data_2ERS
# 
_entry.id   2ERS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2ERS         pdb_00002ers 10.2210/pdb2ers/pdb 
RCSB  RCSB035014   ?            ?                   
WWPDB D_1000035014 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ERS 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lorenzen, I.'   1 
'Dingley, A.J.'  2 
'Grotzinger, J.' 3 
# 
_citation.id                        primary 
_citation.title                     'The structure of the interleukin-15 alpha receptor and its implications for ligand binding.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                6642 
_citation.page_last                 6647 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16377614 
_citation.pdbx_database_id_DOI      10.1074/jbc.M513118200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lorenzen, I.'   1 ? 
primary 'Dingley, A.J.'  2 ? 
primary 'Jacques, Y.'    3 ? 
primary 'Grotzinger, J.' 4 ? 
# 
_cell.entry_id           2ERS 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ERS 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Interleukin-15 receptor alpha chain' 
_entity.formula_weight             7473.593 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'sushi domain of the Interleukin-15 receptor' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IL-15Ralpha, IL-15RA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD 
_entity_poly.pdbx_seq_one_letter_code_can   ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ILE n 
1 2  THR n 
1 3  CYS n 
1 4  PRO n 
1 5  PRO n 
1 6  PRO n 
1 7  MET n 
1 8  SER n 
1 9  VAL n 
1 10 GLU n 
1 11 HIS n 
1 12 ALA n 
1 13 ASP n 
1 14 ILE n 
1 15 TRP n 
1 16 VAL n 
1 17 LYS n 
1 18 SER n 
1 19 TYR n 
1 20 SER n 
1 21 LEU n 
1 22 TYR n 
1 23 SER n 
1 24 ARG n 
1 25 GLU n 
1 26 ARG n 
1 27 TYR n 
1 28 ILE n 
1 29 CYS n 
1 30 ASN n 
1 31 SER n 
1 32 GLY n 
1 33 PHE n 
1 34 LYS n 
1 35 ARG n 
1 36 LYS n 
1 37 ALA n 
1 38 GLY n 
1 39 THR n 
1 40 SER n 
1 41 SER n 
1 42 LEU n 
1 43 THR n 
1 44 GLU n 
1 45 CYS n 
1 46 VAL n 
1 47 LEU n 
1 48 ASN n 
1 49 LYS n 
1 50 ALA n 
1 51 THR n 
1 52 ASN n 
1 53 VAL n 
1 54 ALA n 
1 55 HIS n 
1 56 TRP n 
1 57 THR n 
1 58 THR n 
1 59 PRO n 
1 60 SER n 
1 61 LEU n 
1 62 LYS n 
1 63 CYS n 
1 64 ILE n 
1 65 ARG n 
1 66 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SG13009 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pQE30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    I15RA_HUMAN 
_struct_ref.pdbx_db_accession          Q13261 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD 
_struct_ref.pdbx_align_begin           31 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ERS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 66 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13261 
_struct_ref_seq.db_align_beg                  31 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  96 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       31 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY     1 
2 1 3D_15N-separated_NOESY     1 
3 1 HNCA                       1 
4 1 'HC(CO)NH'                 1 
5 1 'C(CO)NH'                  1 
6 1 '3D_15N_edited TOCSY a.o.' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '150mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1 mM Il-15 receptor sushi domian 15N,13C; 20mM phosphate buffer; 150mM sodium chloride; 7% D2O; pH  = 7.4' 
_pdbx_nmr_sample_details.solvent_system   '20mM phosphate buffer; 150mM sodium chloride; 7% D2O; pH  = 7.4p' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_ensemble.entry_id                                      2ERS 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2ERS 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' DYANA 1.5 GUENTERT 1 
refinement           DYANA 1.5 GUENTERT 2 
# 
_exptl.entry_id          2ERS 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2ERS 
_struct.title                     'Solution structure of the Interleukin-15 receptor sushi domain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        2ERS 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'sushi domain, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 3  SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 33 A CYS 75 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 63 SG ? ? A CYS 59 A CYS 93 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           65 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            95 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ASP 
_struct_mon_prot_cis.pdbx_label_seq_id_2    66 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ASP 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     96 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       10.85 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 24 ? ARG A 26 ? ARG A 54 ARG A 56 
A 2 LEU A 42 ? LEU A 47 ? LEU A 72 LEU A 77 
A 3 ALA A 54 ? TRP A 56 ? ALA A 84 TRP A 86 
B 1 LYS A 34 ? ARG A 35 ? LYS A 64 ARG A 65 
B 2 CYS A 63 ? ILE A 64 ? CYS A 93 ILE A 94 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 25 ? N GLU A 55 O THR A 43 ? O THR A 73 
A 2 3 N VAL A 46 ? N VAL A 76 O HIS A 55 ? O HIS A 85 
B 1 2 N LYS A 34 ? N LYS A 64 O ILE A 64 ? O ILE A 94 
# 
_database_PDB_matrix.entry_id          2ERS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ERS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . ILE A 1 1  ? 1.263   -0.780  -18.801 1.00 12.00 ? 31 ILE A N    1 
ATOM 2    C CA   . ILE A 1 1  ? 0.433   -1.330  -17.701 1.00 12.00 ? 31 ILE A CA   1 
ATOM 3    C C    . ILE A 1 1  ? 0.733   -0.780  -16.291 1.00 12.00 ? 31 ILE A C    1 
ATOM 4    O O    . ILE A 1 1  ? 1.573   -1.280  -15.541 1.00 12.00 ? 31 ILE A O    1 
ATOM 5    C CB   . ILE A 1 1  ? 0.323   -2.870  -17.671 1.00 12.00 ? 31 ILE A CB   1 
ATOM 6    C CG1  . ILE A 1 1  ? 1.623   -3.660  -17.931 1.00 12.00 ? 31 ILE A CG1  1 
ATOM 7    C CG2  . ILE A 1 1  ? -0.907  -3.330  -18.471 1.00 12.00 ? 31 ILE A CG2  1 
ATOM 8    C CD1  . ILE A 1 1  ? 2.163   -3.700  -19.371 1.00 12.00 ? 31 ILE A CD1  1 
ATOM 9    H H1   . ILE A 1 1  ? 2.019   -0.167  -18.530 1.00 0.00  ? 31 ILE A H1   1 
ATOM 10   H HA   . ILE A 1 1  ? -0.571  -0.977  -17.935 1.00 0.00  ? 31 ILE A HA   1 
ATOM 11   H HB   . ILE A 1 1  ? 0.084   -3.107  -16.634 1.00 0.00  ? 31 ILE A HB   1 
ATOM 12   H HG12 . ILE A 1 1  ? 2.401   -3.222  -17.305 1.00 0.00  ? 31 ILE A HG12 1 
ATOM 13   H HG13 . ILE A 1 1  ? 1.445   -4.690  -17.622 1.00 0.00  ? 31 ILE A HG13 1 
ATOM 14   H HG21 . ILE A 1 1  ? -1.052  -4.405  -18.358 1.00 0.00  ? 31 ILE A HG21 1 
ATOM 15   H HG22 . ILE A 1 1  ? -1.791  -2.809  -18.104 1.00 0.00  ? 31 ILE A HG22 1 
ATOM 16   H HG23 . ILE A 1 1  ? -0.759  -3.097  -19.525 1.00 0.00  ? 31 ILE A HG23 1 
ATOM 17   H HD11 . ILE A 1 1  ? 3.082   -4.282  -19.438 1.00 0.00  ? 31 ILE A HD11 1 
ATOM 18   H HD12 . ILE A 1 1  ? 1.414   -4.152  -20.021 1.00 0.00  ? 31 ILE A HD12 1 
ATOM 19   H HD13 . ILE A 1 1  ? 2.368   -2.683  -19.704 1.00 0.00  ? 31 ILE A HD13 1 
ATOM 20   N N    . THR A 1 2  ? -0.057  0.230   -15.961 1.00 12.00 ? 32 THR A N    1 
ATOM 21   C CA   . THR A 1 2  ? -0.027  0.900   -14.651 1.00 12.00 ? 32 THR A CA   1 
ATOM 22   C C    . THR A 1 2  ? -1.297  0.550   -13.861 1.00 12.00 ? 32 THR A C    1 
ATOM 23   O O    . THR A 1 2  ? -2.297  0.100   -14.421 1.00 12.00 ? 32 THR A O    1 
ATOM 24   C CB   . THR A 1 2  ? 0.203   2.420   -14.801 1.00 12.00 ? 32 THR A CB   1 
ATOM 25   O OG1  . THR A 1 2  ? 0.493   2.970   -13.511 1.00 12.00 ? 32 THR A OG1  1 
ATOM 26   C CG2  . THR A 1 2  ? -0.967  3.180   -15.451 1.00 12.00 ? 32 THR A CG2  1 
ATOM 27   H H    . THR A 1 2  ? -0.723  0.567   -16.641 1.00 0.00  ? 32 THR A H    1 
ATOM 28   H HA   . THR A 1 2  ? 0.823   0.500   -14.097 1.00 0.00  ? 32 THR A HA   1 
ATOM 29   H HB   . THR A 1 2  ? 1.077   2.560   -15.438 1.00 0.00  ? 32 THR A HB   1 
ATOM 30   H HG1  . THR A 1 2  ? 0.680   3.906   -13.609 1.00 0.00  ? 32 THR A HG1  1 
ATOM 31   H HG21 . THR A 1 2  ? -0.735  4.241   -15.541 1.00 0.00  ? 32 THR A HG21 1 
ATOM 32   H HG22 . THR A 1 2  ? -1.153  2.771   -16.444 1.00 0.00  ? 32 THR A HG22 1 
ATOM 33   H HG23 . THR A 1 2  ? -1.859  3.061   -14.836 1.00 0.00  ? 32 THR A HG23 1 
ATOM 34   N N    . CYS A 1 3  ? -1.267  0.910   -12.591 1.00 12.00 ? 33 CYS A N    1 
ATOM 35   C CA   . CYS A 1 3  ? -2.287  0.520   -11.611 1.00 12.00 ? 33 CYS A CA   1 
ATOM 36   C C    . CYS A 1 3  ? -3.257  1.680   -11.271 1.00 12.00 ? 33 CYS A C    1 
ATOM 37   O O    . CYS A 1 3  ? -2.947  2.820   -11.591 1.00 12.00 ? 33 CYS A O    1 
ATOM 38   C CB   . CYS A 1 3  ? -1.537  0.020   -10.381 1.00 12.00 ? 33 CYS A CB   1 
ATOM 39   S SG   . CYS A 1 3  ? -0.757  -1.610  -10.661 1.00 12.00 ? 33 CYS A SG   1 
ATOM 40   H H    . CYS A 1 3  ? -0.504  1.486   -12.266 1.00 0.00  ? 33 CYS A H    1 
ATOM 41   H HA   . CYS A 1 3  ? -2.875  -0.299  -12.025 1.00 0.00  ? 33 CYS A HA   1 
ATOM 42   H HB2  . CYS A 1 3  ? -0.761  0.743   -10.129 1.00 0.00  ? 33 CYS A HB2  1 
ATOM 43   H HB3  . CYS A 1 3  ? -2.242  -0.064  -9.554  1.00 0.00  ? 33 CYS A HB3  1 
ATOM 44   H HG   . CYS A 1 3  ? -0.216  -1.740  -9.446  1.00 0.00  ? 33 CYS A HG   1 
ATOM 45   N N    . PRO A 1 4  ? -4.447  1.400   -10.721 1.00 12.00 ? 34 PRO A N    1 
ATOM 46   C CA   . PRO A 1 4  ? -5.307  2.440   -10.121 1.00 12.00 ? 34 PRO A CA   1 
ATOM 47   C C    . PRO A 1 4  ? -4.597  3.110   -8.921  1.00 12.00 ? 34 PRO A C    1 
ATOM 48   O O    . PRO A 1 4  ? -3.567  2.600   -8.491  1.00 12.00 ? 34 PRO A O    1 
ATOM 49   C CB   . PRO A 1 4  ? -6.587  1.700   -9.711  1.00 12.00 ? 34 PRO A CB   1 
ATOM 50   C CG   . PRO A 1 4  ? -6.147  0.250   -9.561  1.00 12.00 ? 34 PRO A CG   1 
ATOM 51   C CD   . PRO A 1 4  ? -5.107  0.080   -10.671 1.00 12.00 ? 34 PRO A CD   1 
ATOM 52   H HA   . PRO A 1 4  ? -5.547  3.205   -10.859 1.00 0.00  ? 34 PRO A HA   1 
ATOM 53   H HB2  . PRO A 1 4  ? -7.009  2.097   -8.788  1.00 0.00  ? 34 PRO A HB2  1 
ATOM 54   H HB3  . PRO A 1 4  ? -7.308  1.765   -10.525 1.00 0.00  ? 34 PRO A HB3  1 
ATOM 55   H HG2  . PRO A 1 4  ? -5.659  0.126   -8.594  1.00 0.00  ? 34 PRO A HG2  1 
ATOM 56   H HG3  . PRO A 1 4  ? -6.978  -0.447  -9.666  1.00 0.00  ? 34 PRO A HG3  1 
ATOM 57   H HD2  . PRO A 1 4  ? -4.404  -0.720  -10.436 1.00 0.00  ? 34 PRO A HD2  1 
ATOM 58   H HD3  . PRO A 1 4  ? -5.601  -0.116  -11.622 1.00 0.00  ? 34 PRO A HD3  1 
ATOM 59   N N    . PRO A 1 5  ? -5.037  4.290   -8.461  1.00 12.00 ? 35 PRO A N    1 
ATOM 60   C CA   . PRO A 1 5  ? -4.477  4.920   -7.251  1.00 12.00 ? 35 PRO A CA   1 
ATOM 61   C C    . PRO A 1 5  ? -4.697  4.080   -5.971  1.00 12.00 ? 35 PRO A C    1 
ATOM 62   O O    . PRO A 1 5  ? -5.817  3.620   -5.741  1.00 12.00 ? 35 PRO A O    1 
ATOM 63   C CB   . PRO A 1 5  ? -5.127  6.300   -7.171  1.00 12.00 ? 35 PRO A CB   1 
ATOM 64   C CG   . PRO A 1 5  ? -6.387  6.170   -8.011  1.00 12.00 ? 35 PRO A CG   1 
ATOM 65   C CD   . PRO A 1 5  ? -5.987  5.210   -9.131  1.00 12.00 ? 35 PRO A CD   1 
ATOM 66   H HA   . PRO A 1 5  ? -3.402  5.045   -7.383  1.00 0.00  ? 35 PRO A HA   1 
ATOM 67   H HB2  . PRO A 1 5  ? -5.348  6.587   -6.143  1.00 0.00  ? 35 PRO A HB2  1 
ATOM 68   H HB3  . PRO A 1 5  ? -4.466  7.029   -7.641  1.00 0.00  ? 35 PRO A HB3  1 
ATOM 69   H HG2  . PRO A 1 5  ? -7.165  5.704   -7.407  1.00 0.00  ? 35 PRO A HG2  1 
ATOM 70   H HG3  . PRO A 1 5  ? -6.722  7.132   -8.398  1.00 0.00  ? 35 PRO A HG3  1 
ATOM 71   H HD2  . PRO A 1 5  ? -6.854  4.684   -9.531  1.00 0.00  ? 35 PRO A HD2  1 
ATOM 72   H HD3  . PRO A 1 5  ? -5.472  5.751   -9.925  1.00 0.00  ? 35 PRO A HD3  1 
ATOM 73   N N    . PRO A 1 6  ? -3.627  3.810   -5.211  1.00 12.00 ? 36 PRO A N    1 
ATOM 74   C CA   . PRO A 1 6  ? -3.727  3.200   -3.861  1.00 12.00 ? 36 PRO A CA   1 
ATOM 75   C C    . PRO A 1 6  ? -4.327  4.210   -2.871  1.00 12.00 ? 36 PRO A C    1 
ATOM 76   O O    . PRO A 1 6  ? -3.757  5.260   -2.581  1.00 12.00 ? 36 PRO A O    1 
ATOM 77   C CB   . PRO A 1 6  ? -2.307  2.770   -3.501  1.00 12.00 ? 36 PRO A CB   1 
ATOM 78   C CG   . PRO A 1 6  ? -1.407  3.670   -4.351  1.00 12.00 ? 36 PRO A CG   1 
ATOM 79   C CD   . PRO A 1 6  ? -2.217  3.880   -5.631  1.00 12.00 ? 36 PRO A CD   1 
ATOM 80   H HA   . PRO A 1 6  ? -4.369  2.320   -3.893  1.00 0.00  ? 36 PRO A HA   1 
ATOM 81   H HB2  . PRO A 1 6  ? -2.106  2.882   -2.435  1.00 0.00  ? 36 PRO A HB2  1 
ATOM 82   H HB3  . PRO A 1 6  ? -2.162  1.736   -3.814  1.00 0.00  ? 36 PRO A HB3  1 
