data_2ERY
# 
_entry.id   2ERY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ERY         
RCSB  RCSB035018   
WWPDB D_1000035018 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ERY 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Salah, E.'                            1  
'Schoch, G.'                           2  
'Turnbull, A.'                         3  
'Papagrigoriou, E.'                    4  
'Soundararajan, M.'                    5  
'Burgess, N.'                          6  
'Elkins, J.'                           7  
'Gileadi, C.'                          8  
'Gileadi, O.'                          9  
'von Delft, F.'                        10 
'Edwards, A.'                          11 
'Arrowsmith, C.'                       12 
'Weigelt, J.'                          13 
'Sundstrom, M.'                        14 
'Doyle, D.'                            15 
'Structural Genomics Consortium (SGC)' 16 
# 
_citation.id                        primary 
_citation.title                     'The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Salah, E.'         1  
primary 'Schoch, G.'        2  
primary 'Turnbull, A.'      3  
primary 'Papagrigoriou, E.' 4  
primary 'Soundararajan, M.' 5  
primary 'Burgess, N.'       6  
primary 'Elkins, J.'        7  
primary 'Gileadi, C.'       8  
primary 'Gileadi, O.'       9  
primary 'von Delft, F.'     10 
primary 'Edwards, A.'       11 
primary 'Arrowsmith, C.'    12 
primary 'Weigelt, J.'       13 
primary 'Sundstrom, M.'     14 
primary 'Doyle, D.'         15 
# 
_cell.entry_id           2ERY 
_cell.length_a           62.191 
_cell.length_b           72.115 
_cell.length_c           82.073 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ERY 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein R-Ras2' 19971.627 2   ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'              24.305    2   ? ? ? ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"   443.201   2   ? ? ? ? 
4 water       nat water                        18.015    290 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ras-like protein TC21, Teratocarcinoma oncogene' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGF
LLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFH
ELVRVIRKFQEQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGF
LLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFH
ELVRVIRKFQEQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLN n 
1 4   GLU n 
1 5   LYS n 
1 6   TYR n 
1 7   ARG n 
1 8   LEU n 
1 9   VAL n 
1 10  VAL n 
1 11  VAL n 
1 12  GLY n 
1 13  GLY n 
1 14  GLY n 
1 15  GLY n 
1 16  VAL n 
1 17  GLY n 
1 18  LYS n 
1 19  SER n 
1 20  ALA n 
1 21  LEU n 
1 22  THR n 
1 23  ILE n 
1 24  GLN n 
1 25  PHE n 
1 26  ILE n 
1 27  GLN n 
1 28  SER n 
1 29  TYR n 
1 30  PHE n 
1 31  VAL n 
1 32  THR n 
1 33  ASP n 
1 34  TYR n 
1 35  ASP n 
1 36  PRO n 
1 37  THR n 
1 38  ILE n 
1 39  GLU n 
1 40  ASP n 
1 41  SER n 
1 42  TYR n 
1 43  THR n 
1 44  LYS n 
1 45  GLN n 
1 46  CYS n 
1 47  VAL n 
1 48  ILE n 
1 49  ASP n 
1 50  ASP n 
1 51  ARG n 
1 52  ALA n 
1 53  ALA n 
1 54  ARG n 
1 55  LEU n 
1 56  ASP n 
1 57  ILE n 
1 58  LEU n 
1 59  ASP n 
1 60  THR n 
1 61  ALA n 
1 62  GLY n 
1 63  GLN n 
1 64  GLU n 
1 65  GLU n 
1 66  PHE n 
1 67  GLY n 
1 68  ALA n 
1 69  MET n 
1 70  ARG n 
1 71  GLU n 
1 72  GLN n 
1 73  TYR n 
1 74  MET n 
1 75  ARG n 
1 76  THR n 
1 77  GLY n 
1 78  GLU n 
1 79  GLY n 
1 80  PHE n 
1 81  LEU n 
1 82  LEU n 
1 83  VAL n 
1 84  PHE n 
1 85  SER n 
1 86  VAL n 
1 87  THR n 
1 88  ASP n 
1 89  ARG n 
1 90  GLY n 
1 91  SER n 
1 92  PHE n 
1 93  GLU n 
1 94  GLU n 
1 95  ILE n 
1 96  TYR n 
1 97  LYS n 
1 98  PHE n 
1 99  GLN n 
1 100 ARG n 
1 101 GLN n 
1 102 ILE n 
1 103 LEU n 
1 104 ARG n 
1 105 VAL n 
1 106 LYS n 
1 107 ASP n 
1 108 ARG n 
1 109 ASP n 
1 110 GLU n 
1 111 PHE n 
1 112 PRO n 
1 113 MET n 
1 114 ILE n 
1 115 LEU n 
1 116 ILE n 
1 117 GLY n 
1 118 ASN n 
1 119 LYS n 
1 120 ALA n 
1 121 ASP n 
1 122 LEU n 
1 123 ASP n 
1 124 HIS n 
1 125 GLN n 
1 126 ARG n 
1 127 GLN n 
1 128 VAL n 
1 129 THR n 
1 130 GLN n 
1 131 GLU n 
1 132 GLU n 
1 133 GLY n 
1 134 GLN n 
1 135 GLN n 
1 136 LEU n 
1 137 ALA n 
1 138 ARG n 
1 139 GLN n 
1 140 LEU n 
1 141 LYS n 
1 142 VAL n 
1 143 THR n 
1 144 TYR n 
1 145 MET n 
1 146 GLU n 
1 147 ALA n 
1 148 SER n 
1 149 ALA n 
1 150 LYS n 
1 151 ILE n 
1 152 ARG n 
1 153 MET n 
1 154 ASN n 
1 155 VAL n 
1 156 ASP n 
1 157 GLN n 
1 158 ALA n 
1 159 PHE n 
1 160 HIS n 
1 161 GLU n 
1 162 LEU n 
1 163 VAL n 
1 164 ARG n 
1 165 VAL n 
1 166 ILE n 
1 167 ARG n 
1 168 LYS n 
1 169 PHE n 
1 170 GLN n 
1 171 GLU n 
1 172 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RRAS2, TC21' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21(DE3)R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RRAS2_HUMAN 
_struct_ref.pdbx_db_accession          P62070 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLL
VFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHEL
VRVIRKFQEQ
;
_struct_ref.pdbx_align_begin           12 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ERY A 3 ? 172 ? P62070 12 ? 181 ? 12 181 
2 1 2ERY B 3 ? 172 ? P62070 12 ? 181 ? 12 181 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ERY SER A 1 ? UNP P62070 ? ? 'CLONING ARTIFACT' 10 1 
1 2ERY MET A 2 ? UNP P62070 ? ? 'CLONING ARTIFACT' 11 2 
2 2ERY SER B 1 ? UNP P62070 ? ? 'CLONING ARTIFACT' 10 3 
2 2ERY MET B 2 ? UNP P62070 ? ? 'CLONING ARTIFACT' 11 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2ERY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_percent_sol   46.60 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.50 
_exptl_crystal_grow.pdbx_details    
;8 % PEG3350, 0.005 M MgCl2, 0.005 M CoCl2, 0.1 M Bis Tris, 0.1 M Mg(Formate)2, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K, pH 5.50
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-10-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99989 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.99989 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2ERY 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   40966 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.800 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   92.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.50 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ERY 
_refine.ls_number_reflns_obs                     38848 
_refine.ls_number_reflns_all                     38848 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          0.198 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.233 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2062 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               18.16 
_refine.aniso_B[1][1]                            -2.00000 
_refine.aniso_B[2][2]                            3.24000 
_refine.aniso_B[3][3]                            -1.24000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ID 1X1R.PDB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.116 
_refine.pdbx_overall_ESU_R_Free                  0.114 
_refine.overall_SU_ML                            0.084 
_refine.overall_SU_B                             4.384 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2688 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             290 
_refine_hist.number_atoms_total               3036 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 2836 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2600 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.352  1.978  ? 3824 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.575  3.000  ? 5997 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       8.911  5.000  ? 337  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.775 23.378 ? 148  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.636 15.000 ? 519  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.328 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.150  0.200  ? 419  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 3127 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 627  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.193  0.200  ? 534  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.179  0.200  ? 2792 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.176  0.200  ? 1388 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.083  0.200  ? 1747 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.133  0.200  ? 201  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.029  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.178  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.209  0.200  ? 66   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.123  0.200  ? 28   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.693  1.500  ? 1749 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.162  1.500  ? 697  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.997  2.000  ? 2690 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.575  3.000  ? 1275 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.292  4.500  ? 1132 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 793  1.29 5.00  'loose positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 1396 0.47 5.00  'loose positional' 2 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 793  1.15 10.00 'loose thermal'    1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 1396 0.86 10.00 'loose thermal'    2 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.74 
_refine_ls_shell.number_reflns_R_work             2548 
_refine_ls_shell.R_factor_R_work                  0.219 
_refine_ls_shell.percent_reflns_obs               90.28 
_refine_ls_shell.R_factor_R_free                  0.283 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             173 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 A 
2 2 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 13 A 70  1 6 A GLU 4  ? A ALA 61  ? 1 ? 
2 B 13 B 70  1 6 B GLU 4  ? B ALA 61  ? 1 ? 
1 A 82 A 180 1 6 A TYR 73 ? A GLU 171 ? 2 ? 
2 B 82 B 180 1 6 B TYR 73 ? B GLU 171 ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2ERY 
_struct.title                     'The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state' 
_struct.pdbx_descriptor           'Ras-related protein R-Ras2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ERY 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'RRAS2, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 17  ? SER A 28  ? GLY A 26  SER A 37  1 ? 12 
HELX_P HELX_P2  2  GLY A 67  ? GLY A 77  ? GLY A 76  GLY A 86  1 ? 11 
HELX_P HELX_P3  3  ASP A 88  ? GLU A 94  ? ASP A 97  GLU A 103 1 ? 7  
HELX_P HELX_P4  4  GLU A 94  ? ASP A 107 ? GLU A 103 ASP A 116 1 ? 14 
HELX_P HELX_P5  5  THR A 129 ? LEU A 140 ? THR A 138 LEU A 149 1 ? 12 
HELX_P HELX_P6  6  ASN A 154 ? GLN A 170 ? ASN A 163 GLN A 179 1 ? 17 
HELX_P HELX_P7  7  GLY B 17  ? SER B 28  ? GLY B 26  SER B 37  1 ? 12 
HELX_P HELX_P8  8  GLN B 72  ? GLY B 77  ? GLN B 81  GLY B 86  1 ? 6  
HELX_P HELX_P9  9  ASP B 88  ? GLU B 93  ? ASP B 97  GLU B 102 1 ? 6  
HELX_P HELX_P10 10 GLU B 94  ? ASP B 107 ? GLU B 103 ASP B 116 1 ? 14 
HELX_P HELX_P11 11 LEU B 122 ? ARG B 126 ? LEU B 131 ARG B 135 5 ? 5  
HELX_P HELX_P12 12 THR B 129 ? LEU B 140 ? THR B 138 LEU B 149 1 ? 12 
HELX_P HELX_P13 13 ASN B 154 ? GLU B 171 ? ASN B 163 GLU B 180 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C MG  . MG  ? ? ? 1_555 G HOH .  O   ? ? A MG  3 A HOH 324 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc2  metalc ? ? C MG  . MG  ? ? ? 1_555 G HOH .  O   ? ? A MG  3 A HOH 332 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc3  metalc ? ? C MG  . MG  ? ? ? 1_555 D GDP .  O2B ? ? A MG  3 A GDP 1   1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc4  metalc ? ? C MG  . MG  ? ? ? 1_555 A SER 19 OG  ? ? A MG  3 A SER 28  1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc5  metalc ? ? C MG  . MG  ? ? ? 1_555 G HOH .  O   ? ? A MG  3 A HOH 328 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc6  metalc ? ? C MG  . MG  ? ? ? 1_555 G HOH .  O   ? ? A MG  3 A HOH 333 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc7  metalc ? ? F GDP . O2B ? ? ? 1_555 E MG  .  MG  ? ? B GDP 2 B MG  4   1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc8  metalc ? ? E MG  . MG  ? ? ? 1_555 H HOH .  O   ? ? B MG  4 B HOH 299 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc9  metalc ? ? E MG  . MG  ? ? ? 1_555 H HOH .  O   ? ? B MG  4 B HOH 300 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc10 metalc ? ? E MG  . MG  ? ? ? 1_555 B SER 19 OG  ? ? B MG  4 B SER 28  1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc11 metalc ? ? E MG  . MG  ? ? ? 1_555 H HOH .  O   ? ? B MG  4 B HOH 291 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc12 metalc ? ? E MG  . MG  ? ? ? 1_555 H HOH .  O   ? ? B MG  4 B HOH 206 1_555 ? ? ? ? ? ? ? 2.086 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            10 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   MET 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    MET 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     11 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 40  ? ILE A 48  ? ASP A 49  ILE A 57  
A 2 ARG A 51  ? ASP A 59  ? ARG A 60  ASP A 68  
A 3 LYS A 5   ? GLY A 12  ? LYS A 14  GLY A 21  
A 4 GLY A 79  ? SER A 85  ? GLY A 88  SER A 94  
A 5 MET A 113 ? ASN A 118 ? MET A 122 ASN A 127 
A 6 THR A 143 ? GLU A 146 ? THR A 152 GLU A 155 
B 1 ASP B 40  ? ILE B 48  ? ASP B 49  ILE B 57  
B 2 ARG B 51  ? ASP B 59  ? ARG B 60  ASP B 68  
B 3 LYS B 5   ? GLY B 12  ? LYS B 14  GLY B 21  
B 4 GLY B 79  ? SER B 85  ? GLY B 88  SER B 94  
B 5 MET B 113 ? ASN B 118 ? MET B 122 ASN B 127 
B 6 THR B 143 ? GLU B 146 ? THR B 152 GLU B 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 44  ? N LYS A 53  O LEU A 55  ? O LEU A 64  
A 2 3 O ASP A 56  ? O ASP A 65  N LEU A 8   ? N LEU A 17  
A 3 4 N VAL A 11  ? N VAL A 20  O LEU A 81  ? O LEU A 90  
A 4 5 N PHE A 84  ? N PHE A 93  O ASN A 118 ? O ASN A 127 
A 5 6 N LEU A 115 ? N LEU A 124 O THR A 143 ? O THR A 152 
B 1 2 N LYS B 44  ? N LYS B 53  O LEU B 55  ? O LEU B 64  
B 2 3 O LEU B 58  ? O LEU B 67  N VAL B 10  ? N VAL B 19  
B 3 4 N VAL B 11  ? N VAL B 20  O VAL B 83  ? O VAL B 92  
B 4 5 N LEU B 82  ? N LEU B 91  O ILE B 114 ? O ILE B 123 
B 5 6 N LEU B 115 ? N LEU B 124 O THR B 143 ? O THR B 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 3'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 4'  
AC3 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE GDP A 1' 
AC4 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE GDP B 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  GDP D .   ? GDP A 1   . ? 1_555 ? 
2  AC1 6  SER A 19  ? SER A 28  . ? 1_555 ? 
3  AC1 6  HOH G .   ? HOH A 324 . ? 1_555 ? 
4  AC1 6  HOH G .   ? HOH A 328 . ? 1_555 ? 
5  AC1 6  HOH G .   ? HOH A 332 . ? 1_555 ? 
6  AC1 6  HOH G .   ? HOH A 333 . ? 1_555 ? 
7  AC2 6  GDP F .   ? GDP B 2   . ? 1_555 ? 
8  AC2 6  SER B 19  ? SER B 28  . ? 1_555 ? 
9  AC2 6  HOH H .   ? HOH B 206 . ? 1_555 ? 
10 AC2 6  HOH H .   ? HOH B 291 . ? 1_555 ? 
11 AC2 6  HOH H .   ? HOH B 299 . ? 1_555 ? 
12 AC2 6  HOH H .   ? HOH B 300 . ? 1_555 ? 
13 AC3 26 MG  C .   ? MG  A 3   . ? 1_555 ? 
14 AC3 26 GLY A 13  ? GLY A 22  . ? 1_555 ? 
15 AC3 26 GLY A 15  ? GLY A 24  . ? 1_555 ? 
16 AC3 26 VAL A 16  ? VAL A 25  . ? 1_555 ? 
17 AC3 26 GLY A 17  ? GLY A 26  . ? 1_555 ? 
18 AC3 26 LYS A 18  ? LYS A 27  . ? 1_555 ? 
19 AC3 26 SER A 19  ? SER A 28  . ? 1_555 ? 
20 AC3 26 ALA A 20  ? ALA A 29  . ? 1_555 ? 
21 AC3 26 PHE A 30  ? PHE A 39  . ? 1_555 ? 
22 AC3 26 VAL A 31  ? VAL A 40  . ? 1_555 ? 
23 AC3 26 THR A 32  ? THR A 41  . ? 1_555 ? 
24 AC3 26 ASN A 118 ? ASN A 127 . ? 1_555 ? 
25 AC3 26 LYS A 119 ? LYS A 128 . ? 1_555 ? 
26 AC3 26 ASP A 121 ? ASP A 130 . ? 1_555 ? 
27 AC3 26 LEU A 122 ? LEU A 131 . ? 1_555 ? 
28 AC3 26 SER A 148 ? SER A 157 . ? 1_555 ? 
29 AC3 26 ALA A 149 ? ALA A 158 . ? 1_555 ? 
30 AC3 26 LYS A 150 ? LYS A 159 . ? 1_555 ? 
31 AC3 26 HOH G .   ? HOH A 275 . ? 1_555 ? 
32 AC3 26 HOH G .   ? HOH A 276 . ? 1_555 ? 
33 AC3 26 HOH G .   ? HOH A 294 . ? 1_555 ? 
34 AC3 26 HOH G .   ? HOH A 313 . ? 1_555 ? 
35 AC3 26 HOH G .   ? HOH A 318 . ? 1_555 ? 
36 AC3 26 HOH G .   ? HOH A 324 . ? 1_555 ? 
37 AC3 26 HOH G .   ? HOH A 332 . ? 1_555 ? 
38 AC3 26 HOH G .   ? HOH A 333 . ? 1_555 ? 
39 AC4 26 MG  E .   ? MG  B 4   . ? 1_555 ? 
40 AC4 26 GLY B 15  ? GLY B 24  . ? 1_555 ? 
41 AC4 26 VAL B 16  ? VAL B 25  . ? 1_555 ? 
42 AC4 26 GLY B 17  ? GLY B 26  . ? 1_555 ? 
43 AC4 26 LYS B 18  ? LYS B 27  . ? 1_555 ? 
44 AC4 26 SER B 19  ? SER B 28  . ? 1_555 ? 
45 AC4 26 ALA B 20  ? ALA B 29  . ? 1_555 ? 
46 AC4 26 PHE B 30  ? PHE B 39  . ? 1_555 ? 
47 AC4 26 VAL B 31  ? VAL B 40  . ? 1_555 ? 
48 AC4 26 THR B 32  ? THR B 41  . ? 1_555 ? 
49 AC4 26 ASN B 118 ? ASN B 127 . ? 1_555 ? 
50 AC4 26 LYS B 119 ? LYS B 128 . ? 1_555 ? 
51 AC4 26 ASP B 121 ? ASP B 130 . ? 1_555 ? 
52 AC4 26 LEU B 122 ? LEU B 131 . ? 1_555 ? 
53 AC4 26 SER B 148 ? SER B 157 . ? 1_555 ? 
54 AC4 26 ALA B 149 ? ALA B 158 . ? 1_555 ? 
55 AC4 26 LYS B 150 ? LYS B 159 . ? 1_555 ? 
56 AC4 26 HOH H .   ? HOH B 217 . ? 1_555 ? 
57 AC4 26 HOH H .   ? HOH B 269 . ? 1_555 ? 
58 AC4 26 HOH H .   ? HOH B 270 . ? 1_555 ? 
59 AC4 26 HOH H .   ? HOH B 271 . ? 1_555 ? 
60 AC4 26 HOH H .   ? HOH B 283 . ? 1_555 ? 
61 AC4 26 HOH H .   ? HOH B 291 . ? 1_555 ? 
62 AC4 26 HOH H .   ? HOH B 295 . ? 1_555 ? 
63 AC4 26 HOH H .   ? HOH B 299 . ? 1_555 ? 
64 AC4 26 HOH H .   ? HOH B 300 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ERY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ERY 
_atom_sites.fract_transf_matrix[1][1]   0.016079 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013867 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012184 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 1   ? 12.569  4.274   -22.691 1.00 46.42 ? 10  SER A N     1 
ATOM   2    C  CA    . SER A 1 1   ? 11.181  4.833   -22.777 1.00 45.97 ? 10  SER A CA    1 
ATOM   3    C  C     . SER A 1 1   ? 10.325  4.009   -23.740 1.00 45.65 ? 10  SER A C     1 
ATOM   4    O  O     . SER A 1 1   ? 10.620  3.973   -24.942 1.00 46.03 ? 10  SER A O     1 
ATOM   5    C  CB    . SER A 1 1   ? 11.211  6.293   -23.229 1.00 46.33 ? 10  SER A CB    1 
ATOM   6    N  N     . MET A 1 2   ? 9.272   3.347   -23.251 1.00 44.93 ? 11  MET A N     1 
ATOM   7    C  CA    . MET A 1 2   ? 8.851   3.369   -21.842 1.00 44.30 ? 11  MET A CA    1 
ATOM   8    C  C     . MET A 1 2   ? 9.867   2.673   -20.934 1.00 42.61 ? 11  MET A C     1 
ATOM   9    O  O     . MET A 1 2   ? 10.347  1.587   -21.248 1.00 42.67 ? 11  MET A O     1 
ATOM   10   C  CB    . MET A 1 2   ? 7.489   2.674   -21.695 1.00 44.86 ? 11  MET A CB    1 
ATOM   11   C  CG    . MET A 1 2   ? 6.879   2.747   -20.293 1.00 46.86 ? 11  MET A CG    1 
ATOM   12   S  SD    . MET A 1 2   ? 6.473   4.430   -19.787 1.00 52.09 ? 11  MET A SD    1 
ATOM   13   C  CE    . MET A 1 2   ? 5.068   4.775   -20.849 1.00 51.27 ? 11  MET A CE    1 
ATOM   14   N  N     . GLN A 1 3   ? 10.174  3.306   -19.804 1.00 40.33 ? 12  GLN A N     1 
ATOM   15   C  CA    . GLN A 1 3   ? 11.154  2.781   -18.858 1.00 38.83 ? 12  GLN A CA    1 
ATOM   16   C  C     . GLN A 1 3   ? 10.523  2.654   -17.474 1.00 37.31 ? 12  GLN A C     1 
ATOM   17   O  O     . GLN A 1 3   ? 9.632   3.427   -17.113 1.00 36.96 ? 12  GLN A O     1 
ATOM   18   C  CB    . GLN A 1 3   ? 12.370  3.706   -18.782 1.00 39.01 ? 12  GLN A CB    1 
ATOM   19   N  N     . GLU A 1 4   ? 10.993  1.668   -16.713 1.00 35.33 ? 13  GLU A N     1 
ATOM   20   C  CA    . GLU A 1 4   ? 10.500  1.426   -15.365 1.00 34.37 ? 13  GLU A CA    1 
ATOM   21   C  C     . GLU A 1 4   ? 10.886  2.583   -14.441 1.00 32.50 ? 13  GLU A C     1 
ATOM   22   O  O     . GLU A 1 4   ? 12.071  2.870   -14.242 1.00 31.09 ? 13  GLU A O     1 
ATOM   23   C  CB    . GLU A 1 4   ? 11.049  0.102   -14.830 1.00 34.40 ? 13  GLU A CB    1 
ATOM   24   C  CG    . GLU A 1 4   ? 10.331  -0.398  -13.605 1.00 35.88 ? 13  GLU A CG    1 
ATOM   25   C  CD    . GLU A 1 4   ? 10.755  -1.790  -13.183 1.00 36.68 ? 13  GLU A CD    1 
ATOM   26   O  OE1   . GLU A 1 4   ? 11.502  -2.465  -13.930 1.00 40.66 ? 13  GLU A OE1   1 
ATOM   27   O  OE2   . GLU A 1 4   ? 10.324  -2.218  -12.090 1.00 40.56 ? 13  GLU A OE2   1 
ATOM   28   N  N     . LYS A 1 5   ? 9.871   3.235   -13.879 1.00 31.03 ? 14  LYS A N     1 
ATOM   29   C  CA    . LYS A 1 5   ? 10.069  4.399   -13.028 1.00 29.95 ? 14  LYS A CA    1 
ATOM   30   C  C     . LYS A 1 5   ? 9.107   4.336   -11.852 1.00 29.02 ? 14  LYS A C     1 
ATOM   31   O  O     . LYS A 1 5   ? 7.940   3.993   -12.032 1.00 27.90 ? 14  LYS A O     1 
ATOM   32   C  CB    . LYS A 1 5   ? 9.803   5.672   -13.814 1.00 30.54 ? 14  LYS A CB    1 
ATOM   33   C  CG    . LYS A 1 5   ? 9.987   6.941   -13.015 1.00 32.14 ? 14  LYS A CG    1 
ATOM   34   C  CD    . LYS A 1 5   ? 9.524   8.148   -13.815 1.00 35.15 ? 14  LYS A CD    1 
ATOM   35   N  N     . TYR A 1 6   ? 9.599   4.686   -10.667 1.00 27.33 ? 15  TYR A N     1 
ATOM   36   C  CA    . TYR A 1 6   ? 8.807   4.574   -9.448  1.00 27.59 ? 15  TYR A CA    1 
ATOM   37   C  C     . TYR A 1 6   ? 8.834   5.849   -8.655  1.00 26.23 ? 15  TYR A C     1 
ATOM   38   O  O     . TYR A 1 6   ? 9.904   6.365   -8.332  1.00 25.92 ? 15  TYR A O     1 
ATOM   39   C  CB    . TYR A 1 6   ? 9.326   3.438   -8.590  1.00 28.98 ? 15  TYR A CB    1 
ATOM   40   C  CG    . TYR A 1 6   ? 9.041   2.115   -9.216  1.00 30.75 ? 15  TYR A CG    1 
ATOM   41   C  CD1   . TYR A 1 6   ? 7.730   1.741   -9.481  1.00 32.99 ? 15  TYR A CD1   1 
ATOM   42   C  CD2   . TYR A 1 6   ? 10.060  1.254   -9.579  1.00 32.52 ? 15  TYR A CD2   1 
ATOM   43   C  CE1   . TYR A 1 6   ? 7.438   0.541   -10.074 1.00 33.63 ? 15  TYR A CE1   1 
ATOM   44   C  CE2   . TYR A 1 6   ? 9.771   0.031   -10.178 1.00 32.12 ? 15  TYR A CE2   1 
ATOM   45   C  CZ    . TYR A 1 6   ? 8.454   -0.311  -10.412 1.00 32.45 ? 15  TYR A CZ    1 
ATOM   46   O  OH    . TYR A 1 6   ? 8.093   -1.506  -11.000 1.00 34.45 ? 15  TYR A OH    1 
ATOM   47   N  N     . ARG A 1 7   ? 7.640   6.347   -8.341  1.00 24.98 ? 16  ARG A N     1 
ATOM   48   C  CA    . ARG A 1 7   ? 7.475   7.515   -7.500  1.00 24.60 ? 16  ARG A CA    1 
ATOM   49   C  C     . ARG A 1 7   ? 7.397   7.013   -6.060  1.00 23.27 ? 16  ARG A C     1 
ATOM   50   O  O     . ARG A 1 7   ? 6.394   6.425   -5.651  1.00 22.41 ? 16  ARG A O     1 
ATOM   51   C  CB    . ARG A 1 7   ? 6.201   8.274   -7.878  1.00 24.84 ? 16  ARG A CB    1 
ATOM   52   C  CG    A ARG A 1 7   ? 6.227   8.825   -9.293  0.50 26.05 ? 16  ARG A CG    1 
ATOM   53   C  CG    B ARG A 1 7   ? 6.267   8.914   -9.255  0.50 26.37 ? 16  ARG A CG    1 
ATOM   54   C  CD    A ARG A 1 7   ? 5.038   9.719   -9.585  0.50 26.46 ? 16  ARG A CD    1 
ATOM   55   C  CD    B ARG A 1 7   ? 6.193   10.446  -9.186  0.50 27.94 ? 16  ARG A CD    1 
ATOM   56   N  NE    A ARG A 1 7   ? 3.758   9.020   -9.484  0.50 29.14 ? 16  ARG A NE    1 
ATOM   57   N  NE    B ARG A 1 7   ? 4.858   10.914  -9.525  0.50 28.24 ? 16  ARG A NE    1 
ATOM   58   C  CZ    A ARG A 1 7   ? 3.218   8.258   -10.438 0.50 29.34 ? 16  ARG A CZ    1 
ATOM   59   C  CZ    B ARG A 1 7   ? 4.365   12.125  -9.276  0.50 28.56 ? 16  ARG A CZ    1 
ATOM   60   N  NH1   A ARG A 1 7   ? 3.832   8.079   -11.605 0.50 31.14 ? 16  ARG A NH1   1 
ATOM   61   N  NH1   B ARG A 1 7   ? 5.071   13.056  -8.635  0.50 29.78 ? 16  ARG A NH1   1 
ATOM   62   N  NH2   A ARG A 1 7   ? 2.040   7.676   -10.231 0.50 28.87 ? 16  ARG A NH2   1 
ATOM   63   N  NH2   B ARG A 1 7   ? 3.131   12.399  -9.665  0.50 28.21 ? 16  ARG A NH2   1 
ATOM   64   N  N     . LEU A 1 8   ? 8.481   7.208   -5.323  1.00 21.93 ? 17  LEU A N     1 
ATOM   65   C  CA    . LEU A 1 8   ? 8.560   6.802   -3.927  1.00 21.32 ? 17  LEU A CA    1 
ATOM   66   C  C     . LEU A 1 8   ? 8.469   8.021   -3.026  1.00 21.10 ? 17  LEU A C     1 
ATOM   67   O  O     . LEU A 1 8   ? 9.004   9.086   -3.341  1.00 22.36 ? 17  LEU A O     1 
ATOM   68   C  CB    . LEU A 1 8   ? 9.871   6.085   -3.660  1.00 20.69 ? 17  LEU A CB    1 
ATOM   69   C  CG    . LEU A 1 8   ? 10.154  4.915   -4.603  1.00 20.76 ? 17  LEU A CG    1 
ATOM   70   C  CD1   . LEU A 1 8   ? 11.441  4.273   -4.125  1.00 20.66 ? 17  LEU A CD1   1 
ATOM   71   C  CD2   . LEU A 1 8   ? 9.016   3.939   -4.637  1.00 22.04 ? 17  LEU A CD2   1 
ATOM   72   N  N     . VAL A 1 9   ? 7.796   7.862   -1.894  1.00 20.38 ? 18  VAL A N     1 
ATOM   73   C  CA    . VAL A 1 9   ? 7.524   8.980   -0.994  1.00 19.60 ? 18  VAL A CA    1 
ATOM   74   C  C     . VAL A 1 9   ? 7.958   8.594   0.417   1.00 19.74 ? 18  VAL A C     1 
ATOM   75   O  O     . VAL A 1 9   ? 7.606   7.517   0.890   1.00 19.70 ? 18  VAL A O     1 
ATOM   76   C  CB    . VAL A 1 9   ? 6.036   9.331   -0.995  1.00 19.72 ? 18  VAL A CB    1 
ATOM   77   C  CG1   . VAL A 1 9   ? 5.760   10.556  -0.088  1.00 20.49 ? 18  VAL A CG1   1 
ATOM   78   C  CG2   . VAL A 1 9   ? 5.571   9.579   -2.408  1.00 20.37 ? 18  VAL A CG2   1 
ATOM   79   N  N     . VAL A 1 10  ? 8.761   9.448   1.035   1.00 19.23 ? 19  VAL A N     1 
ATOM   80   C  CA    . VAL A 1 10  ? 9.318   9.216   2.373   1.00 20.34 ? 19  VAL A CA    1 
ATOM   81   C  C     . VAL A 1 10  ? 8.521   10.069  3.349   1.00 20.92 ? 19  VAL A C     1 
ATOM   82   O  O     . VAL A 1 10  ? 8.511   11.309  3.236   1.00 21.40 ? 19  VAL A O     1 
ATOM   83   C  CB    . VAL A 1 10  ? 10.825  9.590   2.442   1.00 20.47 ? 19  VAL A CB    1 
ATOM   84   C  CG1   . VAL A 1 10  ? 11.407  9.312   3.827   1.00 20.58 ? 19  VAL A CG1   1 
ATOM   85   C  CG2   . VAL A 1 10  ? 11.629  8.846   1.389   1.00 20.69 ? 19  VAL A CG2   1 
ATOM   86   N  N     . VAL A 1 11  ? 7.852   9.403   4.291   1.00 21.30 ? 20  VAL A N     1 
ATOM   87   C  CA    . VAL A 1 11  ? 6.973   10.070  5.264   1.00 21.41 ? 20  VAL A CA    1 
ATOM   88   C  C     . VAL A 1 11  ? 7.431   9.734   6.681   1.00 21.81 ? 20  VAL A C     1 
ATOM   89   O  O     . VAL A 1 11  ? 8.152   8.762   6.886   1.00 20.68 ? 20  VAL A O     1 
ATOM   90   C  CB    . VAL A 1 11  ? 5.478   9.711   5.060   1.00 21.16 ? 20  VAL A CB    1 
ATOM   91   C  CG1   . VAL A 1 11  ? 5.038   10.006  3.629   1.00 21.95 ? 20  VAL A CG1   1 
ATOM   92   C  CG2   . VAL A 1 11  ? 5.182   8.255   5.382   1.00 20.61 ? 20  VAL A CG2   1 
ATOM   93   N  N     . GLY A 1 12  ? 7.044   10.573  7.640   1.00 21.60 ? 21  GLY A N     1 
ATOM   94   C  CA    . GLY A 1 12  ? 7.299   10.317  9.051   1.00 21.79 ? 21  GLY A CA    1 
ATOM   95   C  C     . GLY A 1 12  ? 7.389   11.631  9.795   1.00 21.20 ? 21  GLY A C     1 
ATOM   96   O  O     . GLY A 1 12  ? 7.336   12.690  9.147   1.00 21.01 ? 21  GLY A O     1 
ATOM   97   N  N     . GLY A 1 13  ? 7.517   11.576  11.128  1.00 20.58 ? 22  GLY A N     1 
ATOM   98   C  CA    . GLY A 1 13  ? 7.698   12.811  11.972  1.00 19.96 ? 22  GLY A CA    1 
ATOM   99   C  C     . GLY A 1 13  ? 8.883   13.645  11.471  1.00 19.60 ? 22  GLY A C     1 
ATOM   100  O  O     . GLY A 1 13  ? 9.755   13.085  10.905  1.00 20.16 ? 22  GLY A O     1 
ATOM   101  N  N     . GLY A 1 14  ? 9.094   14.905  11.854  1.00 20.42 ? 23  GLY A N     1 
ATOM   102  C  CA    . GLY A 1 14  ? 9.423   15.261  13.184  1.00 20.35 ? 23  GLY A CA    1 
ATOM   103  C  C     . GLY A 1 14  ? 10.870  14.810  13.447  1.00 19.42 ? 23  GLY A C     1 
ATOM   104  O  O     . GLY A 1 14  ? 11.119  14.186  14.448  1.00 20.98 ? 23  GLY A O     1 
ATOM   105  N  N     . GLY A 1 15  ? 11.821  15.102  12.553  1.00 18.37 ? 24  GLY A N     1 
ATOM   106  C  CA    . GLY A 1 15  ? 13.254  14.827  12.822  1.00 17.15 ? 24  GLY A CA    1 
ATOM   107  C  C     . GLY A 1 15  ? 13.695  13.363  12.833  1.00 16.82 ? 24  GLY A C     1 
ATOM   108  O  O     . GLY A 1 15  ? 14.707  12.992  13.453  1.00 16.02 ? 24  GLY A O     1 
ATOM   109  N  N     . VAL A 1 16  ? 12.931  12.519  12.168  1.00 16.12 ? 25  VAL A N     1 
ATOM   110  C  CA    . VAL A 1 16  ? 13.211  11.089  12.192  1.00 15.82 ? 25  VAL A CA    1 
ATOM   111  C  C     . VAL A 1 16  ? 14.373  10.673  11.295  1.00 16.12 ? 25  VAL A C     1 
ATOM   112  O  O     . VAL A 1 16  ? 14.925  9.593   11.469  1.00 16.05 ? 25  VAL A O     1 
ATOM   113  C  CB    . VAL A 1 16  ? 11.942  10.230  11.860  1.00 16.11 ? 25  VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 16  ? 10.853  10.503  12.899  1.00 16.50 ? 25  VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 16  ? 11.437  10.484  10.458  1.00 15.12 ? 25  VAL A CG2   1 
ATOM   116  N  N     . GLY A 1 17  ? 14.722  11.496  10.314  1.00 15.69 ? 26  GLY A N     1 
ATOM   117  C  CA    . GLY A 1 17  ? 15.765  11.134  9.347   1.00 15.62 ? 26  GLY A CA    1 
ATOM   118  C  C     . GLY A 1 17  ? 15.327  10.960  7.898   1.00 15.79 ? 26  GLY A C     1 
ATOM   119  O  O     . GLY A 1 17  ? 16.059  10.372  7.107   1.00 16.86 ? 26  GLY A O     1 
ATOM   120  N  N     . LYS A 1 18  ? 14.153  11.482  7.535   1.00 15.37 ? 27  LYS A N     1 
ATOM   121  C  CA    . LYS A 1 18  ? 13.665  11.413  6.145   1.00 15.66 ? 27  LYS A CA    1 
ATOM   122  C  C     . LYS A 1 18  ? 14.689  12.030  5.179   1.00 15.77 ? 27  LYS A C     1 
ATOM   123  O  O     . LYS A 1 18  ? 15.084  11.424  4.166   1.00 15.92 ? 27  LYS A O     1 
ATOM   124  C  CB    . LYS A 1 18  ? 12.321  12.142  6.004   1.00 16.28 ? 27  LYS A CB    1 
ATOM   125  C  CG    . LYS A 1 18  ? 11.182  11.613  6.893   1.00 16.99 ? 27  LYS A CG    1 
ATOM   126  C  CD    . LYS A 1 18  ? 9.856   12.360  6.627   1.00 15.33 ? 27  LYS A CD    1 
ATOM   127  C  CE    . LYS A 1 18  ? 9.887   13.794  7.090   1.00 13.80 ? 27  LYS A CE    1 
ATOM   128  N  NZ    . LYS A 1 18  ? 10.189  13.925  8.551   1.00 16.21 ? 27  LYS A NZ    1 
ATOM   129  N  N     . SER A 1 19  ? 15.139  13.225  5.512   1.00 15.38 ? 28  SER A N     1 
ATOM   130  C  CA    . SER A 1 19  ? 16.138  13.903  4.689   1.00 15.62 ? 28  SER A CA    1 
ATOM   131  C  C     . SER A 1 19  ? 17.490  13.186  4.695   1.00 15.53 ? 28  SER A C     1 
ATOM   132  O  O     . SER A 1 19  ? 18.091  12.976  3.642   1.00 14.17 ? 28  SER A O     1 
ATOM   133  C  CB    . SER A 1 19  ? 16.314  15.337  5.162   1.00 15.35 ? 28  SER A CB    1 
ATOM   134  O  OG    . SER A 1 19  ? 15.163  16.126  4.888   1.00 15.25 ? 28  SER A OG    1 
ATOM   135  N  N     . ALA A 1 20  ? 17.973  12.820  5.880   1.00 16.33 ? 29  ALA A N     1 
ATOM   136  C  CA    . ALA A 1 20  ? 19.271  12.133  5.988   1.00 17.03 ? 29  ALA A CA    1 
ATOM   137  C  C     . ALA A 1 20  ? 19.309  10.809  5.218   1.00 16.98 ? 29  ALA A C     1 
ATOM   138  O  O     . ALA A 1 20  ? 20.312  10.514  4.558   1.00 17.43 ? 29  ALA A O     1 
ATOM   139  C  CB    . ALA A 1 20  ? 19.643  11.897  7.443   1.00 17.33 ? 29  ALA A CB    1 
ATOM   140  N  N     . LEU A 1 21  ? 18.248  10.006  5.310   1.00 16.38 ? 30  LEU A N     1 
ATOM   141  C  CA    . LEU A 1 21  ? 18.158  8.761   4.553   1.00 16.52 ? 30  LEU A CA    1 
ATOM   142  C  C     . LEU A 1 21  ? 18.169  9.013   3.056   1.00 16.54 ? 30  LEU A C     1 
ATOM   143  O  O     . LEU A 1 21  ? 18.870  8.333   2.297   1.00 16.28 ? 30  LEU A O     1 
ATOM   144  C  CB    . LEU A 1 21  ? 16.896  7.980   4.947   1.00 16.12 ? 30  LEU A CB    1 
ATOM   145  C  CG    . LEU A 1 21  ? 16.946  7.339   6.340   1.00 17.50 ? 30  LEU A CG    1 
ATOM   146  C  CD1   . LEU A 1 21  ? 15.541  6.878   6.714   1.00 16.27 ? 30  LEU A CD1   1 
ATOM   147  C  CD2   . LEU A 1 21  ? 17.893  6.138   6.379   1.00 16.07 ? 30  LEU A CD2   1 
ATOM   148  N  N     . THR A 1 22  ? 17.371  9.979   2.622   1.00 16.22 ? 31  THR A N     1 
ATOM   149  C  CA    . THR A 1 22  ? 17.276  10.304  1.195   1.00 16.60 ? 31  THR A CA    1 
ATOM   150  C  C     . THR A 1 22  ? 18.613  10.782  0.612   1.00 16.70 ? 31  THR A C     1 
ATOM   151  O  O     . THR A 1 22  ? 19.046  10.325  -0.436  1.00 16.38 ? 31  THR A O     1 
ATOM   152  C  CB    . THR A 1 22  ? 16.213  11.396  0.957   1.00 16.37 ? 31  THR A CB    1 
ATOM   153  O  OG1   . THR A 1 22  ? 14.948  10.943  1.459   1.00 18.02 ? 31  THR A OG1   1 
ATOM   154  C  CG2   . THR A 1 22  ? 16.068  11.710  -0.526  1.00 17.56 ? 31  THR A CG2   1 
ATOM   155  N  N     . ILE A 1 23  ? 19.265  11.703  1.305   1.00 16.41 ? 32  ILE A N     1 
ATOM   156  C  CA    . ILE A 1 23  ? 20.533  12.247  0.847   1.00 16.57 ? 32  ILE A CA    1 
ATOM   157  C  C     . ILE A 1 23  ? 21.657  11.202  0.902   1.00 16.75 ? 32  ILE A C     1 
ATOM   158  O  O     . ILE A 1 23  ? 22.507  11.148  0.009   1.00 16.08 ? 32  ILE A O     1 
ATOM   159  C  CB    . ILE A 1 23  ? 20.870  13.527  1.624   1.00 16.76 ? 32  ILE A CB    1 
ATOM   160  C  CG1   . ILE A 1 23  ? 19.812  14.588  1.295   1.00 16.51 ? 32  ILE A CG1   1 
ATOM   161  C  CG2   . ILE A 1 23  ? 22.264  14.023  1.262   1.00 17.78 ? 32  ILE A CG2   1 
ATOM   162  C  CD1   . ILE A 1 23  ? 19.831  15.825  2.177   1.00 15.93 ? 32  ILE A CD1   1 
ATOM   163  N  N     . GLN A 1 24  ? 21.650  10.352  1.919   1.00 17.05 ? 33  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 24  ? 22.577  9.225   1.941   1.00 17.28 ? 33  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 24  ? 22.351  8.327   0.721   1.00 16.55 ? 33  GLN A C     1 
ATOM   166  O  O     . GLN A 1 24  ? 23.297  7.958   0.039   1.00 16.15 ? 33  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 24  ? 22.448  8.411   3.223   1.00 17.53 ? 33  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 24  ? 23.341  8.873   4.327   1.00 19.16 ? 33  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 24  ? 24.802  8.446   4.152   1.00 19.32 ? 33  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 24  ? 25.284  8.215   3.031   1.00 20.49 ? 33  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 24  ? 25.520  8.371   5.263   1.00 18.02 ? 33  GLN A NE2   1 
ATOM   172  N  N     . PHE A 1 25  ? 21.092  8.005   0.439   1.00 16.36 ? 34  PHE A N     1 
ATOM   173  C  CA    . PHE A 1 25  ? 20.770  7.167   -0.723  1.00 15.81 ? 34  PHE A CA    1 
ATOM   174  C  C     . PHE A 1 25  ? 21.278  7.761   -2.036  1.00 16.20 ? 34  PHE A C     1 
ATOM   175  O  O     . PHE A 1 25  ? 21.889  7.072   -2.850  1.00 16.04 ? 34  PHE A O     1 
ATOM   176  C  CB    . PHE A 1 25  ? 19.255  6.954   -0.813  1.00 15.86 ? 34  PHE A CB    1 
ATOM   177  C  CG    . PHE A 1 25  ? 18.839  6.047   -1.924  1.00 14.12 ? 34  PHE A CG    1 
ATOM   178  C  CD1   . PHE A 1 25  ? 17.906  6.459   -2.874  1.00 14.78 ? 34  PHE A CD1   1 
ATOM   179  C  CD2   . PHE A 1 25  ? 19.354  4.772   -2.015  1.00 15.84 ? 34  PHE A CD2   1 
ATOM   180  C  CE1   . PHE A 1 25  ? 17.517  5.602   -3.890  1.00 14.94 ? 34  PHE A CE1   1 
ATOM   181  C  CE2   . PHE A 1 25  ? 18.967  3.922   -3.028  1.00 16.56 ? 34  PHE A CE2   1 
ATOM   182  C  CZ    . PHE A 1 25  ? 18.052  4.333   -3.960  1.00 16.04 ? 34  PHE A CZ    1 
ATOM   183  N  N     . ILE A 1 26  ? 21.037  9.055   -2.232  1.00 15.86 ? 35  ILE A N     1 
ATOM   184  C  CA    . ILE A 1 26  ? 21.308  9.696   -3.507  1.00 16.89 ? 35  ILE A CA    1 
ATOM   185  C  C     . ILE A 1 26  ? 22.789  10.049  -3.625  1.00 17.24 ? 35  ILE A C     1 
ATOM   186  O  O     . ILE A 1 26  ? 23.394  9.799   -4.671  1.00 18.16 ? 35  ILE A O     1 
ATOM   187  C  CB    . ILE A 1 26  ? 20.435  10.972  -3.709  1.00 16.47 ? 35  ILE A CB    1 
ATOM   188  C  CG1   . ILE A 1 26  ? 18.936  10.633  -3.655  1.00 17.37 ? 35  ILE A CG1   1 
ATOM   189  C  CG2   . ILE A 1 26  ? 20.773  11.664  -5.039  1.00 17.11 ? 35  ILE A CG2   1 
ATOM   190  C  CD1   . ILE A 1 26  ? 18.422  9.787   -4.796  1.00 17.80 ? 35  ILE A CD1   1 
ATOM   191  N  N     . GLN A 1 27  ? 23.373  10.594  -2.551  1.00 17.51 ? 36  GLN A N     1 
ATOM   192  C  CA    . GLN A 1 27  ? 24.733  11.162  -2.580  1.00 17.91 ? 36  GLN A CA    1 
ATOM   193  C  C     . GLN A 1 27  ? 25.807  10.470  -1.719  1.00 17.99 ? 36  GLN A C     1 
ATOM   194  O  O     . GLN A 1 27  ? 26.979  10.876  -1.755  1.00 17.13 ? 36  GLN A O     1 
ATOM   195  C  CB    . GLN A 1 27  ? 24.672  12.636  -2.160  1.00 17.64 ? 36  GLN A CB    1 
ATOM   196  C  CG    . GLN A 1 27  ? 23.586  13.423  -2.860  1.00 18.22 ? 36  GLN A CG    1 
ATOM   197  C  CD    . GLN A 1 27  ? 23.664  14.908  -2.587  1.00 19.08 ? 36  GLN A CD    1 
ATOM   198  O  OE1   . GLN A 1 27  ? 24.584  15.379  -1.919  1.00 20.70 ? 36  GLN A OE1   1 
ATOM   199  N  NE2   . GLN A 1 27  ? 22.703  15.662  -3.119  1.00 21.66 ? 36  GLN A NE2   1 
ATOM   200  N  N     . SER A 1 28  ? 25.434  9.446   -0.953  1.00 18.16 ? 37  SER A N     1 
ATOM   201  C  CA    . SER A 1 28  ? 26.381  8.797   -0.033  1.00 18.64 ? 37  SER A CA    1 
ATOM   202  C  C     . SER A 1 28  ? 27.075  9.796   0.914   1.00 18.60 ? 37  SER A C     1 
ATOM   203  O  O     . SER A 1 28  ? 28.277  9.701   1.187   1.00 18.78 ? 37  SER A O     1 
ATOM   204  C  CB    . SER A 1 28  ? 27.405  7.974   -0.817  1.00 18.96 ? 37  SER A CB    1 
ATOM   205  O  OG    . SER A 1 28  ? 26.758  6.899   -1.478  1.00 20.34 ? 37  SER A OG    1 
ATOM   206  N  N     . TYR A 1 29  ? 26.300  10.756  1.402   1.00 18.38 ? 38  TYR A N     1 
ATOM   207  C  CA    . TYR A 1 29  ? 26.770  11.739  2.359   1.00 18.44 ? 38  TYR A CA    1 
ATOM   208  C  C     . TYR A 1 29  ? 25.757  11.910  3.485   1.00 18.06 ? 38  TYR A C     1 
ATOM   209  O  O     . TYR A 1 29  ? 24.550  11.914  3.233   1.00 17.60 ? 38  TYR A O     1 
ATOM   210  C  CB    . TYR A 1 29  ? 26.987  13.077  1.670   1.00 18.86 ? 38  TYR A CB    1 
ATOM   211  C  CG    . TYR A 1 29  ? 27.517  14.128  2.604   1.00 19.30 ? 38  TYR A CG    1 
ATOM   212  C  CD1   . TYR A 1 29  ? 28.857  14.141  2.969   1.00 20.47 ? 38  TYR A CD1   1 
ATOM   213  C  CD2   . TYR A 1 29  ? 26.679  15.103  3.137   1.00 19.78 ? 38  TYR A CD2   1 
ATOM   214  C  CE1   . TYR A 1 29  ? 29.355  15.100  3.838   1.00 21.01 ? 38  TYR A CE1   1 
ATOM   215  C  CE2   . TYR A 1 29  ? 27.167  16.069  4.007   1.00 20.14 ? 38  TYR A CE2   1 
ATOM   216  C  CZ    . TYR A 1 29  ? 28.503  16.059  4.356   1.00 19.98 ? 38  TYR A CZ    1 
ATOM   217  O  OH    . TYR A 1 29  ? 29.006  17.007  5.216   1.00 20.64 ? 38  TYR A OH    1 
ATOM   218  N  N     . PHE A 1 30  ? 26.248  12.076  4.713   1.00 18.10 ? 39  PHE A N     1 
