1 39 ? 2.059   7.267   -1.474  1.00 0.00 ? 39  GLN A CB   15 
ATOM   10165 C  CG   . GLN A 1 39 ? 2.162   7.103   0.033   1.00 0.00 ? 39  GLN A CG   15 
ATOM   10166 C  CD   . GLN A 1 39 ? 2.440   8.413   0.745   1.00 0.00 ? 39  GLN A CD   15 
ATOM   10167 O  OE1  . GLN A 1 39 ? 3.400   8.526   1.508   1.00 0.00 ? 39  GLN A OE1  15 
ATOM   10168 N  NE2  . GLN A 1 39 ? 1.599   9.410   0.499   1.00 0.00 ? 39  GLN A NE2  15 
ATOM   10169 H  H    . GLN A 1 39 ? 3.238   5.016   -1.816  1.00 0.00 ? 39  GLN A H    15 
ATOM   10170 H  HA   . GLN A 1 39 ? 3.246   7.281   -3.254  1.00 0.00 ? 39  GLN A HA   15 
ATOM   10171 H  HB2  . GLN A 1 39 ? 1.676   8.255   -1.683  1.00 0.00 ? 39  GLN A HB2  15 
ATOM   10172 H  HB3  . GLN A 1 39 ? 1.360   6.533   -1.847  1.00 0.00 ? 39  GLN A HB3  15 
ATOM   10173 H  HG2  . GLN A 1 39 ? 1.230   6.701   0.404   1.00 0.00 ? 39  GLN A HG2  15 
ATOM   10174 H  HG3  . GLN A 1 39 ? 2.963   6.413   0.254   1.00 0.00 ? 39  GLN A HG3  15 
ATOM   10175 H  HE21 . GLN A 1 39 ? 0.855   9.247   -0.119  1.00 0.00 ? 39  GLN A HE21 15 
ATOM   10176 H  HE22 . GLN A 1 39 ? 1.754   10.268  0.946   1.00 0.00 ? 39  GLN A HE22 15 
ATOM   10177 N  N    . LYS A 1 40 ? 5.010   7.756   -0.521  1.00 0.00 ? 40  LYS A N    15 
ATOM   10178 C  CA   . LYS A 1 40 ? 6.006   8.619   0.102   1.00 0.00 ? 40  LYS A CA   15 
ATOM   10179 C  C    . LYS A 1 40 ? 7.039   9.083   -0.921  1.00 0.00 ? 40  LYS A C    15 
ATOM   10180 O  O    . LYS A 1 40 ? 7.350   10.270  -1.008  1.00 0.00 ? 40  LYS A O    15 
ATOM   10181 C  CB   . LYS A 1 40 ? 6.703   7.884   1.249   1.00 0.00 ? 40  LYS A CB   15 
ATOM   10182 C  CG   . LYS A 1 40 ? 6.004   8.044   2.588   1.00 0.00 ? 40  LYS A CG   15 
ATOM   10183 C  CD   . LYS A 1 40 ? 6.896   7.609   3.738   1.00 0.00 ? 40  LYS A CD   15 
ATOM   10184 C  CE   . LYS A 1 40 ? 6.314   8.020   5.082   1.00 0.00 ? 40  LYS A CE   15 
ATOM   10185 N  NZ   . LYS A 1 40 ? 5.369   6.999   5.613   1.00 0.00 ? 40  LYS A NZ   15 
ATOM   10186 H  H    . LYS A 1 40 ? 4.773   6.909   -0.087  1.00 0.00 ? 40  LYS A H    15 
ATOM   10187 H  HA   . LYS A 1 40 ? 5.496   9.484   0.497   1.00 0.00 ? 40  LYS A HA   15 
ATOM   10188 H  HB2  . LYS A 1 40 ? 6.746   6.831   1.012   1.00 0.00 ? 40  LYS A HB2  15 
ATOM   10189 H  HB3  . LYS A 1 40 ? 7.710   8.264   1.344   1.00 0.00 ? 40  LYS A HB3  15 
ATOM   10190 H  HG2  . LYS A 1 40 ? 5.741   9.083   2.724   1.00 0.00 ? 40  LYS A HG2  15 
ATOM   10191 H  HG3  . LYS A 1 40 ? 5.108   7.440   2.590   1.00 0.00 ? 40  LYS A HG3  15 
ATOM   10192 H  HD2  . LYS A 1 40 ? 6.998   6.534   3.717   1.00 0.00 ? 40  LYS A HD2  15 
ATOM   10193 H  HD3  . LYS A 1 40 ? 7.869   8.067   3.621   1.00 0.00 ? 40  LYS A HD3  15 
ATOM   10194 H  HE2  . LYS A 1 40 ? 7.122   8.150   5.785   1.00 0.00 ? 40  LYS A HE2  15 
ATOM   10195 H  HE3  . LYS A 1 40 ? 5.788   8.956   4.960   1.00 0.00 ? 40  LYS A HE3  15 
ATOM   10196 H  HZ1  . LYS A 1 40 ? 5.421   6.969   6.651   1.00 0.00 ? 40  LYS A HZ1  15 
ATOM   10197 H  HZ2  . LYS A 1 40 ? 5.612   6.059   5.237   1.00 0.00 ? 40  LYS A HZ2  15 
ATOM   10198 H  HZ3  . LYS A 1 40 ? 4.396   7.231   5.330   1.00 0.00 ? 40  LYS A HZ3  15 
ATOM   10199 N  N    . ASN A 1 41 ? 7.566   8.139   -1.693  1.00 0.00 ? 41  ASN A N    15 
ATOM   10200 C  CA   . ASN A 1 41 ? 8.563   8.451   -2.711  1.00 0.00 ? 41  ASN A CA   15 
ATOM   10201 C  C    . ASN A 1 41 ? 7.938   9.231   -3.863  1.00 0.00 ? 41  ASN A C    15 
ATOM   10202 O  O    . ASN A 1 41 ? 6.716   9.297   -3.990  1.00 0.00 ? 41  ASN A O    15 
ATOM   10203 C  CB   . ASN A 1 41 ? 9.204   7.166   -3.238  1.00 0.00 ? 41  ASN A CB   15 
ATOM   10204 C  CG   . ASN A 1 41 ? 10.324  6.670   -2.344  1.00 0.00 ? 41  ASN A CG   15 
ATOM   10205 O  OD1  . ASN A 1 41 ? 10.098  5.879   -1.428  1.00 0.00 ? 41  ASN A OD1  15 
ATOM   10206 N  ND2  . ASN A 1 41 ? 11.541  7.134   -2.607  1.00 0.00 ? 41  ASN A ND2  15 
ATOM   10207 H  H    . ASN A 1 41 ? 7.278   7.209   -1.576  1.00 0.00 ? 41  ASN A H    15 
ATOM   10208 H  HA   . ASN A 1 41 ? 9.326   9.061   -2.250  1.00 0.00 ? 41  ASN A HA   15 
ATOM   10209 H  HB2  . ASN A 1 41 ? 8.451   6.394   -3.300  1.00 0.00 ? 41  ASN A HB2  15 
ATOM   10210 H  HB3  . ASN A 1 41 ? 9.608   7.350   -4.222  1.00 0.00 ? 41  ASN A HB3  15 
ATOM   10211 H  HD21 . ASN A 1 41 ? 11.646  7.761   -3.352  1.00 0.00 ? 41  ASN A HD21 15 
ATOM   10212 H  HD22 . ASN A 1 41 ? 12.283  6.829   -2.045  1.00 0.00 ? 41  ASN A HD22 15 
ATOM   10213 N  N    . GLN A 1 42 ? 8.786   9.820   -4.701  1.00 0.00 ? 42  GLN A N    15 
ATOM   10214 C  CA   . GLN A 1 42 ? 8.316   10.595  -5.843  1.00 0.00 ? 42  GLN A CA   15 
ATOM   10215 C  C    . GLN A 1 42 ? 8.584   9.856   -7.150  1.00 0.00 ? 42  GLN A C    15 
ATOM   10216 O  O    . GLN A 1 42 ? 9.735   9.628   -7.521  1.00 0.00 ? 42  GLN A O    15 
ATOM   10217 C  CB   . GLN A 1 42 ? 8.995   11.965  -5.870  1.00 0.00 ? 42  GLN A CB   15 
ATOM   10218 C  CG   . GLN A 1 42 ? 8.429   12.945  -4.855  1.00 0.00 ? 42  GLN A CG   15 
ATOM   10219 C  CD   . GLN A 1 42 ? 8.419   12.385  -3.446  1.00 0.00 ? 42  GLN A CD   15 
ATOM   10220 O  OE1  . GLN A 1 42 ? 9.470   12.178  -2.841  1.00 0.00 ? 42  GLN A OE1  15 
ATOM   10221 N  NE2  . GLN A 1 42 ? 7.227   12.137  -2.916  1.00 0.00 ? 42  GLN A NE2  15 
ATOM   10222 H  H    . GLN A 1 42 ? 9.749   9.731   -4.547  1.00 0.00 ? 42  GLN A H    15 
ATOM   10223 H  HA   . GLN A 1 42 ? 7.251   10.733  -5.734  1.00 0.00 ? 42  GLN A HA   15 
ATOM   10224 H  HB2  . GLN A 1 42 ? 10.048  11.836  -5.666  1.00 0.00 ? 42  GLN A HB2  15 
ATOM   10225 H  HB3  . GLN A 1 42 ? 8.877   12.393  -6.855  1.00 0.00 ? 42  GLN A HB3  15 
ATOM   10226 H  HG2  . GLN A 1 42 ? 9.031   13.842  -4.865  1.00 0.00 ? 42  GLN A HG2  15 
ATOM   10227 H  HG3  . GLN A 1 42 ? 7.415   13.190  -5.137  1.00 0.00 ? 42  GLN A HG3  15 
ATOM   10228 H  HE21 . GLN A 1 42 ? 6.431   12.325  -3.458  1.00 0.00 ? 42  GLN A HE21 15 
ATOM   10229 H  HE22 . GLN A 1 42 ? 7.191   11.774  -2.008  1.00 0.00 ? 42  GLN A HE22 15 
ATOM   10230 N  N    . ASN A 1 43 ? 7.513   9.482   -7.843  1.00 0.00 ? 43  ASN A N    15 
ATOM   10231 C  CA   . ASN A 1 43 ? 7.633   8.767   -9.109  1.00 0.00 ? 43  ASN A CA   15 
ATOM   10232 C  C    . ASN A 1 43 ? 8.790   9.318   -9.937  1.00 0.00 ? 43  ASN A C    15 
ATOM   10233 O  O    . ASN A 1 43 ? 9.556   8.560   -10.532 1.00 0.00 ? 43  ASN A O    15 
ATOM   10234 C  CB   . ASN A 1 43 ? 6.329   8.871   -9.902  1.00 0.00 ? 43  ASN A CB   15 
ATOM   10235 C  CG   . ASN A 1 43 ? 6.215   7.799   -10.969 1.00 0.00 ? 43  ASN A CG   15 
ATOM   10236 O  OD1  . ASN A 1 43 ? 7.206   7.172   -11.343 1.00 0.00 ? 43  ASN A OD1  15 
ATOM   10237 N  ND2  . ASN A 1 43 ? 5.002   7.585   -11.465 1.00 0.00 ? 43  ASN A ND2  15 
ATOM   10238 H  H    . ASN A 1 43 ? 6.621   9.692   -7.495  1.00 0.00 ? 43  ASN A H    15 
ATOM   10239 H  HA   . ASN A 1 43 ? 7.827   7.729   -8.885  1.00 0.00 ? 43  ASN A HA   15 
ATOM   10240 H  HB2  . ASN A 1 43 ? 5.493   8.767   -9.225  1.00 0.00 ? 43  ASN A HB2  15 
ATOM   10241 H  HB3  . ASN A 1 43 ? 6.281   9.837   -10.381 1.00 0.00 ? 43  ASN A HB3  15 
ATOM   10242 H  HD21 . ASN A 1 43 ? 4.258   8.123   -11.120 1.00 0.00 ? 43  ASN A HD21 15 
ATOM   10243 H  HD22 . ASN A 1 43 ? 4.899   6.898   -12.156 1.00 0.00 ? 43  ASN A HD22 15 
ATOM   10244 N  N    . SER A 1 44 ? 8.910   10.641  -9.970  1.00 0.00 ? 44  SER A N    15 
ATOM   10245 C  CA   . SER A 1 44 ? 9.971   11.293  -10.728 1.00 0.00 ? 44  SER A CA   15 
ATOM   10246 C  C    . SER A 1 44 ? 11.314  11.146  -10.019 1.00 0.00 ? 44  SER A C    15 
ATOM   10247 O  O    . SER A 1 44 ? 11.456  11.507  -8.851  1.00 0.00 ? 44  SER A O    15 
ATOM   10248 C  CB   . SER A 1 44 ? 9.647   12.775  -10.927 1.00 0.00 ? 44  SER A CB   15 
ATOM   10249 O  OG   . SER A 1 44 ? 8.662   12.951  -11.931 1.00 0.00 ? 44  SER A OG   15 
ATOM   10250 H  H    . SER A 1 44 ? 8.267   11.191  -9.475  1.00 0.00 ? 44  SER A H    15 
ATOM   10251 H  HA   . SER A 1 44 ? 10.032  10.814  -11.693 1.00 0.00 ? 44  SER A HA   15 
ATOM   10252 H  HB2  . SER A 1 44 ? 9.278   13.189  -10.001 1.00 0.00 ? 44  SER A HB2  15 
ATOM   10253 H  HB3  . SER A 1 44 ? 10.544  13.300  -11.224 1.00 0.00 ? 44  SER A HB3  15 
ATOM   10254 H  HG   . SER A 1 44 ? 8.522   12.121  -12.391 1.00 0.00 ? 44  SER A HG   15 
ATOM   10255 N  N    . GLY A 1 45 ? 12.299  10.612  -10.735 1.00 0.00 ? 45  GLY A N    15 
ATOM   10256 C  CA   . GLY A 1 45 ? 13.618  10.425  -10.160 1.00 0.00 ? 45  GLY A CA   15 
ATOM   10257 C  C    . GLY A 1 45 ? 14.567  11.556  -10.505 1.00 0.00 ? 45  GLY A C    15 
ATOM   10258 O  O    . GLY A 1 45 ? 14.401  12.692  -10.060 1.00 0.00 ? 45  GLY A O    15 
ATOM   10259 H  H    . GLY A 1 45 ? 12.128  10.343  -11.662 1.00 0.00 ? 45  GLY A H    15 
ATOM   10260 H  HA2  . GLY A 1 45 ? 13.525  10.363  -9.086  1.00 0.00 ? 45  GLY A HA2  15 
ATOM   10261 H  HA3  . GLY A 1 45 ? 14.032  9.499   -10.529 1.00 0.00 ? 45  GLY A HA3  15 
ATOM   10262 N  N    . PRO A 1 46 ? 15.590  11.249  -11.316 1.00 0.00 ? 46  PRO A N    15 
ATOM   10263 C  CA   . PRO A 1 46 ? 16.590  12.234  -11.738 1.00 0.00 ? 46  PRO A CA   15 
ATOM   10264 C  C    . PRO A 1 46 ? 16.013  13.271  -12.696 1.00 0.00 ? 46  PRO A C    15 
ATOM   10265 O  O    . PRO A 1 46 ? 16.696  14.219  -13.084 1.00 0.00 ? 46  PRO A O    15 
ATOM   10266 C  CB   . PRO A 1 46 ? 17.650  11.385  -12.443 1.00 0.00 ? 46  PRO A CB   15 
ATOM   10267 C  CG   . PRO A 1 46 ? 16.916  10.175  -12.911 1.00 0.00 ? 46  PRO A CG   15 
ATOM   10268 C  CD   . PRO A 1 46 ? 15.849  9.915   -11.884 1.00 0.00 ? 46  PRO A CD   15 
ATOM   10269 H  HA   . PRO A 1 46 ? 17.033  12.736  -10.891 1.00 0.00 ? 46  PRO A HA   15 
ATOM   10270 H  HB2  . PRO A 1 46 ? 18.067  11.940  -13.271 1.00 0.00 ? 46  PRO A HB2  15 
ATOM   10271 H  HB3  . PRO A 1 46 ? 18.432  11.126  -11.745 1.00 0.00 ? 46  PRO A HB3  15 
ATOM   10272 H  HG2  . PRO A 1 46 ? 16.470  10.367  -13.875 1.00 0.00 ? 46  PRO A HG2  15 
ATOM   10273 H  HG3  . PRO A 1 46 ? 17.593  9.336   -12.969 1.00 0.00 ? 46  PRO A HG3  15 
ATOM   10274 H  HD2  . PRO A 1 46 ? 14.962  9.517   -12.354 1.00 0.00 ? 46  PRO A HD2  15 
ATOM   10275 H  HD3  . PRO A 1 46 ? 16.212  9.238   -11.126 1.00 0.00 ? 46  PRO A HD3  15 
ATOM   10276 N  N    . SER A 1 47 ? 14.753  13.084  -13.075 1.00 0.00 ? 47  SER A N    15 
ATOM   10277 C  CA   . SER A 1 47 ? 14.086  14.002  -13.991 1.00 0.00 ? 47  SER A CA   15 
ATOM   10278 C  C    . SER A 1 47 ? 13.301  15.061  -13.223 1.00 0.00 ? 47  SER A C    15 
ATOM   10279 O  O    . SER A 1 47 ? 12.963  14.874  -12.054 1.00 0.00 ? 47  SER A O    15 
ATOM   10280 C  CB   . SER A 1 47 ? 13.149  13.233  -14.924 1.00 0.00 ? 47  SER A CB   15 
ATOM   10281 O  OG   . SER A 1 47 ? 13.866  12.645  -15.996 1.00 0.00 ? 47  SER A OG   15 
ATOM   10282 H  H    . SER A 1 47 ? 14.261  12.309  -12.731 1.00 0.00 ? 47  SER A H    15 
ATOM   10283 H  HA   . SER A 1 47 ? 14.846  14.491  -14.581 1.00 0.00 ? 47  SER A HA   15 
ATOM   10284 H  HB2  . SER A 1 47 ? 12.652  12.452  -14.368 1.00 0.00 ? 47  SER A HB2  15 
ATOM   10285 H  HB3  . SER A 1 47 ? 12.412  13.911  -15.329 1.00 0.00 ? 47  SER A HB3  15 
ATOM   10286 H  HG   . SER A 1 47 ? 13.383  12.777  -16.815 1.00 0.00 ? 47  SER A HG   15 
ATOM   10287 N  N    . SER A 1 48 ? 13.014  16.174  -13.890 1.00 0.00 ? 48  SER A N    15 
ATOM   10288 C  CA   . SER A 1 48 ? 12.272  17.266  -13.270 1.00 0.00 ? 48  SER A CA   15 
ATOM   10289 C  C    . SER A 1 48 ? 11.232  17.831  -14.233 1.00 0.00 ? 48  SER A C    15 
ATOM   10290 O  O    . SER A 1 48 ? 11.363  17.706  -15.450 1.00 0.00 ? 48  SER A O    15 
ATOM   10291 C  CB   . SER A 1 48 ? 13.229  18.375  -12.828 1.00 0.00 ? 48  SER A CB   15 
ATOM   10292 O  OG   . SER A 1 48 ? 12.525  19.444  -12.219 1.00 0.00 ? 48  SER A OG   15 
ATOM   10293 H  H    . SER A 1 48 ? 13.310  16.264  -14.820 1.00 0.00 ? 48  SER A H    15 
ATOM   10294 H  HA   . SER A 1 48 ? 11.765  16.872  -12.402 1.00 0.00 ? 48  SER A HA   15 
ATOM   10295 H  HB2  . SER A 1 48 ? 13.936  17.974  -12.117 1.00 0.00 ? 48  SER A HB2  15 
ATOM   10296 H  HB3  . SER A 1 48 ? 13.760  18.753  -13.690 1.00 0.00 ? 48  SER A HB3  15 
ATOM   10297 H  HG   . SER A 1 48 ? 13.043  19.795  -11.491 1.00 0.00 ? 48  SER A HG   15 
ATOM   10298 N  N    . GLY A 1 49 ? 10.197  18.454  -13.677 1.00 0.00 ? 49  GLY A N    15 
ATOM   10299 C  CA   . GLY A 1 49 ? 9.148   19.029  -14.499 1.00 0.00 ? 49  GLY A CA   15 
ATOM   10300 C  C    . GLY A 1 49 ? 8.387   20.128  -13.784 1.00 0.00 ? 49  GLY A C    15 
ATOM   10301 O  O    . GLY A 1 49 ? 8.706   20.426  -12.634 1.00 0.00 ? 49  GLY A O    15 
ATOM   10302 H  H    . GLY A 1 49 ? 10.145  18.524  -12.701 1.00 0.00 ? 49  GLY A H    15 
ATOM   10303 H  HA2  . GLY A 1 49 ? 9.592   19.437  -15.395 1.00 0.00 ? 49  GLY A HA2  15 
ATOM   10304 H  HA3  . GLY A 1 49 ? 8.455   18.249  -14.776 1.00 0.00 ? 49  GLY A HA3  15 
HETATM 10305 ZN ZN   . ZN  B 2 .  ? 2.753   -4.772  1.823   1.00 0.00 ? 201 ZN  A ZN   15 