ATOM 83   H HG2  . PRO A 1 6  ? -1.286  4.628   -3.845  1.00 0.00  ? 36 PRO A HG2  1 
ATOM 84   H HG3  . PRO A 1 6  ? -0.437  3.213   -4.549  1.00 0.00  ? 36 PRO A HG3  1 
ATOM 85   H HD2  . PRO A 1 6  ? -1.982  4.843   -6.085  1.00 0.00  ? 36 PRO A HD2  1 
ATOM 86   H HD3  . PRO A 1 6  ? -2.014  3.071   -6.332  1.00 0.00  ? 36 PRO A HD3  1 
ATOM 87   N N    . MET A 1 7  ? -5.547  3.890   -2.461  1.00 12.00 ? 37 MET A N    1 
ATOM 88   C CA   . MET A 1 7  ? -6.377  4.750   -1.591  1.00 12.00 ? 37 MET A CA   1 
ATOM 89   C C    . MET A 1 7  ? -6.947  3.880   -0.461  1.00 12.00 ? 37 MET A C    1 
ATOM 90   O O    . MET A 1 7  ? -7.957  3.190   -0.621  1.00 12.00 ? 37 MET A O    1 
ATOM 91   C CB   . MET A 1 7  ? -7.427  5.430   -2.481  1.00 12.00 ? 37 MET A CB   1 
ATOM 92   C CG   . MET A 1 7  ? -8.377  6.370   -1.741  1.00 12.00 ? 37 MET A CG   1 
ATOM 93   S SD   . MET A 1 7  ? -9.887  5.530   -1.131  1.00 12.00 ? 37 MET A SD   1 
ATOM 94   C CE   . MET A 1 7  ? -9.937  6.140   0.539   1.00 12.00 ? 37 MET A CE   1 
ATOM 95   H H    . MET A 1 7  ? -5.941  3.008   -2.757  1.00 0.00  ? 37 MET A H    1 
ATOM 96   H HA   . MET A 1 7  ? -5.754  5.525   -1.143  1.00 0.00  ? 37 MET A HA   1 
ATOM 97   H HB2  . MET A 1 7  ? -6.904  6.006   -3.244  1.00 0.00  ? 37 MET A HB2  1 
ATOM 98   H HB3  . MET A 1 7  ? -8.023  4.652   -2.958  1.00 0.00  ? 37 MET A HB3  1 
ATOM 99   H HG2  . MET A 1 7  ? -7.850  6.803   -0.891  1.00 0.00  ? 37 MET A HG2  1 
ATOM 100  H HG3  . MET A 1 7  ? -8.672  7.174   -2.415  1.00 0.00  ? 37 MET A HG3  1 
ATOM 101  H HE1  . MET A 1 7  ? -10.803 5.721   1.051   1.00 0.00  ? 37 MET A HE1  1 
ATOM 102  H HE2  . MET A 1 7  ? -9.027  5.844   1.062   1.00 0.00  ? 37 MET A HE2  1 
ATOM 103  H HE3  . MET A 1 7  ? -10.012 7.227   0.527   1.00 0.00  ? 37 MET A HE3  1 
ATOM 104  N N    . SER A 1 8  ? -6.117  3.730   0.569   1.00 12.00 ? 38 SER A N    1 
ATOM 105  C CA   . SER A 1 8  ? -6.357  2.820   1.699   1.00 12.00 ? 38 SER A CA   1 
ATOM 106  C C    . SER A 1 8  ? -5.627  3.320   2.959   1.00 12.00 ? 38 SER A C    1 
ATOM 107  O O    . SER A 1 8  ? -5.547  4.530   3.159   1.00 12.00 ? 38 SER A O    1 
ATOM 108  C CB   . SER A 1 8  ? -5.947  1.390   1.289   1.00 12.00 ? 38 SER A CB   1 
ATOM 109  O OG   . SER A 1 8  ? -6.787  0.920   0.239   1.00 12.00 ? 38 SER A OG   1 
ATOM 110  H H    . SER A 1 8  ? -5.265  4.273   0.584   1.00 0.00  ? 38 SER A H    1 
ATOM 111  H HA   . SER A 1 8  ? -7.425  2.815   1.914   1.00 0.00  ? 38 SER A HA   1 
ATOM 112  H HB2  . SER A 1 8  ? -4.912  1.396   0.947   1.00 0.00  ? 38 SER A HB2  1 
ATOM 113  H HB3  . SER A 1 8  ? -6.041  0.727   2.149   1.00 0.00  ? 38 SER A HB3  1 
ATOM 114  H HG   . SER A 1 8  ? -6.513  0.031   0.002   1.00 0.00  ? 38 SER A HG   1 
ATOM 115  N N    . VAL A 1 9  ? -5.057  2.410   3.749   1.00 12.00 ? 39 VAL A N    1 
ATOM 116  C CA   . VAL A 1 9  ? -4.267  2.660   4.969   1.00 12.00 ? 39 VAL A CA   1 
ATOM 117  C C    . VAL A 1 9  ? -4.967  3.420   6.119   1.00 12.00 ? 39 VAL A C    1 
ATOM 118  O O    . VAL A 1 9  ? -5.467  2.770   7.029   1.00 12.00 ? 39 VAL A O    1 
ATOM 119  C CB   . VAL A 1 9  ? -2.867  3.150   4.519   1.00 12.00 ? 39 VAL A CB   1 
ATOM 120  C CG1  . VAL A 1 9  ? -2.647  4.660   4.349   1.00 12.00 ? 39 VAL A CG1  1 
ATOM 121  C CG2  . VAL A 1 9  ? -1.817  2.550   5.429   1.00 12.00 ? 39 VAL A CG2  1 
ATOM 122  H H    . VAL A 1 9  ? -5.175  1.441   3.490   1.00 0.00  ? 39 VAL A H    1 
ATOM 123  H HA   . VAL A 1 9  ? -4.095  1.670   5.393   1.00 0.00  ? 39 VAL A HA   1 
ATOM 124  H HB   . VAL A 1 9  ? -2.711  2.724   3.528   1.00 0.00  ? 39 VAL A HB   1 
ATOM 125  H HG11 . VAL A 1 9  ? -1.643  4.883   3.988   1.00 0.00  ? 39 VAL A HG11 1 
ATOM 126  H HG12 . VAL A 1 9  ? -3.371  5.047   3.632   1.00 0.00  ? 39 VAL A HG12 1 
ATOM 127  H HG13 . VAL A 1 9  ? -2.790  5.152   5.311   1.00 0.00  ? 39 VAL A HG13 1 
ATOM 128  H HG21 . VAL A 1 9  ? -0.819  2.807   5.074   1.00 0.00  ? 39 VAL A HG21 1 
ATOM 129  H HG22 . VAL A 1 9  ? -1.950  2.938   6.439   1.00 0.00  ? 39 VAL A HG22 1 
ATOM 130  H HG23 . VAL A 1 9  ? -1.925  1.465   5.440   1.00 0.00  ? 39 VAL A HG23 1 
ATOM 131  N N    . GLU A 1 10 ? -5.047  4.750   6.009   1.00 12.00 ? 40 GLU A N    1 
ATOM 132  C CA   . GLU A 1 10 ? -5.557  5.780   6.939   1.00 12.00 ? 40 GLU A CA   1 
ATOM 133  C C    . GLU A 1 10 ? -4.427  6.540   7.639   1.00 12.00 ? 40 GLU A C    1 
ATOM 134  O O    . GLU A 1 10 ? -3.997  7.590   7.149   1.00 12.00 ? 40 GLU A O    1 
ATOM 135  C CB   . GLU A 1 10 ? -6.657  5.340   7.919   1.00 12.00 ? 40 GLU A CB   1 
ATOM 136  C CG   . GLU A 1 10 ? -7.947  4.970   7.159   1.00 12.00 ? 40 GLU A CG   1 
ATOM 137  C CD   . GLU A 1 10 ? -9.057  4.470   8.079   1.00 12.00 ? 40 GLU A CD   1 
ATOM 138  O OE1  . GLU A 1 10 ? -10.187 4.980   7.899   1.00 12.00 ? 40 GLU A OE1  1 
ATOM 139  O OE2  . GLU A 1 10 ? -8.787  3.560   8.899   1.00 12.00 ? 40 GLU A OE2  1 
ATOM 140  H H    . GLU A 1 10 ? -4.698  5.120   5.136   1.00 0.00  ? 40 GLU A H    1 
ATOM 141  H HA   . GLU A 1 10 ? -6.041  6.510   6.290   1.00 0.00  ? 40 GLU A HA   1 
ATOM 142  H HB2  . GLU A 1 10 ? -6.310  4.472   8.480   1.00 0.00  ? 40 GLU A HB2  1 
ATOM 143  H HB3  . GLU A 1 10 ? -6.869  6.157   8.609   1.00 0.00  ? 40 GLU A HB3  1 
ATOM 144  H HG2  . GLU A 1 10 ? -8.305  5.852   6.629   1.00 0.00  ? 40 GLU A HG2  1 
ATOM 145  H HG3  . GLU A 1 10 ? -7.714  4.188   6.437   1.00 0.00  ? 40 GLU A HG3  1 
ATOM 146  H HE2  . GLU A 1 10 ? -9.539  3.289   9.430   1.00 0.00  ? 40 GLU A HE2  1 
ATOM 147  N N    . HIS A 1 11 ? -3.787  5.910   8.629   1.00 12.00 ? 41 HIS A N    1 
ATOM 148  C CA   . HIS A 1 11 ? -2.727  6.570   9.419   1.00 12.00 ? 41 HIS A CA   1 
ATOM 149  C C    . HIS A 1 11 ? -1.317  6.390   8.829   1.00 12.00 ? 41 HIS A C    1 
ATOM 150  O O    . HIS A 1 11 ? -0.327  6.200   9.549   1.00 12.00 ? 41 HIS A O    1 
ATOM 151  C CB   . HIS A 1 11 ? -2.847  6.120   10.879  1.00 12.00 ? 41 HIS A CB   1 
ATOM 152  C CG   . HIS A 1 11 ? -4.197  6.550   11.459  1.00 12.00 ? 41 HIS A CG   1 
ATOM 153  N ND1  . HIS A 1 11 ? -4.677  7.790   11.469  1.00 12.00 ? 41 HIS A ND1  1 
ATOM 154  C CD2  . HIS A 1 11 ? -5.217  5.730   11.679  1.00 12.00 ? 41 HIS A CD2  1 
ATOM 155  C CE1  . HIS A 1 11 ? -5.987  7.740   11.659  1.00 12.00 ? 41 HIS A CE1  1 
ATOM 156  N NE2  . HIS A 1 11 ? -6.327  6.460   11.779  1.00 12.00 ? 41 HIS A NE2  1 
ATOM 157  H H    . HIS A 1 11 ? -4.027  4.955   8.853   1.00 0.00  ? 41 HIS A H    1 
ATOM 158  H HA   . HIS A 1 11 ? -2.934  7.640   9.395   1.00 0.00  ? 41 HIS A HA   1 
ATOM 159  H HB2  . HIS A 1 11 ? -2.759  5.035   10.932  1.00 0.00  ? 41 HIS A HB2  1 
ATOM 160  H HB3  . HIS A 1 11 ? -2.043  6.568   11.463  1.00 0.00  ? 41 HIS A HB3  1 
ATOM 161  H HD1  . HIS A 1 11 ? -4.132  8.632   11.351  1.00 0.00  ? 41 HIS A HD1  1 
ATOM 162  H HD2  . HIS A 1 11 ? -5.157  4.655   11.763  1.00 0.00  ? 41 HIS A HD2  1 
ATOM 163  H HE1  . HIS A 1 11 ? -6.657  8.585   11.708  1.00 0.00  ? 41 HIS A HE1  1 
ATOM 164  H HE2  . HIS A 1 11 ? -7.261  6.104   11.921  1.00 0.00  ? 41 HIS A HE2  1 
ATOM 165  N N    . ALA A 1 12 ? -1.217  6.650   7.529   1.00 12.00 ? 42 ALA A N    1 
ATOM 166  C CA   . ALA A 1 12 ? 0.023   6.480   6.749   1.00 12.00 ? 42 ALA A CA   1 
ATOM 167  C C    . ALA A 1 12 ? 0.063   7.170   5.379   1.00 12.00 ? 42 ALA A C    1 
ATOM 168  O O    . ALA A 1 12 ? -0.967  7.410   4.759   1.00 12.00 ? 42 ALA A O    1 
ATOM 169  C CB   . ALA A 1 12 ? 0.333   4.990   6.559   1.00 12.00 ? 42 ALA A CB   1 
ATOM 170  H H    . ALA A 1 12 ? -2.034  6.983   7.038   1.00 0.00  ? 42 ALA A H    1 
ATOM 171  H HA   . ALA A 1 12 ? 0.822   6.917   7.349   1.00 0.00  ? 42 ALA A HA   1 
ATOM 172  H HB1  . ALA A 1 12 ? 1.288   4.862   6.049   1.00 0.00  ? 42 ALA A HB1  1 
ATOM 173  H HB2  . ALA A 1 12 ? 0.381   4.504   7.534   1.00 0.00  ? 42 ALA A HB2  1 
ATOM 174  H HB3  . ALA A 1 12 ? -0.455  4.531   5.963   1.00 0.00  ? 42 ALA A HB3  1 
ATOM 175  N N    . ASP A 1 13 ? 1.283   7.520   4.979   1.00 12.00 ? 43 ASP A N    1 
ATOM 176  C CA   . ASP A 1 13 ? 1.583   8.060   3.629   1.00 12.00 ? 43 ASP A CA   1 
ATOM 177  C C    . ASP A 1 13 ? 2.323   7.060   2.729   1.00 12.00 ? 43 ASP A C    1 
ATOM 178  O O    . ASP A 1 13 ? 3.013   6.170   3.209   1.00 12.00 ? 43 ASP A O    1 
ATOM 179  C CB   . ASP A 1 13 ? 2.413   9.340   3.749   1.00 12.00 ? 43 ASP A CB   1 
ATOM 180  C CG   . ASP A 1 13 ? 1.523   10.580  3.789   1.00 12.00 ? 43 ASP A CG   1 
ATOM 181  O OD1  . ASP A 1 13 ? 1.193   11.060  2.689   1.00 12.00 ? 43 ASP A OD1  1 
ATOM 182  O OD2  . ASP A 1 13 ? 1.173   11.000  4.919   1.00 12.00 ? 43 ASP A OD2  1 
ATOM 183  H H    . ASP A 1 13 ? 2.055   7.417   5.623   1.00 0.00  ? 43 ASP A H    1 
ATOM 184  H HA   . ASP A 1 13 ? 0.633   8.305   3.153   1.00 0.00  ? 43 ASP A HA   1 
ATOM 185  H HB2  . ASP A 1 13 ? 3.004   9.297   4.664   1.00 0.00  ? 43 ASP A HB2  1 
ATOM 186  H HB3  . ASP A 1 13 ? 3.083   9.411   2.893   1.00 0.00  ? 43 ASP A HB3  1 
ATOM 187  H HD2  . ASP A 1 13 ? 0.610   11.776  4.872   1.00 0.00  ? 43 ASP A HD2  1 
ATOM 188  N N    . ILE A 1 14 ? 2.083   7.200   1.429   1.00 12.00 ? 44 ILE A N    1 
ATOM 189  C CA   . ILE A 1 14 ? 2.863   6.500   0.379   1.00 12.00 ? 44 ILE A CA   1 
ATOM 190  C C    . ILE A 1 14 ? 3.213   7.450   -0.771  1.00 12.00 ? 44 ILE A C    1 
ATOM 191  O O    . ILE A 1 14 ? 2.473   8.400   -1.041  1.00 12.00 ? 44 ILE A O    1 
ATOM 192  C CB   . ILE A 1 14 ? 2.113   5.240   -0.111  1.00 12.00 ? 44 ILE A CB   1 
ATOM 193  C CG1  . ILE A 1 14 ? 3.103   4.200   -0.641  1.00 12.00 ? 44 ILE A CG1  1 
ATOM 194  C CG2  . ILE A 1 14 ? 0.973   5.510   -1.111  1.00 12.00 ? 44 ILE A CG2  1 
ATOM 195  C CD1  . ILE A 1 14 ? 2.623   2.790   -0.311  1.00 12.00 ? 44 ILE A CD1  1 
ATOM 196  H H    . ILE A 1 14 ? 1.336   7.811   1.131   1.00 0.00  ? 44 ILE A H    1 
ATOM 197  H HA   . ILE A 1 14 ? 3.800   6.171   0.830   1.00 0.00  ? 44 ILE A HA   1 
ATOM 198  H HB   . ILE A 1 14 ? 1.641   4.805   0.770   1.00 0.00  ? 44 ILE A HB   1 
ATOM 199  H HG12 . ILE A 1 14 ? 3.190   4.305   -1.722  1.00 0.00  ? 44 ILE A HG12 1 
ATOM 200  H HG13 . ILE A 1 14 ? 4.077   4.364   -0.180  1.00 0.00  ? 44 ILE A HG13 1 
ATOM 201  H HG21 . ILE A 1 14 ? 0.458   4.586   -1.373  1.00 0.00  ? 44 ILE A HG21 1 
ATOM 202  H HG22 . ILE A 1 14 ? 0.258   6.199   -0.662  1.00 0.00  ? 44 ILE A HG22 1 
ATOM 203  H HG23 . ILE A 1 14 ? 1.387   5.954   -2.016  1.00 0.00  ? 44 ILE A HG23 1 
ATOM 204  H HD11 . ILE A 1 14 ? 3.336   2.060   -0.694  1.00 0.00  ? 44 ILE A HD11 1 
ATOM 205  H HD12 . ILE A 1 14 ? 2.539   2.679   0.770   1.00 0.00  ? 44 ILE A HD12 1 
ATOM 206  H HD13 . ILE A 1 14 ? 1.650   2.621   -0.771  1.00 0.00  ? 44 ILE A HD13 1 
ATOM 207  N N    . TRP A 1 15 ? 4.353   7.170   -1.381  1.00 12.00 ? 45 TRP A N    1 
ATOM 208  C CA   . TRP A 1 15 ? 4.703   7.770   -2.671  1.00 12.00 ? 45 TRP A CA   1 
ATOM 209  C C    . TRP A 1 15 ? 5.163   6.690   -3.661  1.00 12.00 ? 45 TRP A C    1 
ATOM 210  O O    . TRP A 1 15 ? 5.863   5.750   -3.301  1.00 12.00 ? 45 TRP A O    1 
ATOM 211  C CB   . TRP A 1 15 ? 5.793   8.830   -2.531  1.00 12.00 ? 45 TRP A CB   1 
ATOM 212  C CG   . TRP A 1 15 ? 5.313   10.140  -3.191  1.00 12.00 ? 45 TRP A CG   1 
ATOM 213  C CD1  . TRP A 1 15 ? 5.293   10.390  -4.491  1.00 12.00 ? 45 TRP A CD1  1 
ATOM 214  C CD2  . TRP A 1 15 ? 4.763   11.220  -2.531  1.00 12.00 ? 45 TRP A CD2  1 
ATOM 215  N NE1  . TRP A 1 15 ? 4.743   11.600  -4.711  1.00 12.00 ? 45 TRP A NE1  1 
ATOM 216  C CE2  . TRP A 1 15 ? 4.423   12.150  -3.541  1.00 12.00 ? 45 TRP A CE2  1 
ATOM 217  C CE3  . TRP A 1 15 ? 4.553   11.540  -1.171  1.00 12.00 ? 45 TRP A CE3  1 
ATOM 218  C CZ2  . TRP A 1 15 ? 3.873   13.400  -3.211  1.00 12.00 ? 45 TRP A CZ2  1 
ATOM 219  C CZ3  . TRP A 1 15 ? 4.013   12.790  -0.831  1.00 12.00 ? 45 TRP A CZ3  1 
ATOM 220  C CH2  . TRP A 1 15 ? 3.673   13.720  -1.841  1.00 12.00 ? 45 TRP A CH2  1 
ATOM 221  H H    . TRP A 1 15 ? 5.006   6.527   -0.956  1.00 0.00  ? 45 TRP A H    1 
ATOM 222  H HA   . TRP A 1 15 ? 3.809   8.249   -3.069  1.00 0.00  ? 45 TRP A HA   1 
ATOM 223  H HB2  . TRP A 1 15 ? 6.005   9.005   -1.476  1.00 0.00  ? 45 TRP A HB2  1 
ATOM 224  H HB3  . TRP A 1 15 ? 6.708   8.486   -3.014  1.00 0.00  ? 45 TRP A HB3  1 
ATOM 225  H HD1  . TRP A 1 15 ? 5.662   9.725   -5.258  1.00 0.00  ? 45 TRP A HD1  1 
ATOM 226  H HE1  . TRP A 1 15 ? 4.609   12.000  -5.629  1.00 0.00  ? 45 TRP A HE1  1 
ATOM 227  H HE3  . TRP A 1 15 ? 4.806   10.828  -0.399  1.00 0.00  ? 45 TRP A HE3  1 