ATOM   219  C  CA    . PHE A 1 30  ? 25.374  12.201  5.893   1.00 18.34 ? 39  PHE A CA    1 
ATOM   220  C  C     . PHE A 1 30  ? 25.202  13.666  6.285   1.00 18.89 ? 39  PHE A C     1 
ATOM   221  O  O     . PHE A 1 30  ? 26.159  14.320  6.704   1.00 18.38 ? 39  PHE A O     1 
ATOM   222  C  CB    . PHE A 1 30  ? 25.921  11.417  7.093   1.00 17.96 ? 39  PHE A CB    1 
ATOM   223  C  CG    . PHE A 1 30  ? 25.113  11.601  8.359   1.00 17.26 ? 39  PHE A CG    1 
ATOM   224  C  CD1   . PHE A 1 30  ? 23.756  11.311  8.380   1.00 15.96 ? 39  PHE A CD1   1 
ATOM   225  C  CD2   . PHE A 1 30  ? 25.712  12.076  9.525   1.00 15.19 ? 39  PHE A CD2   1 
ATOM   226  C  CE1   . PHE A 1 30  ? 23.006  11.479  9.553   1.00 15.36 ? 39  PHE A CE1   1 
ATOM   227  C  CE2   . PHE A 1 30  ? 24.972  12.268  10.688  1.00 15.67 ? 39  PHE A CE2   1 
ATOM   228  C  CZ    . PHE A 1 30  ? 23.609  11.955  10.700  1.00 16.16 ? 39  PHE A CZ    1 
ATOM   229  N  N     . VAL A 1 31  ? 23.968  14.158  6.172   1.00 19.83 ? 40  VAL A N     1 
ATOM   230  C  CA    . VAL A 1 31  ? 23.636  15.535  6.560   1.00 20.31 ? 40  VAL A CA    1 
ATOM   231  C  C     . VAL A 1 31  ? 23.190  15.622  8.023   1.00 20.85 ? 40  VAL A C     1 
ATOM   232  O  O     . VAL A 1 31  ? 22.316  14.866  8.475   1.00 20.78 ? 40  VAL A O     1 
ATOM   233  C  CB    . VAL A 1 31  ? 22.549  16.154  5.638   1.00 20.70 ? 40  VAL A CB    1 
ATOM   234  C  CG1   . VAL A 1 31  ? 23.131  16.434  4.256   1.00 20.49 ? 40  VAL A CG1   1 
ATOM   235  C  CG2   . VAL A 1 31  ? 21.304  15.261  5.542   1.00 21.81 ? 40  VAL A CG2   1 
ATOM   236  N  N     . THR A 1 32  ? 23.795  16.559  8.749   1.00 21.41 ? 41  THR A N     1 
ATOM   237  C  CA    . THR A 1 32  ? 23.631  16.666  10.197  1.00 22.21 ? 41  THR A CA    1 
ATOM   238  C  C     . THR A 1 32  ? 22.618  17.734  10.633  1.00 22.57 ? 41  THR A C     1 
ATOM   239  O  O     . THR A 1 32  ? 22.100  17.669  11.745  1.00 23.10 ? 41  THR A O     1 
ATOM   240  C  CB    . THR A 1 32  ? 24.983  16.970  10.881  1.00 22.16 ? 41  THR A CB    1 
ATOM   241  O  OG1   . THR A 1 32  ? 25.473  18.231  10.424  1.00 22.47 ? 41  THR A OG1   1 
ATOM   242  C  CG2   . THR A 1 32  ? 26.014  15.894  10.557  1.00 21.99 ? 41  THR A CG2   1 
ATOM   243  N  N     . ASP A 1 33  ? 22.358  18.728  9.786   1.00 23.19 ? 42  ASP A N     1 
ATOM   244  C  CA    . ASP A 1 33  ? 21.379  19.764  10.118  1.00 23.43 ? 42  ASP A CA    1 
ATOM   245  C  C     . ASP A 1 33  ? 20.670  20.280  8.864   1.00 23.45 ? 42  ASP A C     1 
ATOM   246  O  O     . ASP A 1 33  ? 20.702  21.468  8.558   1.00 23.91 ? 42  ASP A O     1 
ATOM   247  C  CB    . ASP A 1 33  ? 22.058  20.909  10.875  1.00 23.54 ? 42  ASP A CB    1 
ATOM   248  C  CG    . ASP A 1 33  ? 21.064  21.809  11.591  1.00 24.27 ? 42  ASP A CG    1 
ATOM   249  N  N     . TYR A 1 34  ? 20.015  19.374  8.148   1.00 23.53 ? 43  TYR A N     1 
ATOM   250  C  CA    . TYR A 1 34  ? 19.327  19.738  6.917   1.00 22.97 ? 43  TYR A CA    1 
ATOM   251  C  C     . TYR A 1 34  ? 17.996  20.423  7.220   1.00 22.48 ? 43  TYR A C     1 
ATOM   252  O  O     . TYR A 1 34  ? 17.166  19.890  7.952   1.00 21.27 ? 43  TYR A O     1 
ATOM   253  C  CB    . TYR A 1 34  ? 19.096  18.508  6.042   1.00 23.40 ? 43  TYR A CB    1 
ATOM   254  C  CG    . TYR A 1 34  ? 18.661  18.873  4.649   1.00 23.91 ? 43  TYR A CG    1 
ATOM   255  C  CD1   . TYR A 1 34  ? 19.528  19.550  3.796   1.00 24.92 ? 43  TYR A CD1   1 
ATOM   256  C  CD2   . TYR A 1 34  ? 17.376  18.588  4.194   1.00 23.40 ? 43  TYR A CD2   1 
ATOM   257  C  CE1   . TYR A 1 34  ? 19.140  19.903  2.521   1.00 24.40 ? 43  TYR A CE1   1 
ATOM   258  C  CE2   . TYR A 1 34  ? 16.975  18.928  2.919   1.00 24.62 ? 43  TYR A CE2   1 
ATOM   259  C  CZ    . TYR A 1 34  ? 17.867  19.596  2.087   1.00 24.70 ? 43  TYR A CZ    1 
ATOM   260  O  OH    . TYR A 1 34  ? 17.507  19.962  0.819   1.00 26.46 ? 43  TYR A OH    1 
ATOM   261  N  N     . ASP A 1 35  ? 17.804  21.613  6.654   1.00 21.95 ? 44  ASP A N     1 
ATOM   262  C  CA    . ASP A 1 35  ? 16.604  22.409  6.894   1.00 22.10 ? 44  ASP A CA    1 
ATOM   263  C  C     . ASP A 1 35  ? 15.348  21.536  6.971   1.00 22.33 ? 44  ASP A C     1 
ATOM   264  O  O     . ASP A 1 35  ? 14.969  20.891  5.982   1.00 22.82 ? 44  ASP A O     1 
ATOM   265  C  CB    . ASP A 1 35  ? 16.460  23.477  5.799   1.00 21.73 ? 44  ASP A CB    1 
ATOM   266  C  CG    . ASP A 1 35  ? 15.316  24.436  6.059   1.00 22.00 ? 44  ASP A CG    1 
ATOM   267  O  OD1   . ASP A 1 35  ? 15.369  25.566  5.530   1.00 20.35 ? 44  ASP A OD1   1 
ATOM   268  O  OD2   . ASP A 1 35  ? 14.368  24.071  6.786   1.00 21.48 ? 44  ASP A OD2   1 
ATOM   269  N  N     . PRO A 1 36  ? 14.717  21.470  8.162   1.00 22.24 ? 45  PRO A N     1 
ATOM   270  C  CA    . PRO A 1 36  ? 13.577  20.554  8.361   1.00 22.26 ? 45  PRO A CA    1 
ATOM   271  C  C     . PRO A 1 36  ? 12.320  20.878  7.556   1.00 22.31 ? 45  PRO A C     1 
ATOM   272  O  O     . PRO A 1 36  ? 11.459  20.020  7.404   1.00 22.10 ? 45  PRO A O     1 
ATOM   273  C  CB    . PRO A 1 36  ? 13.279  20.666  9.865   1.00 22.18 ? 45  PRO A CB    1 
ATOM   274  C  CG    . PRO A 1 36  ? 13.919  21.881  10.316  1.00 22.65 ? 45  PRO A CG    1 
ATOM   275  C  CD    . PRO A 1 36  ? 15.059  22.193  9.396   1.00 22.26 ? 45  PRO A CD    1 
ATOM   276  N  N     . THR A 1 37  ? 12.219  22.098  7.047   1.00 21.71 ? 46  THR A N     1 
ATOM   277  C  CA    . THR A 1 37  ? 11.025  22.524  6.344   1.00 22.28 ? 46  THR A CA    1 
ATOM   278  C  C     . THR A 1 37  ? 11.013  22.133  4.858   1.00 21.58 ? 46  THR A C     1 
ATOM   279  O  O     . THR A 1 37  ? 9.921   22.253  4.204   1.00 22.82 ? 46  THR A O     1 
ATOM   280  C  CB    . THR A 1 37  ? 10.913  24.030  6.434   1.00 21.96 ? 46  THR A CB    1 
ATOM   281  O  OG1   . THR A 1 37  ? 12.087  24.599  5.849   1.00 24.62 ? 46  THR A OG1   1 
ATOM   282  C  CG2   . THR A 1 37  ? 10.813  24.478  7.903   1.00 23.86 ? 46  THR A CG2   1 
ATOM   283  N  N     . ILE A 1 38  ? 12.246  21.921  4.326   1.00 21.40 ? 47  ILE A N     1 
ATOM   284  C  CA    . ILE A 1 38  ? 12.428  21.738  2.892   1.00 21.48 ? 47  ILE A CA    1 
ATOM   285  C  C     . ILE A 1 38  ? 11.883  20.394  2.410   1.00 21.50 ? 47  ILE A C     1 
ATOM   286  O  O     . ILE A 1 38  ? 12.371  19.339  2.821   1.00 21.71 ? 47  ILE A O     1 
ATOM   287  C  CB    . ILE A 1 38  ? 13.918  21.831  2.512   1.00 21.44 ? 47  ILE A CB    1 
ATOM   288  C  CG1   . ILE A 1 38  ? 14.468  23.233  2.840   1.00 22.26 ? 47  ILE A CG1   1 
ATOM   289  C  CG2   . ILE A 1 38  ? 14.125  21.469  1.030   1.00 22.26 ? 47  ILE A CG2   1 
ATOM   290  C  CD1   . ILE A 1 38  ? 13.801  24.395  2.115   1.00 23.59 ? 47  ILE A CD1   1 
ATOM   291  N  N     . GLU A 1 39  ? 10.893  20.454  1.520   1.00 21.48 ? 48  GLU A N     1 
ATOM   292  C  CA    . GLU A 1 39  ? 10.374  19.269  0.826   1.00 21.93 ? 48  GLU A CA    1 
ATOM   293  C  C     . GLU A 1 39  ? 10.930  19.320  -0.593  1.00 21.83 ? 48  GLU A C     1 
ATOM   294  O  O     . GLU A 1 39  ? 10.765  20.322  -1.287  1.00 21.77 ? 48  GLU A O     1 
ATOM   295  C  CB    . GLU A 1 39  ? 8.838   19.303  0.805   1.00 21.81 ? 48  GLU A CB    1 
ATOM   296  C  CG    . GLU A 1 39  ? 8.155   17.956  0.714   1.00 23.69 ? 48  GLU A CG    1 
ATOM   297  C  CD    . GLU A 1 39  ? 6.682   18.001  1.124   1.00 23.27 ? 48  GLU A CD    1 
ATOM   298  O  OE1   . GLU A 1 39  ? 5.802   17.989  0.238   1.00 29.38 ? 48  GLU A OE1   1 
ATOM   299  O  OE2   . GLU A 1 39  ? 6.400   18.070  2.329   1.00 25.20 ? 48  GLU A OE2   1 
ATOM   300  N  N     . ASP A 1 40  ? 11.609  18.261  -1.026  1.00 22.16 ? 49  ASP A N     1 
ATOM   301  C  CA    . ASP A 1 40  ? 12.190  18.246  -2.363  1.00 22.45 ? 49  ASP A CA    1 
ATOM   302  C  C     . ASP A 1 40  ? 12.192  16.847  -2.964  1.00 21.88 ? 49  ASP A C     1 
ATOM   303  O  O     . ASP A 1 40  ? 11.956  15.844  -2.277  1.00 21.34 ? 49  ASP A O     1 
ATOM   304  C  CB    . ASP A 1 40  ? 13.619  18.809  -2.342  1.00 22.81 ? 49  ASP A CB    1 
ATOM   305  C  CG    . ASP A 1 40  ? 14.003  19.538  -3.640  1.00 24.81 ? 49  ASP A CG    1 
ATOM   306  O  OD1   . ASP A 1 40  ? 13.325  19.369  -4.686  1.00 27.46 ? 49  ASP A OD1   1 
ATOM   307  O  OD2   . ASP A 1 40  ? 14.999  20.295  -3.613  1.00 26.79 ? 49  ASP A OD2   1 
ATOM   308  N  N     . SER A 1 41  ? 12.455  16.815  -4.267  1.00 21.75 ? 50  SER A N     1 
ATOM   309  C  CA    . SER A 1 41  ? 12.455  15.598  -5.053  1.00 21.86 ? 50  SER A CA    1 
ATOM   310  C  C     . SER A 1 41  ? 13.843  15.282  -5.593  1.00 21.11 ? 50  SER A C     1 
ATOM   311  O  O     . SER A 1 41  ? 14.620  16.176  -5.916  1.00 20.32 ? 50  SER A O     1 
ATOM   312  C  CB    . SER A 1 41  ? 11.476  15.757  -6.206  1.00 22.21 ? 50  SER A CB    1 
ATOM   313  O  OG    . SER A 1 41  ? 10.165  15.905  -5.695  1.00 25.01 ? 50  SER A OG    1 
ATOM   314  N  N     . TYR A 1 42  ? 14.141  13.992  -5.674  1.00 20.72 ? 51  TYR A N     1 
ATOM   315  C  CA    . TYR A 1 42  ? 15.433  13.504  -6.139  1.00 20.58 ? 51  TYR A CA    1 
ATOM   316  C  C     . TYR A 1 42  ? 15.206  12.330  -7.065  1.00 19.56 ? 51  TYR A C     1 
ATOM   317  O  O     . TYR A 1 42  ? 14.122  11.741  -7.079  1.00 19.38 ? 51  TYR A O     1 
ATOM   318  C  CB    . TYR A 1 42  ? 16.273  13.001  -4.974  1.00 21.69 ? 51  TYR A CB    1 
ATOM   319  C  CG    . TYR A 1 42  ? 16.564  14.008  -3.890  1.00 22.88 ? 51  TYR A CG    1 
ATOM   320  C  CD1   . TYR A 1 42  ? 15.631  14.282  -2.893  1.00 23.27 ? 51  TYR A CD1   1 
ATOM   321  C  CD2   . TYR A 1 42  ? 17.788  14.660  -3.843  1.00 23.16 ? 51  TYR A CD2   1 
ATOM   322  C  CE1   . TYR A 1 42  ? 15.911  15.187  -1.884  1.00 24.24 ? 51  TYR A CE1   1 
ATOM   323  C  CE2   . TYR A 1 42  ? 18.076  15.567  -2.841  1.00 24.58 ? 51  TYR A CE2   1 
ATOM   324  C  CZ    . TYR A 1 42  ? 17.138  15.825  -1.863  1.00 24.70 ? 51  TYR A CZ    1 
ATOM   325  O  OH    . TYR A 1 42  ? 17.444  16.740  -0.878  1.00 25.96 ? 51  TYR A OH    1 
ATOM   326  N  N     . THR A 1 43  ? 16.231  11.984  -7.833  1.00 18.53 ? 52  THR A N     1 
ATOM   327  C  CA    A THR A 1 43  ? 16.167  10.848  -8.752  0.50 18.50 ? 52  THR A CA    1 
ATOM   328  C  CA    B THR A 1 43  ? 16.147  10.812  -8.687  0.50 18.35 ? 52  THR A CA    1 
ATOM   329  C  C     . THR A 1 43  ? 17.443  10.011  -8.648  1.00 18.21 ? 52  THR A C     1 
ATOM   330  O  O     . THR A 1 43  ? 18.519  10.552  -8.404  1.00 18.08 ? 52  THR A O     1 
ATOM   331  C  CB    A THR A 1 43  ? 15.959  11.317  -10.215 0.50 18.81 ? 52  THR A CB    1 
ATOM   332  C  CB    B THR A 1 43  ? 15.763  11.176  -10.132 0.50 18.56 ? 52  THR A CB    1 
ATOM   333  O  OG1   A THR A 1 43  ? 14.707  12.008  -10.325 0.50 18.42 ? 52  THR A OG1   1 
ATOM   334  O  OG1   B THR A 1 43  ? 15.447  9.981   -10.860 0.50 18.30 ? 52  THR A OG1   1 
ATOM   335  C  CG2   A THR A 1 43  ? 15.957  10.129  -11.180 0.50 18.83 ? 52  THR A CG2   1 
ATOM   336  C  CG2   B THR A 1 43  ? 16.891  11.931  -10.825 0.50 17.62 ? 52  THR A CG2   1 
ATOM   337  N  N     . LYS A 1 44  ? 17.304  8.700   -8.824  1.00 17.78 ? 53  LYS A N     1 
ATOM   338  C  CA    . LYS A 1 44  ? 18.442  7.796   -8.875  1.00 17.52 ? 53  LYS A CA    1 
ATOM   339  C  C     . LYS A 1 44  ? 18.130  6.676   -9.842  1.00 17.38 ? 53  LYS A C     1 
ATOM   340  O  O     . LYS A 1 44  ? 17.028  6.125   -9.840  1.00 17.02 ? 53  LYS A O     1 
ATOM   341  C  CB    . LYS A 1 44  ? 18.777  7.223   -7.500  1.00 17.62 ? 53  LYS A CB    1 
ATOM   342  C  CG    . LYS A 1 44  ? 20.212  6.673   -7.396  1.00 17.77 ? 53  LYS A CG    1 
ATOM   343  C  CD    . LYS A 1 44  ? 20.490  6.096   -6.028  1.00 17.74 ? 53  LYS A CD    1 
ATOM   344  C  CE    . LYS A 1 44  ? 21.954  5.751   -5.813  1.00 18.52 ? 53  LYS A CE    1 
ATOM   345  N  NZ    . LYS A 1 44  ? 22.183  5.012   -4.535  1.00 20.00 ? 53  LYS A NZ    1 
ATOM   346  N  N     . GLN A 1 45  ? 19.109  6.350   -10.678 1.00 17.25 ? 54  GLN A N     1 
ATOM   347  C  CA    . GLN A 1 45  ? 18.989  5.215   -11.553 1.00 17.61 ? 54  GLN A CA    1 
ATOM   348  C  C     . GLN A 1 45  ? 19.628  4.033   -10.836 1.00 17.27 ? 54  GLN A C     1 
ATOM   349  O  O     . GLN A 1 45  ? 20.794  4.103   -10.444 1.00 18.16 ? 54  GLN A O     1 
ATOM   350  C  CB    . GLN A 1 45  ? 19.692  5.511   -12.879 1.00 17.80 ? 54  GLN A CB    1 
ATOM   351  C  CG    . GLN A 1 45  ? 19.367  4.534   -13.966 1.00 19.27 ? 54  GLN A CG    1 
ATOM   352  C  CD    . GLN A 1 45  ? 17.901  4.561   -14.373 1.00 21.13 ? 54  GLN A CD    1 
ATOM   353  O  OE1   . GLN A 1 45  ? 17.306  5.632   -14.537 1.00 22.39 ? 54  GLN A OE1   1 
ATOM   354  N  NE2   . GLN A 1 45  ? 17.313  3.378   -14.534 1.00 21.02 ? 54  GLN A NE2   1 
ATOM   355  N  N     . CYS A 1 46  ? 18.868  2.957   -10.667 1.00 17.07 ? 55  CYS A N     1 
ATOM   356  C  CA    . CYS A 1 46  ? 19.321  1.783   -9.927  1.00 16.54 ? 55  CYS A CA    1 
ATOM   357  C  C     . CYS A 1 46  ? 19.186  0.530   -10.754 1.00 16.03 ? 55  CYS A C     1 
ATOM   358  O  O     . CYS A 1 46  ? 18.493  0.520   -11.769 1.00 16.27 ? 55  CYS A O     1 
ATOM   359  C  CB    . CYS A 1 46  ? 18.485  1.611   -8.660  1.00 16.90 ? 55  CYS A CB    1 
ATOM   360  S  SG    . CYS A 1 46  ? 18.601  2.994   -7.514  1.00 19.41 ? 55  CYS A SG    1 
ATOM   361  N  N     . VAL A 1 47  ? 19.853  -0.520  -10.296 1.00 15.29 ? 56  VAL A N     1 
ATOM   362  C  CA    . VAL A 1 47  ? 19.677  -1.864  -10.815 1.00 15.21 ? 56  VAL A CA    1 
ATOM   363  C  C     . VAL A 1 47  ? 19.272  -2.697  -9.608  1.00 14.64 ? 56  VAL A C     1 
ATOM   364  O  O     . VAL A 1 47  ? 20.020  -2.767  -8.624  1.00 14.95 ? 56  VAL A O     1 
ATOM   365  C  CB    . VAL A 1 47  ? 20.967  -2.426  -11.414 1.00 14.87 ? 56  VAL A CB    1 
ATOM   366  C  CG1   . VAL A 1 47  ? 20.793  -3.889  -11.783 1.00 15.62 ? 56  VAL A CG1   1 
ATOM   367  C  CG2   . VAL A 1 47  ? 21.407  -1.600  -12.627 1.00 15.73 ? 56  VAL A CG2   1 
ATOM   368  N  N     . ILE A 1 48  ? 18.062  -3.255  -9.655  1.00 15.07 ? 57  ILE A N     1 
ATOM   369  C  CA    . ILE A 1 48  ? 17.501  -4.025  -8.546  1.00 14.26 ? 57  ILE A CA    1 
ATOM   370  C  C     . ILE A 1 48  ? 17.063  -5.389  -9.057  1.00 14.87 ? 57  ILE A C     1 
ATOM   371  O  O     . ILE A 1 48  ? 16.244  -5.481  -9.976  1.00 13.81 ? 57  ILE A O     1 
ATOM   372  C  CB    . ILE A 1 48  ? 16.302  -3.276  -7.884  1.00 14.83 ? 57  ILE A CB    1 
ATOM   373  C  CG1   . ILE A 1 48  ? 16.720  -1.860  -7.485  1.00 14.81 ? 57  ILE A CG1   1 
ATOM   374  C  CG2   . ILE A 1 48  ? 15.767  -4.077  -6.709  1.00 14.12 ? 57  ILE A CG2   1 
ATOM   375  C  CD1   . ILE A 1 48  ? 15.590  -0.951  -7.176  1.00 15.31 ? 57  ILE A CD1   1 
ATOM   376  N  N     . ASP A 1 49  ? 17.630  -6.449  -8.487  1.00 14.82 ? 58  ASP A N     1 
ATOM   377  C  CA    . ASP A 1 49  ? 17.419  -7.800  -8.997  1.00 15.84 ? 58  ASP A CA    1 
ATOM   378  C  C     . ASP A 1 49  ? 17.659  -7.834  -10.517 1.00 16.13 ? 58  ASP A C     1 
ATOM   379  O  O     . ASP A 1 49  ? 16.873  -8.398  -11.279 1.00 17.10 ? 58  ASP A O     1 
ATOM   380  C  CB    . ASP A 1 49  ? 16.007  -8.286  -8.621  1.00 15.97 ? 58  ASP A CB    1 
ATOM   381  C  CG    . ASP A 1 49  ? 15.792  -8.341  -7.131  1.00 16.38 ? 58  ASP A CG    1 
ATOM   382  O  OD1   . ASP A 1 49  ? 16.796  -8.515  -6.407  1.00 16.52 ? 58  ASP A OD1   1 
ATOM   383  O  OD2   . ASP A 1 49  ? 14.633  -8.188  -6.672  1.00 17.27 ? 58  ASP A OD2   1 
ATOM   384  N  N     . ASP A 1 50  ? 18.765  -7.199  -10.917 1.00 16.73 ? 59  ASP A N     1 
ATOM   385  C  CA    . ASP A 1 50  ? 19.260  -7.098  -12.296 1.00 16.95 ? 59  ASP A CA    1 
ATOM   386  C  C     . ASP A 1 50  ? 18.387  -6.291  -13.260 1.00 16.59 ? 59  ASP A C     1 
ATOM   387  O  O     . ASP A 1 50  ? 18.743  -6.151  -14.432 1.00 15.24 ? 59  ASP A O     1 
ATOM   388  C  CB    . ASP A 1 50  ? 19.617  -8.475  -12.871 1.00 17.88 ? 59  ASP A CB    1 
ATOM   389  C  CG    . ASP A 1 50  ? 20.926  -9.017  -12.306 1.00 20.04 ? 59  ASP A CG    1 
ATOM   390  O  OD1   . ASP A 1 50  ? 21.867  -8.224  -12.048 1.00 22.88 ? 59  ASP A OD1   1 
ATOM   391  O  OD2   . ASP A 1 50  ? 21.027  -10.249 -12.136 1.00 24.91 ? 59  ASP A OD2   1 
ATOM   392  N  N     . ARG A 1 51  ? 17.280  -5.739  -12.767 1.00 16.13 ? 60  ARG A N     1 
ATOM   393  C  CA    . ARG A 1 51  ? 16.373  -4.951  -13.597 1.00 16.78 ? 60  ARG A CA    1 
ATOM   394  C  C     . ARG A 1 51  ? 16.562  -3.457  -13.319 1.00 15.86 ? 60  ARG A C     1 
ATOM   395  O  O     . ARG A 1 51  ? 16.557  -3.022  -12.169 1.00 16.97 ? 60  ARG A O     1 
ATOM   396  C  CB    . ARG A 1 51  ? 14.918  -5.330  -13.332 1.00 16.51 ? 60  ARG A CB    1 
ATOM   397  C  CG    . ARG A 1 51  ? 14.460  -6.643  -13.927 1.00 18.82 ? 60  ARG A CG    1 
ATOM   398  C  CD    . ARG A 1 51  ? 13.139  -7.072  -13.286 1.00 20.23 ? 60  ARG A CD    1 
ATOM   399  N  NE    . ARG A 1 51  ? 12.097  -6.044  -13.352 1.00 23.91 ? 60  ARG A NE    1 
ATOM   400  C  CZ    . ARG A 1 51  ? 10.887  -6.150  -12.793 1.00 23.95 ? 60  ARG A CZ    1 
ATOM   401  N  NH1   . ARG A 1 51  ? 10.545  -7.240  -12.106 1.00 24.28 ? 60  ARG A NH1   1 
ATOM   402  N  NH2   . ARG A 1 51  ? 10.009  -5.156  -12.922 1.00 22.72 ? 60  ARG A NH2   1 
ATOM   403  N  N     . ALA A 1 52  ? 16.674  -2.680  -14.387 1.00 15.67 ? 61  ALA A N     1 
ATOM   404  C  CA    . ALA A 1 52  ? 16.846  -1.245  -14.302 1.00 15.79 ? 61  ALA A CA    1 
ATOM   405  C  C     . ALA A 1 52  ? 15.589  -0.600  -13.736 1.00 16.36 ? 61  ALA A C     1 
ATOM   406  O  O     . ALA A 1 52  ? 14.473  -1.005  -14.065 1.00 16.63 ? 61  ALA A O     1 
ATOM   407  C  CB    . ALA A 1 52  ? 17.160  -0.670  -15.689 1.00 16.30 ? 61  ALA A CB    1 
ATOM   408  N  N     . ALA A 1 53  ? 15.770  0.395   -12.878 1.00 16.63 ? 62  ALA A N     1 
ATOM   409  C  CA    . ALA A 1 53  ? 14.645  1.185   -12.355 1.00 17.41 ? 62  ALA A CA    1 
ATOM   410  C  C     . ALA A 1 53  ? 15.096  2.607   -12.027 1.00 16.99 ? 62  ALA A C     1 
ATOM   411  O  O     . ALA A 1 53  ? 16.138  2.808   -11.409 1.00 17.35 ? 62  ALA A O     1 
ATOM   412  C  CB    . ALA A 1 53  ? 14.056  0.535   -11.122 1.00 18.21 ? 62  ALA A CB    1 
ATOM   413  N  N     . ARG A 1 54  ? 14.308  3.591   -12.448 1.00 16.32 ? 63  ARG A N     1 
ATOM   414  C  CA    . ARG A 1 54  ? 14.522  4.961   -12.041 1.00 16.48 ? 63  ARG A CA    1 
ATOM   415  C  C     . ARG A 1 54  ? 13.652  5.191   -10.822 1.00 16.75 ? 63  ARG A C     1 
ATOM   416  O  O     . ARG A 1 54  ? 12.459  4.934   -10.869 1.00 16.79 ? 63  ARG A O     1 
ATOM   417  C  CB    . ARG A 1 54  ? 14.104  5.925   -13.139 1.00 16.94 ? 63  ARG A CB    1 
ATOM   418  C  CG    . ARG A 1 54  ? 14.281  7.389   -12.762 1.00 18.83 ? 63  ARG A CG    1 
ATOM   419  C  CD    . ARG A 1 54  ? 13.827  8.304   -13.866 1.00 21.81 ? 63  ARG A CD    1 
ATOM   420  N  NE    . ARG A 1 54  ? 13.377  9.591   -13.342 1.00 24.39 ? 63  ARG A NE    1 
ATOM   421  N  N     . LEU A 1 55  ? 14.254  5.660   -9.736  1.00 17.21 ? 64  LEU A N     1 
ATOM   422  C  CA    . LEU A 1 55  ? 13.500  5.936   -8.521  1.00 18.08 ? 64  LEU A CA    1 
ATOM   423  C  C     . LEU A 1 55  ? 13.427  7.436   -8.397  1.00 18.11 ? 64  LEU A C     1 
ATOM   424  O  O     . LEU A 1 55  ? 14.469  8.099   -8.343  1.00 19.17 ? 64  LEU A O     1 
ATOM   425  C  CB    . LEU A 1 55  ? 14.170  5.364   -7.273  1.00 18.66 ? 64  LEU A CB    1 
ATOM   426  C  CG    . LEU A 1 55  ? 14.719  3.933   -7.234  1.00 21.33 ? 64  LEU A CG    1 
ATOM   427  C  CD1   . LEU A 1 55  ? 14.815  3.426   -5.791  1.00 20.61 ? 64  LEU A CD1   1 
ATOM   428  C  CD2   . LEU A 1 55  ? 13.992  2.966   -8.115  1.00 22.38 ? 64  LEU A CD2   1 
ATOM   429  N  N     . ASP A 1 56  ? 12.205  7.960   -8.368  1.00 17.79 ? 65  ASP A N     1 
ATOM   430  C  CA    . ASP A 1 56  ? 11.946  9.377   -8.102  1.00 17.91 ? 65  ASP A CA    1 
ATOM   431  C  C     . ASP A 1 56  ? 11.429  9.479   -6.676  1.00 18.21 ? 65  ASP A C     1 
ATOM   432  O  O     . ASP A 1 56  ? 10.404  8.874   -6.342  1.00 18.33 ? 65  ASP A O     1 
ATOM   433  C  CB    . ASP A 1 56  ? 10.908  9.902   -9.079  1.00 18.56 ? 65  ASP A CB    1 
ATOM   434  C  CG    . ASP A 1 56  ? 11.406  9.914   -10.506 1.00 20.53 ? 65  ASP A CG    1 
ATOM   435  O  OD1   . ASP A 1 56  ? 12.639  9.983   -10.717 1.00 23.05 ? 65  ASP A OD1   1 
ATOM   436  O  OD2   . ASP A 1 56  ? 10.560  9.852   -11.423 1.00 24.89 ? 65  ASP A OD2   1 
ATOM   437  N  N     . ILE A 1 57  ? 12.164  10.198  -5.830  1.00 17.58 ? 66  ILE A N     1 
ATOM   438  C  CA    . ILE A 1 57  ? 11.923  10.176  -4.388  1.00 17.37 ? 66  ILE A CA    1 
ATOM   439  C  C     . ILE A 1 57  ? 11.529  11.552  -3.883  1.00 16.26 ? 66  ILE A C     1 
ATOM   440  O  O     . ILE A 1 57  ? 12.235  12.537  -4.110  1.00 16.32 ? 66  ILE A O     1 
ATOM   441  C  CB    . ILE A 1 57  ? 13.161  9.705   -3.608  1.00 17.63 ? 66  ILE A CB    1 
ATOM   442  C  CG1   . ILE A 1 57  ? 13.520  8.263   -3.983  1.00 19.63 ? 66  ILE A CG1   1 
ATOM   443  C  CG2   . ILE A 1 57  ? 12.894  9.793   -2.093  1.00 17.31 ? 66  ILE A CG2   1 
ATOM   444  C  CD1   . ILE A 1 57  ? 14.938  7.916   -3.662  1.00 21.01 ? 66  ILE A CD1   1 
ATOM   445  N  N     . LEU A 1 58  ? 10.378  11.610  -3.217  1.00 15.35 ? 67  LEU A N     1 
ATOM   446  C  CA    . LEU A 1 58  ? 9.933   12.833  -2.562  1.00 15.05 ? 67  LEU A CA    1 
ATOM   447  C  C     . LEU A 1 58  ? 10.264  12.721  -1.079  1.00 14.81 ? 67  LEU A C     1 
ATOM   448  O  O     . LEU A 1 58  ? 9.786   11.818  -0.380  1.00 14.39 ? 67  LEU A O     1 
ATOM   449  C  CB    . LEU A 1 58  ? 8.434   13.027  -2.746  1.00 15.03 ? 67  LEU A CB    1 
ATOM   450  C  CG    . LEU A 1 58  ? 7.823   14.227  -2.025  1.00 14.55 ? 67  LEU A CG    1 
ATOM   451  C  CD1   . LEU A 1 58  ? 8.367   15.508  -2.606  1.00 14.95 ? 67  LEU A CD1   1 
ATOM   452  C  CD2   . LEU A 1 58  ? 6.304   14.172  -2.113  1.00 15.45 ? 67  LEU A CD2   1 
ATOM   453  N  N     . ASP A 1 59  ? 11.090  13.645  -0.613  1.00 13.92 ? 68  ASP A N     1 
ATOM   454  C  CA    . ASP A 1 59  ? 11.455  13.717  0.781   1.00 14.36 ? 68  ASP A CA    1 
ATOM   455  C  C     . ASP A 1 59  ? 10.515  14.728  1.399   1.00 14.74 ? 68  ASP A C     1 
ATOM   456  O  O     . ASP A 1 59  ? 10.709  15.916  1.207   1.00 14.48 ? 68  ASP A O     1 
ATOM   457  C  CB    . ASP A 1 59  ? 12.913  14.143  0.896   1.00 14.53 ? 68  ASP A CB    1 
ATOM   458  C  CG    . ASP A 1 59  ? 13.293  14.580  2.283   1.00 15.93 ? 68  ASP A CG    1 
ATOM   459  O  OD1   . ASP A 1 59  ? 12.736  14.036  3.260   1.00 17.73 ? 68  ASP A OD1   1 
ATOM   460  O  OD2   . ASP A 1 59  ? 14.169  15.478  2.377   1.00 17.12 ? 68  ASP A OD2   1 
ATOM   461  N  N     . THR A 1 60  ? 9.472   14.239  2.081   1.00 15.50 ? 69  THR A N     1 
ATOM   462  C  CA    . THR A 1 60  ? 8.411   15.109  2.581   1.00 14.29 ? 69  THR A CA    1 
ATOM   463  C  C     . THR A 1 60  ? 8.855   15.856  3.811   1.00 14.76 ? 69  THR A C     1 
ATOM   464  O  O     . THR A 1 60  ? 9.717   15.432  4.528   1.00 13.88 ? 69  THR A O     1 
ATOM   465  C  CB    . THR A 1 60  ? 7.106   14.357  2.924   1.00 14.84 ? 69  THR A CB    1 
ATOM   466  O  OG1   . THR A 1 60  ? 7.319   13.488  4.038   1.00 13.23 ? 69  THR A OG1   1 
ATOM   467  C  CG2   . THR A 1 60  ? 6.595   13.564  1.731   1.00 15.70 ? 69  THR A CG2   1 
ATOM   468  N  N     . ALA A 1 61  ? 8.302   17.038  4.010   1.00 13.96 ? 70  ALA A N     1 
ATOM   469  C  CA    . ALA A 1 61  ? 8.583   17.783  5.223   1.00 14.86 ? 70  ALA A CA    1 
ATOM   470  C  C     . ALA A 1 61  ? 7.251   18.254  5.751   1.00 15.72 ? 70  ALA A C     1 
ATOM   471  O  O     . ALA A 1 61  ? 6.533   18.921  5.000   1.00 15.94 ? 70  ALA A O     1 
ATOM   472  C  CB    . ALA A 1 61  ? 9.466   18.970  4.893   1.00 14.41 ? 70  ALA A CB    1 
ATOM   473  N  N     . PHE A 1 66  ? -2.390  17.746  7.564   1.00 26.92 ? 75  PHE A N     1 
ATOM   474  C  CA    . PHE A 1 66  ? -2.947  16.867  6.540   1.00 26.83 ? 75  PHE A CA    1 
ATOM   475  C  C     . PHE A 1 66  ? -4.087  17.553  5.779   1.00 26.14 ? 75  PHE A C     1 
ATOM   476  O  O     . PHE A 1 66  ? -4.904  18.270  6.364   1.00 26.58 ? 75  PHE A O     1 
ATOM   477  C  CB    . PHE A 1 66  ? -3.438  15.561  7.169   1.00 27.15 ? 75  PHE A CB    1 
ATOM   478  C  CG    . PHE A 1 66  ? -3.860  14.524  6.163   1.00 27.90 ? 75  PHE A CG    1 
ATOM   479  C  CD1   . PHE A 1 66  ? -5.206  14.245  5.949   1.00 28.51 ? 75  PHE A CD1   1 
ATOM   480  C  CD2   . PHE A 1 66  ? -2.909  13.839  5.420   1.00 27.72 ? 75  PHE A CD2   1 
ATOM   481  C  CE1   . PHE A 1 66  ? -5.593  13.291  5.014   1.00 28.32 ? 75  PHE A CE1   1 
ATOM   482  C  CE2   . PHE A 1 66  ? -3.288  12.886  4.482   1.00 28.46 ? 75  PHE A CE2   1 
ATOM   483  C  CZ    . PHE A 1 66  ? -4.634  12.610  4.284   1.00 28.31 ? 75  PHE A CZ    1 
ATOM   484  N  N     . GLY A 1 67  ? -4.121  17.336  4.468   1.00 25.09 ? 76  GLY A N     1 
ATOM   485  C  CA    . GLY A 1 67  ? -5.139  17.917  3.609   1.00 24.14 ? 76  GLY A CA    1 
ATOM   486  C  C     . GLY A 1 67  ? -4.946  17.521  2.158   1.00 23.45 ? 76  GLY A C     1 
ATOM   487  O  O     . GLY A 1 67  ? -4.311  16.506  1.863   1.00 22.81 ? 76  GLY A O     1 
ATOM   488  N  N     . ALA A 1 68  ? -5.484  18.336  1.253   1.00 22.83 ? 77  ALA A N     1 
ATOM   489  C  CA    . ALA A 1 68  ? -5.457  18.055  -0.187  1.00 22.76 ? 77  ALA A CA    1 
ATOM   490  C  C     . ALA A 1 68  ? -4.036  17.899  -0.754  1.00 22.86 ? 77  ALA A C     1 
ATOM   491  O  O     . ALA A 1 68  ? -3.790  17.037  -1.605  1.00 22.55 ? 77  ALA A O     1 
ATOM   492  C  CB    . ALA A 1 68  ? -6.213  19.152  -0.949  1.00 22.26 ? 77  ALA A CB    1 
ATOM   493  N  N     . MET A 1 69  ? -3.110  18.728  -0.279  1.00 23.17 ? 78  MET A N     1 
ATOM   494  C  CA    . MET A 1 69  ? -1.738  18.720  -0.784  1.00 23.94 ? 78  MET A CA    1 
ATOM   495  C  C     . MET A 1 69  ? -1.085  17.374  -0.529  1.00 22.91 ? 78  MET A C     1 
ATOM   496  O  O     . MET A 1 69  ? -0.605  16.727  -1.463  1.00 22.86 ? 78  MET A O     1 
ATOM   497  C  CB    . MET A 1 69  ? -0.904  19.817  -0.125  1.00 24.17 ? 78  MET A CB    1 
ATOM   498  C  CG    . MET A 1 69  ? 0.591   19.712  -0.407  1.00 25.19 ? 78  MET A CG    1 
ATOM   499  S  SD    . MET A 1 69  ? 1.392   21.308  -0.178  1.00 27.79 ? 78  MET A SD    1 
ATOM   500  C  CE    . MET A 1 69  ? 2.902   21.059  -1.128  1.00 27.35 ? 78  MET A CE    1 
ATOM   501  N  N     . ARG A 1 70  ? -1.048  16.977  0.742   1.00 22.54 ? 79  ARG A N     1 
ATOM   502  C  CA    . ARG A 1 70  ? -0.449  15.702  1.127   1.00 22.35 ? 79  ARG A CA    1 
ATOM   503  C  C     . ARG A 1 70  ? -1.246  14.545  0.555   1.00 21.84 ? 79  ARG A C     1 
ATOM   504  O  O     . ARG A 1 70  ? -0.672  13.547  0.140   1.00 20.69 ? 79  ARG A O     1 
ATOM   505  C  CB    . ARG A 1 70  ? -0.344  15.568  2.647   1.00 22.67 ? 79  ARG A CB    1 
ATOM   506  C  CG    . ARG A 1 70  ? 0.553   16.612  3.276   1.00 23.20 ? 79  ARG A CG    1 
ATOM   507  C  CD    . ARG A 1 70  ? 0.910   16.275  4.716   1.00 24.10 ? 79  ARG A CD    1 
ATOM   508  N  NE    . ARG A 1 70  ? 1.584   17.403  5.372   1.00 25.44 ? 79  ARG A NE    1 
ATOM   509  C  CZ    . ARG A 1 70  ? 2.884   17.692  5.258   1.00 27.04 ? 79  ARG A CZ    1 
ATOM   510  N  NH1   . ARG A 1 70  ? 3.702   16.941  4.518   1.00 27.35 ? 79  ARG A NH1   1 
ATOM   511  N  NH2   . ARG A 1 70  ? 3.377   18.747  5.899   1.00 27.23 ? 79  ARG A NH2   1 
ATOM   512  N  N     . GLU A 1 71  ? -2.571  14.671  0.531   1.00 21.26 ? 80  GLU A N     1 
ATOM   513  C  CA    . GLU A 1 71  ? -3.397  13.679  -0.156  1.00 21.66 ? 80  GLU A CA    1 
ATOM   514  C  C     . GLU A 1 71  ? -2.953  13.485  -1.610  1.00 21.07 ? 80  GLU A C     1 
ATOM   515  O  O     . GLU A 1 71  ? -2.915  12.351  -2.105  1.00 21.17 ? 80  GLU A O     1 
ATOM   516  C  CB    . GLU A 1 71  ? -4.876  14.052  -0.089  1.00 21.66 ? 80  GLU A CB    1 
ATOM   517  C  CG    . GLU A 1 71  ? -5.496  13.774  1.270   1.00 23.23 ? 80  GLU A CG    1 
ATOM   518  C  CD    . GLU A 1 71  ? -6.899  14.325  1.408   1.00 23.35 ? 80  GLU A CD    1 
ATOM   519  O  OE1   . GLU A 1 71  ? -7.475  14.793  0.400   1.00 25.61 ? 80  GLU A OE1   1 
ATOM   520  O  OE2   . GLU A 1 71  ? -7.432  14.290  2.541   1.00 27.59 ? 80  GLU A OE2   1 
ATOM   521  N  N     . GLN A 1 72  ? -2.581  14.571  -2.287  1.00 20.22 ? 81  GLN A N     1 
ATOM   522  C  CA    . GLN A 1 72  ? -2.142  14.451  -3.681  1.00 20.22 ? 81  GLN A CA    1 
ATOM   523  C  C     . GLN A 1 72  ? -0.823  13.699  -3.833  1.00 19.92 ? 81  GLN A C     1 
ATOM   524  O  O     . GLN A 1 72  ? -0.725  12.841  -4.717  1.00 20.54 ? 81  GLN A O     1 
ATOM   525  C  CB    . GLN A 1 72  ? -2.049  15.808  -4.386  1.00 20.49 ? 81  GLN A CB    1 
ATOM   526  C  CG    . GLN A 1 72  ? -1.679  15.685  -5.883  1.00 20.69 ? 81  GLN A CG    1 
ATOM   527  C  CD    . GLN A 1 72  ? -2.696  14.883  -6.691  1.00 22.19 ? 81  GLN A CD    1 
ATOM   528  O  OE1   . GLN A 1 72  ? -3.907  14.996  -6.483  1.00 23.60 ? 81  GLN A OE1   1 
ATOM   529  N  NE2   . GLN A 1 72  ? -2.207  14.079  -7.625  1.00 23.73 ? 81  GLN A NE2   1 
ATOM   530  N  N     . TYR A 1 73  ? 0.187   13.976  -3.001  1.00 18.92 ? 82  TYR A N     1 
ATOM   531  C  CA    . TYR A 1 73  ? 1.419   13.187  -3.139  1.00 18.42 ? 82  TYR A CA    1 
ATOM   532  C  C     . TYR A 1 73  ? 1.205   11.754  -2.686  1.00 17.95 ? 82  TYR A C     1 
ATOM   533  O  O     . TYR A 1 73  ? 1.851   10.870  -3.213  1.00 18.14 ? 82  TYR A O     1 
ATOM   534  C  CB    . TYR A 1 73  ? 2.694   13.829  -2.556  1.00 18.36 ? 82  TYR A CB    1 
ATOM   535  C  CG    . TYR A 1 73  ? 2.809   14.038  -1.066  1.00 18.32 ? 82  TYR A CG    1 
ATOM   536  C  CD1   . TYR A 1 73  ? 2.774   12.970  -0.171  1.00 19.09 ? 82  TYR A CD1   1 
ATOM   537  C  CD2   . TYR A 1 73  ? 3.058   15.313  -0.556  1.00 19.36 ? 82  TYR A CD2   1 
ATOM   538  C  CE1   . TYR A 1 73  ? 2.910   13.179  1.199   1.00 18.29 ? 82  TYR A CE1   1 
ATOM   539  C  CE2   . TYR A 1 73  ? 3.207   15.525  0.792   1.00 18.79 ? 82  TYR A CE2   1 
ATOM   540  C  CZ    . TYR A 1 73  ? 3.133   14.464  1.662   1.00 18.01 ? 82  TYR A CZ    1 
ATOM   541  O  OH    . TYR A 1 73  ? 3.282   14.691  3.005   1.00 17.87 ? 82  TYR A OH    1 
ATOM   542  N  N     . MET A 1 74  ? 0.261   11.521  -1.772  1.00 17.74 ? 83  MET A N     1 
ATOM   543  C  CA    . MET A 1 74  ? -0.157  10.144  -1.466  1.00 18.31 ? 83  MET A CA    1 
ATOM   544  C  C     . MET A 1 74  ? -0.908  9.509   -2.639  1.00 18.41 ? 83  MET A C     1 
ATOM   545  O  O     . MET A 1 74  ? -0.715  8.325   -2.939  1.00 19.90 ? 83  MET A O     1 
ATOM   546  C  CB    . MET A 1 74  ? -0.996  10.100  -0.194  1.00 18.19 ? 83  MET A CB    1 
ATOM   547  C  CG    . MET A 1 74  ? -0.165  10.336  1.051   1.00 18.28 ? 83  MET A CG    1 
ATOM   548  S  SD    . MET A 1 74  ? -1.175  10.333  2.523   1.00 19.21 ? 83  MET A SD    1 
ATOM   549  C  CE    . MET A 1 74  ? 0.075   10.452  3.803   1.00 18.79 ? 83  MET A CE    1 
ATOM   550  N  N     . ARG A 1 75  ? -1.707  10.298  -3.343  1.00 19.01 ? 84  ARG A N     1 
ATOM   551  C  CA    . ARG A 1 75  ? -2.454  9.789   -4.490  1.00 19.07 ? 84  ARG A CA    1 
ATOM   552  C  C     . ARG A 1 75  ? -1.551  9.278   -5.599  1.00 18.62 ? 84  ARG A C     1 
ATOM   553  O  O     . ARG A 1 75  ? -1.822  8.228   -6.186  1.00 18.71 ? 84  ARG A O     1 
ATOM   554  C  CB    . ARG A 1 75  ? -3.369  10.864  -5.049  1.00 19.51 ? 84  ARG A CB    1 
ATOM   555  C  CG    . ARG A 1 75  ? -4.353  10.372  -6.091  1.00 21.78 ? 84  ARG A CG    1 
ATOM   556  C  CD    . ARG A 1 75  ? -5.280  11.515  -6.503  1.00 24.44 ? 84  ARG A CD    1 
ATOM   557  N  NE    . ARG A 1 75  ? -5.791  12.213  -5.325  1.00 26.95 ? 84  ARG A NE    1 
ATOM   558  C  CZ    . ARG A 1 75  ? -6.771  11.765  -4.546  1.00 28.24 ? 84  ARG A CZ    1 
ATOM   559  N  NH1   . ARG A 1 75  ? -7.381  10.612  -4.818  1.00 30.61 ? 84  ARG A NH1   1 
ATOM   560  N  NH2   . ARG A 1 75  ? -7.146  12.470  -3.485  1.00 27.71 ? 84  ARG A NH2   1 
ATOM   561  N  N     . THR A 1 76  ? -0.484  10.011  -5.887  1.00 18.05 ? 85  THR A N     1 
ATOM   562  C  CA    . THR A 1 76  ? 0.424   9.628   -6.973  1.00 18.38 ? 85  THR A CA    1 
ATOM   563  C  C     . THR A 1 76  ? 1.609   8.765   -6.523  1.00 17.77 ? 85  THR A C     1 
ATOM   564  O  O     . THR A 1 76  ? 2.323   8.236   -7.361  1.00 17.99 ? 85  THR A O     1 
ATOM   565  C  CB    . THR A 1 76  ? 0.940   10.864  -7.728  1.00 18.70 ? 85  THR A CB    1 
ATOM   566  O  OG1   . THR A 1 76  ? 1.613   11.745  -6.822  1.00 19.67 ? 85  THR A OG1   1 
ATOM   567  C  CG2   . THR A 1 76  ? -0.219  11.588  -8.392  1.00 19.68 ? 85  THR A CG2   1 
ATOM   568  N  N     . GLY A 1 77  ? 1.807   8.609   -5.217  1.00 17.05 ? 86  GLY A N     1 
ATOM   569  C  CA    . GLY A 1 77  ? 2.882   7.756   -4.696  1.00 16.67 ? 86  GLY A CA    1 
ATOM   570  C  C     . GLY A 1 77  ? 2.680   6.303   -5.039  1.00 16.72 ? 86  GLY A C     1 
ATOM   571  O  O     . GLY A 1 77  ? 1.592   5.752   -4.835  1.00 17.00 ? 86  GLY A O     1 
ATOM   572  N  N     . GLU A 1 78  ? 3.727   5.669   -5.552  1.00 15.01 ? 87  GLU A N     1 
ATOM   573  C  CA    . GLU A 1 78  ? 3.645   4.256   -5.881  1.00 15.96 ? 87  GLU A CA    1 
ATOM   574  C  C     . GLU A 1 78  ? 4.155   3.381   -4.757  1.00 15.32 ? 87  GLU A C     1 
ATOM   575  O  O     . GLU A 1 78  ? 3.874   2.175   -4.717  1.00 14.93 ? 87  GLU A O     1 
ATOM   576  C  CB    . GLU A 1 78  ? 4.339   3.980   -7.214  1.00 15.94 ? 87  GLU A CB    1 
ATOM   577  C  CG    . GLU A 1 78  ? 3.636   4.691   -8.364  1.00 17.30 ? 87  GLU A CG    1 
ATOM   578  C  CD    . GLU A 1 78  ? 4.387   4.637   -9.675  1.00 18.45 ? 87  GLU A CD    1 
ATOM   579  O  OE1   . GLU A 1 78  ? 3.852   4.032   -10.638 1.00 23.90 ? 87  GLU A OE1   1 
ATOM   580  O  OE2   . GLU A 1 78  ? 5.484   5.218   -9.770  1.00 21.04 ? 87  GLU A OE2   1 
ATOM   581  N  N     . GLY A 1 79  ? 4.887   3.968   -3.820  1.00 15.25 ? 88  GLY A N     1 
ATOM   582  C  CA    . GLY A 1 79  ? 5.307   3.242   -2.634  1.00 15.19 ? 88  GLY A CA    1 
ATOM   583  C  C     . GLY A 1 79  ? 5.765   4.220   -1.585  1.00 15.04 ? 88  GLY A C     1 
ATOM   584  O  O     . GLY A 1 79  ? 6.177   5.342   -1.926  1.00 13.95 ? 88  GLY A O     1 
ATOM   585  N  N     . PHE A 1 80  ? 5.699   3.800   -0.317  1.00 14.87 ? 89  PHE A N     1 
ATOM   586  C  CA    . PHE A 1 80  ? 5.978   4.676   0.816   1.00 15.34 ? 89  PHE A CA    1 
ATOM   587  C  C     . PHE A 1 80  ? 6.971   4.046   1.792   1.00 15.70 ? 89  PHE A C     1 
ATOM   588  O  O     . PHE A 1 80  ? 6.860   2.861   2.126   1.00 17.83 ? 89  PHE A O     1 
ATOM   589  C  CB    . PHE A 1 80  ? 4.688   5.003   1.567   1.00 15.00 ? 89  PHE A CB    1 
ATOM   590  C  CG    . PHE A 1 80  ? 3.684   5.716   0.712   1.00 13.88 ? 89  PHE A CG    1 
ATOM   591  C  CD1   . PHE A 1 80  ? 3.630   7.100   0.685   1.00 13.89 ? 89  PHE A CD1   1 
ATOM   592  C  CD2   . PHE A 1 80  ? 2.845   4.989   -0.119  1.00 14.56 ? 89  PHE A CD2   1 
ATOM   593  C  CE1   . PHE A 1 80  ? 2.728   7.740   -0.136  1.00 14.89 ? 89  PHE A CE1   1 
ATOM   594  C  CE2   . PHE A 1 80  ? 1.948   5.610   -0.922  1.00 14.84 ? 89  PHE A CE2   1 
ATOM   595  C  CZ    . PHE A 1 80  ? 1.898   6.998   -0.946  1.00 13.12 ? 89  PHE A CZ    1 
ATOM   596  N  N     . LEU A 1 81  ? 7.960   4.842   2.184   1.00 16.54 ? 90  LEU A N     1 
ATOM   597  C  CA    . LEU A 1 81  ? 8.788   4.551   3.350   1.00 17.06 ? 90  LEU A CA    1 
ATOM   598  C  C     . LEU A 1 81  ? 8.172   5.261   4.551   1.00 17.10 ? 90  LEU A C     1 
ATOM   599  O  O     . LEU A 1 81  ? 8.097   6.498   4.583   1.00 17.36 ? 90  LEU A O     1 
ATOM   600  C  CB    . LEU A 1 81  ? 10.232  5.034   3.159   1.00 17.74 ? 90  LEU A CB    1 
ATOM   601  C  CG    . LEU A 1 81  ? 11.153  4.301   2.201   1.00 18.79 ? 90  LEU A CG    1 
ATOM   602  C  CD1   . LEU A 1 81  ? 12.568  4.802   2.446   1.00 20.11 ? 90  LEU A CD1   1 
ATOM   603  C  CD2   . LEU A 1 81  ? 11.098  2.801   2.331   1.00 20.80 ? 90  LEU A CD2   1 
ATOM   604  N  N     . LEU A 1 82  ? 7.748   4.482   5.533   1.00 17.42 ? 91  LEU A N     1 
ATOM   605  C  CA    . LEU A 1 82  ? 7.168   5.007   6.770   1.00 16.99 ? 91  LEU A CA    1 
ATOM   606  C  C     . LEU A 1 82  ? 8.303   5.025   7.775   1.00 16.41 ? 91  LEU A C     1 
ATOM   607  O  O     . LEU A 1 82  ? 8.675   3.966   8.285   1.00 16.78 ? 91  LEU A O     1 
ATOM   608  C  CB    . LEU A 1 82  ? 6.076   4.070   7.291   1.00 17.30 ? 91  LEU A CB    1 
ATOM   609  C  CG    . LEU A 1 82  ? 5.012   3.610   6.308   1.00 19.90 ? 91  LEU A CG    1 
ATOM   610  C  CD1   . LEU A 1 82  ? 4.056   2.639   6.977   1.00 20.66 ? 91  LEU A CD1   1 
ATOM   611  C  CD2   . LEU A 1 82  ? 4.310   4.813   5.777   1.00 21.32 ? 91  LEU A CD2   1 
ATOM   612  N  N     . VAL A 1 83  ? 8.832   6.200   8.065   1.00 15.98 ? 92  VAL A N     1 
ATOM   613  C  CA    . VAL A 1 83  ? 10.050  6.301   8.868   1.00 16.08 ? 92  VAL A CA    1 
ATOM   614  C  C     . VAL A 1 83  ? 9.719   6.798   10.260  1.00 15.50 ? 92  VAL A C     1 
ATOM   615  O  O     . VAL A 1 83  ? 9.033   7.793   10.424  1.00 14.68 ? 92  VAL A O     1 
ATOM   616  C  CB    . VAL A 1 83  ? 11.070  7.260   8.235   1.00 15.57 ? 92  VAL A CB    1 
ATOM   617  C  CG1   . VAL A 1 83  ? 12.375  7.276   9.071   1.00 16.69 ? 92  VAL A CG1   1 
ATOM   618  C  CG2   . VAL A 1 83  ? 11.364  6.873   6.781   1.00 14.87 ? 92  VAL A CG2   1 
ATOM   619  N  N     . PHE A 1 84  ? 10.228  6.116   11.272  1.00 15.12 ? 93  PHE A N     1 
ATOM   620  C  CA    . PHE A 1 84  ? 10.280  6.712   12.594  1.00 15.05 ? 93  PHE A CA    1 
ATOM   621  C  C     . PHE A 1 84  ? 11.713  6.664   13.095  1.00 14.99 ? 93  PHE A C     1 
ATOM   622  O  O     . PHE A 1 84  ? 12.567  5.992   12.509  1.00 15.95 ? 93  PHE A O     1 
ATOM   623  C  CB    . PHE A 1 84  ? 9.336   6.019   13.569  1.00 14.82 ? 93  PHE A CB    1 
ATOM   624  C  CG    . PHE A 1 84  ? 9.711   4.600   13.880  1.00 14.66 ? 93  PHE A CG    1 
ATOM   625  C  CD1   . PHE A 1 84  ? 10.435  4.310   15.029  1.00 12.63 ? 93  PHE A CD1   1 
ATOM   626  C  CD2   . PHE A 1 84  ? 9.350   3.563   13.042  1.00 13.70 ? 93  PHE A CD2   1 
ATOM   627  C  CE1   . PHE A 1 84  ? 10.791  3.011   15.330  1.00 14.34 ? 93  PHE A CE1   1 
ATOM   628  C  CE2   . PHE A 1 84  ? 9.722   2.260   13.334  1.00 14.83 ? 93  PHE A CE2   1 
ATOM   629  C  CZ    . PHE A 1 84  ? 10.436  1.987   14.496  1.00 13.89 ? 93  PHE A CZ    1 