ATOM   10306 N  N    . GLY A 1 1  ? -15.145 12.470  0.046   1.00 0.00 ? 1   GLY A N    16 
ATOM   10307 C  CA   . GLY A 1 1  ? -14.616 11.693  -1.060  1.00 0.00 ? 1   GLY A CA   16 
ATOM   10308 C  C    . GLY A 1 1  ? -15.694 10.923  -1.796  1.00 0.00 ? 1   GLY A C    16 
ATOM   10309 O  O    . GLY A 1 1  ? -16.753 10.637  -1.237  1.00 0.00 ? 1   GLY A O    16 
ATOM   10310 H  H1   . GLY A 1 1  ? -15.867 13.113  -0.112  1.00 0.00 ? 1   GLY A H1   16 
ATOM   10311 H  HA2  . GLY A 1 1  ? -14.128 12.361  -1.754  1.00 0.00 ? 1   GLY A HA2  16 
ATOM   10312 H  HA3  . GLY A 1 1  ? -13.888 10.993  -0.677  1.00 0.00 ? 1   GLY A HA3  16 
ATOM   10313 N  N    . SER A 1 2  ? -15.426 10.586  -3.053  1.00 0.00 ? 2   SER A N    16 
ATOM   10314 C  CA   . SER A 1 2  ? -16.385 9.849   -3.869  1.00 0.00 ? 2   SER A CA   16 
ATOM   10315 C  C    . SER A 1 2  ? -17.001 8.700   -3.077  1.00 0.00 ? 2   SER A C    16 
ATOM   10316 O  O    . SER A 1 2  ? -18.221 8.539   -3.043  1.00 0.00 ? 2   SER A O    16 
ATOM   10317 C  CB   . SER A 1 2  ? -15.705 9.309   -5.129  1.00 0.00 ? 2   SER A CB   16 
ATOM   10318 O  OG   . SER A 1 2  ? -15.571 10.322  -6.110  1.00 0.00 ? 2   SER A OG   16 
ATOM   10319 H  H    . SER A 1 2  ? -14.564 10.843  -3.443  1.00 0.00 ? 2   SER A H    16 
ATOM   10320 H  HA   . SER A 1 2  ? -17.169 10.533  -4.158  1.00 0.00 ? 2   SER A HA   16 
ATOM   10321 H  HB2  . SER A 1 2  ? -14.724 8.939   -4.875  1.00 0.00 ? 2   SER A HB2  16 
ATOM   10322 H  HB3  . SER A 1 2  ? -16.299 8.504   -5.537  1.00 0.00 ? 2   SER A HB3  16 
ATOM   10323 H  HG   . SER A 1 2  ? -14.640 10.502  -6.261  1.00 0.00 ? 2   SER A HG   16 
ATOM   10324 N  N    . SER A 1 3  ? -16.148 7.904   -2.440  1.00 0.00 ? 3   SER A N    16 
ATOM   10325 C  CA   . SER A 1 3  ? -16.607 6.767   -1.651  1.00 0.00 ? 3   SER A CA   16 
ATOM   10326 C  C    . SER A 1 3  ? -16.167 6.902   -0.197  1.00 0.00 ? 3   SER A C    16 
ATOM   10327 O  O    . SER A 1 3  ? -15.044 7.317   0.088   1.00 0.00 ? 3   SER A O    16 
ATOM   10328 C  CB   . SER A 1 3  ? -16.069 5.461   -2.239  1.00 0.00 ? 3   SER A CB   16 
ATOM   10329 O  OG   . SER A 1 3  ? -16.788 5.092   -3.404  1.00 0.00 ? 3   SER A OG   16 
ATOM   10330 H  H    . SER A 1 3  ? -15.186 8.084   -2.505  1.00 0.00 ? 3   SER A H    16 
ATOM   10331 H  HA   . SER A 1 3  ? -17.686 6.751   -1.689  1.00 0.00 ? 3   SER A HA   16 
ATOM   10332 H  HB2  . SER A 1 3  ? -15.029 5.587   -2.498  1.00 0.00 ? 3   SER A HB2  16 
ATOM   10333 H  HB3  . SER A 1 3  ? -16.165 4.673   -1.506  1.00 0.00 ? 3   SER A HB3  16 
ATOM   10334 H  HG   . SER A 1 3  ? -17.309 4.306   -3.223  1.00 0.00 ? 3   SER A HG   16 
ATOM   10335 N  N    . GLY A 1 4  ? -17.061 6.548   0.721   1.00 0.00 ? 4   GLY A N    16 
ATOM   10336 C  CA   . GLY A 1 4  ? -16.748 6.636   2.135   1.00 0.00 ? 4   GLY A CA   16 
ATOM   10337 C  C    . GLY A 1 4  ? -16.700 5.277   2.805   1.00 0.00 ? 4   GLY A C    16 
ATOM   10338 O  O    . GLY A 1 4  ? -17.725 4.760   3.248   1.00 0.00 ? 4   GLY A O    16 
ATOM   10339 H  H    . GLY A 1 4  ? -17.941 6.224   0.436   1.00 0.00 ? 4   GLY A H    16 
ATOM   10340 H  HA2  . GLY A 1 4  ? -15.788 7.117   2.251   1.00 0.00 ? 4   GLY A HA2  16 
ATOM   10341 H  HA3  . GLY A 1 4  ? -17.502 7.238   2.622   1.00 0.00 ? 4   GLY A HA3  16 
ATOM   10342 N  N    . SER A 1 5  ? -15.506 4.697   2.877   1.00 0.00 ? 5   SER A N    16 
ATOM   10343 C  CA   . SER A 1 5  ? -15.330 3.387   3.492   1.00 0.00 ? 5   SER A CA   16 
ATOM   10344 C  C    . SER A 1 5  ? -13.987 3.301   4.212   1.00 0.00 ? 5   SER A C    16 
ATOM   10345 O  O    . SER A 1 5  ? -12.934 3.509   3.611   1.00 0.00 ? 5   SER A O    16 
ATOM   10346 C  CB   . SER A 1 5  ? -15.425 2.286   2.434   1.00 0.00 ? 5   SER A CB   16 
ATOM   10347 O  OG   . SER A 1 5  ? -15.928 1.084   2.993   1.00 0.00 ? 5   SER A OG   16 
ATOM   10348 H  H    . SER A 1 5  ? -14.727 5.160   2.505   1.00 0.00 ? 5   SER A H    16 
ATOM   10349 H  HA   . SER A 1 5  ? -16.121 3.250   4.214   1.00 0.00 ? 5   SER A HA   16 
ATOM   10350 H  HB2  . SER A 1 5  ? -16.087 2.606   1.644   1.00 0.00 ? 5   SER A HB2  16 
ATOM   10351 H  HB3  . SER A 1 5  ? -14.443 2.096   2.027   1.00 0.00 ? 5   SER A HB3  16 
ATOM   10352 H  HG   . SER A 1 5  ? -15.425 0.862   3.780   1.00 0.00 ? 5   SER A HG   16 
ATOM   10353 N  N    . SER A 1 6  ? -14.034 2.993   5.504   1.00 0.00 ? 6   SER A N    16 
ATOM   10354 C  CA   . SER A 1 6  ? -12.823 2.883   6.308   1.00 0.00 ? 6   SER A CA   16 
ATOM   10355 C  C    . SER A 1 6  ? -12.059 1.607   5.969   1.00 0.00 ? 6   SER A C    16 
ATOM   10356 O  O    . SER A 1 6  ? -12.530 0.500   6.229   1.00 0.00 ? 6   SER A O    16 
ATOM   10357 C  CB   . SER A 1 6  ? -13.171 2.901   7.798   1.00 0.00 ? 6   SER A CB   16 
ATOM   10358 O  OG   . SER A 1 6  ? -13.507 4.209   8.227   1.00 0.00 ? 6   SER A OG   16 
ATOM   10359 H  H    . SER A 1 6  ? -14.905 2.838   5.927   1.00 0.00 ? 6   SER A H    16 
ATOM   10360 H  HA   . SER A 1 6  ? -12.197 3.734   6.083   1.00 0.00 ? 6   SER A HA   16 
ATOM   10361 H  HB2  . SER A 1 6  ? -14.012 2.250   7.977   1.00 0.00 ? 6   SER A HB2  16 
ATOM   10362 H  HB3  . SER A 1 6  ? -12.320 2.556   8.368   1.00 0.00 ? 6   SER A HB3  16 
ATOM   10363 H  HG   . SER A 1 6  ? -14.391 4.207   8.600   1.00 0.00 ? 6   SER A HG   16 
ATOM   10364 N  N    . GLY A 1 7  ? -10.875 1.770   5.385   1.00 0.00 ? 7   GLY A N    16 
ATOM   10365 C  CA   . GLY A 1 7  ? -10.064 0.624   5.018   1.00 0.00 ? 7   GLY A CA   16 
ATOM   10366 C  C    . GLY A 1 7  ? -10.091 -0.466  6.071   1.00 0.00 ? 7   GLY A C    16 
ATOM   10367 O  O    . GLY A 1 7  ? -10.270 -0.188  7.257   1.00 0.00 ? 7   GLY A O    16 
ATOM   10368 H  H    . GLY A 1 7  ? -10.550 2.677   5.202   1.00 0.00 ? 7   GLY A H    16 
ATOM   10369 H  HA2  . GLY A 1 7  ? -10.432 0.220   4.087   1.00 0.00 ? 7   GLY A HA2  16 
ATOM   10370 H  HA3  . GLY A 1 7  ? -9.044  0.950   4.880   1.00 0.00 ? 7   GLY A HA3  16 
ATOM   10371 N  N    . SER A 1 8  ? -9.915  -1.710  5.638   1.00 0.00 ? 8   SER A N    16 
ATOM   10372 C  CA   . SER A 1 8  ? -9.925  -2.846  6.551   1.00 0.00 ? 8   SER A CA   16 
ATOM   10373 C  C    . SER A 1 8  ? -9.009  -3.957  6.047   1.00 0.00 ? 8   SER A C    16 
ATOM   10374 O  O    . SER A 1 8  ? -9.181  -4.465  4.938   1.00 0.00 ? 8   SER A O    16 
ATOM   10375 C  CB   . SER A 1 8  ? -11.349 -3.381  6.718   1.00 0.00 ? 8   SER A CB   16 
ATOM   10376 O  OG   . SER A 1 8  ? -11.457 -4.194  7.873   1.00 0.00 ? 8   SER A OG   16 
ATOM   10377 H  H    . SER A 1 8  ? -9.777  -1.867  4.680   1.00 0.00 ? 8   SER A H    16 
ATOM   10378 H  HA   . SER A 1 8  ? -9.564  -2.505  7.510   1.00 0.00 ? 8   SER A HA   16 
ATOM   10379 H  HB2  . SER A 1 8  ? -12.034 -2.551  6.811   1.00 0.00 ? 8   SER A HB2  16 
ATOM   10380 H  HB3  . SER A 1 8  ? -11.613 -3.970  5.852   1.00 0.00 ? 8   SER A HB3  16 
ATOM   10381 H  HG   . SER A 1 8  ? -11.113 -3.718  8.633   1.00 0.00 ? 8   SER A HG   16 
ATOM   10382 N  N    . LEU A 1 9  ? -8.034  -4.330  6.869   1.00 0.00 ? 9   LEU A N    16 
ATOM   10383 C  CA   . LEU A 1 9  ? -7.089  -5.381  6.508   1.00 0.00 ? 9   LEU A CA   16 
ATOM   10384 C  C    . LEU A 1 9  ? -7.818  -6.680  6.181   1.00 0.00 ? 9   LEU A C    16 
ATOM   10385 O  O    . LEU A 1 9  ? -8.285  -7.384  7.076   1.00 0.00 ? 9   LEU A O    16 
ATOM   10386 C  CB   . LEU A 1 9  ? -6.095  -5.613  7.648   1.00 0.00 ? 9   LEU A CB   16 
ATOM   10387 C  CG   . LEU A 1 9  ? -5.046  -4.521  7.856   1.00 0.00 ? 9   LEU A CG   16 
ATOM   10388 C  CD1  . LEU A 1 9  ? -4.297  -4.743  9.161   1.00 0.00 ? 9   LEU A CD1  16 
ATOM   10389 C  CD2  . LEU A 1 9  ? -4.077  -4.481  6.683   1.00 0.00 ? 9   LEU A CD2  16 
ATOM   10390 H  H    . LEU A 1 9  ? -7.948  -3.889  7.739   1.00 0.00 ? 9   LEU A H    16 
ATOM   10391 H  HA   . LEU A 1 9  ? -6.550  -5.054  5.632   1.00 0.00 ? 9   LEU A HA   16 
ATOM   10392 H  HB2  . LEU A 1 9  ? -6.659  -5.709  8.563   1.00 0.00 ? 9   LEU A HB2  16 
ATOM   10393 H  HB3  . LEU A 1 9  ? -5.575  -6.540  7.448   1.00 0.00 ? 9   LEU A HB3  16 
ATOM   10394 H  HG   . LEU A 1 9  ? -5.541  -3.562  7.915   1.00 0.00 ? 9   LEU A HG   16 
ATOM   10395 H  HD11 . LEU A 1 9  ? -3.441  -4.086  9.200   1.00 0.00 ? 9   LEU A HD11 16 
ATOM   10396 H  HD12 . LEU A 1 9  ? -3.966  -5.769  9.216   1.00 0.00 ? 9   LEU A HD12 16 
ATOM   10397 H  HD13 . LEU A 1 9  ? -4.953  -4.531  9.993   1.00 0.00 ? 9   LEU A HD13 16 
ATOM   10398 H  HD21 . LEU A 1 9  ? -4.152  -3.525  6.187   1.00 0.00 ? 9   LEU A HD21 16 
ATOM   10399 H  HD22 . LEU A 1 9  ? -4.324  -5.269  5.987   1.00 0.00 ? 9   LEU A HD22 16 
ATOM   10400 H  HD23 . LEU A 1 9  ? -3.069  -4.623  7.044   1.00 0.00 ? 9   LEU A HD23 16 
ATOM   10401 N  N    . MET A 1 10 ? -7.910  -6.993  4.893   1.00 0.00 ? 10  MET A N    16 
ATOM   10402 C  CA   . MET A 1 10 ? -8.579  -8.210  4.448   1.00 0.00 ? 10  MET A CA   16 
ATOM   10403 C  C    . MET A 1 10 ? -7.711  -9.436  4.713   1.00 0.00 ? 10  MET A C    16 
ATOM   10404 O  O    . MET A 1 10 ? -6.565  -9.314  5.147   1.00 0.00 ? 10  MET A O    16 
ATOM   10405 C  CB   . MET A 1 10 ? -8.912  -8.119  2.957   1.00 0.00 ? 10  MET A CB   16 
ATOM   10406 C  CG   . MET A 1 10 ? -9.682  -6.863  2.582   1.00 0.00 ? 10  MET A CG   16 
ATOM   10407 S  SD   . MET A 1 10 ? -10.804 -7.125  1.196   1.00 0.00 ? 10  MET A SD   16 
ATOM   10408 C  CE   . MET A 1 10 ? -9.650  -7.597  -0.090  1.00 0.00 ? 10  MET A CE   16 
ATOM   10409 H  H    . MET A 1 10 ? -7.518  -6.392  4.225   1.00 0.00 ? 10  MET A H    16 
ATOM   10410 H  HA   . MET A 1 10 ? -9.498  -8.306  5.007   1.00 0.00 ? 10  MET A HA   16 
ATOM   10411 H  HB2  . MET A 1 10 ? -7.991  -8.132  2.394   1.00 0.00 ? 10  MET A HB2  16 
ATOM   10412 H  HB3  . MET A 1 10 ? -9.507  -8.976  2.680   1.00 0.00 ? 10  MET A HB3  16 
ATOM   10413 H  HG2  . MET A 1 10 ? -10.258 -6.541  3.437   1.00 0.00 ? 10  MET A HG2  16 
ATOM   10414 H  HG3  . MET A 1 10 ? -8.975  -6.091  2.315   1.00 0.00 ? 10  MET A HG3  16 
ATOM   10415 H  HE1  . MET A 1 10 ? -10.161 -8.196  -0.830  1.00 0.00 ? 10  MET A HE1  16 
ATOM   10416 H  HE2  . MET A 1 10 ? -9.250  -6.710  -0.558  1.00 0.00 ? 10  MET A HE2  16 
ATOM   10417 H  HE3  . MET A 1 10 ? -8.844  -8.171  0.343   1.00 0.00 ? 10  MET A HE3  16 
ATOM   10418 N  N    . ASP A 1 11 ? -8.264  -10.615 4.451   1.00 0.00 ? 11  ASP A N    16 
ATOM   10419 C  CA   . ASP A 1 11 ? -7.540  -11.863 4.660   1.00 0.00 ? 11  ASP A CA   16 
ATOM   10420 C  C    . ASP A 1 11 ? -6.658  -12.188 3.459   1.00 0.00 ? 11  ASP A C    16 
ATOM   10421 O  O    . ASP A 1 11 ? -6.120  -13.290 3.350   1.00 0.00 ? 11  ASP A O    16 
ATOM   10422 C  CB   . ASP A 1 11 ? -8.519  -13.009 4.915   1.00 0.00 ? 11  ASP A CB   16 
ATOM   10423 C  CG   . ASP A 1 11 ? -9.532  -13.165 3.797   1.00 0.00 ? 11  ASP A CG   16 
ATOM   10424 O  OD1  . ASP A 1 11 ? -9.192  -12.843 2.639   1.00 0.00 ? 11  ASP A OD1  16 
ATOM   10425 O  OD2  . ASP A 1 11 ? -10.664 -13.609 4.080   1.00 0.00 ? 11  ASP A OD2  16 
ATOM   10426 H  H    . ASP A 1 11 ? -9.182  -10.646 4.107   1.00 0.00 ? 11  ASP A H    16 
ATOM   10427 H  HA   . ASP A 1 11 ? -6.911  -11.739 5.529   1.00 0.00 ? 11  ASP A HA   16 
ATOM   10428 H  HB2  . ASP A 1 11 ? -7.967  -13.933 5.006   1.00 0.00 ? 11  ASP A HB2  16 
ATOM   10429 H  HB3  . ASP A 1 11 ? -9.052  -12.821 5.836   1.00 0.00 ? 11  ASP A HB3  16 
ATOM   10430 N  N    . VAL A 1 12 ? -6.515  -11.222 2.557   1.00 0.00 ? 12  VAL A N    16 
ATOM   10431 C  CA   . VAL A 1 12 ? -5.699  -11.405 1.363   1.00 0.00 ? 12  VAL A CA   16 
ATOM   10432 C  C    . VAL A 1 12 ? -4.282  -10.886 1.581   1.00 0.00 ? 12  VAL A C    16 
ATOM   10433 O  O    . VAL A 1 12 ? -4.084  -9.779  2.082   1.00 0.00 ? 12  VAL A O    16 
ATOM   10434 C  CB   . VAL A 1 12 ? -6.315  -10.688 0.147   1.00 0.00 ? 12  VAL A CB   16 
ATOM   10435 C  CG1  . VAL A 1 12 ? -5.500  -10.967 -1.107  1.00 0.00 ? 12  VAL A CG1  16 
ATOM   10436 C  CG2  . VAL A 1 12 ? -7.764  -11.111 -0.044  1.00 0.00 ? 12  VAL A CG2  16 
ATOM   10437 H  H    . VAL A 1 12 ? -6.969  -10.365 2.699   1.00 0.00 ? 12  VAL A H    16 
ATOM   10438 H  HA   . VAL A 1 12 ? -5.656  -12.462 1.147   1.00 0.00 ? 12  VAL A HA   16 
ATOM   10439 H  HB   . VAL A 1 12 ? -6.295  -9.624  0.333   1.00 0.00 ? 12  VAL A HB   16 
ATOM   10440 H  HG11 . VAL A 1 12 ? -5.962  -11.769 -1.665  1.00 0.00 ? 12  VAL A HG11 16 
ATOM   10441 H  HG12 . VAL A 1 12 ? -5.463  -10.077 -1.718  1.00 0.00 ? 12  VAL A HG12 16 
ATOM   10442 H  HG13 . VAL A 1 12 ? -4.498  -11.254 -0.828  1.00 0.00 ? 12  VAL A HG13 16 
ATOM   10443 H  HG21 . VAL A 1 12 ? -8.418  -10.315 0.280   1.00 0.00 ? 12  VAL A HG21 16 
ATOM   10444 H  HG22 . VAL A 1 12 ? -7.942  -11.323 -1.087  1.00 0.00 ? 12  VAL A HG22 16 
ATOM   10445 H  HG23 . VAL A 1 12 ? -7.960  -11.998 0.542   1.00 0.00 ? 12  VAL A HG23 16 
ATOM   10446 N  N    . LYS A 1 13 ? -3.298  -11.694 1.200   1.00 0.00 ? 13  LYS A N    16 
ATOM   10447 C  CA   . LYS A 1 13 ? -1.897  -11.317 1.352   1.00 0.00 ? 13  LYS A CA   16 