ATOM 228  H HZ2  . TRP A 1 15 ? 3.607   14.105  -3.984  1.00 0.00  ? 45 TRP A HZ2  1 
ATOM 229  H HZ3  . TRP A 1 15 ? 3.857   13.043  0.207   1.00 0.00  ? 45 TRP A HZ3  1 
ATOM 230  H HH2  . TRP A 1 15 ? 3.259   14.680  -1.569  1.00 0.00  ? 45 TRP A HH2  1 
ATOM 231  N N    . VAL A 1 16 ? 4.523   6.770   -4.821  1.00 12.00 ? 46 VAL A N    1 
ATOM 232  C CA   . VAL A 1 16 ? 4.813   5.940   -6.011  1.00 12.00 ? 46 VAL A CA   1 
ATOM 233  C C    . VAL A 1 16 ? 4.403   6.720   -7.261  1.00 12.00 ? 46 VAL A C    1 
ATOM 234  O O    . VAL A 1 16 ? 3.223   6.900   -7.551  1.00 12.00 ? 46 VAL A O    1 
ATOM 235  C CB   . VAL A 1 16 ? 4.203   4.530   -5.871  1.00 12.00 ? 46 VAL A CB   1 
ATOM 236  C CG1  . VAL A 1 16 ? 2.723   4.510   -5.451  1.00 12.00 ? 46 VAL A CG1  1 
ATOM 237  C CG2  . VAL A 1 16 ? 4.483   3.660   -7.101  1.00 12.00 ? 46 VAL A CG2  1 
ATOM 238  H H    . VAL A 1 16 ? 3.779   7.447   -4.906  1.00 0.00  ? 46 VAL A H    1 
ATOM 239  H HA   . VAL A 1 16 ? 5.894   5.805   -6.061  1.00 0.00  ? 46 VAL A HA   1 
ATOM 240  H HB   . VAL A 1 16 ? 4.742   4.061   -5.047  1.00 0.00  ? 46 VAL A HB   1 
ATOM 241  H HG11 . VAL A 1 16 ? 2.372   3.489   -5.302  1.00 0.00  ? 46 VAL A HG11 1 
ATOM 242  H HG12 . VAL A 1 16 ? 2.607   5.063   -4.519  1.00 0.00  ? 46 VAL A HG12 1 
ATOM 243  H HG13 . VAL A 1 16 ? 2.123   4.980   -6.230  1.00 0.00  ? 46 VAL A HG13 1 
ATOM 244  H HG21 . VAL A 1 16 ? 4.116   2.645   -6.945  1.00 0.00  ? 46 VAL A HG21 1 
ATOM 245  H HG22 . VAL A 1 16 ? 3.983   4.091   -7.968  1.00 0.00  ? 46 VAL A HG22 1 
ATOM 246  H HG23 . VAL A 1 16 ? 5.558   3.627   -7.281  1.00 0.00  ? 46 VAL A HG23 1 
ATOM 247  N N    . LYS A 1 17 ? 5.423   7.240   -7.941  1.00 12.00 ? 47 LYS A N    1 
ATOM 248  C CA   . LYS A 1 17 ? 5.253   8.250   -9.001  1.00 12.00 ? 47 LYS A CA   1 
ATOM 249  C C    . LYS A 1 17 ? 4.583   7.820   -10.321 1.00 12.00 ? 47 LYS A C    1 
ATOM 250  O O    . LYS A 1 17 ? 4.013   8.660   -11.021 1.00 12.00 ? 47 LYS A O    1 
ATOM 251  C CB   . LYS A 1 17 ? 6.573   9.000   -9.281  1.00 12.00 ? 47 LYS A CB   1 
ATOM 252  C CG   . LYS A 1 17 ? 7.723   8.130   -9.801  1.00 12.00 ? 47 LYS A CG   1 
ATOM 253  C CD   . LYS A 1 17 ? 8.733   9.030   -10.521 1.00 12.00 ? 47 LYS A CD   1 
ATOM 254  C CE   . LYS A 1 17 ? 9.913   8.260   -11.121 1.00 12.00 ? 47 LYS A CE   1 
ATOM 255  N NZ   . LYS A 1 17 ? 10.903  7.920   -10.091 1.00 12.00 ? 47 LYS A NZ   1 
ATOM 256  H H    . LYS A 1 17 ? 6.362   6.934   -7.728  1.00 0.00  ? 47 LYS A H    1 
ATOM 257  H HA   . LYS A 1 17 ? 4.574   8.983   -8.566  1.00 0.00  ? 47 LYS A HA   1 
ATOM 258  H HB2  . LYS A 1 17 ? 6.371   9.771   -10.025 1.00 0.00  ? 47 LYS A HB2  1 
ATOM 259  H HB3  . LYS A 1 17 ? 6.899   9.468   -8.352  1.00 0.00  ? 47 LYS A HB3  1 
ATOM 260  H HG2  . LYS A 1 17 ? 8.210   7.628   -8.965  1.00 0.00  ? 47 LYS A HG2  1 
ATOM 261  H HG3  . LYS A 1 17 ? 7.335   7.385   -10.496 1.00 0.00  ? 47 LYS A HG3  1 
ATOM 262  H HD2  . LYS A 1 17 ? 8.217   9.554   -11.326 1.00 0.00  ? 47 LYS A HD2  1 
ATOM 263  H HD3  . LYS A 1 17 ? 9.122   9.755   -9.806  1.00 0.00  ? 47 LYS A HD3  1 
ATOM 264  H HE2  . LYS A 1 17 ? 9.545   7.342   -11.579 1.00 0.00  ? 47 LYS A HE2  1 
ATOM 265  H HE3  . LYS A 1 17 ? 10.390  8.875   -11.884 1.00 0.00  ? 47 LYS A HE3  1 
ATOM 266  H HZ1  . LYS A 1 17 ? 11.668  7.414   -10.513 1.00 0.00  ? 47 LYS A HZ1  1 
ATOM 267  H HZ2  . LYS A 1 17 ? 11.253  8.767   -9.668  1.00 0.00  ? 47 LYS A HZ2  1 
ATOM 268  H HZ3  . LYS A 1 17 ? 10.469  7.345   -9.383  1.00 0.00  ? 47 LYS A HZ3  1 
ATOM 269  N N    . SER A 1 18 ? 4.803   6.570   -10.731 1.00 12.00 ? 48 SER A N    1 
ATOM 270  C CA   . SER A 1 18 ? 4.273   6.040   -12.011 1.00 12.00 ? 48 SER A CA   1 
ATOM 271  C C    . SER A 1 18 ? 3.533   4.690   -11.941 1.00 12.00 ? 48 SER A C    1 
ATOM 272  O O    . SER A 1 18 ? 2.933   4.260   -12.931 1.00 12.00 ? 48 SER A O    1 
ATOM 273  C CB   . SER A 1 18 ? 5.443   5.950   -13.001 1.00 12.00 ? 48 SER A CB   1 
ATOM 274  O OG   . SER A 1 18 ? 6.613   5.450   -12.331 1.00 12.00 ? 48 SER A OG   1 
ATOM 275  H H    . SER A 1 18 ? 5.352   5.950   -10.152 1.00 0.00  ? 48 SER A H    1 
ATOM 276  H HA   . SER A 1 18 ? 3.560   6.773   -12.387 1.00 0.00  ? 48 SER A HA   1 
ATOM 277  H HB2  . SER A 1 18 ? 5.177   5.276   -13.815 1.00 0.00  ? 48 SER A HB2  1 
ATOM 278  H HB3  . SER A 1 18 ? 5.653   6.941   -13.403 1.00 0.00  ? 48 SER A HB3  1 
ATOM 279  H HG   . SER A 1 18 ? 7.332   5.401   -12.965 1.00 0.00  ? 48 SER A HG   1 
ATOM 280  N N    . TYR A 1 19 ? 3.353   4.190   -10.711 1.00 12.00 ? 49 TYR A N    1 
ATOM 281  C CA   . TYR A 1 19 ? 2.873   2.820   -10.401 1.00 12.00 ? 49 TYR A CA   1 
ATOM 282  C C    . TYR A 1 19 ? 3.593   1.750   -11.251 1.00 12.00 ? 49 TYR A C    1 
ATOM 283  O O    . TYR A 1 19 ? 4.713   2.020   -11.691 1.00 12.00 ? 49 TYR A O    1 
ATOM 284  C CB   . TYR A 1 19 ? 1.333   2.740   -10.521 1.00 12.00 ? 49 TYR A CB   1 
ATOM 285  C CG   . TYR A 1 19 ? 0.543   3.820   -9.771  1.00 12.00 ? 49 TYR A CG   1 
ATOM 286  C CD1  . TYR A 1 19 ? 0.993   4.330   -8.531  1.00 12.00 ? 49 TYR A CD1  1 
ATOM 287  C CD2  . TYR A 1 19 ? -0.647  4.290   -10.361 1.00 12.00 ? 49 TYR A CD2  1 
ATOM 288  C CE1  . TYR A 1 19 ? 0.253   5.340   -7.881  1.00 12.00 ? 49 TYR A CE1  1 
ATOM 289  C CE2  . TYR A 1 19 ? -1.397  5.290   -9.711  1.00 12.00 ? 49 TYR A CE2  1 
ATOM 290  C CZ   . TYR A 1 19 ? -0.937  5.800   -8.481  1.00 12.00 ? 49 TYR A CZ   1 
ATOM 291  O OH   . TYR A 1 19 ? -1.707  6.680   -7.791  1.00 12.00 ? 49 TYR A OH   1 
ATOM 292  H H    . TYR A 1 19 ? 3.560   4.788   -9.924  1.00 0.00  ? 49 TYR A H    1 
ATOM 293  H HA   . TYR A 1 19 ? 3.125   2.622   -9.359  1.00 0.00  ? 49 TYR A HA   1 
ATOM 294  H HB2  . TYR A 1 19 ? 1.074   2.806   -11.577 1.00 0.00  ? 49 TYR A HB2  1 
ATOM 295  H HB3  . TYR A 1 19 ? 1.016   1.768   -10.143 1.00 0.00  ? 49 TYR A HB3  1 
ATOM 296  H HD1  . TYR A 1 19 ? 1.899   3.948   -8.084  1.00 0.00  ? 49 TYR A HD1  1 
ATOM 297  H HD2  . TYR A 1 19 ? -0.982  3.886   -11.305 1.00 0.00  ? 49 TYR A HD2  1 
ATOM 298  H HE1  . TYR A 1 19 ? 0.592   5.753   -6.942  1.00 0.00  ? 49 TYR A HE1  1 
ATOM 299  H HE2  . TYR A 1 19 ? -2.311  5.660   -10.150 1.00 0.00  ? 49 TYR A HE2  1 
ATOM 300  H HH   . TYR A 1 19 ? -2.511  6.915   -8.259  1.00 0.00  ? 49 TYR A HH   1 
ATOM 301  N N    . SER A 1 20 ? 3.073   0.520   -11.271 1.00 12.00 ? 50 SER A N    1 
ATOM 302  C CA   . SER A 1 20 ? 3.523   -0.590  -12.151 1.00 12.00 ? 50 SER A CA   1 
ATOM 303  C C    . SER A 1 20 ? 2.783   -1.890  -11.841 1.00 12.00 ? 50 SER A C    1 
ATOM 304  O O    . SER A 1 20 ? 2.373   -2.130  -10.701 1.00 12.00 ? 50 SER A O    1 
ATOM 305  C CB   . SER A 1 20 ? 5.013   -0.910  -12.011 1.00 12.00 ? 50 SER A CB   1 
ATOM 306  O OG   . SER A 1 20 ? 5.593   -1.050  -13.301 1.00 12.00 ? 50 SER A OG   1 
ATOM 307  H H    . SER A 1 20 ? 2.311   0.320   -10.640 1.00 0.00  ? 50 SER A H    1 
ATOM 308  H HA   . SER A 1 20 ? 3.320   -0.297  -13.181 1.00 0.00  ? 50 SER A HA   1 
ATOM 309  H HB2  . SER A 1 20 ? 5.509   -0.100  -11.476 1.00 0.00  ? 50 SER A HB2  1 
ATOM 310  H HB3  . SER A 1 20 ? 5.134   -1.840  -11.456 1.00 0.00  ? 50 SER A HB3  1 
ATOM 311  H HG   . SER A 1 20 ? 6.526   -1.250  -13.196 1.00 0.00  ? 50 SER A HG   1 
ATOM 312  N N    . LEU A 1 21 ? 2.593   -2.700  -12.881 1.00 12.00 ? 51 LEU A N    1 
ATOM 313  C CA   . LEU A 1 21 ? 2.113   -4.100  -12.761 1.00 12.00 ? 51 LEU A CA   1 
ATOM 314  C C    . LEU A 1 21 ? 3.133   -4.910  -11.941 1.00 12.00 ? 51 LEU A C    1 
ATOM 315  O O    . LEU A 1 21 ? 4.343   -4.810  -12.171 1.00 12.00 ? 51 LEU A O    1 
ATOM 316  C CB   . LEU A 1 21 ? 2.013   -4.680  -14.181 1.00 12.00 ? 51 LEU A CB   1 
ATOM 317  C CG   . LEU A 1 21 ? 0.823   -5.630  -14.431 1.00 12.00 ? 51 LEU A CG   1 
ATOM 318  C CD1  . LEU A 1 21 ? 0.883   -6.920  -13.601 1.00 12.00 ? 51 LEU A CD1  1 
ATOM 319  C CD2  . LEU A 1 21 ? -0.517  -4.910  -14.291 1.00 12.00 ? 51 LEU A CD2  1 
ATOM 320  H H    . LEU A 1 21 ? 2.784   -2.351  -13.809 1.00 0.00  ? 51 LEU A H    1 
ATOM 321  H HA   . LEU A 1 21 ? 1.138   -4.125  -12.274 1.00 0.00  ? 51 LEU A HA   1 
ATOM 322  H HB2  . LEU A 1 21 ? 1.929   -3.847  -14.878 1.00 0.00  ? 51 LEU A HB2  1 
ATOM 323  H HB3  . LEU A 1 21 ? 2.931   -5.232  -14.383 1.00 0.00  ? 51 LEU A HB3  1 
ATOM 324  H HG   . LEU A 1 21 ? 0.897   -5.940  -15.473 1.00 0.00  ? 51 LEU A HG   1 
ATOM 325  H HD11 . LEU A 1 21 ? 0.055   -7.582  -13.856 1.00 0.00  ? 51 LEU A HD11 1 
ATOM 326  H HD12 . LEU A 1 21 ? 1.824   -7.434  -13.802 1.00 0.00  ? 51 LEU A HD12 1 
ATOM 327  H HD13 . LEU A 1 21 ? 0.826   -6.669  -12.542 1.00 0.00  ? 51 LEU A HD13 1 
ATOM 328  H HD21 . LEU A 1 21 ? -1.338  -5.583  -14.539 1.00 0.00  ? 51 LEU A HD21 1 
ATOM 329  H HD22 . LEU A 1 21 ? -0.635  -4.565  -13.264 1.00 0.00  ? 51 LEU A HD22 1 
ATOM 330  H HD23 . LEU A 1 21 ? -0.539  -4.055  -14.966 1.00 0.00  ? 51 LEU A HD23 1 
ATOM 331  N N    . TYR A 1 22 ? 2.633   -5.660  -10.961 1.00 12.00 ? 52 TYR A N    1 
ATOM 332  C CA   . TYR A 1 22 ? 3.443   -6.480  -10.021 1.00 12.00 ? 52 TYR A CA   1 
ATOM 333  C C    . TYR A 1 22 ? 4.553   -5.700  -9.281  1.00 12.00 ? 52 TYR A C    1 
ATOM 334  O O    . TYR A 1 22 ? 5.673   -6.170  -9.081  1.00 12.00 ? 52 TYR A O    1 
ATOM 335  C CB   . TYR A 1 22 ? 3.993   -7.750  -10.701 1.00 12.00 ? 52 TYR A CB   1 
ATOM 336  C CG   . TYR A 1 22 ? 2.953   -8.820  -11.051 1.00 12.00 ? 52 TYR A CG   1 
ATOM 337  C CD1  . TYR A 1 22 ? 1.743   -8.930  -10.331 1.00 12.00 ? 52 TYR A CD1  1 
ATOM 338  C CD2  . TYR A 1 22 ? 3.303   -9.750  -12.051 1.00 12.00 ? 52 TYR A CD2  1 
ATOM 339  C CE1  . TYR A 1 22 ? 0.863   -9.990  -10.611 1.00 12.00 ? 52 TYR A CE1  1 
ATOM 340  C CE2  . TYR A 1 22 ? 2.423   -10.820 -12.341 1.00 12.00 ? 52 TYR A CE2  1 
ATOM 341  C CZ   . TYR A 1 22 ? 1.213   -10.920 -11.621 1.00 12.00 ? 52 TYR A CZ   1 
ATOM 342  O OH   . TYR A 1 22 ? 0.333   -11.910 -11.921 1.00 12.00 ? 52 TYR A OH   1 
ATOM 343  H H    . TYR A 1 22 ? 1.631   -5.678  -10.839 1.00 0.00  ? 52 TYR A H    1 
ATOM 344  H HA   . TYR A 1 22 ? 2.748   -6.817  -9.252  1.00 0.00  ? 52 TYR A HA   1 
ATOM 345  H HB2  . TYR A 1 22 ? 4.493   -7.451  -11.622 1.00 0.00  ? 52 TYR A HB2  1 
ATOM 346  H HB3  . TYR A 1 22 ? 4.729   -8.200  -10.034 1.00 0.00  ? 52 TYR A HB3  1 
ATOM 347  H HD1  . TYR A 1 22 ? 1.495   -8.205  -9.570  1.00 0.00  ? 52 TYR A HD1  1 
ATOM 348  H HD2  . TYR A 1 22 ? 4.233   -9.647  -12.590 1.00 0.00  ? 52 TYR A HD2  1 
ATOM 349  H HE1  . TYR A 1 22 ? -0.063  -10.094 -10.066 1.00 0.00  ? 52 TYR A HE1  1 
ATOM 350  H HE2  . TYR A 1 22 ? 2.673   -11.547 -13.100 1.00 0.00  ? 52 TYR A HE2  1 
ATOM 351  H HH   . TYR A 1 22 ? 0.648   -12.486 -12.622 1.00 0.00  ? 52 TYR A HH   1 
ATOM 352  N N    . SER A 1 23 ? 4.133   -4.560  -8.741  1.00 12.00 ? 53 SER A N    1 
ATOM 353  C CA   . SER A 1 23 ? 5.023   -3.700  -7.931  1.00 12.00 ? 53 SER A CA   1 
ATOM 354  C C    . SER A 1 23 ? 4.553   -3.670  -6.471  1.00 12.00 ? 53 SER A C    1 
ATOM 355  O O    . SER A 1 23 ? 3.353   -3.630  -6.191  1.00 12.00 ? 53 SER A O    1 
ATOM 356  C CB   . SER A 1 23 ? 5.043   -2.280  -8.481  1.00 12.00 ? 53 SER A CB   1 
ATOM 357  O OG   . SER A 1 23 ? 6.123   -1.570  -7.871  1.00 12.00 ? 53 SER A OG   1 
ATOM 358  H H    . SER A 1 23 ? 3.178   -4.263  -8.881  1.00 0.00  ? 53 SER A H    1 
ATOM 359  H HA   . SER A 1 23 ? 6.033   -4.110  -7.972  1.00 0.00  ? 53 SER A HA   1 
ATOM 360  H HB2  . SER A 1 23 ? 5.185   -2.307  -9.561  1.00 0.00  ? 53 SER A HB2  1 
ATOM 361  H HB3  . SER A 1 23 ? 4.101   -1.784  -8.250  1.00 0.00  ? 53 SER A HB3  1 
ATOM 362  H HG   . SER A 1 23 ? 6.132   -0.676  -8.220  1.00 0.00  ? 53 SER A HG   1 
ATOM 363  N N    . ARG A 1 24 ? 5.533   -3.770  -5.581  1.00 12.00 ? 54 ARG A N    1 
ATOM 364  C CA   . ARG A 1 24 ? 5.303   -3.730  -4.121  1.00 12.00 ? 54 ARG A CA   1 
ATOM 365  C C    . ARG A 1 24 ? 5.593   -2.320  -3.591  1.00 12.00 ? 54 ARG A C    1 
ATOM 366  O O    . ARG A 1 24 ? 6.563   -1.670  -3.991  1.00 12.00 ? 54 ARG A O    1 
ATOM 367  C CB   . ARG A 1 24 ? 6.253   -4.630  -3.331  1.00 12.00 ? 54 ARG A CB   1 
ATOM 368  C CG   . ARG A 1 24 ? 6.283   -6.100  -3.741  1.00 12.00 ? 54 ARG A CG   1 
ATOM 369  C CD   . ARG A 1 24 ? 7.073   -6.860  -2.681  1.00 12.00 ? 54 ARG A CD   1 
ATOM 370  N NE   . ARG A 1 24 ? 7.493   -8.170  -3.211  1.00 12.00 ? 54 ARG A NE   1 
ATOM 371  C CZ   . ARG A 1 24 ? 8.733   -8.670  -3.171  1.00 12.00 ? 54 ARG A CZ   1 
ATOM 372  N NH1  . ARG A 1 24 ? 9.743   -8.020  -2.621  1.00 12.00 ? 54 ARG A NH1  1 