ATOM   630  N  N     . SER A 1 85  ? 11.969  7.383   14.180  1.00 14.46 ? 94  SER A N     1 
ATOM   631  C  CA    . SER A 1 85  ? 13.255  7.264   14.850  1.00 14.37 ? 94  SER A CA    1 
ATOM   632  C  C     . SER A 1 85  ? 13.139  6.358   16.056  1.00 14.36 ? 94  SER A C     1 
ATOM   633  O  O     . SER A 1 85  ? 12.267  6.558   16.886  1.00 14.05 ? 94  SER A O     1 
ATOM   634  C  CB    . SER A 1 85  ? 13.745  8.599   15.335  1.00 14.61 ? 94  SER A CB    1 
ATOM   635  O  OG    . SER A 1 85  ? 14.871  8.365   16.165  1.00 15.07 ? 94  SER A OG    1 
ATOM   636  N  N     . VAL A 1 86  ? 14.055  5.398   16.172  1.00 15.19 ? 95  VAL A N     1 
ATOM   637  C  CA    . VAL A 1 86  ? 14.085  4.505   17.328  1.00 14.93 ? 95  VAL A CA    1 
ATOM   638  C  C     . VAL A 1 86  ? 14.379  5.228   18.656  1.00 14.81 ? 95  VAL A C     1 
ATOM   639  O  O     . VAL A 1 86  ? 14.191  4.637   19.712  1.00 15.18 ? 95  VAL A O     1 
ATOM   640  C  CB    . VAL A 1 86  ? 15.079  3.322   17.134  1.00 15.29 ? 95  VAL A CB    1 
ATOM   641  C  CG1   . VAL A 1 86  ? 14.744  2.523   15.882  1.00 15.32 ? 95  VAL A CG1   1 
ATOM   642  C  CG2   . VAL A 1 86  ? 16.538  3.785   17.114  1.00 14.77 ? 95  VAL A CG2   1 
ATOM   643  N  N     . THR A 1 87  ? 14.802  6.495   18.603  1.00 14.51 ? 96  THR A N     1 
ATOM   644  C  CA    . THR A 1 87  ? 15.052  7.305   19.794  1.00 15.44 ? 96  THR A CA    1 
ATOM   645  C  C     . THR A 1 87  ? 13.882  8.245   20.126  1.00 15.63 ? 96  THR A C     1 
ATOM   646  O  O     . THR A 1 87  ? 13.992  9.062   21.046  1.00 15.67 ? 96  THR A O     1 
ATOM   647  C  CB    . THR A 1 87  ? 16.333  8.171   19.634  1.00 14.95 ? 96  THR A CB    1 
ATOM   648  O  OG1   . THR A 1 87  ? 16.104  9.210   18.670  1.00 16.05 ? 96  THR A OG1   1 
ATOM   649  C  CG2   . THR A 1 87  ? 17.512  7.324   19.186  1.00 15.01 ? 96  THR A CG2   1 
ATOM   650  N  N     . ASP A 1 88  ? 12.767  8.111   19.402  1.00 15.48 ? 97  ASP A N     1 
ATOM   651  C  CA    . ASP A 1 88  ? 11.631  9.024   19.533  1.00 15.77 ? 97  ASP A CA    1 
ATOM   652  C  C     . ASP A 1 88  ? 10.320  8.251   19.522  1.00 15.53 ? 97  ASP A C     1 
ATOM   653  O  O     . ASP A 1 88  ? 9.763   7.968   18.464  1.00 15.14 ? 97  ASP A O     1 
ATOM   654  C  CB    . ASP A 1 88  ? 11.664  10.052  18.392  1.00 16.37 ? 97  ASP A CB    1 
ATOM   655  C  CG    . ASP A 1 88  ? 10.561  11.093  18.485  1.00 17.83 ? 97  ASP A CG    1 
ATOM   656  O  OD1   . ASP A 1 88  ? 9.620   10.942  19.298  1.00 19.13 ? 97  ASP A OD1   1 
ATOM   657  O  OD2   . ASP A 1 88  ? 10.638  12.075  17.709  1.00 18.82 ? 97  ASP A OD2   1 
ATOM   658  N  N     . ARG A 1 89  ? 9.830   7.907   20.709  1.00 15.33 ? 98  ARG A N     1 
ATOM   659  C  CA    . ARG A 1 89  ? 8.576   7.173   20.836  1.00 15.38 ? 98  ARG A CA    1 
ATOM   660  C  C     . ARG A 1 89  ? 7.403   7.846   20.131  1.00 14.90 ? 98  ARG A C     1 
ATOM   661  O  O     . ARG A 1 89  ? 6.567   7.172   19.533  1.00 15.38 ? 98  ARG A O     1 
ATOM   662  C  CB    . ARG A 1 89  ? 8.221   7.003   22.308  1.00 15.59 ? 98  ARG A CB    1 
ATOM   663  C  CG    . ARG A 1 89  ? 7.077   6.049   22.543  1.00 17.31 ? 98  ARG A CG    1 
ATOM   664  C  CD    . ARG A 1 89  ? 7.583   4.666   22.420  1.00 21.40 ? 98  ARG A CD    1 
ATOM   665  N  NE    . ARG A 1 89  ? 6.530   3.674   22.528  1.00 24.36 ? 98  ARG A NE    1 
ATOM   666  C  CZ    . ARG A 1 89  ? 6.767   2.383   22.715  1.00 24.58 ? 98  ARG A CZ    1 
ATOM   667  N  NH1   . ARG A 1 89  ? 8.013   1.961   22.831  1.00 25.21 ? 98  ARG A NH1   1 
ATOM   668  N  NH2   . ARG A 1 89  ? 5.756   1.522   22.804  1.00 26.50 ? 98  ARG A NH2   1 
ATOM   669  N  N     . GLY A 1 90  ? 7.332   9.172   20.222  1.00 14.95 ? 99  GLY A N     1 
ATOM   670  C  CA    . GLY A 1 90  ? 6.270   9.915   19.561  1.00 15.83 ? 99  GLY A CA    1 
ATOM   671  C  C     . GLY A 1 90  ? 6.197   9.636   18.067  1.00 15.86 ? 99  GLY A C     1 
ATOM   672  O  O     . GLY A 1 90  ? 5.114   9.455   17.512  1.00 16.26 ? 99  GLY A O     1 
ATOM   673  N  N     . SER A 1 91  ? 7.362   9.596   17.422  1.00 15.71 ? 100 SER A N     1 
ATOM   674  C  CA    . SER A 1 91  ? 7.439   9.373   15.981  1.00 14.94 ? 100 SER A CA    1 
ATOM   675  C  C     . SER A 1 91  ? 7.006   7.962   15.629  1.00 15.07 ? 100 SER A C     1 
ATOM   676  O  O     . SER A 1 91  ? 6.440   7.730   14.573  1.00 15.78 ? 100 SER A O     1 
ATOM   677  C  CB    . SER A 1 91  ? 8.861   9.629   15.469  1.00 15.36 ? 100 SER A CB    1 
ATOM   678  O  OG    . SER A 1 91  ? 9.767   8.616   15.870  1.00 14.75 ? 100 SER A OG    1 
ATOM   679  N  N     . PHE A 1 92  ? 7.293   7.025   16.521  1.00 15.14 ? 101 PHE A N     1 
ATOM   680  C  CA    . PHE A 1 92  ? 6.864   5.634   16.365  1.00 15.71 ? 101 PHE A CA    1 
ATOM   681  C  C     . PHE A 1 92  ? 5.341   5.541   16.402  1.00 16.21 ? 101 PHE A C     1 
ATOM   682  O  O     . PHE A 1 92  ? 4.713   4.892   15.562  1.00 16.42 ? 101 PHE A O     1 
ATOM   683  C  CB    . PHE A 1 92  ? 7.505   4.811   17.475  1.00 15.58 ? 101 PHE A CB    1 
ATOM   684  C  CG    . PHE A 1 92  ? 7.118   3.367   17.490  1.00 15.73 ? 101 PHE A CG    1 
ATOM   685  C  CD1   . PHE A 1 92  ? 7.506   2.519   16.466  1.00 16.32 ? 101 PHE A CD1   1 
ATOM   686  C  CD2   . PHE A 1 92  ? 6.407   2.845   18.555  1.00 16.83 ? 101 PHE A CD2   1 
ATOM   687  C  CE1   . PHE A 1 92  ? 7.177   1.187   16.495  1.00 16.65 ? 101 PHE A CE1   1 
ATOM   688  C  CE2   . PHE A 1 92  ? 6.075   1.495   18.589  1.00 18.31 ? 101 PHE A CE2   1 
ATOM   689  C  CZ    . PHE A 1 92  ? 6.471   0.671   17.546  1.00 16.61 ? 101 PHE A CZ    1 
ATOM   690  N  N     . GLU A 1 93  ? 4.733   6.238   17.354  1.00 17.57 ? 102 GLU A N     1 
ATOM   691  C  CA    . GLU A 1 93  ? 3.279   6.215   17.478  1.00 18.58 ? 102 GLU A CA    1 
ATOM   692  C  C     . GLU A 1 93  ? 2.606   6.930   16.300  1.00 19.48 ? 102 GLU A C     1 
ATOM   693  O  O     . GLU A 1 93  ? 1.508   6.548   15.877  1.00 20.85 ? 102 GLU A O     1 
ATOM   694  C  CB    . GLU A 1 93  ? 2.864   6.788   18.836  1.00 18.87 ? 102 GLU A CB    1 
ATOM   695  C  CG    . GLU A 1 93  ? 3.339   5.911   19.989  1.00 19.88 ? 102 GLU A CG    1 
ATOM   696  C  CD    . GLU A 1 93  ? 2.648   4.549   20.030  1.00 23.06 ? 102 GLU A CD    1 
ATOM   697  O  OE1   . GLU A 1 93  ? 1.472   4.462   19.602  1.00 24.40 ? 102 GLU A OE1   1 
ATOM   698  O  OE2   . GLU A 1 93  ? 3.269   3.574   20.520  1.00 24.53 ? 102 GLU A OE2   1 
ATOM   699  N  N     . GLU A 1 94  ? 3.279   7.928   15.736  1.00 19.54 ? 103 GLU A N     1 
ATOM   700  C  CA    . GLU A 1 94  ? 2.755   8.628   14.555  1.00 20.17 ? 103 GLU A CA    1 
ATOM   701  C  C     . GLU A 1 94  ? 2.588   7.726   13.326  1.00 19.27 ? 103 GLU A C     1 
ATOM   702  O  O     . GLU A 1 94  ? 1.834   8.062   12.413  1.00 18.63 ? 103 GLU A O     1 
ATOM   703  C  CB    . GLU A 1 94  ? 3.640   9.815   14.179  1.00 20.38 ? 103 GLU A CB    1 
ATOM   704  C  CG    . GLU A 1 94  ? 3.233   11.135  14.767  1.00 23.93 ? 103 GLU A CG    1 
ATOM   705  C  CD    . GLU A 1 94  ? 3.831   12.282  13.985  1.00 26.92 ? 103 GLU A CD    1 
ATOM   706  O  OE1   . GLU A 1 94  ? 3.109   12.887  13.162  1.00 31.91 ? 103 GLU A OE1   1 
ATOM   707  O  OE2   . GLU A 1 94  ? 5.030   12.558  14.175  1.00 28.67 ? 103 GLU A OE2   1 
ATOM   708  N  N     . ILE A 1 95  ? 3.281   6.588   13.296  1.00 18.67 ? 104 ILE A N     1 
ATOM   709  C  CA    . ILE A 1 95  ? 3.256   5.720   12.117  1.00 18.81 ? 104 ILE A CA    1 
ATOM   710  C  C     . ILE A 1 95  ? 1.831   5.279   11.784  1.00 18.98 ? 104 ILE A C     1 
ATOM   711  O  O     . ILE A 1 95  ? 1.449   5.222   10.610  1.00 18.73 ? 104 ILE A O     1 
ATOM   712  C  CB    . ILE A 1 95  ? 4.169   4.507   12.298  1.00 18.57 ? 104 ILE A CB    1 
ATOM   713  C  CG1   . ILE A 1 95  ? 5.639   4.958   12.336  1.00 18.19 ? 104 ILE A CG1   1 
ATOM   714  C  CG2   . ILE A 1 95  ? 3.944   3.470   11.183  1.00 18.19 ? 104 ILE A CG2   1 
ATOM   715  C  CD1   . ILE A 1 95  ? 6.158   5.514   11.023  1.00 17.97 ? 104 ILE A CD1   1 
ATOM   716  N  N     . TYR A 1 96  ? 1.044   5.003   12.816  1.00 19.58 ? 105 TYR A N     1 
ATOM   717  C  CA    . TYR A 1 96  ? -0.340  4.589   12.629  1.00 20.17 ? 105 TYR A CA    1 
ATOM   718  C  C     . TYR A 1 96  ? -1.104  5.580   11.750  1.00 19.82 ? 105 TYR A C     1 
ATOM   719  O  O     . TYR A 1 96  ? -1.858  5.178   10.861  1.00 20.23 ? 105 TYR A O     1 
ATOM   720  C  CB    . TYR A 1 96  ? -1.066  4.478   13.972  1.00 20.88 ? 105 TYR A CB    1 
ATOM   721  C  CG    . TYR A 1 96  ? -0.623  3.344   14.877  1.00 22.08 ? 105 TYR A CG    1 
ATOM   722  C  CD1   . TYR A 1 96  ? -0.938  2.020   14.584  1.00 23.76 ? 105 TYR A CD1   1 
ATOM   723  C  CD2   . TYR A 1 96  ? 0.077   3.602   16.057  1.00 22.87 ? 105 TYR A CD2   1 
ATOM   724  C  CE1   . TYR A 1 96  ? -0.551  0.984   15.435  1.00 23.97 ? 105 TYR A CE1   1 
ATOM   725  C  CE2   . TYR A 1 96  ? 0.481   2.576   16.898  1.00 21.70 ? 105 TYR A CE2   1 
ATOM   726  C  CZ    . TYR A 1 96  ? 0.163   1.278   16.591  1.00 22.94 ? 105 TYR A CZ    1 
ATOM   727  O  OH    . TYR A 1 96  ? 0.562   0.274   17.443  1.00 23.83 ? 105 TYR A OH    1 
ATOM   728  N  N     . LYS A 1 97  ? -0.904  6.866   12.019  1.00 19.04 ? 106 LYS A N     1 
ATOM   729  C  CA    . LYS A 1 97  ? -1.600  7.927   11.312  1.00 18.91 ? 106 LYS A CA    1 
ATOM   730  C  C     . LYS A 1 97  ? -1.251  7.910   9.835   1.00 18.17 ? 106 LYS A C     1 
ATOM   731  O  O     . LYS A 1 97  ? -2.132  8.031   8.992   1.00 17.46 ? 106 LYS A O     1 
ATOM   732  C  CB    . LYS A 1 97  ? -1.227  9.300   11.871  1.00 18.50 ? 106 LYS A CB    1 
ATOM   733  C  CG    . LYS A 1 97  ? -1.644  9.564   13.300  1.00 19.99 ? 106 LYS A CG    1 
ATOM   734  C  CD    . LYS A 1 97  ? -1.422  11.020  13.664  1.00 20.01 ? 106 LYS A CD    1 
ATOM   735  N  N     . PHE A 1 98  ? 0.037   7.775   9.530   1.00 17.94 ? 107 PHE A N     1 
ATOM   736  C  CA    . PHE A 1 98  ? 0.495   7.802   8.145   1.00 17.61 ? 107 PHE A CA    1 
ATOM   737  C  C     . PHE A 1 98  ? -0.083  6.659   7.342   1.00 17.61 ? 107 PHE A C     1 
ATOM   738  O  O     . PHE A 1 98  ? -0.544  6.848   6.216   1.00 17.27 ? 107 PHE A O     1 
ATOM   739  C  CB    . PHE A 1 98  ? 2.029   7.789   8.073   1.00 18.18 ? 107 PHE A CB    1 
ATOM   740  C  CG    . PHE A 1 98  ? 2.665   9.061   8.541   1.00 18.48 ? 107 PHE A CG    1 
ATOM   741  C  CD1   . PHE A 1 98  ? 2.543   10.209  7.800   1.00 21.06 ? 107 PHE A CD1   1 
ATOM   742  C  CD2   . PHE A 1 98  ? 3.402   9.101   9.721   1.00 19.79 ? 107 PHE A CD2   1 
ATOM   743  C  CE1   . PHE A 1 98  ? 3.131   11.386  8.211   1.00 19.94 ? 107 PHE A CE1   1 
ATOM   744  C  CE2   . PHE A 1 98  ? 4.002   10.268  10.140  1.00 19.72 ? 107 PHE A CE2   1 
ATOM   745  C  CZ    . PHE A 1 98  ? 3.865   11.419  9.393   1.00 19.94 ? 107 PHE A CZ    1 
ATOM   746  N  N     . GLN A 1 99  ? -0.063  5.469   7.911   1.00 17.32 ? 108 GLN A N     1 
ATOM   747  C  CA    . GLN A 1 99  ? -0.569  4.317   7.196   1.00 17.55 ? 108 GLN A CA    1 
ATOM   748  C  C     . GLN A 1 99  ? -2.067  4.458   6.911   1.00 17.30 ? 108 GLN A C     1 
ATOM   749  O  O     . GLN A 1 99  ? -2.526  4.173   5.801   1.00 17.24 ? 108 GLN A O     1 
ATOM   750  C  CB    . GLN A 1 99  ? -0.265  3.052   7.964   1.00 18.17 ? 108 GLN A CB    1 
ATOM   751  C  CG    . GLN A 1 99  ? -0.704  1.788   7.270   1.00 20.67 ? 108 GLN A CG    1 
ATOM   752  C  CD    . GLN A 1 99  ? -1.925  1.167   7.905   1.00 23.63 ? 108 GLN A CD    1 
ATOM   753  O  OE1   . GLN A 1 99  ? -2.724  1.845   8.558   1.00 26.41 ? 108 GLN A OE1   1 
ATOM   754  N  NE2   . GLN A 1 99  ? -2.065  -0.141  7.746   1.00 25.99 ? 108 GLN A NE2   1 
ATOM   755  N  N     . ARG A 1 100 ? -2.825  4.904   7.911   1.00 17.02 ? 109 ARG A N     1 
ATOM   756  C  CA    . ARG A 1 100 ? -4.255  5.128   7.729   1.00 17.35 ? 109 ARG A CA    1 
ATOM   757  C  C     . ARG A 1 100 ? -4.569  6.190   6.682   1.00 17.54 ? 109 ARG A C     1 
ATOM   758  O  O     . ARG A 1 100 ? -5.508  6.025   5.905   1.00 17.38 ? 109 ARG A O     1 
ATOM   759  C  CB    . ARG A 1 100 ? -4.908  5.542   9.048   1.00 17.73 ? 109 ARG A CB    1 
ATOM   760  C  CG    . ARG A 1 100 ? -5.066  4.427   10.030  1.00 20.73 ? 109 ARG A CG    1 
ATOM   761  C  CD    . ARG A 1 100 ? -5.844  4.895   11.255  1.00 24.39 ? 109 ARG A CD    1 
ATOM   762  N  NE    . ARG A 1 100 ? -5.206  6.030   11.942  1.00 25.97 ? 109 ARG A NE    1 
ATOM   763  C  CZ    . ARG A 1 100 ? -5.681  7.279   12.005  1.00 27.22 ? 109 ARG A CZ    1 
ATOM   764  N  NH1   . ARG A 1 100 ? -6.818  7.631   11.417  1.00 28.46 ? 109 ARG A NH1   1 
ATOM   765  N  NH2   . ARG A 1 100 ? -5.001  8.197   12.680  1.00 28.26 ? 109 ARG A NH2   1 
ATOM   766  N  N     . GLN A 1 101 ? -3.815  7.291   6.683   1.00 16.91 ? 110 GLN A N     1 
ATOM   767  C  CA    . GLN A 1 101 ? -4.003  8.337   5.680   1.00 17.28 ? 110 GLN A CA    1 
ATOM   768  C  C     . GLN A 1 101 ? -3.764  7.808   4.272   1.00 16.51 ? 110 GLN A C     1 
ATOM   769  O  O     . GLN A 1 101 ? -4.543  8.079   3.376   1.00 15.92 ? 110 GLN A O     1 
ATOM   770  C  CB    . GLN A 1 101 ? -3.058  9.506   5.928   1.00 17.27 ? 110 GLN A CB    1 
ATOM   771  C  CG    . GLN A 1 101 ? -3.349  10.311  7.155   1.00 18.60 ? 110 GLN A CG    1 
ATOM   772  C  CD    . GLN A 1 101 ? -2.196  11.219  7.535   1.00 19.45 ? 110 GLN A CD    1 
ATOM   773  O  OE1   . GLN A 1 101 ? -1.051  11.008  7.123   1.00 19.21 ? 110 GLN A OE1   1 
ATOM   774  N  NE2   . GLN A 1 101 ? -2.493  12.240  8.330   1.00 20.71 ? 110 GLN A NE2   1 
ATOM   775  N  N     . ILE A 1 102 ? -2.690  7.036   4.092   1.00 16.99 ? 111 ILE A N     1 
ATOM   776  C  CA    . ILE A 1 102 ? -2.349  6.488   2.780   1.00 17.21 ? 111 ILE A CA    1 
ATOM   777  C  C     . ILE A 1 102 ? -3.437  5.541   2.284   1.00 17.19 ? 111 ILE A C     1 
ATOM   778  O  O     . ILE A 1 102 ? -3.895  5.654   1.150   1.00 17.40 ? 111 ILE A O     1 
ATOM   779  C  CB    . ILE A 1 102 ? -0.992  5.721   2.812   1.00 17.42 ? 111 ILE A CB    1 
ATOM   780  C  CG1   . ILE A 1 102 ? 0.166   6.698   3.047   1.00 16.84 ? 111 ILE A CG1   1 
ATOM   781  C  CG2   . ILE A 1 102 ? -0.774  4.921   1.503   1.00 17.44 ? 111 ILE A CG2   1 
ATOM   782  C  CD1   . ILE A 1 102 ? 1.428   6.020   3.576   1.00 17.24 ? 111 ILE A CD1   1 
ATOM   783  N  N     . LEU A 1 103 ? -3.859  4.608   3.134   1.00 16.72 ? 112 LEU A N     1 
ATOM   784  C  CA    . LEU A 1 103 ? -4.913  3.671   2.735   1.00 16.64 ? 112 LEU A CA    1 
ATOM   785  C  C     . LEU A 1 103 ? -6.242  4.351   2.441   1.00 16.64 ? 112 LEU A C     1 
ATOM   786  O  O     . LEU A 1 103 ? -6.985  3.901   1.568   1.00 16.11 ? 112 LEU A O     1 
ATOM   787  C  CB    . LEU A 1 103 ? -5.064  2.542   3.757   1.00 16.29 ? 112 LEU A CB    1 
ATOM   788  C  CG    . LEU A 1 103 ? -3.850  1.627   3.880   1.00 17.07 ? 112 LEU A CG    1 
ATOM   789  C  CD1   . LEU A 1 103 ? -4.159  0.465   4.799   1.00 16.27 ? 112 LEU A CD1   1 
ATOM   790  C  CD2   . LEU A 1 103 ? -3.393  1.114   2.508   1.00 15.42 ? 112 LEU A CD2   1 
ATOM   791  N  N     . ARG A 1 104 ? -6.541  5.447   3.138   1.00 16.15 ? 113 ARG A N     1 
ATOM   792  C  CA    A ARG A 1 104 ? -7.755  6.209   2.906   0.50 16.60 ? 113 ARG A CA    1 
ATOM   793  C  CA    B ARG A 1 104 ? -7.783  6.161   2.875   0.50 16.48 ? 113 ARG A CA    1 
ATOM   794  C  C     . ARG A 1 104 ? -7.704  6.871   1.528   1.00 16.16 ? 113 ARG A C     1 
ATOM   795  O  O     . ARG A 1 104 ? -8.673  6.849   0.778   1.00 15.66 ? 113 ARG A O     1 
ATOM   796  C  CB    A ARG A 1 104 ? -7.885  7.276   3.996   0.50 16.64 ? 113 ARG A CB    1 
ATOM   797  C  CB    B ARG A 1 104 ? -8.133  7.168   3.975   0.50 16.43 ? 113 ARG A CB    1 
ATOM   798  C  CG    A ARG A 1 104 ? -9.122  8.137   3.899   0.50 17.96 ? 113 ARG A CG    1 
ATOM   799  C  CG    B ARG A 1 104 ? -9.460  7.874   3.694   0.50 17.45 ? 113 ARG A CG    1 
ATOM   800  C  CD    A ARG A 1 104 ? -9.507  8.720   5.244   0.50 19.28 ? 113 ARG A CD    1 
ATOM   801  C  CD    B ARG A 1 104 ? -10.089 8.516   4.906   0.50 17.99 ? 113 ARG A CD    1 
ATOM   802  N  NE    A ARG A 1 104 ? -8.664  9.848   5.652   0.50 19.48 ? 113 ARG A NE    1 
ATOM   803  N  NE    B ARG A 1 104 ? -11.441 8.977   4.596   0.50 17.53 ? 113 ARG A NE    1 
ATOM   804  C  CZ    A ARG A 1 104 ? -7.685  9.804   6.559   0.50 20.31 ? 113 ARG A CZ    1 
ATOM   805  C  CZ    B ARG A 1 104 ? -12.218 9.685   5.413   0.50 18.08 ? 113 ARG A CZ    1 
ATOM   806  N  NH1   A ARG A 1 104 ? -7.353  8.676   7.195   0.50 20.68 ? 113 ARG A NH1   1 
ATOM   807  N  NH1   B ARG A 1 104 ? -11.791 10.054  6.613   0.50 18.47 ? 113 ARG A NH1   1 
ATOM   808  N  NH2   A ARG A 1 104 ? -7.011  10.910  6.825   0.50 20.30 ? 113 ARG A NH2   1 
ATOM   809  N  NH2   B ARG A 1 104 ? -13.431 10.035  5.017   0.50 17.78 ? 113 ARG A NH2   1 
ATOM   810  N  N     . VAL A 1 105 ? -6.557  7.474   1.221   1.00 16.25 ? 114 VAL A N     1 
ATOM   811  C  CA    . VAL A 1 105 ? -6.369  8.125   -0.084  1.00 16.37 ? 114 VAL A CA    1 
ATOM   812  C  C     . VAL A 1 105 ? -6.476  7.096   -1.204  1.00 16.54 ? 114 VAL A C     1 
ATOM   813  O  O     . VAL A 1 105 ? -7.180  7.315   -2.194  1.00 15.86 ? 114 VAL A O     1 
ATOM   814  C  CB    . VAL A 1 105 ? -5.033  8.886   -0.161  1.00 16.67 ? 114 VAL A CB    1 
ATOM   815  C  CG1   . VAL A 1 105 ? -4.726  9.319   -1.600  1.00 18.00 ? 114 VAL A CG1   1 
ATOM   816  C  CG2   . VAL A 1 105 ? -5.090  10.108  0.744   1.00 17.11 ? 114 VAL A CG2   1 
ATOM   817  N  N     . LYS A 1 106 ? -5.826  5.956   -1.020  1.00 16.64 ? 115 LYS A N     1 
ATOM   818  C  CA    . LYS A 1 106 ? -5.840  4.891   -2.023  1.00 16.91 ? 115 LYS A CA    1 
ATOM   819  C  C     . LYS A 1 106 ? -7.172  4.134   -2.115  1.00 17.26 ? 115 LYS A C     1 
ATOM   820  O  O     . LYS A 1 106 ? -7.450  3.493   -3.133  1.00 17.07 ? 115 LYS A O     1 
ATOM   821  C  CB    . LYS A 1 106 ? -4.722  3.888   -1.742  1.00 17.34 ? 115 LYS A CB    1 
ATOM   822  C  CG    . LYS A 1 106 ? -3.322  4.460   -1.786  1.00 17.38 ? 115 LYS A CG    1 
ATOM   823  C  CD    . LYS A 1 106 ? -2.923  4.958   -3.169  1.00 17.67 ? 115 LYS A CD    1 
ATOM   824  C  CE    . LYS A 1 106 ? -1.472  5.428   -3.184  1.00 16.40 ? 115 LYS A CE    1 
ATOM   825  N  NZ    . LYS A 1 106 ? -1.059  5.879   -4.548  1.00 16.18 ? 115 LYS A NZ    1 
ATOM   826  N  N     . ASP A 1 107 ? -7.993  4.205   -1.067  1.00 17.17 ? 116 ASP A N     1 
ATOM   827  C  CA    . ASP A 1 107 ? -9.223  3.410   -0.974  1.00 17.02 ? 116 ASP A CA    1 
ATOM   828  C  C     . ASP A 1 107 ? -8.919  1.917   -1.136  1.00 16.81 ? 116 ASP A C     1 
ATOM   829  O  O     . ASP A 1 107 ? -9.643  1.178   -1.796  1.00 16.67 ? 116 ASP A O     1 
ATOM   830  C  CB    . ASP A 1 107 ? -10.287 3.871   -1.968  1.00 17.25 ? 116 ASP A CB    1 
ATOM   831  C  CG    . ASP A 1 107 ? -11.687 3.396   -1.588  1.00 18.41 ? 116 ASP A CG    1 
ATOM   832  O  OD1   . ASP A 1 107 ? -11.916 3.049   -0.402  1.00 19.21 ? 116 ASP A OD1   1 
ATOM   833  O  OD2   . ASP A 1 107 ? -12.562 3.367   -2.476  1.00 21.37 ? 116 ASP A OD2   1 
ATOM   834  N  N     . ARG A 1 108 ? -7.819  1.483   -0.535  1.00 16.70 ? 117 ARG A N     1 
ATOM   835  C  CA    . ARG A 1 108 ? -7.409  0.087   -0.627  1.00 16.77 ? 117 ARG A CA    1 
ATOM   836  C  C     . ARG A 1 108 ? -7.114  -0.465  0.755   1.00 16.19 ? 117 ARG A C     1 
ATOM   837  O  O     . ARG A 1 108 ? -6.919  0.275   1.705   1.00 16.41 ? 117 ARG A O     1 
ATOM   838  C  CB    . ARG A 1 108 ? -6.182  -0.034  -1.528  1.00 17.20 ? 117 ARG A CB    1 
ATOM   839  C  CG    . ARG A 1 108 ? -6.561  -0.179  -2.998  1.00 18.97 ? 117 ARG A CG    1 
ATOM   840  C  CD    . ARG A 1 108 ? -5.374  0.113   -3.907  1.00 20.74 ? 117 ARG A CD    1 
ATOM   841  N  NE    A ARG A 1 108 ? -4.510  -1.039  -3.587  0.50 20.68 ? 117 ARG A NE    1 
ATOM   842  N  NE    B ARG A 1 108 ? -5.719  1.469   -4.360  0.50 20.39 ? 117 ARG A NE    1 
ATOM   843  C  CZ    A ARG A 1 108 ? -3.389  -1.363  -4.227  0.50 21.46 ? 117 ARG A CZ    1 
ATOM   844  C  CZ    B ARG A 1 108 ? -5.086  2.175   -5.299  0.50 20.30 ? 117 ARG A CZ    1 
ATOM   845  N  NH1   A ARG A 1 108 ? -2.966  -0.667  -5.279  0.50 22.27 ? 117 ARG A NH1   1 
ATOM   846  N  NH1   B ARG A 1 108 ? -4.032  1.686   -5.943  0.50 19.94 ? 117 ARG A NH1   1 
ATOM   847  N  NH2   A ARG A 1 108 ? -2.693  -2.413  -3.813  0.50 20.68 ? 117 ARG A NH2   1 
ATOM   848  N  NH2   B ARG A 1 108 ? -5.524  3.395   -5.593  0.50 19.78 ? 117 ARG A NH2   1 
ATOM   849  N  N     . ASP A 1 109 ? -7.097  -1.785  0.866   1.00 15.57 ? 118 ASP A N     1 
ATOM   850  C  CA    . ASP A 1 109 ? -6.828  -2.437  2.143   1.00 16.12 ? 118 ASP A CA    1 
ATOM   851  C  C     . ASP A 1 109 ? -5.337  -2.711  2.408   1.00 16.04 ? 118 ASP A C     1 
ATOM   852  O  O     . ASP A 1 109 ? -4.942  -2.959  3.557   1.00 15.86 ? 118 ASP A O     1 
ATOM   853  C  CB    . ASP A 1 109 ? -7.599  -3.739  2.213   1.00 15.57 ? 118 ASP A CB    1 
ATOM   854  C  CG    . ASP A 1 109 ? -9.090  -3.534  2.117   1.00 17.85 ? 118 ASP A CG    1 
ATOM   855  O  OD1   . ASP A 1 109 ? -9.601  -2.571  2.733   1.00 19.09 ? 118 ASP A OD1   1 
ATOM   856  O  OD2   . ASP A 1 109 ? -9.746  -4.334  1.422   1.00 18.75 ? 118 ASP A OD2   1 
ATOM   857  N  N     . GLU A 1 110 ? -4.533  -2.677  1.348   1.00 16.34 ? 119 GLU A N     1 
ATOM   858  C  CA    . GLU A 1 110 ? -3.084  -2.646  1.462   1.00 17.51 ? 119 GLU A CA    1 
ATOM   859  C  C     . GLU A 1 110 ? -2.471  -1.923  0.270   1.00 17.03 ? 119 GLU A C     1 
ATOM   860  O  O     . GLU A 1 110 ? -3.127  -1.687  -0.753  1.00 17.12 ? 119 GLU A O     1 
ATOM   861  C  CB    . GLU A 1 110 ? -2.497  -4.050  1.650   1.00 17.95 ? 119 GLU A CB    1 
ATOM   862  C  CG    . GLU A 1 110 ? -2.665  -4.995  0.519   1.00 20.92 ? 119 GLU A CG    1 
ATOM   863  C  CD    . GLU A 1 110 ? -1.890  -6.307  0.714   1.00 20.69 ? 119 GLU A CD    1 
ATOM   864  O  OE1   . GLU A 1 110 ? -1.039  -6.426  1.644   1.00 26.78 ? 119 GLU A OE1   1 
ATOM   865  O  OE2   . GLU A 1 110 ? -2.132  -7.236  -0.084  1.00 24.28 ? 119 GLU A OE2   1 
ATOM   866  N  N     . PHE A 1 111 ? -1.224  -1.530  0.439   1.00 16.72 ? 120 PHE A N     1 
ATOM   867  C  CA    . PHE A 1 111 ? -0.514  -0.741  -0.553  1.00 16.35 ? 120 PHE A CA    1 
ATOM   868  C  C     . PHE A 1 111 ? 0.966   -0.811  -0.241  1.00 16.33 ? 120 PHE A C     1 
ATOM   869  O  O     . PHE A 1 111 ? 1.321   -0.839  0.927   1.00 16.38 ? 120 PHE A O     1 
ATOM   870  C  CB    . PHE A 1 111 ? -0.964  0.728   -0.529  1.00 16.58 ? 120 PHE A CB    1 
ATOM   871  C  CG    . PHE A 1 111 ? -0.521  1.465   -1.744  1.00 17.03 ? 120 PHE A CG    1 
ATOM   872  C  CD1   . PHE A 1 111 ? -1.223  1.331   -2.937  1.00 16.73 ? 120 PHE A CD1   1 
ATOM   873  C  CD2   . PHE A 1 111 ? 0.659   2.203   -1.737  1.00 18.45 ? 120 PHE A CD2   1 
ATOM   874  C  CE1   . PHE A 1 111 ? -0.788  1.952   -4.091  1.00 16.57 ? 120 PHE A CE1   1 
ATOM   875  C  CE2   . PHE A 1 111 ? 1.118   2.817   -2.894  1.00 18.41 ? 120 PHE A CE2   1 
ATOM   876  C  CZ    . PHE A 1 111 ? 0.397   2.702   -4.067  1.00 18.62 ? 120 PHE A CZ    1 
ATOM   877  N  N     . PRO A 1 112 ? 1.842   -0.848  -1.274  1.00 16.16 ? 121 PRO A N     1 
ATOM   878  C  CA    . PRO A 1 112 ? 3.294   -0.930  -1.038  1.00 16.39 ? 121 PRO A CA    1 
ATOM   879  C  C     . PRO A 1 112 ? 3.862   0.087   -0.046  1.00 17.06 ? 121 PRO A C     1 
ATOM   880  O  O     . PRO A 1 112 ? 3.832   1.302   -0.269  1.00 16.66 ? 121 PRO A O     1 
ATOM   881  C  CB    . PRO A 1 112 ? 3.879   -0.712  -2.427  1.00 16.53 ? 121 PRO A CB    1 
ATOM   882  C  CG    . PRO A 1 112 ? 2.852   -1.213  -3.331  1.00 15.70 ? 121 PRO A CG    1 
ATOM   883  C  CD    . PRO A 1 112 ? 1.536   -0.888  -2.717  1.00 16.70 ? 121 PRO A CD    1 
ATOM   884  N  N     . MET A 1 113 ? 4.373   -0.430  1.060   1.00 17.48 ? 122 MET A N     1 
ATOM   885  C  CA    . MET A 1 113 ? 4.969   0.391   2.101   1.00 18.88 ? 122 MET A CA    1 
ATOM   886  C  C     . MET A 1 113 ? 6.023   -0.436  2.802   1.00 17.68 ? 122 MET A C     1 
ATOM   887  O  O     . MET A 1 113 ? 5.936   -1.668  2.852   1.00 17.64 ? 122 MET A O     1 
ATOM   888  C  CB    . MET A 1 113 ? 3.947   0.773   3.174   1.00 19.43 ? 122 MET A CB    1 
ATOM   889  C  CG    . MET A 1 113 ? 2.837   1.681   2.757   1.00 21.52 ? 122 MET A CG    1 
ATOM   890  S  SD    . MET A 1 113 ? 1.672   1.817   4.130   1.00 25.01 ? 122 MET A SD    1 
ATOM   891  C  CE    . MET A 1 113 ? 0.186   2.099   3.199   1.00 24.71 ? 122 MET A CE    1 
ATOM   892  N  N     . ILE A 1 114 ? 6.977   0.242   3.414   1.00 17.14 ? 123 ILE A N     1 
ATOM   893  C  CA    . ILE A 1 114 ? 7.923   -0.423  4.330   1.00 16.94 ? 123 ILE A CA    1 
ATOM   894  C  C     . ILE A 1 114 ? 8.110   0.442   5.559   1.00 16.28 ? 123 ILE A C     1 
ATOM   895  O  O     . ILE A 1 114 ? 8.179   1.652   5.457   1.00 16.49 ? 123 ILE A O     1 
ATOM   896  C  CB    . ILE A 1 114 ? 9.319   -0.791  3.683   1.00 17.13 ? 123 ILE A CB    1 
ATOM   897  C  CG1   A ILE A 1 114 ? 9.141   -1.516  2.354   0.50 16.17 ? 123 ILE A CG1   1 
ATOM   898  C  CG1   B ILE A 1 114 ? 10.442  -1.108  4.682   0.50 17.31 ? 123 ILE A CG1   1 
ATOM   899  C  CG2   A ILE A 1 114 ? 10.195  -1.626  4.642   0.50 16.89 ? 123 ILE A CG2   1 
ATOM   900  C  CG2   B ILE A 1 114 ? 9.553   -0.446  2.194   0.50 20.12 ? 123 ILE A CG2   1 
ATOM   901  C  CD1   A ILE A 1 114 ? 10.431  -1.905  1.728   0.50 16.62 ? 123 ILE A CD1   1 
ATOM   902  C  CD1   B ILE A 1 114 ? 11.552  -1.931  4.072   0.50 17.73 ? 123 ILE A CD1   1 
ATOM   903  N  N     . LEU A 1 115 ? 8.177   -0.205  6.715   1.00 15.81 ? 124 LEU A N     1 
ATOM   904  C  CA    . LEU A 1 115 ? 8.404   0.477   7.986   1.00 15.36 ? 124 LEU A CA    1 
ATOM   905  C  C     . LEU A 1 115 ? 9.897   0.501   8.266   1.00 14.96 ? 124 LEU A C     1 
ATOM   906  O  O     . LEU A 1 115 ? 10.553  -0.524  8.281   1.00 14.58 ? 124 LEU A O     1 
ATOM   907  C  CB    . LEU A 1 115 ? 7.652   -0.207  9.111   1.00 15.85 ? 124 LEU A CB    1 
ATOM   908  C  CG    . LEU A 1 115 ? 7.784   0.395   10.513  1.00 14.59 ? 124 LEU A CG    1 
ATOM   909  C  CD1   . LEU A 1 115 ? 7.213   1.800   10.516  1.00 14.95 ? 124 LEU A CD1   1 
ATOM   910  C  CD2   . LEU A 1 115 ? 7.116   -0.453  11.566  1.00 16.25 ? 124 LEU A CD2   1 
ATOM   911  N  N     . ILE A 1 116 ? 10.422  1.703   8.481   1.00 13.89 ? 125 ILE A N     1 
ATOM   912  C  CA    . ILE A 1 116 ? 11.841  1.927   8.730   1.00 14.71 ? 125 ILE A CA    1 
ATOM   913  C  C     . ILE A 1 116 ? 12.072  2.557   10.110  1.00 15.36 ? 125 ILE A C     1 
ATOM   914  O  O     . ILE A 1 116 ? 11.628  3.667   10.361  1.00 16.11 ? 125 ILE A O     1 
ATOM   915  C  CB    . ILE A 1 116 ? 12.448  2.906   7.686   1.00 15.34 ? 125 ILE A CB    1 
ATOM   916  C  CG1   . ILE A 1 116 ? 12.277  2.411   6.250   1.00 14.42 ? 125 ILE A CG1   1 
ATOM   917  C  CG2   . ILE A 1 116 ? 13.931  3.189   7.958   1.00 15.41 ? 125 ILE A CG2   1 
ATOM   918  C  CD1   . ILE A 1 116 ? 12.845  1.027   5.941   1.00 15.76 ? 125 ILE A CD1   1 
ATOM   919  N  N     . GLY A 1 117 ? 12.797  1.845   10.963  1.00 14.25 ? 126 GLY A N     1 
ATOM   920  C  CA    . GLY A 1 117 ? 13.247  2.337   12.263  1.00 14.05 ? 126 GLY A CA    1 
ATOM   921  C  C     . GLY A 1 117 ? 14.648  2.901   12.119  1.00 14.52 ? 126 GLY A C     1 
ATOM   922  O  O     . GLY A 1 117 ? 15.638  2.184   12.078  1.00 14.76 ? 126 GLY A O     1 
ATOM   923  N  N     . ASN A 1 118 ? 14.728  4.214   11.988  1.00 13.86 ? 127 ASN A N     1 
ATOM   924  C  CA    . ASN A 1 118 ? 15.998  4.868   11.740  1.00 14.52 ? 127 ASN A CA    1 
ATOM   925  C  C     . ASN A 1 118 ? 16.707  5.283   13.037  1.00 14.27 ? 127 ASN A C     1 
ATOM   926  O  O     . ASN A 1 118 ? 16.106  5.266   14.101  1.00 14.52 ? 127 ASN A O     1 
ATOM   927  C  CB    . ASN A 1 118 ? 15.769  6.095   10.868  1.00 13.75 ? 127 ASN A CB    1 
ATOM   928  C  CG    . ASN A 1 118 ? 17.069  6.698   10.353  1.00 15.27 ? 127 ASN A CG    1 
ATOM   929  O  OD1   . ASN A 1 118 ? 17.988  5.988   9.949   1.00 13.19 ? 127 ASN A OD1   1 
ATOM   930  N  ND2   . ASN A 1 118 ? 17.155  8.018   10.383  1.00 15.13 ? 127 ASN A ND2   1 
ATOM   931  N  N     . LYS A 1 119 ? 17.979  5.670   12.911  1.00 14.82 ? 128 LYS A N     1 
ATOM   932  C  CA    . LYS A 1 119 ? 18.866  6.038   14.017  1.00 14.69 ? 128 LYS A CA    1 
ATOM   933  C  C     . LYS A 1 119 ? 19.265  4.843   14.885  1.00 15.28 ? 128 LYS A C     1 
ATOM   934  O  O     . LYS A 1 119 ? 19.570  4.996   16.070  1.00 15.84 ? 128 LYS A O     1 
ATOM   935  C  CB    . LYS A 1 119 ? 18.307  7.196   14.876  1.00 14.93 ? 128 LYS A CB    1 
ATOM   936  C  CG    . LYS A 1 119 ? 17.706  8.350   14.095  1.00 14.71 ? 128 LYS A CG    1 
ATOM   937  C  CD    . LYS A 1 119 ? 17.693  9.645   14.907  1.00 13.94 ? 128 LYS A CD    1 
ATOM   938  C  CE    . LYS A 1 119 ? 17.049  10.798  14.162  1.00 14.84 ? 128 LYS A CE    1 
ATOM   939  N  NZ    . LYS A 1 119 ? 16.991  12.039  14.992  1.00 14.78 ? 128 LYS A NZ    1 
ATOM   940  N  N     . ALA A 1 120 ? 19.353  3.670   14.266  1.00 15.85 ? 129 ALA A N     1 
ATOM   941  C  CA    . ALA A 1 120 ? 19.702  2.452   14.996  1.00 16.51 ? 129 ALA A CA    1 
ATOM   942  C  C     . ALA A 1 120 ? 21.144  2.455   15.531  1.00 16.91 ? 129 ALA A C     1 
ATOM   943  O  O     . ALA A 1 120 ? 21.510  1.602   16.357  1.00 17.33 ? 129 ALA A O     1 
ATOM   944  C  CB    . ALA A 1 120 ? 19.465  1.241   14.117  1.00 16.76 ? 129 ALA A CB    1 
ATOM   945  N  N     . ASP A 1 121 ? 21.957  3.407   15.072  1.00 16.77 ? 130 ASP A N     1 
ATOM   946  C  CA    . ASP A 1 121 ? 23.309  3.591   15.618  1.00 17.02 ? 130 ASP A CA    1 
ATOM   947  C  C     . ASP A 1 121 ? 23.319  4.145   17.048  1.00 17.26 ? 130 ASP A C     1 
ATOM   948  O  O     . ASP A 1 121 ? 24.315  3.995   17.752  1.00 16.94 ? 130 ASP A O     1 
ATOM   949  C  CB    . ASP A 1 121 ? 24.134  4.517   14.717  1.00 16.67 ? 130 ASP A CB    1 
ATOM   950  C  CG    . ASP A 1 121 ? 23.508  5.883   14.556  1.00 16.06 ? 130 ASP A CG    1 
ATOM   951  O  OD1   . ASP A 1 121 ? 22.450  5.961   13.905  1.00 16.05 ? 130 ASP A OD1   1 
ATOM   952  O  OD2   . ASP A 1 121 ? 24.079  6.870   15.071  1.00 16.55 ? 130 ASP A OD2   1 
ATOM   953  N  N     . LEU A 1 122 ? 22.235  4.809   17.454  1.00 17.98 ? 131 LEU A N     1 
ATOM   954  C  CA    . LEU A 1 122 ? 22.111  5.389   18.797  1.00 18.86 ? 131 LEU A CA    1 
ATOM   955  C  C     . LEU A 1 122 ? 21.532  4.361   19.763  1.00 19.76 ? 131 LEU A C     1 
ATOM   956  O  O     . LEU A 1 122 ? 20.460  4.563   20.344  1.00 19.39 ? 131 LEU A O     1 
ATOM   957  C  CB    . LEU A 1 122 ? 21.216  6.635   18.754  1.00 18.62 ? 131 LEU A CB    1 
ATOM   958  C  CG    . LEU A 1 122 ? 21.704  7.764   17.851  1.00 18.14 ? 131 LEU A CG    1 
ATOM   959  C  CD1   . LEU A 1 122 ? 20.743  8.930   17.919  1.00 17.09 ? 131 LEU A CD1   1 
ATOM   960  C  CD2   . LEU A 1 122 ? 23.103  8.213   18.256  1.00 18.77 ? 131 LEU A CD2   1 
ATOM   961  N  N     . ASP A 1 123 ? 22.255  3.262   19.938  1.00 20.91 ? 132 ASP A N     1 
ATOM   962  C  CA    . ASP A 1 123 ? 21.731  2.109   20.666  1.00 22.13 ? 132 ASP A CA    1 
ATOM   963  C  C     . ASP A 1 123 ? 21.460  2.330   22.158  1.00 22.66 ? 132 ASP A C     1 
ATOM   964  O  O     . ASP A 1 123 ? 20.707  1.562   22.759  1.00 23.50 ? 132 ASP A O     1 
ATOM   965  C  CB    . ASP A 1 123 ? 22.622  0.872   20.455  1.00 22.69 ? 132 ASP A CB    1 
ATOM   966  C  CG    . ASP A 1 123 ? 24.075  1.104   20.844  1.00 24.46 ? 132 ASP A CG    1 
ATOM   967  O  OD1   . ASP A 1 123 ? 24.371  1.237   22.050  1.00 28.50 ? 132 ASP A OD1   1 
ATOM   968  O  OD2   . ASP A 1 123 ? 24.932  1.115   19.937  1.00 25.98 ? 132 ASP A OD2   1 
ATOM   969  N  N     . HIS A 1 124 ? 22.047  3.371   22.747  1.00 22.58 ? 133 HIS A N     1 
ATOM   970  C  CA    . HIS A 1 124 ? 21.794  3.706   24.154  1.00 22.84 ? 133 HIS A CA    1 
ATOM   971  C  C     . HIS A 1 124 ? 20.893  4.934   24.328  1.00 22.04 ? 133 HIS A C     1 
ATOM   972  O  O     . HIS A 1 124 ? 20.828  5.515   25.407  1.00 21.64 ? 133 HIS A O     1 
ATOM   973  C  CB    . HIS A 1 124 ? 23.122  3.864   24.900  1.00 23.54 ? 133 HIS A CB    1 
ATOM   974  C  CG    . HIS A 1 124 ? 23.675  2.567   25.398  1.00 25.51 ? 133 HIS A CG    1 
ATOM   975  N  ND1   . HIS A 1 124 ? 23.937  1.502   24.562  1.00 28.14 ? 133 HIS A ND1   1 
ATOM   976  C  CD2   . HIS A 1 124 ? 23.985  2.151   26.646  1.00 27.22 ? 133 HIS A CD2   1 
ATOM   977  C  CE1   . HIS A 1 124 ? 24.402  0.490   25.275  1.00 27.49 ? 133 HIS A CE1   1 
ATOM   978  N  NE2   . HIS A 1 124 ? 24.441  0.858   26.542  1.00 28.23 ? 133 HIS A NE2   1 
ATOM   979  N  N     . GLN A 1 125 ? 20.194  5.318   23.262  1.00 20.95 ? 134 GLN A N     1 
ATOM   980  C  CA    . GLN A 1 125 ? 19.174  6.363   23.336  1.00 20.61 ? 134 GLN A CA    1 
ATOM   981  C  C     . GLN A 1 125 ? 17.819  5.887   22.820  1.00 19.50 ? 134 GLN A C     1 
ATOM   982  O  O     . GLN A 1 125 ? 16.913  6.693   22.627  1.00 19.15 ? 134 GLN A O     1 
ATOM   983  C  CB    . GLN A 1 125 ? 19.621  7.591   22.546  1.00 20.62 ? 134 GLN A CB    1 
ATOM   984  C  CG    . GLN A 1 125 ? 20.937  8.169   23.033  1.00 21.72 ? 134 GLN A CG    1 
ATOM   985  C  CD    . GLN A 1 125 ? 21.324  9.448   22.324  1.00 22.15 ? 134 GLN A CD    1 
ATOM   986  O  OE1   . GLN A 1 125 ? 20.481  10.145  21.758  1.00 24.02 ? 134 GLN A OE1   1 
ATOM   987  N  NE2   . GLN A 1 125 ? 22.612  9.775   22.367  1.00 24.51 ? 134 GLN A NE2   1 
ATOM   988  N  N     . ARG A 1 126 ? 17.673  4.581   22.615  1.00 18.57 ? 135 ARG A N     1 
ATOM   989  C  CA    . ARG A 1 126 ? 16.455  4.034   22.021  1.00 18.13 ? 135 ARG A CA    1 
ATOM   990  C  C     . ARG A 1 126 ? 15.280  4.160   22.973  1.00 17.23 ? 135 ARG A C     1 
ATOM   991  O  O     . ARG A 1 126 ? 15.395  3.833   24.168  1.00 17.15 ? 135 ARG A O     1 
ATOM   992  C  CB    . ARG A 1 126 ? 16.619  2.556   21.649  1.00 18.03 ? 135 ARG A CB    1 
ATOM   993  C  CG    . ARG A 1 126 ? 17.605  2.301   20.535  1.00 18.99 ? 135 ARG A CG    1 
ATOM   994  C  CD    . ARG A 1 126 ? 17.610  0.844   20.121  1.00 18.70 ? 135 ARG A CD    1 
ATOM   995  N  NE    . ARG A 1 126 ? 16.362  0.462   19.475  1.00 18.97 ? 135 ARG A NE    1 
ATOM   996  C  CZ    . ARG A 1 126 ? 16.254  -0.061  18.255  1.00 16.90 ? 135 ARG A CZ    1 
ATOM   997  N  NH1   . ARG A 1 126 ? 17.320  -0.312  17.510  1.00 17.19 ? 135 ARG A NH1   1 
ATOM   998  N  NH2   . ARG A 1 126 ? 15.063  -0.366  17.785  1.00 19.38 ? 135 ARG A NH2   1 
ATOM   999  N  N     . GLN A 1 127 ? 14.158  4.623   22.430  1.00 15.88 ? 136 GLN A N     1 
ATOM   1000 C  CA    . GLN A 1 127 ? 12.882  4.617   23.122  1.00 15.33 ? 136 GLN A CA    1 
ATOM   1001 C  C     . GLN A 1 127 ? 11.936  3.553   22.574  1.00 15.66 ? 136 GLN A C     1 
ATOM   1002 O  O     . GLN A 1 127 ? 10.843  3.374   23.110  1.00 15.83 ? 136 GLN A O     1 
ATOM   1003 C  CB    . GLN A 1 127 ? 12.216  5.990   23.024  1.00 15.23 ? 136 GLN A CB    1 
ATOM   1004 C  CG    . GLN A 1 127 ? 13.022  7.102   23.665  1.00 14.72 ? 136 GLN A CG    1 
ATOM   1005 C  CD    . GLN A 1 127 ? 12.261  8.410   23.749  1.00 14.84 ? 136 GLN A CD    1 
ATOM   1006 O  OE1   . GLN A 1 127 ? 11.172  8.544   23.194  1.00 14.16 ? 136 GLN A OE1   1 
ATOM   1007 N  NE2   . GLN A 1 127 ? 12.837  9.392   24.445  1.00 14.36 ? 136 GLN A NE2   1 
ATOM   1008 N  N     . VAL A 1 128 ? 12.346  2.878   21.495  1.00 15.26 ? 137 VAL A N     1 
ATOM   1009 C  CA    . VAL A 1 128 ? 11.557  1.822   20.861  1.00 15.29 ? 137 VAL A CA    1 
ATOM   1010 C  C     . VAL A 1 128 ? 12.470  0.631   20.639  1.00 14.72 ? 137 VAL A C     1 
ATOM   1011 O  O     . VAL A 1 128 ? 13.529  0.781   20.043  1.00 15.54 ? 137 VAL A O     1 
ATOM   1012 C  CB    . VAL A 1 128 ? 11.021  2.272   19.478  1.00 15.33 ? 137 VAL A CB    1 
ATOM   1013 C  CG1   . VAL A 1 128 ? 10.164  1.180   18.841  1.00 16.08 ? 137 VAL A CG1   1 
ATOM   1014 C  CG2   . VAL A 1 128 ? 10.260  3.582   19.578  1.00 15.84 ? 137 VAL A CG2   1 
ATOM   1015 N  N     . THR A 1 129 ? 12.066  -0.556  21.076  1.00 14.71 ? 138 THR A N     1 
ATOM   1016 C  CA    . THR A 1 129 ? 12.887  -1.741  20.840  1.00 14.96 ? 138 THR A CA    1 
ATOM   1017 C  C     . THR A 1 129 ? 12.667  -2.288  19.441  1.00 15.48 ? 138 THR A C     1 
ATOM   1018 O  O     . THR A 1 129 ? 11.664  -2.012  18.795  1.00 14.75 ? 138 THR A O     1 
ATOM   1019 C  CB    . THR A 1 129 ? 12.604  -2.866  21.841  1.00 15.03 ? 138 THR A CB    1 
ATOM   1020 O  OG1   . THR A 1 129 ? 11.333  -3.456  21.567  1.00 15.40 ? 138 THR A OG1   1 
ATOM   1021 C  CG2   . THR A 1 129 ? 12.632  -2.341  23.272  1.00 14.60 ? 138 THR A CG2   1 
ATOM   1022 N  N     . GLN A 1 130 ? 13.612  -3.097  18.992  1.00 16.77 ? 139 GLN A N     1 
ATOM   1023 C  CA    . GLN A 1 130 ? 13.493  -3.727  17.694  1.00 17.91 ? 139 GLN A CA    1 
ATOM   1024 C  C     . GLN A 1 130 ? 12.243  -4.604  17.662  1.00 18.11 ? 139 GLN A C     1 
ATOM   1025 O  O     . GLN A 1 130 ? 11.514  -4.614  16.667  1.00 17.77 ? 139 GLN A O     1 
ATOM   1026 C  CB    . GLN A 1 130 ? 14.742  -4.546  17.401  1.00 18.32 ? 139 GLN A CB    1 
ATOM   1027 C  CG    . GLN A 1 130 ? 14.780  -5.152  16.015  1.00 19.95 ? 139 GLN A CG    1 
ATOM   1028 C  CD    . GLN A 1 130 ? 16.178  -5.573  15.580  1.00 20.62 ? 139 GLN A CD    1 
ATOM   1029 O  OE1   . GLN A 1 130 ? 17.122  -5.592  16.374  1.00 24.78 ? 139 GLN A OE1   1 
ATOM   1030 N  NE2   . GLN A 1 130 ? 16.310  -5.916  14.299  1.00 27.02 ? 139 GLN A NE2   1 
ATOM   1031 N  N     . GLU A 1 131 ? 11.992  -5.316  18.758  1.00 18.35 ? 140 GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 131 ? 10.812  -6.172  18.882  1.00 18.94 ? 140 GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 131 ? 9.519   -5.368  18.739  1.00 17.54 ? 140 GLU A C     1 
ATOM   1034 O  O     . GLU A 1 131 ? 8.563   -5.821  18.108  1.00 17.21 ? 140 GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 131 ? 10.823  -6.885  20.232  1.00 19.16 ? 140 GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 131 ? 9.923   -8.105  20.321  1.00 21.73 ? 140 GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 131 ? 10.264  -8.995  21.491  1.00 22.11 ? 140 GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 131 ? 11.466  -9.080  21.834  1.00 27.37 ? 140 GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 131 ? 9.347   -9.621  22.077  1.00 27.70 ? 140 GLU A OE2   1 