ATOM   10448 C  C    . LYS A 1 13 ? -1.559  -10.116 0.475   1.00 0.00 ? 13  LYS A C    16 
ATOM   10449 O  O    . LYS A 1 13 ? -2.143  -9.929  -0.593  1.00 0.00 ? 13  LYS A O    16 
ATOM   10450 C  CB   . LYS A 1 13 ? -0.990  -12.496 0.992   1.00 0.00 ? 13  LYS A CB   16 
ATOM   10451 C  CG   . LYS A 1 13 ? -0.798  -13.485 2.129   1.00 0.00 ? 13  LYS A CG   16 
ATOM   10452 C  CD   . LYS A 1 13 ? -1.925  -14.503 2.178   1.00 0.00 ? 13  LYS A CD   16 
ATOM   10453 C  CE   . LYS A 1 13 ? -1.762  -15.568 1.105   1.00 0.00 ? 13  LYS A CE   16 
ATOM   10454 N  NZ   . LYS A 1 13 ? -2.794  -16.635 1.221   1.00 0.00 ? 13  LYS A NZ   16 
ATOM   10455 H  H    . LYS A 1 13 ? -3.519  -12.564 0.807   1.00 0.00 ? 13  LYS A H    16 
ATOM   10456 H  HA   . LYS A 1 13 ? -1.735  -11.051 2.385   1.00 0.00 ? 13  LYS A HA   16 
ATOM   10457 H  HB2  . LYS A 1 13 ? -1.419  -13.022 0.153   1.00 0.00 ? 13  LYS A HB2  16 
ATOM   10458 H  HB3  . LYS A 1 13 ? -0.019  -12.114 0.708   1.00 0.00 ? 13  LYS A HB3  16 
ATOM   10459 H  HG2  . LYS A 1 13 ? 0.137   -14.006 1.987   1.00 0.00 ? 13  LYS A HG2  16 
ATOM   10460 H  HG3  . LYS A 1 13 ? -0.773  -12.944 3.064   1.00 0.00 ? 13  LYS A HG3  16 
ATOM   10461 H  HD2  . LYS A 1 13 ? -1.925  -14.981 3.146   1.00 0.00 ? 13  LYS A HD2  16 
ATOM   10462 H  HD3  . LYS A 1 13 ? -2.866  -13.992 2.026   1.00 0.00 ? 13  LYS A HD3  16 
ATOM   10463 H  HE2  . LYS A 1 13 ? -1.847  -15.100 0.136   1.00 0.00 ? 13  LYS A HE2  16 
ATOM   10464 H  HE3  . LYS A 1 13 ? -0.783  -16.013 1.204   1.00 0.00 ? 13  LYS A HE3  16 
ATOM   10465 H  HZ1  . LYS A 1 13 ? -3.406  -16.633 0.380   1.00 0.00 ? 13  LYS A HZ1  16 
ATOM   10466 H  HZ2  . LYS A 1 13 ? -3.381  -16.474 2.064   1.00 0.00 ? 13  LYS A HZ2  16 
ATOM   10467 H  HZ3  . LYS A 1 13 ? -2.338  -17.566 1.302   1.00 0.00 ? 13  LYS A HZ3  16 
ATOM   10468 N  N    . CYS A 1 14 ? -0.612  -9.304  0.932   1.00 0.00 ? 14  CYS A N    16 
ATOM   10469 C  CA   . CYS A 1 14 ? -0.194  -8.120  0.190   1.00 0.00 ? 14  CYS A CA   16 
ATOM   10470 C  C    . CYS A 1 14 ? 0.306   -8.499  -1.201  1.00 0.00 ? 14  CYS A C    16 
ATOM   10471 O  O    . CYS A 1 14 ? 0.959   -9.527  -1.377  1.00 0.00 ? 14  CYS A O    16 
ATOM   10472 C  CB   . CYS A 1 14 ? 0.902   -7.374  0.953   1.00 0.00 ? 14  CYS A CB   16 
ATOM   10473 S  SG   . CYS A 1 14 ? 1.587   -5.942  0.060   1.00 0.00 ? 14  CYS A SG   16 
ATOM   10474 H  H    . CYS A 1 14 ? -0.182  -9.505  1.791   1.00 0.00 ? 14  CYS A H    16 
ATOM   10475 H  HA   . CYS A 1 14 ? -1.052  -7.474  0.087   1.00 0.00 ? 14  CYS A HA   16 
ATOM   10476 H  HB2  . CYS A 1 14 ? 0.498   -7.015  1.888   1.00 0.00 ? 14  CYS A HB2  16 
ATOM   10477 H  HB3  . CYS A 1 14 ? 1.716   -8.055  1.156   1.00 0.00 ? 14  CYS A HB3  16 
ATOM   10478 N  N    . GLU A 1 15 ? -0.005  -7.661  -2.184  1.00 0.00 ? 15  GLU A N    16 
ATOM   10479 C  CA   . GLU A 1 15 ? 0.413   -7.908  -3.559  1.00 0.00 ? 15  GLU A CA   16 
ATOM   10480 C  C    . GLU A 1 15 ? 1.787   -8.571  -3.599  1.00 0.00 ? 15  GLU A C    16 
ATOM   10481 O  O    . GLU A 1 15 ? 1.933   -9.696  -4.079  1.00 0.00 ? 15  GLU A O    16 
ATOM   10482 C  CB   . GLU A 1 15 ? 0.443   -6.599  -4.350  1.00 0.00 ? 15  GLU A CB   16 
ATOM   10483 C  CG   . GLU A 1 15 ? 0.537   -6.798  -5.854  1.00 0.00 ? 15  GLU A CG   16 
ATOM   10484 C  CD   . GLU A 1 15 ? 1.967   -6.958  -6.332  1.00 0.00 ? 15  GLU A CD   16 
ATOM   10485 O  OE1  . GLU A 1 15 ? 2.767   -6.020  -6.132  1.00 0.00 ? 15  GLU A OE1  16 
ATOM   10486 O  OE2  . GLU A 1 15 ? 2.286   -8.020  -6.906  1.00 0.00 ? 15  GLU A OE2  16 
ATOM   10487 H  H    . GLU A 1 15 ? -0.528  -6.857  -1.981  1.00 0.00 ? 15  GLU A H    16 
ATOM   10488 H  HA   . GLU A 1 15 ? -0.308  -8.574  -4.010  1.00 0.00 ? 15  GLU A HA   16 
ATOM   10489 H  HB2  . GLU A 1 15 ? -0.459  -6.043  -4.137  1.00 0.00 ? 15  GLU A HB2  16 
ATOM   10490 H  HB3  . GLU A 1 15 ? 1.296   -6.019  -4.031  1.00 0.00 ? 15  GLU A HB3  16 
ATOM   10491 H  HG2  . GLU A 1 15 ? -0.017  -7.685  -6.122  1.00 0.00 ? 15  GLU A HG2  16 
ATOM   10492 H  HG3  . GLU A 1 15 ? 0.102   -5.941  -6.346  1.00 0.00 ? 15  GLU A HG3  16 
ATOM   10493 N  N    . THR A 1 16 ? 2.793   -7.865  -3.092  1.00 0.00 ? 16  THR A N    16 
ATOM   10494 C  CA   . THR A 1 16 ? 4.155   -8.383  -3.071  1.00 0.00 ? 16  THR A CA   16 
ATOM   10495 C  C    . THR A 1 16 ? 4.207   -9.769  -2.441  1.00 0.00 ? 16  THR A C    16 
ATOM   10496 O  O    . THR A 1 16 ? 3.769   -9.980  -1.310  1.00 0.00 ? 16  THR A O    16 
ATOM   10497 C  CB   . THR A 1 16 ? 5.101   -7.444  -2.298  1.00 0.00 ? 16  THR A CB   16 
ATOM   10498 O  OG1  . THR A 1 16 ? 5.077   -6.136  -2.881  1.00 0.00 ? 16  THR A OG1  16 
ATOM   10499 C  CG2  . THR A 1 16 ? 6.523   -7.983  -2.305  1.00 0.00 ? 16  THR A CG2  16 
ATOM   10500 H  H    . THR A 1 16 ? 2.613   -6.975  -2.725  1.00 0.00 ? 16  THR A H    16 
ATOM   10501 H  HA   . THR A 1 16 ? 4.503   -8.448  -4.092  1.00 0.00 ? 16  THR A HA   16 
ATOM   10502 H  HB   . THR A 1 16 ? 4.761   -7.380  -1.274  1.00 0.00 ? 16  THR A HB   16 
ATOM   10503 H  HG1  . THR A 1 16 ? 4.436   -5.591  -2.419  1.00 0.00 ? 16  THR A HG1  16 
ATOM   10504 H  HG21 . THR A 1 16 ? 6.555   -8.904  -2.867  1.00 0.00 ? 16  THR A HG21 16 
ATOM   10505 H  HG22 . THR A 1 16 ? 6.843   -8.168  -1.291  1.00 0.00 ? 16  THR A HG22 16 
ATOM   10506 H  HG23 . THR A 1 16 ? 7.180   -7.259  -2.764  1.00 0.00 ? 16  THR A HG23 16 
ATOM   10507 N  N    . PRO A 1 17 ? 4.755   -10.740 -3.187  1.00 0.00 ? 17  PRO A N    16 
ATOM   10508 C  CA   . PRO A 1 17 ? 4.878   -12.124 -2.720  1.00 0.00 ? 17  PRO A CA   16 
ATOM   10509 C  C    . PRO A 1 17 ? 5.904   -12.269 -1.602  1.00 0.00 ? 17  PRO A C    16 
ATOM   10510 O  O    . PRO A 1 17 ? 6.149   -13.370 -1.111  1.00 0.00 ? 17  PRO A O    16 
ATOM   10511 C  CB   . PRO A 1 17 ? 5.337   -12.880 -3.970  1.00 0.00 ? 17  PRO A CB   16 
ATOM   10512 C  CG   . PRO A 1 17 ? 6.020   -11.853 -4.804  1.00 0.00 ? 17  PRO A CG   16 
ATOM   10513 C  CD   . PRO A 1 17 ? 5.297   -10.560 -4.544  1.00 0.00 ? 17  PRO A CD   16 
ATOM   10514 H  HA   . PRO A 1 17 ? 3.928   -12.516 -2.389  1.00 0.00 ? 17  PRO A HA   16 
ATOM   10515 H  HB2  . PRO A 1 17 ? 6.014   -13.673 -3.685  1.00 0.00 ? 17  PRO A HB2  16 
ATOM   10516 H  HB3  . PRO A 1 17 ? 4.481   -13.296 -4.478  1.00 0.00 ? 17  PRO A HB3  16 
ATOM   10517 H  HG2  . PRO A 1 17 ? 7.055   -11.769 -4.510  1.00 0.00 ? 17  PRO A HG2  16 
ATOM   10518 H  HG3  . PRO A 1 17 ? 5.946   -12.120 -5.848  1.00 0.00 ? 17  PRO A HG3  16 
ATOM   10519 H  HD2  . PRO A 1 17 ? 5.986   -9.729  -4.577  1.00 0.00 ? 17  PRO A HD2  16 
ATOM   10520 H  HD3  . PRO A 1 17 ? 4.502   -10.422 -5.262  1.00 0.00 ? 17  PRO A HD3  16 
ATOM   10521 N  N    . ASN A 1 18 ? 6.501   -11.151 -1.204  1.00 0.00 ? 18  ASN A N    16 
ATOM   10522 C  CA   . ASN A 1 18 ? 7.502   -11.154 -0.143  1.00 0.00 ? 18  ASN A CA   16 
ATOM   10523 C  C    . ASN A 1 18 ? 6.976   -10.449 1.103   1.00 0.00 ? 18  ASN A C    16 
ATOM   10524 O  O    . ASN A 1 18 ? 7.555   -10.559 2.184   1.00 0.00 ? 18  ASN A O    16 
ATOM   10525 C  CB   . ASN A 1 18 ? 8.787   -10.476 -0.623  1.00 0.00 ? 18  ASN A CB   16 
ATOM   10526 C  CG   . ASN A 1 18 ? 9.991   -10.863 0.213   1.00 0.00 ? 18  ASN A CG   16 
ATOM   10527 O  OD1  . ASN A 1 18 ? 10.216  -12.041 0.491   1.00 0.00 ? 18  ASN A OD1  16 
ATOM   10528 N  ND2  . ASN A 1 18 ? 10.773  -9.869  0.619   1.00 0.00 ? 18  ASN A ND2  16 
ATOM   10529 H  H    . ASN A 1 18 ? 6.264   -10.302 -1.634  1.00 0.00 ? 18  ASN A H    16 
ATOM   10530 H  HA   . ASN A 1 18 ? 7.719   -12.183 0.104   1.00 0.00 ? 18  ASN A HA   16 
ATOM   10531 H  HB2  . ASN A 1 18 ? 8.977   -10.763 -1.647  1.00 0.00 ? 18  ASN A HB2  16 
ATOM   10532 H  HB3  . ASN A 1 18 ? 8.663   -9.405  -0.570  1.00 0.00 ? 18  ASN A HB3  16 
ATOM   10533 H  HD21 . ASN A 1 18 ? 10.533  -8.955  0.360   1.00 0.00 ? 18  ASN A HD21 16 
ATOM   10534 H  HD22 . ASN A 1 18 ? 11.560  -10.091 1.161   1.00 0.00 ? 18  ASN A HD22 16 
ATOM   10535 N  N    . CYS A 1 19 ? 5.874   -9.723  0.945   1.00 0.00 ? 19  CYS A N    16 
ATOM   10536 C  CA   . CYS A 1 19 ? 5.269   -8.999  2.056   1.00 0.00 ? 19  CYS A CA   16 
ATOM   10537 C  C    . CYS A 1 19 ? 4.250   -9.871  2.784   1.00 0.00 ? 19  CYS A C    16 
ATOM   10538 O  O    . CYS A 1 19 ? 3.177   -10.181 2.265   1.00 0.00 ? 19  CYS A O    16 
ATOM   10539 C  CB   . CYS A 1 19 ? 4.594   -7.721  1.552   1.00 0.00 ? 19  CYS A CB   16 
ATOM   10540 S  SG   . CYS A 1 19 ? 4.133   -6.554  2.872   1.00 0.00 ? 19  CYS A SG   16 
ATOM   10541 H  H    . CYS A 1 19 ? 5.458   -9.673  0.058   1.00 0.00 ? 19  CYS A H    16 
ATOM   10542 H  HA   . CYS A 1 19 ? 6.054   -8.732  2.746   1.00 0.00 ? 19  CYS A HA   16 
ATOM   10543 H  HB2  . CYS A 1 19 ? 5.268   -7.208  0.881   1.00 0.00 ? 19  CYS A HB2  16 
ATOM   10544 H  HB3  . CYS A 1 19 ? 3.694   -7.985  1.017   1.00 0.00 ? 19  CYS A HB3  16 
ATOM   10545 N  N    . PRO A 1 20 ? 4.593   -10.278 4.015   1.00 0.00 ? 20  PRO A N    16 
ATOM   10546 C  CA   . PRO A 1 20 ? 3.722   -11.120 4.841   1.00 0.00 ? 20  PRO A CA   16 
ATOM   10547 C  C    . PRO A 1 20 ? 2.484   -10.374 5.326   1.00 0.00 ? 20  PRO A C    16 
ATOM   10548 O  O    . PRO A 1 20 ? 1.502   -10.986 5.746   1.00 0.00 ? 20  PRO A O    16 
ATOM   10549 C  CB   . PRO A 1 20 ? 4.615   -11.499 6.025   1.00 0.00 ? 20  PRO A CB   16 
ATOM   10550 C  CG   . PRO A 1 20 ? 5.618   -10.401 6.110   1.00 0.00 ? 20  PRO A CG   16 
ATOM   10551 C  CD   . PRO A 1 20 ? 5.856   -9.947  4.696   1.00 0.00 ? 20  PRO A CD   16 
ATOM   10552 H  HA   . PRO A 1 20 ? 3.420   -12.014 4.316   1.00 0.00 ? 20  PRO A HA   16 
ATOM   10553 H  HB2  . PRO A 1 20 ? 4.018   -11.560 6.925   1.00 0.00 ? 20  PRO A HB2  16 
ATOM   10554 H  HB3  . PRO A 1 20 ? 5.087   -12.451 5.834   1.00 0.00 ? 20  PRO A HB3  16 
ATOM   10555 H  HG2  . PRO A 1 20 ? 5.226   -9.590  6.704   1.00 0.00 ? 20  PRO A HG2  16 
ATOM   10556 H  HG3  . PRO A 1 20 ? 6.535   -10.775 6.542   1.00 0.00 ? 20  PRO A HG3  16 
ATOM   10557 H  HD2  . PRO A 1 20 ? 6.042   -8.884  4.668   1.00 0.00 ? 20  PRO A HD2  16 
ATOM   10558 H  HD3  . PRO A 1 20 ? 6.682   -10.489 4.259   1.00 0.00 ? 20  PRO A HD3  16 
ATOM   10559 N  N    . PHE A 1 21 ? 2.536   -9.047  5.264   1.00 0.00 ? 21  PHE A N    16 
ATOM   10560 C  CA   . PHE A 1 21 ? 1.418   -8.217  5.697   1.00 0.00 ? 21  PHE A CA   16 
ATOM   10561 C  C    . PHE A 1 21 ? 0.250   -8.325  4.721   1.00 0.00 ? 21  PHE A C    16 
ATOM   10562 O  O    . PHE A 1 21 ? 0.446   -8.504  3.518   1.00 0.00 ? 21  PHE A O    16 
ATOM   10563 C  CB   . PHE A 1 21 ? 1.858   -6.757  5.823   1.00 0.00 ? 21  PHE A CB   16 
ATOM   10564 C  CG   . PHE A 1 21 ? 2.980   -6.551  6.800   1.00 0.00 ? 21  PHE A CG   16 
ATOM   10565 C  CD1  . PHE A 1 21 ? 2.869   -7.000  8.107   1.00 0.00 ? 21  PHE A CD1  16 
ATOM   10566 C  CD2  . PHE A 1 21 ? 4.145   -5.909  6.413   1.00 0.00 ? 21  PHE A CD2  16 
ATOM   10567 C  CE1  . PHE A 1 21 ? 3.899   -6.812  9.009   1.00 0.00 ? 21  PHE A CE1  16 
ATOM   10568 C  CE2  . PHE A 1 21 ? 5.179   -5.719  7.311   1.00 0.00 ? 21  PHE A CE2  16 
ATOM   10569 C  CZ   . PHE A 1 21 ? 5.055   -6.170  8.610   1.00 0.00 ? 21  PHE A CZ   16 
ATOM   10570 H  H    . PHE A 1 21 ? 3.346   -8.616  4.919   1.00 0.00 ? 21  PHE A H    16 
ATOM   10571 H  HA   . PHE A 1 21 ? 1.098   -8.572  6.664   1.00 0.00 ? 21  PHE A HA   16 
ATOM   10572 H  HB2  . PHE A 1 21 ? 2.191   -6.404  4.858   1.00 0.00 ? 21  PHE A HB2  16 
ATOM   10573 H  HB3  . PHE A 1 21 ? 1.019   -6.162  6.149   1.00 0.00 ? 21  PHE A HB3  16 
ATOM   10574 H  HD1  . PHE A 1 21 ? 1.964   -7.502  8.420   1.00 0.00 ? 21  PHE A HD1  16 
ATOM   10575 H  HD2  . PHE A 1 21 ? 4.243   -5.555  5.398   1.00 0.00 ? 21  PHE A HD2  16 
ATOM   10576 H  HE1  . PHE A 1 21 ? 3.799   -7.166  10.024  1.00 0.00 ? 21  PHE A HE1  16 
ATOM   10577 H  HE2  . PHE A 1 21 ? 6.081   -5.217  6.997   1.00 0.00 ? 21  PHE A HE2  16 
ATOM   10578 H  HZ   . PHE A 1 21 ? 5.861   -6.024  9.313   1.00 0.00 ? 21  PHE A HZ   16 
ATOM   10579 N  N    . PHE A 1 22 ? -0.965  -8.216  5.247   1.00 0.00 ? 22  PHE A N    16 
ATOM   10580 C  CA   . PHE A 1 22 ? -2.166  -8.303  4.424   1.00 0.00 ? 22  PHE A CA   16 
ATOM   10581 C  C    . PHE A 1 22 ? -2.503  -6.948  3.809   1.00 0.00 ? 22  PHE A C    16 
ATOM   10582 O  O    . PHE A 1 22 ? -2.160  -5.902  4.360   1.00 0.00 ? 22  PHE A O    16 
ATOM   10583 C  CB   . PHE A 1 22 ? -3.346  -8.806  5.258   1.00 0.00 ? 22  PHE A CB   16 
ATOM   10584 C  CG   . PHE A 1 22 ? -3.197  -10.230 5.711   1.00 0.00 ? 22  PHE A CG   16 
ATOM   10585 C  CD1  . PHE A 1 22 ? -3.177  -11.266 4.790   1.00 0.00 ? 22  PHE A CD1  16 
ATOM   10586 C  CD2  . PHE A 1 22 ? -3.075  -10.534 7.057   1.00 0.00 ? 22  PHE A CD2  16 
ATOM   10587 C  CE1  . PHE A 1 22 ? -3.040  -12.577 5.205   1.00 0.00 ? 22  PHE A CE1  16 
ATOM   10588 C  CE2  . PHE A 1 22 ? -2.937  -11.843 7.478   1.00 0.00 ? 22  PHE A CE2  16 
ATOM   10589 C  CZ   . PHE A 1 22 ? -2.919  -12.866 6.550   1.00 0.00 ? 22  PHE A CZ   16 
ATOM   10590 H  H    . PHE A 1 22 ? -1.057  -8.074  6.213   1.00 0.00 ? 22  PHE A H    16 