ATOM 373  N NH2  . ARG A 1 24 ? 8.983   -9.830  -3.751  1.00 12.00 ? 54 ARG A NH2  1 
ATOM 374  H H    . ARG A 1 24 ? 6.483   -3.880  -5.906  1.00 0.00  ? 54 ARG A H    1 
ATOM 375  H HA   . ARG A 1 24 ? 4.270   -4.013  -3.921  1.00 0.00  ? 54 ARG A HA   1 
ATOM 376  H HB2  . ARG A 1 24 ? 7.261   -4.232  -3.445  1.00 0.00  ? 54 ARG A HB2  1 
ATOM 377  H HB3  . ARG A 1 24 ? 5.961   -4.583  -2.282  1.00 0.00  ? 54 ARG A HB3  1 
ATOM 378  H HG2  . ARG A 1 24 ? 5.267   -6.490  -3.797  1.00 0.00  ? 54 ARG A HG2  1 
ATOM 379  H HG3  . ARG A 1 24 ? 6.768   -6.205  -4.712  1.00 0.00  ? 54 ARG A HG3  1 
ATOM 380  H HD2  . ARG A 1 24 ? 7.954   -6.282  -2.402  1.00 0.00  ? 54 ARG A HD2  1 
ATOM 381  H HD3  . ARG A 1 24 ? 6.449   -7.008  -1.800  1.00 0.00  ? 54 ARG A HD3  1 
ATOM 382  H HE   . ARG A 1 24 ? 6.773   -8.733  -3.641  1.00 0.00  ? 54 ARG A HE   1 
ATOM 383  H HH11 . ARG A 1 24 ? 9.585   -7.118  -2.196  1.00 0.00  ? 54 ARG A HH11 1 
ATOM 384  H HH12 . ARG A 1 24 ? 10.673  -8.414  -2.619  1.00 0.00  ? 54 ARG A HH12 1 
ATOM 385  H HH21 . ARG A 1 24 ? 8.237   -10.338 -4.205  1.00 0.00  ? 54 ARG A HH21 1 
ATOM 386  H HH22 . ARG A 1 24 ? 9.919   -10.211 -3.742  1.00 0.00  ? 54 ARG A HH22 1 
ATOM 387  N N    . GLU A 1 25 ? 4.703   -1.870  -2.721  1.00 12.00 ? 55 GLU A N    1 
ATOM 388  C CA   . GLU A 1 25 ? 4.953   -0.680  -1.891  1.00 12.00 ? 55 GLU A CA   1 
ATOM 389  C C    . GLU A 1 25 ? 4.503   -0.870  -0.441  1.00 12.00 ? 55 GLU A C    1 
ATOM 390  O O    . GLU A 1 25 ? 3.503   -1.530  -0.161  1.00 12.00 ? 55 GLU A O    1 
ATOM 391  C CB   . GLU A 1 25 ? 4.273   0.570   -2.471  1.00 12.00 ? 55 GLU A CB   1 
ATOM 392  C CG   . GLU A 1 25 ? 4.993   1.120   -3.701  1.00 12.00 ? 55 GLU A CG   1 
ATOM 393  C CD   . GLU A 1 25 ? 4.153   0.930   -4.971  1.00 12.00 ? 55 GLU A CD   1 
ATOM 394  O OE1  . GLU A 1 25 ? 4.713   0.420   -5.961  1.00 12.00 ? 55 GLU A OE1  1 
ATOM 395  O OE2  . GLU A 1 25 ? 3.003   1.410   -4.951  1.00 12.00 ? 55 GLU A OE2  1 
ATOM 396  H H    . GLU A 1 25 ? 3.822   -2.351  -2.614  1.00 0.00  ? 55 GLU A H    1 
ATOM 397  H HA   . GLU A 1 25 ? 6.030   -0.509  -1.890  1.00 0.00  ? 55 GLU A HA   1 
ATOM 398  H HB2  . GLU A 1 25 ? 3.252   0.312   -2.751  1.00 0.00  ? 55 GLU A HB2  1 
ATOM 399  H HB3  . GLU A 1 25 ? 4.254   1.344   -1.703  1.00 0.00  ? 55 GLU A HB3  1 
ATOM 400  H HG2  . GLU A 1 25 ? 5.184   2.183   -3.556  1.00 0.00  ? 55 GLU A HG2  1 
ATOM 401  H HG3  . GLU A 1 25 ? 5.943   0.598   -3.821  1.00 0.00  ? 55 GLU A HG3  1 
ATOM 402  H HE2  . GLU A 1 25 ? 2.536   1.289   -5.780  1.00 0.00  ? 55 GLU A HE2  1 
ATOM 403  N N    . ARG A 1 26 ? 5.343   -0.360  0.449   1.00 12.00 ? 56 ARG A N    1 
ATOM 404  C CA   . ARG A 1 26 ? 4.993   -0.240  1.869   1.00 12.00 ? 56 ARG A CA   1 
ATOM 405  C C    . ARG A 1 26 ? 4.783   1.230   2.259   1.00 12.00 ? 56 ARG A C    1 
ATOM 406  O O    . ARG A 1 26 ? 5.423   2.140   1.729   1.00 12.00 ? 56 ARG A O    1 
ATOM 407  C CB   . ARG A 1 26 ? 6.013   -0.920  2.799   1.00 12.00 ? 56 ARG A CB   1 
ATOM 408  C CG   . ARG A 1 26 ? 7.413   -0.330  2.709   1.00 12.00 ? 56 ARG A CG   1 
ATOM 409  C CD   . ARG A 1 26 ? 8.323   -0.900  3.799   1.00 12.00 ? 56 ARG A CD   1 
ATOM 410  N NE   . ARG A 1 26 ? 9.683   -0.380  3.579   1.00 12.00 ? 56 ARG A NE   1 
ATOM 411  C CZ   . ARG A 1 26 ? 10.673  -1.010  2.959   1.00 12.00 ? 56 ARG A CZ   1 
ATOM 412  N NH1  . ARG A 1 26 ? 10.543  -2.250  2.499   1.00 12.00 ? 56 ARG A NH1  1 
ATOM 413  N NH2  . ARG A 1 26 ? 11.763  -0.340  2.619   1.00 12.00 ? 56 ARG A NH2  1 
ATOM 414  H H    . ARG A 1 26 ? 6.255   -0.042  0.152   1.00 0.00  ? 56 ARG A H    1 
ATOM 415  H HA   . ARG A 1 26 ? 4.042   -0.755  2.005   1.00 0.00  ? 56 ARG A HA   1 
ATOM 416  H HB2  . ARG A 1 26 ? 5.663   -0.819  3.826   1.00 0.00  ? 56 ARG A HB2  1 
ATOM 417  H HB3  . ARG A 1 26 ? 6.068   -1.976  2.536   1.00 0.00  ? 56 ARG A HB3  1 
ATOM 418  H HG2  . ARG A 1 26 ? 7.837   -0.566  1.733   1.00 0.00  ? 56 ARG A HG2  1 
ATOM 419  H HG3  . ARG A 1 26 ? 7.352   0.752   2.827   1.00 0.00  ? 56 ARG A HG3  1 
ATOM 420  H HD2  . ARG A 1 26 ? 7.963   -0.592  4.781   1.00 0.00  ? 56 ARG A HD2  1 
ATOM 421  H HD3  . ARG A 1 26 ? 8.329   -1.989  3.745   1.00 0.00  ? 56 ARG A HD3  1 
ATOM 422  H HE   . ARG A 1 26 ? 9.871   0.545   3.938   1.00 0.00  ? 56 ARG A HE   1 
ATOM 423  H HH11 . ARG A 1 26 ? 9.686   -2.758  2.666   1.00 0.00  ? 56 ARG A HH11 1 
ATOM 424  H HH12 . ARG A 1 26 ? 11.290  -2.693  1.984   1.00 0.00  ? 56 ARG A HH12 1 
ATOM 425  H HH21 . ARG A 1 26 ? 11.857  0.632   2.877   1.00 0.00  ? 56 ARG A HH21 1 
ATOM 426  H HH22 . ARG A 1 26 ? 12.503  -0.795  2.103   1.00 0.00  ? 56 ARG A HH22 1 
ATOM 427  N N    . TYR A 1 27 ? 3.793   1.410   3.109   1.00 12.00 ? 57 TYR A N    1 
ATOM 428  C CA   . TYR A 1 27 ? 3.443   2.730   3.669   1.00 12.00 ? 57 TYR A CA   1 
ATOM 429  C C    . TYR A 1 27 ? 4.463   3.220   4.709   1.00 12.00 ? 57 TYR A C    1 
ATOM 430  O O    . TYR A 1 27 ? 4.703   2.550   5.709   1.00 12.00 ? 57 TYR A O    1 
ATOM 431  C CB   . TYR A 1 27 ? 2.033   2.680   4.259   1.00 12.00 ? 57 TYR A CB   1 
ATOM 432  C CG   . TYR A 1 27 ? 0.953   2.660   3.169   1.00 12.00 ? 57 TYR A CG   1 
ATOM 433  C CD1  . TYR A 1 27 ? 0.486   3.872   2.612   1.00 12.00 ? 57 TYR A CD1  1 
ATOM 434  C CD2  . TYR A 1 27 ? 0.520   1.403   2.708   1.00 12.00 ? 57 TYR A CD2  1 
ATOM 435  C CE1  . TYR A 1 27 ? -0.434  3.805   1.535   1.00 12.00 ? 57 TYR A CE1  1 
ATOM 436  C CE2  . TYR A 1 27 ? -0.409  1.346   1.650   1.00 12.00 ? 57 TYR A CE2  1 
ATOM 437  C CZ   . TYR A 1 27 ? -0.856  2.548   1.064   1.00 12.00 ? 57 TYR A CZ   1 
ATOM 438  O OH   . TYR A 1 27 ? -1.584  2.463   -0.082  1.00 12.00 ? 57 TYR A OH   1 
ATOM 439  H H    . TYR A 1 27 ? 3.241   0.614   3.396   1.00 0.00  ? 57 TYR A H    1 
ATOM 440  H HA   . TYR A 1 27 ? 3.441   3.446   2.847   1.00 0.00  ? 57 TYR A HA   1 
ATOM 441  H HB2  . TYR A 1 27 ? 1.936   1.783   4.871   1.00 0.00  ? 57 TYR A HB2  1 
ATOM 442  H HB3  . TYR A 1 27 ? 1.882   3.554   4.892   1.00 0.00  ? 57 TYR A HB3  1 
ATOM 443  H HD1  . TYR A 1 27 ? 0.821   4.824   2.996   1.00 0.00  ? 57 TYR A HD1  1 
ATOM 444  H HD2  . TYR A 1 27 ? 0.894   0.495   3.158   1.00 0.00  ? 57 TYR A HD2  1 
ATOM 445  H HE1  . TYR A 1 27 ? -0.807  4.710   1.080   1.00 0.00  ? 57 TYR A HE1  1 
ATOM 446  H HE2  . TYR A 1 27 ? -0.773  0.394   1.293   1.00 0.00  ? 57 TYR A HE2  1 
ATOM 447  H HH   . TYR A 1 27 ? -1.782  1.561   -0.343  1.00 0.00  ? 57 TYR A HH   1 
ATOM 448  N N    . ILE A 1 28 ? 4.793   4.500   4.569   1.00 12.00 ? 58 ILE A N    1 
ATOM 449  C CA   . ILE A 1 28 ? 5.823   5.230   5.349   1.00 12.00 ? 58 ILE A CA   1 
ATOM 450  C C    . ILE A 1 28 ? 5.383   5.530   6.799   1.00 12.00 ? 58 ILE A C    1 
ATOM 451  O O    . ILE A 1 28 ? 6.173   6.030   7.599   1.00 12.00 ? 58 ILE A O    1 
ATOM 452  C CB   . ILE A 1 28 ? 6.153   6.520   4.549   1.00 12.00 ? 58 ILE A CB   1 
ATOM 453  C CG1  . ILE A 1 28 ? 6.553   6.260   3.089   1.00 12.00 ? 58 ILE A CG1  1 
ATOM 454  C CG2  . ILE A 1 28 ? 7.183   7.450   5.219   1.00 12.00 ? 58 ILE A CG2  1 
ATOM 455  C CD1  . ILE A 1 28 ? 7.743   5.320   2.859   1.00 12.00 ? 58 ILE A CD1  1 
ATOM 456  H H    . ILE A 1 28 ? 4.300   5.033   3.868   1.00 0.00  ? 58 ILE A H    1 
ATOM 457  H HA   . ILE A 1 28 ? 6.719   4.611   5.399   1.00 0.00  ? 58 ILE A HA   1 
ATOM 458  H HB   . ILE A 1 28 ? 5.220   7.082   4.513   1.00 0.00  ? 58 ILE A HB   1 
ATOM 459  H HG12 . ILE A 1 28 ? 5.690   5.830   2.581   1.00 0.00  ? 58 ILE A HG12 1 
ATOM 460  H HG13 . ILE A 1 28 ? 6.800   7.221   2.638   1.00 0.00  ? 58 ILE A HG13 1 
ATOM 461  H HG21 . ILE A 1 28 ? 7.318   8.369   4.649   1.00 0.00  ? 58 ILE A HG21 1 
ATOM 462  H HG22 . ILE A 1 28 ? 6.837   7.704   6.221   1.00 0.00  ? 58 ILE A HG22 1 
ATOM 463  H HG23 . ILE A 1 28 ? 8.141   6.934   5.286   1.00 0.00  ? 58 ILE A HG23 1 
ATOM 464  H HD11 . ILE A 1 28 ? 7.950   5.196   1.796   1.00 0.00  ? 58 ILE A HD11 1 
ATOM 465  H HD12 . ILE A 1 28 ? 8.627   5.736   3.344   1.00 0.00  ? 58 ILE A HD12 1 
ATOM 466  H HD13 . ILE A 1 28 ? 7.517   4.345   3.290   1.00 0.00  ? 58 ILE A HD13 1 
ATOM 467  N N    . CYS A 1 29 ? 4.233   4.980   7.199   1.00 12.00 ? 59 CYS A N    1 
ATOM 468  C CA   . CYS A 1 29 ? 3.433   5.460   8.339   1.00 12.00 ? 59 CYS A CA   1 
ATOM 469  C C    . CYS A 1 29 ? 3.103   6.970   8.239   1.00 12.00 ? 59 CYS A C    1 
ATOM 470  O O    . CYS A 1 29 ? 3.233   7.560   7.169   1.00 12.00 ? 59 CYS A O    1 
ATOM 471  C CB   . CYS A 1 29 ? 4.053   5.100   9.699   1.00 12.00 ? 59 CYS A CB   1 
ATOM 472  S SG   . CYS A 1 29 ? 3.763   3.390   10.269  1.00 12.00 ? 59 CYS A SG   1 
ATOM 473  H H    . CYS A 1 29 ? 3.881   4.180   6.692   1.00 0.00  ? 59 CYS A H    1 
ATOM 474  H HA   . CYS A 1 29 ? 2.483   4.929   8.282   1.00 0.00  ? 59 CYS A HA   1 
ATOM 475  H HB2  . CYS A 1 29 ? 5.129   5.255   9.622   1.00 0.00  ? 59 CYS A HB2  1 
ATOM 476  H HB3  . CYS A 1 29 ? 3.638   5.781   10.442  1.00 0.00  ? 59 CYS A HB3  1 
ATOM 477  H HG   . CYS A 1 29 ? 4.427   3.476   11.425  1.00 0.00  ? 59 CYS A HG   1 
ATOM 478  N N    . ASN A 1 30 ? 2.283   7.440   9.179   1.00 12.00 ? 60 ASN A N    1 
ATOM 479  C CA   . ASN A 1 30 ? 2.113   8.890   9.419   1.00 12.00 ? 60 ASN A CA   1 
ATOM 480  C C    . ASN A 1 30 ? 3.423   9.450   9.999   1.00 12.00 ? 60 ASN A C    1 
ATOM 481  O O    . ASN A 1 30 ? 4.313   8.680   10.359  1.00 12.00 ? 60 ASN A O    1 
ATOM 482  C CB   . ASN A 1 30 ? 0.923   9.090   10.369  1.00 12.00 ? 60 ASN A CB   1 
ATOM 483  C CG   . ASN A 1 30 ? 0.273   10.460  10.209  1.00 12.00 ? 60 ASN A CG   1 
ATOM 484  O OD1  . ASN A 1 30 ? 0.783   11.490  10.619  1.00 12.00 ? 60 ASN A OD1  1 
ATOM 485  N ND2  . ASN A 1 30 ? -0.847  10.510  9.519   1.00 12.00 ? 60 ASN A ND2  1 
ATOM 486  H H    . ASN A 1 30 ? 1.757   6.795   9.751   1.00 0.00  ? 60 ASN A H    1 
ATOM 487  H HA   . ASN A 1 30 ? 1.901   9.393   8.476   1.00 0.00  ? 60 ASN A HA   1 
ATOM 488  H HB2  . ASN A 1 30 ? 0.178   8.321   10.165  1.00 0.00  ? 60 ASN A HB2  1 
ATOM 489  H HB3  . ASN A 1 30 ? 1.273   8.986   11.396  1.00 0.00  ? 60 ASN A HB3  1 
ATOM 490  H HD21 . ASN A 1 30 ? -1.247  9.655   9.160   1.00 0.00  ? 60 ASN A HD21 1 
ATOM 491  H HD22 . ASN A 1 30 ? -1.299  11.397  9.352   1.00 0.00  ? 60 ASN A HD22 1 
ATOM 492  N N    . SER A 1 31 ? 3.483   10.770  10.219  1.00 12.00 ? 61 SER A N    1 
ATOM 493  C CA   . SER A 1 31 ? 4.733   11.480  10.579  1.00 12.00 ? 61 SER A CA   1 
ATOM 494  C C    . SER A 1 31 ? 5.273   11.080  11.959  1.00 12.00 ? 61 SER A C    1 
ATOM 495  O O    . SER A 1 31 ? 4.733   11.480  12.999  1.00 12.00 ? 61 SER A O    1 
ATOM 496  C CB   . SER A 1 31 ? 4.493   12.990  10.509  1.00 12.00 ? 61 SER A CB   1 
ATOM 497  O OG   . SER A 1 31 ? 5.733   13.680  10.609  1.00 12.00 ? 61 SER A OG   1 
ATOM 498  H H    . SER A 1 31 ? 2.639   11.318  10.139  1.00 0.00  ? 61 SER A H    1 
ATOM 499  H HA   . SER A 1 31 ? 5.489   11.218  9.838   1.00 0.00  ? 61 SER A HA   1 
ATOM 500  H HB2  . SER A 1 31 ? 4.017   13.237  9.560   1.00 0.00  ? 61 SER A HB2  1 
ATOM 501  H HB3  . SER A 1 31 ? 3.844   13.292  11.331  1.00 0.00  ? 61 SER A HB3  1 
ATOM 502  H HG   . SER A 1 31 ? 5.563   14.624  10.563  1.00 0.00  ? 61 SER A HG   1 
ATOM 503  N N    . GLY A 1 32 ? 6.113   10.050  11.929  1.00 12.00 ? 62 GLY A N    1 
ATOM 504  C CA   . GLY A 1 32 ? 6.763   9.470   13.119  1.00 12.00 ? 62 GLY A CA   1 
ATOM 505  C C    . GLY A 1 32 ? 6.213   8.090   13.539  1.00 12.00 ? 62 GLY A C    1 
ATOM 506  O O    . GLY A 1 32 ? 6.953   7.300   14.129  1.00 12.00 ? 62 GLY A O    1 
ATOM 507  H H    . GLY A 1 32 ? 6.326   9.630   11.036  1.00 0.00  ? 62 GLY A H    1 
ATOM 508  H HA2  . GLY A 1 32 ? 7.827   9.364   12.908  1.00 0.00  ? 62 GLY A HA2  1 
ATOM 509  H HA3  . GLY A 1 32 ? 6.627   10.160  13.952  1.00 0.00  ? 62 GLY A HA3  1 
ATOM 510  N N    . PHE A 1 33 ? 4.943   7.820   13.229  1.00 12.00 ? 63 PHE A N    1 
ATOM 511  C CA   . PHE A 1 33 ? 4.223   6.590   13.609  1.00 12.00 ? 63 PHE A CA   1 
ATOM 512  C C    . PHE A 1 33 ? 4.973   5.280   13.299  1.00 12.00 ? 63 PHE A C    1 
ATOM 513  O O    . PHE A 1 33 ? 5.683   5.170   12.299  1.00 12.00 ? 63 PHE A O    1 
ATOM 514  C CB   . PHE A 1 33 ? 2.853   6.550   12.899  1.00 12.00 ? 63 PHE A CB   1 
ATOM 515  C CG   . PHE A 1 33 ? 1.693   7.300   13.559  1.00 12.00 ? 63 PHE A CG   1 
ATOM 516  C CD1  . PHE A 1 33 ? 1.883   8.330   14.519  1.00 12.00 ? 63 PHE A CD1  1 
ATOM 517  C CD2  . PHE A 1 33 ? 0.383   6.900   13.199  1.00 12.00 ? 63 PHE A CD2  1 