ATOM   1040 N  N     . GLU A 1 132 ? 9.500   -4.169  19.314  1.00 16.51 ? 141 GLU A N     1 
ATOM   1041 C  CA    . GLU A 1 132 ? 8.339   -3.299  19.209  1.00 16.07 ? 141 GLU A CA    1 
ATOM   1042 C  C     . GLU A 1 132 ? 8.141   -2.832  17.769  1.00 15.79 ? 141 GLU A C     1 
ATOM   1043 O  O     . GLU A 1 132 ? 7.005   -2.712  17.302  1.00 15.05 ? 141 GLU A O     1 
ATOM   1044 C  CB    . GLU A 1 132 ? 8.462   -2.093  20.146  1.00 16.21 ? 141 GLU A CB    1 
ATOM   1045 C  CG    . GLU A 1 132 ? 8.282   -2.455  21.584  1.00 17.09 ? 141 GLU A CG    1 
ATOM   1046 C  CD    . GLU A 1 132 ? 8.432   -1.280  22.513  1.00 19.29 ? 141 GLU A CD    1 
ATOM   1047 O  OE1   . GLU A 1 132 ? 9.461   -0.569  22.437  1.00 19.33 ? 141 GLU A OE1   1 
ATOM   1048 O  OE2   . GLU A 1 132 ? 7.520   -1.088  23.345  1.00 21.19 ? 141 GLU A OE2   1 
ATOM   1049 N  N     . GLY A 1 133 ? 9.244   -2.579  17.070  1.00 15.06 ? 142 GLY A N     1 
ATOM   1050 C  CA    . GLY A 1 133 ? 9.195   -2.197  15.657  1.00 15.58 ? 142 GLY A CA    1 
ATOM   1051 C  C     . GLY A 1 133 ? 8.648   -3.337  14.805  1.00 15.82 ? 142 GLY A C     1 
ATOM   1052 O  O     . GLY A 1 133 ? 7.775   -3.128  13.944  1.00 15.33 ? 142 GLY A O     1 
ATOM   1053 N  N     . GLN A 1 134 ? 9.137   -4.551  15.065  1.00 16.38 ? 143 GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 134 ? 8.649   -5.757  14.376  1.00 17.14 ? 143 GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 134 ? 7.157   -6.018  14.647  1.00 17.15 ? 143 GLN A C     1 
ATOM   1056 O  O     . GLN A 1 134 ? 6.412   -6.406  13.745  1.00 17.47 ? 143 GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 134 ? 9.458   -6.991  14.782  1.00 17.42 ? 143 GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 134 ? 10.902  -6.996  14.302  1.00 18.36 ? 143 GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 134 ? 11.772  -8.051  14.999  1.00 18.38 ? 143 GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 134 ? 11.393  -8.628  16.013  1.00 21.40 ? 143 GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 134 ? 12.954  -8.294  14.439  1.00 23.51 ? 143 GLN A NE2   1 
ATOM   1062 N  N     . GLN A 1 135 ? 6.724   -5.811  15.889  1.00 17.11 ? 144 GLN A N     1 
ATOM   1063 C  CA    . GLN A 1 135 ? 5.316   -5.963  16.246  1.00 17.14 ? 144 GLN A CA    1 
ATOM   1064 C  C     . GLN A 1 135 ? 4.443   -4.953  15.515  1.00 16.85 ? 144 GLN A C     1 
ATOM   1065 O  O     . GLN A 1 135 ? 3.359   -5.302  15.044  1.00 16.52 ? 144 GLN A O     1 
ATOM   1066 C  CB    . GLN A 1 135 ? 5.120   -5.802  17.753  1.00 17.65 ? 144 GLN A CB    1 
ATOM   1067 C  CG    . GLN A 1 135 ? 3.656   -5.853  18.221  1.00 20.48 ? 144 GLN A CG    1 
ATOM   1068 C  CD    . GLN A 1 135 ? 2.902   -7.089  17.722  1.00 24.65 ? 144 GLN A CD    1 
ATOM   1069 O  OE1   . GLN A 1 135 ? 3.330   -8.229  17.934  1.00 27.94 ? 144 GLN A OE1   1 
ATOM   1070 N  NE2   . GLN A 1 135 ? 1.757   -6.865  17.081  1.00 26.85 ? 144 GLN A NE2   1 
ATOM   1071 N  N     . LEU A 1 136 ? 4.889   -3.699  15.440  1.00 16.52 ? 145 LEU A N     1 
ATOM   1072 C  CA    . LEU A 1 136 ? 4.122   -2.699  14.701  1.00 16.61 ? 145 LEU A CA    1 
ATOM   1073 C  C     . LEU A 1 136 ? 4.002   -3.107  13.233  1.00 17.11 ? 145 LEU A C     1 
ATOM   1074 O  O     . LEU A 1 136 ? 2.920   -3.025  12.650  1.00 16.44 ? 145 LEU A O     1 
ATOM   1075 C  CB    . LEU A 1 136 ? 4.712   -1.299  14.831  1.00 16.82 ? 145 LEU A CB    1 
ATOM   1076 C  CG    . LEU A 1 136 ? 3.952   -0.194  14.095  1.00 17.33 ? 145 LEU A CG    1 
ATOM   1077 C  CD1   . LEU A 1 136 ? 2.502   -0.095  14.547  1.00 17.69 ? 145 LEU A CD1   1 
ATOM   1078 C  CD2   . LEU A 1 136 ? 4.662   1.113   14.282  1.00 17.82 ? 145 LEU A CD2   1 
ATOM   1079 N  N     . ALA A 1 137 ? 5.107   -3.553  12.644  1.00 17.39 ? 146 ALA A N     1 
ATOM   1080 C  CA    . ALA A 1 137 ? 5.101   -3.990  11.239  1.00 18.19 ? 146 ALA A CA    1 
ATOM   1081 C  C     . ALA A 1 137 ? 4.138   -5.153  11.015  1.00 19.12 ? 146 ALA A C     1 
ATOM   1082 O  O     . ALA A 1 137 ? 3.471   -5.237  9.973   1.00 19.66 ? 146 ALA A O     1 
ATOM   1083 C  CB    . ALA A 1 137 ? 6.503   -4.374  10.799  1.00 18.13 ? 146 ALA A CB    1 
ATOM   1084 N  N     . ARG A 1 138 ? 4.078   -6.067  11.974  1.00 19.81 ? 147 ARG A N     1 
ATOM   1085 C  CA    . ARG A 1 138 ? 3.121   -7.175  11.901  1.00 20.54 ? 147 ARG A CA    1 
ATOM   1086 C  C     . ARG A 1 138 ? 1.680   -6.671  11.926  1.00 20.75 ? 147 ARG A C     1 
ATOM   1087 O  O     . ARG A 1 138 ? 0.853   -7.134  11.136  1.00 20.81 ? 147 ARG A O     1 
ATOM   1088 C  CB    . ARG A 1 138 ? 3.340   -8.184  13.032  1.00 21.19 ? 147 ARG A CB    1 
ATOM   1089 C  CG    . ARG A 1 138 ? 4.453   -9.163  12.745  1.00 23.40 ? 147 ARG A CG    1 
ATOM   1090 C  CD    . ARG A 1 138 ? 4.340   -10.385 13.624  1.00 25.64 ? 147 ARG A CD    1 
ATOM   1091 N  NE    . ARG A 1 138 ? 4.597   -10.049 15.019  1.00 27.67 ? 147 ARG A NE    1 
ATOM   1092 C  CZ    . ARG A 1 138 ? 5.807   -9.875  15.553  1.00 27.38 ? 147 ARG A CZ    1 
ATOM   1093 N  NH1   . ARG A 1 138 ? 6.911   -10.004 14.823  1.00 28.09 ? 147 ARG A NH1   1 
ATOM   1094 N  NH2   . ARG A 1 138 ? 5.912   -9.571  16.834  1.00 27.68 ? 147 ARG A NH2   1 
ATOM   1095 N  N     . GLN A 1 139 ? 1.391   -5.722  12.816  1.00 21.24 ? 148 GLN A N     1 
ATOM   1096 C  CA    . GLN A 1 139 ? 0.046   -5.141  12.939  1.00 21.84 ? 148 GLN A CA    1 
ATOM   1097 C  C     . GLN A 1 139 ? -0.367  -4.429  11.659  1.00 21.61 ? 148 GLN A C     1 
ATOM   1098 O  O     . GLN A 1 139 ? -1.537  -4.507  11.251  1.00 21.20 ? 148 GLN A O     1 
ATOM   1099 C  CB    . GLN A 1 139 ? -0.032  -4.144  14.101  1.00 22.20 ? 148 GLN A CB    1 
ATOM   1100 C  CG    . GLN A 1 139 ? -0.138  -4.780  15.455  1.00 23.62 ? 148 GLN A CG    1 
ATOM   1101 C  CD    . GLN A 1 139 ? -0.023  -3.786  16.603  1.00 24.02 ? 148 GLN A CD    1 
ATOM   1102 O  OE1   . GLN A 1 139 ? 0.178   -4.182  17.749  1.00 27.39 ? 148 GLN A OE1   1 
ATOM   1103 N  NE2   . GLN A 1 139 ? -0.141  -2.493  16.297  1.00 27.45 ? 148 GLN A NE2   1 
ATOM   1104 N  N     . LEU A 1 140 ? 0.590   -3.736  11.040  1.00 20.78 ? 149 LEU A N     1 
ATOM   1105 C  CA    . LEU A 1 140 ? 0.363   -3.009  9.787   1.00 21.13 ? 149 LEU A CA    1 
ATOM   1106 C  C     . LEU A 1 140 ? 0.542   -3.870  8.539   1.00 20.30 ? 149 LEU A C     1 
ATOM   1107 O  O     . LEU A 1 140 ? 0.330   -3.391  7.418   1.00 20.80 ? 149 LEU A O     1 
ATOM   1108 C  CB    . LEU A 1 140 ? 1.289   -1.794  9.704   1.00 21.61 ? 149 LEU A CB    1 
ATOM   1109 C  CG    . LEU A 1 140 ? 1.181   -0.783  10.851  1.00 23.48 ? 149 LEU A CG    1 
ATOM   1110 C  CD1   . LEU A 1 140 ? 2.131   0.358   10.620  1.00 26.11 ? 149 LEU A CD1   1 
ATOM   1111 C  CD2   . LEU A 1 140 ? -0.237  -0.269  11.024  1.00 25.69 ? 149 LEU A CD2   1 
ATOM   1112 N  N     . LYS A 1 141 ? 0.926   -5.131  8.720   1.00 19.85 ? 150 LYS A N     1 
ATOM   1113 C  CA    . LYS A 1 141 ? 1.165   -6.058  7.615   1.00 20.34 ? 150 LYS A CA    1 
ATOM   1114 C  C     . LYS A 1 141 ? 2.166   -5.517  6.579   1.00 20.05 ? 150 LYS A C     1 
ATOM   1115 O  O     . LYS A 1 141 ? 1.929   -5.574  5.365   1.00 19.14 ? 150 LYS A O     1 
ATOM   1116 C  CB    . LYS A 1 141 ? -0.166  -6.474  6.965   1.00 20.81 ? 150 LYS A CB    1 
ATOM   1117 C  CG    . LYS A 1 141 ? -1.076  -7.222  7.921   1.00 21.64 ? 150 LYS A CG    1 
ATOM   1118 C  CD    . LYS A 1 141 ? -2.363  -7.654  7.258   1.00 22.45 ? 150 LYS A CD    1 
ATOM   1119 C  CE    . LYS A 1 141 ? -3.331  -8.238  8.262   1.00 24.69 ? 150 LYS A CE    1 
ATOM   1120 N  NZ    . LYS A 1 141 ? -4.437  -8.951  7.590   1.00 26.11 ? 150 LYS A NZ    1 
ATOM   1121 N  N     . VAL A 1 142 ? 3.289   -5.000  7.077   1.00 19.70 ? 151 VAL A N     1 
ATOM   1122 C  CA    . VAL A 1 142 ? 4.384   -4.523  6.231   1.00 19.73 ? 151 VAL A CA    1 
ATOM   1123 C  C     . VAL A 1 142 ? 5.720   -5.065  6.686   1.00 20.02 ? 151 VAL A C     1 
ATOM   1124 O  O     . VAL A 1 142 ? 5.839   -5.626  7.777   1.00 19.90 ? 151 VAL A O     1 
ATOM   1125 C  CB    . VAL A 1 142 ? 4.487   -2.984  6.206   1.00 19.73 ? 151 VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1 142 ? 3.224   -2.398  5.634   1.00 21.39 ? 151 VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1 142 ? 4.765   -2.420  7.615   1.00 19.36 ? 151 VAL A CG2   1 
ATOM   1128 N  N     . THR A 1 143 ? 6.707   -4.905  5.815   1.00 19.76 ? 152 THR A N     1 
ATOM   1129 C  CA    . THR A 1 143 ? 8.089   -5.272  6.080   1.00 20.93 ? 152 THR A CA    1 
ATOM   1130 C  C     . THR A 1 143 ? 8.700   -4.236  7.010   1.00 19.99 ? 152 THR A C     1 
ATOM   1131 O  O     . THR A 1 143 ? 8.390   -3.047  6.882   1.00 19.51 ? 152 THR A O     1 
ATOM   1132 C  CB    . THR A 1 143 ? 8.894   -5.339  4.743   1.00 21.72 ? 152 THR A CB    1 
ATOM   1133 O  OG1   . THR A 1 143 ? 8.367   -6.397  3.920   1.00 25.22 ? 152 THR A OG1   1 
ATOM   1134 C  CG2   . THR A 1 143 ? 10.365  -5.585  4.998   1.00 23.08 ? 152 THR A CG2   1 
ATOM   1135 N  N     . TYR A 1 144 ? 9.525   -4.694  7.956   1.00 19.39 ? 153 TYR A N     1 
ATOM   1136 C  CA    . TYR A 1 144 ? 10.269  -3.807  8.861   1.00 18.95 ? 153 TYR A CA    1 
ATOM   1137 C  C     . TYR A 1 144 ? 11.750  -3.908  8.574   1.00 19.14 ? 153 TYR A C     1 
ATOM   1138 O  O     . TYR A 1 144 ? 12.303  -5.014  8.425   1.00 19.50 ? 153 TYR A O     1 
ATOM   1139 C  CB    . TYR A 1 144 ? 10.057  -4.183  10.329  1.00 19.22 ? 153 TYR A CB    1 
ATOM   1140 C  CG    . TYR A 1 144 ? 10.743  -3.292  11.352  1.00 17.89 ? 153 TYR A CG    1 
ATOM   1141 C  CD1   . TYR A 1 144 ? 10.534  -1.916  11.370  1.00 19.38 ? 153 TYR A CD1   1 
ATOM   1142 C  CD2   . TYR A 1 144 ? 11.577  -3.827  12.327  1.00 19.79 ? 153 TYR A CD2   1 
ATOM   1143 C  CE1   . TYR A 1 144 ? 11.141  -1.114  12.319  1.00 19.16 ? 153 TYR A CE1   1 
ATOM   1144 C  CE2   . TYR A 1 144 ? 12.195  -3.029  13.276  1.00 18.54 ? 153 TYR A CE2   1 
ATOM   1145 C  CZ    . TYR A 1 144 ? 11.978  -1.659  13.262  1.00 18.28 ? 153 TYR A CZ    1 
ATOM   1146 O  OH    . TYR A 1 144 ? 12.565  -0.842  14.205  1.00 18.57 ? 153 TYR A OH    1 
ATOM   1147 N  N     . MET A 1 145 ? 12.389  -2.751  8.568   1.00 18.94 ? 154 MET A N     1 
ATOM   1148 C  CA    . MET A 1 145 ? 13.827  -2.654  8.441   1.00 19.63 ? 154 MET A CA    1 
ATOM   1149 C  C     . MET A 1 145 ? 14.356  -1.580  9.367   1.00 18.60 ? 154 MET A C     1 
ATOM   1150 O  O     . MET A 1 145 ? 13.834  -0.463  9.418   1.00 18.79 ? 154 MET A O     1 
ATOM   1151 C  CB    . MET A 1 145 ? 14.167  -2.251  7.023   1.00 19.69 ? 154 MET A CB    1 
ATOM   1152 C  CG    A MET A 1 145 ? 15.255  -3.084  6.411   0.50 21.41 ? 154 MET A CG    1 
ATOM   1153 C  CG    B MET A 1 145 ? 14.417  -3.395  6.090   0.50 20.83 ? 154 MET A CG    1 
ATOM   1154 S  SD    A MET A 1 145 ? 16.020  -2.353  4.946   0.50 20.02 ? 154 MET A SD    1 
ATOM   1155 S  SD    B MET A 1 145 ? 14.258  -2.910  4.356   0.50 21.27 ? 154 MET A SD    1 
ATOM   1156 C  CE    A MET A 1 145 ? 15.456  -3.577  3.775   0.50 20.57 ? 154 MET A CE    1 
ATOM   1157 C  CE    B MET A 1 145 ? 15.995  -2.843  3.956   0.50 22.05 ? 154 MET A CE    1 
ATOM   1158 N  N     . GLU A 1 146 ? 15.419  -1.900  10.081  1.00 18.01 ? 155 GLU A N     1 
ATOM   1159 C  CA    . GLU A 1 146 ? 16.131  -0.882  10.818  1.00 17.84 ? 155 GLU A CA    1 
ATOM   1160 C  C     . GLU A 1 146 ? 17.240  -0.339  9.944   1.00 17.60 ? 155 GLU A C     1 
ATOM   1161 O  O     . GLU A 1 146 ? 17.805  -1.048  9.102   1.00 17.90 ? 155 GLU A O     1 
ATOM   1162 C  CB    . GLU A 1 146 ? 16.658  -1.396  12.144  1.00 18.42 ? 155 GLU A CB    1 
ATOM   1163 C  CG    . GLU A 1 146 ? 15.545  -1.885  13.036  1.00 19.01 ? 155 GLU A CG    1 
ATOM   1164 C  CD    . GLU A 1 146 ? 15.836  -1.798  14.516  1.00 19.69 ? 155 GLU A CD    1 
ATOM   1165 O  OE1   . GLU A 1 146 ? 17.007  -1.870  14.925  1.00 19.37 ? 155 GLU A OE1   1 
ATOM   1166 O  OE2   . GLU A 1 146 ? 14.853  -1.655  15.274  1.00 19.77 ? 155 GLU A OE2   1 
ATOM   1167 N  N     . ALA A 1 147 ? 17.517  0.941   10.147  1.00 16.58 ? 156 ALA A N     1 
ATOM   1168 C  CA    . ALA A 1 147 ? 18.452  1.680   9.322   1.00 16.49 ? 156 ALA A CA    1 
ATOM   1169 C  C     . ALA A 1 147 ? 19.210  2.682   10.168  1.00 16.10 ? 156 ALA A C     1 
ATOM   1170 O  O     . ALA A 1 147 ? 18.841  2.991   11.306  1.00 15.53 ? 156 ALA A O     1 
ATOM   1171 C  CB    . ALA A 1 147 ? 17.702  2.414   8.179   1.00 16.42 ? 156 ALA A CB    1 
ATOM   1172 N  N     . SER A 1 148 ? 20.296  3.182   9.598   1.00 16.28 ? 157 SER A N     1 
ATOM   1173 C  CA    . SER A 1 148 ? 20.957  4.361   10.116  1.00 16.32 ? 157 SER A CA    1 
ATOM   1174 C  C     . SER A 1 148 ? 21.484  5.154   8.951   1.00 16.96 ? 157 SER A C     1 
ATOM   1175 O  O     . SER A 1 148 ? 22.336  4.653   8.215   1.00 17.46 ? 157 SER A O     1 
ATOM   1176 C  CB    . SER A 1 148 ? 22.133  3.981   11.032  1.00 16.37 ? 157 SER A CB    1 
ATOM   1177 O  OG    . SER A 1 148 ? 22.921  5.127   11.355  1.00 16.24 ? 157 SER A OG    1 
ATOM   1178 N  N     . ALA A 1 149 ? 21.001  6.385   8.797   1.00 16.81 ? 158 ALA A N     1 
ATOM   1179 C  CA    . ALA A 1 149 ? 21.558  7.309   7.831   1.00 18.07 ? 158 ALA A CA    1 
ATOM   1180 C  C     . ALA A 1 149 ? 22.997  7.674   8.201   1.00 18.18 ? 158 ALA A C     1 
ATOM   1181 O  O     . ALA A 1 149 ? 23.827  7.879   7.322   1.00 18.68 ? 158 ALA A O     1 
ATOM   1182 C  CB    . ALA A 1 149 ? 20.698  8.553   7.737   1.00 17.68 ? 158 ALA A CB    1 
ATOM   1183 N  N     . LYS A 1 150 ? 23.301  7.731   9.498   1.00 18.31 ? 159 LYS A N     1 
ATOM   1184 C  CA    . LYS A 1 150 ? 24.626  8.163   9.959   1.00 18.70 ? 159 LYS A CA    1 
ATOM   1185 C  C     . LYS A 1 150 ? 25.741  7.203   9.549   1.00 18.88 ? 159 LYS A C     1 
ATOM   1186 O  O     . LYS A 1 150 ? 26.770  7.643   9.045   1.00 18.81 ? 159 LYS A O     1 
ATOM   1187 C  CB    . LYS A 1 150 ? 24.642  8.386   11.474  1.00 18.73 ? 159 LYS A CB    1 
ATOM   1188 C  CG    . LYS A 1 150 ? 26.018  8.750   12.023  1.00 19.74 ? 159 LYS A CG    1 
ATOM   1189 C  CD    . LYS A 1 150 ? 25.921  9.457   13.358  1.00 21.24 ? 159 LYS A CD    1 
ATOM   1190 C  CE    . LYS A 1 150 ? 27.287  9.845   13.880  1.00 22.76 ? 159 LYS A CE    1 
ATOM   1191 N  NZ    . LYS A 1 150 ? 27.196  10.902  14.933  1.00 24.84 ? 159 LYS A NZ    1 
ATOM   1192 N  N     . ILE A 1 151 ? 25.540  5.903   9.746   1.00 19.43 ? 160 ILE A N     1 
ATOM   1193 C  CA    . ILE A 1 151 ? 26.566  4.922   9.381   1.00 20.18 ? 160 ILE A CA    1 
ATOM   1194 C  C     . ILE A 1 151 ? 26.221  4.212   8.066   1.00 20.36 ? 160 ILE A C     1 
ATOM   1195 O  O     . ILE A 1 151 ? 26.884  3.242   7.686   1.00 20.78 ? 160 ILE A O     1 
ATOM   1196 C  CB    . ILE A 1 151 ? 26.824  3.900   10.521  1.00 20.21 ? 160 ILE A CB    1 
ATOM   1197 C  CG1   . ILE A 1 151 ? 25.570  3.082   10.846  1.00 20.54 ? 160 ILE A CG1   1 
ATOM   1198 C  CG2   . ILE A 1 151 ? 27.327  4.622   11.760  1.00 20.64 ? 160 ILE A CG2   1 
ATOM   1199 C  CD1   . ILE A 1 151 ? 25.850  1.807   11.641  1.00 21.05 ? 160 ILE A CD1   1 
ATOM   1200 N  N     . ARG A 1 152 ? 25.191  4.711   7.381   1.00 20.50 ? 161 ARG A N     1 
ATOM   1201 C  CA    . ARG A 1 152 ? 24.710  4.159   6.125   1.00 20.64 ? 161 ARG A CA    1 
ATOM   1202 C  C     . ARG A 1 152 ? 24.404  2.658   6.210   1.00 20.48 ? 161 ARG A C     1 
ATOM   1203 O  O     . ARG A 1 152 ? 24.834  1.882   5.364   1.00 20.86 ? 161 ARG A O     1 
ATOM   1204 C  CB    . ARG A 1 152 ? 25.686  4.491   4.981   1.00 20.71 ? 161 ARG A CB    1 
ATOM   1205 C  CG    . ARG A 1 152 ? 25.013  4.557   3.618   1.00 21.47 ? 161 ARG A CG    1 
ATOM   1206 C  CD    . ARG A 1 152 ? 25.914  5.123   2.529   1.00 22.51 ? 161 ARG A CD    1 
ATOM   1207 N  NE    . ARG A 1 152 ? 25.145  5.530   1.345   1.00 23.92 ? 161 ARG A NE    1 
ATOM   1208 C  CZ    . ARG A 1 152 ? 24.630  4.694   0.443   1.00 24.68 ? 161 ARG A CZ    1 
ATOM   1209 N  NH1   . ARG A 1 152 ? 23.958  5.173   -0.600  1.00 24.49 ? 161 ARG A NH1   1 
ATOM   1210 N  NH2   . ARG A 1 152 ? 24.784  3.379   0.568   1.00 26.10 ? 161 ARG A NH2   1 
ATOM   1211 N  N     . MET A 1 153 ? 23.633  2.273   7.227   1.00 19.49 ? 162 MET A N     1 
ATOM   1212 C  CA    . MET A 1 153 ? 23.152  0.896   7.381   1.00 20.36 ? 162 MET A CA    1 
ATOM   1213 C  C     . MET A 1 153 ? 21.768  0.767   6.763   1.00 18.77 ? 162 MET A C     1 
ATOM   1214 O  O     . MET A 1 153 ? 20.860  1.484   7.157   1.00 18.37 ? 162 MET A O     1 
ATOM   1215 C  CB    . MET A 1 153 ? 23.051  0.522   8.858   1.00 19.91 ? 162 MET A CB    1 
ATOM   1216 C  CG    . MET A 1 153 ? 22.589  -0.911  9.103   1.00 22.67 ? 162 MET A CG    1 
ATOM   1217 S  SD    . MET A 1 153 ? 22.547  -1.336  10.852  1.00 25.30 ? 162 MET A SD    1 
ATOM   1218 C  CE    . MET A 1 153 ? 21.052  -0.479  11.323  1.00 23.05 ? 162 MET A CE    1 
ATOM   1219 N  N     . ASN A 1 154 ? 21.621  -0.162  5.822   1.00 18.27 ? 163 ASN A N     1 
ATOM   1220 C  CA    . ASN A 1 154 ? 20.326  -0.492  5.212   1.00 18.23 ? 163 ASN A CA    1 
ATOM   1221 C  C     . ASN A 1 154 ? 19.663  0.654   4.453   1.00 16.95 ? 163 ASN A C     1 
ATOM   1222 O  O     . ASN A 1 154 ? 18.446  0.621   4.207   1.00 16.73 ? 163 ASN A O     1 
ATOM   1223 C  CB    . ASN A 1 154 ? 19.356  -1.069  6.249   1.00 19.02 ? 163 ASN A CB    1 
ATOM   1224 C  CG    . ASN A 1 154 ? 19.574  -2.540  6.486   1.00 22.46 ? 163 ASN A CG    1 
ATOM   1225 O  OD1   . ASN A 1 154 ? 20.289  -3.192  5.732   1.00 25.28 ? 163 ASN A OD1   1 
ATOM   1226 N  ND2   . ASN A 1 154 ? 18.963  -3.078  7.546   1.00 26.03 ? 163 ASN A ND2   1 
ATOM   1227 N  N     . VAL A 1 155 ? 20.454  1.634   4.043   1.00 16.53 ? 164 VAL A N     1 
ATOM   1228 C  CA    . VAL A 1 155 ? 19.929  2.772   3.300   1.00 16.80 ? 164 VAL A CA    1 
ATOM   1229 C  C     . VAL A 1 155 ? 19.547  2.362   1.867   1.00 16.46 ? 164 VAL A C     1 
ATOM   1230 O  O     . VAL A 1 155 ? 18.389  2.482   1.478   1.00 17.01 ? 164 VAL A O     1 
ATOM   1231 C  CB    . VAL A 1 155 ? 20.921  3.958   3.271   1.00 16.72 ? 164 VAL A CB    1 
ATOM   1232 C  CG1   . VAL A 1 155 ? 20.366  5.092   2.416   1.00 18.03 ? 164 VAL A CG1   1 
ATOM   1233 C  CG2   . VAL A 1 155 ? 21.236  4.448   4.692   1.00 18.66 ? 164 VAL A CG2   1 
ATOM   1234 N  N     . ASP A 1 156 ? 20.502  1.869   1.076   1.00 15.97 ? 165 ASP A N     1 
ATOM   1235 C  CA    . ASP A 1 156 ? 20.167  1.393   -0.276  1.00 16.22 ? 165 ASP A CA    1 
ATOM   1236 C  C     . ASP A 1 156 ? 19.112  0.291   -0.214  1.00 16.21 ? 165 ASP A C     1 
ATOM   1237 O  O     . ASP A 1 156 ? 18.176  0.256   -1.029  1.00 16.03 ? 165 ASP A O     1 
ATOM   1238 C  CB    . ASP A 1 156 ? 21.405  0.829   -0.996  1.00 16.60 ? 165 ASP A CB    1 
ATOM   1239 C  CG    . ASP A 1 156 ? 22.409  1.896   -1.399  1.00 17.54 ? 165 ASP A CG    1 
ATOM   1240 O  OD1   . ASP A 1 156 ? 22.141  3.094   -1.178  1.00 19.78 ? 165 ASP A OD1   1 
ATOM   1241 O  OD2   . ASP A 1 156 ? 23.488  1.530   -1.932  1.00 16.68 ? 165 ASP A OD2   1 
ATOM   1242 N  N     . GLN A 1 157 ? 19.276  -0.602  0.763   1.00 16.13 ? 166 GLN A N     1 
ATOM   1243 C  CA    . GLN A 1 157 ? 18.457  -1.801  0.892   1.00 16.42 ? 166 GLN A CA    1 
ATOM   1244 C  C     . GLN A 1 157 ? 16.991  -1.437  1.125   1.00 16.58 ? 166 GLN A C     1 
ATOM   1245 O  O     . GLN A 1 157 ? 16.092  -2.113  0.635   1.00 16.57 ? 166 GLN A O     1 
ATOM   1246 C  CB    . GLN A 1 157 ? 18.995  -2.691  2.014   1.00 16.05 ? 166 GLN A CB    1 
ATOM   1247 C  CG    . GLN A 1 157 ? 20.367  -3.304  1.729   1.00 16.36 ? 166 GLN A CG    1 
ATOM   1248 C  CD    . GLN A 1 157 ? 21.546  -2.504  2.261   1.00 16.87 ? 166 GLN A CD    1 
ATOM   1249 O  OE1   . GLN A 1 157 ? 21.514  -1.279  2.342   1.00 16.82 ? 166 GLN A OE1   1 
ATOM   1250 N  NE2   . GLN A 1 157 ? 22.607  -3.212  2.618   1.00 17.89 ? 166 GLN A NE2   1 
ATOM   1251 N  N     . ALA A 1 158 ? 16.762  -0.377  1.893   1.00 16.17 ? 167 ALA A N     1 
ATOM   1252 C  CA    . ALA A 1 158 ? 15.402  0.043   2.202   1.00 16.52 ? 167 ALA A CA    1 
ATOM   1253 C  C     . ALA A 1 158 ? 14.704  0.450   0.915   1.00 16.09 ? 167 ALA A C     1 
ATOM   1254 O  O     . ALA A 1 158 ? 13.557  0.057   0.672   1.00 15.73 ? 167 ALA A O     1 
ATOM   1255 C  CB    . ALA A 1 158 ? 15.415  1.172   3.183   1.00 16.47 ? 167 ALA A CB    1 
ATOM   1256 N  N     . PHE A 1 159 ? 15.397  1.236   0.084   1.00 15.88 ? 168 PHE A N     1 
ATOM   1257 C  CA    . PHE A 1 159 ? 14.804  1.742   -1.156  1.00 16.08 ? 168 PHE A CA    1 
ATOM   1258 C  C     . PHE A 1 159 ? 14.643  0.645   -2.181  1.00 15.93 ? 168 PHE A C     1 
ATOM   1259 O  O     . PHE A 1 159 ? 13.612  0.581   -2.846  1.00 16.66 ? 168 PHE A O     1 
ATOM   1260 C  CB    . PHE A 1 159 ? 15.611  2.906   -1.726  1.00 15.81 ? 168 PHE A CB    1 
ATOM   1261 C  CG    . PHE A 1 159 ? 15.412  4.203   -0.986  1.00 15.21 ? 168 PHE A CG    1 
ATOM   1262 C  CD1   . PHE A 1 159 ? 14.330  5.006   -1.269  1.00 16.36 ? 168 PHE A CD1   1 
ATOM   1263 C  CD2   . PHE A 1 159 ? 16.286  4.593   0.024   1.00 14.41 ? 168 PHE A CD2   1 
ATOM   1264 C  CE1   . PHE A 1 159 ? 14.134  6.217   -0.595  1.00 15.92 ? 168 PHE A CE1   1 
ATOM   1265 C  CE2   . PHE A 1 159 ? 16.110  5.817   0.701   1.00 15.99 ? 168 PHE A CE2   1 
ATOM   1266 C  CZ    . PHE A 1 159 ? 15.019  6.609   0.398   1.00 17.11 ? 168 PHE A CZ    1 
ATOM   1267 N  N     . HIS A 1 160 ? 15.651  -0.220  -2.297  1.00 16.05 ? 169 HIS A N     1 
ATOM   1268 C  CA    . HIS A 1 160 ? 15.561  -1.416  -3.135  1.00 15.91 ? 169 HIS A CA    1 
ATOM   1269 C  C     . HIS A 1 160 ? 14.390  -2.306  -2.734  1.00 16.25 ? 169 HIS A C     1 
ATOM   1270 O  O     . HIS A 1 160 ? 13.650  -2.787  -3.590  1.00 16.59 ? 169 HIS A O     1 
ATOM   1271 C  CB    . HIS A 1 160 ? 16.841  -2.232  -3.031  1.00 15.85 ? 169 HIS A CB    1 
ATOM   1272 C  CG    . HIS A 1 160 ? 18.007  -1.643  -3.762  1.00 17.20 ? 169 HIS A CG    1 
ATOM   1273 N  ND1   . HIS A 1 160 ? 19.121  -2.385  -4.088  1.00 19.24 ? 169 HIS A ND1   1 
ATOM   1274 C  CD2   . HIS A 1 160 ? 18.240  -0.392  -4.222  1.00 17.57 ? 169 HIS A CD2   1 
ATOM   1275 C  CE1   . HIS A 1 160 ? 19.989  -1.619  -4.727  1.00 19.83 ? 169 HIS A CE1   1 
ATOM   1276 N  NE2   . HIS A 1 160 ? 19.480  -0.404  -4.820  1.00 18.73 ? 169 HIS A NE2   1 
ATOM   1277 N  N     . GLU A 1 161 ? 14.223  -2.536  -1.430  1.00 15.87 ? 170 GLU A N     1 
ATOM   1278 C  CA    . GLU A 1 161 ? 13.155  -3.421  -0.965  1.00 16.46 ? 170 GLU A CA    1 
ATOM   1279 C  C     . GLU A 1 161 ? 11.786  -2.821  -1.236  1.00 16.36 ? 170 GLU A C     1 
ATOM   1280 O  O     . GLU A 1 161 ? 10.879  -3.533  -1.581  1.00 16.37 ? 170 GLU A O     1 
ATOM   1281 C  CB    . GLU A 1 161 ? 13.307  -3.752  0.514   1.00 16.95 ? 170 GLU A CB    1 
ATOM   1282 C  CG    . GLU A 1 161 ? 12.405  -4.891  0.991   1.00 19.19 ? 170 GLU A CG    1 
ATOM   1283 C  CD    . GLU A 1 161 ? 12.747  -6.217  0.388   1.00 23.48 ? 170 GLU A CD    1 
ATOM   1284 O  OE1   . GLU A 1 161 ? 13.888  -6.420  -0.108  1.00 22.70 ? 170 GLU A OE1   1 
ATOM   1285 O  OE2   . GLU A 1 161 ? 11.854  -7.084  0.434   1.00 27.51 ? 170 GLU A OE2   1 
ATOM   1286 N  N     . LEU A 1 162 ? 11.637  -1.507  -1.116  1.00 15.03 ? 171 LEU A N     1 
ATOM   1287 C  CA    . LEU A 1 162 ? 10.376  -0.882  -1.473  1.00 15.31 ? 171 LEU A CA    1 
ATOM   1288 C  C     . LEU A 1 162 ? 10.033  -1.126  -2.935  1.00 14.65 ? 171 LEU A C     1 
ATOM   1289 O  O     . LEU A 1 162 ? 8.894   -1.435  -3.279  1.00 14.41 ? 171 LEU A O     1 
ATOM   1290 C  CB    . LEU A 1 162 ? 10.398  0.613   -1.169  1.00 14.52 ? 171 LEU A CB    1 
ATOM   1291 C  CG    . LEU A 1 162 ? 9.092   1.357   -1.450  1.00 15.94 ? 171 LEU A CG    1 
ATOM   1292 C  CD1   . LEU A 1 162 ? 7.883   0.684   -0.800  1.00 15.39 ? 171 LEU A CD1   1 
ATOM   1293 C  CD2   . LEU A 1 162 ? 9.229   2.801   -1.027  1.00 16.09 ? 171 LEU A CD2   1 
ATOM   1294 N  N     . VAL A 1 163 ? 11.020  -1.016  -3.811  1.00 14.39 ? 172 VAL A N     1 
ATOM   1295 C  CA    . VAL A 1 163 ? 10.794  -1.340  -5.214  1.00 14.16 ? 172 VAL A CA    1 
ATOM   1296 C  C     . VAL A 1 163 ? 10.405  -2.804  -5.380  1.00 14.22 ? 172 VAL A C     1 
ATOM   1297 O  O     . VAL A 1 163 ? 9.528   -3.127  -6.193  1.00 14.54 ? 172 VAL A O     1 
ATOM   1298 C  CB    . VAL A 1 163 ? 12.021  -1.000  -6.070  1.00 14.89 ? 172 VAL A CB    1 
ATOM   1299 C  CG1   . VAL A 1 163 ? 11.929  -1.604  -7.469  1.00 12.77 ? 172 VAL A CG1   1 
ATOM   1300 C  CG2   . VAL A 1 163 ? 12.184  0.496   -6.143  1.00 14.97 ? 172 VAL A CG2   1 
ATOM   1301 N  N     . ARG A 1 164 ? 11.047  -3.687  -4.635  1.00 14.85 ? 173 ARG A N     1 
ATOM   1302 C  CA    . ARG A 1 164 ? 10.672  -5.101  -4.711  1.00 15.07 ? 173 ARG A CA    1 
ATOM   1303 C  C     . ARG A 1 164 ? 9.206   -5.285  -4.345  1.00 15.43 ? 173 ARG A C     1 
ATOM   1304 O  O     . ARG A 1 164 ? 8.500   -6.071  -4.979  1.00 15.83 ? 173 ARG A O     1 
ATOM   1305 C  CB    . ARG A 1 164 ? 11.528  -5.968  -3.802  1.00 15.44 ? 173 ARG A CB    1 
ATOM   1306 C  CG    . ARG A 1 164 ? 12.920  -6.078  -4.277  1.00 16.32 ? 173 ARG A CG    1 
ATOM   1307 C  CD    . ARG A 1 164 ? 13.660  -7.175  -3.569  1.00 17.55 ? 173 ARG A CD    1 
ATOM   1308 N  NE    . ARG A 1 164 ? 15.030  -7.151  -4.034  1.00 16.77 ? 173 ARG A NE    1 
ATOM   1309 C  CZ    . ARG A 1 164 ? 16.009  -6.435  -3.487  1.00 17.45 ? 173 ARG A CZ    1 
ATOM   1310 N  NH1   . ARG A 1 164 ? 15.832  -5.740  -2.373  1.00 17.77 ? 173 ARG A NH1   1 
ATOM   1311 N  NH2   . ARG A 1 164 ? 17.203  -6.481  -4.040  1.00 18.85 ? 173 ARG A NH2   1 
ATOM   1312 N  N     . VAL A 1 165 ? 8.762   -4.554  -3.329  1.00 16.69 ? 174 VAL A N     1 
ATOM   1313 C  CA    . VAL A 1 165 ? 7.381   -4.656  -2.861  1.00 16.28 ? 174 VAL A CA    1 
ATOM   1314 C  C     . VAL A 1 165 ? 6.425   -4.166  -3.933  1.00 16.01 ? 174 VAL A C     1 
ATOM   1315 O  O     . VAL A 1 165 ? 5.435   -4.828  -4.245  1.00 16.26 ? 174 VAL A O     1 
ATOM   1316 C  CB    . VAL A 1 165 ? 7.173   -3.882  -1.535  1.00 16.61 ? 174 VAL A CB    1 
ATOM   1317 C  CG1   . VAL A 1 165 ? 5.684   -3.764  -1.204  1.00 17.00 ? 174 VAL A CG1   1 
ATOM   1318 C  CG2   . VAL A 1 165 ? 7.901   -4.606  -0.413  1.00 17.52 ? 174 VAL A CG2   1 
ATOM   1319 N  N     . ILE A 1 166 ? 6.734   -3.016  -4.530  1.00 15.80 ? 175 ILE A N     1 
ATOM   1320 C  CA    . ILE A 1 166 ? 5.912   -2.512  -5.625  1.00 16.11 ? 175 ILE A CA    1 
ATOM   1321 C  C     . ILE A 1 166 ? 5.804   -3.526  -6.753  1.00 15.64 ? 175 ILE A C     1 
ATOM   1322 O  O     . ILE A 1 166 ? 4.724   -3.775  -7.262  1.00 16.38 ? 175 ILE A O     1 
ATOM   1323 C  CB    . ILE A 1 166 ? 6.469   -1.181  -6.172  1.00 15.91 ? 175 ILE A CB    1 
ATOM   1324 C  CG1   . ILE A 1 166 ? 6.411   -0.122  -5.079  1.00 16.48 ? 175 ILE A CG1   1 
ATOM   1325 C  CG2   . ILE A 1 166 ? 5.671   -0.728  -7.396  1.00 16.92 ? 175 ILE A CG2   1 
ATOM   1326 C  CD1   . ILE A 1 166 ? 7.145   1.172   -5.394  1.00 16.66 ? 175 ILE A CD1   1 
ATOM   1327 N  N     . ARG A 1 167 ? 6.933   -4.103  -7.145  1.00 15.71 ? 176 ARG A N     1 
ATOM   1328 C  CA    . ARG A 1 167 ? 6.953   -5.098  -8.203  1.00 16.08 ? 176 ARG A CA    1 
ATOM   1329 C  C     . ARG A 1 167 ? 6.122   -6.327  -7.838  1.00 16.74 ? 176 ARG A C     1 
ATOM   1330 O  O     . ARG A 1 167 ? 5.398   -6.838  -8.681  1.00 17.24 ? 176 ARG A O     1 
ATOM   1331 C  CB    . ARG A 1 167 ? 8.390   -5.500  -8.529  1.00 15.93 ? 176 ARG A CB    1 
ATOM   1332 C  CG    . ARG A 1 167 ? 9.186   -4.423  -9.238  1.00 15.14 ? 176 ARG A CG    1 
ATOM   1333 C  CD    . ARG A 1 167 ? 10.644  -4.828  -9.322  1.00 15.36 ? 176 ARG A CD    1 
ATOM   1334 N  NE    . ARG A 1 167 ? 11.424  -3.948  -10.180 1.00 15.47 ? 176 ARG A NE    1 
ATOM   1335 C  CZ    . ARG A 1 167 ? 12.750  -3.984  -10.285 1.00 15.21 ? 176 ARG A CZ    1 
ATOM   1336 N  NH1   . ARG A 1 167 ? 13.447  -4.861  -9.596  1.00 15.79 ? 176 ARG A NH1   1 
ATOM   1337 N  NH2   . ARG A 1 167 ? 13.378  -3.143  -11.099 1.00 14.29 ? 176 ARG A NH2   1 
ATOM   1338 N  N     . LYS A 1 168 ? 6.213   -6.793  -6.593  1.00 17.68 ? 177 LYS A N     1 
ATOM   1339 C  CA    . LYS A 1 168 ? 5.444   -7.976  -6.175  1.00 19.05 ? 177 LYS A CA    1 
ATOM   1340 C  C     . LYS A 1 168 ? 3.939   -7.693  -6.213  1.00 19.44 ? 177 LYS A C     1 
ATOM   1341 O  O     . LYS A 1 168 ? 3.150   -8.563  -6.575  1.00 19.29 ? 177 LYS A O     1 
ATOM   1342 C  CB    . LYS A 1 168 ? 5.861   -8.438  -4.782  1.00 19.41 ? 177 LYS A CB    1 
ATOM   1343 C  CG    . LYS A 1 168 ? 5.111   -9.659  -4.246  1.00 21.89 ? 177 LYS A CG    1 
ATOM   1344 C  CD    . LYS A 1 168 ? 5.445   -10.922 -5.010  1.00 24.32 ? 177 LYS A CD    1 
ATOM   1345 C  CE    . LYS A 1 168 ? 4.690   -12.123 -4.457  1.00 25.82 ? 177 LYS A CE    1 
ATOM   1346 N  NZ    . LYS A 1 168 ? 3.234   -12.045 -4.751  1.00 27.48 ? 177 LYS A NZ    1 
ATOM   1347 N  N     . PHE A 1 169 ? 3.538   -6.478  -5.843  1.00 20.02 ? 178 PHE A N     1 
ATOM   1348 C  CA    . PHE A 1 169 ? 2.128   -6.079  -5.948  1.00 21.29 ? 178 PHE A CA    1 
ATOM   1349 C  C     . PHE A 1 169 ? 1.645   -6.084  -7.405  1.00 22.92 ? 178 PHE A C     1 
ATOM   1350 O  O     . PHE A 1 169 ? 0.451   -6.273  -7.664  1.00 23.00 ? 178 PHE A O     1 
ATOM   1351 C  CB    . PHE A 1 169 ? 1.900   -4.691  -5.352  1.00 20.51 ? 178 PHE A CB    1 
ATOM   1352 C  CG    . PHE A 1 169 ? 1.582   -4.687  -3.879  1.00 20.04 ? 178 PHE A CG    1 
ATOM   1353 C  CD1   . PHE A 1 169 ? 2.558   -4.943  -2.924  1.00 19.19 ? 178 PHE A CD1   1 
ATOM   1354 C  CD2   . PHE A 1 169 ? 0.309   -4.368  -3.446  1.00 20.14 ? 178 PHE A CD2   1 
ATOM   1355 C  CE1   . PHE A 1 169 ? 2.251   -4.906  -1.553  1.00 19.15 ? 178 PHE A CE1   1 
ATOM   1356 C  CE2   . PHE A 1 169 ? -0.007  -4.341  -2.095  1.00 19.79 ? 178 PHE A CE2   1 
ATOM   1357 C  CZ    . PHE A 1 169 ? 0.962   -4.604  -1.145  1.00 19.85 ? 178 PHE A CZ    1 
ATOM   1358 N  N     . GLN A 1 170 ? 2.563   -5.857  -8.343  1.00 24.90 ? 179 GLN A N     1 
ATOM   1359 C  CA    . GLN A 1 170 ? 2.224   -5.807  -9.770  1.00 26.90 ? 179 GLN A CA    1 
ATOM   1360 C  C     . GLN A 1 170 ? 2.398   -7.142  -10.498 1.00 27.82 ? 179 GLN A C     1 
ATOM   1361 O  O     . GLN A 1 170 ? 2.110   -7.231  -11.692 1.00 28.64 ? 179 GLN A O     1 
ATOM   1362 C  CB    . GLN A 1 170 ? 3.042   -4.709  -10.459 1.00 27.12 ? 179 GLN A CB    1 
ATOM   1363 C  CG    . GLN A 1 170 ? 2.646   -3.324  -9.990  1.00 28.39 ? 179 GLN A CG    1 
ATOM   1364 C  CD    . GLN A 1 170 ? 3.613   -2.239  -10.413 1.00 28.97 ? 179 GLN A CD    1 
ATOM   1365 O  OE1   . GLN A 1 170 ? 4.699   -2.503  -10.955 1.00 33.98 ? 179 GLN A OE1   1 
ATOM   1366 N  NE2   . GLN A 1 170 ? 3.226   -0.996  -10.155 1.00 31.97 ? 179 GLN A NE2   1 
ATOM   1367 N  N     . GLU A 1 171 ? 2.830   -8.182  -9.784  1.00 28.97 ? 180 GLU A N     1 
ATOM   1368 C  CA    . GLU A 1 171 ? 3.025   -9.510  -10.380 1.00 29.66 ? 180 GLU A CA    1 
ATOM   1369 C  C     . GLU A 1 171 ? 1.745   -10.052 -11.010 1.00 30.02 ? 180 GLU A C     1 
ATOM   1370 O  O     . GLU A 1 171 ? 0.783   -10.386 -10.313 1.00 30.99 ? 180 GLU A O     1 
ATOM   1371 C  CB    . GLU A 1 171 ? 3.534   -10.504 -9.332  1.00 29.86 ? 180 GLU A CB    1 
ATOM   1372 N  N     . GLU B 1 4   ? -19.880 -4.125  13.407  1.00 34.87 ? 13  GLU B N     1 
ATOM   1373 C  CA    . GLU B 1 4   ? -20.521 -3.617  12.157  1.00 34.68 ? 13  GLU B CA    1 
ATOM   1374 C  C     . GLU B 1 4   ? -20.148 -4.509  10.975  1.00 33.55 ? 13  GLU B C     1 
ATOM   1375 O  O     . GLU B 1 4   ? -18.973 -4.622  10.614  1.00 32.94 ? 13  GLU B O     1 
ATOM   1376 C  CB    . GLU B 1 4   ? -20.089 -2.184  11.905  1.00 35.43 ? 13  GLU B CB    1 
ATOM   1377 C  CG    . GLU B 1 4   ? -20.716 -1.520  10.715  1.00 37.70 ? 13  GLU B CG    1 
ATOM   1378 C  CD    . GLU B 1 4   ? -20.128 -0.154  10.499  1.00 41.68 ? 13  GLU B CD    1 
ATOM   1379 O  OE1   . GLU B 1 4   ? -19.313 0.008   9.558   1.00 42.45 ? 13  GLU B OE1   1 
ATOM   1380 O  OE2   . GLU B 1 4   ? -20.447 0.747   11.304  1.00 42.82 ? 13  GLU B OE2   1 
ATOM   1381 N  N     . LYS B 1 5   ? -21.165 -5.128  10.382  1.00 31.51 ? 14  LYS B N     1 
ATOM   1382 C  CA    . LYS B 1 5   ? -20.976 -6.213  9.439   1.00 30.85 ? 14  LYS B CA    1 
ATOM   1383 C  C     . LYS B 1 5   ? -21.924 -6.013  8.268   1.00 29.77 ? 14  LYS B C     1 
ATOM   1384 O  O     . LYS B 1 5   ? -23.036 -5.537  8.460   1.00 29.46 ? 14  LYS B O     1 
ATOM   1385 C  CB    . LYS B 1 5   ? -21.264 -7.541  10.133  1.00 31.16 ? 14  LYS B CB    1 
ATOM   1386 C  CG    . LYS B 1 5   ? -21.080 -8.759  9.259   1.00 32.86 ? 14  LYS B CG    1 
ATOM   1387 N  N     . TYR B 1 6   ? -21.475 -6.372  7.070   1.00 28.85 ? 15  TYR B N     1 
ATOM   1388 C  CA    . TYR B 1 6   ? -22.279 -6.209  5.853   1.00 28.26 ? 15  TYR B CA    1 
ATOM   1389 C  C     . TYR B 1 6   ? -22.263 -7.474  5.039   1.00 27.54 ? 15  TYR B C     1 
ATOM   1390 O  O     . TYR B 1 6   ? -21.181 -7.995  4.709   1.00 26.72 ? 15  TYR B O     1 
ATOM   1391 C  CB    . TYR B 1 6   ? -21.741 -5.077  4.992   1.00 29.39 ? 15  TYR B CB    1 
ATOM   1392 C  CG    . TYR B 1 6   ? -21.731 -3.744  5.695   1.00 29.98 ? 15  TYR B CG    1 
ATOM   1393 C  CD1   . TYR B 1 6   ? -22.831 -2.907  5.657   1.00 33.09 ? 15  TYR B CD1   1 
ATOM   1394 C  CD2   . TYR B 1 6   ? -20.623 -3.334  6.422   1.00 32.70 ? 15  TYR B CD2   1 
ATOM   1395 C  CE1   . TYR B 1 6   ? -22.820 -1.682  6.309   1.00 33.58 ? 15  TYR B CE1   1 
ATOM   1396 C  CE2   . TYR B 1 6   ? -20.604 -2.128  7.074   1.00 32.30 ? 15  TYR B CE2   1 
ATOM   1397 C  CZ    . TYR B 1 6   ? -21.701 -1.303  7.015   1.00 32.87 ? 15  TYR B CZ    1 
ATOM   1398 O  OH    . TYR B 1 6   ? -21.658 -0.102  7.685   1.00 33.47 ? 15  TYR B OH    1 
ATOM   1399 N  N     . ARG B 1 7   ? -23.454 -7.958  4.689   1.00 25.93 ? 16  ARG B N     1 
ATOM   1400 C  CA    . ARG B 1 7   ? -23.564 -9.150  3.862   1.00 25.84 ? 16  ARG B CA    1 
ATOM   1401 C  C     . ARG B 1 7   ? -23.637 -8.734  2.388   1.00 24.81 ? 16  ARG B C     1 
ATOM   1402 O  O     . ARG B 1 7   ? -24.692 -8.326  1.902   1.00 24.43 ? 16  ARG B O     1 
ATOM   1403 C  CB    . ARG B 1 7   ? -24.790 -9.979  4.259   1.00 26.43 ? 16  ARG B CB    1 
ATOM   1404 C  CG    . ARG B 1 7   ? -24.604 -11.476 4.067   1.00 29.62 ? 16  ARG B CG    1 
ATOM   1405 C  CD    . ARG B 1 7   ? -24.534 -11.922 2.594   1.00 33.01 ? 16  ARG B CD    1 
ATOM   1406 N  NE    . ARG B 1 7   ? -24.345 -13.371 2.474   1.00 34.77 ? 16  ARG B NE    1 
ATOM   1407 C  CZ    . ARG B 1 7   ? -23.193 -14.007 2.697   1.00 36.18 ? 16  ARG B CZ    1 
ATOM   1408 N  NH1   . ARG B 1 7   ? -22.104 -13.330 3.018   1.00 37.19 ? 16  ARG B NH1   1 
ATOM   1409 N  NH2   . ARG B 1 7   ? -23.118 -15.335 2.573   1.00 35.56 ? 16  ARG B NH2   1 
ATOM   1410 N  N     . LEU B 1 8   ? -22.508 -8.817  1.688   1.00 23.95 ? 17  LEU B N     1 
ATOM   1411 C  CA    . LEU B 1 8   ? -22.441 -8.439  0.285   1.00 23.20 ? 17  LEU B CA    1 
ATOM   1412 C  C     . LEU B 1 8   ? -22.558 -9.632  -0.633  1.00 22.96 ? 17  LEU B C     1 
ATOM   1413 O  O     . LEU B 1 8   ? -22.063 -10.745 -0.335  1.00 23.79 ? 17  LEU B O     1 
ATOM   1414 C  CB    . LEU B 1 8   ? -21.147 -7.680  -0.014  1.00 23.04 ? 17  LEU B CB    1 
ATOM   1415 C  CG    . LEU B 1 8   ? -20.791 -6.548  0.954   1.00 23.84 ? 17  LEU B CG    1 
ATOM   1416 C  CD1   . LEU B 1 8   ? -19.493 -5.918  0.519   1.00 23.27 ? 17  LEU B CD1   1 
ATOM   1417 C  CD2   . LEU B 1 8   ? -21.881 -5.493  1.050   1.00 24.50 ? 17  LEU B CD2   1 
ATOM   1418 N  N     . VAL B 1 9   ? -23.221 -9.409  -1.760  1.00 21.21 ? 18  VAL B N     1 
ATOM   1419 C  CA    . VAL B 1 9   ? -23.490 -10.461 -2.713  1.00 21.00 ? 18  VAL B CA    1 
ATOM   1420 C  C     . VAL B 1 9   ? -23.023 -10.047 -4.100  1.00 21.01 ? 18  VAL B C     1 
ATOM   1421 O  O     . VAL B 1 9   ? -23.415 -8.992  -4.600  1.00 19.76 ? 18  VAL B O     1 
ATOM   1422 C  CB    . VAL B 1 9   ? -25.001 -10.797 -2.739  1.00 20.81 ? 18  VAL B CB    1 
ATOM   1423 C  CG1   . VAL B 1 9   ? -25.258 -12.046 -3.601  1.00 21.22 ? 18  VAL B CG1   1 
ATOM   1424 C  CG2   . VAL B 1 9   ? -25.512 -11.010 -1.328  1.00 21.24 ? 18  VAL B CG2   1 
ATOM   1425 N  N     . VAL B 1 10  ? -22.202 -10.889 -4.722  1.00 20.56 ? 19  VAL B N     1 
ATOM   1426 C  CA    . VAL B 1 10  ? -21.687 -10.639 -6.061  1.00 21.08 ? 19  VAL B CA    1 
ATOM   1427 C  C     . VAL B 1 10  ? -22.513 -11.451 -7.042  1.00 21.57 ? 19  VAL B C     1 
ATOM   1428 O  O     . VAL B 1 10  ? -22.521 -12.684 -6.970  1.00 22.16 ? 19  VAL B O     1 
ATOM   1429 C  CB    . VAL B 1 10  ? -20.191 -11.077 -6.168  1.00 20.81 ? 19  VAL B CB    1 
ATOM   1430 C  CG1   . VAL B 1 10  ? -19.600 -10.734 -7.514  1.00 21.89 ? 19  VAL B CG1   1 
ATOM   1431 C  CG2   . VAL B 1 10  ? -19.360 -10.488 -5.022  1.00 20.27 ? 19  VAL B CG2   1 
ATOM   1432 N  N     . VAL B 1 11  ? -23.209 -10.776 -7.953  1.00 22.28 ? 20  VAL B N     1 
ATOM   1433 C  CA    . VAL B 1 11  ? -24.052 -11.444 -8.943  1.00 22.68 ? 20  VAL B CA    1 
ATOM   1434 C  C     . VAL B 1 11  ? -23.671 -11.008 -10.363 1.00 23.20 ? 20  VAL B C     1 
ATOM   1435 O  O     . VAL B 1 11  ? -22.963 -10.015 -10.554 1.00 23.21 ? 20  VAL B O     1 
ATOM   1436 C  CB    . VAL B 1 11  ? -25.566 -11.216 -8.675  1.00 23.10 ? 20  VAL B CB    1 
ATOM   1437 C  CG1   . VAL B 1 11  ? -25.944 -11.722 -7.279  1.00 22.98 ? 20  VAL B CG1   1 
ATOM   1438 C  CG2   . VAL B 1 11  ? -25.955 -9.733  -8.840  1.00 23.06 ? 20  VAL B CG2   1 
ATOM   1439 N  N     . GLY B 1 12  ? -24.129 -11.771 -11.348 1.00 23.31 ? 21  GLY B N     1 
ATOM   1440 C  CA    . GLY B 1 12  ? -23.812 -11.491 -12.736 1.00 23.60 ? 21  GLY B CA    1 
ATOM   1441 C  C     . GLY B 1 12  ? -23.800 -12.751 -13.553 1.00 24.62 ? 21  GLY B C     1 
ATOM   1442 O  O     . GLY B 1 12  ? -23.834 -13.850 -13.001 1.00 23.91 ? 21  GLY B O     1 
ATOM   1443 N  N     . GLY B 1 13  ? -23.738 -12.579 -14.868 1.00 25.61 ? 22  GLY B N     1 
ATOM   1444 C  CA    . GLY B 1 13  ? -23.778 -13.704 -15.794 1.00 26.39 ? 22  GLY B CA    1 
ATOM   1445 C  C     . GLY B 1 13  ? -22.530 -14.552 -15.698 1.00 26.82 ? 22  GLY B C     1 
ATOM   1446 O  O     . GLY B 1 13  ? -21.550 -14.174 -15.063 1.00 26.54 ? 22  GLY B O     1 
ATOM   1447 N  N     . GLY B 1 14  ? -22.559 -15.711 -16.342 1.00 27.57 ? 23  GLY B N     1 
ATOM   1448 C  CA    . GLY B 1 14  ? -21.430 -16.628 -16.271 1.00 27.39 ? 23  GLY B CA    1 
ATOM   1449 C  C     . GLY B 1 14  ? -20.179 -16.015 -16.864 1.00 27.09 ? 23  GLY B C     1 