ATOM   10591 H  HA   . PHE A 1 22 ? -1.971  -9.007  3.630   1.00 0.00 ? 22  PHE A HA   16 
ATOM   10592 H  HB2  . PHE A 1 22 ? -3.446  -8.188  6.137   1.00 0.00 ? 22  PHE A HB2  16 
ATOM   10593 H  HB3  . PHE A 1 22 ? -4.248  -8.737  4.669   1.00 0.00 ? 22  PHE A HB3  16 
ATOM   10594 H  HD1  . PHE A 1 22 ? -3.270  -11.041 3.738   1.00 0.00 ? 22  PHE A HD1  16 
ATOM   10595 H  HD2  . PHE A 1 22 ? -3.089  -9.734  7.784   1.00 0.00 ? 22  PHE A HD2  16 
ATOM   10596 H  HE1  . PHE A 1 22 ? -3.026  -13.375 4.477   1.00 0.00 ? 22  PHE A HE1  16 
ATOM   10597 H  HE2  . PHE A 1 22 ? -2.843  -12.065 8.530   1.00 0.00 ? 22  PHE A HE2  16 
ATOM   10598 H  HZ   . PHE A 1 22 ? -2.813  -13.890 6.876   1.00 0.00 ? 22  PHE A HZ   16 
ATOM   10599 N  N    . MET A 1 23 ? -3.178  -6.976  2.665   1.00 0.00 ? 23  MET A N    16 
ATOM   10600 C  CA   . MET A 1 23 ? -3.562  -5.750  1.975   1.00 0.00 ? 23  MET A CA   16 
ATOM   10601 C  C    . MET A 1 23 ? -4.975  -5.328  2.364   1.00 0.00 ? 23  MET A C    16 
ATOM   10602 O  O    . MET A 1 23 ? -5.910  -6.126  2.306   1.00 0.00 ? 23  MET A O    16 
ATOM   10603 C  CB   . MET A 1 23 ? -3.474  -5.943  0.460   1.00 0.00 ? 23  MET A CB   16 
ATOM   10604 C  CG   . MET A 1 23 ? -4.202  -7.181  -0.039  1.00 0.00 ? 23  MET A CG   16 
ATOM   10605 S  SD   . MET A 1 23 ? -4.640  -7.074  -1.785  1.00 0.00 ? 23  MET A SD   16 
ATOM   10606 C  CE   . MET A 1 23 ? -3.453  -8.208  -2.501  1.00 0.00 ? 23  MET A CE   16 
ATOM   10607 H  H    . MET A 1 23 ? -3.423  -7.841  2.274   1.00 0.00 ? 23  MET A H    16 
ATOM   10608 H  HA   . MET A 1 23 ? -2.873  -4.974  2.270   1.00 0.00 ? 23  MET A HA   16 
ATOM   10609 H  HB2  . MET A 1 23 ? -3.903  -5.079  -0.027  1.00 0.00 ? 23  MET A HB2  16 
ATOM   10610 H  HB3  . MET A 1 23 ? -2.435  -6.026  0.179   1.00 0.00 ? 23  MET A HB3  16 
ATOM   10611 H  HG2  . MET A 1 23 ? -3.564  -8.040  0.105   1.00 0.00 ? 23  MET A HG2  16 
ATOM   10612 H  HG3  . MET A 1 23 ? -5.107  -7.306  0.538   1.00 0.00 ? 23  MET A HG3  16 
ATOM   10613 H  HE1  . MET A 1 23 ? -2.478  -8.025  -2.074  1.00 0.00 ? 23  MET A HE1  16 
ATOM   10614 H  HE2  . MET A 1 23 ? -3.754  -9.224  -2.291  1.00 0.00 ? 23  MET A HE2  16 
ATOM   10615 H  HE3  . MET A 1 23 ? -3.413  -8.058  -3.570  1.00 0.00 ? 23  MET A HE3  16 
ATOM   10616 N  N    . SER A 1 24 ? -5.123  -4.068  2.762   1.00 0.00 ? 24  SER A N    16 
ATOM   10617 C  CA   . SER A 1 24 ? -6.422  -3.541  3.165   1.00 0.00 ? 24  SER A CA   16 
ATOM   10618 C  C    . SER A 1 24 ? -7.312  -3.301  1.949   1.00 0.00 ? 24  SER A C    16 
ATOM   10619 O  O    . SER A 1 24 ? -6.895  -3.510  0.809   1.00 0.00 ? 24  SER A O    16 
ATOM   10620 C  CB   . SER A 1 24 ? -6.247  -2.239  3.948   1.00 0.00 ? 24  SER A CB   16 
ATOM   10621 O  OG   . SER A 1 24 ? -7.277  -2.078  4.908   1.00 0.00 ? 24  SER A OG   16 
ATOM   10622 H  H    . SER A 1 24 ? -4.340  -3.480  2.787   1.00 0.00 ? 24  SER A H    16 
ATOM   10623 H  HA   . SER A 1 24 ? -6.894  -4.274  3.802   1.00 0.00 ? 24  SER A HA   16 
ATOM   10624 H  HB2  . SER A 1 24 ? -5.296  -2.253  4.458   1.00 0.00 ? 24  SER A HB2  16 
ATOM   10625 H  HB3  . SER A 1 24 ? -6.275  -1.403  3.263   1.00 0.00 ? 24  SER A HB3  16 
ATOM   10626 H  HG   . SER A 1 24 ? -7.582  -1.168  4.902   1.00 0.00 ? 24  SER A HG   16 
ATOM   10627 N  N    . VAL A 1 25 ? -8.541  -2.861  2.201   1.00 0.00 ? 25  VAL A N    16 
ATOM   10628 C  CA   . VAL A 1 25 ? -9.490  -2.590  1.128   1.00 0.00 ? 25  VAL A CA   16 
ATOM   10629 C  C    . VAL A 1 25 ? -9.180  -1.266  0.440   1.00 0.00 ? 25  VAL A C    16 
ATOM   10630 O  O    . VAL A 1 25 ? -9.545  -1.055  -0.716  1.00 0.00 ? 25  VAL A O    16 
ATOM   10631 C  CB   . VAL A 1 25 ? -10.937 -2.556  1.655   1.00 0.00 ? 25  VAL A CB   16 
ATOM   10632 C  CG1  . VAL A 1 25 ? -11.913 -2.285  0.520   1.00 0.00 ? 25  VAL A CG1  16 
ATOM   10633 C  CG2  . VAL A 1 25 ? -11.278 -3.859  2.362   1.00 0.00 ? 25  VAL A CG2  16 
ATOM   10634 H  H    . VAL A 1 25 ? -8.814  -2.713  3.130   1.00 0.00 ? 25  VAL A H    16 
ATOM   10635 H  HA   . VAL A 1 25 ? -9.412  -3.388  0.404   1.00 0.00 ? 25  VAL A HA   16 
ATOM   10636 H  HB   . VAL A 1 25 ? -11.019 -1.750  2.370   1.00 0.00 ? 25  VAL A HB   16 
ATOM   10637 H  HG11 . VAL A 1 25 ? -12.922 -2.283  0.906   1.00 0.00 ? 25  VAL A HG11 16 
ATOM   10638 H  HG12 . VAL A 1 25 ? -11.693 -1.324  0.078   1.00 0.00 ? 25  VAL A HG12 16 
ATOM   10639 H  HG13 . VAL A 1 25 ? -11.816 -3.057  -0.229  1.00 0.00 ? 25  VAL A HG13 16 
ATOM   10640 H  HG21 . VAL A 1 25 ? -11.113 -3.747  3.424   1.00 0.00 ? 25  VAL A HG21 16 
ATOM   10641 H  HG22 . VAL A 1 25 ? -12.313 -4.106  2.182   1.00 0.00 ? 25  VAL A HG22 16 
ATOM   10642 H  HG23 . VAL A 1 25 ? -10.648 -4.650  1.982   1.00 0.00 ? 25  VAL A HG23 16 
ATOM   10643 N  N    . ASN A 1 26 ? -8.503  -0.376  1.159   1.00 0.00 ? 26  ASN A N    16 
ATOM   10644 C  CA   . ASN A 1 26 ? -8.143  0.929   0.617   1.00 0.00 ? 26  ASN A CA   16 
ATOM   10645 C  C    . ASN A 1 26 ? -6.652  0.994   0.299   1.00 0.00 ? 26  ASN A C    16 
ATOM   10646 O  O    . ASN A 1 26 ? -6.148  2.017   -0.165  1.00 0.00 ? 26  ASN A O    16 
ATOM   10647 C  CB   . ASN A 1 26 ? -8.513  2.035   1.608   1.00 0.00 ? 26  ASN A CB   16 
ATOM   10648 C  CG   . ASN A 1 26 ? -8.809  3.353   0.919   1.00 0.00 ? 26  ASN A CG   16 
ATOM   10649 O  OD1  . ASN A 1 26 ? -9.965  3.682   0.653   1.00 0.00 ? 26  ASN A OD1  16 
ATOM   10650 N  ND2  . ASN A 1 26 ? -7.762  4.115   0.625   1.00 0.00 ? 26  ASN A ND2  16 
ATOM   10651 H  H    . ASN A 1 26 ? -8.240  -0.602  2.075   1.00 0.00 ? 26  ASN A H    16 
ATOM   10652 H  HA   . ASN A 1 26 ? -8.701  1.075   -0.296  1.00 0.00 ? 26  ASN A HA   16 
ATOM   10653 H  HB2  . ASN A 1 26 ? -9.391  1.735   2.161   1.00 0.00 ? 26  ASN A HB2  16 
ATOM   10654 H  HB3  . ASN A 1 26 ? -7.693  2.185   2.294   1.00 0.00 ? 26  ASN A HB3  16 
ATOM   10655 H  HD21 . ASN A 1 26 ? -6.869  3.789   0.866   1.00 0.00 ? 26  ASN A HD21 16 
ATOM   10656 H  HD22 . ASN A 1 26 ? -7.925  4.973   0.180   1.00 0.00 ? 26  ASN A HD22 16 
ATOM   10657 N  N    . THR A 1 27 ? -5.951  -0.107  0.550   1.00 0.00 ? 27  THR A N    16 
ATOM   10658 C  CA   . THR A 1 27 ? -4.518  -0.177  0.292   1.00 0.00 ? 27  THR A CA   16 
ATOM   10659 C  C    . THR A 1 27 ? -4.209  -1.162  -0.830  1.00 0.00 ? 27  THR A C    16 
ATOM   10660 O  O    . THR A 1 27 ? -3.192  -1.040  -1.512  1.00 0.00 ? 27  THR A O    16 
ATOM   10661 C  CB   . THR A 1 27 ? -3.739  -0.591  1.554   1.00 0.00 ? 27  THR A CB   16 
ATOM   10662 O  OG1  . THR A 1 27 ? -3.990  -1.969  1.854   1.00 0.00 ? 27  THR A OG1  16 
ATOM   10663 C  CG2  . THR A 1 27 ? -4.134  0.273   2.742   1.00 0.00 ? 27  THR A CG2  16 
ATOM   10664 H  H    . THR A 1 27 ? -6.409  -0.891  0.920   1.00 0.00 ? 27  THR A H    16 
ATOM   10665 H  HA   . THR A 1 27 ? -4.185  0.807   -0.005  1.00 0.00 ? 27  THR A HA   16 
ATOM   10666 H  HB   . THR A 1 27 ? -2.683  -0.459  1.366   1.00 0.00 ? 27  THR A HB   16 
ATOM   10667 H  HG1  . THR A 1 27 ? -4.414  -2.388  1.102   1.00 0.00 ? 27  THR A HG1  16 
ATOM   10668 H  HG21 . THR A 1 27 ? -4.972  0.896   2.470   1.00 0.00 ? 27  THR A HG21 16 
ATOM   10669 H  HG22 . THR A 1 27 ? -3.299  0.897   3.026   1.00 0.00 ? 27  THR A HG22 16 
ATOM   10670 H  HG23 . THR A 1 27 ? -4.409  -0.361  3.572   1.00 0.00 ? 27  THR A HG23 16 
ATOM   10671 N  N    . GLN A 1 28 ? -5.093  -2.137  -1.015  1.00 0.00 ? 28  GLN A N    16 
ATOM   10672 C  CA   . GLN A 1 28 ? -4.913  -3.144  -2.054  1.00 0.00 ? 28  GLN A CA   16 
ATOM   10673 C  C    . GLN A 1 28 ? -4.661  -2.489  -3.408  1.00 0.00 ? 28  GLN A C    16 
ATOM   10674 O  O    . GLN A 1 28 ? -5.072  -1.357  -3.664  1.00 0.00 ? 28  GLN A O    16 
ATOM   10675 C  CB   . GLN A 1 28 ? -6.143  -4.050  -2.134  1.00 0.00 ? 28  GLN A CB   16 
ATOM   10676 C  CG   . GLN A 1 28 ? -7.381  -3.350  -2.671  1.00 0.00 ? 28  GLN A CG   16 
ATOM   10677 C  CD   . GLN A 1 28 ? -8.468  -4.322  -3.084  1.00 0.00 ? 28  GLN A CD   16 
ATOM   10678 O  OE1  . GLN A 1 28 ? -8.404  -4.925  -4.156  1.00 0.00 ? 28  GLN A OE1  16 
ATOM   10679 N  NE2  . GLN A 1 28 ? -9.476  -4.480  -2.234  1.00 0.00 ? 28  GLN A NE2  16 
ATOM   10680 H  H    . GLN A 1 28 ? -5.884  -2.181  -0.439  1.00 0.00 ? 28  GLN A H    16 
ATOM   10681 H  HA   . GLN A 1 28 ? -4.054  -3.741  -1.792  1.00 0.00 ? 28  GLN A HA   16 
ATOM   10682 H  HB2  . GLN A 1 28 ? -5.919  -4.885  -2.781  1.00 0.00 ? 28  GLN A HB2  16 
ATOM   10683 H  HB3  . GLN A 1 28 ? -6.367  -4.421  -1.145  1.00 0.00 ? 28  GLN A HB3  16 
ATOM   10684 H  HG2  . GLN A 1 28 ? -7.774  -2.700  -1.903  1.00 0.00 ? 28  GLN A HG2  16 
ATOM   10685 H  HG3  . GLN A 1 28 ? -7.100  -2.760  -3.531  1.00 0.00 ? 28  GLN A HG3  16 
ATOM   10686 H  HE21 . GLN A 1 28 ? -9.461  -3.965  -1.399  1.00 0.00 ? 28  GLN A HE21 16 
ATOM   10687 H  HE22 . GLN A 1 28 ? -10.193 -5.101  -2.476  1.00 0.00 ? 28  GLN A HE22 16 
ATOM   10688 N  N    . PRO A 1 29 ? -3.968  -3.215  -4.297  1.00 0.00 ? 29  PRO A N    16 
ATOM   10689 C  CA   . PRO A 1 29 ? -3.473  -4.563  -4.004  1.00 0.00 ? 29  PRO A CA   16 
ATOM   10690 C  C    . PRO A 1 29 ? -2.341  -4.556  -2.981  1.00 0.00 ? 29  PRO A C    16 
ATOM   10691 O  O    . PRO A 1 29 ? -1.945  -5.604  -2.471  1.00 0.00 ? 29  PRO A O    16 
ATOM   10692 C  CB   . PRO A 1 29 ? -2.964  -5.058  -5.360  1.00 0.00 ? 29  PRO A CB   16 
ATOM   10693 C  CG   . PRO A 1 29 ? -2.629  -3.817  -6.114  1.00 0.00 ? 29  PRO A CG   16 
ATOM   10694 C  CD   . PRO A 1 29 ? -3.614  -2.776  -5.658  1.00 0.00 ? 29  PRO A CD   16 
ATOM   10695 H  HA   . PRO A 1 29 ? -4.265  -5.210  -3.657  1.00 0.00 ? 29  PRO A HA   16 
ATOM   10696 H  HB2  . PRO A 1 29 ? -2.092  -5.681  -5.216  1.00 0.00 ? 29  PRO A HB2  16 
ATOM   10697 H  HB3  . PRO A 1 29 ? -3.739  -5.623  -5.856  1.00 0.00 ? 29  PRO A HB3  16 
ATOM   10698 H  HG2  . PRO A 1 29 ? -1.621  -3.507  -5.882  1.00 0.00 ? 29  PRO A HG2  16 
ATOM   10699 H  HG3  . PRO A 1 29 ? -2.734  -3.992  -7.175  1.00 0.00 ? 29  PRO A HG3  16 
ATOM   10700 H  HD2  . PRO A 1 29 ? -3.151  -1.801  -5.640  1.00 0.00 ? 29  PRO A HD2  16 
ATOM   10701 H  HD3  . PRO A 1 29 ? -4.483  -2.772  -6.299  1.00 0.00 ? 29  PRO A HD3  16 
ATOM   10702 N  N    . LEU A 1 30 ? -1.826  -3.368  -2.685  1.00 0.00 ? 30  LEU A N    16 
ATOM   10703 C  CA   . LEU A 1 30 ? -0.740  -3.223  -1.722  1.00 0.00 ? 30  LEU A CA   16 
ATOM   10704 C  C    . LEU A 1 30 ? -1.284  -3.098  -0.303  1.00 0.00 ? 30  LEU A C    16 
ATOM   10705 O  O    . LEU A 1 30 ? -2.476  -2.863  -0.102  1.00 0.00 ? 30  LEU A O    16 
ATOM   10706 C  CB   . LEU A 1 30 ? 0.112   -2.000  -2.064  1.00 0.00 ? 30  LEU A CB   16 
ATOM   10707 C  CG   . LEU A 1 30 ? 0.924   -2.088  -3.358  1.00 0.00 ? 30  LEU A CG   16 
ATOM   10708 C  CD1  . LEU A 1 30 ? 1.634   -0.772  -3.632  1.00 0.00 ? 30  LEU A CD1  16 
ATOM   10709 C  CD2  . LEU A 1 30 ? 1.925   -3.231  -3.283  1.00 0.00 ? 30  LEU A CD2  16 
ATOM   10710 H  H    . LEU A 1 30 ? -2.184  -2.568  -3.124  1.00 0.00 ? 30  LEU A H    16 
ATOM   10711 H  HA   . LEU A 1 30 ? -0.125  -4.109  -1.782  1.00 0.00 ? 30  LEU A HA   16 
ATOM   10712 H  HB2  . LEU A 1 30 ? -0.547  -1.150  -2.145  1.00 0.00 ? 30  LEU A HB2  16 
ATOM   10713 H  HB3  . LEU A 1 30 ? 0.804   -1.841  -1.249  1.00 0.00 ? 30  LEU A HB3  16 
ATOM   10714 H  HG   . LEU A 1 30 ? 0.253   -2.283  -4.183  1.00 0.00 ? 30  LEU A HG   16 
ATOM   10715 H  HD11 . LEU A 1 30 ? 1.485   -0.490  -4.663  1.00 0.00 ? 30  LEU A HD11 16 
ATOM   10716 H  HD12 . LEU A 1 30 ? 2.691   -0.886  -3.440  1.00 0.00 ? 30  LEU A HD12 16 
ATOM   10717 H  HD13 . LEU A 1 30 ? 1.232   -0.004  -2.987  1.00 0.00 ? 30  LEU A HD13 16 
ATOM   10718 H  HD21 . LEU A 1 30 ? 2.012   -3.566  -2.260  1.00 0.00 ? 30  LEU A HD21 16 
ATOM   10719 H  HD22 . LEU A 1 30 ? 2.888   -2.889  -3.634  1.00 0.00 ? 30  LEU A HD22 16 
ATOM   10720 H  HD23 . LEU A 1 30 ? 1.585   -4.048  -3.902  1.00 0.00 ? 30  LEU A HD23 16 
ATOM   10721 N  N    . CYS A 1 31 ? -0.402  -3.253  0.679   1.00 0.00 ? 31  CYS A N    16 
ATOM   10722 C  CA   . CYS A 1 31 ? -0.792  -3.155  2.080   1.00 0.00 ? 31  CYS A CA   16 
ATOM   10723 C  C    . CYS A 1 31 ? -0.424  -1.789  2.654   1.00 0.00 ? 31  CYS A C    16 
ATOM   10724 O  O    . CYS A 1 31 ? 0.515   -1.142  2.189   1.00 0.00 ? 31  CYS A O    16 
ATOM   10725 C  CB   . CYS A 1 31 ? -0.121  -4.261  2.897   1.00 0.00 ? 31  CYS A CB   16 
ATOM   10726 S  SG   . CYS A 1 31 ? 1.619   -3.922  3.318   1.00 0.00 ? 31  CYS A SG   16 
ATOM   10727 H  H    . CYS A 1 31 ? 0.535   -3.438  0.456   1.00 0.00 ? 31  CYS A H    16 
ATOM   10728 H  HA   . CYS A 1 31 ? -1.863  -3.278  2.136   1.00 0.00 ? 31  CYS A HA   16 
ATOM   10729 H  HB2  . CYS A 1 31 ? -0.662  -4.393  3.823   1.00 0.00 ? 31  CYS A HB2  16 
ATOM   10730 H  HB3  . CYS A 1 31 ? -0.150  -5.182  2.334   1.00 0.00 ? 31  CYS A HB3  16 
ATOM   10731 N  N    . HIS A 1 32 ? -1.169  -1.358  3.666   1.00 0.00 ? 32  HIS A N    16 
ATOM   10732 C  CA   . HIS A 1 32 ? -0.921  -0.070  4.304   1.00 0.00 ? 32  HIS A CA   16 