ATOM 518  C CE1  . PHE A 1 33 ? 0.763   8.940   15.129  1.00 12.00 ? 63 PHE A CE1  1 
ATOM 519  C CE2  . PHE A 1 33 ? -0.737  7.510   13.799  1.00 12.00 ? 63 PHE A CE2  1 
ATOM 520  C CZ   . PHE A 1 33 ? -0.537  8.520   14.769  1.00 12.00 ? 63 PHE A CZ   1 
ATOM 521  H H    . PHE A 1 33 ? 4.429   8.505   12.694  1.00 0.00  ? 63 PHE A H    1 
ATOM 522  H HA   . PHE A 1 33 ? 4.058   6.633   14.686  1.00 0.00  ? 63 PHE A HA   1 
ATOM 523  H HB2  . PHE A 1 33 ? 2.987   6.965   11.900  1.00 0.00  ? 63 PHE A HB2  1 
ATOM 524  H HB3  . PHE A 1 33 ? 2.559   5.504   12.807  1.00 0.00  ? 63 PHE A HB3  1 
ATOM 525  H HD1  . PHE A 1 33 ? 2.882   8.646   14.783  1.00 0.00  ? 63 PHE A HD1  1 
ATOM 526  H HD2  . PHE A 1 33 ? 0.242   6.124   12.462  1.00 0.00  ? 63 PHE A HD2  1 
ATOM 527  H HE1  . PHE A 1 33 ? 0.900   9.719   15.864  1.00 0.00  ? 63 PHE A HE1  1 
ATOM 528  H HE2  . PHE A 1 33 ? -1.736  7.209   13.522  1.00 0.00  ? 63 PHE A HE2  1 
ATOM 529  H HZ   . PHE A 1 33 ? -1.393  8.978   15.243  1.00 0.00  ? 63 PHE A HZ   1 
ATOM 530  N N    . LYS A 1 34 ? 4.693   4.260   14.109  1.00 12.00 ? 64 LYS A N    1 
ATOM 531  C CA   . LYS A 1 34 ? 5.303   2.920   13.979  1.00 12.00 ? 64 LYS A CA   1 
ATOM 532  C C    . LYS A 1 34 ? 4.203   1.900   13.669  1.00 12.00 ? 64 LYS A C    1 
ATOM 533  O O    . LYS A 1 34 ? 3.033   2.090   14.019  1.00 12.00 ? 64 LYS A O    1 
ATOM 534  C CB   . LYS A 1 34 ? 5.913   2.570   15.339  1.00 12.00 ? 64 LYS A CB   1 
ATOM 535  C CG   . LYS A 1 34 ? 7.043   1.530   15.299  1.00 12.00 ? 64 LYS A CG   1 
ATOM 536  C CD   . LYS A 1 34 ? 8.313   2.100   14.669  1.00 12.00 ? 64 LYS A CD   1 
ATOM 537  C CE   . LYS A 1 34 ? 9.583   1.480   15.269  1.00 12.00 ? 64 LYS A CE   1 
ATOM 538  N NZ   . LYS A 1 34 ? 9.733   0.060   14.899  1.00 12.00 ? 64 LYS A NZ   1 
ATOM 539  H H    . LYS A 1 34 ? 4.029   4.400   14.856  1.00 0.00  ? 64 LYS A H    1 
ATOM 540  H HA   . LYS A 1 34 ? 6.064   2.915   13.198  1.00 0.00  ? 64 LYS A HA   1 
ATOM 541  H HB2  . LYS A 1 34 ? 6.312   3.486   15.775  1.00 0.00  ? 64 LYS A HB2  1 
ATOM 542  H HB3  . LYS A 1 34 ? 5.118   2.181   15.975  1.00 0.00  ? 64 LYS A HB3  1 
ATOM 543  H HG2  . LYS A 1 34 ? 7.266   1.211   16.317  1.00 0.00  ? 64 LYS A HG2  1 
ATOM 544  H HG3  . LYS A 1 34 ? 6.713   0.672   14.714  1.00 0.00  ? 64 LYS A HG3  1 
ATOM 545  H HD2  . LYS A 1 34 ? 8.296   1.898   13.598  1.00 0.00  ? 64 LYS A HD2  1 
ATOM 546  H HD3  . LYS A 1 34 ? 8.335   3.177   14.836  1.00 0.00  ? 64 LYS A HD3  1 
ATOM 547  H HE2  . LYS A 1 34 ? 10.451  2.032   14.908  1.00 0.00  ? 64 LYS A HE2  1 
ATOM 548  H HE3  . LYS A 1 34 ? 9.535   1.558   16.355  1.00 0.00  ? 64 LYS A HE3  1 
ATOM 549  H HZ1  . LYS A 1 34 ? 10.577  -0.312  15.311  1.00 0.00  ? 64 LYS A HZ1  1 
ATOM 550  H HZ2  . LYS A 1 34 ? 8.937   -0.461  15.238  1.00 0.00  ? 64 LYS A HZ2  1 
ATOM 551  H HZ3  . LYS A 1 34 ? 9.787   -0.022  13.894  1.00 0.00  ? 64 LYS A HZ3  1 
ATOM 552  N N    . ARG A 1 35 ? 4.553   0.840   12.969  1.00 12.00 ? 65 ARG A N    1 
ATOM 553  C CA   . ARG A 1 35 ? 3.663   -0.340  12.909  1.00 12.00 ? 65 ARG A CA   1 
ATOM 554  C C    . ARG A 1 35 ? 3.543   -1.000  14.289  1.00 12.00 ? 65 ARG A C    1 
ATOM 555  O O    . ARG A 1 35 ? 4.533   -1.280  14.959  1.00 12.00 ? 65 ARG A O    1 
ATOM 556  C CB   . ARG A 1 35 ? 4.173   -1.400  11.929  1.00 12.00 ? 65 ARG A CB   1 
ATOM 557  C CG   . ARG A 1 35 ? 4.093   -0.970  10.459  1.00 12.00 ? 65 ARG A CG   1 
ATOM 558  C CD   . ARG A 1 35 ? 4.533   -2.110  9.529   1.00 12.00 ? 65 ARG A CD   1 
ATOM 559  N NE   . ARG A 1 35 ? 5.923   -2.490  9.829   1.00 12.00 ? 65 ARG A NE   1 
ATOM 560  C CZ   . ARG A 1 35 ? 6.893   -2.770  8.959   1.00 12.00 ? 65 ARG A CZ   1 
ATOM 561  N NH1  . ARG A 1 35 ? 6.673   -2.830  7.649   1.00 12.00 ? 65 ARG A NH1  1 
ATOM 562  N NH2  . ARG A 1 35 ? 8.143   -2.840  9.379   1.00 12.00 ? 65 ARG A NH2  1 
ATOM 563  H H    . ARG A 1 35 ? 5.429   0.821   12.467  1.00 0.00  ? 65 ARG A H    1 
ATOM 564  H HA   . ARG A 1 35 ? 2.678   -0.005  12.585  1.00 0.00  ? 65 ARG A HA   1 
ATOM 565  H HB2  . ARG A 1 35 ? 5.214   -1.617  12.168  1.00 0.00  ? 65 ARG A HB2  1 
ATOM 566  H HB3  . ARG A 1 35 ? 3.575   -2.302  12.057  1.00 0.00  ? 65 ARG A HB3  1 
ATOM 567  H HG2  . ARG A 1 35 ? 3.065   -0.695  10.224  1.00 0.00  ? 65 ARG A HG2  1 
ATOM 568  H HG3  . ARG A 1 35 ? 4.745   -0.111  10.303  1.00 0.00  ? 65 ARG A HG3  1 
ATOM 569  H HD2  . ARG A 1 35 ? 3.881   -2.971  9.677   1.00 0.00  ? 65 ARG A HD2  1 
ATOM 570  H HD3  . ARG A 1 35 ? 4.462   -1.781  8.492   1.00 0.00  ? 65 ARG A HD3  1 
ATOM 571  H HE   . ARG A 1 35 ? 6.161   -2.543  10.810  1.00 0.00  ? 65 ARG A HE   1 
ATOM 572  H HH11 . ARG A 1 35 ? 5.737   -2.705  7.293   1.00 0.00  ? 65 ARG A HH11 1 
ATOM 573  H HH12 . ARG A 1 35 ? 7.432   -3.000  7.004   1.00 0.00  ? 65 ARG A HH12 1 
ATOM 574  H HH21 . ARG A 1 35 ? 8.352   -2.724  10.361  1.00 0.00  ? 65 ARG A HH21 1 
ATOM 575  H HH22 . ARG A 1 35 ? 8.893   -3.010  8.723   1.00 0.00  ? 65 ARG A HH22 1 
ATOM 576  N N    . LYS A 1 36 ? 2.293   -1.080  14.759  1.00 12.00 ? 66 LYS A N    1 
ATOM 577  C CA   . LYS A 1 36 ? 1.883   -1.960  15.879  1.00 12.00 ? 66 LYS A CA   1 
ATOM 578  C C    . LYS A 1 36 ? 2.463   -3.380  15.689  1.00 12.00 ? 66 LYS A C    1 
ATOM 579  O O    . LYS A 1 36 ? 2.723   -3.810  14.559  1.00 12.00 ? 66 LYS A O    1 
ATOM 580  C CB   . LYS A 1 36 ? 0.343   -1.960  15.839  1.00 12.00 ? 66 LYS A CB   1 
ATOM 581  C CG   . LYS A 1 36 ? -0.407  -2.990  16.679  1.00 12.00 ? 66 LYS A CG   1 
ATOM 582  C CD   . LYS A 1 36 ? -0.467  -2.640  18.169  1.00 12.00 ? 66 LYS A CD   1 
ATOM 583  C CE   . LYS A 1 36 ? -1.227  -3.740  18.919  1.00 12.00 ? 66 LYS A CE   1 
ATOM 584  N NZ   . LYS A 1 36 ? -1.587  -3.260  20.259  1.00 12.00 ? 66 LYS A NZ   1 
ATOM 585  H H    . LYS A 1 36 ? 1.578   -0.510  14.331  1.00 0.00  ? 66 LYS A H    1 
ATOM 586  H HA   . LYS A 1 36 ? 2.233   -1.554  16.828  1.00 0.00  ? 66 LYS A HA   1 
ATOM 587  H HB2  . LYS A 1 36 ? 0.013   -0.975  16.168  1.00 0.00  ? 66 LYS A HB2  1 
ATOM 588  H HB3  . LYS A 1 36 ? 0.048   -2.115  14.801  1.00 0.00  ? 66 LYS A HB3  1 
ATOM 589  H HG2  . LYS A 1 36 ? -1.426  -3.066  16.302  1.00 0.00  ? 66 LYS A HG2  1 
ATOM 590  H HG3  . LYS A 1 36 ? 0.093   -3.953  16.571  1.00 0.00  ? 66 LYS A HG3  1 
ATOM 591  H HD2  . LYS A 1 36 ? 0.546   -2.562  18.566  1.00 0.00  ? 66 LYS A HD2  1 
ATOM 592  H HD3  . LYS A 1 36 ? -0.982  -1.689  18.299  1.00 0.00  ? 66 LYS A HD3  1 
ATOM 593  H HE2  . LYS A 1 36 ? -2.131  -3.998  18.369  1.00 0.00  ? 66 LYS A HE2  1 
ATOM 594  H HE3  . LYS A 1 36 ? -0.596  -4.625  19.006  1.00 0.00  ? 66 LYS A HE3  1 
ATOM 595  H HZ1  . LYS A 1 36 ? -2.087  -3.990  20.747  1.00 0.00  ? 66 LYS A HZ1  1 
ATOM 596  H HZ2  . LYS A 1 36 ? -0.748  -3.024  20.770  1.00 0.00  ? 66 LYS A HZ2  1 
ATOM 597  H HZ3  . LYS A 1 36 ? -2.174  -2.442  20.179  1.00 0.00  ? 66 LYS A HZ3  1 
ATOM 598  N N    . ALA A 1 37 ? 2.643   -4.110  16.779  1.00 12.00 ? 67 ALA A N    1 
ATOM 599  C CA   . ALA A 1 37 ? 3.183   -5.490  16.749  1.00 12.00 ? 67 ALA A CA   1 
ATOM 600  C C    . ALA A 1 37 ? 2.283   -6.440  15.919  1.00 12.00 ? 67 ALA A C    1 
ATOM 601  O O    . ALA A 1 37 ? 1.123   -6.640  16.249  1.00 12.00 ? 67 ALA A O    1 
ATOM 602  C CB   . ALA A 1 37 ? 3.343   -6.010  18.179  1.00 12.00 ? 67 ALA A CB   1 
ATOM 603  H H    . ALA A 1 37 ? 2.405   -3.717  17.678  1.00 0.00  ? 67 ALA A H    1 
ATOM 604  H HA   . ALA A 1 37 ? 4.167   -5.458  16.281  1.00 0.00  ? 67 ALA A HA   1 
ATOM 605  H HB1  . ALA A 1 37 ? 3.774   -7.011  18.159  1.00 0.00  ? 67 ALA A HB1  1 
ATOM 606  H HB2  . ALA A 1 37 ? 4.002   -5.343  18.736  1.00 0.00  ? 67 ALA A HB2  1 
ATOM 607  H HB3  . ALA A 1 37 ? 2.368   -6.045  18.664  1.00 0.00  ? 67 ALA A HB3  1 
ATOM 608  N N    . GLY A 1 38 ? 2.763   -6.710  14.709  1.00 12.00 ? 68 GLY A N    1 
ATOM 609  C CA   . GLY A 1 38 ? 2.143   -7.700  13.799  1.00 12.00 ? 68 GLY A CA   1 
ATOM 610  C C    . GLY A 1 38 ? 1.553   -7.140  12.489  1.00 12.00 ? 68 GLY A C    1 
ATOM 611  O O    . GLY A 1 38 ? 1.473   -7.870  11.499  1.00 12.00 ? 68 GLY A O    1 
ATOM 612  H H    . GLY A 1 38 ? 3.587   -6.223  14.387  1.00 0.00  ? 68 GLY A H    1 
ATOM 613  H HA2  . GLY A 1 38 ? 2.906   -8.434  13.537  1.00 0.00  ? 68 GLY A HA2  1 
ATOM 614  H HA3  . GLY A 1 38 ? 1.339   -8.195  14.344  1.00 0.00  ? 68 GLY A HA3  1 
ATOM 615  N N    . THR A 1 39 ? 1.133   -5.880  12.489  1.00 12.00 ? 69 THR A N    1 
ATOM 616  C CA   . THR A 1 39 ? 0.533   -5.220  11.299  1.00 12.00 ? 69 THR A CA   1 
ATOM 617  C C    . THR A 1 39 ? 1.453   -5.190  10.069  1.00 12.00 ? 69 THR A C    1 
ATOM 618  O O    . THR A 1 39 ? 2.573   -4.680  10.129  1.00 12.00 ? 69 THR A O    1 
ATOM 619  C CB   . THR A 1 39 ? -0.047  -3.820  11.579  1.00 12.00 ? 69 THR A CB   1 
ATOM 620  O OG1  . THR A 1 39 ? -0.247  -3.100  10.359  1.00 12.00 ? 69 THR A OG1  1 
ATOM 621  C CG2  . THR A 1 39 ? 0.843   -2.930  12.429  1.00 12.00 ? 69 THR A CG2  1 
ATOM 622  H H    . THR A 1 39 ? 1.222   -5.334  13.335  1.00 0.00  ? 69 THR A H    1 
ATOM 623  H HA   . THR A 1 39 ? -0.315  -5.848  11.027  1.00 0.00  ? 69 THR A HA   1 
ATOM 624  H HB   . THR A 1 39 ? -1.002  -3.950  12.088  1.00 0.00  ? 69 THR A HB   1 
ATOM 625  H HG1  . THR A 1 39 ? -0.635  -2.244  10.552  1.00 0.00  ? 69 THR A HG1  1 
ATOM 626  H HG21 . THR A 1 39 ? 0.378   -1.959  12.600  1.00 0.00  ? 69 THR A HG21 1 
ATOM 627  H HG22 . THR A 1 39 ? 1.019   -3.412  13.391  1.00 0.00  ? 69 THR A HG22 1 
ATOM 628  H HG23 . THR A 1 39 ? 1.795   -2.782  11.918  1.00 0.00  ? 69 THR A HG23 1 
ATOM 629  N N    . SER A 1 40 ? 0.793   -5.400  8.939   1.00 12.00 ? 70 SER A N    1 
ATOM 630  C CA   . SER A 1 40 ? 1.433   -5.460  7.609   1.00 12.00 ? 70 SER A CA   1 
ATOM 631  C C    . SER A 1 40 ? 0.753   -4.490  6.629   1.00 12.00 ? 70 SER A C    1 
ATOM 632  O O    . SER A 1 40 ? -0.477  -4.460  6.519   1.00 12.00 ? 70 SER A O    1 
ATOM 633  C CB   . SER A 1 40 ? 1.333   -6.890  7.069   1.00 12.00 ? 70 SER A CB   1 
ATOM 634  O OG   . SER A 1 40 ? 1.953   -6.990  5.789   1.00 12.00 ? 70 SER A OG   1 
ATOM 635  H H    . SER A 1 40 ? -0.208  -5.527  8.980   1.00 0.00  ? 70 SER A H    1 
ATOM 636  H HA   . SER A 1 40 ? 2.483   -5.186  7.710   1.00 0.00  ? 70 SER A HA   1 
ATOM 637  H HB2  . SER A 1 40 ? 1.831   -7.570  7.761   1.00 0.00  ? 70 SER A HB2  1 
ATOM 638  H HB3  . SER A 1 40 ? 0.283   -7.166  6.980   1.00 0.00  ? 70 SER A HB3  1 
ATOM 639  H HG   . SER A 1 40 ? 1.875   -7.895  5.477   1.00 0.00  ? 70 SER A HG   1 
ATOM 640  N N    . SER A 1 41 ? 1.553   -3.540  6.169   1.00 12.00 ? 71 SER A N    1 
ATOM 641  C CA   . SER A 1 41 ? 1.173   -2.600  5.089   1.00 12.00 ? 71 SER A CA   1 
ATOM 642  C C    . SER A 1 41 ? 1.953   -2.840  3.789   1.00 12.00 ? 71 SER A C    1 
ATOM 643  O O    . SER A 1 41 ? 2.693   -1.980  3.289   1.00 12.00 ? 71 SER A O    1 
ATOM 644  C CB   . SER A 1 41 ? 1.323   -1.150  5.539   1.00 12.00 ? 71 SER A CB   1 
ATOM 645  O OG   . SER A 1 41 ? 2.563   -0.960  6.229   1.00 12.00 ? 71 SER A OG   1 
ATOM 646  H H    . SER A 1 41 ? 2.475   -3.444  6.570   1.00 0.00  ? 71 SER A H    1 
ATOM 647  H HA   . SER A 1 41 ? 0.119   -2.773  4.874   1.00 0.00  ? 71 SER A HA   1 
ATOM 648  H HB2  . SER A 1 41 ? 1.297   -0.499  4.665   1.00 0.00  ? 71 SER A HB2  1 
ATOM 649  H HB3  . SER A 1 41 ? 0.500   -0.895  6.207   1.00 0.00  ? 71 SER A HB3  1 
ATOM 650  H HG   . SER A 1 41 ? 2.631   -0.042  6.500   1.00 0.00  ? 71 SER A HG   1 
ATOM 651  N N    . LEU A 1 42 ? 1.683   -4.000  3.199   1.00 12.00 ? 72 LEU A N    1 
ATOM 652  C CA   . LEU A 1 42 ? 2.263   -4.350  1.899   1.00 12.00 ? 72 LEU A CA   1 
ATOM 653  C C    . LEU A 1 42 ? 1.173   -4.290  0.829   1.00 12.00 ? 72 LEU A C    1 
ATOM 654  O O    . LEU A 1 42 ? 0.293   -5.160  0.719   1.00 12.00 ? 72 LEU A O    1 
ATOM 655  C CB   . LEU A 1 42 ? 2.983   -5.710  1.969   1.00 12.00 ? 72 LEU A CB   1 
ATOM 656  C CG   . LEU A 1 42 ? 4.093   -5.920  0.919   1.00 12.00 ? 72 LEU A CG   1 
ATOM 657  C CD1  . LEU A 1 42 ? 3.533   -6.190  -0.481  1.00 12.00 ? 72 LEU A CD1  1 
ATOM 658  C CD2  . LEU A 1 42 ? 5.133   -4.790  0.909   1.00 12.00 ? 72 LEU A CD2  1 
ATOM 659  H H    . LEU A 1 42 ? 1.066   -4.663  3.647   1.00 0.00  ? 72 LEU A H    1 
ATOM 660  H HA   . LEU A 1 42 ? 3.012   -3.598  1.652   1.00 0.00  ? 72 LEU A HA   1 
ATOM 661  H HB2  . LEU A 1 42 ? 3.432   -5.803  2.958   1.00 0.00  ? 72 LEU A HB2  1 