ATOM   1450 O  O     . GLY B 1 14  ? -20.235 -15.309 -17.870 1.00 27.55 ? 23  GLY B O     1 
ATOM   1451 N  N     . GLY B 1 15  ? -19.044 -16.275 -16.223 1.00 26.33 ? 24  GLY B N     1 
ATOM   1452 C  CA    . GLY B 1 15  ? -17.752 -15.892 -16.766 1.00 25.19 ? 24  GLY B CA    1 
ATOM   1453 C  C     . GLY B 1 15  ? -17.397 -14.408 -16.743 1.00 23.89 ? 24  GLY B C     1 
ATOM   1454 O  O     . GLY B 1 15  ? -16.405 -14.009 -17.359 1.00 24.77 ? 24  GLY B O     1 
ATOM   1455 N  N     . VAL B 1 16  ? -18.179 -13.583 -16.050 1.00 21.21 ? 25  VAL B N     1 
ATOM   1456 C  CA    . VAL B 1 16  ? -17.913 -12.134 -16.024 1.00 19.46 ? 25  VAL B CA    1 
ATOM   1457 C  C     . VAL B 1 16  ? -16.777 -11.749 -15.074 1.00 18.59 ? 25  VAL B C     1 
ATOM   1458 O  O     . VAL B 1 16  ? -16.222 -10.655 -15.175 1.00 17.36 ? 25  VAL B O     1 
ATOM   1459 C  CB    . VAL B 1 16  ? -19.159 -11.285 -15.649 1.00 19.23 ? 25  VAL B CB    1 
ATOM   1460 C  CG1   . VAL B 1 16  ? -20.282 -11.506 -16.656 1.00 18.68 ? 25  VAL B CG1   1 
ATOM   1461 C  CG2   . VAL B 1 16  ? -19.630 -11.560 -14.213 1.00 19.26 ? 25  VAL B CG2   1 
ATOM   1462 N  N     . GLY B 1 17  ? -16.453 -12.641 -14.143 1.00 17.53 ? 26  GLY B N     1 
ATOM   1463 C  CA    . GLY B 1 17  ? -15.410 -12.378 -13.163 1.00 17.07 ? 26  GLY B CA    1 
ATOM   1464 C  C     . GLY B 1 17  ? -15.854 -12.264 -11.714 1.00 16.93 ? 26  GLY B C     1 
ATOM   1465 O  O     . GLY B 1 17  ? -15.148 -11.674 -10.906 1.00 17.35 ? 26  GLY B O     1 
ATOM   1466 N  N     . LYS B 1 18  ? -17.011 -12.827 -11.380 1.00 15.99 ? 27  LYS B N     1 
ATOM   1467 C  CA    . LYS B 1 18  ? -17.490 -12.824 -9.996  1.00 15.98 ? 27  LYS B CA    1 
ATOM   1468 C  C     . LYS B 1 18  ? -16.459 -13.474 -9.081  1.00 15.90 ? 27  LYS B C     1 
ATOM   1469 O  O     . LYS B 1 18  ? -15.979 -12.871 -8.121  1.00 15.83 ? 27  LYS B O     1 
ATOM   1470 C  CB    . LYS B 1 18  ? -18.823 -13.557 -9.878  1.00 16.18 ? 27  LYS B CB    1 
ATOM   1471 C  CG    . LYS B 1 18  ? -19.934 -12.971 -10.713 1.00 16.79 ? 27  LYS B CG    1 
ATOM   1472 C  CD    . LYS B 1 18  ? -21.246 -13.677 -10.493 1.00 16.65 ? 27  LYS B CD    1 
ATOM   1473 C  CE    . LYS B 1 18  ? -21.247 -15.093 -11.045 1.00 15.69 ? 27  LYS B CE    1 
ATOM   1474 N  NZ    . LYS B 1 18  ? -21.034 -15.126 -12.531 1.00 17.46 ? 27  LYS B NZ    1 
ATOM   1475 N  N     . SER B 1 19  ? -16.090 -14.706 -9.391  1.00 15.34 ? 28  SER B N     1 
ATOM   1476 C  CA    . SER B 1 19  ? -15.138 -15.397 -8.554  1.00 15.43 ? 28  SER B CA    1 
ATOM   1477 C  C     . SER B 1 19  ? -13.754 -14.747 -8.577  1.00 15.14 ? 28  SER B C     1 
ATOM   1478 O  O     . SER B 1 19  ? -13.114 -14.612 -7.526  1.00 15.14 ? 28  SER B O     1 
ATOM   1479 C  CB    . SER B 1 19  ? -15.035 -16.866 -8.968  1.00 15.08 ? 28  SER B CB    1 
ATOM   1480 O  OG    . SER B 1 19  ? -16.291 -17.529 -8.857  1.00 17.39 ? 28  SER B OG    1 
ATOM   1481 N  N     . ALA B 1 20  ? -13.280 -14.356 -9.759  1.00 15.10 ? 29  ALA B N     1 
ATOM   1482 C  CA    . ALA B 1 20  ? -11.964 -13.701 -9.861  1.00 15.57 ? 29  ALA B CA    1 
ATOM   1483 C  C     . ALA B 1 20  ? -11.913 -12.401 -9.057  1.00 15.75 ? 29  ALA B C     1 
ATOM   1484 O  O     . ALA B 1 20  ? -10.919 -12.127 -8.386  1.00 15.41 ? 29  ALA B O     1 
ATOM   1485 C  CB    . ALA B 1 20  ? -11.582 -13.444 -11.317 1.00 15.11 ? 29  ALA B CB    1 
ATOM   1486 N  N     . LEU B 1 21  ? -12.974 -11.598 -9.119  1.00 16.04 ? 30  LEU B N     1 
ATOM   1487 C  CA    . LEU B 1 21  ? -13.030 -10.366 -8.314  1.00 16.21 ? 30  LEU B CA    1 
ATOM   1488 C  C     . LEU B 1 21  ? -13.034 -10.650 -6.809  1.00 16.27 ? 30  LEU B C     1 
ATOM   1489 O  O     . LEU B 1 21  ? -12.289 -10.028 -6.063  1.00 16.45 ? 30  LEU B O     1 
ATOM   1490 C  CB    . LEU B 1 21  ? -14.244 -9.508  -8.676  1.00 16.04 ? 30  LEU B CB    1 
ATOM   1491 C  CG    . LEU B 1 21  ? -14.194 -8.776  -10.020 1.00 17.06 ? 30  LEU B CG    1 
ATOM   1492 C  CD1   . LEU B 1 21  ? -15.575 -8.197  -10.315 1.00 15.89 ? 30  LEU B CD1   1 
ATOM   1493 C  CD2   . LEU B 1 21  ? -13.168 -7.669  -10.012 1.00 15.67 ? 30  LEU B CD2   1 
ATOM   1494 N  N     . THR B 1 22  ? -13.861 -11.604 -6.382  1.00 16.50 ? 31  THR B N     1 
ATOM   1495 C  CA    . THR B 1 22  ? -13.981 -11.974 -4.977  1.00 16.28 ? 31  THR B CA    1 
ATOM   1496 C  C     . THR B 1 22  ? -12.648 -12.517 -4.436  1.00 16.54 ? 31  THR B C     1 
ATOM   1497 O  O     . THR B 1 22  ? -12.181 -12.095 -3.380  1.00 17.15 ? 31  THR B O     1 
ATOM   1498 C  CB    . THR B 1 22  ? -15.064 -13.067 -4.780  1.00 16.13 ? 31  THR B CB    1 
ATOM   1499 O  OG1   . THR B 1 22  ? -16.308 -12.635 -5.350  1.00 16.24 ? 31  THR B OG1   1 
ATOM   1500 C  CG2   . THR B 1 22  ? -15.269 -13.356 -3.305  1.00 16.45 ? 31  THR B CG2   1 
ATOM   1501 N  N     . ILE B 1 23  ? -12.054 -13.463 -5.159  1.00 16.51 ? 32  ILE B N     1 
ATOM   1502 C  CA    . ILE B 1 23  ? -10.799 -14.082 -4.726  1.00 16.16 ? 32  ILE B CA    1 
ATOM   1503 C  C     . ILE B 1 23  ? -9.652  -13.045 -4.740  1.00 16.17 ? 32  ILE B C     1 
ATOM   1504 O  O     . ILE B 1 23  ? -8.800  -13.053 -3.855  1.00 16.03 ? 32  ILE B O     1 
ATOM   1505 C  CB    . ILE B 1 23  ? -10.462 -15.333 -5.563  1.00 16.30 ? 32  ILE B CB    1 
ATOM   1506 C  CG1   . ILE B 1 23  ? -11.502 -16.430 -5.283  1.00 16.18 ? 32  ILE B CG1   1 
ATOM   1507 C  CG2   . ILE B 1 23  ? -9.064  -15.833 -5.227  1.00 15.52 ? 32  ILE B CG2   1 
ATOM   1508 C  CD1   . ILE B 1 23  ? -11.555 -17.540 -6.332  1.00 16.79 ? 32  ILE B CD1   1 
ATOM   1509 N  N     . GLN B 1 24  ? -9.650  -12.124 -5.705  1.00 16.23 ? 33  GLN B N     1 
ATOM   1510 C  CA    . GLN B 1 24  ? -8.668  -11.044 -5.676  1.00 16.03 ? 33  GLN B CA    1 
ATOM   1511 C  C     . GLN B 1 24  ? -8.873  -10.208 -4.423  1.00 15.77 ? 33  GLN B C     1 
ATOM   1512 O  O     . GLN B 1 24  ? -7.914  -9.856  -3.733  1.00 15.92 ? 33  GLN B O     1 
ATOM   1513 C  CB    . GLN B 1 24  ? -8.735  -10.154 -6.924  1.00 16.00 ? 33  GLN B CB    1 
ATOM   1514 C  CG    . GLN B 1 24  ? -7.816  -10.588 -8.016  1.00 16.92 ? 33  GLN B CG    1 
ATOM   1515 C  CD    . GLN B 1 24  ? -6.360  -10.203 -7.771  1.00 15.79 ? 33  GLN B CD    1 
ATOM   1516 O  OE1   . GLN B 1 24  ? -5.928  -9.988  -6.633  1.00 17.16 ? 33  GLN B OE1   1 
ATOM   1517 N  NE2   . GLN B 1 24  ? -5.589  -10.128 -8.848  1.00 16.02 ? 33  GLN B NE2   1 
ATOM   1518 N  N     . PHE B 1 25  ? -10.124 -9.902  -4.117  1.00 15.42 ? 34  PHE B N     1 
ATOM   1519 C  CA    . PHE B 1 25  ? -10.424 -9.054  -2.983  1.00 15.33 ? 34  PHE B CA    1 
ATOM   1520 C  C     . PHE B 1 25  ? -9.960  -9.668  -1.664  1.00 15.62 ? 34  PHE B C     1 
ATOM   1521 O  O     . PHE B 1 25  ? -9.313  -9.007  -0.849  1.00 15.98 ? 34  PHE B O     1 
ATOM   1522 C  CB    . PHE B 1 25  ? -11.922 -8.783  -2.928  1.00 15.37 ? 34  PHE B CB    1 
ATOM   1523 C  CG    . PHE B 1 25  ? -12.329 -7.916  -1.781  1.00 14.77 ? 34  PHE B CG    1 
ATOM   1524 C  CD1   . PHE B 1 25  ? -11.799 -6.640  -1.641  1.00 15.75 ? 34  PHE B CD1   1 
ATOM   1525 C  CD2   . PHE B 1 25  ? -13.240 -8.362  -0.850  1.00 16.17 ? 34  PHE B CD2   1 
ATOM   1526 C  CE1   . PHE B 1 25  ? -12.168 -5.850  -0.593  1.00 16.98 ? 34  PHE B CE1   1 
ATOM   1527 C  CE2   . PHE B 1 25  ? -13.623 -7.572  0.207   1.00 16.62 ? 34  PHE B CE2   1 
ATOM   1528 C  CZ    . PHE B 1 25  ? -13.094 -6.311  0.333   1.00 15.92 ? 34  PHE B CZ    1 
ATOM   1529 N  N     . ILE B 1 26  ? -10.282 -10.945 -1.471  1.00 15.94 ? 35  ILE B N     1 
ATOM   1530 C  CA    . ILE B 1 26  ? -9.964  -11.654 -0.225  1.00 16.79 ? 35  ILE B CA    1 
ATOM   1531 C  C     . ILE B 1 26  ? -8.514  -12.165 -0.172  1.00 17.14 ? 35  ILE B C     1 
ATOM   1532 O  O     . ILE B 1 26  ? -7.847  -12.025 0.861   1.00 17.10 ? 35  ILE B O     1 
ATOM   1533 C  CB    . ILE B 1 26  ? -10.931 -12.842 -0.001  1.00 16.71 ? 35  ILE B CB    1 
ATOM   1534 C  CG1   . ILE B 1 26  ? -12.393 -12.372 -0.055  1.00 17.83 ? 35  ILE B CG1   1 
ATOM   1535 C  CG2   . ILE B 1 26  ? -10.635 -13.552 1.322   1.00 16.69 ? 35  ILE B CG2   1 
ATOM   1536 C  CD1   . ILE B 1 26  ? -12.789 -11.399 1.044   1.00 17.97 ? 35  ILE B CD1   1 
ATOM   1537 N  N     . GLN B 1 27  ? -8.037  -12.775 -1.260  1.00 17.69 ? 36  GLN B N     1 
ATOM   1538 C  CA    . GLN B 1 27  ? -6.757  -13.512 -1.237  1.00 18.10 ? 36  GLN B CA    1 
ATOM   1539 C  C     . GLN B 1 27  ? -5.625  -12.894 -2.069  1.00 18.12 ? 36  GLN B C     1 
ATOM   1540 O  O     . GLN B 1 27  ? -4.485  -13.338 -1.975  1.00 17.62 ? 36  GLN B O     1 
ATOM   1541 C  CB    . GLN B 1 27  ? -6.983  -14.976 -1.652  1.00 18.25 ? 36  GLN B CB    1 
ATOM   1542 C  CG    . GLN B 1 27  ? -8.060  -15.682 -0.813  1.00 19.22 ? 36  GLN B CG    1 
ATOM   1543 C  CD    . GLN B 1 27  ? -8.250  -17.145 -1.159  1.00 19.88 ? 36  GLN B CD    1 
ATOM   1544 O  OE1   . GLN B 1 27  ? -7.543  -17.694 -1.997  1.00 22.36 ? 36  GLN B OE1   1 
ATOM   1545 N  NE2   . GLN B 1 27  ? -9.209  -17.789 -0.498  1.00 22.33 ? 36  GLN B NE2   1 
ATOM   1546 N  N     . SER B 1 28  ? -5.933  -11.875 -2.869  1.00 18.23 ? 37  SER B N     1 
ATOM   1547 C  CA    . SER B 1 28  ? -4.921  -11.133 -3.637  1.00 18.83 ? 37  SER B CA    1 
ATOM   1548 C  C     . SER B 1 28  ? -4.124  -11.991 -4.625  1.00 18.80 ? 37  SER B C     1 
ATOM   1549 O  O     . SER B 1 28  ? -2.901  -11.834 -4.777  1.00 18.92 ? 37  SER B O     1 
ATOM   1550 C  CB    . SER B 1 28  ? -3.988  -10.362 -2.690  1.00 19.12 ? 37  SER B CB    1 
ATOM   1551 O  OG    . SER B 1 28  ? -4.652  -9.212  -2.177  1.00 20.25 ? 37  SER B OG    1 
ATOM   1552 N  N     . TYR B 1 29  ? -4.814  -12.918 -5.280  1.00 18.48 ? 38  TYR B N     1 
ATOM   1553 C  CA    . TYR B 1 29  ? -4.279  -13.557 -6.481  1.00 19.23 ? 38  TYR B CA    1 
ATOM   1554 C  C     . TYR B 1 29  ? -5.403  -13.735 -7.496  1.00 18.84 ? 38  TYR B C     1 
ATOM   1555 O  O     . TYR B 1 29  ? -6.590  -13.626 -7.164  1.00 18.60 ? 38  TYR B O     1 
ATOM   1556 C  CB    . TYR B 1 29  ? -3.551  -14.874 -6.174  1.00 20.21 ? 38  TYR B CB    1 
ATOM   1557 C  CG    . TYR B 1 29  ? -4.454  -16.064 -5.972  1.00 21.45 ? 38  TYR B CG    1 
ATOM   1558 C  CD1   . TYR B 1 29  ? -4.591  -17.042 -6.959  1.00 22.46 ? 38  TYR B CD1   1 
ATOM   1559 C  CD2   . TYR B 1 29  ? -5.170  -16.216 -4.793  1.00 22.31 ? 38  TYR B CD2   1 
ATOM   1560 C  CE1   . TYR B 1 29  ? -5.425  -18.138 -6.770  1.00 22.50 ? 38  TYR B CE1   1 
ATOM   1561 C  CE2   . TYR B 1 29  ? -6.008  -17.296 -4.600  1.00 22.56 ? 38  TYR B CE2   1 
ATOM   1562 C  CZ    . TYR B 1 29  ? -6.145  -18.249 -5.586  1.00 22.73 ? 38  TYR B CZ    1 
ATOM   1563 O  OH    . TYR B 1 29  ? -6.984  -19.323 -5.359  1.00 23.02 ? 38  TYR B OH    1 
ATOM   1564 N  N     . PHE B 1 30  ? -5.008  -13.970 -8.739  1.00 18.71 ? 39  PHE B N     1 
ATOM   1565 C  CA    . PHE B 1 30  ? -5.929  -14.047 -9.857  1.00 18.93 ? 39  PHE B CA    1 
ATOM   1566 C  C     . PHE B 1 30  ? -6.154  -15.510 -10.241 1.00 19.46 ? 39  PHE B C     1 
ATOM   1567 O  O     . PHE B 1 30  ? -5.199  -16.217 -10.575 1.00 19.21 ? 39  PHE B O     1 
ATOM   1568 C  CB    . PHE B 1 30  ? -5.353  -13.244 -11.028 1.00 18.39 ? 39  PHE B CB    1 
ATOM   1569 C  CG    . PHE B 1 30  ? -6.179  -13.305 -12.283 1.00 18.00 ? 39  PHE B CG    1 
ATOM   1570 C  CD1   . PHE B 1 30  ? -7.526  -12.981 -12.266 1.00 16.85 ? 39  PHE B CD1   1 
ATOM   1571 C  CD2   . PHE B 1 30  ? -5.594  -13.664 -13.494 1.00 17.08 ? 39  PHE B CD2   1 
ATOM   1572 C  CE1   . PHE B 1 30  ? -8.285  -13.034 -13.426 1.00 17.24 ? 39  PHE B CE1   1 
ATOM   1573 C  CE2   . PHE B 1 30  ? -6.348  -13.718 -14.656 1.00 17.72 ? 39  PHE B CE2   1 
ATOM   1574 C  CZ    . PHE B 1 30  ? -7.694  -13.395 -14.621 1.00 17.93 ? 39  PHE B CZ    1 
ATOM   1575 N  N     . VAL B 1 31  ? -7.406  -15.969 -10.160 1.00 20.23 ? 40  VAL B N     1 
ATOM   1576 C  CA    . VAL B 1 31  ? -7.751  -17.330 -10.608 1.00 21.06 ? 40  VAL B CA    1 
ATOM   1577 C  C     . VAL B 1 31  ? -8.169  -17.372 -12.079 1.00 21.48 ? 40  VAL B C     1 
ATOM   1578 O  O     . VAL B 1 31  ? -8.979  -16.563 -12.539 1.00 21.75 ? 40  VAL B O     1 
ATOM   1579 C  CB    . VAL B 1 31  ? -8.852  -18.005 -9.750  1.00 21.24 ? 40  VAL B CB    1 
ATOM   1580 C  CG1   . VAL B 1 31  ? -8.338  -18.270 -8.354  1.00 21.50 ? 40  VAL B CG1   1 
ATOM   1581 C  CG2   . VAL B 1 31  ? -10.142 -17.187 -9.720  1.00 21.44 ? 40  VAL B CG2   1 
ATOM   1582 N  N     . THR B 1 32  ? -7.616  -18.344 -12.801 1.00 21.76 ? 41  THR B N     1 
ATOM   1583 C  CA    . THR B 1 32  ? -7.868  -18.491 -14.230 1.00 22.09 ? 41  THR B CA    1 
ATOM   1584 C  C     . THR B 1 32  ? -8.933  -19.546 -14.541 1.00 22.13 ? 41  THR B C     1 
ATOM   1585 O  O     . THR B 1 32  ? -9.553  -19.499 -15.606 1.00 22.09 ? 41  THR B O     1 
ATOM   1586 C  CB    . THR B 1 32  ? -6.576  -18.883 -14.971 1.00 22.18 ? 41  THR B CB    1 
ATOM   1587 O  OG1   . THR B 1 32  ? -6.140  -20.174 -14.528 1.00 22.37 ? 41  THR B OG1   1 
ATOM   1588 C  CG2   . THR B 1 32  ? -5.478  -17.864 -14.713 1.00 22.72 ? 41  THR B CG2   1 
ATOM   1589 N  N     . ASP B 1 33  ? -9.132  -20.494 -13.625 1.00 22.16 ? 42  ASP B N     1 
ATOM   1590 C  CA    . ASP B 1 33  ? -10.023 -21.636 -13.873 1.00 22.10 ? 42  ASP B CA    1 
ATOM   1591 C  C     . ASP B 1 33  ? -10.767 -22.093 -12.614 1.00 21.72 ? 42  ASP B C     1 
ATOM   1592 O  O     . ASP B 1 33  ? -10.759 -23.272 -12.270 1.00 22.30 ? 42  ASP B O     1 
ATOM   1593 C  CB    . ASP B 1 33  ? -9.225  -22.801 -14.460 1.00 22.30 ? 42  ASP B CB    1 
ATOM   1594 N  N     . TYR B 1 34  ? -11.422 -21.159 -11.939 1.00 21.09 ? 43  TYR B N     1 
ATOM   1595 C  CA    . TYR B 1 34  ? -12.206 -21.474 -10.743 1.00 20.60 ? 43  TYR B CA    1 
ATOM   1596 C  C     . TYR B 1 34  ? -13.570 -22.020 -11.157 1.00 19.89 ? 43  TYR B C     1 
ATOM   1597 O  O     . TYR B 1 34  ? -14.294 -21.369 -11.918 1.00 20.32 ? 43  TYR B O     1 
ATOM   1598 C  CB    . TYR B 1 34  ? -12.364 -20.227 -9.878  1.00 20.99 ? 43  TYR B CB    1 
ATOM   1599 C  CG    . TYR B 1 34  ? -13.079 -20.456 -8.562  1.00 21.76 ? 43  TYR B CG    1 
ATOM   1600 C  CD1   . TYR B 1 34  ? -14.406 -20.089 -8.410  1.00 21.28 ? 43  TYR B CD1   1 
ATOM   1601 C  CD2   . TYR B 1 34  ? -12.434 -21.059 -7.472  1.00 22.84 ? 43  TYR B CD2   1 
ATOM   1602 C  CE1   . TYR B 1 34  ? -15.084 -20.282 -7.221  1.00 21.47 ? 43  TYR B CE1   1 
ATOM   1603 C  CE2   . TYR B 1 34  ? -13.111 -21.259 -6.261  1.00 22.76 ? 43  TYR B CE2   1 
ATOM   1604 C  CZ    . TYR B 1 34  ? -14.442 -20.852 -6.148  1.00 22.54 ? 43  TYR B CZ    1 
ATOM   1605 O  OH    . TYR B 1 34  ? -15.162 -21.017 -4.979  1.00 22.30 ? 43  TYR B OH    1 
ATOM   1606 N  N     . ASP B 1 35  ? -13.911 -23.207 -10.654 1.00 18.85 ? 44  ASP B N     1 
ATOM   1607 C  CA    . ASP B 1 35  ? -15.139 -23.909 -11.041 1.00 17.99 ? 44  ASP B CA    1 
ATOM   1608 C  C     . ASP B 1 35  ? -16.314 -22.940 -11.232 1.00 17.74 ? 44  ASP B C     1 
ATOM   1609 O  O     . ASP B 1 35  ? -16.663 -22.199 -10.308 1.00 16.66 ? 44  ASP B O     1 
ATOM   1610 C  CB    . ASP B 1 35  ? -15.492 -24.980 -9.998  1.00 17.85 ? 44  ASP B CB    1 
ATOM   1611 C  CG    . ASP B 1 35  ? -16.495 -26.005 -10.516 1.00 16.30 ? 44  ASP B CG    1 
ATOM   1612 O  OD1   . ASP B 1 35  ? -16.316 -27.211 -10.238 1.00 13.73 ? 44  ASP B OD1   1 
ATOM   1613 O  OD2   . ASP B 1 35  ? -17.465 -25.624 -11.203 1.00 12.86 ? 44  ASP B OD2   1 
ATOM   1614 N  N     . PRO B 1 36  ? -16.928 -22.938 -12.434 1.00 17.70 ? 45  PRO B N     1 
ATOM   1615 C  CA    . PRO B 1 36  ? -18.016 -21.987 -12.675 1.00 17.85 ? 45  PRO B CA    1 
ATOM   1616 C  C     . PRO B 1 36  ? -19.293 -22.266 -11.865 1.00 18.24 ? 45  PRO B C     1 
ATOM   1617 O  O     . PRO B 1 36  ? -20.135 -21.372 -11.735 1.00 18.48 ? 45  PRO B O     1 
ATOM   1618 C  CB    . PRO B 1 36  ? -18.288 -22.146 -14.172 1.00 17.93 ? 45  PRO B CB    1 
ATOM   1619 C  CG    . PRO B 1 36  ? -17.903 -23.561 -14.469 1.00 17.56 ? 45  PRO B CG    1 
ATOM   1620 C  CD    . PRO B 1 36  ? -16.683 -23.790 -13.616 1.00 17.82 ? 45  PRO B CD    1 
ATOM   1621 N  N     . THR B 1 37  ? -19.423 -23.482 -11.328 1.00 18.59 ? 46  THR B N     1 
ATOM   1622 C  CA    . THR B 1 37  ? -20.638 -23.917 -10.624 1.00 18.76 ? 46  THR B CA    1 
ATOM   1623 C  C     . THR B 1 37  ? -20.579 -23.719 -9.102  1.00 19.22 ? 46  THR B C     1 
ATOM   1624 O  O     . THR B 1 37  ? -21.575 -23.951 -8.411  1.00 19.38 ? 46  THR B O     1 
ATOM   1625 C  CB    . THR B 1 37  ? -20.928 -25.411 -10.906 1.00 18.71 ? 46  THR B CB    1 
ATOM   1626 O  OG1   . THR B 1 37  ? -19.906 -26.220 -10.313 1.00 18.36 ? 46  THR B OG1   1 
ATOM   1627 C  CG2   . THR B 1 37  ? -20.980 -25.672 -12.408 1.00 18.76 ? 46  THR B CG2   1 
ATOM   1628 N  N     . ILE B 1 38  ? -19.435 -23.282 -8.579  1.00 19.53 ? 47  ILE B N     1 
ATOM   1629 C  CA    . ILE B 1 38  ? -19.244 -23.209 -7.127  1.00 19.71 ? 47  ILE B CA    1 
ATOM   1630 C  C     . ILE B 1 38  ? -19.662 -21.851 -6.563  1.00 20.10 ? 47  ILE B C     1 
ATOM   1631 O  O     . ILE B 1 38  ? -19.267 -20.797 -7.074  1.00 19.99 ? 47  ILE B O     1 
ATOM   1632 C  CB    . ILE B 1 38  ? -17.787 -23.506 -6.714  1.00 19.45 ? 47  ILE B CB    1 
ATOM   1633 C  CG1   . ILE B 1 38  ? -17.396 -24.931 -7.111  1.00 19.34 ? 47  ILE B CG1   1 
ATOM   1634 C  CG2   . ILE B 1 38  ? -17.613 -23.344 -5.204  1.00 19.50 ? 47  ILE B CG2   1 
ATOM   1635 N  N     . GLU B 1 39  ? -20.470 -21.903 -5.505  1.00 20.55 ? 48  GLU B N     1 
ATOM   1636 C  CA    . GLU B 1 39  ? -20.933 -20.714 -4.788  1.00 20.71 ? 48  GLU B CA    1 
ATOM   1637 C  C     . GLU B 1 39  ? -20.459 -20.835 -3.341  1.00 20.77 ? 48  GLU B C     1 
ATOM   1638 O  O     . GLU B 1 39  ? -20.822 -21.788 -2.646  1.00 21.34 ? 48  GLU B O     1 
ATOM   1639 C  CB    . GLU B 1 39  ? -22.459 -20.637 -4.889  1.00 20.75 ? 48  GLU B CB    1 
ATOM   1640 C  CG    . GLU B 1 39  ? -23.152 -19.553 -4.075  1.00 20.89 ? 48  GLU B CG    1 
ATOM   1641 C  CD    . GLU B 1 39  ? -24.622 -19.409 -4.463  1.00 21.57 ? 48  GLU B CD    1 
ATOM   1642 O  OE1   . GLU B 1 39  ? -24.909 -19.150 -5.655  1.00 21.95 ? 48  GLU B OE1   1 
ATOM   1643 O  OE2   . GLU B 1 39  ? -25.496 -19.587 -3.582  1.00 23.46 ? 48  GLU B OE2   1 
ATOM   1644 N  N     . ASP B 1 40  ? -19.624 -19.890 -2.906  1.00 20.86 ? 49  ASP B N     1 
ATOM   1645 C  CA    . ASP B 1 40  ? -18.978 -19.945 -1.588  1.00 20.91 ? 49  ASP B CA    1 
ATOM   1646 C  C     . ASP B 1 40  ? -18.933 -18.550 -0.948  1.00 20.48 ? 49  ASP B C     1 
ATOM   1647 O  O     . ASP B 1 40  ? -19.054 -17.544 -1.643  1.00 20.59 ? 49  ASP B O     1 
ATOM   1648 C  CB    . ASP B 1 40  ? -17.551 -20.484 -1.730  1.00 21.02 ? 49  ASP B CB    1 
ATOM   1649 C  CG    . ASP B 1 40  ? -17.003 -21.084 -0.435  1.00 23.56 ? 49  ASP B CG    1 
ATOM   1650 O  OD1   . ASP B 1 40  ? -17.729 -21.130 0.590   1.00 25.25 ? 49  ASP B OD1   1 
ATOM   1651 O  OD2   . ASP B 1 40  ? -15.834 -21.531 -0.449  1.00 26.79 ? 49  ASP B OD2   1 
ATOM   1652 N  N     . SER B 1 41  ? -18.748 -18.525 0.374   1.00 20.07 ? 50  SER B N     1 
ATOM   1653 C  CA    . SER B 1 41  ? -18.692 -17.295 1.167   1.00 19.70 ? 50  SER B CA    1 
ATOM   1654 C  C     . SER B 1 41  ? -17.287 -17.015 1.692   1.00 19.12 ? 50  SER B C     1 
ATOM   1655 O  O     . SER B 1 41  ? -16.535 -17.930 2.000   1.00 17.94 ? 50  SER B O     1 
ATOM   1656 C  CB    . SER B 1 41  ? -19.619 -17.419 2.373   1.00 20.07 ? 50  SER B CB    1 
ATOM   1657 O  OG    . SER B 1 41  ? -20.934 -17.749 1.976   1.00 22.71 ? 50  SER B OG    1 
ATOM   1658 N  N     . TYR B 1 42  ? -16.959 -15.733 1.821   1.00 18.46 ? 51  TYR B N     1 
ATOM   1659 C  CA    . TYR B 1 42  ? -15.668 -15.289 2.328   1.00 18.78 ? 51  TYR B CA    1 
ATOM   1660 C  C     . TYR B 1 42  ? -15.907 -14.160 3.306   1.00 18.29 ? 51  TYR B C     1 
ATOM   1661 O  O     . TYR B 1 42  ? -17.004 -13.610 3.361   1.00 18.05 ? 51  TYR B O     1 
ATOM   1662 C  CB    . TYR B 1 42  ? -14.803 -14.755 1.186   1.00 19.52 ? 51  TYR B CB    1 
ATOM   1663 C  CG    . TYR B 1 42  ? -14.567 -15.737 0.068   1.00 20.94 ? 51  TYR B CG    1 
ATOM   1664 C  CD1   . TYR B 1 42  ? -13.448 -16.557 0.074   1.00 21.90 ? 51  TYR B CD1   1 
ATOM   1665 C  CD2   . TYR B 1 42  ? -15.469 -15.862 -0.989  1.00 21.67 ? 51  TYR B CD2   1 
ATOM   1666 C  CE1   . TYR B 1 42  ? -13.219 -17.466 -0.942  1.00 22.07 ? 51  TYR B CE1   1 
ATOM   1667 C  CE2   . TYR B 1 42  ? -15.250 -16.784 -2.015  1.00 22.38 ? 51  TYR B CE2   1 
ATOM   1668 C  CZ    . TYR B 1 42  ? -14.117 -17.572 -1.985  1.00 21.66 ? 51  TYR B CZ    1 
ATOM   1669 O  OH    . TYR B 1 42  ? -13.855 -18.496 -2.980  1.00 22.98 ? 51  TYR B OH    1 
ATOM   1670 N  N     . THR B 1 43  ? -14.876 -13.794 4.058   1.00 17.99 ? 52  THR B N     1 
ATOM   1671 C  CA    . THR B 1 43  ? -14.960 -12.624 4.929   1.00 17.64 ? 52  THR B CA    1 
ATOM   1672 C  C     . THR B 1 43  ? -13.641 -11.844 4.944   1.00 17.51 ? 52  THR B C     1 
ATOM   1673 O  O     . THR B 1 43  ? -12.563 -12.421 4.748   1.00 17.38 ? 52  THR B O     1 
ATOM   1674 C  CB    . THR B 1 43  ? -15.387 -13.012 6.362   1.00 17.90 ? 52  THR B CB    1 
ATOM   1675 O  OG1   . THR B 1 43  ? -15.547 -11.832 7.159   1.00 18.04 ? 52  THR B OG1   1 
ATOM   1676 C  CG2   . THR B 1 43  ? -14.349 -13.914 7.015   1.00 17.46 ? 52  THR B CG2   1 
ATOM   1677 N  N     . LYS B 1 44  ? -13.743 -10.538 5.177   1.00 17.20 ? 53  LYS B N     1 
ATOM   1678 C  CA    . LYS B 1 44  ? -12.584 -9.649  5.250   1.00 17.07 ? 53  LYS B CA    1 
ATOM   1679 C  C     . LYS B 1 44  ? -12.911 -8.500  6.188   1.00 17.24 ? 53  LYS B C     1 
ATOM   1680 O  O     . LYS B 1 44  ? -14.036 -8.004  6.175   1.00 17.54 ? 53  LYS B O     1 
ATOM   1681 C  CB    . LYS B 1 44  ? -12.234 -9.081  3.872   1.00 17.36 ? 53  LYS B CB    1 
ATOM   1682 C  CG    . LYS B 1 44  ? -10.858 -8.405  3.794   1.00 17.43 ? 53  LYS B CG    1 
ATOM   1683 C  CD    . LYS B 1 44  ? -10.574 -7.883  2.398   1.00 16.27 ? 53  LYS B CD    1 
ATOM   1684 C  CE    . LYS B 1 44  ? -9.117  -7.493  2.180   1.00 17.50 ? 53  LYS B CE    1 
ATOM   1685 N  NZ    . LYS B 1 44  ? -8.862  -6.922  0.820   1.00 18.17 ? 53  LYS B NZ    1 
ATOM   1686 N  N     . GLN B 1 45  ? -11.940 -8.102  7.012   1.00 17.34 ? 54  GLN B N     1 
ATOM   1687 C  CA    . GLN B 1 45  ? -12.062 -6.913  7.862   1.00 17.48 ? 54  GLN B CA    1 
ATOM   1688 C  C     . GLN B 1 45  ? -11.433 -5.729  7.141   1.00 16.85 ? 54  GLN B C     1 
ATOM   1689 O  O     . GLN B 1 45  ? -10.272 -5.796  6.719   1.00 16.79 ? 54  GLN B O     1 
ATOM   1690 C  CB    . GLN B 1 45  ? -11.380 -7.128  9.218   1.00 18.39 ? 54  GLN B CB    1 
ATOM   1691 C  CG    . GLN B 1 45  ? -11.634 -6.005  10.248  1.00 20.98 ? 54  GLN B CG    1 
ATOM   1692 C  CD    . GLN B 1 45  ? -13.059 -5.970  10.786  1.00 24.03 ? 54  GLN B CD    1 
ATOM   1693 O  OE1   . GLN B 1 45  ? -13.787 -6.967  10.744  1.00 26.01 ? 54  GLN B OE1   1 
ATOM   1694 N  NE2   . GLN B 1 45  ? -13.461 -4.812  11.315  1.00 25.62 ? 54  GLN B NE2   1 
ATOM   1695 N  N     . CYS B 1 46  ? -12.190 -4.643  7.017   1.00 16.54 ? 55  CYS B N     1 
ATOM   1696 C  CA    . CYS B 1 46  ? -11.747 -3.459  6.275   1.00 16.25 ? 55  CYS B CA    1 
ATOM   1697 C  C     . CYS B 1 46  ? -11.941 -2.211  7.109   1.00 15.84 ? 55  CYS B C     1 
ATOM   1698 O  O     . CYS B 1 46  ? -12.722 -2.202  8.050   1.00 16.76 ? 55  CYS B O     1 
ATOM   1699 C  CB    . CYS B 1 46  ? -12.536 -3.301  4.955   1.00 15.77 ? 55  CYS B CB    1 
ATOM   1700 S  SG    . CYS B 1 46  ? -12.468 -4.725  3.863   1.00 18.63 ? 55  CYS B SG    1 
ATOM   1701 N  N     . VAL B 1 47  ? -11.212 -1.162  6.750   1.00 15.27 ? 56  VAL B N     1 
ATOM   1702 C  CA    . VAL B 1 47  ? -11.450 0.181   7.248   1.00 15.05 ? 56  VAL B CA    1 
ATOM   1703 C  C     . VAL B 1 47  ? -11.883 1.019   6.055   1.00 15.35 ? 56  VAL B C     1 
ATOM   1704 O  O     . VAL B 1 47  ? -11.166 1.112   5.053   1.00 15.49 ? 56  VAL B O     1 
ATOM   1705 C  CB    . VAL B 1 47  ? -10.184 0.773   7.891   1.00 15.32 ? 56  VAL B CB    1 
ATOM   1706 C  CG1   . VAL B 1 47  ? -10.414 2.236   8.293   1.00 14.89 ? 56  VAL B CG1   1 
ATOM   1707 C  CG2   . VAL B 1 47  ? -9.759  -0.076  9.085   1.00 15.50 ? 56  VAL B CG2   1 
ATOM   1708 N  N     . ILE B 1 48  ? -13.084 1.587   6.140   1.00 14.86 ? 57  ILE B N     1 
ATOM   1709 C  CA    . ILE B 1 48  ? -13.669 2.335   5.033   1.00 15.17 ? 57  ILE B CA    1 
ATOM   1710 C  C     . ILE B 1 48  ? -14.105 3.696   5.577   1.00 14.84 ? 57  ILE B C     1 
ATOM   1711 O  O     . ILE B 1 48  ? -14.931 3.762   6.490   1.00 14.41 ? 57  ILE B O     1 
ATOM   1712 C  CB    . ILE B 1 48  ? -14.882 1.579   4.462   1.00 15.13 ? 57  ILE B CB    1 
ATOM   1713 C  CG1   . ILE B 1 48  ? -14.461 0.185   3.968   1.00 15.57 ? 57  ILE B CG1   1 
ATOM   1714 C  CG2   . ILE B 1 48  ? -15.548 2.368   3.354   1.00 16.11 ? 57  ILE B CG2   1 
ATOM   1715 C  CD1   . ILE B 1 48  ? -15.625 -0.789  3.780   1.00 15.71 ? 57  ILE B CD1   1 
ATOM   1716 N  N     . ASP B 1 49  ? -13.551 4.771   5.027   1.00 14.88 ? 58  ASP B N     1 
ATOM   1717 C  CA    . ASP B 1 49  ? -13.793 6.122   5.550   1.00 14.79 ? 58  ASP B CA    1 
ATOM   1718 C  C     . ASP B 1 49  ? -13.523 6.166   7.059   1.00 15.72 ? 58  ASP B C     1 
ATOM   1719 O  O     . ASP B 1 49  ? -14.281 6.765   7.819   1.00 15.20 ? 58  ASP B O     1 
ATOM   1720 C  CB    . ASP B 1 49  ? -15.215 6.586   5.202   1.00 15.34 ? 58  ASP B CB    1 
ATOM   1721 C  CG    . ASP B 1 49  ? -15.455 6.603   3.710   1.00 15.22 ? 58  ASP B CG    1 
ATOM   1722 O  OD1   . ASP B 1 49  ? -14.451 6.635   2.971   1.00 16.26 ? 58  ASP B OD1   1 
ATOM   1723 O  OD2   . ASP B 1 49  ? -16.625 6.590   3.273   1.00 16.72 ? 58  ASP B OD2   1 
ATOM   1724 N  N     . ASP B 1 50  ? -12.430 5.505   7.450   1.00 16.12 ? 59  ASP B N     1 
ATOM   1725 C  CA    . ASP B 1 50  ? -11.937 5.417   8.835   1.00 17.11 ? 59  ASP B CA    1 
ATOM   1726 C  C     . ASP B 1 50  ? -12.875 4.714   9.831   1.00 16.77 ? 59  ASP B C     1 
ATOM   1727 O  O     . ASP B 1 50  ? -12.632 4.746   11.033  1.00 16.65 ? 59  ASP B O     1 
ATOM   1728 C  CB    . ASP B 1 50  ? -11.515 6.800   9.345   1.00 17.70 ? 59  ASP B CB    1 
ATOM   1729 C  CG    . ASP B 1 50  ? -10.172 7.261   8.764   1.00 20.41 ? 59  ASP B CG    1 
ATOM   1730 O  OD1   . ASP B 1 50  ? -9.162  6.506   8.811   1.00 23.88 ? 59  ASP B OD1   1 
ATOM   1731 O  OD2   . ASP B 1 50  ? -10.116 8.405   8.286   1.00 23.19 ? 59  ASP B OD2   1 
ATOM   1732 N  N     . ARG B 1 51  ? -13.911 4.042   9.323   1.00 17.10 ? 60  ARG B N     1 
ATOM   1733 C  CA    . ARG B 1 51  ? -14.817 3.245   10.143  1.00 17.29 ? 60  ARG B CA    1 
ATOM   1734 C  C     . ARG B 1 51  ? -14.606 1.775   9.819   1.00 17.21 ? 60  ARG B C     1 
ATOM   1735 O  O     . ARG B 1 51  ? -14.702 1.383   8.653   1.00 16.74 ? 60  ARG B O     1 
ATOM   1736 C  CB    . ARG B 1 51  ? -16.270 3.575   9.815   1.00 17.59 ? 60  ARG B CB    1 
ATOM   1737 C  CG    . ARG B 1 51  ? -16.784 4.887   10.364  1.00 17.98 ? 60  ARG B CG    1 
ATOM   1738 C  CD    . ARG B 1 51  ? -18.163 5.215   9.783   1.00 18.99 ? 60  ARG B CD    1 
ATOM   1739 N  NE    . ARG B 1 51  ? -19.183 4.196   10.053  1.00 20.93 ? 60  ARG B NE    1 
ATOM   1740 C  CZ    . ARG B 1 51  ? -20.430 4.229   9.575   1.00 22.12 ? 60  ARG B CZ    1 
ATOM   1741 N  NH1   . ARG B 1 51  ? -20.838 5.229   8.802   1.00 23.52 ? 60  ARG B NH1   1 
ATOM   1742 N  NH2   . ARG B 1 51  ? -21.283 3.263   9.881   1.00 22.20 ? 60  ARG B NH2   1 
ATOM   1743 N  N     . ALA B 1 52  ? -14.345 0.956   10.834  1.00 17.13 ? 61  ALA B N     1 
ATOM   1744 C  CA    . ALA B 1 52  ? -14.111 -0.471  10.589  1.00 17.47 ? 61  ALA B CA    1 
ATOM   1745 C  C     . ALA B 1 52  ? -15.409 -1.154  10.133  1.00 17.75 ? 61  ALA B C     1 
ATOM   1746 O  O     . ALA B 1 52  ? -16.507 -0.805  10.596  1.00 17.94 ? 61  ALA B O     1 
ATOM   1747 C  CB    . ALA B 1 52  ? -13.564 -1.149  11.829  1.00 18.09 ? 61  ALA B CB    1 
ATOM   1748 N  N     . ALA B 1 53  ? -15.279 -2.124  9.234   1.00 17.86 ? 62  ALA B N     1 
ATOM   1749 C  CA    . ALA B 1 53  ? -16.419 -2.932  8.824   1.00 17.82 ? 62  ALA B CA    1 
ATOM   1750 C  C     . ALA B 1 53  ? -15.979 -4.357  8.518   1.00 18.13 ? 62  ALA B C     1 
ATOM   1751 O  O     . ALA B 1 53  ? -14.902 -4.573  7.945   1.00 18.66 ? 62  ALA B O     1 
ATOM   1752 C  CB    . ALA B 1 53  ? -17.088 -2.312  7.621   1.00 18.66 ? 62  ALA B CB    1 
ATOM   1753 N  N     . ARG B 1 54  ? -16.794 -5.330  8.919   1.00 17.57 ? 63  ARG B N     1 
ATOM   1754 C  CA    . ARG B 1 54  ? -16.581 -6.716  8.501   1.00 18.00 ? 63  ARG B CA    1 
ATOM   1755 C  C     . ARG B 1 54  ? -17.440 -6.950  7.271   1.00 17.96 ? 63  ARG B C     1 
ATOM   1756 O  O     . ARG B 1 54  ? -18.643 -6.703  7.310   1.00 17.92 ? 63  ARG B O     1 
ATOM   1757 C  CB    . ARG B 1 54  ? -16.981 -7.715  9.580   1.00 17.65 ? 63  ARG B CB    1 
ATOM   1758 C  CG    . ARG B 1 54  ? -16.679 -9.169  9.210   1.00 18.44 ? 63  ARG B CG    1 
ATOM   1759 C  CD    . ARG B 1 54  ? -17.364 -10.152 10.158  1.00 18.60 ? 63  ARG B CD    1 
ATOM   1760 N  N     . LEU B 1 55  ? -16.823 -7.440  6.201   1.00 18.18 ? 64  LEU B N     1 
ATOM   1761 C  CA    . LEU B 1 55  ? -17.518 -7.673  4.938   1.00 18.00 ? 64  LEU B CA    1 
ATOM   1762 C  C     . LEU B 1 55  ? -17.631 -9.168  4.717   1.00 18.17 ? 64  LEU B C     1 
ATOM   1763 O  O     . LEU B 1 55  ? -16.619 -9.824  4.516   1.00 18.53 ? 64  LEU B O     1 
ATOM   1764 C  CB    . LEU B 1 55  ? -16.758 -7.043  3.770   1.00 18.51 ? 64  LEU B CB    1 
ATOM   1765 C  CG    . LEU B 1 55  ? -16.974 -5.557  3.469   1.00 18.22 ? 64  LEU B CG    1 
ATOM   1766 C  CD1   . LEU B 1 55  ? -16.605 -4.713  4.645   1.00 19.47 ? 64  LEU B CD1   1 
ATOM   1767 C  CD2   . LEU B 1 55  ? -16.186 -5.126  2.227   1.00 18.27 ? 64  LEU B CD2   1 
ATOM   1768 N  N     . ASP B 1 56  ? -18.853 -9.701  4.765   1.00 17.61 ? 65  ASP B N     1 
ATOM   1769 C  CA    . ASP B 1 56  ? -19.101 -11.118 4.503   1.00 17.76 ? 65  ASP B CA    1 
ATOM   1770 C  C     . ASP B 1 56  ? -19.615 -11.224 3.065   1.00 17.30 ? 65  ASP B C     1 
ATOM   1771 O  O     . ASP B 1 56  ? -20.722 -10.785 2.785   1.00 17.48 ? 65  ASP B O     1 
ATOM   1772 C  CB    . ASP B 1 56  ? -20.125 -11.668 5.500   1.00 17.95 ? 65  ASP B CB    1 
ATOM   1773 C  CG    . ASP B 1 56  ? -19.677 -11.521 6.946   1.00 19.88 ? 65  ASP B CG    1 
ATOM   1774 O  OD1   . ASP B 1 56  ? -18.471 -11.695 7.226   1.00 20.93 ? 65  ASP B OD1   1 
ATOM   1775 O  OD2   . ASP B 1 56  ? -20.545 -11.255 7.808   1.00 23.12 ? 65  ASP B OD2   1 
ATOM   1776 N  N     . ILE B 1 57  ? -18.785 -11.760 2.166   1.00 16.78 ? 66  ILE B N     1 
ATOM   1777 C  CA    . ILE B 1 57  ? -19.058 -11.792 0.729   1.00 16.65 ? 66  ILE B CA    1 
ATOM   1778 C  C     . ILE B 1 57  ? -19.525 -13.165 0.251   1.00 16.34 ? 66  ILE B C     1 
ATOM   1779 O  O     . ILE B 1 57  ? -18.878 -14.169 0.535   1.00 16.72 ? 66  ILE B O     1 
ATOM   1780 C  CB    . ILE B 1 57  ? -17.789 -11.455 -0.100  1.00 17.01 ? 66  ILE B CB    1 
ATOM   1781 C  CG1   . ILE B 1 57  ? -17.056 -10.221 0.443   1.00 18.76 ? 66  ILE B CG1   1 
ATOM   1782 C  CG2   . ILE B 1 57  ? -18.109 -11.319 -1.573  1.00 16.73 ? 66  ILE B CG2   1 
ATOM   1783 C  CD1   . ILE B 1 57  ? -17.856 -9.021  0.518   1.00 20.93 ? 66  ILE B CD1   1 
ATOM   1784 N  N     . LEU B 1 58  ? -20.633 -13.182 -0.495  1.00 15.91 ? 67  LEU B N     1 
ATOM   1785 C  CA    . LEU B 1 58  ? -21.076 -14.384 -1.196  1.00 15.84 ? 67  LEU B CA    1 
ATOM   1786 C  C     . LEU B 1 58  ? -20.803 -14.252 -2.694  1.00 15.83 ? 67  LEU B C     1 
ATOM   1787 O  O     . LEU B 1 58  ? -21.255 -13.306 -3.341  1.00 15.32 ? 67  LEU B O     1 
ATOM   1788 C  CB    . LEU B 1 58  ? -22.569 -14.638 -0.964  1.00 15.79 ? 67  LEU B CB    1 
ATOM   1789 C  CG    . LEU B 1 58  ? -23.103 -15.904 -1.646  1.00 15.74 ? 67  LEU B CG    1 
ATOM   1790 C  CD1   . LEU B 1 58  ? -22.513 -17.139 -0.991  1.00 15.57 ? 67  LEU B CD1   1 
ATOM   1791 C  CD2   . LEU B 1 58  ? -24.600 -15.960 -1.604  1.00 15.68 ? 67  LEU B CD2   1 
ATOM   1792 N  N     . ASP B 1 59  ? -20.046 -15.211 -3.215  1.00 15.71 ? 68  ASP B N     1 
ATOM   1793 C  CA    . ASP B 1 59  ? -19.737 -15.330 -4.631  1.00 15.89 ? 68  ASP B CA    1 
ATOM   1794 C  C     . ASP B 1 59  ? -20.745 -16.314 -5.234  1.00 16.05 ? 68  ASP B C     1 
ATOM   1795 O  O     . ASP B 1 59  ? -20.647 -17.509 -4.989  1.00 16.49 ? 68  ASP B O     1 
ATOM   1796 C  CB    . ASP B 1 59  ? -18.299 -15.848 -4.778  1.00 15.87 ? 68  ASP B CB    1 
ATOM   1797 C  CG    . ASP B 1 59  ? -17.913 -16.176 -6.211  1.00 15.61 ? 68  ASP B CG    1 
ATOM   1798 O  OD1   . ASP B 1 59  ? -18.491 -15.603 -7.162  1.00 15.59 ? 68  ASP B OD1   1 
ATOM   1799 O  OD2   . ASP B 1 59  ? -17.015 -17.030 -6.387  1.00 16.76 ? 68  ASP B OD2   1 
ATOM   1800 N  N     . THR B 1 60  ? -21.721 -15.801 -5.990  1.00 16.53 ? 69  THR B N     1 
ATOM   1801 C  CA    . THR B 1 60  ? -22.825 -16.634 -6.491  1.00 16.46 ? 69  THR B CA    1 
ATOM   1802 C  C     . THR B 1 60  ? -22.475 -17.367 -7.786  1.00 17.53 ? 69  THR B C     1 
ATOM   1803 O  O     . THR B 1 60  ? -21.591 -16.957 -8.524  1.00 17.07 ? 69  THR B O     1 
ATOM   1804 C  CB    . THR B 1 60  ? -24.144 -15.834 -6.651  1.00 16.44 ? 69  THR B CB    1 
ATOM   1805 O  OG1   . THR B 1 60  ? -24.023 -14.880 -7.713  1.00 14.91 ? 69  THR B OG1   1 
ATOM   1806 C  CG2   . THR B 1 60  ? -24.488 -15.106 -5.348  1.00 15.93 ? 69  THR B CG2   1 
ATOM   1807 N  N     . ALA B 1 61  ? -23.164 -18.479 -8.034  1.00 18.51 ? 70  ALA B N     1 
ATOM   1808 C  CA    . ALA B 1 61  ? -22.994 -19.239 -9.263  1.00 19.97 ? 70  ALA B CA    1 
ATOM   1809 C  C     . ALA B 1 61  ? -24.343 -19.813 -9.656  1.00 21.35 ? 70  ALA B C     1 
ATOM   1810 O  O     . ALA B 1 61  ? -24.977 -20.502 -8.855  1.00 21.63 ? 70  ALA B O     1 
ATOM   1811 C  CB    . ALA B 1 61  ? -21.994 -20.361 -9.051  1.00 19.65 ? 70  ALA B CB    1 
ATOM   1812 N  N     . GLY B 1 62  ? -24.787 -19.524 -10.876 1.00 23.06 ? 71  GLY B N     1 
ATOM   1813 C  CA    . GLY B 1 62  ? -26.051 -20.067 -11.386 1.00 24.37 ? 71  GLY B CA    1 
ATOM   1814 C  C     . GLY B 1 62  ? -27.251 -19.302 -10.859 1.00 25.39 ? 71  GLY B C     1 
ATOM   1815 O  O     . GLY B 1 62  ? -27.100 -18.274 -10.209 1.00 26.20 ? 71  GLY B O     1 
ATOM   1816 N  N     . GLN B 1 63  ? -28.448 -19.809 -11.137 1.00 26.68 ? 72  GLN B N     1 
ATOM   1817 C  CA    . GLN B 1 63  ? -29.688 -19.133 -10.739 1.00 27.36 ? 72  GLN B CA    1 
ATOM   1818 C  C     . GLN B 1 63  ? -30.088 -19.472 -9.301  1.00 27.82 ? 72  GLN B C     1 
ATOM   1819 O  O     . GLN B 1 63  ? -29.806 -20.573 -8.817  1.00 28.09 ? 72  GLN B O     1 
ATOM   1820 C  CB    . GLN B 1 63  ? -30.831 -19.527 -11.683 1.00 27.49 ? 72  GLN B CB    1 
ATOM   1821 N  N     . GLU B 1 64  ? -30.745 -18.521 -8.632  1.00 28.07 ? 73  GLU B N     1 
ATOM   1822 C  CA    . GLU B 1 64  ? -31.388 -18.771 -7.333  1.00 27.92 ? 73  GLU B CA    1 
ATOM   1823 C  C     . GLU B 1 64  ? -32.353 -19.954 -7.419  1.00 27.38 ? 73  GLU B C     1 
ATOM   1824 O  O     . GLU B 1 64  ? -33.215 -20.001 -8.303  1.00 27.55 ? 73  GLU B O     1 
ATOM   1825 C  CB    . GLU B 1 64  ? -32.176 -17.539 -6.855  1.00 28.32 ? 73  GLU B CB    1 
ATOM   1826 C  CG    . GLU B 1 64  ? -31.386 -16.540 -6.030  1.00 29.11 ? 73  GLU B CG    1 
ATOM   1827 C  CD    . GLU B 1 64  ? -31.552 -16.737 -4.529  1.00 30.09 ? 73  GLU B CD    1 
ATOM   1828 O  OE1   . GLU B 1 64  ? -31.995 -15.778 -3.844  1.00 29.47 ? 73  GLU B OE1   1 
ATOM   1829 O  OE2   . GLU B 1 64  ? -31.247 -17.852 -4.042  1.00 31.27 ? 73  GLU B OE2   1 
ATOM   1830 N  N     . GLU B 1 65  ? -32.187 -20.910 -6.507  1.00 26.31 ? 74  GLU B N     1 
ATOM   1831 C  CA    . GLU B 1 65  ? -33.135 -22.010 -6.324  1.00 25.60 ? 74  GLU B CA    1 
ATOM   1832 C  C     . GLU B 1 65  ? -33.257 -22.272 -4.828  1.00 24.34 ? 74  GLU B C     1 
ATOM   1833 O  O     . GLU B 1 65  ? -32.291 -22.084 -4.091  1.00 23.98 ? 74  GLU B O     1 
ATOM   1834 C  CB    . GLU B 1 65  ? -32.652 -23.275 -7.046  1.00 25.64 ? 74  GLU B CB    1 
ATOM   1835 C  CG    . GLU B 1 65  ? -32.422 -23.080 -8.545  1.00 26.35 ? 74  GLU B CG    1 
ATOM   1836 C  CD    . GLU B 1 65  ? -31.627 -24.203 -9.169  1.00 26.54 ? 74  GLU B CD    1 
ATOM   1837 O  OE1   . GLU B 1 65  ? -32.010 -25.378 -8.982  1.00 28.26 ? 74  GLU B OE1   1 
ATOM   1838 O  OE2   . GLU B 1 65  ? -30.620 -23.909 -9.851  1.00 27.75 ? 74  GLU B OE2   1 
ATOM   1839 N  N     . PHE B 1 66  ? -34.438 -22.691 -4.378  1.00 23.09 ? 75  PHE B N     1 
ATOM   1840 C  CA    . PHE B 1 66  ? -34.643 -22.997 -2.966  1.00 22.08 ? 75  PHE B CA    1 
ATOM   1841 C  C     . PHE B 1 66  ? -34.026 -24.353 -2.647  1.00 21.27 ? 75  PHE B C     1 
ATOM   1842 O  O     . PHE B 1 66  ? -34.104 -25.286 -3.453  1.00 21.22 ? 75  PHE B O     1 
ATOM   1843 C  CB    . PHE B 1 66  ? -36.130 -23.060 -2.606  1.00 22.00 ? 75  PHE B CB    1 
ATOM   1844 C  CG    . PHE B 1 66  ? -36.858 -21.754 -2.736  1.00 21.81 ? 75  PHE B CG    1 
ATOM   1845 C  CD1   . PHE B 1 66  ? -37.986 -21.653 -3.540  1.00 22.02 ? 75  PHE B CD1   1 
ATOM   1846 C  CD2   . PHE B 1 66  ? -36.437 -20.631 -2.038  1.00 22.14 ? 75  PHE B CD2   1 
ATOM   1847 C  CE1   . PHE B 1 66  ? -38.668 -20.451 -3.654  1.00 22.21 ? 75  PHE B CE1   1 
ATOM   1848 C  CE2   . PHE B 1 66  ? -37.119 -19.423 -2.156  1.00 22.02 ? 75  PHE B CE2   1 
ATOM   1849 C  CZ    . PHE B 1 66  ? -38.231 -19.338 -2.963  1.00 21.94 ? 75  PHE B CZ    1 
ATOM   1850 N  N     . GLY B 1 67  ? -33.438 -24.460 -1.461  1.00 20.16 ? 76  GLY B N     1 
ATOM   1851 C  CA    . GLY B 1 67  ? -32.927 -25.739 -0.974  1.00 19.64 ? 76  GLY B CA    1 
ATOM   1852 C  C     . GLY B 1 67  ? -32.196 -25.598 0.348   1.00 18.92 ? 76  GLY B C     1 
ATOM   1853 O  O     . GLY B 1 67  ? -31.843 -24.489 0.758   1.00 18.54 ? 76  GLY B O     1 
ATOM   1854 N  N     . ALA B 1 68  ? -31.962 -26.730 1.011   1.00 18.09 ? 77  ALA B N     1 
ATOM   1855 C  CA    . ALA B 1 68  ? -31.241 -26.740 2.281   1.00 17.94 ? 77  ALA B CA    1 
ATOM   1856 C  C     . ALA B 1 68  ? -29.808 -26.204 2.147   1.00 17.80 ? 77  ALA B C     1 
ATOM   1857 O  O     . ALA B 1 68  ? -29.244 -25.711 3.121   1.00 17.67 ? 77  ALA B O     1 
ATOM   1858 C  CB    . ALA B 1 68  ? -31.227 -28.137 2.865   1.00 17.86 ? 77  ALA B CB    1 
ATOM   1859 N  N     . MET B 1 69  ? -29.230 -26.307 0.949   1.00 17.93 ? 78  MET B N     1 
ATOM   1860 C  CA    . MET B 1 69  ? -27.860 -25.843 0.686   1.00 18.44 ? 78  MET B CA    1 