ATOM   10733 C  C    . HIS A 1 32 ? 0.565   0.274   4.274   1.00 0.00 ? 32  HIS A C    16 
ATOM   10734 O  O    . HIS A 1 32 ? 0.944   1.402   3.960   1.00 0.00 ? 32  HIS A O    16 
ATOM   10735 C  CB   . HIS A 1 32 ? -1.424  -0.086  5.748   1.00 0.00 ? 32  HIS A CB   16 
ATOM   10736 C  CG   . HIS A 1 32 ? -1.892  1.250   6.234   1.00 0.00 ? 32  HIS A CG   16 
ATOM   10737 N  ND1  . HIS A 1 32 ? -2.974  1.409   7.075   1.00 0.00 ? 32  HIS A ND1  16 
ATOM   10738 C  CD2  . HIS A 1 32 ? -1.418  2.495   5.995   1.00 0.00 ? 32  HIS A CD2  16 
ATOM   10739 C  CE1  . HIS A 1 32 ? -3.146  2.693   7.330   1.00 0.00 ? 32  HIS A CE1  16 
ATOM   10740 N  NE2  . HIS A 1 32 ? -2.214  3.374   6.687   1.00 0.00 ? 32  HIS A NE2  16 
ATOM   10741 H  H    . HIS A 1 32 ? -1.903  -1.919  3.992   1.00 0.00 ? 32  HIS A H    16 
ATOM   10742 H  HA   . HIS A 1 32 ? -1.463  0.683   3.752   1.00 0.00 ? 32  HIS A HA   16 
ATOM   10743 H  HB2  . HIS A 1 32 ? -2.251  -0.776  5.826   1.00 0.00 ? 32  HIS A HB2  16 
ATOM   10744 H  HB3  . HIS A 1 32 ? -0.625  -0.415  6.396   1.00 0.00 ? 32  HIS A HB3  16 
ATOM   10745 H  HD1  . HIS A 1 32 ? -3.533  0.687   7.430   1.00 0.00 ? 32  HIS A HD1  16 
ATOM   10746 H  HD2  . HIS A 1 32 ? -0.571  2.751   5.374   1.00 0.00 ? 32  HIS A HD2  16 
ATOM   10747 H  HE1  . HIS A 1 32 ? -3.916  3.115   7.958   1.00 0.00 ? 32  HIS A HE1  16 
ATOM   10748 N  N    . GLU A 1 33 ? 1.401   -0.706  4.603   1.00 0.00 ? 33  GLU A N    16 
ATOM   10749 C  CA   . GLU A 1 33 ? 2.845   -0.506  4.615   1.00 0.00 ? 33  GLU A CA   16 
ATOM   10750 C  C    . GLU A 1 33 ? 3.357   -0.155  3.221   1.00 0.00 ? 33  GLU A C    16 
ATOM   10751 O  O    . GLU A 1 33 ? 3.957   0.901   3.015   1.00 0.00 ? 33  GLU A O    16 
ATOM   10752 C  CB   . GLU A 1 33 ? 3.552   -1.761  5.129   1.00 0.00 ? 33  GLU A CB   16 
ATOM   10753 C  CG   . GLU A 1 33 ? 4.974   -1.509  5.602   1.00 0.00 ? 33  GLU A CG   16 
ATOM   10754 C  CD   . GLU A 1 33 ? 5.899   -1.095  4.474   1.00 0.00 ? 33  GLU A CD   16 
ATOM   10755 O  OE1  . GLU A 1 33 ? 5.880   -1.761  3.417   1.00 0.00 ? 33  GLU A OE1  16 
ATOM   10756 O  OE2  . GLU A 1 33 ? 6.642   -0.106  4.647   1.00 0.00 ? 33  GLU A OE2  16 
ATOM   10757 H  H    . GLU A 1 33 ? 1.038   -1.584  4.844   1.00 0.00 ? 33  GLU A H    16 
ATOM   10758 H  HA   . GLU A 1 33 ? 3.060   0.315   5.282   1.00 0.00 ? 33  GLU A HA   16 
ATOM   10759 H  HB2  . GLU A 1 33 ? 2.987   -2.166  5.955   1.00 0.00 ? 33  GLU A HB2  16 
ATOM   10760 H  HB3  . GLU A 1 33 ? 3.584   -2.492  4.335   1.00 0.00 ? 33  GLU A HB3  16 
ATOM   10761 H  HG2  . GLU A 1 33 ? 4.960   -0.722  6.341   1.00 0.00 ? 33  GLU A HG2  16 
ATOM   10762 H  HG3  . GLU A 1 33 ? 5.358   -2.414  6.048   1.00 0.00 ? 33  GLU A HG3  16 
ATOM   10763 N  N    . CYS A 1 34 ? 3.118   -1.048  2.267   1.00 0.00 ? 34  CYS A N    16 
ATOM   10764 C  CA   . CYS A 1 34 ? 3.554   -0.835  0.893   1.00 0.00 ? 34  CYS A CA   16 
ATOM   10765 C  C    . CYS A 1 34 ? 2.806   0.334   0.259   1.00 0.00 ? 34  CYS A C    16 
ATOM   10766 O  O    . CYS A 1 34 ? 3.212   0.854   -0.781  1.00 0.00 ? 34  CYS A O    16 
ATOM   10767 C  CB   . CYS A 1 34 ? 3.338   -2.103  0.064   1.00 0.00 ? 34  CYS A CB   16 
ATOM   10768 S  SG   . CYS A 1 34 ? 4.336   -3.527  0.609   1.00 0.00 ? 34  CYS A SG   16 
ATOM   10769 H  H    . CYS A 1 34 ? 2.635   -1.871  2.493   1.00 0.00 ? 34  CYS A H    16 
ATOM   10770 H  HA   . CYS A 1 34 ? 4.609   -0.604  0.911   1.00 0.00 ? 34  CYS A HA   16 
ATOM   10771 H  HB2  . CYS A 1 34 ? 2.298   -2.390  0.125   1.00 0.00 ? 34  CYS A HB2  16 
ATOM   10772 H  HB3  . CYS A 1 34 ? 3.590   -1.899  -0.966  1.00 0.00 ? 34  CYS A HB3  16 
ATOM   10773 N  N    . SER A 1 35 ? 1.711   0.741   0.892   1.00 0.00 ? 35  SER A N    16 
ATOM   10774 C  CA   . SER A 1 35 ? 0.903   1.846   0.389   1.00 0.00 ? 35  SER A CA   16 
ATOM   10775 C  C    . SER A 1 35 ? 1.470   3.186   0.846   1.00 0.00 ? 35  SER A C    16 
ATOM   10776 O  O    . SER A 1 35 ? 1.606   4.117   0.053   1.00 0.00 ? 35  SER A O    16 
ATOM   10777 C  CB   . SER A 1 35 ? -0.545  1.704   0.862   1.00 0.00 ? 35  SER A CB   16 
ATOM   10778 O  OG   . SER A 1 35 ? -1.223  2.947   0.808   1.00 0.00 ? 35  SER A OG   16 
ATOM   10779 H  H    . SER A 1 35 ? 1.439   0.286   1.717   1.00 0.00 ? 35  SER A H    16 
ATOM   10780 H  HA   . SER A 1 35 ? 0.925   1.808   -0.690  1.00 0.00 ? 35  SER A HA   16 
ATOM   10781 H  HB2  . SER A 1 35 ? -1.061  0.999   0.229   1.00 0.00 ? 35  SER A HB2  16 
ATOM   10782 H  HB3  . SER A 1 35 ? -0.554  1.346   1.882   1.00 0.00 ? 35  SER A HB3  16 
ATOM   10783 H  HG   . SER A 1 35 ? -2.118  2.838   1.139   1.00 0.00 ? 35  SER A HG   16 
ATOM   10784 N  N    . GLU A 1 36 ? 1.800   3.275   2.131   1.00 0.00 ? 36  GLU A N    16 
ATOM   10785 C  CA   . GLU A 1 36 ? 2.352   4.501   2.695   1.00 0.00 ? 36  GLU A CA   16 
ATOM   10786 C  C    . GLU A 1 36 ? 3.736   4.789   2.122   1.00 0.00 ? 36  GLU A C    16 
ATOM   10787 O  O    . GLU A 1 36 ? 4.141   5.945   1.997   1.00 0.00 ? 36  GLU A O    16 
ATOM   10788 C  CB   . GLU A 1 36 ? 2.430   4.398   4.219   1.00 0.00 ? 36  GLU A CB   16 
ATOM   10789 C  CG   . GLU A 1 36 ? 3.359   3.300   4.708   1.00 0.00 ? 36  GLU A CG   16 
ATOM   10790 C  CD   . GLU A 1 36 ? 3.733   3.459   6.169   1.00 0.00 ? 36  GLU A CD   16 
ATOM   10791 O  OE1  . GLU A 1 36 ? 4.124   4.577   6.564   1.00 0.00 ? 36  GLU A OE1  16 
ATOM   10792 O  OE2  . GLU A 1 36 ? 3.633   2.465   6.918   1.00 0.00 ? 36  GLU A OE2  16 
ATOM   10793 H  H    . GLU A 1 36 ? 1.668   2.498   2.714   1.00 0.00 ? 36  GLU A H    16 
ATOM   10794 H  HA   . GLU A 1 36 ? 1.691   5.314   2.432   1.00 0.00 ? 36  GLU A HA   16 
ATOM   10795 H  HB2  . GLU A 1 36 ? 2.780   5.341   4.614   1.00 0.00 ? 36  GLU A HB2  16 
ATOM   10796 H  HB3  . GLU A 1 36 ? 1.441   4.202   4.606   1.00 0.00 ? 36  GLU A HB3  16 
ATOM   10797 H  HG2  . GLU A 1 36 ? 2.869   2.347   4.580   1.00 0.00 ? 36  GLU A HG2  16 
ATOM   10798 H  HG3  . GLU A 1 36 ? 4.263   3.321   4.117   1.00 0.00 ? 36  GLU A HG3  16 
ATOM   10799 N  N    . ARG A 1 37 ? 4.458   3.728   1.775   1.00 0.00 ? 37  ARG A N    16 
ATOM   10800 C  CA   . ARG A 1 37 ? 5.798   3.865   1.217   1.00 0.00 ? 37  ARG A CA   16 
ATOM   10801 C  C    . ARG A 1 37 ? 5.737   4.299   -0.245  1.00 0.00 ? 37  ARG A C    16 
ATOM   10802 O  O    . ARG A 1 37 ? 6.522   5.137   -0.687  1.00 0.00 ? 37  ARG A O    16 
ATOM   10803 C  CB   . ARG A 1 37 ? 6.561   2.544   1.336   1.00 0.00 ? 37  ARG A CB   16 
ATOM   10804 C  CG   . ARG A 1 37 ? 6.106   1.486   0.344   1.00 0.00 ? 37  ARG A CG   16 
ATOM   10805 C  CD   . ARG A 1 37 ? 6.849   0.175   0.548   1.00 0.00 ? 37  ARG A CD   16 
ATOM   10806 N  NE   . ARG A 1 37 ? 6.557   -0.789  -0.510  1.00 0.00 ? 37  ARG A NE   16 
ATOM   10807 C  CZ   . ARG A 1 37 ? 7.166   -0.791  -1.691  1.00 0.00 ? 37  ARG A CZ   16 
ATOM   10808 N  NH1  . ARG A 1 37 ? 8.095   0.115   -1.963  1.00 0.00 ? 37  ARG A NH1  16 
ATOM   10809 N  NH2  . ARG A 1 37 ? 6.847   -1.701  -2.602  1.00 0.00 ? 37  ARG A NH2  16 
ATOM   10810 H  H    . ARG A 1 37 ? 4.082   2.832   1.898   1.00 0.00 ? 37  ARG A H    16 
ATOM   10811 H  HA   . ARG A 1 37 ? 6.318   4.623   1.784   1.00 0.00 ? 37  ARG A HA   16 
ATOM   10812 H  HB2  . ARG A 1 37 ? 7.612   2.732   1.171   1.00 0.00 ? 37  ARG A HB2  16 
ATOM   10813 H  HB3  . ARG A 1 37 ? 6.426   2.153   2.333   1.00 0.00 ? 37  ARG A HB3  16 
ATOM   10814 H  HG2  . ARG A 1 37 ? 5.048   1.312   0.478   1.00 0.00 ? 37  ARG A HG2  16 
ATOM   10815 H  HG3  . ARG A 1 37 ? 6.290   1.843   -0.658  1.00 0.00 ? 37  ARG A HG3  16 
ATOM   10816 H  HD2  . ARG A 1 37 ? 7.910   0.376   0.556   1.00 0.00 ? 37  ARG A HD2  16 
ATOM   10817 H  HD3  . ARG A 1 37 ? 6.555   -0.246  1.497   1.00 0.00 ? 37  ARG A HD3  16 
ATOM   10818 H  HE   . ARG A 1 37 ? 5.874   -1.467  -0.330  1.00 0.00 ? 37  ARG A HE   16 
ATOM   10819 H  HH11 . ARG A 1 37 ? 8.339   0.801   -1.277  1.00 0.00 ? 37  ARG A HH11 16 
ATOM   10820 H  HH12 . ARG A 1 37 ? 8.553   0.111   -2.852  1.00 0.00 ? 37  ARG A HH12 16 
ATOM   10821 H  HH21 . ARG A 1 37 ? 6.147   -2.385  -2.400  1.00 0.00 ? 37  ARG A HH21 16 
ATOM   10822 H  HH22 . ARG A 1 37 ? 7.305   -1.701  -3.490  1.00 0.00 ? 37  ARG A HH22 16 
ATOM   10823 N  N    . ARG A 1 38 ? 4.799   3.722   -0.989  1.00 0.00 ? 38  ARG A N    16 
ATOM   10824 C  CA   . ARG A 1 38 ? 4.636   4.048   -2.400  1.00 0.00 ? 38  ARG A CA   16 
ATOM   10825 C  C    . ARG A 1 38 ? 4.065   5.453   -2.572  1.00 0.00 ? 38  ARG A C    16 
ATOM   10826 O  O    . ARG A 1 38 ? 4.597   6.260   -3.333  1.00 0.00 ? 38  ARG A O    16 
ATOM   10827 C  CB   . ARG A 1 38 ? 3.720   3.028   -3.079  1.00 0.00 ? 38  ARG A CB   16 
ATOM   10828 C  CG   . ARG A 1 38 ? 4.447   1.782   -3.559  1.00 0.00 ? 38  ARG A CG   16 
ATOM   10829 C  CD   . ARG A 1 38 ? 4.974   1.955   -4.974  1.00 0.00 ? 38  ARG A CD   16 
ATOM   10830 N  NE   . ARG A 1 38 ? 3.919   1.810   -5.973  1.00 0.00 ? 38  ARG A NE   16 
ATOM   10831 C  CZ   . ARG A 1 38 ? 3.524   0.639   -6.460  1.00 0.00 ? 38  ARG A CZ   16 
ATOM   10832 N  NH1  . ARG A 1 38 ? 4.094   -0.483  -6.042  1.00 0.00 ? 38  ARG A NH1  16 
ATOM   10833 N  NH2  . ARG A 1 38 ? 2.557   0.588   -7.367  1.00 0.00 ? 38  ARG A NH2  16 
ATOM   10834 H  H    . ARG A 1 38 ? 4.202   3.061   -0.579  1.00 0.00 ? 38  ARG A H    16 
ATOM   10835 H  HA   . ARG A 1 38 ? 5.610   4.009   -2.864  1.00 0.00 ? 38  ARG A HA   16 
ATOM   10836 H  HB2  . ARG A 1 38 ? 2.956   2.725   -2.378  1.00 0.00 ? 38  ARG A HB2  16 
ATOM   10837 H  HB3  . ARG A 1 38 ? 3.250   3.495   -3.931  1.00 0.00 ? 38  ARG A HB3  16 
ATOM   10838 H  HG2  . ARG A 1 38 ? 5.278   1.585   -2.898  1.00 0.00 ? 38  ARG A HG2  16 
ATOM   10839 H  HG3  . ARG A 1 38 ? 3.762   0.947   -3.538  1.00 0.00 ? 38  ARG A HG3  16 
ATOM   10840 H  HD2  . ARG A 1 38 ? 5.409   2.940   -5.064  1.00 0.00 ? 38  ARG A HD2  16 
ATOM   10841 H  HD3  . ARG A 1 38 ? 5.734   1.209   -5.155  1.00 0.00 ? 38  ARG A HD3  16 
ATOM   10842 H  HE   . ARG A 1 38 ? 3.485   2.626   -6.297  1.00 0.00 ? 38  ARG A HE   16 
ATOM   10843 H  HH11 . ARG A 1 38 ? 4.822   -0.448  -5.357  1.00 0.00 ? 38  ARG A HH11 16 
ATOM   10844 H  HH12 . ARG A 1 38 ? 3.794   -1.364  -6.409  1.00 0.00 ? 38  ARG A HH12 16 
ATOM   10845 H  HH21 . ARG A 1 38 ? 2.125   1.431   -7.685  1.00 0.00 ? 38  ARG A HH21 16 
ATOM   10846 H  HH22 . ARG A 1 38 ? 2.261   -0.294  -7.733  1.00 0.00 ? 38  ARG A HH22 16 
ATOM   10847 N  N    . GLN A 1 39 ? 2.979   5.736   -1.859  1.00 0.00 ? 39  GLN A N    16 
ATOM   10848 C  CA   . GLN A 1 39 ? 2.336   7.042   -1.934  1.00 0.00 ? 39  GLN A CA   16 
ATOM   10849 C  C    . GLN A 1 39 ? 3.369   8.162   -1.863  1.00 0.00 ? 39  GLN A C    16 
ATOM   10850 O  O    . GLN A 1 39 ? 3.217   9.203   -2.504  1.00 0.00 ? 39  GLN A O    16 
ATOM   10851 C  CB   . GLN A 1 39 ? 1.318   7.199   -0.802  1.00 0.00 ? 39  GLN A CB   16 
ATOM   10852 C  CG   . GLN A 1 39 ? 1.948   7.240   0.581   1.00 0.00 ? 39  GLN A CG   16 
ATOM   10853 C  CD   . GLN A 1 39 ? 0.964   7.654   1.657   1.00 0.00 ? 39  GLN A CD   16 
ATOM   10854 O  OE1  . GLN A 1 39 ? -0.247  7.672   1.434   1.00 0.00 ? 39  GLN A OE1  16 
ATOM   10855 N  NE2  . GLN A 1 39 ? 1.480   7.989   2.834   1.00 0.00 ? 39  GLN A NE2  16 
ATOM   10856 H  H    . GLN A 1 39 ? 2.602   5.050   -1.270  1.00 0.00 ? 39  GLN A H    16 
ATOM   10857 H  HA   . GLN A 1 39 ? 1.821   7.104   -2.880  1.00 0.00 ? 39  GLN A HA   16 
ATOM   10858 H  HB2  . GLN A 1 39 ? 0.769   8.116   -0.952  1.00 0.00 ? 39  GLN A HB2  16 
ATOM   10859 H  HB3  . GLN A 1 39 ? 0.630   6.367   -0.836  1.00 0.00 ? 39  GLN A HB3  16 
ATOM   10860 H  HG2  . GLN A 1 39 ? 2.326   6.257   0.820   1.00 0.00 ? 39  GLN A HG2  16 
ATOM   10861 H  HG3  . GLN A 1 39 ? 2.765   7.946   0.569   1.00 0.00 ? 39  GLN A HG3  16 
ATOM   10862 H  HE21 . GLN A 1 39 ? 2.454   7.952   2.939   1.00 0.00 ? 39  GLN A HE21 16 
ATOM   10863 H  HE22 . GLN A 1 39 ? 0.867   8.262   3.548   1.00 0.00 ? 39  GLN A HE22 16 
ATOM   10864 N  N    . LYS A 1 40 ? 4.419   7.943   -1.079  1.00 0.00 ? 40  LYS A N    16 
ATOM   10865 C  CA   . LYS A 1 40 ? 5.479   8.933   -0.924  1.00 0.00 ? 40  LYS A CA   16 
ATOM   10866 C  C    . LYS A 1 40 ? 5.944   9.449   -2.282  1.00 0.00 ? 40  LYS A C    16 
ATOM   10867 O  O    . LYS A 1 40 ? 6.127   10.651  -2.470  1.00 0.00 ? 40  LYS A O    16 
ATOM   10868 C  CB   . LYS A 1 40 ? 6.661   8.329   -0.163  1.00 0.00 ? 40  LYS A CB   16 
ATOM   10869 C  CG   . LYS A 1 40 ? 7.638   9.366   0.363   1.00 0.00 ? 40  LYS A CG   16 
ATOM   10870 C  CD   . LYS A 1 40 ? 7.049   10.148  1.525   1.00 0.00 ? 40  LYS A CD   16 
ATOM   10871 C  CE   . LYS A 1 40 ? 7.923   11.336  1.898   1.00 0.00 ? 40  LYS A CE   16 
ATOM   10872 N  NZ   . LYS A 1 40 ? 7.623   11.837  3.268   1.00 0.00 ? 40  LYS A NZ   16 
ATOM   10873 H  H    . LYS A 1 40 ? 4.484   7.094   -0.593  1.00 0.00 ? 40  LYS A H    16 
ATOM   10874 H  HA   . LYS A 1 40 ? 5.080   9.759   -0.356  1.00 0.00 ? 40  LYS A HA   16 