ATOM 662  H HB3  . LEU A 1 42 ? 2.238   -6.494  1.833   1.00 0.00  ? 72 LEU A HB3  1 
ATOM 663  H HG   . LEU A 1 42 ? 4.626   -6.823  1.217   1.00 0.00  ? 72 LEU A HG   1 
ATOM 664  H HD11 . LEU A 1 42 ? 4.340   -6.396  -1.184  1.00 0.00  ? 72 LEU A HD11 1 
ATOM 665  H HD12 . LEU A 1 42 ? 2.866   -7.051  -0.442  1.00 0.00  ? 72 LEU A HD12 1 
ATOM 666  H HD13 . LEU A 1 42 ? 2.978   -5.316  -0.821  1.00 0.00  ? 72 LEU A HD13 1 
ATOM 667  H HD21 . LEU A 1 42 ? 5.931   -5.007  0.198   1.00 0.00  ? 72 LEU A HD21 1 
ATOM 668  H HD22 . LEU A 1 42 ? 4.647   -3.856  0.626   1.00 0.00  ? 72 LEU A HD22 1 
ATOM 669  H HD23 . LEU A 1 42 ? 5.563   -4.688  1.906   1.00 0.00  ? 72 LEU A HD23 1 
ATOM 670  N N    . THR A 1 43 ? 1.173   -3.140  0.169   1.00 12.00 ? 73 THR A N    1 
ATOM 671  C CA   . THR A 1 43 ? 0.273   -2.880  -0.961  1.00 12.00 ? 73 THR A CA   1 
ATOM 672  C C    . THR A 1 43 ? 0.983   -3.250  -2.261  1.00 12.00 ? 73 THR A C    1 
ATOM 673  O O    . THR A 1 43 ? 2.033   -2.710  -2.601  1.00 12.00 ? 73 THR A O    1 
ATOM 674  C CB   . THR A 1 43 ? -0.317  -1.460  -0.951  1.00 12.00 ? 73 THR A CB   1 
ATOM 675  O OG1  . THR A 1 43 ? -1.227  -1.370  -2.041  1.00 12.00 ? 73 THR A OG1  1 
ATOM 676  C CG2  . THR A 1 43 ? 0.713   -0.320  -1.061  1.00 12.00 ? 73 THR A CG2  1 
ATOM 677  H H    . THR A 1 43 ? 1.813   -2.409  0.446   1.00 0.00  ? 73 THR A H    1 
ATOM 678  H HA   . THR A 1 43 ? -0.571  -3.561  -0.854  1.00 0.00  ? 73 THR A HA   1 
ATOM 679  H HB   . THR A 1 43 ? -0.861  -1.328  -0.016  1.00 0.00  ? 73 THR A HB   1 
ATOM 680  H HG1  . THR A 1 43 ? -1.637  -0.503  -2.025  1.00 0.00  ? 73 THR A HG1  1 
ATOM 681  H HG21 . THR A 1 43 ? 0.220   0.651   -1.048  1.00 0.00  ? 73 THR A HG21 1 
ATOM 682  H HG22 . THR A 1 43 ? 1.404   -0.378  -0.220  1.00 0.00  ? 73 THR A HG22 1 
ATOM 683  H HG23 . THR A 1 43 ? 1.267   -0.425  -1.994  1.00 0.00  ? 73 THR A HG23 1 
ATOM 684  N N    . GLU A 1 44 ? 0.573   -4.410  -2.761  1.00 12.00 ? 74 GLU A N    1 
ATOM 685  C CA   . GLU A 1 44 ? 1.183   -5.020  -3.951  1.00 12.00 ? 74 GLU A CA   1 
ATOM 686  C C    . GLU A 1 44 ? 0.173   -5.020  -5.091  1.00 12.00 ? 74 GLU A C    1 
ATOM 687  O O    . GLU A 1 44 ? -0.987  -5.410  -4.911  1.00 12.00 ? 74 GLU A O    1 
ATOM 688  C CB   . GLU A 1 44 ? 1.663   -6.440  -3.651  1.00 12.00 ? 74 GLU A CB   1 
ATOM 689  C CG   . GLU A 1 44 ? 2.543   -7.010  -4.771  1.00 12.00 ? 74 GLU A CG   1 
ATOM 690  C CD   . GLU A 1 44 ? 3.023   -8.430  -4.471  1.00 12.00 ? 74 GLU A CD   1 
ATOM 691  O OE1  . GLU A 1 44 ? 2.223   -9.360  -4.681  1.00 12.00 ? 74 GLU A OE1  1 
ATOM 692  O OE2  . GLU A 1 44 ? 4.193   -8.560  -4.041  1.00 12.00 ? 74 GLU A OE2  1 
ATOM 693  H H    . GLU A 1 44 ? -0.188  -4.901  -2.313  1.00 0.00  ? 74 GLU A H    1 
ATOM 694  H HA   . GLU A 1 44 ? 2.045   -4.420  -4.245  1.00 0.00  ? 74 GLU A HA   1 
ATOM 695  H HB2  . GLU A 1 44 ? 2.239   -6.426  -2.726  1.00 0.00  ? 74 GLU A HB2  1 
ATOM 696  H HB3  . GLU A 1 44 ? 0.793   -7.085  -3.527  1.00 0.00  ? 74 GLU A HB3  1 
ATOM 697  H HG2  . GLU A 1 44 ? 1.969   -7.022  -5.697  1.00 0.00  ? 74 GLU A HG2  1 
ATOM 698  H HG3  . GLU A 1 44 ? 3.413   -6.365  -4.897  1.00 0.00  ? 74 GLU A HG3  1 
ATOM 699  H HE2  . GLU A 1 44 ? 4.434   -9.475  -3.874  1.00 0.00  ? 74 GLU A HE2  1 
ATOM 700  N N    . CYS A 1 45 ? 0.663   -4.590  -6.251  1.00 12.00 ? 75 CYS A N    1 
ATOM 701  C CA   . CYS A 1 45 ? -0.137  -4.590  -7.481  1.00 12.00 ? 75 CYS A CA   1 
ATOM 702  C C    . CYS A 1 45 ? -0.317  -5.980  -8.101  1.00 12.00 ? 75 CYS A C    1 
ATOM 703  O O    . CYS A 1 45 ? 0.293   -6.360  -9.101  1.00 12.00 ? 75 CYS A O    1 
ATOM 704  C CB   . CYS A 1 45 ? 0.353   -3.530  -8.471  1.00 12.00 ? 75 CYS A CB   1 
ATOM 705  S SG   . CYS A 1 45 ? -1.127  -2.550  -8.891  1.00 12.00 ? 75 CYS A SG   1 
ATOM 706  H H    . CYS A 1 45 ? 1.614   -4.252  -6.298  1.00 0.00  ? 75 CYS A H    1 
ATOM 707  H HA   . CYS A 1 45 ? -1.135  -4.275  -7.177  1.00 0.00  ? 75 CYS A HA   1 
ATOM 708  H HB2  . CYS A 1 45 ? 1.110   -2.895  -8.011  1.00 0.00  ? 75 CYS A HB2  1 
ATOM 709  H HB3  . CYS A 1 45 ? 0.764   -3.999  -9.365  1.00 0.00  ? 75 CYS A HB3  1 
ATOM 710  H HG   . CYS A 1 45 ? -0.498  -1.722  -9.729  1.00 0.00  ? 75 CYS A HG   1 
ATOM 711  N N    . VAL A 1 46 ? -1.217  -6.700  -7.441  1.00 12.00 ? 76 VAL A N    1 
ATOM 712  C CA   . VAL A 1 46 ? -1.617  -8.090  -7.761  1.00 12.00 ? 76 VAL A CA   1 
ATOM 713  C C    . VAL A 1 46 ? -2.707  -8.140  -8.841  1.00 12.00 ? 76 VAL A C    1 
ATOM 714  O O    . VAL A 1 46 ? -3.737  -7.470  -8.751  1.00 12.00 ? 76 VAL A O    1 
ATOM 715  C CB   . VAL A 1 46 ? -2.087  -8.850  -6.491  1.00 12.00 ? 76 VAL A CB   1 
ATOM 716  C CG1  . VAL A 1 46 ? -0.887  -9.180  -5.591  1.00 12.00 ? 76 VAL A CG1  1 
ATOM 717  C CG2  . VAL A 1 46 ? -3.187  -8.130  -5.701  1.00 12.00 ? 76 VAL A CG2  1 
ATOM 718  H H    . VAL A 1 46 ? -1.673  -6.269  -6.650  1.00 0.00  ? 76 VAL A H    1 
ATOM 719  H HA   . VAL A 1 46 ? -0.736  -8.600  -8.151  1.00 0.00  ? 76 VAL A HA   1 
ATOM 720  H HB   . VAL A 1 46 ? -2.512  -9.796  -6.828  1.00 0.00  ? 76 VAL A HB   1 
ATOM 721  H HG11 . VAL A 1 46 ? -1.213  -9.764  -4.730  1.00 0.00  ? 76 VAL A HG11 1 
ATOM 722  H HG12 . VAL A 1 46 ? -0.156  -9.756  -6.159  1.00 0.00  ? 76 VAL A HG12 1 
ATOM 723  H HG13 . VAL A 1 46 ? -0.429  -8.253  -5.244  1.00 0.00  ? 76 VAL A HG13 1 
ATOM 724  H HG21 . VAL A 1 46 ? -3.501  -8.727  -4.845  1.00 0.00  ? 76 VAL A HG21 1 
ATOM 725  H HG22 . VAL A 1 46 ? -2.806  -7.172  -5.346  1.00 0.00  ? 76 VAL A HG22 1 
ATOM 726  H HG23 . VAL A 1 46 ? -4.045  -7.961  -6.352  1.00 0.00  ? 76 VAL A HG23 1 
ATOM 727  N N    . LEU A 1 47 ? -2.447  -8.960  -9.861  1.00 12.00 ? 77 LEU A N    1 
ATOM 728  C CA   . LEU A 1 47 ? -3.377  -9.140  -10.991 1.00 12.00 ? 77 LEU A CA   1 
ATOM 729  C C    . LEU A 1 47 ? -4.557  -10.010 -10.541 1.00 12.00 ? 77 LEU A C    1 
ATOM 730  O O    . LEU A 1 47 ? -4.447  -11.220 -10.381 1.00 12.00 ? 77 LEU A O    1 
ATOM 731  C CB   . LEU A 1 47 ? -2.627  -9.790  -12.171 1.00 12.00 ? 77 LEU A CB   1 
ATOM 732  C CG   . LEU A 1 47 ? -3.127  -9.370  -13.581 1.00 12.00 ? 77 LEU A CG   1 
ATOM 733  C CD1  . LEU A 1 47 ? -4.577  -9.790  -13.861 1.00 12.00 ? 77 LEU A CD1  1 
ATOM 734  C CD2  . LEU A 1 47 ? -2.917  -7.880  -13.841 1.00 12.00 ? 77 LEU A CD2  1 
ATOM 735  H H    . LEU A 1 47 ? -1.582  -9.483  -9.869  1.00 0.00  ? 77 LEU A H    1 
ATOM 736  H HA   . LEU A 1 47 ? -3.752  -8.166  -11.304 1.00 0.00  ? 77 LEU A HA   1 
ATOM 737  H HB2  . LEU A 1 47 ? -1.574  -9.520  -12.091 1.00 0.00  ? 77 LEU A HB2  1 
ATOM 738  H HB3  . LEU A 1 47 ? -2.732  -10.871 -12.083 1.00 0.00  ? 77 LEU A HB3  1 
ATOM 739  H HG   . LEU A 1 47 ? -2.506  -9.905  -14.300 1.00 0.00  ? 77 LEU A HG   1 
ATOM 740  H HD11 . LEU A 1 47 ? -4.865  -9.522  -14.877 1.00 0.00  ? 77 LEU A HD11 1 
ATOM 741  H HD12 . LEU A 1 47 ? -4.669  -10.869 -13.737 1.00 0.00  ? 77 LEU A HD12 1 
ATOM 742  H HD13 . LEU A 1 47 ? -5.240  -9.286  -13.158 1.00 0.00  ? 77 LEU A HD13 1 
ATOM 743  H HD21 . LEU A 1 47 ? -3.219  -7.625  -14.857 1.00 0.00  ? 77 LEU A HD21 1 
ATOM 744  H HD22 . LEU A 1 47 ? -3.514  -7.303  -13.135 1.00 0.00  ? 77 LEU A HD22 1 
ATOM 745  H HD23 . LEU A 1 47 ? -1.863  -7.636  -13.709 1.00 0.00  ? 77 LEU A HD23 1 
ATOM 746  N N    . ASN A 1 48 ? -5.707  -9.340  -10.371 1.00 12.00 ? 78 ASN A N    1 
ATOM 747  C CA   . ASN A 1 48 ? -6.957  -9.970  -9.891  1.00 12.00 ? 78 ASN A CA   1 
ATOM 748  C C    . ASN A 1 48 ? -7.637  -10.990 -10.841 1.00 12.00 ? 78 ASN A C    1 
ATOM 749  O O    . ASN A 1 48 ? -8.827  -11.250 -10.711 1.00 12.00 ? 78 ASN A O    1 
ATOM 750  C CB   . ASN A 1 48 ? -7.907  -8.830  -9.491  1.00 12.00 ? 78 ASN A CB   1 
ATOM 751  C CG   . ASN A 1 48 ? -9.047  -9.290  -8.581  1.00 12.00 ? 78 ASN A CG   1 
ATOM 752  O OD1  . ASN A 1 48 ? -8.857  -9.820  -7.491  1.00 12.00 ? 78 ASN A OD1  1 
ATOM 753  N ND2  . ASN A 1 48 ? -10.277 -9.040  -8.981  1.00 12.00 ? 78 ASN A ND2  1 
ATOM 754  H H    . ASN A 1 48 ? -5.730  -8.352  -10.579 1.00 0.00  ? 78 ASN A H    1 
ATOM 755  H HA   . ASN A 1 48 ? -6.701  -10.523 -8.987  1.00 0.00  ? 78 ASN A HA   1 
ATOM 756  H HB2  . ASN A 1 48 ? -7.332  -8.065  -8.970  1.00 0.00  ? 78 ASN A HB2  1 
ATOM 757  H HB3  . ASN A 1 48 ? -8.337  -8.401  -10.396 1.00 0.00  ? 78 ASN A HB3  1 
ATOM 758  H HD21 . ASN A 1 48 ? -10.424 -8.585  -9.870  1.00 0.00  ? 78 ASN A HD21 1 
ATOM 759  H HD22 . ASN A 1 48 ? -11.062 -9.301  -8.402  1.00 0.00  ? 78 ASN A HD22 1 
ATOM 760  N N    . LYS A 1 49 ? -6.897  -11.510 -11.831 1.00 12.00 ? 79 LYS A N    1 
ATOM 761  C CA   . LYS A 1 49 ? -7.307  -12.590 -12.761 1.00 12.00 ? 79 LYS A CA   1 
ATOM 762  C C    . LYS A 1 49 ? -8.707  -12.500 -13.431 1.00 12.00 ? 79 LYS A C    1 
ATOM 763  O O    . LYS A 1 49 ? -9.217  -13.490 -13.951 1.00 12.00 ? 79 LYS A O    1 
ATOM 764  C CB   . LYS A 1 49 ? -7.147  -13.940 -12.041 1.00 12.00 ? 79 LYS A CB   1 
ATOM 765  C CG   . LYS A 1 49 ? -5.777  -14.610 -12.211 1.00 12.00 ? 79 LYS A CG   1 
ATOM 766  C CD   . LYS A 1 49 ? -5.657  -15.290 -13.581 1.00 12.00 ? 79 LYS A CD   1 
ATOM 767  C CE   . LYS A 1 49 ? -4.407  -16.160 -13.721 1.00 12.00 ? 79 LYS A CE   1 
ATOM 768  N NZ   . LYS A 1 49 ? -4.527  -17.430 -12.971 1.00 12.00 ? 79 LYS A NZ   1 
ATOM 769  H H    . LYS A 1 49 ? -5.968  -11.135 -11.962 1.00 0.00  ? 79 LYS A H    1 
ATOM 770  H HA   . LYS A 1 49 ? -6.584  -12.565 -13.577 1.00 0.00  ? 79 LYS A HA   1 
ATOM 771  H HB2  . LYS A 1 49 ? -7.313  -13.777 -10.976 1.00 0.00  ? 79 LYS A HB2  1 
ATOM 772  H HB3  . LYS A 1 49 ? -7.906  -14.621 -12.427 1.00 0.00  ? 79 LYS A HB3  1 
ATOM 773  H HG2  . LYS A 1 49 ? -4.997  -13.853 -12.120 1.00 0.00  ? 79 LYS A HG2  1 
ATOM 774  H HG3  . LYS A 1 49 ? -5.648  -15.359 -11.430 1.00 0.00  ? 79 LYS A HG3  1 
ATOM 775  H HD2  . LYS A 1 49 ? -6.534  -15.919 -13.732 1.00 0.00  ? 79 LYS A HD2  1 
ATOM 776  H HD3  . LYS A 1 49 ? -5.627  -14.517 -14.349 1.00 0.00  ? 79 LYS A HD3  1 
ATOM 777  H HE2  . LYS A 1 49 ? -4.251  -16.387 -14.776 1.00 0.00  ? 79 LYS A HE2  1 
ATOM 778  H HE3  . LYS A 1 49 ? -3.547  -15.607 -13.342 1.00 0.00  ? 79 LYS A HE3  1 
ATOM 779  H HZ1  . LYS A 1 49 ? -3.685  -17.976 -13.087 1.00 0.00  ? 79 LYS A HZ1  1 
ATOM 780  H HZ2  . LYS A 1 49 ? -4.663  -17.230 -11.991 1.00 0.00  ? 79 LYS A HZ2  1 
ATOM 781  H HZ3  . LYS A 1 49 ? -5.316  -17.954 -13.321 1.00 0.00  ? 79 LYS A HZ3  1 
ATOM 782  N N    . ALA A 1 50 ? -9.257  -11.290 -13.491 1.00 12.00 ? 80 ALA A N    1 
ATOM 783  C CA   . ALA A 1 50 ? -10.597 -11.020 -14.051 1.00 12.00 ? 80 ALA A CA   1 
ATOM 784  C C    . ALA A 1 50 ? -10.697 -9.610  -14.661 1.00 12.00 ? 80 ALA A C    1 
ATOM 785  O O    . ALA A 1 50 ? -10.757 -9.460  -15.871 1.00 12.00 ? 80 ALA A O    1 
ATOM 786  C CB   . ALA A 1 50 ? -11.677 -11.230 -12.971 1.00 12.00 ? 80 ALA A CB   1 
ATOM 787  H H    . ALA A 1 50 ? -8.734  -10.503 -13.134 1.00 0.00  ? 80 ALA A H    1 
ATOM 788  H HA   . ALA A 1 50 ? -10.771 -11.741 -14.849 1.00 0.00  ? 80 ALA A HA   1 
ATOM 789  H HB1  . ALA A 1 50 ? -12.666 -11.072 -13.401 1.00 0.00  ? 80 ALA A HB1  1 
ATOM 790  H HB2  . ALA A 1 50 ? -11.609 -12.247 -12.584 1.00 0.00  ? 80 ALA A HB2  1 
ATOM 791  H HB3  . ALA A 1 50 ? -11.519 -10.521 -12.158 1.00 0.00  ? 80 ALA A HB3  1 
ATOM 792  N N    . THR A 1 51 ? -10.507 -8.600  -13.811 1.00 12.00 ? 81 THR A N    1 
ATOM 793  C CA   . THR A 1 51 ? -10.487 -7.170  -14.201 1.00 12.00 ? 81 THR A CA   1 
ATOM 794  C C    . THR A 1 51 ? -9.307  -6.740  -15.111 1.00 12.00 ? 81 THR A C    1 
ATOM 795  O O    . THR A 1 51 ? -9.257  -5.620  -15.611 1.00 12.00 ? 81 THR A O    1 
ATOM 796  C CB   . THR A 1 51 ? -10.577 -6.290  -12.931 1.00 12.00 ? 81 THR A CB   1 
ATOM 797  O OG1  . THR A 1 51 ? -10.787 -4.930  -13.281 1.00 12.00 ? 81 THR A OG1  1 
ATOM 798  C CG2  . THR A 1 51 ? -9.367  -6.430  -11.991 1.00 12.00 ? 81 THR A CG2  1 
ATOM 799  H H    . THR A 1 51 ? -10.366 -8.815  -12.834 1.00 0.00  ? 81 THR A H    1 
ATOM 800  H HA   . THR A 1 51 ? -11.395 -7.000  -14.778 1.00 0.00  ? 81 THR A HA   1 
ATOM 801  H HB   . THR A 1 51 ? -11.453 -6.622  -12.374 1.00 0.00  ? 81 THR A HB   1 
ATOM 802  H HG1  . THR A 1 51 ? -10.889 -4.410  -12.481 1.00 0.00  ? 81 THR A HG1  1 
ATOM 803  H HG21 . THR A 1 51 ? -9.498  -5.817  -11.100 1.00 0.00  ? 81 THR A HG21 1 
ATOM 804  H HG22 . THR A 1 51 ? -9.262  -7.473  -11.692 1.00 0.00  ? 81 THR A HG22 1 
ATOM 805  H HG23 . THR A 1 51 ? -8.466  -6.110  -12.514 1.00 0.00  ? 81 THR A HG23 1 
ATOM 806  N N    . ASN A 1 52 ? -8.387  -7.680  -15.361 1.00 12.00 ? 82 ASN A N    1 