ATOM   1861 C  C     . MET B 1 69  ? -27.816 -24.405 0.209   1.00 18.81 ? 78  MET B C     1 
ATOM   1862 O  O     . MET B 1 69  ? -26.751 -23.779 0.215   1.00 18.79 ? 78  MET B O     1 
ATOM   1863 C  CB    . MET B 1 69  ? -27.206 -26.694 -0.401  1.00 18.40 ? 78  MET B CB    1 
ATOM   1864 C  CG    . MET B 1 69  ? -27.085 -28.157 -0.064  1.00 18.78 ? 78  MET B CG    1 
ATOM   1865 S  SD    . MET B 1 69  ? -26.076 -28.420 1.396   1.00 20.06 ? 78  MET B SD    1 
ATOM   1866 C  CE    . MET B 1 69  ? -24.512 -27.687 0.918   1.00 20.27 ? 78  MET B CE    1 
ATOM   1867 N  N     . ARG B 1 70  ? -28.965 -23.892 -0.227  1.00 19.44 ? 79  ARG B N     1 
ATOM   1868 C  CA    . ARG B 1 70  ? -29.025 -22.612 -0.933  1.00 19.92 ? 79  ARG B CA    1 
ATOM   1869 C  C     . ARG B 1 70  ? -29.463 -21.461 -0.034  1.00 20.02 ? 79  ARG B C     1 
ATOM   1870 O  O     . ARG B 1 70  ? -30.610 -21.414 0.416   1.00 19.90 ? 79  ARG B O     1 
ATOM   1871 C  CB    . ARG B 1 70  ? -29.983 -22.720 -2.124  1.00 20.22 ? 79  ARG B CB    1 
ATOM   1872 C  CG    . ARG B 1 70  ? -29.684 -23.873 -3.085  1.00 21.31 ? 79  ARG B CG    1 
ATOM   1873 C  CD    . ARG B 1 70  ? -28.268 -23.811 -3.652  1.00 23.38 ? 79  ARG B CD    1 
ATOM   1874 N  NE    . ARG B 1 70  ? -28.024 -22.577 -4.401  1.00 24.38 ? 79  ARG B NE    1 
ATOM   1875 C  CZ    . ARG B 1 70  ? -28.271 -22.409 -5.703  1.00 24.99 ? 79  ARG B CZ    1 
ATOM   1876 N  NH1   . ARG B 1 70  ? -28.771 -23.392 -6.450  1.00 25.12 ? 79  ARG B NH1   1 
ATOM   1877 N  NH2   . ARG B 1 70  ? -28.006 -21.240 -6.270  1.00 25.30 ? 79  ARG B NH2   1 
ATOM   1878 N  N     . GLU B 1 71  ? -28.539 -20.538 0.228   1.00 20.28 ? 80  GLU B N     1 
ATOM   1879 C  CA    . GLU B 1 71  ? -28.885 -19.281 0.876   1.00 20.57 ? 80  GLU B CA    1 
ATOM   1880 C  C     . GLU B 1 71  ? -29.719 -18.460 -0.099  1.00 20.85 ? 80  GLU B C     1 
ATOM   1881 O  O     . GLU B 1 71  ? -29.329 -18.298 -1.272  1.00 19.83 ? 80  GLU B O     1 
ATOM   1882 C  CB    . GLU B 1 71  ? -27.623 -18.508 1.278   1.00 20.72 ? 80  GLU B CB    1 
ATOM   1883 C  CG    . GLU B 1 71  ? -27.900 -17.122 1.882   1.00 21.03 ? 80  GLU B CG    1 
ATOM   1884 C  CD    . GLU B 1 71  ? -26.640 -16.365 2.269   1.00 21.56 ? 80  GLU B CD    1 
ATOM   1885 O  OE1   . GLU B 1 71  ? -25.566 -16.985 2.383   1.00 21.30 ? 80  GLU B OE1   1 
ATOM   1886 O  OE2   . GLU B 1 71  ? -26.723 -15.132 2.460   1.00 23.01 ? 80  GLU B OE2   1 
ATOM   1887 N  N     . GLN B 1 72  ? -30.858 -17.937 0.374   1.00 20.92 ? 81  GLN B N     1 
ATOM   1888 C  CA    . GLN B 1 72  ? -31.647 -16.993 -0.431  1.00 20.70 ? 81  GLN B CA    1 
ATOM   1889 C  C     . GLN B 1 72  ? -31.012 -15.631 -0.316  1.00 20.95 ? 81  GLN B C     1 
ATOM   1890 O  O     . GLN B 1 72  ? -31.484 -14.766 0.428   1.00 20.65 ? 81  GLN B O     1 
ATOM   1891 C  CB    . GLN B 1 72  ? -33.106 -16.934 0.021   1.00 20.79 ? 81  GLN B CB    1 
ATOM   1892 C  CG    A GLN B 1 72  ? -33.897 -18.203 -0.147  0.50 20.79 ? 81  GLN B CG    1 
ATOM   1893 C  CG    B GLN B 1 72  ? -33.840 -18.244 -0.241  0.50 20.17 ? 81  GLN B CG    1 
ATOM   1894 C  CD    A GLN B 1 72  ? -35.217 -18.129 0.594   0.50 20.76 ? 81  GLN B CD    1 
ATOM   1895 C  CD    B GLN B 1 72  ? -33.601 -18.764 -1.656  0.50 19.38 ? 81  GLN B CD    1 
ATOM   1896 O  OE1   A GLN B 1 72  ? -35.998 -17.197 0.403   0.50 20.55 ? 81  GLN B OE1   1 
ATOM   1897 O  OE1   B GLN B 1 72  ? -34.248 -18.328 -2.606  0.50 18.12 ? 81  GLN B OE1   1 
ATOM   1898 N  NE2   A GLN B 1 72  ? -35.463 -19.101 1.456   0.50 21.48 ? 81  GLN B NE2   1 
ATOM   1899 N  NE2   B GLN B 1 72  ? -32.659 -19.694 -1.799  0.50 19.02 ? 81  GLN B NE2   1 
ATOM   1900 N  N     . TYR B 1 73  ? -29.945 -15.443 -1.083  1.00 21.08 ? 82  TYR B N     1 
ATOM   1901 C  CA    . TYR B 1 73  ? -29.106 -14.251 -0.960  1.00 21.12 ? 82  TYR B CA    1 
ATOM   1902 C  C     . TYR B 1 73  ? -29.792 -12.946 -1.344  1.00 22.13 ? 82  TYR B C     1 
ATOM   1903 O  O     . TYR B 1 73  ? -29.316 -11.869 -1.013  1.00 22.27 ? 82  TYR B O     1 
ATOM   1904 C  CB    . TYR B 1 73  ? -27.796 -14.419 -1.743  1.00 20.93 ? 82  TYR B CB    1 
ATOM   1905 C  CG    . TYR B 1 73  ? -27.911 -14.915 -3.173  1.00 19.75 ? 82  TYR B CG    1 
ATOM   1906 C  CD1   . TYR B 1 73  ? -28.237 -14.057 -4.217  1.00 19.39 ? 82  TYR B CD1   1 
ATOM   1907 C  CD2   . TYR B 1 73  ? -27.637 -16.247 -3.485  1.00 20.44 ? 82  TYR B CD2   1 
ATOM   1908 C  CE1   . TYR B 1 73  ? -28.319 -14.520 -5.537  1.00 18.85 ? 82  TYR B CE1   1 
ATOM   1909 C  CE2   . TYR B 1 73  ? -27.714 -16.712 -4.785  1.00 19.51 ? 82  TYR B CE2   1 
ATOM   1910 C  CZ    . TYR B 1 73  ? -28.047 -15.852 -5.805  1.00 19.76 ? 82  TYR B CZ    1 
ATOM   1911 O  OH    . TYR B 1 73  ? -28.113 -16.331 -7.088  1.00 19.41 ? 82  TYR B OH    1 
ATOM   1912 N  N     . MET B 1 74  ? -30.923 -13.030 -2.020  1.00 23.02 ? 83  MET B N     1 
ATOM   1913 C  CA    . MET B 1 74  ? -31.601 -11.819 -2.427  1.00 24.54 ? 83  MET B CA    1 
ATOM   1914 C  C     . MET B 1 74  ? -32.709 -11.262 -1.520  1.00 24.47 ? 83  MET B C     1 
ATOM   1915 O  O     . MET B 1 74  ? -32.873 -10.048 -1.494  1.00 24.92 ? 83  MET B O     1 
ATOM   1916 C  CB    . MET B 1 74  ? -32.275 -12.059 -3.796  1.00 24.82 ? 83  MET B CB    1 
ATOM   1917 C  CG    . MET B 1 74  ? -31.387 -11.868 -5.022  1.00 25.90 ? 83  MET B CG    1 
ATOM   1918 S  SD    . MET B 1 74  ? -32.299 -12.181 -6.536  1.00 28.05 ? 83  MET B SD    1 
ATOM   1919 C  CE    . MET B 1 74  ? -30.991 -12.117 -7.751  1.00 27.05 ? 83  MET B CE    1 
ATOM   1920 N  N     . ARG B 1 75  ? -33.414 -12.047 -0.700  1.00 24.47 ? 84  ARG B N     1 
ATOM   1921 C  CA    . ARG B 1 75  ? -33.427 -12.020 0.790   1.00 23.83 ? 84  ARG B CA    1 
ATOM   1922 C  C     . ARG B 1 75  ? -32.343 -11.515 1.728   1.00 22.81 ? 84  ARG B C     1 
ATOM   1923 O  O     . ARG B 1 75  ? -32.534 -10.454 2.325   1.00 22.91 ? 84  ARG B O     1 
ATOM   1924 C  CB    . ARG B 1 75  ? -34.065 -13.296 1.378   1.00 24.08 ? 84  ARG B CB    1 
ATOM   1925 C  CG    . ARG B 1 75  ? -34.826 -13.006 2.683   1.00 25.28 ? 84  ARG B CG    1 
ATOM   1926 C  CD    . ARG B 1 75  ? -35.798 -14.119 3.060   1.00 25.43 ? 84  ARG B CD    1 
ATOM   1927 N  NE    . ARG B 1 75  ? -35.117 -15.406 3.145   1.00 27.18 ? 84  ARG B NE    1 
ATOM   1928 C  CZ    . ARG B 1 75  ? -34.325 -15.792 4.147   1.00 28.04 ? 84  ARG B CZ    1 
ATOM   1929 N  NH1   . ARG B 1 75  ? -34.090 -15.001 5.195   1.00 28.83 ? 84  ARG B NH1   1 
ATOM   1930 N  NH2   . ARG B 1 75  ? -33.755 -16.992 4.096   1.00 27.97 ? 84  ARG B NH2   1 
ATOM   1931 N  N     . THR B 1 76  ? -31.280 -12.272 1.951   1.00 21.23 ? 85  THR B N     1 
ATOM   1932 C  CA    . THR B 1 76  ? -30.328 -11.924 3.017   1.00 20.84 ? 85  THR B CA    1 
ATOM   1933 C  C     . THR B 1 76  ? -29.350 -10.794 2.675   1.00 19.86 ? 85  THR B C     1 
ATOM   1934 O  O     . THR B 1 76  ? -28.775 -10.177 3.578   1.00 19.47 ? 85  THR B O     1 
ATOM   1935 C  CB    . THR B 1 76  ? -29.483 -13.130 3.426   1.00 20.50 ? 85  THR B CB    1 
ATOM   1936 O  OG1   . THR B 1 76  ? -28.676 -13.542 2.316   1.00 21.26 ? 85  THR B OG1   1 
ATOM   1937 C  CG2   . THR B 1 76  ? -30.366 -14.275 3.886   1.00 21.48 ? 85  THR B CG2   1 
ATOM   1938 N  N     . GLY B 1 77  ? -29.146 -10.525 1.390   1.00 18.96 ? 86  GLY B N     1 
ATOM   1939 C  CA    . GLY B 1 77  ? -28.080 -9.608  0.966   1.00 18.48 ? 86  GLY B CA    1 
ATOM   1940 C  C     . GLY B 1 77  ? -28.351 -8.161  1.339   1.00 18.09 ? 86  GLY B C     1 
ATOM   1941 O  O     . GLY B 1 77  ? -29.450 -7.670  1.122   1.00 18.19 ? 86  GLY B O     1 
ATOM   1942 N  N     . GLU B 1 78  ? -27.348 -7.493  1.911   1.00 17.43 ? 87  GLU B N     1 
ATOM   1943 C  CA    . GLU B 1 78  ? -27.456 -6.084  2.306   1.00 17.59 ? 87  GLU B CA    1 
ATOM   1944 C  C     . GLU B 1 78  ? -26.961 -5.121  1.228   1.00 17.28 ? 87  GLU B C     1 
ATOM   1945 O  O     . GLU B 1 78  ? -27.240 -3.924  1.273   1.00 17.54 ? 87  GLU B O     1 
ATOM   1946 C  CB    . GLU B 1 78  ? -26.728 -5.857  3.628   1.00 17.71 ? 87  GLU B CB    1 
ATOM   1947 C  CG    . GLU B 1 78  ? -27.432 -6.518  4.794   1.00 18.86 ? 87  GLU B CG    1 
ATOM   1948 C  CD    . GLU B 1 78  ? -26.656 -6.441  6.094   1.00 19.86 ? 87  GLU B CD    1 
ATOM   1949 O  OE1   . GLU B 1 78  ? -25.548 -7.012  6.180   1.00 18.88 ? 87  GLU B OE1   1 
ATOM   1950 O  OE2   . GLU B 1 78  ? -27.182 -5.830  7.046   1.00 24.94 ? 87  GLU B OE2   1 
ATOM   1951 N  N     . GLY B 1 79  ? -26.234 -5.650  0.254   1.00 16.05 ? 88  GLY B N     1 
ATOM   1952 C  CA    . GLY B 1 79  ? -25.818 -4.895  -0.918  1.00 16.27 ? 88  GLY B CA    1 
ATOM   1953 C  C     . GLY B 1 79  ? -25.368 -5.861  -1.973  1.00 15.86 ? 88  GLY B C     1 
ATOM   1954 O  O     . GLY B 1 79  ? -24.944 -6.980  -1.637  1.00 16.06 ? 88  GLY B O     1 
ATOM   1955 N  N     . PHE B 1 80  ? -25.451 -5.433  -3.234  1.00 15.38 ? 89  PHE B N     1 
ATOM   1956 C  CA    . PHE B 1 80  ? -25.157 -6.281  -4.383  1.00 15.52 ? 89  PHE B CA    1 
ATOM   1957 C  C     . PHE B 1 80  ? -24.180 -5.616  -5.341  1.00 16.16 ? 89  PHE B C     1 
ATOM   1958 O  O     . PHE B 1 80  ? -24.359 -4.452  -5.710  1.00 16.91 ? 89  PHE B O     1 
ATOM   1959 C  CB    . PHE B 1 80  ? -26.456 -6.639  -5.123  1.00 15.70 ? 89  PHE B CB    1 
ATOM   1960 C  CG    . PHE B 1 80  ? -27.424 -7.399  -4.280  1.00 14.53 ? 89  PHE B CG    1 
ATOM   1961 C  CD1   . PHE B 1 80  ? -27.454 -8.791  -4.318  1.00 15.71 ? 89  PHE B CD1   1 
ATOM   1962 C  CD2   . PHE B 1 80  ? -28.257 -6.747  -3.405  1.00 14.84 ? 89  PHE B CD2   1 
ATOM   1963 C  CE1   . PHE B 1 80  ? -28.318 -9.493  -3.519  1.00 14.52 ? 89  PHE B CE1   1 
ATOM   1964 C  CE2   . PHE B 1 80  ? -29.111 -7.455  -2.587  1.00 14.73 ? 89  PHE B CE2   1 
ATOM   1965 C  CZ    . PHE B 1 80  ? -29.137 -8.831  -2.648  1.00 15.38 ? 89  PHE B CZ    1 
ATOM   1966 N  N     . LEU B 1 81  ? -23.155 -6.370  -5.735  1.00 16.89 ? 90  LEU B N     1 
ATOM   1967 C  CA    . LEU B 1 81  ? -22.294 -5.987  -6.845  1.00 17.41 ? 90  LEU B CA    1 
ATOM   1968 C  C     . LEU B 1 81  ? -22.890 -6.602  -8.094  1.00 16.76 ? 90  LEU B C     1 
ATOM   1969 O  O     . LEU B 1 81  ? -22.995 -7.836  -8.186  1.00 16.81 ? 90  LEU B O     1 
ATOM   1970 C  CB    . LEU B 1 81  ? -20.867 -6.506  -6.646  1.00 18.54 ? 90  LEU B CB    1 
ATOM   1971 C  CG    . LEU B 1 81  ? -19.958 -5.804  -5.638  1.00 20.26 ? 90  LEU B CG    1 
ATOM   1972 C  CD1   . LEU B 1 81  ? -18.532 -6.257  -5.870  1.00 22.36 ? 90  LEU B CD1   1 
ATOM   1973 C  CD2   . LEU B 1 81  ? -20.030 -4.267  -5.722  1.00 22.80 ? 90  LEU B CD2   1 
ATOM   1974 N  N     . LEU B 1 82  ? -23.315 -5.751  -9.027  1.00 16.52 ? 91  LEU B N     1 
ATOM   1975 C  CA    . LEU B 1 82  ? -23.901 -6.207  -10.282 1.00 16.06 ? 91  LEU B CA    1 
ATOM   1976 C  C     . LEU B 1 82  ? -22.768 -6.225  -11.290 1.00 15.90 ? 91  LEU B C     1 
ATOM   1977 O  O     . LEU B 1 82  ? -22.367 -5.174  -11.783 1.00 15.48 ? 91  LEU B O     1 
ATOM   1978 C  CB    . LEU B 1 82  ? -25.018 -5.254  -10.769 1.00 16.35 ? 91  LEU B CB    1 
ATOM   1979 C  CG    . LEU B 1 82  ? -26.166 -4.927  -9.803  1.00 17.02 ? 91  LEU B CG    1 
ATOM   1980 C  CD1   . LEU B 1 82  ? -27.135 -3.918  -10.413 1.00 19.08 ? 91  LEU B CD1   1 
ATOM   1981 C  CD2   . LEU B 1 82  ? -26.881 -6.221  -9.388  1.00 18.49 ? 91  LEU B CD2   1 
ATOM   1982 N  N     . VAL B 1 83  ? -22.255 -7.412  -11.602 1.00 15.21 ? 92  VAL B N     1 
ATOM   1983 C  CA    . VAL B 1 83  ? -21.045 -7.511  -12.430 1.00 15.22 ? 92  VAL B CA    1 
ATOM   1984 C  C     . VAL B 1 83  ? -21.380 -7.913  -13.863 1.00 15.22 ? 92  VAL B C     1 
ATOM   1985 O  O     . VAL B 1 83  ? -22.120 -8.866  -14.091 1.00 14.75 ? 92  VAL B O     1 
ATOM   1986 C  CB    . VAL B 1 83  ? -20.022 -8.523  -11.847 1.00 15.05 ? 92  VAL B CB    1 
ATOM   1987 C  CG1   . VAL B 1 83  ? -18.692 -8.478  -12.625 1.00 14.39 ? 92  VAL B CG1   1 
ATOM   1988 C  CG2   . VAL B 1 83  ? -19.743 -8.248  -10.375 1.00 15.54 ? 92  VAL B CG2   1 
ATOM   1989 N  N     . PHE B 1 84  ? -20.817 -7.185  -14.828 1.00 15.54 ? 93  PHE B N     1 
ATOM   1990 C  CA    . PHE B 1 84  ? -20.746 -7.653  -16.209 1.00 15.24 ? 93  PHE B CA    1 
ATOM   1991 C  C     . PHE B 1 84  ? -19.306 -7.523  -16.690 1.00 14.94 ? 93  PHE B C     1 
ATOM   1992 O  O     . PHE B 1 84  ? -18.479 -6.899  -16.027 1.00 15.26 ? 93  PHE B O     1 
ATOM   1993 C  CB    . PHE B 1 84  ? -21.724 -6.882  -17.110 1.00 15.43 ? 93  PHE B CB    1 
ATOM   1994 C  CG    . PHE B 1 84  ? -21.328 -5.459  -17.365 1.00 15.66 ? 93  PHE B CG    1 
ATOM   1995 C  CD1   . PHE B 1 84  ? -20.616 -5.121  -18.512 1.00 15.33 ? 93  PHE B CD1   1 
ATOM   1996 C  CD2   . PHE B 1 84  ? -21.657 -4.459  -16.474 1.00 16.09 ? 93  PHE B CD2   1 
ATOM   1997 C  CE1   . PHE B 1 84  ? -20.230 -3.817  -18.751 1.00 15.41 ? 93  PHE B CE1   1 
ATOM   1998 C  CE2   . PHE B 1 84  ? -21.276 -3.146  -16.716 1.00 16.47 ? 93  PHE B CE2   1 
ATOM   1999 C  CZ    . PHE B 1 84  ? -20.566 -2.828  -17.859 1.00 15.98 ? 93  PHE B CZ    1 
ATOM   2000 N  N     . SER B 1 85  ? -19.013 -8.159  -17.815 1.00 14.70 ? 94  SER B N     1 
ATOM   2001 C  CA    . SER B 1 85  ? -17.722 -8.026  -18.470 1.00 14.40 ? 94  SER B CA    1 
ATOM   2002 C  C     . SER B 1 85  ? -17.850 -7.035  -19.617 1.00 14.92 ? 94  SER B C     1 
ATOM   2003 O  O     . SER B 1 85  ? -18.735 -7.178  -20.461 1.00 13.96 ? 94  SER B O     1 
ATOM   2004 C  CB    . SER B 1 85  ? -17.271 -9.370  -19.024 1.00 14.92 ? 94  SER B CB    1 
ATOM   2005 O  OG    . SER B 1 85  ? -16.186 -9.195  -19.912 1.00 14.01 ? 94  SER B OG    1 
ATOM   2006 N  N     . VAL B 1 86  ? -16.942 -6.063  -19.671 1.00 15.22 ? 95  VAL B N     1 
ATOM   2007 C  CA    . VAL B 1 86  ? -16.954 -5.066  -20.756 1.00 15.92 ? 95  VAL B CA    1 
ATOM   2008 C  C     . VAL B 1 86  ? -16.631 -5.685  -22.118 1.00 15.78 ? 95  VAL B C     1 
ATOM   2009 O  O     . VAL B 1 86  ? -16.835 -5.047  -23.158 1.00 15.75 ? 95  VAL B O     1 
ATOM   2010 C  CB    . VAL B 1 86  ? -16.002 -3.878  -20.468 1.00 16.04 ? 95  VAL B CB    1 
ATOM   2011 C  CG1   . VAL B 1 86  ? -16.358 -3.226  -19.148 1.00 16.64 ? 95  VAL B CG1   1 
ATOM   2012 C  CG2   . VAL B 1 86  ? -14.544 -4.315  -20.494 1.00 17.02 ? 95  VAL B CG2   1 
ATOM   2013 N  N     . THR B 1 87  ? -16.134 -6.923  -22.118 1.00 15.92 ? 96  THR B N     1 
ATOM   2014 C  CA    . THR B 1 87  ? -15.884 -7.657  -23.359 1.00 16.76 ? 96  THR B CA    1 
ATOM   2015 C  C     . THR B 1 87  ? -17.071 -8.532  -23.786 1.00 16.75 ? 96  THR B C     1 
ATOM   2016 O  O     . THR B 1 87  ? -17.002 -9.196  -24.820 1.00 16.62 ? 96  THR B O     1 
ATOM   2017 C  CB    . THR B 1 87  ? -14.650 -8.578  -23.227 1.00 16.68 ? 96  THR B CB    1 
ATOM   2018 O  OG1   . THR B 1 87  ? -14.938 -9.626  -22.295 1.00 17.63 ? 96  THR B OG1   1 
ATOM   2019 C  CG2   . THR B 1 87  ? -13.444 -7.802  -22.764 1.00 17.52 ? 96  THR B CG2   1 
ATOM   2020 N  N     . ASP B 1 88  ? -18.153 -8.527  -23.007 1.00 17.34 ? 97  ASP B N     1 
ATOM   2021 C  CA    . ASP B 1 88  ? -19.294 -9.406  -23.258 1.00 18.06 ? 97  ASP B CA    1 
ATOM   2022 C  C     . ASP B 1 88  ? -20.609 -8.625  -23.191 1.00 17.91 ? 97  ASP B C     1 
ATOM   2023 O  O     . ASP B 1 88  ? -21.172 -8.429  -22.117 1.00 17.58 ? 97  ASP B O     1 
ATOM   2024 C  CB    . ASP B 1 88  ? -19.294 -10.545 -22.231 1.00 18.85 ? 97  ASP B CB    1 
ATOM   2025 C  CG    . ASP B 1 88  ? -20.416 -11.554 -22.453 1.00 20.85 ? 97  ASP B CG    1 
ATOM   2026 O  OD1   . ASP B 1 88  ? -21.313 -11.319 -23.303 1.00 23.06 ? 97  ASP B OD1   1 
ATOM   2027 O  OD2   . ASP B 1 88  ? -20.397 -12.598 -21.766 1.00 23.19 ? 97  ASP B OD2   1 
ATOM   2028 N  N     . ARG B 1 89  ? -21.093 -8.189  -24.348 1.00 17.63 ? 98  ARG B N     1 
ATOM   2029 C  CA    . ARG B 1 89  ? -22.333 -7.428  -24.406 1.00 18.10 ? 98  ARG B CA    1 
ATOM   2030 C  C     . ARG B 1 89  ? -23.511 -8.197  -23.817 1.00 17.78 ? 98  ARG B C     1 
ATOM   2031 O  O     . ARG B 1 89  ? -24.391 -7.596  -23.219 1.00 17.69 ? 98  ARG B O     1 
ATOM   2032 C  CB    . ARG B 1 89  ? -22.669 -7.034  -25.836 1.00 18.32 ? 98  ARG B CB    1 
ATOM   2033 C  CG    . ARG B 1 89  ? -23.733 -5.953  -25.935 1.00 19.88 ? 98  ARG B CG    1 
ATOM   2034 C  CD    . ARG B 1 89  ? -23.089 -4.602  -25.975 1.00 22.02 ? 98  ARG B CD    1 
ATOM   2035 N  NE    . ARG B 1 89  ? -24.057 -3.517  -25.908 1.00 22.75 ? 98  ARG B NE    1 
ATOM   2036 C  CZ    . ARG B 1 89  ? -23.749 -2.236  -26.070 1.00 23.37 ? 98  ARG B CZ    1 
ATOM   2037 N  NH1   . ARG B 1 89  ? -22.498 -1.882  -26.322 1.00 24.26 ? 98  ARG B NH1   1 
ATOM   2038 N  NH2   . ARG B 1 89  ? -24.696 -1.312  -25.988 1.00 24.20 ? 98  ARG B NH2   1 
ATOM   2039 N  N     . GLY B 1 90  ? -23.540 -9.515  -24.012 1.00 17.76 ? 99  GLY B N     1 
ATOM   2040 C  CA    . GLY B 1 90  ? -24.597 -10.350 -23.436 1.00 17.94 ? 99  GLY B CA    1 
ATOM   2041 C  C     . GLY B 1 90  ? -24.713 -10.208 -21.928 1.00 18.00 ? 99  GLY B C     1 
ATOM   2042 O  O     . GLY B 1 90  ? -25.810 -10.097 -21.387 1.00 17.56 ? 99  GLY B O     1 
ATOM   2043 N  N     . SER B 1 91  ? -23.568 -10.184 -21.251 1.00 17.98 ? 100 SER B N     1 
ATOM   2044 C  CA    . SER B 1 91  ? -23.531 -10.034 -19.795 1.00 18.15 ? 100 SER B CA    1 
ATOM   2045 C  C     . SER B 1 91  ? -24.024 -8.655  -19.357 1.00 18.03 ? 100 SER B C     1 
ATOM   2046 O  O     . SER B 1 91  ? -24.660 -8.519  -18.321 1.00 17.78 ? 100 SER B O     1 
ATOM   2047 C  CB    . SER B 1 91  ? -22.120 -10.285 -19.244 1.00 18.50 ? 100 SER B CB    1 
ATOM   2048 O  OG    . SER B 1 91  ? -21.213 -9.231  -19.555 1.00 18.57 ? 100 SER B OG    1 
ATOM   2049 N  N     . PHE B 1 92  ? -23.702 -7.646  -20.158 1.00 18.10 ? 101 PHE B N     1 
ATOM   2050 C  CA    . PHE B 1 92  ? -24.173 -6.277  -19.955 1.00 18.49 ? 101 PHE B CA    1 
ATOM   2051 C  C     . PHE B 1 92  ? -25.694 -6.229  -20.035 1.00 19.60 ? 101 PHE B C     1 
ATOM   2052 O  O     . PHE B 1 92  ? -26.360 -5.622  -19.179 1.00 19.92 ? 101 PHE B O     1 
ATOM   2053 C  CB    . PHE B 1 92  ? -23.557 -5.385  -21.039 1.00 18.10 ? 101 PHE B CB    1 
ATOM   2054 C  CG    . PHE B 1 92  ? -23.873 -3.920  -20.903 1.00 17.58 ? 101 PHE B CG    1 
ATOM   2055 C  CD1   . PHE B 1 92  ? -23.550 -3.231  -19.748 1.00 18.82 ? 101 PHE B CD1   1 
ATOM   2056 C  CD2   . PHE B 1 92  ? -24.468 -3.225  -21.953 1.00 18.75 ? 101 PHE B CD2   1 
ATOM   2057 C  CE1   . PHE B 1 92  ? -23.822 -1.880  -19.630 1.00 18.50 ? 101 PHE B CE1   1 
ATOM   2058 C  CE2   . PHE B 1 92  ? -24.743 -1.869  -21.840 1.00 18.80 ? 101 PHE B CE2   1 
ATOM   2059 C  CZ    . PHE B 1 92  ? -24.406 -1.198  -20.674 1.00 17.89 ? 101 PHE B CZ    1 
ATOM   2060 N  N     . GLU B 1 93  ? -26.225 -6.889  -21.064 1.00 20.43 ? 102 GLU B N     1 
ATOM   2061 C  CA    . GLU B 1 93  ? -27.664 -6.980  -21.314 1.00 21.69 ? 102 GLU B CA    1 
ATOM   2062 C  C     . GLU B 1 93  ? -28.397 -7.900  -20.325 1.00 21.94 ? 102 GLU B C     1 
ATOM   2063 O  O     . GLU B 1 93  ? -29.619 -7.958  -20.353 1.00 22.80 ? 102 GLU B O     1 
ATOM   2064 C  CB    . GLU B 1 93  ? -27.924 -7.467  -22.753 1.00 21.81 ? 102 GLU B CB    1 
ATOM   2065 C  CG    . GLU B 1 93  ? -27.513 -6.479  -23.859 1.00 22.50 ? 102 GLU B CG    1 
ATOM   2066 C  CD    . GLU B 1 93  ? -27.370 -7.118  -25.248 1.00 22.92 ? 102 GLU B CD    1 
ATOM   2067 O  OE1   . GLU B 1 93  ? -27.363 -8.365  -25.361 1.00 24.97 ? 102 GLU B OE1   1 
ATOM   2068 O  OE2   . GLU B 1 93  ? -27.249 -6.365  -26.242 1.00 24.49 ? 102 GLU B OE2   1 
ATOM   2069 N  N     . GLU B 1 94  ? -27.662 -8.631  -19.488 1.00 21.77 ? 103 GLU B N     1 
ATOM   2070 C  CA    . GLU B 1 94  ? -28.256 -9.480  -18.438 1.00 22.04 ? 103 GLU B CA    1 
ATOM   2071 C  C     . GLU B 1 94  ? -28.431 -8.738  -17.109 1.00 20.84 ? 103 GLU B C     1 
ATOM   2072 O  O     . GLU B 1 94  ? -29.144 -9.200  -16.219 1.00 20.44 ? 103 GLU B O     1 
ATOM   2073 C  CB    . GLU B 1 94  ? -27.369 -10.707 -18.212 1.00 22.16 ? 103 GLU B CB    1 
ATOM   2074 C  CG    . GLU B 1 94  ? -28.014 -11.826 -17.419 1.00 24.19 ? 103 GLU B CG    1 
ATOM   2075 C  CD    . GLU B 1 94  ? -27.136 -13.070 -17.320 1.00 24.81 ? 103 GLU B CD    1 
ATOM   2076 O  OE1   . GLU B 1 94  ? -26.302 -13.291 -18.222 1.00 29.35 ? 103 GLU B OE1   1 
ATOM   2077 O  OE2   . GLU B 1 94  ? -27.297 -13.842 -16.345 1.00 30.04 ? 103 GLU B OE2   1 
ATOM   2078 N  N     . ILE B 1 95  ? -27.786 -7.584  -16.974 1.00 20.03 ? 104 ILE B N     1 
ATOM   2079 C  CA    . ILE B 1 95  ? -27.781 -6.858  -15.714 1.00 19.68 ? 104 ILE B CA    1 
ATOM   2080 C  C     . ILE B 1 95  ? -29.200 -6.535  -15.248 1.00 19.41 ? 104 ILE B C     1 
ATOM   2081 O  O     . ILE B 1 95  ? -29.503 -6.660  -14.066 1.00 19.29 ? 104 ILE B O     1 
ATOM   2082 C  CB    . ILE B 1 95  ? -26.935 -5.548  -15.810 1.00 19.43 ? 104 ILE B CB    1 
ATOM   2083 C  CG1   . ILE B 1 95  ? -25.432 -5.875  -15.894 1.00 19.62 ? 104 ILE B CG1   1 
ATOM   2084 C  CG2   . ILE B 1 95  ? -27.226 -4.606  -14.657 1.00 19.76 ? 104 ILE B CG2   1 
ATOM   2085 C  CD1   . ILE B 1 95  ? -24.819 -6.462  -14.627 1.00 20.46 ? 104 ILE B CD1   1 
ATOM   2086 N  N     . TYR B 1 96  ? -30.062 -6.112  -16.163 1.00 19.23 ? 105 TYR B N     1 
ATOM   2087 C  CA    . TYR B 1 96  ? -31.433 -5.737  -15.791 1.00 19.01 ? 105 TYR B CA    1 
ATOM   2088 C  C     . TYR B 1 96  ? -32.166 -6.854  -15.039 1.00 18.85 ? 105 TYR B C     1 
ATOM   2089 O  O     . TYR B 1 96  ? -32.966 -6.566  -14.158 1.00 18.63 ? 105 TYR B O     1 
ATOM   2090 C  CB    . TYR B 1 96  ? -32.256 -5.329  -17.025 1.00 19.51 ? 105 TYR B CB    1 
ATOM   2091 C  CG    . TYR B 1 96  ? -32.839 -6.520  -17.750 1.00 20.03 ? 105 TYR B CG    1 
ATOM   2092 C  CD1   . TYR B 1 96  ? -34.160 -6.928  -17.533 1.00 21.53 ? 105 TYR B CD1   1 
ATOM   2093 C  CD2   . TYR B 1 96  ? -32.061 -7.256  -18.628 1.00 21.21 ? 105 TYR B CD2   1 
ATOM   2094 C  CE1   . TYR B 1 96  ? -34.690 -8.030  -18.200 1.00 21.81 ? 105 TYR B CE1   1 
ATOM   2095 C  CE2   . TYR B 1 96  ? -32.570 -8.355  -19.294 1.00 21.46 ? 105 TYR B CE2   1 
ATOM   2096 C  CZ    . TYR B 1 96  ? -33.885 -8.739  -19.076 1.00 21.13 ? 105 TYR B CZ    1 
ATOM   2097 O  OH    . TYR B 1 96  ? -34.367 -9.841  -19.725 1.00 20.64 ? 105 TYR B OH    1 
ATOM   2098 N  N     . LYS B 1 97  ? -31.919 -8.114  -15.408 1.00 18.76 ? 106 LYS B N     1 
ATOM   2099 C  CA    . LYS B 1 97  ? -32.598 -9.260  -14.788 1.00 18.72 ? 106 LYS B CA    1 
ATOM   2100 C  C     . LYS B 1 97  ? -32.273 -9.345  -13.300 1.00 18.21 ? 106 LYS B C     1 
ATOM   2101 O  O     . LYS B 1 97  ? -33.163 -9.545  -12.472 1.00 17.60 ? 106 LYS B O     1 
ATOM   2102 C  CB    . LYS B 1 97  ? -32.186 -10.585 -15.438 1.00 18.74 ? 106 LYS B CB    1 
ATOM   2103 C  CG    . LYS B 1 97  ? -32.596 -10.751 -16.869 1.00 19.66 ? 106 LYS B CG    1 
ATOM   2104 C  CD    . LYS B 1 97  ? -32.334 -12.173 -17.364 1.00 20.02 ? 106 LYS B CD    1 
ATOM   2105 N  N     . PHE B 1 98  ? -30.988 -9.208  -12.979 1.00 17.60 ? 107 PHE B N     1 
ATOM   2106 C  CA    . PHE B 1 98  ? -30.540 -9.235  -11.596 1.00 17.47 ? 107 PHE B CA    1 
ATOM   2107 C  C     . PHE B 1 98  ? -31.116 -8.053  -10.801 1.00 17.07 ? 107 PHE B C     1 
ATOM   2108 O  O     . PHE B 1 98  ? -31.634 -8.255  -9.713  1.00 15.76 ? 107 PHE B O     1 
ATOM   2109 C  CB    . PHE B 1 98  ? -29.003 -9.242  -11.516 1.00 17.68 ? 107 PHE B CB    1 
ATOM   2110 C  CG    . PHE B 1 98  ? -28.370 -10.456 -12.141 1.00 17.87 ? 107 PHE B CG    1 
ATOM   2111 C  CD1   . PHE B 1 98  ? -28.418 -11.678 -11.501 1.00 19.28 ? 107 PHE B CD1   1 
ATOM   2112 C  CD2   . PHE B 1 98  ? -27.708 -10.368 -13.359 1.00 18.36 ? 107 PHE B CD2   1 
ATOM   2113 C  CE1   . PHE B 1 98  ? -27.830 -12.812 -12.067 1.00 19.73 ? 107 PHE B CE1   1 
ATOM   2114 C  CE2   . PHE B 1 98  ? -27.120 -11.491 -13.929 1.00 19.64 ? 107 PHE B CE2   1 
ATOM   2115 C  CZ    . PHE B 1 98  ? -27.184 -12.714 -13.280 1.00 18.47 ? 107 PHE B CZ    1 
ATOM   2116 N  N     . GLN B 1 99  ? -31.034 -6.837  -11.344 1.00 17.45 ? 108 GLN B N     1 
ATOM   2117 C  CA    . GLN B 1 99  ? -31.565 -5.659  -10.662 1.00 17.39 ? 108 GLN B CA    1 
ATOM   2118 C  C     . GLN B 1 99  ? -33.058 -5.840  -10.351 1.00 17.32 ? 108 GLN B C     1 
ATOM   2119 O  O     . GLN B 1 99  ? -33.504 -5.613  -9.219  1.00 17.25 ? 108 GLN B O     1 
ATOM   2120 C  CB    . GLN B 1 99  ? -31.332 -4.387  -11.491 1.00 17.62 ? 108 GLN B CB    1 
ATOM   2121 C  CG    . GLN B 1 99  ? -31.735 -3.054  -10.814 1.00 19.39 ? 108 GLN B CG    1 
ATOM   2122 C  CD    . GLN B 1 99  ? -32.967 -2.385  -11.413 1.00 23.97 ? 108 GLN B CD    1 
ATOM   2123 O  OE1   . GLN B 1 99  ? -33.716 -2.992  -12.170 1.00 26.97 ? 108 GLN B OE1   1 
ATOM   2124 N  NE2   . GLN B 1 99  ? -33.179 -1.114  -11.066 1.00 25.58 ? 108 GLN B NE2   1 
ATOM   2125 N  N     . ARG B 1 100 ? -33.828 -6.240  -11.359 1.00 17.02 ? 109 ARG B N     1 
ATOM   2126 C  CA    . ARG B 1 100 ? -35.269 -6.433  -11.180 1.00 17.15 ? 109 ARG B CA    1 
ATOM   2127 C  C     . ARG B 1 100 ? -35.605 -7.558  -10.200 1.00 16.93 ? 109 ARG B C     1 
ATOM   2128 O  O     . ARG B 1 100 ? -36.571 -7.452  -9.445  1.00 16.50 ? 109 ARG B O     1 
ATOM   2129 C  CB    . ARG B 1 100 ? -35.958 -6.683  -12.526 1.00 16.73 ? 109 ARG B CB    1 
ATOM   2130 C  CG    . ARG B 1 100 ? -36.104 -5.447  -13.380 1.00 18.30 ? 109 ARG B CG    1 
ATOM   2131 C  CD    . ARG B 1 100 ? -36.633 -5.809  -14.778 1.00 19.00 ? 109 ARG B CD    1 
ATOM   2132 N  NE    . ARG B 1 100 ? -37.973 -6.394  -14.776 1.00 21.07 ? 109 ARG B NE    1 
ATOM   2133 C  CZ    . ARG B 1 100 ? -39.117 -5.702  -14.820 1.00 22.20 ? 109 ARG B CZ    1 
ATOM   2134 N  NH1   . ARG B 1 100 ? -39.110 -4.376  -14.802 1.00 23.87 ? 109 ARG B NH1   1 
ATOM   2135 N  NH2   . ARG B 1 100 ? -40.284 -6.337  -14.843 1.00 22.61 ? 109 ARG B NH2   1 
ATOM   2136 N  N     . GLN B 1 101 ? -34.819 -8.635  -10.217 1.00 17.18 ? 110 GLN B N     1 
ATOM   2137 C  CA    . GLN B 1 101 ? -35.054 -9.756  -9.312  1.00 17.14 ? 110 GLN B CA    1 
ATOM   2138 C  C     . GLN B 1 101 ? -34.837 -9.327  -7.876  1.00 16.96 ? 110 GLN B C     1 
ATOM   2139 O  O     . GLN B 1 101 ? -35.631 -9.669  -6.989  1.00 16.63 ? 110 GLN B O     1 
ATOM   2140 C  CB    . GLN B 1 101 ? -34.138 -10.929 -9.647  1.00 17.70 ? 110 GLN B CB    1 
ATOM   2141 C  CG    . GLN B 1 101 ? -34.334 -12.132 -8.742  1.00 18.62 ? 110 GLN B CG    1 
ATOM   2142 N  N     . ILE B 1 102 ? -33.771 -8.562  -7.654  1.00 16.43 ? 111 ILE B N     1 
ATOM   2143 C  CA    . ILE B 1 102 ? -33.418 -8.111  -6.314  1.00 16.65 ? 111 ILE B CA    1 
ATOM   2144 C  C     . ILE B 1 102 ? -34.542 -7.216  -5.790  1.00 16.42 ? 111 ILE B C     1 
ATOM   2145 O  O     . ILE B 1 102 ? -35.059 -7.441  -4.701  1.00 16.53 ? 111 ILE B O     1 
ATOM   2146 C  CB    . ILE B 1 102 ? -32.067 -7.367  -6.282  1.00 16.67 ? 111 ILE B CB    1 
ATOM   2147 C  CG1   . ILE B 1 102 ? -30.919 -8.329  -6.583  1.00 16.67 ? 111 ILE B CG1   1 
ATOM   2148 C  CG2   . ILE B 1 102 ? -31.842 -6.717  -4.914  1.00 17.08 ? 111 ILE B CG2   1 
ATOM   2149 C  CD1   . ILE B 1 102 ? -29.623 -7.643  -7.007  1.00 16.56 ? 111 ILE B CD1   1 
ATOM   2150 N  N     . LEU B 1 103 ? -34.927 -6.211  -6.577  1.00 16.06 ? 112 LEU B N     1 
ATOM   2151 C  CA    . LEU B 1 103 ? -35.979 -5.289  -6.147  1.00 16.19 ? 112 LEU B CA    1 
ATOM   2152 C  C     . LEU B 1 103 ? -37.316 -6.005  -5.934  1.00 16.10 ? 112 LEU B C     1 
ATOM   2153 O  O     . LEU B 1 103 ? -38.084 -5.624  -5.052  1.00 16.18 ? 112 LEU B O     1 
ATOM   2154 C  CB    . LEU B 1 103 ? -36.129 -4.128  -7.130  1.00 16.39 ? 112 LEU B CB    1 
ATOM   2155 C  CG    . LEU B 1 103 ? -34.930 -3.187  -7.255  1.00 17.59 ? 112 LEU B CG    1 
ATOM   2156 C  CD1   . LEU B 1 103 ? -35.277 -2.123  -8.269  1.00 18.76 ? 112 LEU B CD1   1 
ATOM   2157 C  CD2   . LEU B 1 103 ? -34.522 -2.565  -5.906  1.00 18.69 ? 112 LEU B CD2   1 
ATOM   2158 N  N     . ARG B 1 104 ? -37.591 -7.058  -6.708  1.00 16.07 ? 113 ARG B N     1 
ATOM   2159 C  CA    . ARG B 1 104 ? -38.817 -7.830  -6.504  1.00 16.55 ? 113 ARG B CA    1 
ATOM   2160 C  C     . ARG B 1 104 ? -38.789 -8.568  -5.159  1.00 16.06 ? 113 ARG B C     1 
ATOM   2161 O  O     . ARG B 1 104 ? -39.754 -8.543  -4.407  1.00 15.52 ? 113 ARG B O     1 
ATOM   2162 C  CB    . ARG B 1 104 ? -39.022 -8.827  -7.646  1.00 16.56 ? 113 ARG B CB    1 
ATOM   2163 C  CG    A ARG B 1 104 ? -40.331 -9.570  -7.637  0.50 17.23 ? 113 ARG B CG    1 
ATOM   2164 C  CG    B ARG B 1 104 ? -40.382 -9.497  -7.619  0.50 17.37 ? 113 ARG B CG    1 
ATOM   2165 C  CD    A ARG B 1 104 ? -40.546 -10.319 -8.954  0.50 17.68 ? 113 ARG B CD    1 
ATOM   2166 C  CD    B ARG B 1 104 ? -40.570 -10.460 -8.780  0.50 17.90 ? 113 ARG B CD    1 
ATOM   2167 N  NE    A ARG B 1 104 ? -39.573 -11.399 -9.171  0.50 18.96 ? 113 ARG B NE    1 
ATOM   2168 N  NE    B ARG B 1 104 ? -41.977 -10.642 -9.140  0.50 19.55 ? 113 ARG B NE    1 
ATOM   2169 C  CZ    A ARG B 1 104 ? -38.529 -11.367 -10.008 0.50 19.26 ? 113 ARG B CZ    1 
ATOM   2170 C  CZ    B ARG B 1 104 ? -42.870 -11.324 -8.422  0.50 19.69 ? 113 ARG B CZ    1 
ATOM   2171 N  NH1   A ARG B 1 104 ? -38.256 -10.301 -10.759 0.50 19.76 ? 113 ARG B NH1   1 
ATOM   2172 N  NH1   B ARG B 1 104 ? -44.119 -11.427 -8.857  0.50 19.85 ? 113 ARG B NH1   1 
ATOM   2173 N  NH2   A ARG B 1 104 ? -37.735 -12.429 -10.093 0.50 18.80 ? 113 ARG B NH2   1 
ATOM   2174 N  NH2   B ARG B 1 104 ? -42.533 -11.893 -7.267  0.50 20.79 ? 113 ARG B NH2   1 
ATOM   2175 N  N     . VAL B 1 105 ? -37.670 -9.218  -4.857  1.00 16.07 ? 114 VAL B N     1 
ATOM   2176 C  CA    . VAL B 1 105 ? -37.556 -9.972  -3.608  1.00 15.99 ? 114 VAL B CA    1 
ATOM   2177 C  C     . VAL B 1 105 ? -37.589 -9.026  -2.409  1.00 15.68 ? 114 VAL B C     1 
ATOM   2178 O  O     . VAL B 1 105 ? -38.207 -9.334  -1.381  1.00 16.15 ? 114 VAL B O     1 
ATOM   2179 C  CB    . VAL B 1 105 ? -36.281 -10.831 -3.588  1.00 16.26 ? 114 VAL B CB    1 
ATOM   2180 C  CG1   . VAL B 1 105 ? -36.099 -11.493 -2.235  1.00 17.23 ? 114 VAL B CG1   1 
ATOM   2181 C  CG2   . VAL B 1 105 ? -36.358 -11.896 -4.679  1.00 16.66 ? 114 VAL B CG2   1 
ATOM   2182 N  N     . LYS B 1 106 ? -36.948 -7.873  -2.552  1.00 15.53 ? 115 LYS B N     1 
ATOM   2183 C  CA    . LYS B 1 106 ? -36.952 -6.840  -1.499  1.00 15.78 ? 115 LYS B CA    1 
ATOM   2184 C  C     . LYS B 1 106 ? -38.262 -6.057  -1.374  1.00 15.97 ? 115 LYS B C     1 
ATOM   2185 O  O     . LYS B 1 106 ? -38.516 -5.431  -0.335  1.00 15.00 ? 115 LYS B O     1 
ATOM   2186 C  CB    . LYS B 1 106 ? -35.818 -5.847  -1.736  1.00 15.79 ? 115 LYS B CB    1 
ATOM   2187 C  CG    . LYS B 1 106 ? -34.423 -6.432  -1.721  1.00 16.05 ? 115 LYS B CG    1 
ATOM   2188 C  CD    . LYS B 1 106 ? -34.017 -6.979  -0.362  1.00 17.02 ? 115 LYS B CD    1 
ATOM   2189 C  CE    . LYS B 1 106 ? -32.556 -7.343  -0.349  1.00 18.13 ? 115 LYS B CE    1 
ATOM   2190 N  NZ    . LYS B 1 106 ? -32.151 -7.943  0.941   1.00 17.82 ? 115 LYS B NZ    1 
ATOM   2191 N  N     . ASP B 1 107 ? -39.080 -6.082  -2.424  1.00 15.99 ? 116 ASP B N     1 
ATOM   2192 C  CA    . ASP B 1 107 ? -40.309 -5.275  -2.497  1.00 16.38 ? 116 ASP B CA    1 
ATOM   2193 C  C     . ASP B 1 107 ? -40.001 -3.781  -2.294  1.00 16.17 ? 116 ASP B C     1 
ATOM   2194 O  O     . ASP B 1 107 ? -40.695 -3.072  -1.572  1.00 16.45 ? 116 ASP B O     1 
ATOM   2195 C  CB    . ASP B 1 107 ? -41.370 -5.762  -1.501  1.00 16.78 ? 116 ASP B CB    1 
ATOM   2196 C  CG    . ASP B 1 107 ? -42.755 -5.208  -1.804  1.00 17.07 ? 116 ASP B CG    1 
ATOM   2197 O  OD1   . ASP B 1 107 ? -43.017 -4.834  -2.967  1.00 18.40 ? 116 ASP B OD1   1 
ATOM   2198 O  OD2   . ASP B 1 107 ? -43.593 -5.142  -0.887  1.00 19.68 ? 116 ASP B OD2   1 
ATOM   2199 N  N     . ARG B 1 108 ? -38.952 -3.323  -2.960  1.00 16.84 ? 117 ARG B N     1 
ATOM   2200 C  CA    . ARG B 1 108 ? -38.490 -1.947  -2.842  1.00 17.02 ? 117 ARG B CA    1 
ATOM   2201 C  C     . ARG B 1 108 ? -38.271 -1.375  -4.228  1.00 16.76 ? 117 ARG B C     1 
ATOM   2202 O  O     . ARG B 1 108 ? -38.089 -2.107  -5.190  1.00 16.05 ? 117 ARG B O     1 
ATOM   2203 C  CB    . ARG B 1 108 ? -37.186 -1.905  -2.037  1.00 18.15 ? 117 ARG B CB    1 
ATOM   2204 C  CG    . ARG B 1 108 ? -37.373 -2.083  -0.534  1.00 22.53 ? 117 ARG B CG    1 
ATOM   2205 C  CD    . ARG B 1 108 ? -36.027 -2.189  0.127   1.00 28.32 ? 117 ARG B CD    1 
ATOM   2206 N  NE    . ARG B 1 108 ? -36.045 -2.283  1.592   1.00 31.16 ? 117 ARG B NE    1 
ATOM   2207 C  CZ    . ARG B 1 108 ? -36.192 -3.403  2.308   1.00 32.76 ? 117 ARG B CZ    1 
ATOM   2208 N  NH1   . ARG B 1 108 ? -36.153 -3.327  3.635   1.00 33.76 ? 117 ARG B NH1   1 
ATOM   2209 N  NH2   . ARG B 1 108 ? -36.407 -4.588  1.737   1.00 32.61 ? 117 ARG B NH2   1 
ATOM   2210 N  N     . ASP B 1 109 ? -38.287 -0.055  -4.319  1.00 15.42 ? 118 ASP B N     1 
ATOM   2211 C  CA    . ASP B 1 109 ? -38.023 0.639   -5.571  1.00 16.28 ? 118 ASP B CA    1 
ATOM   2212 C  C     . ASP B 1 109 ? -36.535 0.895   -5.790  1.00 16.40 ? 118 ASP B C     1 
ATOM   2213 O  O     . ASP B 1 109 ? -36.102 1.121   -6.921  1.00 16.63 ? 118 ASP B O     1 
ATOM   2214 C  CB    . ASP B 1 109 ? -38.767 1.966   -5.575  1.00 15.73 ? 118 ASP B CB    1 
ATOM   2215 C  CG    . ASP B 1 109 ? -40.274 1.791   -5.557  1.00 17.22 ? 118 ASP B CG    1 
ATOM   2216 O  OD1   . ASP B 1 109 ? -40.796 0.853   -6.201  1.00 17.77 ? 118 ASP B OD1   1 
ATOM   2217 O  OD2   . ASP B 1 109 ? -40.956 2.613   -4.918  1.00 17.16 ? 118 ASP B OD2   1 
ATOM   2218 N  N     . GLU B 1 110 ? -35.776 0.907   -4.699  1.00 16.44 ? 119 GLU B N     1 
ATOM   2219 C  CA    . GLU B 1 110 ? -34.324 0.996   -4.761  1.00 18.00 ? 119 GLU B CA    1 
ATOM   2220 C  C     . GLU B 1 110 ? -33.699 0.230   -3.621  1.00 16.88 ? 119 GLU B C     1 
ATOM   2221 O  O     . GLU B 1 110 ? -34.305 0.008   -2.571  1.00 16.58 ? 119 GLU B O     1 
ATOM   2222 C  CB    . GLU B 1 110 ? -33.853 2.443   -4.681  1.00 17.88 ? 119 GLU B CB    1 
ATOM   2223 C  CG    . GLU B 1 110 ? -34.376 3.326   -5.794  1.00 21.05 ? 119 GLU B CG    1 
ATOM   2224 C  CD    . GLU B 1 110 ? -33.775 4.699   -5.784  1.00 21.91 ? 119 GLU B CD    1 
ATOM   2225 O  OE1   . GLU B 1 110 ? -32.548 4.804   -5.566  1.00 28.39 ? 119 GLU B OE1   1 
ATOM   2226 O  OE2   . GLU B 1 110 ? -34.528 5.670   -6.010  1.00 29.17 ? 119 GLU B OE2   1 
ATOM   2227 N  N     . PHE B 1 111 ? -32.448 -0.139  -3.826  1.00 16.81 ? 120 PHE B N     1 
ATOM   2228 C  CA    . PHE B 1 111 ? -31.720 -0.921  -2.849  1.00 16.42 ? 120 PHE B CA    1 
ATOM   2229 C  C     . PHE B 1 111 ? -30.220 -0.845  -3.188  1.00 16.63 ? 120 PHE B C     1 
ATOM   2230 O  O     . PHE B 1 111 ? -29.871 -0.778  -4.372  1.00 17.14 ? 120 PHE B O     1 
ATOM   2231 C  CB    . PHE B 1 111 ? -32.218 -2.372  -2.844  1.00 17.35 ? 120 PHE B CB    1 
ATOM   2232 C  CG    . PHE B 1 111 ? -31.724 -3.152  -1.676  1.00 16.70 ? 120 PHE B CG    1 
ATOM   2233 C  CD1   . PHE B 1 111 ? -32.402 -3.112  -0.470  1.00 17.10 ? 120 PHE B CD1   1 
ATOM   2234 C  CD2   . PHE B 1 111 ? -30.534 -3.875  -1.764  1.00 17.76 ? 120 PHE B CD2   1 
ATOM   2235 C  CE1   . PHE B 1 111 ? -31.922 -3.799  0.638   1.00 18.06 ? 120 PHE B CE1   1 
ATOM   2236 C  CE2   . PHE B 1 111 ? -30.052 -4.557  -0.670  1.00 18.19 ? 120 PHE B CE2   1 
ATOM   2237 C  CZ    . PHE B 1 111 ? -30.739 -4.517  0.534   1.00 17.96 ? 120 PHE B CZ    1 
ATOM   2238 N  N     . PRO B 1 112 ? -29.341 -0.815  -2.162  1.00 16.59 ? 121 PRO B N     1 
ATOM   2239 C  CA    . PRO B 1 112 ? -27.883 -0.748  -2.369  1.00 16.51 ? 121 PRO B CA    1 
ATOM   2240 C  C     . PRO B 1 112 ? -27.282 -1.722  -3.391  1.00 16.90 ? 121 PRO B C     1 
ATOM   2241 O  O     . PRO B 1 112 ? -27.283 -2.957  -3.199  1.00 16.91 ? 121 PRO B O     1 
ATOM   2242 C  CB    . PRO B 1 112 ? -27.324 -1.003  -0.964  1.00 16.58 ? 121 PRO B CB    1 
ATOM   2243 C  CG    . PRO B 1 112 ? -28.339 -0.454  -0.074  1.00 16.76 ? 121 PRO B CG    1 
ATOM   2244 C  CD    . PRO B 1 112 ? -29.670 -0.734  -0.729  1.00 16.72 ? 121 PRO B CD    1 
ATOM   2245 N  N     . MET B 1 113 ? -26.789 -1.144  -4.479  1.00 17.27 ? 122 MET B N     1 
ATOM   2246 C  CA    . MET B 1 113 ? -26.164 -1.878  -5.557  1.00 18.02 ? 122 MET B CA    1 
ATOM   2247 C  C     . MET B 1 113 ? -25.108 -0.991  -6.198  1.00 17.42 ? 122 MET B C     1 
ATOM   2248 O  O     . MET B 1 113 ? -25.183 0.250   -6.125  1.00 16.60 ? 122 MET B O     1 
ATOM   2249 C  CB    . MET B 1 113 ? -27.179 -2.237  -6.639  1.00 18.33 ? 122 MET B CB    1 
ATOM   2250 C  CG    . MET B 1 113 ? -28.341 -3.092  -6.206  1.00 19.42 ? 122 MET B CG    1 
ATOM   2251 S  SD    . MET B 1 113 ? -29.462 -3.335  -7.592  1.00 22.63 ? 122 MET B SD    1 
ATOM   2252 C  CE    . MET B 1 113 ? -30.913 -3.888  -6.730  1.00 23.20 ? 122 MET B CE    1 
ATOM   2253 N  N     . ILE B 1 114 ? -24.138 -1.631  -6.835  1.00 16.05 ? 123 ILE B N     1 
ATOM   2254 C  CA    . ILE B 1 114 ? -23.171 -0.932  -7.710  1.00 16.15 ? 123 ILE B CA    1 
ATOM   2255 C  C     . ILE B 1 114 ? -22.977 -1.748  -8.960  1.00 15.74 ? 123 ILE B C     1 
ATOM   2256 O  O     . ILE B 1 114 ? -22.990 -2.978  -8.923  1.00 15.84 ? 123 ILE B O     1 
ATOM   2257 C  CB    . ILE B 1 114 ? -21.779 -0.611  -7.022  1.00 16.31 ? 123 ILE B CB    1 
ATOM   2258 C  CG1   A ILE B 1 114 ? -21.964 -0.094  -5.607  0.50 16.37 ? 123 ILE B CG1   1 
ATOM   2259 C  CG1   B ILE B 1 114 ? -20.666 -0.089  -7.936  0.50 15.78 ? 123 ILE B CG1   1 
ATOM   2260 C  CG2   A ILE B 1 114 ? -20.914 0.317   -7.909  0.50 15.98 ? 123 ILE B CG2   1 
ATOM   2261 C  CG2   B ILE B 1 114 ? -21.512 -1.225  -5.635  0.50 18.21 ? 123 ILE B CG2   1 
ATOM   2262 C  CD1   A ILE B 1 114 ? -20.719 0.457   -5.007  0.50 16.26 ? 123 ILE B CD1   1 
ATOM   2263 C  CD1   B ILE B 1 114 ? -19.564 0.579   -7.115  0.50 16.52 ? 123 ILE B CD1   1 
ATOM   2264 N  N     . LEU B 1 115 ? -22.831 -1.045  -10.074 1.00 15.65 ? 124 LEU B N     1 
ATOM   2265 C  CA    . LEU B 1 115 ? -22.611 -1.669  -11.377 1.00 15.29 ? 124 LEU B CA    1 
ATOM   2266 C  C     . LEU B 1 115 ? -21.110 -1.726  -11.654 1.00 15.28 ? 124 LEU B C     1 
ATOM   2267 O  O     . LEU B 1 115 ? -20.449 -0.698  -11.681 1.00 14.87 ? 124 LEU B O     1 
ATOM   2268 C  CB    . LEU B 1 115 ? -23.327 -0.862  -12.455 1.00 15.22 ? 124 LEU B CB    1 
ATOM   2269 C  CG    . LEU B 1 115 ? -23.229 -1.429  -13.864 1.00 15.24 ? 124 LEU B CG    1 
ATOM   2270 C  CD1   . LEU B 1 115 ? -23.843 -2.816  -13.918 1.00 16.25 ? 124 LEU B CD1   1 
ATOM   2271 C  CD2   . LEU B 1 115 ? -23.862 -0.498  -14.882 1.00 16.04 ? 124 LEU B CD2   1 