ATOM   10875 H  HB2  . LYS A 1 40 ? 6.283   7.763   0.675   1.00 0.00 ? 40  LYS A HB2  16 
ATOM   10876 H  HB3  . LYS A 1 40 ? 7.197   7.664   -0.825  1.00 0.00 ? 40  LYS A HB3  16 
ATOM   10877 H  HG2  . LYS A 1 40 ? 8.535   8.866   0.698   1.00 0.00 ? 40  LYS A HG2  16 
ATOM   10878 H  HG3  . LYS A 1 40 ? 7.884   10.053  -0.434  1.00 0.00 ? 40  LYS A HG3  16 
ATOM   10879 H  HD2  . LYS A 1 40 ? 6.071   10.509  1.246   1.00 0.00 ? 40  LYS A HD2  16 
ATOM   10880 H  HD3  . LYS A 1 40 ? 6.962   9.493   2.381   1.00 0.00 ? 40  LYS A HD3  16 
ATOM   10881 H  HE2  . LYS A 1 40 ? 8.958   11.033  1.854   1.00 0.00 ? 40  LYS A HE2  16 
ATOM   10882 H  HE3  . LYS A 1 40 ? 7.750   12.130  1.187   1.00 0.00 ? 40  LYS A HE3  16 
ATOM   10883 H  HZ1  . LYS A 1 40 ? 6.777   12.442  3.250   1.00 0.00 ? 40  LYS A HZ1  16 
ATOM   10884 H  HZ2  . LYS A 1 40 ? 8.426   12.392  3.629   1.00 0.00 ? 40  LYS A HZ2  16 
ATOM   10885 H  HZ3  . LYS A 1 40 ? 7.452   11.038  3.911   1.00 0.00 ? 40  LYS A HZ3  16 
ATOM   10886 N  N    . ASN A 1 41 ? 6.132   8.532   -3.226  1.00 0.00 ? 41  ASN A N    16 
ATOM   10887 C  CA   . ASN A 1 41 ? 6.575   8.895   -4.567  1.00 0.00 ? 41  ASN A CA   16 
ATOM   10888 C  C    . ASN A 1 41 ? 5.473   9.631   -5.323  1.00 0.00 ? 41  ASN A C    16 
ATOM   10889 O  O    . ASN A 1 41 ? 4.292   9.320   -5.176  1.00 0.00 ? 41  ASN A O    16 
ATOM   10890 C  CB   . ASN A 1 41 ? 6.995   7.646   -5.344  1.00 0.00 ? 41  ASN A CB   16 
ATOM   10891 C  CG   . ASN A 1 41 ? 7.991   7.957   -6.444  1.00 0.00 ? 41  ASN A CG   16 
ATOM   10892 O  OD1  . ASN A 1 41 ? 7.610   8.222   -7.584  1.00 0.00 ? 41  ASN A OD1  16 
ATOM   10893 N  ND2  . ASN A 1 41 ? 9.275   7.925   -6.107  1.00 0.00 ? 41  ASN A ND2  16 
ATOM   10894 H  H    . ASN A 1 41 ? 5.969   7.589   -3.015  1.00 0.00 ? 41  ASN A H    16 
ATOM   10895 H  HA   . ASN A 1 41 ? 7.427   9.550   -4.468  1.00 0.00 ? 41  ASN A HA   16 
ATOM   10896 H  HB2  . ASN A 1 41 ? 7.450   6.942   -4.662  1.00 0.00 ? 41  ASN A HB2  16 
ATOM   10897 H  HB3  . ASN A 1 41 ? 6.121   7.195   -5.790  1.00 0.00 ? 41  ASN A HB3  16 
ATOM   10898 H  HD21 . ASN A 1 41 ? 9.505   7.706   -5.179  1.00 0.00 ? 41  ASN A HD21 16 
ATOM   10899 H  HD22 . ASN A 1 41 ? 9.940   8.123   -6.799  1.00 0.00 ? 41  ASN A HD22 16 
ATOM   10900 N  N    . GLN A 1 42 ? 5.869   10.608  -6.133  1.00 0.00 ? 42  GLN A N    16 
ATOM   10901 C  CA   . GLN A 1 42 ? 4.915   11.388  -6.912  1.00 0.00 ? 42  GLN A CA   16 
ATOM   10902 C  C    . GLN A 1 42 ? 3.979   10.476  -7.698  1.00 0.00 ? 42  GLN A C    16 
ATOM   10903 O  O    . GLN A 1 42 ? 2.775   10.717  -7.767  1.00 0.00 ? 42  GLN A O    16 
ATOM   10904 C  CB   . GLN A 1 42 ? 5.652   12.328  -7.867  1.00 0.00 ? 42  GLN A CB   16 
ATOM   10905 C  CG   . GLN A 1 42 ? 4.807   13.499  -8.341  1.00 0.00 ? 42  GLN A CG   16 
ATOM   10906 C  CD   . GLN A 1 42 ? 5.591   14.476  -9.195  1.00 0.00 ? 42  GLN A CD   16 
ATOM   10907 O  OE1  . GLN A 1 42 ? 6.507   14.088  -9.921  1.00 0.00 ? 42  GLN A OE1  16 
ATOM   10908 N  NE2  . GLN A 1 42 ? 5.234   15.753  -9.114  1.00 0.00 ? 42  GLN A NE2  16 
ATOM   10909 H  H    . GLN A 1 42 ? 6.825   10.809  -6.207  1.00 0.00 ? 42  GLN A H    16 
ATOM   10910 H  HA   . GLN A 1 42 ? 4.329   11.977  -6.223  1.00 0.00 ? 42  GLN A HA   16 
ATOM   10911 H  HB2  . GLN A 1 42 ? 6.525   12.720  -7.366  1.00 0.00 ? 42  GLN A HB2  16 
ATOM   10912 H  HB3  . GLN A 1 42 ? 5.967   11.766  -8.734  1.00 0.00 ? 42  GLN A HB3  16 
ATOM   10913 H  HG2  . GLN A 1 42 ? 3.981   13.119  -8.923  1.00 0.00 ? 42  GLN A HG2  16 
ATOM   10914 H  HG3  . GLN A 1 42 ? 4.426   14.024  -7.477  1.00 0.00 ? 42  GLN A HG3  16 
ATOM   10915 H  HE21 . GLN A 1 42 ? 4.495   15.989  -8.514  1.00 0.00 ? 42  GLN A HE21 16 
ATOM   10916 H  HE22 . GLN A 1 42 ? 5.724   16.406  -9.655  1.00 0.00 ? 42  GLN A HE22 16 
ATOM   10917 N  N    . ASN A 1 43 ? 4.543   9.428   -8.290  1.00 0.00 ? 43  ASN A N    16 
ATOM   10918 C  CA   . ASN A 1 43 ? 3.758   8.479   -9.073  1.00 0.00 ? 43  ASN A CA   16 
ATOM   10919 C  C    . ASN A 1 43 ? 2.438   8.162   -8.378  1.00 0.00 ? 43  ASN A C    16 
ATOM   10920 O  O    . ASN A 1 43 ? 1.364   8.338   -8.953  1.00 0.00 ? 43  ASN A O    16 
ATOM   10921 C  CB   . ASN A 1 43 ? 4.553   7.191   -9.297  1.00 0.00 ? 43  ASN A CB   16 
ATOM   10922 C  CG   . ASN A 1 43 ? 5.687   7.375   -10.286 1.00 0.00 ? 43  ASN A CG   16 
ATOM   10923 O  OD1  . ASN A 1 43 ? 5.572   8.140   -11.244 1.00 0.00 ? 43  ASN A OD1  16 
ATOM   10924 N  ND2  . ASN A 1 43 ? 6.791   6.673   -10.059 1.00 0.00 ? 43  ASN A ND2  16 
ATOM   10925 H  H    . ASN A 1 43 ? 5.508   9.288   -8.199  1.00 0.00 ? 43  ASN A H    16 
ATOM   10926 H  HA   . ASN A 1 43 ? 3.548   8.933   -10.030 1.00 0.00 ? 43  ASN A HA   16 
ATOM   10927 H  HB2  . ASN A 1 43 ? 4.971   6.865   -8.356  1.00 0.00 ? 43  ASN A HB2  16 
ATOM   10928 H  HB3  . ASN A 1 43 ? 3.890   6.427   -9.675  1.00 0.00 ? 43  ASN A HB3  16 
ATOM   10929 H  HD21 . ASN A 1 43 ? 6.811   6.083   -9.276  1.00 0.00 ? 43  ASN A HD21 16 
ATOM   10930 H  HD22 . ASN A 1 43 ? 7.540   6.774   -10.682 1.00 0.00 ? 43  ASN A HD22 16 
ATOM   10931 N  N    . SER A 1 44 ? 2.526   7.692   -7.138  1.00 0.00 ? 44  SER A N    16 
ATOM   10932 C  CA   . SER A 1 44 ? 1.338   7.347   -6.365  1.00 0.00 ? 44  SER A CA   16 
ATOM   10933 C  C    . SER A 1 44 ? 0.971   8.471   -5.401  1.00 0.00 ? 44  SER A C    16 
ATOM   10934 O  O    . SER A 1 44 ? 1.836   9.044   -4.740  1.00 0.00 ? 44  SER A O    16 
ATOM   10935 C  CB   . SER A 1 44 ? 1.569   6.049   -5.588  1.00 0.00 ? 44  SER A CB   16 
ATOM   10936 O  OG   . SER A 1 44 ? 0.526   5.819   -4.658  1.00 0.00 ? 44  SER A OG   16 
ATOM   10937 H  H    . SER A 1 44 ? 3.411   7.573   -6.734  1.00 0.00 ? 44  SER A H    16 
ATOM   10938 H  HA   . SER A 1 44 ? 0.523   7.201   -7.058  1.00 0.00 ? 44  SER A HA   16 
ATOM   10939 H  HB2  . SER A 1 44 ? 1.608   5.221   -6.279  1.00 0.00 ? 44  SER A HB2  16 
ATOM   10940 H  HB3  . SER A 1 44 ? 2.505   6.115   -5.053  1.00 0.00 ? 44  SER A HB3  16 
ATOM   10941 H  HG   . SER A 1 44 ? -0.164  6.476   -4.781  1.00 0.00 ? 44  SER A HG   16 
ATOM   10942 N  N    . GLY A 1 45 ? -0.320  8.781   -5.328  1.00 0.00 ? 45  GLY A N    16 
ATOM   10943 C  CA   . GLY A 1 45 ? -0.780  9.836   -4.443  1.00 0.00 ? 45  GLY A CA   16 
ATOM   10944 C  C    . GLY A 1 45 ? -2.256  10.137  -4.619  1.00 0.00 ? 45  GLY A C    16 
ATOM   10945 O  O    . GLY A 1 45 ? -2.926  9.580   -5.489  1.00 0.00 ? 45  GLY A O    16 
ATOM   10946 H  H    . GLY A 1 45 ? -0.965  8.290   -5.879  1.00 0.00 ? 45  GLY A H    16 
ATOM   10947 H  HA2  . GLY A 1 45 ? -0.604  9.536   -3.421  1.00 0.00 ? 45  GLY A HA2  16 
ATOM   10948 H  HA3  . GLY A 1 45 ? -0.215  10.733  -4.647  1.00 0.00 ? 45  GLY A HA3  16 
ATOM   10949 N  N    . PRO A 1 46 ? -2.784  11.036  -3.777  1.00 0.00 ? 46  PRO A N    16 
ATOM   10950 C  CA   . PRO A 1 46 ? -4.196  11.430  -3.822  1.00 0.00 ? 46  PRO A CA   16 
ATOM   10951 C  C    . PRO A 1 46 ? -4.529  12.251  -5.063  1.00 0.00 ? 46  PRO A C    16 
ATOM   10952 O  O    . PRO A 1 46 ? -5.661  12.702  -5.235  1.00 0.00 ? 46  PRO A O    16 
ATOM   10953 C  CB   . PRO A 1 46 ? -4.369  12.277  -2.559  1.00 0.00 ? 46  PRO A CB   16 
ATOM   10954 C  CG   . PRO A 1 46 ? -3.007  12.805  -2.267  1.00 0.00 ? 46  PRO A CG   16 
ATOM   10955 C  CD   . PRO A 1 46 ? -2.045  11.740  -2.715  1.00 0.00 ? 46  PRO A CD   16 
ATOM   10956 H  HA   . PRO A 1 46 ? -4.849  10.571  -3.774  1.00 0.00 ? 46  PRO A HA   16 
ATOM   10957 H  HB2  . PRO A 1 46 ? -5.071  13.076  -2.752  1.00 0.00 ? 46  PRO A HB2  16 
ATOM   10958 H  HB3  . PRO A 1 46 ? -4.733  11.657  -1.753  1.00 0.00 ? 46  PRO A HB3  16 
ATOM   10959 H  HG2  . PRO A 1 46 ? -2.841  13.717  -2.820  1.00 0.00 ? 46  PRO A HG2  16 
ATOM   10960 H  HG3  . PRO A 1 46 ? -2.902  12.983  -1.207  1.00 0.00 ? 46  PRO A HG3  16 
ATOM   10961 H  HD2  . PRO A 1 46 ? -1.142  12.186  -3.105  1.00 0.00 ? 46  PRO A HD2  16 
ATOM   10962 H  HD3  . PRO A 1 46 ? -1.815  11.071  -1.898  1.00 0.00 ? 46  PRO A HD3  16 
ATOM   10963 N  N    . SER A 1 47 ? -3.536  12.440  -5.926  1.00 0.00 ? 47  SER A N    16 
ATOM   10964 C  CA   . SER A 1 47 ? -3.723  13.210  -7.150  1.00 0.00 ? 47  SER A CA   16 
ATOM   10965 C  C    . SER A 1 47 ? -3.983  12.287  -8.338  1.00 0.00 ? 47  SER A C    16 
ATOM   10966 O  O    . SER A 1 47 ? -3.152  11.445  -8.678  1.00 0.00 ? 47  SER A O    16 
ATOM   10967 C  CB   . SER A 1 47 ? -2.494  14.078  -7.425  1.00 0.00 ? 47  SER A CB   16 
ATOM   10968 O  OG   . SER A 1 47 ? -2.362  15.098  -6.449  1.00 0.00 ? 47  SER A OG   16 
ATOM   10969 H  H    . SER A 1 47 ? -2.655  12.055  -5.733  1.00 0.00 ? 47  SER A H    16 
ATOM   10970 H  HA   . SER A 1 47 ? -4.582  13.849  -7.012  1.00 0.00 ? 47  SER A HA   16 
ATOM   10971 H  HB2  . SER A 1 47 ? -1.609  13.462  -7.405  1.00 0.00 ? 47  SER A HB2  16 
ATOM   10972 H  HB3  . SER A 1 47 ? -2.592  14.538  -8.398  1.00 0.00 ? 47  SER A HB3  16 
ATOM   10973 H  HG   . SER A 1 47 ? -2.835  15.881  -6.739  1.00 0.00 ? 47  SER A HG   16 
ATOM   10974 N  N    . SER A 1 48 ? -5.144  12.453  -8.964  1.00 0.00 ? 48  SER A N    16 
ATOM   10975 C  CA   . SER A 1 48 ? -5.517  11.633  -10.111 1.00 0.00 ? 48  SER A CA   16 
ATOM   10976 C  C    . SER A 1 48 ? -5.960  12.506  -11.281 1.00 0.00 ? 48  SER A C    16 
ATOM   10977 O  O    . SER A 1 48 ? -6.533  13.577  -11.089 1.00 0.00 ? 48  SER A O    16 
ATOM   10978 C  CB   . SER A 1 48 ? -6.638  10.664  -9.730  1.00 0.00 ? 48  SER A CB   16 
ATOM   10979 O  OG   . SER A 1 48 ? -6.209  9.757   -8.730  1.00 0.00 ? 48  SER A OG   16 
ATOM   10980 H  H    . SER A 1 48 ? -5.765  13.141  -8.646  1.00 0.00 ? 48  SER A H    16 
ATOM   10981 H  HA   . SER A 1 48 ? -4.648  11.066  -10.410 1.00 0.00 ? 48  SER A HA   16 
ATOM   10982 H  HB2  . SER A 1 48 ? -7.481  11.224  -9.353  1.00 0.00 ? 48  SER A HB2  16 
ATOM   10983 H  HB3  . SER A 1 48 ? -6.938  10.104  -10.603 1.00 0.00 ? 48  SER A HB3  16 
ATOM   10984 H  HG   . SER A 1 48 ? -5.943  8.930   -9.140  1.00 0.00 ? 48  SER A HG   16 
ATOM   10985 N  N    . GLY A 1 49 ? -5.689  12.038  -12.496 1.00 0.00 ? 49  GLY A N    16 
ATOM   10986 C  CA   . GLY A 1 49 ? -6.066  12.788  -13.681 1.00 0.00 ? 49  GLY A CA   16 
ATOM   10987 C  C    . GLY A 1 49 ? -5.400  12.261  -14.936 1.00 0.00 ? 49  GLY A C    16 
ATOM   10988 O  O    . GLY A 1 49 ? -4.172  12.212  -14.988 1.00 0.00 ? 49  GLY A O    16 
ATOM   10989 H  H    . GLY A 1 49 ? -5.229  11.178  -12.589 1.00 0.00 ? 49  GLY A H    16 
ATOM   10990 H  HA2  . GLY A 1 49 ? -7.137  12.732  -13.803 1.00 0.00 ? 49  GLY A HA2  16 
ATOM   10991 H  HA3  . GLY A 1 49 ? -5.783  13.821  -13.544 1.00 0.00 ? 49  GLY A HA3  16 
HETATM 10992 ZN ZN   . ZN  B 2 .  ? 2.923   -4.939  1.708   1.00 0.00 ? 201 ZN  A ZN   16 
ATOM   10993 N  N    . GLY A 1 1  ? -8.621  12.029  2.285   1.00 0.00 ? 1   GLY A N    17 
ATOM   10994 C  CA   . GLY A 1 1  ? -8.992  11.539  3.600   1.00 0.00 ? 1   GLY A CA   17 
ATOM   10995 C  C    . GLY A 1 1  ? -10.335 12.070  4.060   1.00 0.00 ? 1   GLY A C    17 
ATOM   10996 O  O    . GLY A 1 1  ? -10.544 13.282  4.118   1.00 0.00 ? 1   GLY A O    17 
ATOM   10997 H  H1   . GLY A 1 1  ? -8.315  12.954  2.178   1.00 0.00 ? 1   GLY A H1   17 
ATOM   10998 H  HA2  . GLY A 1 1  ? -9.033  10.460  3.572   1.00 0.00 ? 1   GLY A HA2  17 
ATOM   10999 H  HA3  . GLY A 1 1  ? -8.236  11.841  4.310   1.00 0.00 ? 1   GLY A HA3  17 
ATOM   11000 N  N    . SER A 1 2  ? -11.249 11.161  4.386   1.00 0.00 ? 2   SER A N    17 
ATOM   11001 C  CA   . SER A 1 2  ? -12.581 11.545  4.838   1.00 0.00 ? 2   SER A CA   17 
ATOM   11002 C  C    . SER A 1 2  ? -12.657 11.551  6.362   1.00 0.00 ? 2   SER A C    17 
ATOM   11003 O  O    . SER A 1 2  ? -11.881 10.874  7.036   1.00 0.00 ? 2   SER A O    17 
ATOM   11004 C  CB   . SER A 1 2  ? -13.631 10.590  4.267   1.00 0.00 ? 2   SER A CB   17 
ATOM   11005 O  OG   . SER A 1 2  ? -13.591 10.576  2.851   1.00 0.00 ? 2   SER A OG   17 
ATOM   11006 H  H    . SER A 1 2  ? -11.022 10.210  4.319   1.00 0.00 ? 2   SER A H    17 
ATOM   11007 H  HA   . SER A 1 2  ? -12.779 12.543  4.475   1.00 0.00 ? 2   SER A HA   17 
ATOM   11008 H  HB2  . SER A 1 2  ? -13.441 9.591   4.630   1.00 0.00 ? 2   SER A HB2  17 
ATOM   11009 H  HB3  . SER A 1 2  ? -14.613 10.908  4.585   1.00 0.00 ? 2   SER A HB3  17 
ATOM   11010 H  HG   . SER A 1 2  ? -12.874 10.011  2.556   1.00 0.00 ? 2   SER A HG   17 
ATOM   11011 N  N    . SER A 1 3  ? -13.599 12.321  6.898   1.00 0.00 ? 3   SER A N    17 
ATOM   11012 C  CA   . SER A 1 3  ? -13.776 12.419  8.342   1.00 0.00 ? 3   SER A CA   17 
ATOM   11013 C  C    . SER A 1 3  ? -13.581 11.060  9.007   1.00 0.00 ? 3   SER A C    17 
ATOM   11014 O  O    . SER A 1 3  ? -12.824 10.929  9.967   1.00 0.00 ? 3   SER A O    17 
ATOM   11015 C  CB   . SER A 1 3  ? -15.166 12.966  8.671   1.00 0.00 ? 3   SER A CB   17 
ATOM   11016 O  OG   . SER A 1 3  ? -15.371 13.029  10.072  1.00 0.00 ? 3   SER A OG   17 