ATOM 807  C CA   . ASN A 1 52 ? -7.077  -7.450  -16.041 1.00 12.00 ? 82 ASN A CA   1 
ATOM 808  C C    . ASN A 1 52 ? -6.177  -6.290  -15.561 1.00 12.00 ? 82 ASN A C    1 
ATOM 809  O O    . ASN A 1 52 ? -5.077  -6.090  -16.081 1.00 12.00 ? 82 ASN A O    1 
ATOM 810  C CB   . ASN A 1 52 ? -7.237  -7.410  -17.561 1.00 12.00 ? 82 ASN A CB   1 
ATOM 811  C CG   . ASN A 1 52 ? -7.127  -8.810  -18.181 1.00 12.00 ? 82 ASN A CG   1 
ATOM 812  O OD1  . ASN A 1 52 ? -6.627  -9.760  -17.601 1.00 12.00 ? 82 ASN A OD1  1 
ATOM 813  N ND2  . ASN A 1 52 ? -7.587  -8.940  -19.401 1.00 12.00 ? 82 ASN A ND2  1 
ATOM 814  H H    . ASN A 1 52 ? -8.588  -8.626  -15.069 1.00 0.00  ? 82 ASN A H    1 
ATOM 815  H HA   . ASN A 1 52 ? -6.505  -8.352  -15.822 1.00 0.00  ? 82 ASN A HA   1 
ATOM 816  H HB2  . ASN A 1 52 ? -8.213  -6.990  -17.803 1.00 0.00  ? 82 ASN A HB2  1 
ATOM 817  H HB3  . ASN A 1 52 ? -6.458  -6.775  -17.983 1.00 0.00  ? 82 ASN A HB3  1 
ATOM 818  H HD21 . ASN A 1 52 ? -7.993  -8.144  -19.871 1.00 0.00  ? 82 ASN A HD21 1 
ATOM 819  H HD22 . ASN A 1 52 ? -7.535  -9.835  -19.867 1.00 0.00  ? 82 ASN A HD22 1 
ATOM 820  N N    . VAL A 1 53 ? -6.577  -5.660  -14.471 1.00 12.00 ? 83 VAL A N    1 
ATOM 821  C CA   . VAL A 1 53 ? -5.827  -4.550  -13.861 1.00 12.00 ? 83 VAL A CA   1 
ATOM 822  C C    . VAL A 1 53 ? -5.447  -4.910  -12.421 1.00 12.00 ? 83 VAL A C    1 
ATOM 823  O O    . VAL A 1 53 ? -6.257  -5.430  -11.651 1.00 12.00 ? 83 VAL A O    1 
ATOM 824  C CB   . VAL A 1 53 ? -6.577  -3.210  -14.021 1.00 12.00 ? 83 VAL A CB   1 
ATOM 825  C CG1  . VAL A 1 53 ? -7.877  -3.120  -13.211 1.00 12.00 ? 83 VAL A CG1  1 
ATOM 826  C CG2  . VAL A 1 53 ? -5.657  -2.030  -13.701 1.00 12.00 ? 83 VAL A CG2  1 
ATOM 827  H H    . VAL A 1 53 ? -7.438  -5.946  -14.027 1.00 0.00  ? 83 VAL A H    1 
ATOM 828  H HA   . VAL A 1 53 ? -4.894  -4.450  -14.416 1.00 0.00  ? 83 VAL A HA   1 
ATOM 829  H HB   . VAL A 1 53 ? -6.855  -3.130  -15.072 1.00 0.00  ? 83 VAL A HB   1 
ATOM 830  H HG11 . VAL A 1 53 ? -8.382  -2.172  -13.394 1.00 0.00  ? 83 VAL A HG11 1 
ATOM 831  H HG12 . VAL A 1 53 ? -8.538  -3.937  -13.501 1.00 0.00  ? 83 VAL A HG12 1 
ATOM 832  H HG13 . VAL A 1 53 ? -7.645  -3.200  -12.149 1.00 0.00  ? 83 VAL A HG13 1 
ATOM 833  H HG21 . VAL A 1 53 ? -6.177  -1.088  -13.873 1.00 0.00  ? 83 VAL A HG21 1 
ATOM 834  H HG22 . VAL A 1 53 ? -5.349  -2.085  -12.656 1.00 0.00  ? 83 VAL A HG22 1 
ATOM 835  H HG23 . VAL A 1 53 ? -4.776  -2.075  -14.341 1.00 0.00  ? 83 VAL A HG23 1 
ATOM 836  N N    . ALA A 1 54 ? -4.137  -4.890  -12.221 1.00 12.00 ? 84 ALA A N    1 
ATOM 837  C CA   . ALA A 1 54 ? -3.547  -5.090  -10.891 1.00 12.00 ? 84 ALA A CA   1 
ATOM 838  C C    . ALA A 1 54 ? -3.897  -3.920  -9.961  1.00 12.00 ? 84 ALA A C    1 
ATOM 839  O O    . ALA A 1 54 ? -3.747  -2.760  -10.321 1.00 12.00 ? 84 ALA A O    1 
ATOM 840  C CB   . ALA A 1 54 ? -2.027  -5.230  -11.041 1.00 12.00 ? 84 ALA A CB   1 
ATOM 841  H H    . ALA A 1 54 ? -3.515  -4.734  -13.001 1.00 0.00  ? 84 ALA A H    1 
ATOM 842  H HA   . ALA A 1 54 ? -3.947  -6.009  -10.463 1.00 0.00  ? 84 ALA A HA   1 
ATOM 843  H HB1  . ALA A 1 54 ? -1.582  -5.402  -10.061 1.00 0.00  ? 84 ALA A HB1  1 
ATOM 844  H HB2  . ALA A 1 54 ? -1.802  -6.072  -11.695 1.00 0.00  ? 84 ALA A HB2  1 
ATOM 845  H HB3  . ALA A 1 54 ? -1.618  -4.316  -11.472 1.00 0.00  ? 84 ALA A HB3  1 
ATOM 846  N N    . HIS A 1 55 ? -4.607  -4.280  -8.891  1.00 12.00 ? 85 HIS A N    1 
ATOM 847  C CA   . HIS A 1 55 ? -4.917  -3.340  -7.811  1.00 12.00 ? 85 HIS A CA   1 
ATOM 848  C C    . HIS A 1 55 ? -4.107  -3.640  -6.531  1.00 12.00 ? 85 HIS A C    1 
ATOM 849  O O    . HIS A 1 55 ? -3.297  -4.560  -6.501  1.00 12.00 ? 85 HIS A O    1 
ATOM 850  C CB   . HIS A 1 55 ? -6.437  -3.140  -7.591  1.00 12.00 ? 85 HIS A CB   1 
ATOM 851  C CG   . HIS A 1 55 ? -7.267  -4.410  -7.371  1.00 12.00 ? 85 HIS A CG   1 
ATOM 852  N ND1  . HIS A 1 55 ? -8.017  -4.670  -6.301  1.00 12.00 ? 85 HIS A ND1  1 
ATOM 853  C CD2  . HIS A 1 55 ? -7.637  -5.250  -8.331  1.00 12.00 ? 85 HIS A CD2  1 
ATOM 854  C CE1  . HIS A 1 55 ? -8.847  -5.670  -6.601  1.00 12.00 ? 85 HIS A CE1  1 
ATOM 855  N NE2  . HIS A 1 55 ? -8.607  -6.020  -7.861  1.00 12.00 ? 85 HIS A NE2  1 
ATOM 856  H H    . HIS A 1 55 ? -4.947  -5.228  -8.813  1.00 0.00  ? 85 HIS A H    1 
ATOM 857  H HA   . HIS A 1 55 ? -4.552  -2.375  -8.162  1.00 0.00  ? 85 HIS A HA   1 
ATOM 858  H HB2  . HIS A 1 55 ? -6.567  -2.501  -6.718  1.00 0.00  ? 85 HIS A HB2  1 
ATOM 859  H HB3  . HIS A 1 55 ? -6.836  -2.628  -8.466  1.00 0.00  ? 85 HIS A HB3  1 
ATOM 860  H HD1  . HIS A 1 55 ? -7.965  -4.191  -5.413  1.00 0.00  ? 85 HIS A HD1  1 
ATOM 861  H HD2  . HIS A 1 55 ? -7.218  -5.297  -9.325  1.00 0.00  ? 85 HIS A HD2  1 
ATOM 862  H HE1  . HIS A 1 55 ? -9.579  -6.114  -5.942  1.00 0.00  ? 85 HIS A HE1  1 
ATOM 863  H HE2  . HIS A 1 55 ? -9.083  -6.749  -8.372  1.00 0.00  ? 85 HIS A HE2  1 
ATOM 864  N N    . TRP A 1 56 ? -4.447  -2.940  -5.451  1.00 12.00 ? 86 TRP A N    1 
ATOM 865  C CA   . TRP A 1 56 ? -3.517  -2.750  -4.331  1.00 12.00 ? 86 TRP A CA   1 
ATOM 866  C C    . TRP A 1 56 ? -3.887  -3.480  -3.031  1.00 12.00 ? 86 TRP A C    1 
ATOM 867  O O    . TRP A 1 56 ? -4.097  -2.870  -1.981  1.00 12.00 ? 86 TRP A O    1 
ATOM 868  C CB   . TRP A 1 56 ? -3.357  -1.240  -4.141  1.00 12.00 ? 86 TRP A CB   1 
ATOM 869  C CG   . TRP A 1 56 ? -2.617  -0.600  -5.331  1.00 12.00 ? 86 TRP A CG   1 
ATOM 870  C CD1  . TRP A 1 56 ? -3.197  0.140   -6.271  1.00 12.00 ? 86 TRP A CD1  1 
ATOM 871  C CD2  . TRP A 1 56 ? -1.247  -0.590  -5.561  1.00 12.00 ? 86 TRP A CD2  1 
ATOM 872  N NE1  . TRP A 1 56 ? -2.257  0.650   -7.071  1.00 12.00 ? 86 TRP A NE1  1 
ATOM 873  C CE2  . TRP A 1 56 ? -1.057  0.230   -6.691  1.00 12.00 ? 86 TRP A CE2  1 
ATOM 874  C CE3  . TRP A 1 56 ? -0.157  -1.280  -4.991  1.00 12.00 ? 86 TRP A CE3  1 
ATOM 875  C CZ2  . TRP A 1 56 ? 0.223   0.390   -7.261  1.00 12.00 ? 86 TRP A CZ2  1 
ATOM 876  C CZ3  . TRP A 1 56 ? 1.123   -1.140  -5.571  1.00 12.00 ? 86 TRP A CZ3  1 
ATOM 877  C CH2  . TRP A 1 56 ? 1.303   -0.310  -6.701  1.00 12.00 ? 86 TRP A CH2  1 
ATOM 878  H H    . TRP A 1 56 ? -5.366  -2.526  -5.389  1.00 0.00  ? 86 TRP A H    1 
ATOM 879  H HA   . TRP A 1 56 ? -2.553  -3.151  -4.644  1.00 0.00  ? 86 TRP A HA   1 
ATOM 880  H HB2  . TRP A 1 56 ? -4.342  -0.784  -4.044  1.00 0.00  ? 86 TRP A HB2  1 
ATOM 881  H HB3  . TRP A 1 56 ? -2.796  -1.050  -3.225  1.00 0.00  ? 86 TRP A HB3  1 
ATOM 882  H HD1  . TRP A 1 56 ? -4.260  0.303   -6.372  1.00 0.00  ? 86 TRP A HD1  1 
ATOM 883  H HE1  . TRP A 1 56 ? -2.460  1.264   -7.846  1.00 0.00  ? 86 TRP A HE1  1 
ATOM 884  H HE3  . TRP A 1 56 ? -0.299  -1.907  -4.123  1.00 0.00  ? 86 TRP A HE3  1 
ATOM 885  H HZ2  . TRP A 1 56 ? 0.370   1.038   -8.112  1.00 0.00  ? 86 TRP A HZ2  1 
ATOM 886  H HZ3  . TRP A 1 56 ? 1.966   -1.668  -5.150  1.00 0.00  ? 86 TRP A HZ3  1 
ATOM 887  H HH2  . TRP A 1 56 ? 2.286   -0.213  -7.140  1.00 0.00  ? 86 TRP A HH2  1 
ATOM 888  N N    . THR A 1 57 ? -3.797  -4.810  -3.131  1.00 12.00 ? 87 THR A N    1 
ATOM 889  C CA   . THR A 1 57 ? -4.167  -5.790  -2.071  1.00 12.00 ? 87 THR A CA   1 
ATOM 890  C C    . THR A 1 57 ? -5.297  -5.320  -1.111  1.00 12.00 ? 87 THR A C    1 
ATOM 891  O O    . THR A 1 57 ? -6.237  -4.660  -1.561  1.00 12.00 ? 87 THR A O    1 
ATOM 892  C CB   . THR A 1 57 ? -2.917  -6.280  -1.321  1.00 12.00 ? 87 THR A CB   1 
ATOM 893  O OG1  . THR A 1 57 ? -2.047  -5.190  -0.971  1.00 12.00 ? 87 THR A OG1  1 
ATOM 894  C CG2  . THR A 1 57 ? -2.157  -7.340  -2.111  1.00 12.00 ? 87 THR A CG2  1 
ATOM 895  H H    . THR A 1 57 ? -3.447  -5.192  -3.998  1.00 0.00  ? 87 THR A H    1 
ATOM 896  H HA   . THR A 1 57 ? -4.568  -6.656  -2.598  1.00 0.00  ? 87 THR A HA   1 
ATOM 897  H HB   . THR A 1 57 ? -3.254  -6.740  -0.392  1.00 0.00  ? 87 THR A HB   1 
ATOM 898  H HG1  . THR A 1 57 ? -1.298  -5.528  -0.474  1.00 0.00  ? 87 THR A HG1  1 
ATOM 899  H HG21 . THR A 1 57 ? -1.298  -7.695  -1.541  1.00 0.00  ? 87 THR A HG21 1 
ATOM 900  H HG22 . THR A 1 57 ? -2.820  -8.180  -2.318  1.00 0.00  ? 87 THR A HG22 1 
ATOM 901  H HG23 . THR A 1 57 ? -1.811  -6.910  -3.051  1.00 0.00  ? 87 THR A HG23 1 
ATOM 902  N N    . THR A 1 58 ? -5.377  -5.950  0.059   1.00 12.00 ? 88 THR A N    1 
ATOM 903  C CA   . THR A 1 58 ? -6.107  -5.390  1.219   1.00 12.00 ? 88 THR A CA   1 
ATOM 904  C C    . THR A 1 58 ? -5.157  -5.410  2.439   1.00 12.00 ? 88 THR A C    1 
ATOM 905  O O    . THR A 1 58 ? -5.057  -6.450  3.099   1.00 12.00 ? 88 THR A O    1 
ATOM 906  C CB   . THR A 1 58 ? -7.397  -6.190  1.529   1.00 12.00 ? 88 THR A CB   1 
ATOM 907  O OG1  . THR A 1 58 ? -8.207  -6.290  0.349   1.00 12.00 ? 88 THR A OG1  1 
ATOM 908  C CG2  . THR A 1 58 ? -8.227  -5.550  2.639   1.00 12.00 ? 88 THR A CG2  1 
ATOM 909  H H    . THR A 1 58 ? -4.924  -6.846  0.171   1.00 0.00  ? 88 THR A H    1 
ATOM 910  H HA   . THR A 1 58 ? -6.384  -4.360  0.995   1.00 0.00  ? 88 THR A HA   1 
ATOM 911  H HB   . THR A 1 58 ? -7.109  -7.192  1.847   1.00 0.00  ? 88 THR A HB   1 
ATOM 912  H HG1  . THR A 1 58 ? -8.989  -6.809  0.551   1.00 0.00  ? 88 THR A HG1  1 
ATOM 913  H HG21 . THR A 1 58 ? -9.118  -6.146  2.837   1.00 0.00  ? 88 THR A HG21 1 
ATOM 914  H HG22 . THR A 1 58 ? -7.628  -5.490  3.548   1.00 0.00  ? 88 THR A HG22 1 
ATOM 915  H HG23 . THR A 1 58 ? -8.526  -4.547  2.334   1.00 0.00  ? 88 THR A HG23 1 
ATOM 916  N N    . PRO A 1 59 ? -4.357  -4.360  2.639   1.00 12.00 ? 89 PRO A N    1 
ATOM 917  C CA   . PRO A 1 59 ? -3.547  -4.230  3.869   1.00 12.00 ? 89 PRO A CA   1 
ATOM 918  C C    . PRO A 1 59 ? -4.337  -3.490  4.959   1.00 12.00 ? 89 PRO A C    1 
ATOM 919  O O    . PRO A 1 59 ? -4.947  -2.460  4.699   1.00 12.00 ? 89 PRO A O    1 
ATOM 920  C CB   . PRO A 1 59 ? -2.307  -3.460  3.429   1.00 12.00 ? 89 PRO A CB   1 
ATOM 921  C CG   . PRO A 1 59 ? -2.797  -2.580  2.279   1.00 12.00 ? 89 PRO A CG   1 
ATOM 922  C CD   . PRO A 1 59 ? -3.877  -3.420  1.599   1.00 12.00 ? 89 PRO A CD   1 
ATOM 923  H HA   . PRO A 1 59 ? -3.259  -5.212  4.244   1.00 0.00  ? 89 PRO A HA   1 
ATOM 924  H HB2  . PRO A 1 59 ? -1.883  -2.871  4.243   1.00 0.00  ? 89 PRO A HB2  1 
ATOM 925  H HB3  . PRO A 1 59 ? -1.572  -4.166  3.041   1.00 0.00  ? 89 PRO A HB3  1 
ATOM 926  H HG2  . PRO A 1 59 ? -3.256  -1.683  2.695   1.00 0.00  ? 89 PRO A HG2  1 
ATOM 927  H HG3  . PRO A 1 59 ? -1.991  -2.319  1.593   1.00 0.00  ? 89 PRO A HG3  1 
ATOM 928  H HD2  . PRO A 1 59 ? -4.684  -2.787  1.230   1.00 0.00  ? 89 PRO A HD2  1 
ATOM 929  H HD3  . PRO A 1 59 ? -3.438  -3.991  0.781   1.00 0.00  ? 89 PRO A HD3  1 
ATOM 930  N N    . SER A 1 60 ? -4.417  -4.120  6.139   1.00 12.00 ? 90 SER A N    1 
ATOM 931  C CA   . SER A 1 60 ? -5.057  -3.510  7.319   1.00 12.00 ? 90 SER A CA   1 
ATOM 932  C C    . SER A 1 60 ? -4.337  -2.230  7.789   1.00 12.00 ? 90 SER A C    1 
ATOM 933  O O    . SER A 1 60 ? -4.887  -1.140  7.699   1.00 12.00 ? 90 SER A O    1 
ATOM 934  C CB   . SER A 1 60 ? -5.117  -4.490  8.499   1.00 12.00 ? 90 SER A CB   1 
ATOM 935  O OG   . SER A 1 60 ? -5.847  -5.660  8.139   1.00 12.00 ? 90 SER A OG   1 
ATOM 936  H H    . SER A 1 60 ? -4.027  -5.047  6.235   1.00 0.00  ? 90 SER A H    1 
ATOM 937  H HA   . SER A 1 60 ? -6.076  -3.246  7.037   1.00 0.00  ? 90 SER A HA   1 
ATOM 938  H HB2  . SER A 1 60 ? -4.103  -4.773  8.783   1.00 0.00  ? 90 SER A HB2  1 
ATOM 939  H HB3  . SER A 1 60 ? -5.609  -4.006  9.343   1.00 0.00  ? 90 SER A HB3  1 
ATOM 940  H HG   . SER A 1 60 ? -5.869  -6.254  8.893   1.00 0.00  ? 90 SER A HG   1 
ATOM 941  N N    . LEU A 1 61 ? -3.057  -2.400  8.089   1.00 12.00 ? 91 LEU A N    1 
ATOM 942  C CA   . LEU A 1 61 ? -2.177  -1.400  8.709   1.00 12.00 ? 91 LEU A CA   1 
ATOM 943  C C    . LEU A 1 61 ? -2.727  -0.670  9.949   1.00 12.00 ? 91 LEU A C    1 
ATOM 944  O O    . LEU A 1 61 ? -3.627  0.160   9.899   1.00 12.00 ? 91 LEU A O    1 
ATOM 945  C CB   . LEU A 1 61 ? -1.617  -0.430  7.649   1.00 12.00 ? 91 LEU A CB   1 
ATOM 946  C CG   . LEU A 1 61 ? -0.547  0.570   8.149   1.00 12.00 ? 91 LEU A CG   1 
ATOM 947  C CD1  . LEU A 1 61 ? -1.197  1.830   8.739   1.00 12.00 ? 91 LEU A CD1  1 
ATOM 948  C CD2  . LEU A 1 61 ? 0.553   -0.060  9.009   1.00 12.00 ? 91 LEU A CD2  1 
ATOM 949  H H    . LEU A 1 61 ? -2.641  -3.296  7.875   1.00 0.00  ? 91 LEU A H    1 
ATOM 950  H HA   . LEU A 1 61 ? -1.323  -1.971  9.074   1.00 0.00  ? 91 LEU A HA   1 
ATOM 951  H HB2  . LEU A 1 61 ? -1.171  -1.026  6.853   1.00 0.00  ? 91 LEU A HB2  1 