ATOM   2272 N  N     . ILE B 1 116 ? -20.595 -2.934  -11.878 1.00 15.69 ? 125 ILE B N     1 
ATOM   2273 C  CA    . ILE B 1 116 ? -19.175 -3.153  -12.111 1.00 16.30 ? 125 ILE B CA    1 
ATOM   2274 C  C     . ILE B 1 116 ? -18.963 -3.677  -13.526 1.00 16.39 ? 125 ILE B C     1 
ATOM   2275 O  O     . ILE B 1 116 ? -19.500 -4.719  -13.900 1.00 16.79 ? 125 ILE B O     1 
ATOM   2276 C  CB    . ILE B 1 116 ? -18.579 -4.148  -11.092 1.00 16.34 ? 125 ILE B CB    1 
ATOM   2277 C  CG1   . ILE B 1 116 ? -18.850 -3.685  -9.658  1.00 16.52 ? 125 ILE B CG1   1 
ATOM   2278 C  CG2   . ILE B 1 116 ? -17.087 -4.347  -11.335 1.00 17.07 ? 125 ILE B CG2   1 
ATOM   2279 C  CD1   . ILE B 1 116 ? -18.212 -2.349  -9.278  1.00 15.56 ? 125 ILE B CD1   1 
ATOM   2280 N  N     . GLY B 1 117 ? -18.199 -2.923  -14.309 1.00 15.92 ? 126 GLY B N     1 
ATOM   2281 C  CA    . GLY B 1 117 ? -17.773 -3.349  -15.636 1.00 16.18 ? 126 GLY B CA    1 
ATOM   2282 C  C     . GLY B 1 117 ? -16.377 -3.928  -15.505 1.00 15.75 ? 126 GLY B C     1 
ATOM   2283 O  O     . GLY B 1 117 ? -15.392 -3.196  -15.449 1.00 15.33 ? 126 GLY B O     1 
ATOM   2284 N  N     . ASN B 1 118 ? -16.306 -5.251  -15.416 1.00 15.96 ? 127 ASN B N     1 
ATOM   2285 C  CA    . ASN B 1 118 ? -15.051 -5.956  -15.194 1.00 15.91 ? 127 ASN B CA    1 
ATOM   2286 C  C     . ASN B 1 118 ? -14.331 -6.273  -16.519 1.00 15.96 ? 127 ASN B C     1 
ATOM   2287 O  O     . ASN B 1 118 ? -14.909 -6.135  -17.605 1.00 15.62 ? 127 ASN B O     1 
ATOM   2288 C  CB    . ASN B 1 118 ? -15.318 -7.245  -14.413 1.00 15.74 ? 127 ASN B CB    1 
ATOM   2289 C  CG    . ASN B 1 118 ? -14.042 -7.909  -13.931 1.00 14.99 ? 127 ASN B CG    1 
ATOM   2290 O  OD1   . ASN B 1 118 ? -13.102 -7.245  -13.490 1.00 16.39 ? 127 ASN B OD1   1 
ATOM   2291 N  ND2   . ASN B 1 118 ? -13.988 -9.219  -14.049 1.00 16.85 ? 127 ASN B ND2   1 
ATOM   2292 N  N     . LYS B 1 119 ? -13.066 -6.671  -16.411 1.00 15.95 ? 128 LYS B N     1 
ATOM   2293 C  CA    . LYS B 1 119 ? -12.205 -7.026  -17.557 1.00 16.06 ? 128 LYS B CA    1 
ATOM   2294 C  C     . LYS B 1 119 ? -11.766 -5.800  -18.369 1.00 16.41 ? 128 LYS B C     1 
ATOM   2295 O  O     . LYS B 1 119 ? -11.464 -5.914  -19.554 1.00 16.88 ? 128 LYS B O     1 
ATOM   2296 C  CB    . LYS B 1 119 ? -12.847 -8.086  -18.479 1.00 15.80 ? 128 LYS B CB    1 
ATOM   2297 C  CG    . LYS B 1 119 ? -13.381 -9.317  -17.757 1.00 15.25 ? 128 LYS B CG    1 
ATOM   2298 C  CD    . LYS B 1 119 ? -13.351 -10.552 -18.637 1.00 14.17 ? 128 LYS B CD    1 
ATOM   2299 C  CE    . LYS B 1 119 ? -14.000 -11.738 -17.960 1.00 13.95 ? 128 LYS B CE    1 
ATOM   2300 N  NZ    . LYS B 1 119 ? -14.111 -12.934 -18.856 1.00 13.85 ? 128 LYS B NZ    1 
ATOM   2301 N  N     . ALA B 1 120 ? -11.681 -4.643  -17.715 1.00 16.93 ? 129 ALA B N     1 
ATOM   2302 C  CA    . ALA B 1 120 ? -11.285 -3.404  -18.388 1.00 17.34 ? 129 ALA B CA    1 
ATOM   2303 C  C     . ALA B 1 120 ? -9.836  -3.417  -18.909 1.00 17.73 ? 129 ALA B C     1 
ATOM   2304 O  O     . ALA B 1 120 ? -9.452  -2.563  -19.723 1.00 18.02 ? 129 ALA B O     1 
ATOM   2305 C  CB    . ALA B 1 120 ? -11.500 -2.225  -17.460 1.00 17.41 ? 129 ALA B CB    1 
ATOM   2306 N  N     . ASP B 1 121 ? -9.034  -4.377  -18.450 1.00 17.57 ? 130 ASP B N     1 
ATOM   2307 C  CA    . ASP B 1 121 ? -7.687  -4.579  -19.001 1.00 17.90 ? 130 ASP B CA    1 
ATOM   2308 C  C     . ASP B 1 121 ? -7.684  -5.058  -20.462 1.00 18.50 ? 130 ASP B C     1 
ATOM   2309 O  O     . ASP B 1 121 ? -6.697  -4.871  -21.167 1.00 18.79 ? 130 ASP B O     1 
ATOM   2310 C  CB    . ASP B 1 121 ? -6.890  -5.567  -18.148 1.00 17.68 ? 130 ASP B CB    1 
ATOM   2311 C  CG    . ASP B 1 121 ? -7.563  -6.912  -18.038 1.00 16.70 ? 130 ASP B CG    1 
ATOM   2312 O  OD1   . ASP B 1 121 ? -8.610  -6.990  -17.366 1.00 15.38 ? 130 ASP B OD1   1 
ATOM   2313 O  OD2   . ASP B 1 121 ? -7.050  -7.886  -18.624 1.00 17.30 ? 130 ASP B OD2   1 
ATOM   2314 N  N     . LEU B 1 122 ? -8.778  -5.677  -20.905 1.00 19.31 ? 131 LEU B N     1 
ATOM   2315 C  CA    . LEU B 1 122 ? -8.893  -6.178  -22.275 1.00 20.12 ? 131 LEU B CA    1 
ATOM   2316 C  C     . LEU B 1 122 ? -9.441  -5.096  -23.224 1.00 21.02 ? 131 LEU B C     1 
ATOM   2317 O  O     . LEU B 1 122 ? -10.487 -5.273  -23.851 1.00 21.19 ? 131 LEU B O     1 
ATOM   2318 C  CB    . LEU B 1 122 ? -9.797  -7.418  -22.301 1.00 19.93 ? 131 LEU B CB    1 
ATOM   2319 C  CG    . LEU B 1 122 ? -9.349  -8.609  -21.450 1.00 19.73 ? 131 LEU B CG    1 
ATOM   2320 C  CD1   . LEU B 1 122 ? -10.385 -9.728  -21.517 1.00 18.39 ? 131 LEU B CD1   1 
ATOM   2321 C  CD2   . LEU B 1 122 ? -7.974  -9.113  -21.867 1.00 20.16 ? 131 LEU B CD2   1 
ATOM   2322 N  N     . ASP B 1 123 ? -8.717  -3.986  -23.343 1.00 22.18 ? 132 ASP B N     1 
ATOM   2323 C  CA    . ASP B 1 123 ? -9.204  -2.823  -24.113 1.00 23.00 ? 132 ASP B CA    1 
ATOM   2324 C  C     . ASP B 1 123 ? -9.434  -3.069  -25.621 1.00 22.90 ? 132 ASP B C     1 
ATOM   2325 O  O     . ASP B 1 123 ? -10.301 -2.426  -26.218 1.00 23.16 ? 132 ASP B O     1 
ATOM   2326 C  CB    . ASP B 1 123 ? -8.318  -1.579  -23.886 1.00 23.53 ? 132 ASP B CB    1 
ATOM   2327 C  CG    . ASP B 1 123 ? -6.834  -1.897  -23.849 1.00 25.80 ? 132 ASP B CG    1 
ATOM   2328 O  OD1   . ASP B 1 123 ? -6.403  -2.908  -24.448 1.00 28.44 ? 132 ASP B OD1   1 
ATOM   2329 O  OD2   . ASP B 1 123 ? -6.087  -1.122  -23.214 1.00 29.76 ? 132 ASP B OD2   1 
ATOM   2330 N  N     . HIS B 1 124 ? -8.693  -4.001  -26.224 1.00 22.36 ? 133 HIS B N     1 
ATOM   2331 C  CA    . HIS B 1 124 ? -8.890  -4.356  -27.640 1.00 22.13 ? 133 HIS B CA    1 
ATOM   2332 C  C     . HIS B 1 124 ? -10.021 -5.376  -27.846 1.00 21.39 ? 133 HIS B C     1 
ATOM   2333 O  O     . HIS B 1 124 ? -10.248 -5.831  -28.959 1.00 20.48 ? 133 HIS B O     1 
ATOM   2334 C  CB    . HIS B 1 124 ? -7.588  -4.903  -28.242 1.00 22.52 ? 133 HIS B CB    1 
ATOM   2335 C  CG    . HIS B 1 124 ? -6.448  -3.931  -28.215 1.00 23.95 ? 133 HIS B CG    1 
ATOM   2336 N  ND1   . HIS B 1 124 ? -5.276  -4.141  -28.911 1.00 25.67 ? 133 HIS B ND1   1 
ATOM   2337 C  CD2   . HIS B 1 124 ? -6.300  -2.741  -27.584 1.00 25.65 ? 133 HIS B CD2   1 
ATOM   2338 C  CE1   . HIS B 1 124 ? -4.453  -3.128  -28.703 1.00 25.74 ? 133 HIS B CE1   1 
ATOM   2339 N  NE2   . HIS B 1 124 ? -5.049  -2.267  -27.896 1.00 25.52 ? 133 HIS B NE2   1 
ATOM   2340 N  N     . GLN B 1 125 ? -10.731 -5.739  -26.776 1.00 20.52 ? 134 GLN B N     1 
ATOM   2341 C  CA    . GLN B 1 125 ? -11.853 -6.673  -26.878 1.00 20.61 ? 134 GLN B CA    1 
ATOM   2342 C  C     . GLN B 1 125 ? -13.153 -6.093  -26.313 1.00 19.70 ? 134 GLN B C     1 
ATOM   2343 O  O     . GLN B 1 125 ? -14.131 -6.821  -26.167 1.00 19.23 ? 134 GLN B O     1 
ATOM   2344 C  CB    . GLN B 1 125 ? -11.518 -7.983  -26.154 1.00 20.59 ? 134 GLN B CB    1 
ATOM   2345 C  CG    . GLN B 1 125 ? -10.334 -8.736  -26.751 1.00 21.66 ? 134 GLN B CG    1 
ATOM   2346 C  CD    . GLN B 1 125 ? -9.825  -9.839  -25.838 1.00 22.00 ? 134 GLN B CD    1 
ATOM   2347 O  OE1   . GLN B 1 125 ? -10.592 -10.704 -25.411 1.00 25.62 ? 134 GLN B OE1   1 
ATOM   2348 N  NE2   . GLN B 1 125 ? -8.529  -9.816  -25.541 1.00 23.88 ? 134 GLN B NE2   1 
ATOM   2349 N  N     . ARG B 1 126 ? -13.176 -4.794  -26.013 1.00 19.40 ? 135 ARG B N     1 
ATOM   2350 C  CA    . ARG B 1 126 ? -14.347 -4.183  -25.368 1.00 19.51 ? 135 ARG B CA    1 
ATOM   2351 C  C     . ARG B 1 126 ? -15.538 -4.137  -26.308 1.00 18.74 ? 135 ARG B C     1 
ATOM   2352 O  O     . ARG B 1 126 ? -15.437 -3.657  -27.439 1.00 18.91 ? 135 ARG B O     1 
ATOM   2353 C  CB    . ARG B 1 126 ? -14.068 -2.753  -24.899 1.00 19.32 ? 135 ARG B CB    1 
ATOM   2354 C  CG    . ARG B 1 126 ? -13.083 -2.631  -23.775 1.00 20.70 ? 135 ARG B CG    1 
ATOM   2355 C  CD    . ARG B 1 126 ? -12.881 -1.169  -23.411 1.00 20.71 ? 135 ARG B CD    1 
ATOM   2356 N  NE    . ARG B 1 126 ? -14.091 -0.588  -22.845 1.00 21.37 ? 135 ARG B NE    1 
ATOM   2357 C  CZ    . ARG B 1 126 ? -14.315 -0.371  -21.552 1.00 21.15 ? 135 ARG B CZ    1 
ATOM   2358 N  NH1   . ARG B 1 126 ? -13.398 -0.667  -20.628 1.00 20.90 ? 135 ARG B NH1   1 
ATOM   2359 N  NH2   . ARG B 1 126 ? -15.476 0.152   -21.179 1.00 20.91 ? 135 ARG B NH2   1 
ATOM   2360 N  N     . GLN B 1 127 ? -16.676 -4.622  -25.822 1.00 18.13 ? 136 GLN B N     1 
ATOM   2361 C  CA    . GLN B 1 127 ? -17.940 -4.526  -26.545 1.00 17.53 ? 136 GLN B CA    1 
ATOM   2362 C  C     . GLN B 1 127 ? -18.895 -3.534  -25.886 1.00 17.52 ? 136 GLN B C     1 
ATOM   2363 O  O     . GLN B 1 127 ? -19.939 -3.223  -26.447 1.00 17.67 ? 136 GLN B O     1 
ATOM   2364 C  CB    . GLN B 1 127 ? -18.616 -5.882  -26.592 1.00 17.60 ? 136 GLN B CB    1 
ATOM   2365 C  CG    . GLN B 1 127 ? -17.831 -6.948  -27.309 1.00 17.88 ? 136 GLN B CG    1 
ATOM   2366 C  CD    . GLN B 1 127 ? -18.589 -8.252  -27.388 1.00 18.97 ? 136 GLN B CD    1 
ATOM   2367 O  OE1   . GLN B 1 127 ? -19.680 -8.385  -26.826 1.00 18.53 ? 136 GLN B OE1   1 
ATOM   2368 N  NE2   . GLN B 1 127 ? -18.008 -9.232  -28.071 1.00 20.46 ? 136 GLN B NE2   1 
ATOM   2369 N  N     . VAL B 1 128 ? -18.555 -3.061  -24.693 1.00 16.93 ? 137 VAL B N     1 
ATOM   2370 C  CA    . VAL B 1 128 ? -19.346 -2.038  -24.014 1.00 17.06 ? 137 VAL B CA    1 
ATOM   2371 C  C     . VAL B 1 128 ? -18.418 -0.876  -23.727 1.00 16.76 ? 137 VAL B C     1 
ATOM   2372 O  O     . VAL B 1 128 ? -17.346 -1.080  -23.153 1.00 16.80 ? 137 VAL B O     1 
ATOM   2373 C  CB    . VAL B 1 128 ? -19.924 -2.543  -22.676 1.00 17.24 ? 137 VAL B CB    1 
ATOM   2374 C  CG1   . VAL B 1 128 ? -20.751 -1.451  -22.005 1.00 17.65 ? 137 VAL B CG1   1 
ATOM   2375 C  CG2   . VAL B 1 128 ? -20.743 -3.807  -22.876 1.00 17.70 ? 137 VAL B CG2   1 
ATOM   2376 N  N     . THR B 1 129 ? -18.816 0.327   -24.135 1.00 16.42 ? 138 THR B N     1 
ATOM   2377 C  CA    . THR B 1 129 ? -18.047 1.526   -23.851 1.00 16.57 ? 138 THR B CA    1 
ATOM   2378 C  C     . THR B 1 129 ? -18.287 1.985   -22.413 1.00 16.87 ? 138 THR B C     1 
ATOM   2379 O  O     . THR B 1 129 ? -19.296 1.652   -21.802 1.00 16.66 ? 138 THR B O     1 
ATOM   2380 C  CB    . THR B 1 129 ? -18.410 2.690   -24.791 1.00 16.38 ? 138 THR B CB    1 
ATOM   2381 O  OG1   . THR B 1 129 ? -19.726 3.163   -24.491 1.00 16.80 ? 138 THR B OG1   1 
ATOM   2382 C  CG2   . THR B 1 129 ? -18.347 2.247   -26.247 1.00 16.66 ? 138 THR B CG2   1 
ATOM   2383 N  N     . GLN B 1 130 ? -17.352 2.771   -21.902 1.00 17.83 ? 139 GLN B N     1 
ATOM   2384 C  CA    . GLN B 1 130 ? -17.474 3.364   -20.576 1.00 18.74 ? 139 GLN B CA    1 
ATOM   2385 C  C     . GLN B 1 130 ? -18.712 4.267   -20.505 1.00 18.29 ? 139 GLN B C     1 
ATOM   2386 O  O     . GLN B 1 130 ? -19.426 4.259   -19.516 1.00 18.70 ? 139 GLN B O     1 
ATOM   2387 C  CB    . GLN B 1 130 ? -16.205 4.154   -20.245 1.00 18.89 ? 139 GLN B CB    1 
ATOM   2388 C  CG    . GLN B 1 130 ? -16.100 4.606   -18.806 1.00 20.79 ? 139 GLN B CG    1 
ATOM   2389 C  CD    . GLN B 1 130 ? -14.727 5.176   -18.477 1.00 21.01 ? 139 GLN B CD    1 
ATOM   2390 O  OE1   . GLN B 1 130 ? -13.824 5.186   -19.320 1.00 26.03 ? 139 GLN B OE1   1 
ATOM   2391 N  NE2   . GLN B 1 130 ? -14.564 5.654   -17.244 1.00 25.50 ? 139 GLN B NE2   1 
ATOM   2392 N  N     . GLU B 1 131 ? -18.983 5.028   -21.563 1.00 18.28 ? 140 GLU B N     1 
ATOM   2393 C  CA    . GLU B 1 131 ? -20.184 5.868   -21.584 1.00 17.99 ? 140 GLU B CA    1 
ATOM   2394 C  C     . GLU B 1 131 ? -21.473 5.042   -21.533 1.00 17.69 ? 140 GLU B C     1 
ATOM   2395 O  O     . GLU B 1 131 ? -22.452 5.446   -20.905 1.00 17.40 ? 140 GLU B O     1 
ATOM   2396 C  CB    . GLU B 1 131 ? -20.183 6.791   -22.804 1.00 18.14 ? 140 GLU B CB    1 
ATOM   2397 C  CG    . GLU B 1 131 ? -19.167 7.914   -22.710 1.00 19.37 ? 140 GLU B CG    1 
ATOM   2398 N  N     . GLU B 1 132 ? -21.471 3.883   -22.182 1.00 17.31 ? 141 GLU B N     1 
ATOM   2399 C  CA    . GLU B 1 132 ? -22.624 2.988   -22.143 1.00 17.24 ? 141 GLU B CA    1 
ATOM   2400 C  C     . GLU B 1 132 ? -22.842 2.388   -20.756 1.00 16.77 ? 141 GLU B C     1 
ATOM   2401 O  O     . GLU B 1 132 ? -23.977 2.247   -20.306 1.00 17.06 ? 141 GLU B O     1 
ATOM   2402 C  CB    . GLU B 1 132 ? -22.485 1.882   -23.179 1.00 17.23 ? 141 GLU B CB    1 
ATOM   2403 C  CG    . GLU B 1 132 ? -22.799 2.359   -24.583 1.00 18.01 ? 141 GLU B CG    1 
ATOM   2404 C  CD    . GLU B 1 132 ? -22.455 1.354   -25.650 1.00 19.13 ? 141 GLU B CD    1 
ATOM   2405 O  OE1   . GLU B 1 132 ? -21.467 0.605   -25.487 1.00 19.94 ? 141 GLU B OE1   1 
ATOM   2406 O  OE2   . GLU B 1 132 ? -23.165 1.333   -26.679 1.00 21.83 ? 141 GLU B OE2   1 
ATOM   2407 N  N     . GLY B 1 133 ? -21.761 2.023   -20.087 1.00 16.61 ? 142 GLY B N     1 
ATOM   2408 C  CA    . GLY B 1 133 ? -21.837 1.578   -18.700 1.00 16.62 ? 142 GLY B CA    1 
ATOM   2409 C  C     . GLY B 1 133 ? -22.422 2.655   -17.803 1.00 16.84 ? 142 GLY B C     1 
ATOM   2410 O  O     . GLY B 1 133 ? -23.275 2.377   -16.953 1.00 16.58 ? 142 GLY B O     1 
ATOM   2411 N  N     . GLN B 1 134 ? -21.976 3.892   -18.020 1.00 17.02 ? 143 GLN B N     1 
ATOM   2412 C  CA    . GLN B 1 134 ? -22.459 5.044   -17.256 1.00 17.68 ? 143 GLN B CA    1 
ATOM   2413 C  C     . GLN B 1 134 ? -23.939 5.306   -17.511 1.00 17.30 ? 143 GLN B C     1 
ATOM   2414 O  O     . GLN B 1 134 ? -24.682 5.638   -16.585 1.00 17.33 ? 143 GLN B O     1 
ATOM   2415 C  CB    . GLN B 1 134 ? -21.625 6.289   -17.574 1.00 17.64 ? 143 GLN B CB    1 
ATOM   2416 C  CG    . GLN B 1 134 ? -20.174 6.186   -17.105 1.00 18.82 ? 143 GLN B CG    1 
ATOM   2417 C  CD    . GLN B 1 134 ? -19.235 7.198   -17.745 1.00 19.22 ? 143 GLN B CD    1 
ATOM   2418 O  OE1   . GLN B 1 134 ? -19.592 7.907   -18.691 1.00 22.94 ? 143 GLN B OE1   1 
ATOM   2419 N  NE2   . GLN B 1 134 ? -18.013 7.264   -17.225 1.00 24.04 ? 143 GLN B NE2   1 
ATOM   2420 N  N     . GLN B 1 135 ? -24.370 5.137   -18.760 1.00 17.15 ? 144 GLN B N     1 
ATOM   2421 C  CA    . GLN B 1 135 ? -25.769 5.312   -19.123 1.00 17.57 ? 144 GLN B CA    1 
ATOM   2422 C  C     . GLN B 1 135 ? -26.644 4.278   -18.435 1.00 16.78 ? 144 GLN B C     1 
ATOM   2423 O  O     . GLN B 1 135 ? -27.682 4.623   -17.887 1.00 16.78 ? 144 GLN B O     1 
ATOM   2424 C  CB    . GLN B 1 135 ? -25.942 5.232   -20.645 1.00 17.82 ? 144 GLN B CB    1 
ATOM   2425 C  CG    . GLN B 1 135 ? -27.387 5.265   -21.137 1.00 19.12 ? 144 GLN B CG    1 
ATOM   2426 C  CD    . GLN B 1 135 ? -27.471 5.368   -22.652 1.00 19.94 ? 144 GLN B CD    1 
ATOM   2427 O  OE1   . GLN B 1 135 ? -26.692 4.730   -23.378 1.00 25.39 ? 144 GLN B OE1   1 
ATOM   2428 N  NE2   . GLN B 1 135 ? -28.400 6.180   -23.140 1.00 23.00 ? 144 GLN B NE2   1 
ATOM   2429 N  N     . LEU B 1 136 ? -26.240 3.013   -18.473 1.00 16.26 ? 145 LEU B N     1 
ATOM   2430 C  CA    . LEU B 1 136 ? -27.002 1.969   -17.788 1.00 16.56 ? 145 LEU B CA    1 
ATOM   2431 C  C     . LEU B 1 136 ? -27.096 2.248   -16.295 1.00 16.84 ? 145 LEU B C     1 
ATOM   2432 O  O     . LEU B 1 136 ? -28.166 2.120   -15.695 1.00 16.41 ? 145 LEU B O     1 
ATOM   2433 C  CB    . LEU B 1 136 ? -26.391 0.589   -18.006 1.00 16.30 ? 145 LEU B CB    1 
ATOM   2434 C  CG    . LEU B 1 136 ? -27.158 -0.546  -17.329 1.00 16.27 ? 145 LEU B CG    1 
ATOM   2435 C  CD1   . LEU B 1 136 ? -28.579 -0.622  -17.846 1.00 17.26 ? 145 LEU B CD1   1 
ATOM   2436 C  CD2   . LEU B 1 136 ? -26.430 -1.866  -17.521 1.00 17.01 ? 145 LEU B CD2   1 
ATOM   2437 N  N     . ALA B 1 137 ? -25.975 2.620   -15.690 1.00 17.12 ? 146 ALA B N     1 
ATOM   2438 C  CA    . ALA B 1 137 ? -25.958 2.914   -14.265 1.00 17.40 ? 146 ALA B CA    1 
ATOM   2439 C  C     . ALA B 1 137 ? -26.915 4.061   -13.939 1.00 18.25 ? 146 ALA B C     1 
ATOM   2440 O  O     . ALA B 1 137 ? -27.624 4.005   -12.939 1.00 18.31 ? 146 ALA B O     1 
ATOM   2441 C  CB    . ALA B 1 137 ? -24.561 3.234   -13.812 1.00 17.31 ? 146 ALA B CB    1 
ATOM   2442 N  N     . ARG B 1 138 ? -26.956 5.089   -14.787 1.00 18.97 ? 147 ARG B N     1 
ATOM   2443 C  CA    . ARG B 1 138 ? -27.925 6.183   -14.617 1.00 19.85 ? 147 ARG B CA    1 
ATOM   2444 C  C     . ARG B 1 138 ? -29.377 5.694   -14.667 1.00 20.46 ? 147 ARG B C     1 
ATOM   2445 O  O     . ARG B 1 138 ? -30.202 6.103   -13.853 1.00 20.73 ? 147 ARG B O     1 
ATOM   2446 C  CB    . ARG B 1 138 ? -27.727 7.274   -15.673 1.00 20.21 ? 147 ARG B CB    1 
ATOM   2447 C  CG    . ARG B 1 138 ? -26.557 8.198   -15.403 1.00 21.16 ? 147 ARG B CG    1 
ATOM   2448 C  CD    . ARG B 1 138 ? -26.621 9.439   -16.261 1.00 23.22 ? 147 ARG B CD    1 
ATOM   2449 N  NE    . ARG B 1 138 ? -26.697 9.117   -17.688 1.00 24.21 ? 147 ARG B NE    1 
ATOM   2450 C  CZ    . ARG B 1 138 ? -25.647 8.901   -18.484 1.00 24.39 ? 147 ARG B CZ    1 
ATOM   2451 N  NH1   . ARG B 1 138 ? -24.403 8.974   -18.019 1.00 24.56 ? 147 ARG B NH1   1 
ATOM   2452 N  NH2   . ARG B 1 138 ? -25.848 8.614   -19.767 1.00 25.50 ? 147 ARG B NH2   1 
ATOM   2453 N  N     . GLN B 1 139 ? -29.685 4.827   -15.625 1.00 21.00 ? 148 GLN B N     1 
ATOM   2454 C  CA    . GLN B 1 139 ? -31.028 4.265   -15.743 1.00 21.66 ? 148 GLN B CA    1 
ATOM   2455 C  C     . GLN B 1 139 ? -31.386 3.399   -14.533 1.00 21.55 ? 148 GLN B C     1 
ATOM   2456 O  O     . GLN B 1 139 ? -32.548 3.365   -14.115 1.00 21.53 ? 148 GLN B O     1 
ATOM   2457 C  CB    . GLN B 1 139 ? -31.163 3.430   -17.017 1.00 21.75 ? 148 GLN B CB    1 
ATOM   2458 C  CG    . GLN B 1 139 ? -31.110 4.229   -18.294 1.00 22.88 ? 148 GLN B CG    1 
ATOM   2459 C  CD    . GLN B 1 139 ? -30.906 3.364   -19.527 1.00 23.41 ? 148 GLN B CD    1 
ATOM   2460 O  OE1   . GLN B 1 139 ? -30.858 2.135   -19.442 1.00 27.44 ? 148 GLN B OE1   1 
ATOM   2461 N  NE2   . GLN B 1 139 ? -30.774 4.007   -20.683 1.00 26.09 ? 148 GLN B NE2   1 
ATOM   2462 N  N     . LEU B 1 140 ? -30.396 2.694   -13.991 1.00 21.51 ? 149 LEU B N     1 
ATOM   2463 C  CA    . LEU B 1 140 ? -30.590 1.855   -12.810 1.00 21.70 ? 149 LEU B CA    1 
ATOM   2464 C  C     . LEU B 1 140 ? -30.470 2.634   -11.508 1.00 21.47 ? 149 LEU B C     1 
ATOM   2465 O  O     . LEU B 1 140 ? -30.660 2.066   -10.429 1.00 21.94 ? 149 LEU B O     1 
ATOM   2466 C  CB    . LEU B 1 140 ? -29.588 0.699   -12.807 1.00 21.91 ? 149 LEU B CB    1 
ATOM   2467 C  CG    . LEU B 1 140 ? -29.675 -0.294  -13.967 1.00 23.39 ? 149 LEU B CG    1 
ATOM   2468 C  CD1   . LEU B 1 140 ? -28.705 -1.429  -13.741 1.00 25.01 ? 149 LEU B CD1   1 
ATOM   2469 C  CD2   . LEU B 1 140 ? -31.089 -0.817  -14.146 1.00 25.49 ? 149 LEU B CD2   1 
ATOM   2470 N  N     . LYS B 1 141 ? -30.148 3.923   -11.599 1.00 20.88 ? 150 LYS B N     1 
ATOM   2471 C  CA    . LYS B 1 141 ? -29.906 4.766   -10.421 1.00 20.64 ? 150 LYS B CA    1 
ATOM   2472 C  C     . LYS B 1 141 ? -28.842 4.198   -9.462  1.00 20.26 ? 150 LYS B C     1 
ATOM   2473 O  O     . LYS B 1 141 ? -29.024 4.188   -8.243  1.00 20.19 ? 150 LYS B O     1 
ATOM   2474 C  CB    . LYS B 1 141 ? -31.231 5.060   -9.697  1.00 20.70 ? 150 LYS B CB    1 
ATOM   2475 C  CG    . LYS B 1 141 ? -32.280 5.703   -10.589 1.00 20.75 ? 150 LYS B CG    1 
ATOM   2476 N  N     . VAL B 1 142 ? -27.731 3.730   -10.036 1.00 19.35 ? 151 VAL B N     1 
ATOM   2477 C  CA    . VAL B 1 142 ? -26.581 3.236   -9.271  1.00 18.96 ? 151 VAL B CA    1 
ATOM   2478 C  C     . VAL B 1 142 ? -25.287 3.878   -9.787  1.00 19.01 ? 151 VAL B C     1 
ATOM   2479 O  O     . VAL B 1 142 ? -25.278 4.516   -10.838 1.00 19.30 ? 151 VAL B O     1 
ATOM   2480 C  CB    . VAL B 1 142 ? -26.473 1.688   -9.306  1.00 19.07 ? 151 VAL B CB    1 
ATOM   2481 C  CG1   . VAL B 1 142 ? -27.782 1.065   -8.863  1.00 19.41 ? 151 VAL B CG1   1 
ATOM   2482 C  CG2   . VAL B 1 142 ? -26.091 1.174   -10.695 1.00 18.56 ? 151 VAL B CG2   1 
ATOM   2483 N  N     . THR B 1 143 ? -24.224 3.758   -9.001  1.00 18.99 ? 152 THR B N     1 
ATOM   2484 C  CA    . THR B 1 143 ? -22.883 4.180   -9.402  1.00 18.89 ? 152 THR B CA    1 
ATOM   2485 C  C     . THR B 1 143 ? -22.288 3.132   -10.333 1.00 18.61 ? 152 THR B C     1 
ATOM   2486 O  O     . THR B 1 143 ? -22.626 1.949   -10.239 1.00 19.05 ? 152 THR B O     1 
ATOM   2487 C  CB    A THR B 1 143 ? -21.965 4.254   -8.139  0.50 19.09 ? 152 THR B CB    1 
ATOM   2488 C  CB    B THR B 1 143 ? -21.940 4.460   -8.217  0.50 19.14 ? 152 THR B CB    1 
ATOM   2489 O  OG1   A THR B 1 143 ? -22.514 5.171   -7.179  0.50 19.76 ? 152 THR B OG1   1 
ATOM   2490 O  OG1   B THR B 1 143 ? -22.049 3.416   -7.254  0.50 18.37 ? 152 THR B OG1   1 
ATOM   2491 C  CG2   A THR B 1 143 ? -20.535 4.658   -8.488  0.50 18.99 ? 152 THR B CG2   1 
ATOM   2492 C  CG2   B THR B 1 143 ? -22.282 5.800   -7.565  0.50 19.63 ? 152 THR B CG2   1 
ATOM   2493 N  N     . TYR B 1 144 ? -21.418 3.578   -11.238 1.00 18.12 ? 153 TYR B N     1 
ATOM   2494 C  CA    . TYR B 1 144 ? -20.684 2.693   -12.145 1.00 17.54 ? 153 TYR B CA    1 
ATOM   2495 C  C     . TYR B 1 144 ? -19.188 2.736   -11.856 1.00 17.42 ? 153 TYR B C     1 
ATOM   2496 O  O     . TYR B 1 144 ? -18.624 3.805   -11.663 1.00 16.86 ? 153 TYR B O     1 
ATOM   2497 C  CB    . TYR B 1 144 ? -20.899 3.149   -13.581 1.00 18.02 ? 153 TYR B CB    1 
ATOM   2498 C  CG    . TYR B 1 144 ? -20.208 2.295   -14.613 1.00 17.69 ? 153 TYR B CG    1 
ATOM   2499 C  CD1   . TYR B 1 144 ? -20.446 0.923   -14.678 1.00 18.73 ? 153 TYR B CD1   1 
ATOM   2500 C  CD2   . TYR B 1 144 ? -19.322 2.852   -15.523 1.00 18.34 ? 153 TYR B CD2   1 
ATOM   2501 C  CE1   . TYR B 1 144 ? -19.826 0.141   -15.628 1.00 17.89 ? 153 TYR B CE1   1 
ATOM   2502 C  CE2   . TYR B 1 144 ? -18.694 2.082   -16.474 1.00 17.39 ? 153 TYR B CE2   1 
ATOM   2503 C  CZ    . TYR B 1 144 ? -18.950 0.732   -16.529 1.00 18.62 ? 153 TYR B CZ    1 
ATOM   2504 O  OH    . TYR B 1 144 ? -18.338 -0.028  -17.489 1.00 18.27 ? 153 TYR B OH    1 
ATOM   2505 N  N     . MET B 1 145 ? -18.550 1.573   -11.812 1.00 16.82 ? 154 MET B N     1 
ATOM   2506 C  CA    . MET B 1 145 ? -17.096 1.514   -11.685 1.00 17.58 ? 154 MET B CA    1 
ATOM   2507 C  C     . MET B 1 145 ? -16.579 0.418   -12.595 1.00 16.98 ? 154 MET B C     1 
ATOM   2508 O  O     . MET B 1 145 ? -17.171 -0.652  -12.670 1.00 17.51 ? 154 MET B O     1 
ATOM   2509 C  CB    . MET B 1 145 ? -16.662 1.303   -10.207 1.00 17.40 ? 154 MET B CB    1 
ATOM   2510 C  CG    A MET B 1 145 ? -15.205 0.902   -10.011 0.50 16.79 ? 154 MET B CG    1 
ATOM   2511 C  CG    B MET B 1 145 ? -17.687 1.784   -9.181  0.50 18.59 ? 154 MET B CG    1 
ATOM   2512 S  SD    A MET B 1 145 ? -14.839 0.739   -8.225  0.50 16.64 ? 154 MET B SD    1 
ATOM   2513 S  SD    B MET B 1 145 ? -17.075 1.572   -7.482  0.50 21.59 ? 154 MET B SD    1 
ATOM   2514 C  CE    A MET B 1 145 ? -15.392 2.303   -7.538  0.50 17.40 ? 154 MET B CE    1 
ATOM   2515 C  CE    B MET B 1 145 ? -15.317 1.260   -7.676  0.50 20.81 ? 154 MET B CE    1 
ATOM   2516 N  N     . GLU B 1 146 ? -15.482 0.681   -13.296 1.00 16.61 ? 155 GLU B N     1 
ATOM   2517 C  CA    . GLU B 1 146 ? -14.837 -0.364  -14.073 1.00 17.07 ? 155 GLU B CA    1 
ATOM   2518 C  C     . GLU B 1 146 ? -13.741 -1.028  -13.251 1.00 16.75 ? 155 GLU B C     1 
ATOM   2519 O  O     . GLU B 1 146 ? -13.142 -0.413  -12.379 1.00 18.05 ? 155 GLU B O     1 
ATOM   2520 C  CB    . GLU B 1 146 ? -14.300 0.185   -15.392 1.00 17.23 ? 155 GLU B CB    1 
ATOM   2521 C  CG    . GLU B 1 146 ? -15.407 0.792   -16.248 1.00 18.49 ? 155 GLU B CG    1 
ATOM   2522 C  CD    . GLU B 1 146 ? -15.085 0.888   -17.724 1.00 18.50 ? 155 GLU B CD    1 
ATOM   2523 O  OE1   . GLU B 1 146 ? -13.896 0.986   -18.104 1.00 17.82 ? 155 GLU B OE1   1 
ATOM   2524 O  OE2   . GLU B 1 146 ? -16.053 0.890   -18.513 1.00 19.22 ? 155 GLU B OE2   1 
ATOM   2525 N  N     . ALA B 1 147 ? -13.507 -2.305  -13.504 1.00 16.41 ? 156 ALA B N     1 
ATOM   2526 C  CA    . ALA B 1 147 ? -12.527 -3.042  -12.713 1.00 15.79 ? 156 ALA B CA    1 
ATOM   2527 C  C     . ALA B 1 147 ? -11.771 -4.012  -13.587 1.00 15.71 ? 156 ALA B C     1 
ATOM   2528 O  O     . ALA B 1 147 ? -12.140 -4.248  -14.734 1.00 15.42 ? 156 ALA B O     1 
ATOM   2529 C  CB    . ALA B 1 147 ? -13.225 -3.791  -11.583 1.00 16.35 ? 156 ALA B CB    1 
ATOM   2530 N  N     . SER B 1 148 ? -10.688 -4.555  -13.035 1.00 15.49 ? 157 SER B N     1 
ATOM   2531 C  CA    . SER B 1 148 ? -10.007 -5.695  -13.622 1.00 15.39 ? 157 SER B CA    1 
ATOM   2532 C  C     . SER B 1 148 ? -9.529  -6.582  -12.489 1.00 15.72 ? 157 SER B C     1 
ATOM   2533 O  O     . SER B 1 148 ? -8.669  -6.176  -11.695 1.00 16.07 ? 157 SER B O     1 
ATOM   2534 C  CB    . SER B 1 148 ? -8.795  -5.264  -14.463 1.00 14.96 ? 157 SER B CB    1 
ATOM   2535 O  OG    . SER B 1 148 ? -8.076  -6.408  -14.930 1.00 15.35 ? 157 SER B OG    1 
ATOM   2536 N  N     . ALA B 1 149 ? -10.075 -7.790  -12.425 1.00 15.44 ? 158 ALA B N     1 
ATOM   2537 C  CA    . ALA B 1 149 ? -9.556  -8.811  -11.534 1.00 15.71 ? 158 ALA B CA    1 
ATOM   2538 C  C     . ALA B 1 149 ? -8.137  -9.221  -11.913 1.00 15.93 ? 158 ALA B C     1 
ATOM   2539 O  O     . ALA B 1 149 ? -7.366  -9.564  -11.037 1.00 16.62 ? 158 ALA B O     1 
ATOM   2540 C  CB    . ALA B 1 149 ? -10.454 -10.028 -11.538 1.00 15.62 ? 158 ALA B CB    1 
ATOM   2541 N  N     . LYS B 1 150 ? -7.794  -9.187  -13.202 1.00 16.28 ? 159 LYS B N     1 
ATOM   2542 C  CA    . LYS B 1 150 ? -6.478  -9.657  -13.662 1.00 16.99 ? 159 LYS B CA    1 
ATOM   2543 C  C     . LYS B 1 150 ? -5.328  -8.767  -13.192 1.00 17.15 ? 159 LYS B C     1 
ATOM   2544 O  O     . LYS B 1 150 ? -4.279  -9.281  -12.791 1.00 17.67 ? 159 LYS B O     1 
ATOM   2545 C  CB    . LYS B 1 150 ? -6.426  -9.777  -15.188 1.00 16.88 ? 159 LYS B CB    1 
ATOM   2546 C  CG    . LYS B 1 150 ? -5.097  -10.318 -15.705 1.00 17.23 ? 159 LYS B CG    1 
ATOM   2547 C  CD    . LYS B 1 150 ? -5.164  -10.672 -17.173 1.00 18.02 ? 159 LYS B CD    1 
ATOM   2548 C  CE    . LYS B 1 150 ? -3.787  -10.991 -17.717 1.00 19.57 ? 159 LYS B CE    1 
ATOM   2549 N  NZ    . LYS B 1 150 ? -3.847  -11.394 -19.143 1.00 21.32 ? 159 LYS B NZ    1 
ATOM   2550 N  N     . ILE B 1 151 ? -5.508  -7.449  -13.271 1.00 17.45 ? 160 ILE B N     1 
ATOM   2551 C  CA    . ILE B 1 151 ? -4.479  -6.510  -12.805 1.00 17.97 ? 160 ILE B CA    1 
ATOM   2552 C  C     . ILE B 1 151 ? -4.831  -5.860  -11.464 1.00 18.33 ? 160 ILE B C     1 
ATOM   2553 O  O     . ILE B 1 151 ? -4.118  -4.971  -10.996 1.00 18.69 ? 160 ILE B O     1 
ATOM   2554 C  CB    . ILE B 1 151 ? -4.156  -5.430  -13.866 1.00 18.20 ? 160 ILE B CB    1 
ATOM   2555 C  CG1   . ILE B 1 151 ? -5.352  -4.507  -14.134 1.00 18.24 ? 160 ILE B CG1   1 
ATOM   2556 C  CG2   . ILE B 1 151 ? -3.703  -6.092  -15.153 1.00 17.96 ? 160 ILE B CG2   1 
ATOM   2557 C  CD1   . ILE B 1 151 ? -4.990  -3.251  -14.932 1.00 18.38 ? 160 ILE B CD1   1 
ATOM   2558 N  N     . ARG B 1 152 ? -5.905  -6.342  -10.840 1.00 18.36 ? 161 ARG B N     1 
ATOM   2559 C  CA    . ARG B 1 152 ? -6.375  -5.830  -9.558  1.00 18.34 ? 161 ARG B CA    1 
ATOM   2560 C  C     . ARG B 1 152 ? -6.612  -4.316  -9.611  1.00 18.79 ? 161 ARG B C     1 
ATOM   2561 O  O     . ARG B 1 152 ? -6.170  -3.562  -8.751  1.00 20.41 ? 161 ARG B O     1 
ATOM   2562 C  CB    . ARG B 1 152 ? -5.421  -6.241  -8.417  1.00 18.23 ? 161 ARG B CB    1 
ATOM   2563 C  CG    . ARG B 1 152 ? -6.174  -6.572  -7.129  1.00 18.08 ? 161 ARG B CG    1 
ATOM   2564 C  CD    . ARG B 1 152 ? -5.268  -7.031  -6.006  1.00 18.54 ? 161 ARG B CD    1 
ATOM   2565 N  NE    . ARG B 1 152 ? -6.045  -7.467  -4.851  1.00 18.17 ? 161 ARG B NE    1 
ATOM   2566 C  CZ    . ARG B 1 152 ? -6.622  -6.643  -3.979  1.00 20.16 ? 161 ARG B CZ    1 
ATOM   2567 N  NH1   . ARG B 1 152 ? -6.488  -5.330  -4.112  1.00 19.76 ? 161 ARG B NH1   1 
ATOM   2568 N  NH2   . ARG B 1 152 ? -7.325  -7.131  -2.967  1.00 19.70 ? 161 ARG B NH2   1 
ATOM   2569 N  N     . MET B 1 153 ? -7.330  -3.879  -10.637 1.00 19.19 ? 162 MET B N     1 
ATOM   2570 C  CA    . MET B 1 153 ? -7.768  -2.492  -10.723 1.00 19.72 ? 162 MET B CA    1 
ATOM   2571 C  C     . MET B 1 153 ? -9.173  -2.373  -10.130 1.00 18.82 ? 162 MET B C     1 
ATOM   2572 O  O     . MET B 1 153 ? -10.096 -3.043  -10.595 1.00 17.44 ? 162 MET B O     1 
ATOM   2573 C  CB    . MET B 1 153 ? -7.798  -2.026  -12.178 1.00 19.83 ? 162 MET B CB    1 
ATOM   2574 C  CG    . MET B 1 153 ? -8.151  -0.548  -12.340 1.00 21.24 ? 162 MET B CG    1 
ATOM   2575 S  SD    . MET B 1 153 ? -8.386  -0.049  -14.054 1.00 23.76 ? 162 MET B SD    1 
ATOM   2576 C  CE    . MET B 1 153 ? -9.888  -0.905  -14.475 1.00 22.31 ? 162 MET B CE    1 
ATOM   2577 N  N     . ASN B 1 154 ? -9.309  -1.515  -9.115  1.00 18.30 ? 163 ASN B N     1 
ATOM   2578 C  CA    . ASN B 1 154 ? -10.602 -1.181  -8.495  1.00 17.94 ? 163 ASN B CA    1 
ATOM   2579 C  C     . ASN B 1 154 ? -11.283 -2.345  -7.772  1.00 17.65 ? 163 ASN B C     1 
ATOM   2580 O  O     . ASN B 1 154 ? -12.509 -2.375  -7.653  1.00 18.08 ? 163 ASN B O     1 
ATOM   2581 C  CB    . ASN B 1 154 ? -11.560 -0.539  -9.524  1.00 17.91 ? 163 ASN B CB    1 
ATOM   2582 C  CG    . ASN B 1 154 ? -11.242 0.917   -9.781  1.00 20.72 ? 163 ASN B CG    1 
ATOM   2583 O  OD1   . ASN B 1 154 ? -10.628 1.589   -8.943  1.00 24.84 ? 163 ASN B OD1   1 
ATOM   2584 N  ND2   . ASN B 1 154 ? -11.638 1.418   -10.956 1.00 22.50 ? 163 ASN B ND2   1 
ATOM   2585 N  N     . VAL B 1 155 ? -10.496 -3.301  -7.291  1.00 17.14 ? 164 VAL B N     1 
ATOM   2586 C  CA    . VAL B 1 155 ? -11.068 -4.457  -6.627  1.00 16.64 ? 164 VAL B CA    1 
ATOM   2587 C  C     . VAL B 1 155 ? -11.514 -4.081  -5.224  1.00 16.64 ? 164 VAL B C     1 
ATOM   2588 O  O     . VAL B 1 155 ? -12.703 -4.185  -4.907  1.00 16.04 ? 164 VAL B O     1 
ATOM   2589 C  CB    . VAL B 1 155 ? -10.122 -5.660  -6.616  1.00 16.79 ? 164 VAL B CB    1 
ATOM   2590 C  CG1   . VAL B 1 155 ? -10.741 -6.799  -5.816  1.00 17.65 ? 164 VAL B CG1   1 
ATOM   2591 C  CG2   . VAL B 1 155 ? -9.857  -6.103  -8.040  1.00 16.53 ? 164 VAL B CG2   1 
ATOM   2592 N  N     . ASP B 1 156 ? -10.583 -3.616  -4.397  1.00 16.48 ? 165 ASP B N     1 
ATOM   2593 C  CA    . ASP B 1 156 ? -10.921 -3.178  -3.033  1.00 16.42 ? 165 ASP B CA    1 
ATOM   2594 C  C     . ASP B 1 156 ? -11.946 -2.041  -3.107  1.00 16.64 ? 165 ASP B C     1 
ATOM   2595 O  O     . ASP B 1 156 ? -12.924 -2.024  -2.354  1.00 16.11 ? 165 ASP B O     1 
ATOM   2596 C  CB    . ASP B 1 156 ? -9.685  -2.682  -2.283  1.00 16.82 ? 165 ASP B CB    1 
ATOM   2597 C  CG    . ASP B 1 156 ? -8.697  -3.777  -1.964  1.00 18.34 ? 165 ASP B CG    1 
ATOM   2598 O  OD1   . ASP B 1 156 ? -9.019  -4.978  -2.137  1.00 20.12 ? 165 ASP B OD1   1 
ATOM   2599 O  OD2   . ASP B 1 156 ? -7.586  -3.439  -1.501  1.00 19.08 ? 165 ASP B OD2   1 
ATOM   2600 N  N     . GLN B 1 157 ? -11.727 -1.137  -4.057  1.00 16.80 ? 166 GLN B N     1 
ATOM   2601 C  CA    . GLN B 1 157 ? -12.540 0.068   -4.200  1.00 17.02 ? 166 GLN B CA    1 
ATOM   2602 C  C     . GLN B 1 157 ? -14.001 -0.277  -4.482  1.00 17.01 ? 166 GLN B C     1 
ATOM   2603 O  O     . GLN B 1 157 ? -14.910 0.390   -3.973  1.00 17.90 ? 166 GLN B O     1 
ATOM   2604 C  CB    . GLN B 1 157 ? -11.998 0.962   -5.323  1.00 16.59 ? 166 GLN B CB    1 
ATOM   2605 C  CG    . GLN B 1 157 ? -10.650 1.587   -5.025  1.00 17.19 ? 166 GLN B CG    1 
ATOM   2606 C  CD    . GLN B 1 157 ? -9.478  0.792   -5.538  1.00 15.06 ? 166 GLN B CD    1 
ATOM   2607 O  OE1   . GLN B 1 157 ? -9.488  -0.443  -5.554  1.00 17.11 ? 166 GLN B OE1   1 
ATOM   2608 N  NE2   . GLN B 1 157 ? -8.452  1.489   -5.959  1.00 16.62 ? 166 GLN B NE2   1 
ATOM   2609 N  N     . ALA B 1 158 ? -14.231 -1.305  -5.288  1.00 17.19 ? 167 ALA B N     1 
ATOM   2610 C  CA    . ALA B 1 158 ? -15.601 -1.725  -5.628  1.00 16.85 ? 167 ALA B CA    1 
ATOM   2611 C  C     . ALA B 1 158 ? -16.334 -2.175  -4.367  1.00 16.90 ? 167 ALA B C     1 
ATOM   2612 O  O     . ALA B 1 158 ? -17.483 -1.804  -4.134  1.00 17.00 ? 167 ALA B O     1 
ATOM   2613 C  CB    . ALA B 1 158 ? -15.583 -2.840  -6.652  1.00 16.61 ? 167 ALA B CB    1 
ATOM   2614 N  N     . PHE B 1 159 ? -15.664 -2.985  -3.550  1.00 17.42 ? 168 PHE B N     1 
ATOM   2615 C  CA    . PHE B 1 159 ? -16.285 -3.493  -2.334  1.00 17.26 ? 168 PHE B CA    1 
ATOM   2616 C  C     . PHE B 1 159 ? -16.443 -2.387  -1.295  1.00 17.41 ? 168 PHE B C     1 
ATOM   2617 O  O     . PHE B 1 159 ? -17.487 -2.306  -0.631  1.00 17.44 ? 168 PHE B O     1 
ATOM   2618 C  CB    . PHE B 1 159 ? -15.531 -4.695  -1.774  1.00 17.17 ? 168 PHE B CB    1 
ATOM   2619 C  CG    . PHE B 1 159 ? -15.737 -5.942  -2.572  1.00 17.89 ? 168 PHE B CG    1 
ATOM   2620 C  CD1   . PHE B 1 159 ? -16.872 -6.718  -2.390  1.00 17.48 ? 168 PHE B CD1   1 
ATOM   2621 C  CD2   . PHE B 1 159 ? -14.812 -6.327  -3.530  1.00 17.13 ? 168 PHE B CD2   1 
ATOM   2622 C  CE1   . PHE B 1 159 ? -17.072 -7.858  -3.152  1.00 16.90 ? 168 PHE B CE1   1 
ATOM   2623 C  CE2   . PHE B 1 159 ? -15.001 -7.494  -4.277  1.00 17.53 ? 168 PHE B CE2   1 
ATOM   2624 C  CZ    . PHE B 1 159 ? -16.127 -8.243  -4.093  1.00 16.67 ? 168 PHE B CZ    1 
ATOM   2625 N  N     . HIS B 1 160 ? -15.439 -1.526  -1.166  1.00 16.80 ? 169 HIS B N     1 
ATOM   2626 C  CA    . HIS B 1 160 ? -15.543 -0.371  -0.274  1.00 16.67 ? 169 HIS B CA    1 
ATOM   2627 C  C     . HIS B 1 160 ? -16.713 0.505   -0.679  1.00 15.98 ? 169 HIS B C     1 
ATOM   2628 O  O     . HIS B 1 160 ? -17.478 0.961   0.167   1.00 15.45 ? 169 HIS B O     1 
ATOM   2629 C  CB    . HIS B 1 160 ? -14.284 0.483   -0.317  1.00 17.27 ? 169 HIS B CB    1 
ATOM   2630 C  CG    . HIS B 1 160 ? -13.111 -0.110  0.399   1.00 17.79 ? 169 HIS B CG    1 
ATOM   2631 N  ND1   . HIS B 1 160 ? -12.043 0.655   0.816   1.00 20.10 ? 169 HIS B ND1   1 
ATOM   2632 C  CD2   . HIS B 1 160 ? -12.838 -1.378  0.780   1.00 18.09 ? 169 HIS B CD2   1 
ATOM   2633 C  CE1   . HIS B 1 160 ? -11.155 -0.120  1.414   1.00 20.85 ? 169 HIS B CE1   1 
ATOM   2634 N  NE2   . HIS B 1 160 ? -11.609 -1.360  1.403   1.00 18.49 ? 169 HIS B NE2   1 
ATOM   2635 N  N     . GLU B 1 161 ? -16.838 0.769   -1.975  1.00 15.42 ? 170 GLU B N     1 
ATOM   2636 C  CA    . GLU B 1 161 ? -17.887 1.665   -2.464  1.00 15.21 ? 170 GLU B CA    1 
ATOM   2637 C  C     . GLU B 1 161 ? -19.271 1.117   -2.186  1.00 14.56 ? 170 GLU B C     1 
ATOM   2638 O  O     . GLU B 1 161 ? -20.178 1.855   -1.847  1.00 14.51 ? 170 GLU B O     1 
ATOM   2639 C  CB    . GLU B 1 161 ? -17.735 1.936   -3.956  1.00 15.63 ? 170 GLU B CB    1 
ATOM   2640 C  CG    . GLU B 1 161 ? -18.592 3.104   -4.466  1.00 17.35 ? 170 GLU B CG    1 
ATOM   2641 C  CD    . GLU B 1 161 ? -18.251 4.457   -3.840  1.00 20.60 ? 170 GLU B CD    1 
ATOM   2642 O  OE1   . GLU B 1 161 ? -17.114 4.671   -3.364  1.00 21.73 ? 170 GLU B OE1   1 
ATOM   2643 O  OE2   . GLU B 1 161 ? -19.156 5.304   -3.833  1.00 23.22 ? 170 GLU B OE2   1 
ATOM   2644 N  N     . LEU B 1 162 ? -19.445 -0.197  -2.294  1.00 14.35 ? 171 LEU B N     1 
ATOM   2645 C  CA    . LEU B 1 162 ? -20.745 -0.775  -1.983  1.00 14.29 ? 171 LEU B CA    1 
ATOM   2646 C  C     . LEU B 1 162 ? -21.090 -0.569  -0.504  1.00 14.09 ? 171 LEU B C     1 
ATOM   2647 O  O     . LEU B 1 162 ? -22.228 -0.252  -0.165  1.00 14.15 ? 171 LEU B O     1 
ATOM   2648 C  CB    . LEU B 1 162 ? -20.760 -2.257  -2.333  1.00 15.12 ? 171 LEU B CB    1 
ATOM   2649 C  CG    . LEU B 1 162 ? -22.074 -2.978  -2.080  1.00 15.33 ? 171 LEU B CG    1 
ATOM   2650 C  CD1   . LEU B 1 162 ? -23.268 -2.312  -2.758  1.00 15.31 ? 171 LEU B CD1   1 
ATOM   2651 C  CD2   . LEU B 1 162 ? -21.940 -4.408  -2.533  1.00 17.41 ? 171 LEU B CD2   1 
ATOM   2652 N  N     . VAL B 1 163 ? -20.098 -0.680  0.376   1.00 13.71 ? 172 VAL B N     1 
ATOM   2653 C  CA    . VAL B 1 163 ? -20.336 -0.412  1.794   1.00 14.02 ? 172 VAL B CA    1 
ATOM   2654 C  C     . VAL B 1 163 ? -20.748 1.052   1.990   1.00 13.76 ? 172 VAL B C     1 
ATOM   2655 O  O     . VAL B 1 163 ? -21.670 1.343   2.751   1.00 14.30 ? 172 VAL B O     1 
ATOM   2656 C  CB    . VAL B 1 163 ? -19.112 -0.745  2.653   1.00 13.75 ? 172 VAL B CB    1 
ATOM   2657 C  CG1   . VAL B 1 163 ? -19.287 -0.239  4.068   1.00 13.85 ? 172 VAL B CG1   1 
ATOM   2658 C  CG2   . VAL B 1 163 ? -18.848 -2.257  2.630   1.00 14.31 ? 172 VAL B CG2   1 
ATOM   2659 N  N     . ARG B 1 164 ? -20.094 1.973   1.296   1.00 14.34 ? 173 ARG B N     1 
ATOM   2660 C  CA    . ARG B 1 164 ? -20.493 3.382   1.391   1.00 14.03 ? 173 ARG B CA    1 
ATOM   2661 C  C     . ARG B 1 164 ? -21.937 3.593   0.952   1.00 15.09 ? 173 ARG B C     1 
ATOM   2662 O  O     . ARG B 1 164 ? -22.645 4.403   1.537   1.00 15.38 ? 173 ARG B O     1 
ATOM   2663 C  CB    . ARG B 1 164 ? -19.629 4.268   0.525   1.00 14.50 ? 173 ARG B CB    1 
ATOM   2664 C  CG    . ARG B 1 164 ? -18.205 4.348   0.978   1.00 15.02 ? 173 ARG B CG    1 
ATOM   2665 C  CD    . ARG B 1 164 ? -17.441 5.324   0.122   1.00 17.06 ? 173 ARG B CD    1 
ATOM   2666 N  NE    . ARG B 1 164 ? -16.068 5.394   0.593   1.00 16.32 ? 173 ARG B NE    1 
ATOM   2667 C  CZ    . ARG B 1 164 ? -15.038 4.771   0.041   1.00 17.27 ? 173 ARG B CZ    1 
ATOM   2668 N  NH1   . ARG B 1 164 ? -15.162 4.073   -1.078  1.00 16.03 ? 173 ARG B NH1   1 
ATOM   2669 N  NH2   . ARG B 1 164 ? -13.858 4.884   0.614   1.00 17.62 ? 173 ARG B NH2   1 
ATOM   2670 N  N     . VAL B 1 165 ? -22.342 2.872   -0.087  1.00 15.17 ? 174 VAL B N     1 
ATOM   2671 C  CA    . VAL B 1 165 ? -23.717 2.953   -0.582  1.00 16.26 ? 174 VAL B CA    1 
ATOM   2672 C  C     . VAL B 1 165 ? -24.694 2.416   0.467   1.00 16.25 ? 174 VAL B C     1 
ATOM   2673 O  O     . VAL B 1 165 ? -25.740 3.030   0.722   1.00 16.95 ? 174 VAL B O     1 
ATOM   2674 C  CB    . VAL B 1 165 ? -23.879 2.202   -1.925  1.00 16.01 ? 174 VAL B CB    1 
ATOM   2675 C  CG1   . VAL B 1 165 ? -25.366 2.097   -2.323  1.00 17.53 ? 174 VAL B CG1   1 
ATOM   2676 C  CG2   . VAL B 1 165 ? -23.064 2.892   -3.009  1.00 16.28 ? 174 VAL B CG2   1 
ATOM   2677 N  N     . ILE B 1 166 ? -24.350 1.285   1.075   1.00 16.23 ? 175 ILE B N     1 
ATOM   2678 C  CA    . ILE B 1 166 ? -25.170 0.706   2.132   1.00 16.31 ? 175 ILE B CA    1 
ATOM   2679 C  C     . ILE B 1 166 ? -25.299 1.688   3.295   1.00 16.69 ? 175 ILE B C     1 
ATOM   2680 O  O     . ILE B 1 166 ? -26.401 1.903   3.822   1.00 16.58 ? 175 ILE B O     1 
ATOM   2681 C  CB    . ILE B 1 166 ? -24.611 -0.642  2.624   1.00 16.36 ? 175 ILE B CB    1 
ATOM   2682 C  CG1   . ILE B 1 166 ? -24.684 -1.682  1.506   1.00 16.71 ? 175 ILE B CG1   1 