ATOM   11017 H  H    . SER A 1 3  ? -14.187 12.837  6.307   1.00 0.00 ? 3   SER A H    17 
ATOM   11018 H  HA   . SER A 1 3  ? -13.031 13.102  8.721   1.00 0.00 ? 3   SER A HA   17 
ATOM   11019 H  HB2  . SER A 1 3  ? -15.266 13.959  8.260   1.00 0.00 ? 3   SER A HB2  17 
ATOM   11020 H  HB3  . SER A 1 3  ? -15.916 12.319  8.238   1.00 0.00 ? 3   SER A HB3  17 
ATOM   11021 H  HG   . SER A 1 3  ? -14.522 13.048  10.519  1.00 0.00 ? 3   SER A HG   17 
ATOM   11022 N  N    . GLY A 1 4  ? -14.272 10.049  8.487   1.00 0.00 ? 4   GLY A N    17 
ATOM   11023 C  CA   . GLY A 1 4  ? -14.162 8.713   9.042   1.00 0.00 ? 4   GLY A CA   17 
ATOM   11024 C  C    . GLY A 1 4  ? -13.161 7.855   8.294   1.00 0.00 ? 4   GLY A C    17 
ATOM   11025 O  O    . GLY A 1 4  ? -13.073 7.918   7.068   1.00 0.00 ? 4   GLY A O    17 
ATOM   11026 H  H    . GLY A 1 4  ? -14.861 10.213  7.721   1.00 0.00 ? 4   GLY A H    17 
ATOM   11027 H  HA2  . GLY A 1 4  ? -13.856 8.788   10.075  1.00 0.00 ? 4   GLY A HA2  17 
ATOM   11028 H  HA3  . GLY A 1 4  ? -15.131 8.236   8.997   1.00 0.00 ? 4   GLY A HA3  17 
ATOM   11029 N  N    . SER A 1 5  ? -12.403 7.051   9.034   1.00 0.00 ? 5   SER A N    17 
ATOM   11030 C  CA   . SER A 1 5  ? -11.399 6.181   8.433   1.00 0.00 ? 5   SER A CA   17 
ATOM   11031 C  C    . SER A 1 5  ? -11.957 4.778   8.216   1.00 0.00 ? 5   SER A C    17 
ATOM   11032 O  O    . SER A 1 5  ? -12.509 4.168   9.132   1.00 0.00 ? 5   SER A O    17 
ATOM   11033 C  CB   . SER A 1 5  ? -10.154 6.116   9.320   1.00 0.00 ? 5   SER A CB   17 
ATOM   11034 O  OG   . SER A 1 5  ? -9.493  7.368   9.364   1.00 0.00 ? 5   SER A OG   17 
ATOM   11035 H  H    . SER A 1 5  ? -12.521 7.046   10.007  1.00 0.00 ? 5   SER A H    17 
ATOM   11036 H  HA   . SER A 1 5  ? -11.127 6.600   7.476   1.00 0.00 ? 5   SER A HA   17 
ATOM   11037 H  HB2  . SER A 1 5  ? -10.444 5.840   10.323  1.00 0.00 ? 5   SER A HB2  17 
ATOM   11038 H  HB3  . SER A 1 5  ? -9.473  5.376   8.926   1.00 0.00 ? 5   SER A HB3  17 
ATOM   11039 H  HG   . SER A 1 5  ? -9.101  7.494   10.231  1.00 0.00 ? 5   SER A HG   17 
ATOM   11040 N  N    . SER A 1 6  ? -11.807 4.271   6.996   1.00 0.00 ? 6   SER A N    17 
ATOM   11041 C  CA   . SER A 1 6  ? -12.299 2.941   6.655   1.00 0.00 ? 6   SER A CA   17 
ATOM   11042 C  C    . SER A 1 6  ? -11.228 2.137   5.923   1.00 0.00 ? 6   SER A C    17 
ATOM   11043 O  O    . SER A 1 6  ? -10.959 2.369   4.745   1.00 0.00 ? 6   SER A O    17 
ATOM   11044 C  CB   . SER A 1 6  ? -13.556 3.045   5.790   1.00 0.00 ? 6   SER A CB   17 
ATOM   11045 O  OG   . SER A 1 6  ? -14.135 1.769   5.576   1.00 0.00 ? 6   SER A OG   17 
ATOM   11046 H  H    . SER A 1 6  ? -11.358 4.806   6.308   1.00 0.00 ? 6   SER A H    17 
ATOM   11047 H  HA   . SER A 1 6  ? -12.547 2.434   7.576   1.00 0.00 ? 6   SER A HA   17 
ATOM   11048 H  HB2  . SER A 1 6  ? -14.279 3.677   6.283   1.00 0.00 ? 6   SER A HB2  17 
ATOM   11049 H  HB3  . SER A 1 6  ? -13.296 3.474   4.833   1.00 0.00 ? 6   SER A HB3  17 
ATOM   11050 H  HG   . SER A 1 6  ? -13.930 1.196   6.318   1.00 0.00 ? 6   SER A HG   17 
ATOM   11051 N  N    . GLY A 1 7  ? -10.620 1.190   6.631   1.00 0.00 ? 7   GLY A N    17 
ATOM   11052 C  CA   . GLY A 1 7  ? -9.586  0.366   6.034   1.00 0.00 ? 7   GLY A CA   17 
ATOM   11053 C  C    . GLY A 1 7  ? -9.381  -0.938  6.779   1.00 0.00 ? 7   GLY A C    17 
ATOM   11054 O  O    . GLY A 1 7  ? -8.389  -1.106  7.488   1.00 0.00 ? 7   GLY A O    17 
ATOM   11055 H  H    . GLY A 1 7  ? -10.876 1.050   7.567   1.00 0.00 ? 7   GLY A H    17 
ATOM   11056 H  HA2  . GLY A 1 7  ? -9.861  0.146   5.013   1.00 0.00 ? 7   GLY A HA2  17 
ATOM   11057 H  HA3  . GLY A 1 7  ? -8.657  0.917   6.034   1.00 0.00 ? 7   GLY A HA3  17 
ATOM   11058 N  N    . SER A 1 8  ? -10.322 -1.863  6.621   1.00 0.00 ? 8   SER A N    17 
ATOM   11059 C  CA   . SER A 1 8  ? -10.243 -3.156  7.289   1.00 0.00 ? 8   SER A CA   17 
ATOM   11060 C  C    . SER A 1 8  ? -9.335  -4.111  6.520   1.00 0.00 ? 8   SER A C    17 
ATOM   11061 O  O    . SER A 1 8  ? -9.503  -4.312  5.316   1.00 0.00 ? 8   SER A O    17 
ATOM   11062 C  CB   . SER A 1 8  ? -11.638 -3.767  7.433   1.00 0.00 ? 8   SER A CB   17 
ATOM   11063 O  OG   . SER A 1 8  ? -11.564 -5.109  7.881   1.00 0.00 ? 8   SER A OG   17 
ATOM   11064 H  H    . SER A 1 8  ? -11.090 -1.669  6.043   1.00 0.00 ? 8   SER A H    17 
ATOM   11065 H  HA   . SER A 1 8  ? -9.826  -2.996  8.273   1.00 0.00 ? 8   SER A HA   17 
ATOM   11066 H  HB2  . SER A 1 8  ? -12.208 -3.192  8.147   1.00 0.00 ? 8   SER A HB2  17 
ATOM   11067 H  HB3  . SER A 1 8  ? -12.137 -3.747  6.474   1.00 0.00 ? 8   SER A HB3  17 
ATOM   11068 H  HG   . SER A 1 8  ? -11.179 -5.656  7.193   1.00 0.00 ? 8   SER A HG   17 
ATOM   11069 N  N    . LEU A 1 9  ? -8.371  -4.696  7.222   1.00 0.00 ? 9   LEU A N    17 
ATOM   11070 C  CA   . LEU A 1 9  ? -7.434  -5.630  6.607   1.00 0.00 ? 9   LEU A CA   17 
ATOM   11071 C  C    . LEU A 1 9  ? -8.173  -6.807  5.978   1.00 0.00 ? 9   LEU A C    17 
ATOM   11072 O  O    . LEU A 1 9  ? -9.098  -7.360  6.571   1.00 0.00 ? 9   LEU A O    17 
ATOM   11073 C  CB   . LEU A 1 9  ? -6.433  -6.138  7.646   1.00 0.00 ? 9   LEU A CB   17 
ATOM   11074 C  CG   . LEU A 1 9  ? -5.360  -5.141  8.087   1.00 0.00 ? 9   LEU A CG   17 
ATOM   11075 C  CD1  . LEU A 1 9  ? -4.697  -5.607  9.374   1.00 0.00 ? 9   LEU A CD1  17 
ATOM   11076 C  CD2  . LEU A 1 9  ? -4.324  -4.951  6.989   1.00 0.00 ? 9   LEU A CD2  17 
ATOM   11077 H  H    . LEU A 1 9  ? -8.286  -4.496  8.177   1.00 0.00 ? 9   LEU A H    17 
ATOM   11078 H  HA   . LEU A 1 9  ? -6.900  -5.100  5.832   1.00 0.00 ? 9   LEU A HA   17 
ATOM   11079 H  HB2  . LEU A 1 9  ? -6.988  -6.435  8.522   1.00 0.00 ? 9   LEU A HB2  17 
ATOM   11080 H  HB3  . LEU A 1 9  ? -5.933  -7.000  7.228   1.00 0.00 ? 9   LEU A HB3  17 
ATOM   11081 H  HG   . LEU A 1 9  ? -5.825  -4.184  8.279   1.00 0.00 ? 9   LEU A HG   17 
ATOM   11082 H  HD11 . LEU A 1 9  ? -5.432  -5.652  10.162  1.00 0.00 ? 9   LEU A HD11 17 
ATOM   11083 H  HD12 . LEU A 1 9  ? -3.916  -4.913  9.648   1.00 0.00 ? 9   LEU A HD12 17 
ATOM   11084 H  HD13 . LEU A 1 9  ? -4.269  -6.587  9.223   1.00 0.00 ? 9   LEU A HD13 17 
ATOM   11085 H  HD21 . LEU A 1 9  ? -4.057  -5.913  6.576   1.00 0.00 ? 9   LEU A HD21 17 
ATOM   11086 H  HD22 . LEU A 1 9  ? -3.445  -4.480  7.402   1.00 0.00 ? 9   LEU A HD22 17 
ATOM   11087 H  HD23 . LEU A 1 9  ? -4.736  -4.326  6.210   1.00 0.00 ? 9   LEU A HD23 17 
ATOM   11088 N  N    . MET A 1 10 ? -7.756  -7.185  4.774   1.00 0.00 ? 10  MET A N    17 
ATOM   11089 C  CA   . MET A 1 10 ? -8.377  -8.299  4.066   1.00 0.00 ? 10  MET A CA   17 
ATOM   11090 C  C    . MET A 1 10 ? -7.698  -9.617  4.425   1.00 0.00 ? 10  MET A C    17 
ATOM   11091 O  O    . MET A 1 10 ? -6.607  -9.629  4.997   1.00 0.00 ? 10  MET A O    17 
ATOM   11092 C  CB   . MET A 1 10 ? -8.309  -8.072  2.555   1.00 0.00 ? 10  MET A CB   17 
ATOM   11093 C  CG   . MET A 1 10 ? -9.199  -6.938  2.070   1.00 0.00 ? 10  MET A CG   17 
ATOM   11094 S  SD   . MET A 1 10 ? -10.890 -7.473  1.745   1.00 0.00 ? 10  MET A SD   17 
ATOM   11095 C  CE   . MET A 1 10 ? -11.229 -6.607  0.214   1.00 0.00 ? 10  MET A CE   17 
ATOM   11096 H  H    . MET A 1 10 ? -7.014  -6.705  4.351   1.00 0.00 ? 10  MET A H    17 
ATOM   11097 H  HA   . MET A 1 10 ? -9.412  -8.348  4.368   1.00 0.00 ? 10  MET A HA   17 
ATOM   11098 H  HB2  . MET A 1 10 ? -7.290  -7.843  2.282   1.00 0.00 ? 10  MET A HB2  17 
ATOM   11099 H  HB3  . MET A 1 10 ? -8.613  -8.978  2.052   1.00 0.00 ? 10  MET A HB3  17 
ATOM   11100 H  HG2  . MET A 1 10 ? -9.220  -6.167  2.826   1.00 0.00 ? 10  MET A HG2  17 
ATOM   11101 H  HG3  . MET A 1 10 ? -8.781  -6.536  1.160   1.00 0.00 ? 10  MET A HG3  17 
ATOM   11102 H  HE1  . MET A 1 10 ? -11.727 -5.673  0.431   1.00 0.00 ? 10  MET A HE1  17 
ATOM   11103 H  HE2  . MET A 1 10 ? -10.301 -6.409  -0.301  1.00 0.00 ? 10  MET A HE2  17 
ATOM   11104 H  HE3  . MET A 1 10 ? -11.865 -7.217  -0.411  1.00 0.00 ? 10  MET A HE3  17 
ATOM   11105 N  N    . ASP A 1 11 ? -8.348  -10.724 4.086   1.00 0.00 ? 11  ASP A N    17 
ATOM   11106 C  CA   . ASP A 1 11 ? -7.807  -12.048 4.372   1.00 0.00 ? 11  ASP A CA   17 
ATOM   11107 C  C    . ASP A 1 11 ? -6.805  -12.467 3.301   1.00 0.00 ? 11  ASP A C    17 
ATOM   11108 O  O    . ASP A 1 11 ? -6.466  -13.645 3.180   1.00 0.00 ? 11  ASP A O    17 
ATOM   11109 C  CB   . ASP A 1 11 ? -8.935  -13.076 4.463   1.00 0.00 ? 11  ASP A CB   17 
ATOM   11110 C  CG   . ASP A 1 11 ? -10.083 -12.600 5.332   1.00 0.00 ? 11  ASP A CG   17 
ATOM   11111 O  OD1  . ASP A 1 11 ? -9.836  -12.269 6.510   1.00 0.00 ? 11  ASP A OD1  17 
ATOM   11112 O  OD2  . ASP A 1 11 ? -11.228 -12.560 4.834   1.00 0.00 ? 11  ASP A OD2  17 
ATOM   11113 H  H    . ASP A 1 11 ? -9.214  -10.650 3.632   1.00 0.00 ? 11  ASP A H    17 
ATOM   11114 H  HA   . ASP A 1 11 ? -7.298  -12.000 5.323   1.00 0.00 ? 11  ASP A HA   17 
ATOM   11115 H  HB2  . ASP A 1 11 ? -9.317  -13.271 3.471   1.00 0.00 ? 11  ASP A HB2  17 
ATOM   11116 H  HB3  . ASP A 1 11 ? -8.546  -13.992 4.881   1.00 0.00 ? 11  ASP A HB3  17 
ATOM   11117 N  N    . VAL A 1 12 ? -6.334  -11.496 2.525   1.00 0.00 ? 12  VAL A N    17 
ATOM   11118 C  CA   . VAL A 1 12 ? -5.371  -11.765 1.464   1.00 0.00 ? 12  VAL A CA   17 
ATOM   11119 C  C    . VAL A 1 12 ? -4.037  -11.082 1.747   1.00 0.00 ? 12  VAL A C    17 
ATOM   11120 O  O    . VAL A 1 12 ? -3.995  -9.920  2.151   1.00 0.00 ? 12  VAL A O    17 
ATOM   11121 C  CB   . VAL A 1 12 ? -5.897  -11.292 0.095   1.00 0.00 ? 12  VAL A CB   17 
ATOM   11122 C  CG1  . VAL A 1 12 ? -6.113  -9.786  0.097   1.00 0.00 ? 12  VAL A CG1  17 
ATOM   11123 C  CG2  . VAL A 1 12 ? -4.938  -11.700 -1.013  1.00 0.00 ? 12  VAL A CG2  17 
ATOM   11124 H  H    . VAL A 1 12 ? -6.641  -10.577 2.670   1.00 0.00 ? 12  VAL A H    17 
ATOM   11125 H  HA   . VAL A 1 12 ? -5.215  -12.833 1.417   1.00 0.00 ? 12  VAL A HA   17 
ATOM   11126 H  HB   . VAL A 1 12 ? -6.848  -11.770 -0.086  1.00 0.00 ? 12  VAL A HB   17 
ATOM   11127 H  HG11 . VAL A 1 12 ? -6.943  -9.543  0.744   1.00 0.00 ? 12  VAL A HG11 17 
ATOM   11128 H  HG12 . VAL A 1 12 ? -5.220  -9.295  0.456   1.00 0.00 ? 12  VAL A HG12 17 
ATOM   11129 H  HG13 . VAL A 1 12 ? -6.330  -9.453  -0.907  1.00 0.00 ? 12  VAL A HG13 17 
ATOM   11130 H  HG21 . VAL A 1 12 ? -4.230  -10.904 -1.188  1.00 0.00 ? 12  VAL A HG21 17 
ATOM   11131 H  HG22 . VAL A 1 12 ? -4.410  -12.595 -0.720  1.00 0.00 ? 12  VAL A HG22 17 
ATOM   11132 H  HG23 . VAL A 1 12 ? -5.495  -11.891 -1.919  1.00 0.00 ? 12  VAL A HG23 17 
ATOM   11133 N  N    . LYS A 1 13 ? -2.948  -11.812 1.531   1.00 0.00 ? 13  LYS A N    17 
ATOM   11134 C  CA   . LYS A 1 13 ? -1.610  -11.278 1.760   1.00 0.00 ? 13  LYS A CA   17 
ATOM   11135 C  C    . LYS A 1 13 ? -1.303  -10.145 0.786   1.00 0.00 ? 13  LYS A C    17 
ATOM   11136 O  O    . LYS A 1 13 ? -1.924  -10.035 -0.271  1.00 0.00 ? 13  LYS A O    17 
ATOM   11137 C  CB   . LYS A 1 13 ? -0.565  -12.386 1.617   1.00 0.00 ? 13  LYS A CB   17 
ATOM   11138 C  CG   . LYS A 1 13 ? -0.414  -13.245 2.861   1.00 0.00 ? 13  LYS A CG   17 
ATOM   11139 C  CD   . LYS A 1 13 ? -1.528  -14.272 2.967   1.00 0.00 ? 13  LYS A CD   17 
ATOM   11140 C  CE   . LYS A 1 13 ? -1.331  -15.413 1.981   1.00 0.00 ? 13  LYS A CE   17 
ATOM   11141 N  NZ   . LYS A 1 13 ? -2.445  -16.399 2.043   1.00 0.00 ? 13  LYS A NZ   17 
ATOM   11142 H  H    . LYS A 1 13 ? -3.046  -12.733 1.208   1.00 0.00 ? 13  LYS A H    17 
ATOM   11143 H  HA   . LYS A 1 13 ? -1.576  -10.890 2.767   1.00 0.00 ? 13  LYS A HA   17 
ATOM   11144 H  HB2  . LYS A 1 13 ? -0.847  -13.027 0.794   1.00 0.00 ? 13  LYS A HB2  17 
ATOM   11145 H  HB3  . LYS A 1 13 ? 0.392   -11.935 1.398   1.00 0.00 ? 13  LYS A HB3  17 
ATOM   11146 H  HG2  . LYS A 1 13 ? 0.534   -13.760 2.818   1.00 0.00 ? 13  LYS A HG2  17 
ATOM   11147 H  HG3  . LYS A 1 13 ? -0.440  -12.607 3.733   1.00 0.00 ? 13  LYS A HG3  17 
ATOM   11148 H  HD2  . LYS A 1 13 ? -1.540  -14.675 3.969   1.00 0.00 ? 13  LYS A HD2  17 
ATOM   11149 H  HD3  . LYS A 1 13 ? -2.473  -13.789 2.761   1.00 0.00 ? 13  LYS A HD3  17 
ATOM   11150 H  HE2  . LYS A 1 13 ? -1.278  -15.004 0.984   1.00 0.00 ? 13  LYS A HE2  17 
ATOM   11151 H  HE3  . LYS A 1 13 ? -0.403  -15.916 2.214   1.00 0.00 ? 13  LYS A HE3  17 
ATOM   11152 H  HZ1  . LYS A 1 13 ? -3.004  -16.362 1.167   1.00 0.00 ? 13  LYS A HZ1  17 
ATOM   11153 H  HZ2  . LYS A 1 13 ? -3.068  -16.184 2.848   1.00 0.00 ? 13  LYS A HZ2  17 
ATOM   11154 H  HZ3  . LYS A 1 13 ? -2.066  -17.360 2.159   1.00 0.00 ? 13  LYS A HZ3  17 
ATOM   11155 N  N    . CYS A 1 14 ? -0.339  -9.305  1.149   1.00 0.00 ? 14  CYS A N    17 
ATOM   11156 C  CA   . CYS A 1 14 ? 0.053   -8.181  0.307   1.00 0.00 ? 14  CYS A CA   17 
ATOM   11157 C  C    . CYS A 1 14 ? 0.593   -8.668  -1.034  1.00 0.00 ? 14  CYS A C    17 
ATOM   11158 O  O    . CYS A 1 14 ? 1.255   -9.702  -1.109  1.00 0.00 ? 14  CYS A O    17 