ATOM 952  H HB3  . LEU A 1 61 ? -2.451  0.145   7.249   1.00 0.00  ? 91 LEU A HB3  1 
ATOM 953  H HG   . LEU A 1 61 ? -0.030  0.911   7.252   1.00 0.00  ? 91 LEU A HG   1 
ATOM 954  H HD11 . LEU A 1 61 ? -0.433  2.561   9.003   1.00 0.00  ? 91 LEU A HD11 1 
ATOM 955  H HD12 . LEU A 1 61 ? -1.871  2.266   8.003   1.00 0.00  ? 91 LEU A HD12 1 
ATOM 956  H HD13 . LEU A 1 61 ? -1.760  1.561   9.633   1.00 0.00  ? 91 LEU A HD13 1 
ATOM 957  H HD21 . LEU A 1 61 ? 1.315   0.676   9.265   1.00 0.00  ? 91 LEU A HD21 1 
ATOM 958  H HD22 . LEU A 1 61 ? 0.113   -0.449  9.927   1.00 0.00  ? 91 LEU A HD22 1 
ATOM 959  H HD23 . LEU A 1 61 ? 1.019   -0.875  8.456   1.00 0.00  ? 91 LEU A HD23 1 
ATOM 960  N N    . LYS A 1 62 ? -1.987  -0.880  11.039  1.00 12.00 ? 92 LYS A N    1 
ATOM 961  C CA   . LYS A 1 62 ? -2.137  -0.090  12.269  1.00 12.00 ? 92 LYS A CA   1 
ATOM 962  C C    . LYS A 1 62 ? -0.837  0.640   12.649  1.00 12.00 ? 92 LYS A C    1 
ATOM 963  O O    . LYS A 1 62 ? 0.023   0.130   13.369  1.00 12.00 ? 92 LYS A O    1 
ATOM 964  C CB   . LYS A 1 62 ? -2.717  -0.940  13.409  1.00 12.00 ? 92 LYS A CB   1 
ATOM 965  C CG   . LYS A 1 62 ? -4.197  -1.180  13.139  1.00 12.00 ? 92 LYS A CG   1 
ATOM 966  C CD   . LYS A 1 62 ? -4.867  -2.070  14.189  1.00 12.00 ? 92 LYS A CD   1 
ATOM 967  C CE   . LYS A 1 62 ? -6.357  -2.170  13.869  1.00 12.00 ? 92 LYS A CE   1 
ATOM 968  N NZ   . LYS A 1 62 ? -7.037  -3.030  14.849  1.00 12.00 ? 92 LYS A NZ   1 
ATOM 969  H H    . LYS A 1 62 ? -1.290  -1.612  11.029  1.00 0.00  ? 92 LYS A H    1 
ATOM 970  H HA   . LYS A 1 62 ? -2.874  0.683   12.053  1.00 0.00  ? 92 LYS A HA   1 
ATOM 971  H HB2  . LYS A 1 62 ? -2.193  -1.895  13.456  1.00 0.00  ? 92 LYS A HB2  1 
ATOM 972  H HB3  . LYS A 1 62 ? -2.598  -0.413  14.356  1.00 0.00  ? 92 LYS A HB3  1 
ATOM 973  H HG2  . LYS A 1 62 ? -4.707  -0.217  13.126  1.00 0.00  ? 92 LYS A HG2  1 
ATOM 974  H HG3  . LYS A 1 62 ? -4.298  -1.658  12.165  1.00 0.00  ? 92 LYS A HG3  1 
ATOM 975  H HD2  . LYS A 1 62 ? -4.419  -3.064  14.167  1.00 0.00  ? 92 LYS A HD2  1 
ATOM 976  H HD3  . LYS A 1 62 ? -4.733  -1.634  15.179  1.00 0.00  ? 92 LYS A HD3  1 
ATOM 977  H HE2  . LYS A 1 62 ? -6.798  -1.174  13.896  1.00 0.00  ? 92 LYS A HE2  1 
ATOM 978  H HE3  . LYS A 1 62 ? -6.483  -2.591  12.872  1.00 0.00  ? 92 LYS A HE3  1 
ATOM 979  H HZ1  . LYS A 1 62 ? -8.019  -3.084  14.622  1.00 0.00  ? 92 LYS A HZ1  1 
ATOM 980  H HZ2  . LYS A 1 62 ? -6.633  -3.955  14.823  1.00 0.00  ? 92 LYS A HZ2  1 
ATOM 981  H HZ3  . LYS A 1 62 ? -6.925  -2.640  15.774  1.00 0.00  ? 92 LYS A HZ3  1 
ATOM 982  N N    . CYS A 1 63 ? -0.627  1.750   11.939  1.00 12.00 ? 93 CYS A N    1 
ATOM 983  C CA   . CYS A 1 63 ? 0.423   2.730   12.279  1.00 12.00 ? 93 CYS A CA   1 
ATOM 984  C C    . CYS A 1 63 ? -0.047  3.560   13.469  1.00 12.00 ? 93 CYS A C    1 
ATOM 985  O O    . CYS A 1 63 ? -1.097  4.210   13.429  1.00 12.00 ? 93 CYS A O    1 
ATOM 986  C CB   . CYS A 1 63 ? 0.783   3.690   11.149  1.00 12.00 ? 93 CYS A CB   1 
ATOM 987  S SG   . CYS A 1 63 ? 1.813   3.030   9.789   1.00 12.00 ? 93 CYS A SG   1 
ATOM 988  H H    . CYS A 1 63 ? -1.206  1.937   11.133  1.00 0.00  ? 93 CYS A H    1 
ATOM 989  H HA   . CYS A 1 63 ? 1.320   2.175   12.556  1.00 0.00  ? 93 CYS A HA   1 
ATOM 990  H HB2  . CYS A 1 63 ? -0.153  4.043   10.718  1.00 0.00  ? 93 CYS A HB2  1 
ATOM 991  H HB3  . CYS A 1 63 ? 1.318   4.527   11.598  1.00 0.00  ? 93 CYS A HB3  1 
ATOM 992  H HG   . CYS A 1 63 ? 1.887   4.145   9.056   1.00 0.00  ? 93 CYS A HG   1 
ATOM 993  N N    . ILE A 1 64 ? 0.613   3.280   14.579  1.00 12.00 ? 94 ILE A N    1 
ATOM 994  C CA   . ILE A 1 64 ? 0.493   4.010   15.849  1.00 12.00 ? 94 ILE A CA   1 
ATOM 995  C C    . ILE A 1 64 ? 1.893   4.270   16.409  1.00 12.00 ? 94 ILE A C    1 
ATOM 996  O O    . ILE A 1 64 ? 2.793   3.440   16.289  1.00 12.00 ? 94 ILE A O    1 
ATOM 997  C CB   . ILE A 1 64 ? -0.397  3.290   16.879  1.00 12.00 ? 94 ILE A CB   1 
ATOM 998  C CG1  . ILE A 1 64 ? -0.017  1.810   17.079  1.00 12.00 ? 94 ILE A CG1  1 
ATOM 999  C CG2  . ILE A 1 64 ? -1.877  3.500   16.519  1.00 12.00 ? 94 ILE A CG2  1 
ATOM 1000 C CD1  . ILE A 1 64 ? -0.557  1.210   18.379  1.00 12.00 ? 94 ILE A CD1  1 
ATOM 1001 H H    . ILE A 1 64 ? 1.257   2.501   14.561  1.00 0.00  ? 94 ILE A H    1 
ATOM 1002 H HA   . ILE A 1 64 ? 0.029   4.972   15.633  1.00 0.00  ? 94 ILE A HA   1 
ATOM 1003 H HB   . ILE A 1 64 ? -0.232  3.779   17.839  1.00 0.00  ? 94 ILE A HB   1 
ATOM 1004 H HG12 . ILE A 1 64 ? -0.415  1.235   16.243  1.00 0.00  ? 94 ILE A HG12 1 
ATOM 1005 H HG13 . ILE A 1 64 ? 1.070   1.731   17.089  1.00 0.00  ? 94 ILE A HG13 1 
ATOM 1006 H HG21 . ILE A 1 64 ? -2.510  3.043   17.280  1.00 0.00  ? 94 ILE A HG21 1 
ATOM 1007 H HG22 . ILE A 1 64 ? -2.089  4.568   16.466  1.00 0.00  ? 94 ILE A HG22 1 
ATOM 1008 H HG23 . ILE A 1 64 ? -2.084  3.040   15.553  1.00 0.00  ? 94 ILE A HG23 1 
ATOM 1009 H HD11 . ILE A 1 64 ? -0.260  0.165   18.468  1.00 0.00  ? 94 ILE A HD11 1 
ATOM 1010 H HD12 . ILE A 1 64 ? -0.158  1.768   19.226  1.00 0.00  ? 94 ILE A HD12 1 
ATOM 1011 H HD13 . ILE A 1 64 ? -1.645  1.274   18.381  1.00 0.00  ? 94 ILE A HD13 1 
ATOM 1012 N N    . ARG A 1 65 ? 2.103   5.510   16.829  1.00 12.00 ? 95 ARG A N    1 
ATOM 1013 C CA   . ARG A 1 65 ? 3.343   5.960   17.509  1.00 12.00 ? 95 ARG A CA   1 
ATOM 1014 C C    . ARG A 1 65 ? 3.903   4.900   18.499  1.00 12.00 ? 95 ARG A C    1 
ATOM 1015 O O    . ARG A 1 65 ? 3.143   4.190   19.139  1.00 12.00 ? 95 ARG A O    1 
ATOM 1016 C CB   . ARG A 1 65 ? 3.013   7.310   18.159  1.00 12.00 ? 95 ARG A CB   1 
ATOM 1017 C CG   . ARG A 1 65 ? 1.883   7.260   19.199  1.00 12.00 ? 95 ARG A CG   1 
ATOM 1018 C CD   . ARG A 1 65 ? 2.453   7.310   20.619  1.00 12.00 ? 95 ARG A CD   1 
ATOM 1019 N NE   . ARG A 1 65 ? 2.123   8.610   21.239  1.00 12.00 ? 95 ARG A NE   1 
ATOM 1020 C CZ   . ARG A 1 65 ? 2.663   9.800   20.989  1.00 12.00 ? 95 ARG A CZ   1 
ATOM 1021 N NH1  . ARG A 1 65 ? 3.643   9.990   20.119  1.00 12.00 ? 95 ARG A NH1  1 
ATOM 1022 N NH2  . ARG A 1 65 ? 2.253   10.850  21.689  1.00 12.00 ? 95 ARG A NH2  1 
ATOM 1023 H H    . ARG A 1 65 ? 1.380   6.198   16.681  1.00 0.00  ? 95 ARG A H    1 
ATOM 1024 H HA   . ARG A 1 65 ? 4.108   6.126   16.751  1.00 0.00  ? 95 ARG A HA   1 
ATOM 1025 H HB2  . ARG A 1 65 ? 3.913   7.679   18.652  1.00 0.00  ? 95 ARG A HB2  1 
ATOM 1026 H HB3  . ARG A 1 65 ? 2.720   8.003   17.371  1.00 0.00  ? 95 ARG A HB3  1 
ATOM 1027 H HG2  . ARG A 1 65 ? 1.221   8.113   19.049  1.00 0.00  ? 95 ARG A HG2  1 
ATOM 1028 H HG3  . ARG A 1 65 ? 1.320   6.335   19.072  1.00 0.00  ? 95 ARG A HG3  1 
ATOM 1029 H HD2  . ARG A 1 65 ? 2.023   6.503   21.213  1.00 0.00  ? 95 ARG A HD2  1 
ATOM 1030 H HD3  . ARG A 1 65 ? 3.536   7.188   20.581  1.00 0.00  ? 95 ARG A HD3  1 
ATOM 1031 H HE   . ARG A 1 65 ? 1.396   8.583   21.940  1.00 0.00  ? 95 ARG A HE   1 
ATOM 1032 H HH11 . ARG A 1 65 ? 4.001   9.206   19.593  1.00 0.00  ? 95 ARG A HH11 1 
ATOM 1033 H HH12 . ARG A 1 65 ? 4.042   10.906  19.970  1.00 0.00  ? 95 ARG A HH12 1 
ATOM 1034 H HH21 . ARG A 1 65 ? 1.530   10.740  22.386  1.00 0.00  ? 95 ARG A HH21 1 
ATOM 1035 H HH22 . ARG A 1 65 ? 2.662   11.759  21.529  1.00 0.00  ? 95 ARG A HH22 1 
ATOM 1036 N N    . ASP A 1 66 ? 5.213   4.770   18.679  1.00 12.00 ? 96 ASP A N    1 
ATOM 1037 C CA   . ASP A 1 66 ? 6.293   5.670   18.209  1.00 12.00 ? 96 ASP A CA   1 
ATOM 1038 C C    . ASP A 1 66 ? 7.343   5.050   17.259  1.00 12.00 ? 96 ASP A C    1 
ATOM 1039 O O    . ASP A 1 66 ? 7.313   5.420   16.079  1.00 12.00 ? 96 ASP A O    1 
ATOM 1040 C CB   . ASP A 1 66 ? 6.963   6.380   19.409  1.00 12.00 ? 96 ASP A CB   1 
ATOM 1041 C CG   . ASP A 1 66 ? 7.203   5.470   20.629  1.00 12.00 ? 96 ASP A CG   1 
ATOM 1042 O OD1  . ASP A 1 66 ? 7.983   4.510   20.489  1.00 12.00 ? 96 ASP A OD1  1 
ATOM 1043 H H    . ASP A 1 66 ? 5.517   3.960   19.201  1.00 0.00  ? 96 ASP A H    1 
ATOM 1044 H HA   . ASP A 1 66 ? 5.791   6.443   17.628  1.00 0.00  ? 96 ASP A HA   1 
ATOM 1045 H HB2  . ASP A 1 66 ? 7.925   6.774   19.081  1.00 0.00  ? 96 ASP A HB2  1 
ATOM 1046 H HB3  . ASP A 1 66 ? 6.324   7.206   19.719  1.00 0.00  ? 96 ASP A HB3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ILE 1  31 31 ILE ILE A . n 
A 1 2  THR 2  32 32 THR THR A . n 
A 1 3  CYS 3  33 33 CYS CYS A . n 
A 1 4  PRO 4  34 34 PRO PRO A . n 
A 1 5  PRO 5  35 35 PRO PRO A . n 
A 1 6  PRO 6  36 36 PRO PRO A . n 
A 1 7  MET 7  37 37 MET MET A . n 
A 1 8  SER 8  38 38 SER SER A . n 
A 1 9  VAL 9  39 39 VAL VAL A . n 
A 1 10 GLU 10 40 40 GLU GLU A . n 
A 1 11 HIS 11 41 41 HIS HIS A . n 
A 1 12 ALA 12 42 42 ALA ALA A . n 
A 1 13 ASP 13 43 43 ASP ASP A . n 
A 1 14 ILE 14 44 44 ILE ILE A . n 
A 1 15 TRP 15 45 45 TRP TRP A . n 
A 1 16 VAL 16 46 46 VAL VAL A . n 
A 1 17 LYS 17 47 47 LYS LYS A . n 
A 1 18 SER 18 48 48 SER SER A . n 
A 1 19 TYR 19 49 49 TYR TYR A . n 
A 1 20 SER 20 50 50 SER SER A . n 
A 1 21 LEU 21 51 51 LEU LEU A . n 
A 1 22 TYR 22 52 52 TYR TYR A . n 
A 1 23 SER 23 53 53 SER SER A . n 
A 1 24 ARG 24 54 54 ARG ARG A . n 
A 1 25 GLU 25 55 55 GLU GLU A . n 
A 1 26 ARG 26 56 56 ARG ARG A . n 
A 1 27 TYR 27 57 57 TYR TYR A . n 
A 1 28 ILE 28 58 58 ILE ILE A . n 
A 1 29 CYS 29 59 59 CYS CYS A . n 
A 1 30 ASN 30 60 60 ASN ASN A . n 
A 1 31 SER 31 61 61 SER SER A . n 
A 1 32 GLY 32 62 62 GLY GLY A . n 
A 1 33 PHE 33 63 63 PHE PHE A . n 
A 1 34 LYS 34 64 64 LYS LYS A . n 
A 1 35 ARG 35 65 65 ARG ARG A . n 
A 1 36 LYS 36 66 66 LYS LYS A . n 
A 1 37 ALA 37 67 67 ALA ALA A . n 
A 1 38 GLY 38 68 68 GLY GLY A . n 
A 1 39 THR 39 69 69 THR THR A . n 
A 1 40 SER 40 70 70 SER SER A . n 
A 1 41 SER 41 71 71 SER SER A . n 
A 1 42 LEU 42 72 72 LEU LEU A . n 
A 1 43 THR 43 73 73 THR THR A . n 
A 1 44 GLU 44 74 74 GLU GLU A . n 
A 1 45 CYS 45 75 75 CYS CYS A . n 
A 1 46 VAL 46 76 76 VAL VAL A . n 
A 1 47 LEU 47 77 77 LEU LEU A . n 
A 1 48 ASN 48 78 78 ASN ASN A . n 
A 1 49 LYS 49 79 79 LYS LYS A . n 
A 1 50 ALA 50 80 80 ALA ALA A . n 
A 1 51 THR 51 81 81 THR THR A . n 
A 1 52 ASN 52 82 82 ASN ASN A . n 
A 1 53 VAL 53 83 83 VAL VAL A . n 
A 1 54 ALA 54 84 84 ALA ALA A . n 
A 1 55 HIS 55 85 85 HIS HIS A . n 
A 1 56 TRP 56 86 86 TRP TRP A . n 
A 1 57 THR 57 87 87 THR THR A . n 
A 1 58 THR 58 88 88 THR THR A . n 
A 1 59 PRO 59 89 89 PRO PRO A . n 
A 1 60 SER 60 90 90 SER SER A . n 
A 1 61 LEU 61 91 91 LEU LEU A . n 
A 1 62 LYS 62 92 92 LYS LYS A . n 
A 1 63 CYS 63 93 93 CYS CYS A . n 
A 1 64 ILE 64 94 94 ILE ILE A . n 
A 1 65 ARG 65 95 95 ARG ARG A . n 
A 1 66 ASP 66 96 96 ASP ASP A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-07 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HG  A CYS 33 ? ? HG A CYS 75 ? ? 0.40 
2 1 SG  A CYS 33 ? ? HG A CYS 75 ? ? 0.97 
3 1 HG1 A THR 69 ? ? H  A LYS 92 ? ? 1.03 
4 1 HA  A CYS 59 ? ? HG A CYS 93 ? ? 1.25 
5 1 HG  A CYS 33 ? ? SG A CYS 75 ? ? 1.34 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A TYR 52 ? ? CG A TYR 52 ? ? CD2 A TYR 52 ? ? 117.01 121.00 -3.99 0.60 N 
2 1 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH1 A ARG 95 ? ? 123.52 120.30 3.22  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 38 ? ? -153.84 -141.07 
2  1 VAL A 39 ? ? 59.17   -79.90  
3  1 GLU A 40 ? ? 103.44  -75.85  
4  1 HIS A 41 ? ? -89.87  48.60   
5  1 TYR A 49 ? ? 45.92   -166.65 
6  1 SER A 50 ? ? 175.69  148.40  
7  1 CYS A 59 ? ? 53.44   174.35  
8  1 SER A 61 ? ? -66.39  89.91   
9  1 PHE A 63 ? ? -49.32  151.09  
10 1 LYS A 66 ? ? -46.58  154.48  
11 1 SER A 71 ? ? -110.93 66.39   
12 1 ASN A 78 ? ? -67.90  18.08   
13 1 LYS A 79 ? ? 46.85   21.67   
14 1 ALA A 80 ? ? -150.27 -61.79  
15 1 ASN A 82 ? ? 49.16   6.94    
16 1 TRP A 86 ? ? -110.72 67.84   
17 1 THR A 87 ? ? 29.38   -160.13 
18 1 LEU A 91 ? ? 47.80   118.78  
19 1 ARG A 95 ? ? -38.77  146.18  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             CYS 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              59 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   11.59 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 HIS A 41 ? ? 0.092 'SIDE CHAIN' 
2 1 TYR A 57 ? ? 0.071 'SIDE CHAIN' 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     ASP 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      96 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OD2 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    ASP 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     66 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OD2 
#