ATOM   11159 C  CB   . CYS A 1 14 ? 1.108   -7.329  1.016   1.00 0.00 ? 14  CYS A CB   17 
ATOM   11160 S  SG   . CYS A 1 14 ? 1.760   -5.960  0.006   1.00 0.00 ? 14  CYS A SG   17 
ATOM   11161 H  H    . CYS A 1 14 ? 0.120   -9.444  2.004   1.00 0.00 ? 14  CYS A H    17 
ATOM   11162 H  HA   . CYS A 1 14 ? -0.824  -7.577  0.130   1.00 0.00 ? 14  CYS A HA   17 
ATOM   11163 H  HB2  . CYS A 1 14 ? 0.674   -6.901  1.908   1.00 0.00 ? 14  CYS A HB2  17 
ATOM   11164 H  HB3  . CYS A 1 14 ? 1.940   -7.959  1.294   1.00 0.00 ? 14  CYS A HB3  17 
ATOM   11165 N  N    . GLU A 1 15 ? 0.306   -7.914  -2.091  1.00 0.00 ? 15  GLU A N    17 
ATOM   11166 C  CA   . GLU A 1 15 ? 0.763   -8.269  -3.429  1.00 0.00 ? 15  GLU A CA   17 
ATOM   11167 C  C    . GLU A 1 15 ? 2.230   -8.688  -3.409  1.00 0.00 ? 15  GLU A C    17 
ATOM   11168 O  O    . GLU A 1 15 ? 2.603   -9.715  -3.979  1.00 0.00 ? 15  GLU A O    17 
ATOM   11169 C  CB   . GLU A 1 15 ? 0.570   -7.092  -4.387  1.00 0.00 ? 15  GLU A CB   17 
ATOM   11170 C  CG   . GLU A 1 15 ? 0.993   -7.394  -5.815  1.00 0.00 ? 15  GLU A CG   17 
ATOM   11171 C  CD   . GLU A 1 15 ? 1.294   -6.140  -6.612  1.00 0.00 ? 15  GLU A CD   17 
ATOM   11172 O  OE1  . GLU A 1 15 ? 2.250   -5.422  -6.251  1.00 0.00 ? 15  GLU A OE1  17 
ATOM   11173 O  OE2  . GLU A 1 15 ? 0.574   -5.877  -7.598  1.00 0.00 ? 15  GLU A OE2  17 
ATOM   11174 H  H    . GLU A 1 15 ? -0.226  -7.100  -1.967  1.00 0.00 ? 15  GLU A H    17 
ATOM   11175 H  HA   . GLU A 1 15 ? 0.168   -9.102  -3.772  1.00 0.00 ? 15  GLU A HA   17 
ATOM   11176 H  HB2  . GLU A 1 15 ? -0.474  -6.816  -4.394  1.00 0.00 ? 15  GLU A HB2  17 
ATOM   11177 H  HB3  . GLU A 1 15 ? 1.152   -6.255  -4.031  1.00 0.00 ? 15  GLU A HB3  17 
ATOM   11178 H  HG2  . GLU A 1 15 ? 1.881   -8.009  -5.792  1.00 0.00 ? 15  GLU A HG2  17 
ATOM   11179 H  HG3  . GLU A 1 15 ? 0.197   -7.933  -6.307  1.00 0.00 ? 15  GLU A HG3  17 
ATOM   11180 N  N    . THR A 1 16 ? 3.060   -7.885  -2.750  1.00 0.00 ? 16  THR A N    17 
ATOM   11181 C  CA   . THR A 1 16 ? 4.486   -8.170  -2.657  1.00 0.00 ? 16  THR A CA   17 
ATOM   11182 C  C    . THR A 1 16 ? 4.733   -9.567  -2.098  1.00 0.00 ? 16  THR A C    17 
ATOM   11183 O  O    . THR A 1 16 ? 4.229   -9.934  -1.036  1.00 0.00 ? 16  THR A O    17 
ATOM   11184 C  CB   . THR A 1 16 ? 5.209   -7.140  -1.770  1.00 0.00 ? 16  THR A CB   17 
ATOM   11185 O  OG1  . THR A 1 16 ? 5.178   -5.850  -2.392  1.00 0.00 ? 16  THR A OG1  17 
ATOM   11186 C  CG2  . THR A 1 16 ? 6.651   -7.555  -1.522  1.00 0.00 ? 16  THR A CG2  17 
ATOM   11187 H  H    . THR A 1 16 ? 2.703   -7.082  -2.317  1.00 0.00 ? 16  THR A H    17 
ATOM   11188 H  HA   . THR A 1 16 ? 4.904   -8.113  -3.652  1.00 0.00 ? 16  THR A HA   17 
ATOM   11189 H  HB   . THR A 1 16 ? 4.697   -7.084  -0.819  1.00 0.00 ? 16  THR A HB   17 
ATOM   11190 H  HG1  . THR A 1 16 ? 4.317   -5.708  -2.792  1.00 0.00 ? 16  THR A HG1  17 
ATOM   11191 H  HG21 . THR A 1 16 ? 6.726   -8.035  -0.558  1.00 0.00 ? 16  THR A HG21 17 
ATOM   11192 H  HG22 . THR A 1 16 ? 7.285   -6.681  -1.538  1.00 0.00 ? 16  THR A HG22 17 
ATOM   11193 H  HG23 . THR A 1 16 ? 6.965   -8.242  -2.293  1.00 0.00 ? 16  THR A HG23 17 
ATOM   11194 N  N    . PRO A 1 17 ? 5.526   -10.366 -2.827  1.00 0.00 ? 17  PRO A N    17 
ATOM   11195 C  CA   . PRO A 1 17 ? 5.858   -11.735 -2.421  1.00 0.00 ? 17  PRO A CA   17 
ATOM   11196 C  C    . PRO A 1 17 ? 6.774   -11.773 -1.203  1.00 0.00 ? 17  PRO A C    17 
ATOM   11197 O  O    . PRO A 1 17 ? 7.079   -12.842 -0.677  1.00 0.00 ? 17  PRO A O    17 
ATOM   11198 C  CB   . PRO A 1 17 ? 6.575   -12.304 -3.648  1.00 0.00 ? 17  PRO A CB   17 
ATOM   11199 C  CG   . PRO A 1 17 ? 7.135   -11.113 -4.346  1.00 0.00 ? 17  PRO A CG   17 
ATOM   11200 C  CD   . PRO A 1 17 ? 6.160   -9.994  -4.103  1.00 0.00 ? 17  PRO A CD   17 
ATOM   11201 H  HA   . PRO A 1 17 ? 4.970   -12.316 -2.220  1.00 0.00 ? 17  PRO A HA   17 
ATOM   11202 H  HB2  . PRO A 1 17 ? 7.357   -12.980 -3.330  1.00 0.00 ? 17  PRO A HB2  17 
ATOM   11203 H  HB3  . PRO A 1 17 ? 5.868   -12.830 -4.271  1.00 0.00 ? 17  PRO A HB3  17 
ATOM   11204 H  HG2  . PRO A 1 17 ? 8.101   -10.865 -3.932  1.00 0.00 ? 17  PRO A HG2  17 
ATOM   11205 H  HG3  . PRO A 1 17 ? 7.219   -11.313 -5.404  1.00 0.00 ? 17  PRO A HG3  17 
ATOM   11206 H  HD2  . PRO A 1 17 ? 6.681   -9.052  -4.014  1.00 0.00 ? 17  PRO A HD2  17 
ATOM   11207 H  HD3  . PRO A 1 17 ? 5.430   -9.951  -4.897  1.00 0.00 ? 17  PRO A HD3  17 
ATOM   11208 N  N    . ASN A 1 18 ? 7.210   -10.598 -0.759  1.00 0.00 ? 18  ASN A N    17 
ATOM   11209 C  CA   . ASN A 1 18 ? 8.092   -10.498 0.398   1.00 0.00 ? 18  ASN A CA   17 
ATOM   11210 C  C    . ASN A 1 18 ? 7.427   -9.708  1.522   1.00 0.00 ? 18  ASN A C    17 
ATOM   11211 O  O    . ASN A 1 18 ? 8.083   -9.300  2.481   1.00 0.00 ? 18  ASN A O    17 
ATOM   11212 C  CB   . ASN A 1 18 ? 9.411   -9.831  0.003   1.00 0.00 ? 18  ASN A CB   17 
ATOM   11213 C  CG   . ASN A 1 18 ? 10.389  -10.809 -0.622  1.00 0.00 ? 18  ASN A CG   17 
ATOM   11214 O  OD1  . ASN A 1 18 ? 9.991   -11.838 -1.167  1.00 0.00 ? 18  ASN A OD1  17 
ATOM   11215 N  ND2  . ASN A 1 18 ? 11.675  -10.490 -0.544  1.00 0.00 ? 18  ASN A ND2  17 
ATOM   11216 H  H    . ASN A 1 18 ? 6.932   -9.779  -1.221  1.00 0.00 ? 18  ASN A H    17 
ATOM   11217 H  HA   . ASN A 1 18 ? 8.295   -11.498 0.748   1.00 0.00 ? 18  ASN A HA   17 
ATOM   11218 H  HB2  . ASN A 1 18 ? 9.211   -9.046  -0.712  1.00 0.00 ? 18  ASN A HB2  17 
ATOM   11219 H  HB3  . ASN A 1 18 ? 9.870   -9.404  0.882   1.00 0.00 ? 18  ASN A HB3  17 
ATOM   11220 H  HD21 . ASN A 1 18 ? 11.919  -9.653  -0.094  1.00 0.00 ? 18  ASN A HD21 17 
ATOM   11221 H  HD22 . ASN A 1 18 ? 12.328  -11.104 -0.940  1.00 0.00 ? 18  ASN A HD22 17 
ATOM   11222 N  N    . CYS A 1 19 ? 6.121   -9.497  1.397   1.00 0.00 ? 19  CYS A N    17 
ATOM   11223 C  CA   . CYS A 1 19 ? 5.366   -8.758  2.401   1.00 0.00 ? 19  CYS A CA   17 
ATOM   11224 C  C    . CYS A 1 19 ? 4.261   -9.624  2.998   1.00 0.00 ? 19  CYS A C    17 
ATOM   11225 O  O    . CYS A 1 19 ? 3.244   -9.902  2.363   1.00 0.00 ? 19  CYS A O    17 
ATOM   11226 C  CB   . CYS A 1 19 ? 4.762   -7.494  1.786   1.00 0.00 ? 19  CYS A CB   17 
ATOM   11227 S  SG   . CYS A 1 19 ? 4.163   -6.284  3.010   1.00 0.00 ? 19  CYS A SG   17 
ATOM   11228 H  H    . CYS A 1 19 ? 5.653   -9.848  0.609   1.00 0.00 ? 19  CYS A H    17 
ATOM   11229 H  HA   . CYS A 1 19 ? 6.049   -8.474  3.187   1.00 0.00 ? 19  CYS A HA   17 
ATOM   11230 H  HB2  . CYS A 1 19 ? 5.510   -7.004  1.180   1.00 0.00 ? 19  CYS A HB2  17 
ATOM   11231 H  HB3  . CYS A 1 19 ? 3.926   -7.771  1.161   1.00 0.00 ? 19  CYS A HB3  17 
ATOM   11232 N  N    . PRO A 1 20 ? 4.465   -10.062 4.250   1.00 0.00 ? 20  PRO A N    17 
ATOM   11233 C  CA   . PRO A 1 20 ? 3.497   -10.903 4.961   1.00 0.00 ? 20  PRO A CA   17 
ATOM   11234 C  C    . PRO A 1 20 ? 2.228   -10.141 5.329   1.00 0.00 ? 20  PRO A C    17 
ATOM   11235 O  O    . PRO A 1 20 ? 1.194   -10.743 5.621   1.00 0.00 ? 20  PRO A O    17 
ATOM   11236 C  CB   . PRO A 1 20 ? 4.253   -11.323 6.224   1.00 0.00 ? 20  PRO A CB   17 
ATOM   11237 C  CG   . PRO A 1 20 ? 5.262   -10.247 6.437   1.00 0.00 ? 20  PRO A CG   17 
ATOM   11238 C  CD   . PRO A 1 20 ? 5.654   -9.770  5.067   1.00 0.00 ? 20  PRO A CD   17 
ATOM   11239 H  HA   . PRO A 1 20 ? 3.236   -11.780 4.387   1.00 0.00 ? 20  PRO A HA   17 
ATOM   11240 H  HB2  . PRO A 1 20 ? 3.564   -11.390 7.054   1.00 0.00 ? 20  PRO A HB2  17 
ATOM   11241 H  HB3  . PRO A 1 20 ? 4.726   -12.280 6.063   1.00 0.00 ? 20  PRO A HB3  17 
ATOM   11242 H  HG2  . PRO A 1 20 ? 4.823   -9.440  7.004   1.00 0.00 ? 20  PRO A HG2  17 
ATOM   11243 H  HG3  . PRO A 1 20 ? 6.121   -10.647 6.955   1.00 0.00 ? 20  PRO A HG3  17 
ATOM   11244 H  HD2  . PRO A 1 20 ? 5.862   -8.710  5.081   1.00 0.00 ? 20  PRO A HD2  17 
ATOM   11245 H  HD3  . PRO A 1 20 ? 6.512   -10.319 4.707   1.00 0.00 ? 20  PRO A HD3  17 
ATOM   11246 N  N    . PHE A 1 21 ? 2.313   -8.815  5.312   1.00 0.00 ? 21  PHE A N    17 
ATOM   11247 C  CA   . PHE A 1 21 ? 1.171   -7.972  5.644   1.00 0.00 ? 21  PHE A CA   17 
ATOM   11248 C  C    . PHE A 1 21 ? -0.028  -8.307  4.762   1.00 0.00 ? 21  PHE A C    17 
ATOM   11249 O  O    . PHE A 1 21 ? 0.107   -8.986  3.744   1.00 0.00 ? 21  PHE A O    17 
ATOM   11250 C  CB   . PHE A 1 21 ? 1.538   -6.495  5.486   1.00 0.00 ? 21  PHE A CB   17 
ATOM   11251 C  CG   . PHE A 1 21 ? 2.337   -5.949  6.635   1.00 0.00 ? 21  PHE A CG   17 
ATOM   11252 C  CD1  . PHE A 1 21 ? 1.713   -5.574  7.814   1.00 0.00 ? 21  PHE A CD1  17 
ATOM   11253 C  CD2  . PHE A 1 21 ? 3.712   -5.811  6.536   1.00 0.00 ? 21  PHE A CD2  17 
ATOM   11254 C  CE1  . PHE A 1 21 ? 2.446   -5.072  8.873   1.00 0.00 ? 21  PHE A CE1  17 
ATOM   11255 C  CE2  . PHE A 1 21 ? 4.450   -5.310  7.592   1.00 0.00 ? 21  PHE A CE2  17 
ATOM   11256 C  CZ   . PHE A 1 21 ? 3.816   -4.939  8.761   1.00 0.00 ? 21  PHE A CZ   17 
ATOM   11257 H  H    . PHE A 1 21 ? 3.165   -8.394  5.071   1.00 0.00 ? 21  PHE A H    17 
ATOM   11258 H  HA   . PHE A 1 21 ? 0.909   -8.161  6.674   1.00 0.00 ? 21  PHE A HA   17 
ATOM   11259 H  HB2  . PHE A 1 21 ? 2.123   -6.371  4.587   1.00 0.00 ? 21  PHE A HB2  17 
ATOM   11260 H  HB3  . PHE A 1 21 ? 0.632   -5.913  5.405   1.00 0.00 ? 21  PHE A HB3  17 
ATOM   11261 H  HD1  . PHE A 1 21 ? 0.641   -5.677  7.902   1.00 0.00 ? 21  PHE A HD1  17 
ATOM   11262 H  HD2  . PHE A 1 21 ? 4.209   -6.100  5.621   1.00 0.00 ? 21  PHE A HD2  17 
ATOM   11263 H  HE1  . PHE A 1 21 ? 1.947   -4.783  9.786   1.00 0.00 ? 21  PHE A HE1  17 
ATOM   11264 H  HE2  . PHE A 1 21 ? 5.521   -5.207  7.502   1.00 0.00 ? 21  PHE A HE2  17 
ATOM   11265 H  HZ   . PHE A 1 21 ? 4.390   -4.548  9.588   1.00 0.00 ? 21  PHE A HZ   17 
ATOM   11266 N  N    . PHE A 1 22 ? -1.201  -7.826  5.161   1.00 0.00 ? 22  PHE A N    17 
ATOM   11267 C  CA   . PHE A 1 22 ? -2.425  -8.075  4.408   1.00 0.00 ? 22  PHE A CA   17 
ATOM   11268 C  C    . PHE A 1 22 ? -2.853  -6.830  3.638   1.00 0.00 ? 22  PHE A C    17 
ATOM   11269 O  O    . PHE A 1 22 ? -2.546  -5.706  4.035   1.00 0.00 ? 22  PHE A O    17 
ATOM   11270 C  CB   . PHE A 1 22 ? -3.547  -8.517  5.350   1.00 0.00 ? 22  PHE A CB   17 
ATOM   11271 C  CG   . PHE A 1 22 ? -3.344  -9.892  5.920   1.00 0.00 ? 22  PHE A CG   17 
ATOM   11272 C  CD1  . PHE A 1 22 ? -3.249  -10.995 5.087   1.00 0.00 ? 22  PHE A CD1  17 
ATOM   11273 C  CD2  . PHE A 1 22 ? -3.249  -10.081 7.289   1.00 0.00 ? 22  PHE A CD2  17 
ATOM   11274 C  CE1  . PHE A 1 22 ? -3.063  -12.261 5.609   1.00 0.00 ? 22  PHE A CE1  17 
ATOM   11275 C  CE2  . PHE A 1 22 ? -3.063  -11.345 7.817   1.00 0.00 ? 22  PHE A CE2  17 
ATOM   11276 C  CZ   . PHE A 1 22 ? -2.969  -12.436 6.976   1.00 0.00 ? 22  PHE A CZ   17 
ATOM   11277 H  H    . PHE A 1 22 ? -1.245  -7.291  5.981   1.00 0.00 ? 22  PHE A H    17 
ATOM   11278 H  HA   . PHE A 1 22 ? -2.224  -8.868  3.704   1.00 0.00 ? 22  PHE A HA   17 
ATOM   11279 H  HB2  . PHE A 1 22 ? -3.610  -7.823  6.174   1.00 0.00 ? 22  PHE A HB2  17 
ATOM   11280 H  HB3  . PHE A 1 22 ? -4.482  -8.515  4.810   1.00 0.00 ? 22  PHE A HB3  17 
ATOM   11281 H  HD1  . PHE A 1 22 ? -3.322  -10.860 4.018   1.00 0.00 ? 22  PHE A HD1  17 
ATOM   11282 H  HD2  . PHE A 1 22 ? -3.322  -9.228  7.949   1.00 0.00 ? 22  PHE A HD2  17 
ATOM   11283 H  HE1  . PHE A 1 22 ? -2.990  -13.112 4.949   1.00 0.00 ? 22  PHE A HE1  17 
ATOM   11284 H  HE2  . PHE A 1 22 ? -2.989  -11.478 8.886   1.00 0.00 ? 22  PHE A HE2  17 
ATOM   11285 H  HZ   . PHE A 1 22 ? -2.824  -13.424 7.386   1.00 0.00 ? 22  PHE A HZ   17 
ATOM   11286 N  N    . MET A 1 23 ? -3.563  -7.039  2.534   1.00 0.00 ? 23  MET A N    17 
ATOM   11287 C  CA   . MET A 1 23 ? -4.034  -5.933  1.708   1.00 0.00 ? 23  MET A CA   17 
ATOM   11288 C  C    . MET A 1 23 ? -5.254  -5.266  2.336   1.00 0.00 ? 23  MET A C    17 
ATOM   11289 O  O    . MET A 1 23 ? -6.293  -5.900  2.522   1.00 0.00 ? 23  MET A O    17 
ATOM   11290 C  CB   . MET A 1 23 ? -4.377  -6.429  0.302   1.00 0.00 ? 23  MET A CB   17 
ATOM   11291 C  CG   . MET A 1 23 ? -3.363  -7.412  -0.260  1.00 0.00 ? 23  MET A CG   17 
ATOM   11292 S  SD   . MET A 1 23 ? -4.016  -8.372  -1.639  1.00 0.00 ? 23  MET A SD   17 
ATOM   11293 C  CE   . MET A 1 23 ? -2.742  -8.106  -2.870  1.00 0.00 ? 23  MET A CE   17 
ATOM   11294 H  H    . MET A 1 23 ? -3.777  -7.958  2.269   1.00 0.00 ? 23  MET A H    17 
ATOM   11295 H  HA   . MET A 1 23 ? -3.237  -5.208  1.640   1.00 0.00 ? 23  MET A HA   17 
ATOM   11296 H  HB2  . MET A 1 23 ? -5.340  -6.915  0.329   1.00 0.00 ? 23  MET A HB2  17 
ATOM   11297 H  HB3  . MET A 1 23 ? -4.429  -5.580  -0.364  1.00 0.00 ? 23  MET A HB3  17 
ATOM   11298 H  HG2  . MET A 1 23 ? -2.498  -6.862  -0.601  1.00 0.00 ? 23  MET A HG2  17 
ATOM   11299 H  HG3  . MET A 1 23 ? -3.068  -8.091  0.526   1.00 0.00 ? 23  MET A HG3  17 
ATOM   11300 H  HE1  . MET A 1 23 ? -2.017  -7.401  -2.490  1.00 0.00 ? 23