ATOM   2683 C  CG2   . ILE B 1 166 ? -25.391 -1.136  3.856   1.00 17.32 ? 175 ILE B CG2   1 
ATOM   2684 C  CD1   . ILE B 1 166 ? -23.917 -2.953  1.788   1.00 16.71 ? 175 ILE B CD1   1 
ATOM   2685 N  N     . ARG B 1 167 ? -24.181 2.297   3.686   1.00 16.85 ? 176 ARG B N     1 
ATOM   2686 C  CA    . ARG B 1 167 ? -24.201 3.306   4.752   1.00 17.20 ? 176 ARG B CA    1 
ATOM   2687 C  C     . ARG B 1 167 ? -25.076 4.519   4.410   1.00 18.39 ? 176 ARG B C     1 
ATOM   2688 O  O     . ARG B 1 167 ? -25.841 4.992   5.255   1.00 18.78 ? 176 ARG B O     1 
ATOM   2689 C  CB    . ARG B 1 167 ? -22.774 3.758   5.078   1.00 16.97 ? 176 ARG B CB    1 
ATOM   2690 C  CG    . ARG B 1 167 ? -21.969 2.726   5.841   1.00 15.77 ? 176 ARG B CG    1 
ATOM   2691 C  CD    . ARG B 1 167 ? -20.508 3.139   5.928   1.00 14.47 ? 176 ARG B CD    1 
ATOM   2692 N  NE    . ARG B 1 167 ? -19.691 2.195   6.688   1.00 14.25 ? 176 ARG B NE    1 
ATOM   2693 C  CZ    . ARG B 1 167 ? -18.365 2.274   6.783   1.00 15.27 ? 176 ARG B CZ    1 
ATOM   2694 N  NH1   . ARG B 1 167 ? -17.721 3.256   6.182   1.00 16.39 ? 176 ARG B NH1   1 
ATOM   2695 N  NH2   . ARG B 1 167 ? -17.678 1.385   7.496   1.00 15.21 ? 176 ARG B NH2   1 
ATOM   2696 N  N     . LYS B 1 168 ? -24.974 5.026   3.187   1.00 19.78 ? 177 LYS B N     1 
ATOM   2697 C  CA    . LYS B 1 168 ? -25.802 6.161   2.767   1.00 21.11 ? 177 LYS B CA    1 
ATOM   2698 C  C     . LYS B 1 168 ? -27.295 5.825   2.891   1.00 22.24 ? 177 LYS B C     1 
ATOM   2699 O  O     . LYS B 1 168 ? -28.090 6.640   3.377   1.00 22.53 ? 177 LYS B O     1 
ATOM   2700 C  CB    . LYS B 1 168 ? -25.485 6.572   1.328   1.00 21.26 ? 177 LYS B CB    1 
ATOM   2701 C  CG    . LYS B 1 168 ? -24.124 7.222   1.133   1.00 22.36 ? 177 LYS B CG    1 
ATOM   2702 N  N     . PHE B 1 169 ? -27.657 4.617   2.461   1.00 23.51 ? 178 PHE B N     1 
ATOM   2703 C  CA    . PHE B 1 169 ? -29.044 4.131   2.521   1.00 24.83 ? 178 PHE B CA    1 
ATOM   2704 C  C     . PHE B 1 169 ? -29.567 3.958   3.958   1.00 26.23 ? 178 PHE B C     1 
ATOM   2705 O  O     . PHE B 1 169 ? -30.677 4.398   4.274   1.00 25.54 ? 178 PHE B O     1 
ATOM   2706 C  CB    . PHE B 1 169 ? -29.166 2.783   1.798   1.00 24.87 ? 178 PHE B CB    1 
ATOM   2707 C  CG    . PHE B 1 169 ? -29.558 2.884   0.340   1.00 25.53 ? 178 PHE B CG    1 
ATOM   2708 C  CD1   . PHE B 1 169 ? -28.591 3.032   -0.657  1.00 24.91 ? 178 PHE B CD1   1 
ATOM   2709 C  CD2   . PHE B 1 169 ? -30.888 2.764   -0.040  1.00 25.25 ? 178 PHE B CD2   1 
ATOM   2710 C  CE1   . PHE B 1 169 ? -28.958 3.089   -2.011  1.00 24.16 ? 178 PHE B CE1   1 
ATOM   2711 C  CE2   . PHE B 1 169 ? -31.261 2.829   -1.383  1.00 25.34 ? 178 PHE B CE2   1 
ATOM   2712 C  CZ    . PHE B 1 169 ? -30.289 2.985   -2.368  1.00 25.70 ? 178 PHE B CZ    1 
ATOM   2713 N  N     . GLN B 1 170 ? -28.777 3.294   4.805   1.00 27.83 ? 179 GLN B N     1 
ATOM   2714 C  CA    . GLN B 1 170 ? -29.207 2.924   6.157   1.00 29.66 ? 179 GLN B CA    1 
ATOM   2715 C  C     . GLN B 1 170 ? -29.115 4.109   7.113   1.00 30.71 ? 179 GLN B C     1 
ATOM   2716 O  O     . GLN B 1 170 ? -29.851 4.188   8.103   1.00 31.19 ? 179 GLN B O     1 
ATOM   2717 C  CB    . GLN B 1 170 ? -28.366 1.756   6.698   1.00 29.74 ? 179 GLN B CB    1 
ATOM   2718 C  CG    . GLN B 1 170 ? -28.599 0.434   5.965   1.00 30.87 ? 179 GLN B CG    1 
ATOM   2719 C  CD    . GLN B 1 170 ? -27.815 -0.730  6.557   1.00 30.66 ? 179 GLN B CD    1 
ATOM   2720 O  OE1   . GLN B 1 170 ? -27.050 -0.567  7.511   1.00 33.44 ? 179 GLN B OE1   1 
ATOM   2721 N  NE2   . GLN B 1 170 ? -28.001 -1.919  5.982   1.00 31.93 ? 179 GLN B NE2   1 
ATOM   2722 N  N     . GLU B 1 171 ? -28.199 5.021   6.817   1.00 31.91 ? 180 GLU B N     1 
ATOM   2723 C  CA    . GLU B 1 171 ? -27.970 6.192   7.645   1.00 32.99 ? 180 GLU B CA    1 
ATOM   2724 C  C     . GLU B 1 171 ? -28.434 7.396   6.824   1.00 33.61 ? 180 GLU B C     1 
ATOM   2725 O  O     . GLU B 1 171 ? -29.622 7.497   6.537   1.00 34.14 ? 180 GLU B O     1 
ATOM   2726 C  CB    . GLU B 1 171 ? -26.491 6.243   8.063   1.00 33.07 ? 180 GLU B CB    1 
ATOM   2727 C  CG    . GLU B 1 171 ? -26.066 4.996   8.852   1.00 33.61 ? 180 GLU B CG    1 
ATOM   2728 C  CD    . GLU B 1 171 ? -24.589 4.663   8.734   1.00 34.92 ? 180 GLU B CD    1 
ATOM   2729 O  OE1   . GLU B 1 171 ? -23.764 5.594   8.618   1.00 34.21 ? 180 GLU B OE1   1 
ATOM   2730 O  OE2   . GLU B 1 171 ? -24.256 3.456   8.772   1.00 35.97 ? 180 GLU B OE2   1 
ATOM   2731 N  N     . GLN B 1 172 ? -27.522 8.285   6.430   1.00 34.42 ? 181 GLN B N     1 
ATOM   2732 C  CA    . GLN B 1 172 ? -27.851 9.393   5.529   1.00 34.87 ? 181 GLN B CA    1 
ATOM   2733 C  C     . GLN B 1 172 ? -29.076 10.186  5.967   1.00 35.19 ? 181 GLN B C     1 
ATOM   2734 O  O     . GLN B 1 172 ? -29.054 10.898  6.972   1.00 35.50 ? 181 GLN B O     1 
ATOM   2735 O  OXT   . GLN B 1 172 ? -30.127 10.124  5.322   1.00 35.62 ? 181 GLN B OXT   1 
HETATM 2736 MG MG    . MG  C 2 .   ? 13.667  16.843  6.282   1.00 26.68 ? 3   MG  A MG    1 
HETATM 2737 P  PB    . GDP D 3 .   ? 13.698  14.857  8.941   1.00 24.37 ? 1   GDP A PB    1 
HETATM 2738 O  O1B   . GDP D 3 .   ? 12.864  13.607  9.126   1.00 25.70 ? 1   GDP A O1B   1 
HETATM 2739 O  O2B   . GDP D 3 .   ? 13.998  15.169  7.475   1.00 23.03 ? 1   GDP A O2B   1 
HETATM 2740 O  O3B   . GDP D 3 .   ? 13.047  16.024  9.627   1.00 24.98 ? 1   GDP A O3B   1 
HETATM 2741 O  O3A   . GDP D 3 .   ? 15.053  14.575  9.741   1.00 24.06 ? 1   GDP A O3A   1 
HETATM 2742 P  PA    . GDP D 3 .   ? 16.564  14.809  9.286   1.00 24.36 ? 1   GDP A PA    1 
HETATM 2743 O  O1A   . GDP D 3 .   ? 16.751  16.300  9.028   1.00 27.69 ? 1   GDP A O1A   1 
HETATM 2744 O  O2A   . GDP D 3 .   ? 17.026  13.960  8.138   1.00 26.01 ? 1   GDP A O2A   1 
HETATM 2745 O  "O5'" . GDP D 3 .   ? 17.379  14.439  10.612  1.00 25.00 ? 1   GDP A "O5'" 1 
HETATM 2746 C  "C5'" . GDP D 3 .   ? 17.140  15.118  11.845  1.00 27.16 ? 1   GDP A "C5'" 1 
HETATM 2747 C  "C4'" . GDP D 3 .   ? 18.383  15.070  12.719  1.00 26.97 ? 1   GDP A "C4'" 1 
HETATM 2748 O  "O4'" . GDP D 3 .   ? 18.677  13.712  13.043  1.00 27.40 ? 1   GDP A "O4'" 1 
HETATM 2749 C  "C3'" . GDP D 3 .   ? 19.630  15.613  12.034  1.00 28.05 ? 1   GDP A "C3'" 1 
HETATM 2750 O  "O3'" . GDP D 3 .   ? 20.461  16.203  13.041  1.00 30.99 ? 1   GDP A "O3'" 1 
HETATM 2751 C  "C2'" . GDP D 3 .   ? 20.304  14.377  11.468  1.00 27.29 ? 1   GDP A "C2'" 1 
HETATM 2752 O  "O2'" . GDP D 3 .   ? 21.730  14.418  11.380  1.00 29.60 ? 1   GDP A "O2'" 1 
HETATM 2753 C  "C1'" . GDP D 3 .   ? 19.932  13.345  12.505  1.00 25.19 ? 1   GDP A "C1'" 1 
HETATM 2754 N  N9    . GDP D 3 .   ? 19.869  11.987  11.943  1.00 25.52 ? 1   GDP A N9    1 
HETATM 2755 C  C8    . GDP D 3 .   ? 19.163  11.566  10.869  1.00 24.29 ? 1   GDP A C8    1 
HETATM 2756 N  N7    . GDP D 3 .   ? 19.351  10.239  10.691  1.00 23.58 ? 1   GDP A N7    1 
HETATM 2757 C  C5    . GDP D 3 .   ? 20.168  9.811   11.675  1.00 23.60 ? 1   GDP A C5    1 
HETATM 2758 C  C6    . GDP D 3 .   ? 20.771  8.542   12.083  1.00 24.17 ? 1   GDP A C6    1 
HETATM 2759 O  O6    . GDP D 3 .   ? 20.545  7.482   11.454  1.00 24.58 ? 1   GDP A O6    1 
HETATM 2760 N  N1    . GDP D 3 .   ? 21.558  8.545   13.176  1.00 25.18 ? 1   GDP A N1    1 
HETATM 2761 C  C2    . GDP D 3 .   ? 21.825  9.646   13.900  1.00 24.68 ? 1   GDP A C2    1 
HETATM 2762 N  N2    . GDP D 3 .   ? 22.637  9.562   14.986  1.00 25.25 ? 1   GDP A N2    1 
HETATM 2763 N  N3    . GDP D 3 .   ? 21.314  10.848  13.588  1.00 23.93 ? 1   GDP A N3    1 
HETATM 2764 C  C4    . GDP D 3 .   ? 20.494  10.970  12.505  1.00 24.11 ? 1   GDP A C4    1 
HETATM 2765 MG MG    . MG  E 2 .   ? -17.642 -18.168 -10.350 1.00 30.55 ? 4   MG  B MG    1 
HETATM 2766 P  PB    . GDP F 3 .   ? -17.558 -16.150 -12.961 1.00 26.63 ? 2   GDP B PB    1 
HETATM 2767 O  O1B   . GDP F 3 .   ? -18.265 -14.815 -13.010 1.00 25.97 ? 2   GDP B O1B   1 
HETATM 2768 O  O2B   . GDP F 3 .   ? -17.276 -16.622 -11.550 1.00 24.78 ? 2   GDP B O2B   1 
HETATM 2769 O  O3B   . GDP F 3 .   ? -18.373 -17.214 -13.682 1.00 30.26 ? 2   GDP B O3B   1 
HETATM 2770 O  O3A   . GDP F 3 .   ? -16.195 -15.872 -13.777 1.00 27.14 ? 2   GDP B O3A   1 
HETATM 2771 P  PA    . GDP F 3 .   ? -14.684 -16.139 -13.250 1.00 28.56 ? 2   GDP B PA    1 
HETATM 2772 O  O1A   . GDP F 3 .   ? -14.485 -17.603 -12.946 1.00 28.58 ? 2   GDP B O1A   1 
HETATM 2773 O  O2A   . GDP F 3 .   ? -14.288 -15.242 -12.126 1.00 26.62 ? 2   GDP B O2A   1 
HETATM 2774 O  "O5'" . GDP F 3 .   ? -13.835 -15.725 -14.535 1.00 26.53 ? 2   GDP B "O5'" 1 
HETATM 2775 C  "C5'" . GDP F 3 .   ? -14.097 -16.333 -15.802 1.00 28.61 ? 2   GDP B "C5'" 1 
HETATM 2776 C  "C4'" . GDP F 3 .   ? -12.862 -16.256 -16.684 1.00 29.16 ? 2   GDP B "C4'" 1 
HETATM 2777 O  "O4'" . GDP F 3 .   ? -12.598 -14.886 -16.942 1.00 29.32 ? 2   GDP B "O4'" 1 
HETATM 2778 C  "C3'" . GDP F 3 .   ? -11.607 -16.837 -16.040 1.00 30.68 ? 2   GDP B "C3'" 1 
HETATM 2779 O  "O3'" . GDP F 3 .   ? -10.804 -17.460 -17.054 1.00 32.46 ? 2   GDP B "O3'" 1 
HETATM 2780 C  "C2'" . GDP F 3 .   ? -10.905 -15.639 -15.444 1.00 29.94 ? 2   GDP B "C2'" 1 
HETATM 2781 O  "O2'" . GDP F 3 .   ? -9.474  -15.755 -15.369 1.00 31.18 ? 2   GDP B "O2'" 1 
HETATM 2782 C  "C1'" . GDP F 3 .   ? -11.318 -14.551 -16.419 1.00 27.61 ? 2   GDP B "C1'" 1 
HETATM 2783 N  N9    . GDP F 3 .   ? -11.364 -13.201 -15.818 1.00 27.21 ? 2   GDP B N9    1 
HETATM 2784 C  C8    . GDP F 3 .   ? -12.034 -12.811 -14.715 1.00 26.66 ? 2   GDP B C8    1 
HETATM 2785 N  N7    . GDP F 3 .   ? -11.832 -11.490 -14.485 1.00 25.45 ? 2   GDP B N7    1 
HETATM 2786 C  C5    . GDP F 3 .   ? -11.008 -11.035 -15.441 1.00 26.37 ? 2   GDP B C5    1 
HETATM 2787 C  C6    . GDP F 3 .   ? -10.384 -9.748  -15.781 1.00 26.39 ? 2   GDP B C6    1 
HETATM 2788 O  O6    . GDP F 3 .   ? -10.581 -8.734  -15.092 1.00 25.87 ? 2   GDP B O6    1 
HETATM 2789 N  N1    . GDP F 3 .   ? -9.597  -9.698  -16.869 1.00 26.75 ? 2   GDP B N1    1 
HETATM 2790 C  C2    . GDP F 3 .   ? -9.352  -10.779 -17.627 1.00 26.39 ? 2   GDP B C2    1 
HETATM 2791 N  N2    . GDP F 3 .   ? -8.544  -10.652 -18.707 1.00 27.14 ? 2   GDP B N2    1 
HETATM 2792 N  N3    . GDP F 3 .   ? -9.890  -11.992 -17.379 1.00 26.09 ? 2   GDP B N3    1 
HETATM 2793 C  C4    . GDP F 3 .   ? -10.702 -12.174 -16.315 1.00 27.28 ? 2   GDP B C4    1 
HETATM 2794 O  O     . HOH G 4 .   ? 14.820  11.270  16.724  1.00 28.34 ? 182 HOH A O     1 
HETATM 2795 O  O     . HOH G 4 .   ? 2.251   0.943   -6.684  1.00 25.28 ? 183 HOH A O     1 
HETATM 2796 O  O     . HOH G 4 .   ? 5.662   13.083  6.223   1.00 27.43 ? 184 HOH A O     1 
HETATM 2797 O  O     . HOH G 4 .   ? -2.906  -3.506  5.261   1.00 29.33 ? 185 HOH A O     1 
HETATM 2798 O  O     . HOH G 4 .   ? 7.283   8.975   12.212  1.00 20.19 ? 186 HOH A O     1 
HETATM 2799 O  O     . HOH G 4 .   ? 23.338  -6.264  -10.285 1.00 27.73 ? 187 HOH A O     1 
HETATM 2800 O  O     . HOH G 4 .   ? -1.645  4.194   -6.740  1.00 30.94 ? 188 HOH A O     1 
HETATM 2801 O  O     . HOH G 4 .   ? -8.910  -1.568  5.016   1.00 27.45 ? 189 HOH A O     1 
HETATM 2802 O  O     . HOH G 4 .   ? 3.174   -3.142  1.612   1.00 26.06 ? 190 HOH A O     1 
HETATM 2803 O  O     . HOH G 4 .   ? 12.363  12.506  15.833  1.00 30.56 ? 191 HOH A O     1 
HETATM 2804 O  O     . HOH G 4 .   ? -0.692  -1.329  5.817   1.00 45.23 ? 192 HOH A O     1 
HETATM 2805 O  O     . HOH G 4 .   ? 16.646  -4.621  9.988   1.00 27.31 ? 193 HOH A O     1 
HETATM 2806 O  O     . HOH G 4 .   ? 23.142  0.987   2.393   1.00 26.03 ? 194 HOH A O     1 
HETATM 2807 O  O     . HOH G 4 .   ? -7.821  4.734   6.796   1.00 24.28 ? 195 HOH A O     1 
HETATM 2808 O  O     . HOH G 4 .   ? 14.177  -6.013  20.804  1.00 32.24 ? 196 HOH A O     1 
HETATM 2809 O  O     . HOH G 4 .   ? 12.491  -7.258  -7.973  1.00 24.72 ? 197 HOH A O     1 
HETATM 2810 O  O     . HOH G 4 .   ? 9.949   -7.969  -6.565  1.00 30.21 ? 198 HOH A O     1 
HETATM 2811 O  O     . HOH G 4 .   ? -2.109  18.915  2.947   1.00 36.46 ? 199 HOH A O     1 
HETATM 2812 O  O     . HOH G 4 .   ? -0.196  -2.068  3.224   1.00 26.64 ? 200 HOH A O     1 
HETATM 2813 O  O     . HOH G 4 .   ? 26.274  7.270   16.512  1.00 35.04 ? 201 HOH A O     1 
HETATM 2814 O  O     . HOH G 4 .   ? 22.868  3.453   -8.702  1.00 35.16 ? 202 HOH A O     1 
HETATM 2815 O  O     . HOH G 4 .   ? 10.370  -5.010  23.494  1.00 36.32 ? 203 HOH A O     1 
HETATM 2816 O  O     . HOH G 4 .   ? 12.785  -0.122  -17.515 1.00 42.68 ? 204 HOH A O     1 
HETATM 2817 O  O     . HOH G 4 .   ? 22.821  -2.578  -7.897  1.00 26.27 ? 205 HOH A O     1 
HETATM 2818 O  O     . HOH G 4 .   ? 8.954   13.424  15.752  1.00 40.34 ? 206 HOH A O     1 
HETATM 2819 O  O     . HOH G 4 .   ? -9.424  2.389   2.712   1.00 31.00 ? 207 HOH A O     1 
HETATM 2820 O  O     . HOH G 4 .   ? -11.226 6.280   1.160   1.00 26.49 ? 208 HOH A O     1 
HETATM 2821 O  O     . HOH G 4 .   ? 7.387   -8.013  11.590  1.00 29.82 ? 209 HOH A O     1 
HETATM 2822 O  O     . HOH G 4 .   ? 24.154  -1.594  4.806   1.00 31.54 ? 210 HOH A O     1 
HETATM 2823 O  O     . HOH G 4 .   ? 19.565  12.441  16.076  1.00 33.04 ? 211 HOH A O     1 
HETATM 2824 O  O     . HOH G 4 .   ? 3.001   12.768  4.782   1.00 34.36 ? 212 HOH A O     1 
HETATM 2825 O  O     . HOH G 4 .   ? 16.287  8.973   24.141  1.00 38.31 ? 213 HOH A O     1 
HETATM 2826 O  O     . HOH G 4 .   ? 5.939   -4.215  3.143   1.00 30.12 ? 214 HOH A O     1 
HETATM 2827 O  O     . HOH G 4 .   ? 9.675   -7.410  8.310   1.00 42.40 ? 215 HOH A O     1 
HETATM 2828 O  O     . HOH G 4 .   ? 14.933  1.384   -18.085 1.00 32.92 ? 216 HOH A O     1 
HETATM 2829 O  O     . HOH G 4 .   ? 3.656   11.325  -5.257  1.00 33.39 ? 217 HOH A O     1 
HETATM 2830 O  O     . HOH G 4 .   ? -6.977  2.188   6.684   1.00 26.58 ? 218 HOH A O     1 
HETATM 2831 O  O     . HOH G 4 .   ? 15.039  -5.413  11.911  1.00 55.17 ? 219 HOH A O     1 
HETATM 2832 O  O     . HOH G 4 .   ? 7.601   0.106   25.810  1.00 43.38 ? 220 HOH A O     1 
HETATM 2833 O  O     . HOH G 4 .   ? -2.385  2.699   11.244  1.00 29.64 ? 221 HOH A O     1 
HETATM 2834 O  O     . HOH G 4 .   ? 9.363   16.634  8.887   1.00 34.05 ? 222 HOH A O     1 
HETATM 2835 O  O     . HOH G 4 .   ? 0.144   2.322   -7.862  1.00 35.37 ? 223 HOH A O     1 
HETATM 2836 O  O     . HOH G 4 .   ? 11.716  2.499   -26.914 1.00 32.98 ? 224 HOH A O     1 
HETATM 2837 O  O     . HOH G 4 .   ? 0.745   13.136  6.308   1.00 31.63 ? 225 HOH A O     1 
HETATM 2838 O  O     . HOH G 4 .   ? 4.613   -2.407  19.105  1.00 34.28 ? 226 HOH A O     1 
HETATM 2839 O  O     . HOH G 4 .   ? 27.480  14.983  -1.533  1.00 35.79 ? 227 HOH A O     1 
HETATM 2840 O  O     . HOH G 4 .   ? 13.751  14.967  16.929  1.00 44.66 ? 228 HOH A O     1 
HETATM 2841 O  O     . HOH G 4 .   ? 25.657  3.080   -2.816  1.00 36.76 ? 229 HOH A O     1 
HETATM 2842 O  O     . HOH G 4 .   ? 12.408  -8.634  -10.191 1.00 37.27 ? 230 HOH A O     1 
HETATM 2843 O  O     . HOH G 4 .   ? 9.369   9.458   25.076  1.00 46.69 ? 231 HOH A O     1 
HETATM 2844 O  O     . HOH G 4 .   ? 2.223   1.169   19.391  1.00 50.48 ? 232 HOH A O     1 
HETATM 2845 O  O     . HOH G 4 .   ? 6.920   -4.933  -12.371 1.00 37.89 ? 233 HOH A O     1 
HETATM 2846 O  O     . HOH G 4 .   ? -8.479  3.310   11.408  1.00 40.46 ? 234 HOH A O     1 
HETATM 2847 O  O     . HOH G 4 .   ? 28.989  5.099   3.049   1.00 48.72 ? 235 HOH A O     1 
HETATM 2848 O  O     . HOH G 4 .   ? -0.014  -4.845  3.617   1.00 45.41 ? 236 HOH A O     1 
HETATM 2849 O  O     . HOH G 4 .   ? 15.478  5.275   -16.543 1.00 41.21 ? 237 HOH A O     1 
HETATM 2850 O  O     . HOH G 4 .   ? 22.322  -6.318  2.620   1.00 39.82 ? 238 HOH A O     1 
HETATM 2851 O  O     . HOH G 4 .   ? 18.903  -5.507  4.953   1.00 48.99 ? 239 HOH A O     1 
HETATM 2852 O  O     . HOH G 4 .   ? 10.341  0.516   25.191  1.00 34.66 ? 240 HOH A O     1 
HETATM 2853 O  O     . HOH G 4 .   ? -5.513  1.160   8.705   1.00 30.27 ? 241 HOH A O     1 
HETATM 2854 O  O     . HOH G 4 .   ? -1.888  -6.604  -5.888  1.00 52.15 ? 242 HOH A O     1 
HETATM 2855 O  O     . HOH G 4 .   ? 13.555  11.700  21.238  1.00 38.24 ? 243 HOH A O     1 
HETATM 2856 O  O     . HOH G 4 .   ? 5.927   6.358   -12.173 1.00 40.20 ? 244 HOH A O     1 
HETATM 2857 O  O     . HOH G 4 .   ? 10.827  -0.030  -23.082 1.00 30.18 ? 245 HOH A O     1 
HETATM 2858 O  O     . HOH G 4 .   ? 8.384   -9.160  -8.446  1.00 44.92 ? 246 HOH A O     1 
HETATM 2859 O  O     . HOH G 4 .   ? 19.454  -4.085  11.331  1.00 48.30 ? 247 HOH A O     1 
HETATM 2860 O  O     . HOH G 4 .   ? -9.469  9.046   12.116  1.00 49.69 ? 248 HOH A O     1 
HETATM 2861 O  O     . HOH G 4 .   ? 28.630  9.663   9.299   1.00 44.08 ? 249 HOH A O     1 
HETATM 2862 O  O     . HOH G 4 .   ? 28.467  7.859   5.722   1.00 47.40 ? 250 HOH A O     1 
HETATM 2863 O  O     . HOH G 4 .   ? 15.079  12.479  19.122  1.00 36.88 ? 251 HOH A O     1 
HETATM 2864 O  O     . HOH G 4 .   ? 14.509  -9.724  -11.474 1.00 37.38 ? 252 HOH A O     1 
HETATM 2865 O  O     . HOH G 4 .   ? -12.592 4.605   -4.723  1.00 33.79 ? 253 HOH A O     1 
HETATM 2866 O  O     . HOH G 4 .   ? 1.102   14.238  -7.495  1.00 45.28 ? 254 HOH A O     1 
HETATM 2867 O  O     . HOH G 4 .   ? -5.460  -1.415  8.246   1.00 51.85 ? 255 HOH A O     1 
HETATM 2868 O  O     . HOH G 4 .   ? -3.151  3.230   17.335  1.00 42.27 ? 256 HOH A O     1 
HETATM 2869 O  O     . HOH G 4 .   ? 25.003  5.014   -4.458  1.00 37.82 ? 257 HOH A O     1 
HETATM 2870 O  O     . HOH G 4 .   ? -6.572  1.664   11.195  1.00 34.77 ? 258 HOH A O     1 
HETATM 2871 O  O     . HOH G 4 .   ? 11.060  -10.003 -5.143  1.00 49.66 ? 259 HOH A O     1 
HETATM 2872 O  O     . HOH G 4 .   ? 8.969   -3.833  25.379  1.00 50.06 ? 260 HOH A O     1 
HETATM 2873 O  O     . HOH G 4 .   ? 8.636   10.732  22.382  1.00 36.92 ? 261 HOH A O     1 
HETATM 2874 O  O     . HOH G 4 .   ? 22.795  -4.413  6.628   1.00 39.95 ? 262 HOH A O     1 
HETATM 2875 O  O     . HOH G 4 .   ? -5.663  16.178  -3.426  1.00 42.80 ? 263 HOH A O     1 
HETATM 2876 O  O     . HOH G 4 .   ? 14.729  2.964   -15.818 1.00 30.49 ? 264 HOH A O     1 
HETATM 2877 O  O     . HOH G 4 .   ? 7.950   13.020  19.413  1.00 47.31 ? 265 HOH A O     1 
HETATM 2878 O  O     . HOH G 4 .   ? -0.442  3.222   21.017  1.00 33.81 ? 266 HOH A O     1 
HETATM 2879 O  O     . HOH G 4 .   ? 0.790   1.405   22.391  1.00 48.01 ? 267 HOH A O     1 
HETATM 2880 O  O     . HOH G 4 .   ? 2.238   15.664  -5.635  1.00 50.40 ? 268 HOH A O     1 
HETATM 2881 O  O     . HOH G 4 .   ? 26.450  0.047   8.449   1.00 47.84 ? 269 HOH A O     1 
HETATM 2882 O  O     . HOH G 4 .   ? 0.991   -8.430  1.424   1.00 38.83 ? 270 HOH A O     1 
HETATM 2883 O  O     . HOH G 4 .   ? 20.854  -6.337  -9.124  1.00 27.48 ? 271 HOH A O     1 
HETATM 2884 O  O     . HOH G 4 .   ? 22.325  12.393  4.621   1.00 28.41 ? 272 HOH A O     1 
HETATM 2885 O  O     . HOH G 4 .   ? 19.546  -6.060  -6.423  1.00 29.96 ? 273 HOH A O     1 
HETATM 2886 O  O     . HOH G 4 .   ? 18.469  13.987  -7.604  1.00 34.85 ? 274 HOH A O     1 
HETATM 2887 O  O     . HOH G 4 .   ? 17.184  18.507  10.198  1.00 35.81 ? 275 HOH A O     1 
HETATM 2888 O  O     . HOH G 4 .   ? 14.341  17.787  11.163  1.00 35.40 ? 276 HOH A O     1 
HETATM 2889 O  O     . HOH G 4 .   ? 21.122  10.518  -8.769  1.00 33.99 ? 277 HOH A O     1 
HETATM 2890 O  O     . HOH G 4 .   ? 29.071  11.499  5.204   1.00 37.27 ? 278 HOH A O     1 
HETATM 2891 O  O     . HOH G 4 .   ? 23.569  6.067   21.889  1.00 39.26 ? 279 HOH A O     1 
HETATM 2892 O  O     . HOH G 4 .   ? 14.073  17.514  0.974   1.00 37.38 ? 280 HOH A O     1 
HETATM 2893 O  O     . HOH G 4 .   ? 19.505  1.314   -14.355 1.00 35.07 ? 281 HOH A O     1 
HETATM 2894 O  O     . HOH G 4 .   ? 21.498  8.162   -10.739 1.00 38.39 ? 282 HOH A O     1 
HETATM 2895 O  O     . HOH G 4 .   ? 4.820   14.414  -5.922  1.00 51.92 ? 283 HOH A O     1 
HETATM 2896 O  O     . HOH G 4 .   ? -2.156  1.862   19.375  1.00 41.09 ? 284 HOH A O     1 
HETATM 2897 O  O     . HOH G 4 .   ? 17.524  8.324   -14.778 1.00 45.20 ? 285 HOH A O     1 
HETATM 2898 O  O     . HOH G 4 .   ? 13.072  -2.691  -15.980 1.00 38.82 ? 286 HOH A O     1 
HETATM 2899 O  O     . HOH G 4 .   ? 22.699  9.123   -7.086  1.00 35.19 ? 287 HOH A O     1 
HETATM 2900 O  O     . HOH G 4 .   ? 29.108  12.547  -1.587  1.00 46.45 ? 288 HOH A O     1 
HETATM 2901 O  O     . HOH G 4 .   ? 0.282   -1.367  -5.734  1.00 58.23 ? 289 HOH A O     1 
HETATM 2902 O  O     . HOH G 4 .   ? -6.678  -2.845  5.906   1.00 32.79 ? 290 HOH A O     1 
HETATM 2903 O  O     . HOH G 4 .   ? 16.392  14.899  15.809  1.00 43.75 ? 291 HOH A O     1 
HETATM 2904 O  O     . HOH G 4 .   ? 6.137   12.052  -5.567  1.00 49.28 ? 292 HOH A O     1 
HETATM 2905 O  O     . HOH G 4 .   ? 8.000   1.364   -25.311 1.00 61.85 ? 293 HOH A O     1 
HETATM 2906 O  O     . HOH G 4 .   ? 24.100  11.832  16.424  1.00 50.31 ? 294 HOH A O     1 
HETATM 2907 O  O     . HOH G 4 .   ? 18.875  -9.050  -2.245  1.00 44.37 ? 295 HOH A O     1 
HETATM 2908 O  O     . HOH G 4 .   ? 10.156  6.292   -19.753 1.00 51.50 ? 296 HOH A O     1 
HETATM 2909 O  O     . HOH G 4 .   ? 12.706  17.344  15.686  1.00 53.70 ? 297 HOH A O     1 
HETATM 2910 O  O     . HOH G 4 .   ? 18.351  9.900   25.992  1.00 56.25 ? 298 HOH A O     1 
HETATM 2911 O  O     . HOH G 4 .   ? 13.604  -10.613 -6.045  1.00 45.23 ? 299 HOH A O     1 
HETATM 2912 O  O     . HOH G 4 .   ? -2.892  -5.362  -3.596  1.00 44.13 ? 300 HOH A O     1 
HETATM 2913 O  O     . HOH G 4 .   ? 24.105  7.151   -8.604  1.00 40.67 ? 301 HOH A O     1 
HETATM 2914 O  O     . HOH G 4 .   ? 8.551   12.923  -6.451  1.00 61.85 ? 302 HOH A O     1 
HETATM 2915 O  O     . HOH G 4 .   ? 19.924  16.305  8.676   1.00 39.28 ? 303 HOH A O     1 
HETATM 2916 O  O     . HOH G 4 .   ? 19.916  -5.664  8.958   1.00 49.52 ? 304 HOH A O     1 
HETATM 2917 O  O     . HOH G 4 .   ? 9.712   -7.391  1.803   1.00 39.18 ? 305 HOH A O     1 
HETATM 2918 O  O     . HOH G 4 .   ? -9.136  10.829  0.447   1.00 51.30 ? 306 HOH A O     1 
HETATM 2919 O  O     . HOH G 4 .   ? 25.500  11.091  18.892  1.00 56.54 ? 307 HOH A O     1 
HETATM 2920 O  O     . HOH G 4 .   ? 22.848  2.311   -12.574 1.00 49.62 ? 308 HOH A O     1 
HETATM 2921 O  O     . HOH G 4 .   ? 6.982   -7.225  -11.500 1.00 57.00 ? 309 HOH A O     1 
HETATM 2922 O  O     . HOH G 4 .   ? 9.828   18.776  -5.405  1.00 57.10 ? 310 HOH A O     1 
HETATM 2923 O  O     . HOH G 4 .   ? 13.982  14.947  -9.466  1.00 59.35 ? 311 HOH A O     1 
HETATM 2924 O  O     . HOH G 4 .   ? -0.280  13.777  9.487   1.00 49.11 ? 312 HOH A O     1 
HETATM 2925 O  O     . HOH G 4 .   ? 23.392  14.579  13.458  1.00 41.66 ? 313 HOH A O     1 
HETATM 2926 O  O     . HOH G 4 .   ? 13.609  -7.047  4.234   1.00 53.71 ? 314 HOH A O     1 
HETATM 2927 O  O     . HOH G 4 .   ? -3.569  2.472   -9.350  1.00 62.02 ? 315 HOH A O     1 
HETATM 2928 O  O     . HOH G 4 .   ? 3.995   2.631   24.879  1.00 44.43 ? 316 HOH A O     1 
HETATM 2929 O  O     . HOH G 4 .   ? 1.217   -9.337  9.860   1.00 44.33 ? 317 HOH A O     1 
HETATM 2930 O  O     . HOH G 4 .   ? 20.656  15.609  15.634  1.00 50.45 ? 318 HOH A O     1 
HETATM 2931 O  O     . HOH G 4 .   ? 9.862   -8.413  -1.103  1.00 64.09 ? 319 HOH A O     1 
HETATM 2932 O  O     . HOH G 4 .   ? 25.343  12.170  -6.571  1.00 61.48 ? 320 HOH A O     1 
HETATM 2933 O  O     . HOH G 4 .   ? 4.757   -2.355  23.623  1.00 55.41 ? 321 HOH A O     1 
HETATM 2934 O  O     . HOH G 4 .   ? 15.982  17.192  14.721  1.00 58.31 ? 322 HOH A O     1 
HETATM 2935 O  O     . HOH G 4 .   ? -5.433  11.971  9.817   1.00 56.48 ? 323 HOH A O     1 
HETATM 2936 O  O     . HOH G 4 .   ? 12.264  17.485  7.493   1.00 28.44 ? 324 HOH A O     1 
HETATM 2937 O  O     . HOH G 4 .   ? 26.897  13.910  -5.163  1.00 62.42 ? 325 HOH A O     1 
HETATM 2938 O  O     . HOH G 4 .   ? 14.528  -10.777 -2.738  1.00 55.95 ? 326 HOH A O     1 
HETATM 2939 O  O     . HOH G 4 .   ? 17.966  26.188  4.430   1.00 59.62 ? 327 HOH A O     1 
HETATM 2940 O  O     . HOH G 4 .   ? 13.514  18.681  5.277   1.00 27.96 ? 328 HOH A O     1 
HETATM 2941 O  O     . HOH G 4 .   ? -9.516  17.420  0.241   1.00 56.43 ? 329 HOH A O     1 
HETATM 2942 O  O     . HOH G 4 .   ? -8.603  9.538   -2.305  1.00 53.57 ? 330 HOH A O     1 
HETATM 2943 O  O     . HOH G 4 .   ? -10.440 13.321  -4.905  1.00 49.30 ? 331 HOH A O     1 
HETATM 2944 O  O     . HOH G 4 .   ? 12.284  15.874  5.110   1.00 30.21 ? 332 HOH A O     1 
HETATM 2945 O  O     . HOH G 4 .   ? 15.271  17.786  7.393   1.00 29.61 ? 333 HOH A O     1 
HETATM 2946 O  O     . HOH G 4 .   ? 3.375   1.125   -9.345  1.00 34.98 ? 334 HOH A O     1 
HETATM 2947 O  O     . HOH G 4 .   ? 4.052   14.883  11.653  1.00 61.02 ? 335 HOH A O     1 
HETATM 2948 O  O     . HOH G 4 .   ? 4.191   -5.280  2.219   1.00 39.38 ? 336 HOH A O     1 
HETATM 2949 O  O     . HOH G 4 .   ? -1.589  -7.520  -9.947  1.00 55.62 ? 337 HOH A O     1 
HETATM 2950 O  O     . HOH G 4 .   ? 14.249  7.581   -17.307 1.00 48.35 ? 338 HOH A O     1 
HETATM 2951 O  O     . HOH G 4 .   ? 15.927  18.619  -0.346  1.00 52.20 ? 339 HOH A O     1 
HETATM 2952 O  O     . HOH G 4 .   ? 24.067  6.923   25.525  0.50 33.21 ? 340 HOH A O     1 
HETATM 2953 O  O     . HOH G 4 .   ? 6.643   9.086   -12.762 1.00 53.04 ? 341 HOH A O     1 
HETATM 2954 O  O     . HOH G 4 .   ? 11.785  13.017  -7.994  1.00 49.46 ? 342 HOH A O     1 
HETATM 2955 O  O     . HOH G 4 .   ? 6.255   15.125  8.167   1.00 51.87 ? 343 HOH A O     1 
HETATM 2956 O  O     . HOH G 4 .   ? 8.118   -8.191  17.884  1.00 49.85 ? 344 HOH A O     1 
HETATM 2957 O  O     . HOH H 4 .   ? -8.020  -2.714  -5.690  1.00 23.69 ? 182 HOH B O     1 
HETATM 2958 O  O     . HOH H 4 .   ? -18.699 5.526   4.633   1.00 25.90 ? 183 HOH B O     1 
HETATM 2959 O  O     . HOH H 4 .   ? -11.502 4.343   2.994   1.00 28.10 ? 184 HOH B O     1 
HETATM 2960 O  O     . HOH H 4 .   ? -29.109 -5.270  -18.723 1.00 32.08 ? 185 HOH B O     1 
HETATM 2961 O  O     . HOH H 4 .   ? -8.231  0.910   4.449   1.00 26.74 ? 186 HOH B O     1 
HETATM 2962 O  O     . HOH H 4 .   ? -27.899 1.707   -4.845  1.00 26.16 ? 187 HOH B O     1 
HETATM 2963 O  O     . HOH H 4 .   ? -10.394 4.851   5.593   1.00 28.80 ? 188 HOH B O     1 
HETATM 2964 O  O     . HOH H 4 .   ? -5.332  -3.401  -5.932  1.00 31.55 ? 189 HOH B O     1 
HETATM 2965 O  O     . HOH H 4 .   ? -37.001 -9.171  -15.435 1.00 44.72 ? 190 HOH B O     1 
HETATM 2966 O  O     . HOH H 4 .   ? -19.454 -14.460 4.139   1.00 37.13 ? 191 HOH B O     1 
HETATM 2967 O  O     . HOH H 4 .   ? -8.919  -14.179 -8.589  1.00 26.89 ? 192 HOH B O     1 
HETATM 2968 O  O     . HOH H 4 .   ? -40.424 -4.410  -6.119  1.00 30.61 ? 193 HOH B O     1 
HETATM 2969 O  O     . HOH H 4 .   ? -14.219 3.258   -12.976 1.00 28.31 ? 194 HOH B O     1 
HETATM 2970 O  O     . HOH H 4 .   ? -23.822 -9.874  -15.962 1.00 26.09 ? 195 HOH B O     1 
HETATM 2971 O  O     . HOH H 4 .   ? -12.618 -15.736 3.866   1.00 35.97 ? 196 HOH B O     1 
HETATM 2972 O  O     . HOH H 4 .   ? -40.133 -0.086  -8.526  1.00 29.29 ? 197 HOH B O     1 
HETATM 2973 O  O     . HOH H 4 .   ? -25.396 -14.375 -10.003 1.00 32.23 ? 198 HOH B O     1 
HETATM 2974 O  O     . HOH H 4 .   ? -4.695  -8.213  -20.049 1.00 37.48 ? 199 HOH B O     1 
HETATM 2975 O  O     . HOH H 4 .   ? -6.769  -0.139  -8.144  1.00 29.50 ? 200 HOH B O     1 
HETATM 2976 O  O     . HOH H 4 .   ? -24.612 2.665   -6.343  1.00 26.46 ? 201 HOH B O     1 
HETATM 2977 O  O     . HOH H 4 .   ? -31.509 0.508   -6.691  1.00 32.98 ? 202 HOH B O     1 
HETATM 2978 O  O     . HOH H 4 .   ? -18.713 -13.200 -19.766 1.00 37.89 ? 203 HOH B O     1 
HETATM 2979 O  O     . HOH H 4 .   ? -28.917 -2.706  3.169   1.00 28.87 ? 204 HOH B O     1 
HETATM 2980 O  O     . HOH H 4 .   ? -21.331 6.291   -11.679 1.00 32.14 ? 205 HOH B O     1 
HETATM 2981 O  O     . HOH H 4 .   ? -17.894 -20.016 -9.415  1.00 29.20 ? 206 HOH B O     1 
HETATM 2982 O  O     . HOH H 4 .   ? -20.474 5.182   -26.233 1.00 49.10 ? 207 HOH B O     1 
HETATM 2983 O  O     . HOH H 4 .   ? -9.454  -9.566  7.045   1.00 34.81 ? 208 HOH B O     1 
HETATM 2984 O  O     . HOH H 4 .   ? -22.291 -17.731 -12.813 1.00 33.46 ? 209 HOH B O     1 
HETATM 2985 O  O     . HOH H 4 .   ? -14.738 3.061   -23.663 1.00 36.96 ? 210 HOH B O     1 
HETATM 2986 O  O     . HOH H 4 .   ? -16.267 -12.069 -20.484 1.00 30.21 ? 211 HOH B O     1 
HETATM 2987 O  O     . HOH H 4 .   ? -31.873 0.072   -9.187  1.00 41.83 ? 212 HOH B O     1 
HETATM 2988 O  O     . HOH H 4 .   ? -26.350 1.974   -22.178 1.00 36.74 ? 213 HOH B O     1 
HETATM 2989 O  O     . HOH H 4 .   ? -2.635  -9.451  -8.653  1.00 38.22 ? 214 HOH B O     1 
HETATM 2990 O  O     . HOH H 4 .   ? -27.073 -18.717 -7.497  1.00 46.40 ? 215 HOH B O     1 
HETATM 2991 O  O     . HOH H 4 .   ? -25.132 -16.159 -12.248 1.00 50.53 ? 216 HOH B O     1 
HETATM 2992 O  O     . HOH H 4 .   ? -11.613 -18.170 -12.743 1.00 44.96 ? 217 HOH B O     1 
HETATM 2993 O  O     . HOH H 4 .   ? -42.294 -8.050  -4.585  1.00 29.50 ? 218 HOH B O     1 
HETATM 2994 O  O     . HOH H 4 .   ? -23.528 6.816   -14.409 1.00 35.13 ? 219 HOH B O     1 
HETATM 2995 O  O     . HOH H 4 .   ? -12.593 -2.741  -28.309 1.00 43.83 ? 220 HOH B O     1 
HETATM 2996 O  O     . HOH H 4 .   ? -4.047  -6.780  -1.721  1.00 33.20 ? 221 HOH B O     1 
HETATM 2997 O  O     . HOH H 4 .   ? -6.029  -7.135  1.259   1.00 39.63 ? 222 HOH B O     1 
HETATM 2998 O  O     . HOH H 4 .   ? -21.619 9.539   -19.469 1.00 49.09 ? 223 HOH B O     1 
HETATM 2999 O  O     . HOH H 4 .   ? -5.706  -10.134 0.490   1.00 41.10 ? 224 HOH B O     1 
HETATM 3000 O  O     . HOH H 4 .   ? -20.702 0.164   -28.354 1.00 44.38 ? 225 HOH B O     1 
HETATM 3001 O  O     . HOH H 4 .   ? -38.031 -3.662  -10.179 1.00 24.90 ? 226 HOH B O     1 
HETATM 3002 O  O     . HOH H 4 .   ? -5.728  -4.956  -0.602  1.00 34.48 ? 227 HOH B O     1 
HETATM 3003 O  O     . HOH H 4 .   ? -41.739 -3.139  -15.388 1.00 32.48 ? 228 HOH B O     1 
HETATM 3004 O  O     . HOH H 4 .   ? -15.975 4.472   -14.775 1.00 48.54 ? 229 HOH B O     1 
HETATM 3005 O  O     . HOH H 4 .   ? -43.605 -6.369  1.271   1.00 43.61 ? 230 HOH B O     1 
HETATM 3006 O  O     . HOH H 4 .   ? -11.807 3.190   -14.373 1.00 51.46 ? 231 HOH B O     1 
HETATM 3007 O  O     . HOH H 4 .   ? -25.043 6.845   -12.188 1.00 47.84 ? 232 HOH B O     1 
HETATM 3008 O  O     . HOH H 4 .   ? -36.772 -2.146  -11.930 1.00 30.60 ? 233 HOH B O     1 
HETATM 3009 O  O     . HOH H 4 .   ? -32.924 0.461   1.007   1.00 53.67 ? 234 HOH B O     1 
HETATM 3010 O  O     . HOH H 4 .   ? -8.568  4.423   -6.217  1.00 37.64 ? 235 HOH B O     1 
HETATM 3011 O  O     . HOH H 4 .   ? -28.120 -14.232 -8.930  1.00 35.57 ? 236 HOH B O     1 
HETATM 3012 O  O     . HOH H 4 .   ? -30.665 2.682   -6.289  1.00 49.21 ? 237 HOH B O     1 
HETATM 3013 O  O     . HOH H 4 .   ? -35.283 -15.647 -2.961  1.00 50.04 ? 238 HOH B O     1 
HETATM 3014 O  O     . HOH H 4 .   ? -12.239 7.142   -1.330  1.00 37.97 ? 239 HOH B O     1 
HETATM 3015 O  O     . HOH H 4 .   ? -18.078 -29.150 -10.946 1.00 41.29 ? 240 HOH B O     1 
HETATM 3016 O  O     . HOH H 4 .   ? -16.637 8.027   7.842   1.00 42.28 ? 241 HOH B O     1 
HETATM 3017 O  O     . HOH H 4 .   ? -8.418  -11.056 3.275   1.00 26.37 ? 242 HOH B O     1 
HETATM 3018 O  O     . HOH H 4 .   ? -32.802 -6.334  3.025   1.00 35.20 ? 243 HOH B O     1 
HETATM 3019 O  O     . HOH H 4 .   ? -6.009  -6.914  3.995   1.00 42.38 ? 244 HOH B O     1 
HETATM 3020 O  O     . HOH H 4 .   ? -23.705 9.449   -14.629 1.00 57.37 ? 245 HOH B O     1 
HETATM 3021 O  O     . HOH H 4 .   ? -37.293 -2.097  -14.449 1.00 35.45 ? 246 HOH B O     1 
HETATM 3022 O  O     . HOH H 4 .   ? -25.047 -15.899 -18.050 1.00 53.57 ? 247 HOH B O     1 
HETATM 3023 O  O     . HOH H 4 .   ? -35.759 -10.306 -13.104 1.00 36.79 ? 248 HOH B O     1 
HETATM 3024 O  O     . HOH H 4 .   ? -33.412 -3.399  -14.487 1.00 41.75 ? 249 HOH B O     1 
HETATM 3025 O  O     . HOH H 4 .   ? -18.858 7.092   6.850   1.00 37.85 ? 250 HOH B O     1 
HETATM 3026 O  O     . HOH H 4 .   ? -7.432  -7.036  -25.447 1.00 39.67 ? 251 HOH B O     1 
HETATM 3027 O  O     . HOH H 4 .   ? -35.695 -8.543  2.828   1.00 46.21 ? 252 HOH B O     1 
HETATM 3028 O  O     . HOH H 4 .   ? -30.982 -0.352  2.690   1.00 47.95 ? 253 HOH B O     1 
HETATM 3029 O  O     . HOH H 4 .   ? -36.264 -11.121 -17.976 1.00 45.56 ? 254 HOH B O     1 
HETATM 3030 O  O     . HOH H 4 .   ? -11.526 1.806   -16.815 1.00 38.39 ? 255 HOH B O     1 
HETATM 3031 O  O     . HOH H 4 .   ? -2.159  -13.942 -9.269  1.00 39.91 ? 256 HOH B O     1 
HETATM 3032 O  O     . HOH H 4 .   ? -22.925 -13.545 -23.630 1.00 51.38 ? 257 HOH B O     1 
HETATM 3033 O  O     . HOH H 4 .   ? -33.877 -10.686 -22.181 1.00 47.31 ? 258 HOH B O     1 
HETATM 3034 O  O     . HOH H 4 .   ? -35.663 1.401   -0.538  1.00 51.46 ? 259 HOH B O     1 
HETATM 3035 O  O     . HOH H 4 .   ? -36.382 0.953   2.115   1.00 44.74 ? 260 HOH B O     1 
HETATM 3036 O  O     . HOH H 4 .   ? -11.734 3.937   -7.861  1.00 39.14 ? 261 HOH B O     1 
HETATM 3037 O  O     . HOH H 4 .   ? -30.104 8.620   -12.799 1.00 57.66 ? 262 HOH B O     1 
HETATM 3038 O  O     . HOH H 4 .   ? -12.122 -24.743 -9.222  1.00 46.88 ? 263 HOH B O     1 
HETATM 3039 O  O     . HOH H 4 .   ? -31.072 -4.511  4.099   1.00 38.64 ? 264 HOH B O     1 
HETATM 3040 O  O     . HOH H 4 .   ? -7.979  2.567   -9.879  1.00 59.32 ? 265 HOH B O     1 
HETATM 3041 O  O     . HOH H 4 .   ? -32.527 -20.970 3.018   1.00 61.72 ? 266 HOH B O     1 
HETATM 3042 O  O     . HOH H 4 .   ? -22.876 7.921   -21.138 1.00 53.68 ? 267 HOH B O     1 
HETATM 3043 O  O     . HOH H 4 .   ? -21.285 6.113   3.367   1.00 28.51 ? 268 HOH B O     1 
HETATM 3044 O  O     . HOH H 4 .   ? -17.017 -19.023 -15.264 1.00 35.50 ? 269 HOH B O     1 
HETATM 3045 O  O     . HOH H 4 .   ? -14.346 -19.775 -14.512 1.00 45.93 ? 270 HOH B O     1 
HETATM 3046 O  O     . HOH H 4 .   ? -6.940  -12.739 -20.135 1.00 46.60 ? 271 HOH B O     1 
HETATM 3047 O  O     . HOH H 4 .   ? -12.710 -20.345 -16.615 1.00 59.03 ? 272 HOH B O     1 
HETATM 3048 O  O     . HOH H 4 .   ? -26.826 -2.055  -28.094 1.00 45.24 ? 273 HOH B O     1 
HETATM 3049 O  O     . HOH H 4 .   ? -1.942  -9.329  -5.987  1.00 45.47 ? 274 HOH B O     1 
HETATM 3050 O  O     . HOH H 4 .   ? -28.276 7.202   -25.901 1.00 53.17 ? 275 HOH B O     1 
HETATM 3051 O  O     . HOH H 4 .   ? -5.196  -19.656 -11.590 1.00 56.61 ? 276 HOH B O     1 
HETATM 3052 O  O     . HOH H 4 .   ? -26.739 4.254   -5.505  1.00 46.54 ? 277 HOH B O     1 
HETATM 3053 O  O     . HOH H 4 .   ? -11.444 -13.442 -19.651 1.00 43.59 ? 278 HOH B O     1 
HETATM 3054 O  O     . HOH H 4 .   ? -22.131 -13.927 -19.837 1.00 50.16 ? 279 HOH B O     1 
HETATM 3055 O  O     . HOH H 4 .   ? -8.143  -5.165  5.241   1.00 39.09 ? 280 HOH B O     1 
HETATM 3056 O  O     . HOH H 4 .   ? -24.882 -8.359  8.443   1.00 43.87 ? 281 HOH B O     1 
HETATM 3057 O  O     . HOH H 4 .   ? -16.404 -4.346  12.402  1.00 45.69 ? 282 HOH B O     1 
HETATM 3058 O  O     . HOH H 4 .   ? -10.794 -16.096 -19.635 1.00 57.04 ? 283 HOH B O     1 
HETATM 3059 O  O     . HOH H 4 .   ? -10.319 -0.476  -20.989 1.00 38.61 ? 284 HOH B O     1 
HETATM 3060 O  O     . HOH H 4 .   ? -7.023  -9.675  5.051   1.00 51.55 ? 285 HOH B O     1 
HETATM 3061 O  O     . HOH H 4 .   ? -37.914 1.251   -9.263  1.00 37.47 ? 286 HOH B O     1 
HETATM 3062 O  O     . HOH H 4 .   ? -4.651  -0.453  -11.683 1.00 44.23 ? 287 HOH B O     1 
HETATM 3063 O  O     . HOH H 4 .   ? -25.475 -5.830  9.022   1.00 51.32 ? 288 HOH B O     1 
HETATM 3064 O  O     . HOH H 4 .   ? -1.301  -9.272  -15.390 1.00 53.59 ? 289 HOH B O     1 
HETATM 3065 O  O     . HOH H 4 .   ? -13.638 -9.473  11.093  1.00 52.04 ? 290 HOH B O     1 
HETATM 3066 O  O     . HOH H 4 .   ? -16.106 -19.091 -11.592 1.00 29.85 ? 291 HOH B O     1 
HETATM 3067 O  O     . HOH H 4 .   ? -26.014 2.657   -27.019 1.00 61.41 ? 292 HOH B O     1 
HETATM 3068 O  O     . HOH H 4 .   ? -14.799 -8.645  -28.052 1.00 38.85 ? 293 HOH B O     1 
HETATM 3069 O  O     . HOH H 4 .   ? -34.897 2.547   -10.958 1.00 47.41 ? 294 HOH B O     1 
HETATM 3070 O  O     . HOH H 4 .   ? -7.780  -16.149 -17.236 1.00 47.29 ? 295 HOH B O     1 
HETATM 3071 O  O     . HOH H 4 .   ? -31.286 6.498   -0.663  1.00 47.38 ? 296 HOH B O     1 
HETATM 3072 O  O     . HOH H 4 .   ? -7.539  -18.153 -18.951 1.00 46.10 ? 297 HOH B O     1 
HETATM 3073 O  O     . HOH H 4 .   ? -30.096 -26.413 -5.785  1.00 50.30 ? 298 HOH B O     1 
HETATM 3074 O  O     . HOH H 4 .   ? -18.999 -17.195 -9.090  1.00 26.79 ? 299 HOH B O     1 
HETATM 3075 O  O     . HOH H 4 .   ? -19.185 -18.732 -11.659 1.00 26.73 ? 300 HOH B O     1 
HETATM 3076 O  O     . HOH H 4 .   ? -28.412 -19.819 -3.319  1.00 40.04 ? 301 HOH B O     1 
HETATM 3077 O  O     . HOH H 4 .   ? -26.247 -14.668 5.524   1.00 38.24 ? 302 HOH B O     1 
HETATM 3078 O  O     . HOH H 4 .   ? -24.014 -24.200 -10.953 1.00 48.01 ? 303 HOH B O     1 
HETATM 3079 O  O     . HOH H 4 .   ? -32.545 -13.143 -11.213 1.00 62.38 ? 304 HOH B O     1 
HETATM 3080 O  O     . HOH H 4 .   ? -23.934 -22.582 -12.946 1.00 50.84 ? 305 HOH B O     1 
HETATM 3081 O  O     . HOH H 4 .   ? -28.392 -10.729 -24.965 1.00 47.44 ? 306 HOH B O     1 
HETATM 3082 O  O     . HOH H 4 .   ? -16.999 5.768   -23.664 1.00 46.83 ? 307 HOH B O     1 
HETATM 3083 O  O     . HOH H 4 .   ? -35.249 -19.062 -4.823  1.00 51.62 ? 308 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   10  10  SER SER A . n 
A 1 2   MET 2   11  11  MET MET A . n 
A 1 3   GLN 3   12  12  GLN GLN A . n 
A 1 4   GLU 4   13  13  GLU GLU A . n 
A 1 5   LYS 5   14  14  LYS LYS A . n 
A 1 6   TYR 6   15  15  TYR TYR A . n 
A 1 7   ARG 7   16  16  ARG ARG A . n 
A 1 8   LEU 8   17  17  LEU LEU A . n 
A 1 9   VAL 9   18  18  VAL VAL A . n 
A 1 10  VAL 10  19  19  VAL VAL A . n 
A 1 11  VAL 11  20  20  VAL VAL A . n 
A 1 12  GLY 12  21  21  GLY GLY A . n 
A 1 13  GLY 13  22  22  GLY GLY A . n 
A 1 14  GLY 14  23  23  GLY GLY A . n 
A 1 15  GLY 15  24  24  GLY GLY A . n 
A 1 16  VAL 16  25  25  VAL VAL A . n 
A 1 17  GLY 17  26  26  GLY GLY A . n 
A 1 18  LYS 18  27  27  LYS LYS A . n 
A 1 19  SER 19  28  28  SER SER A . n 
A 1 20  ALA 20  29  29  ALA ALA A . n 
A 1 21  LEU 21  30  30  LEU LEU A . n 
A 1 22  THR 22  31  31  THR THR A . n 
A 1 23  ILE 23  32  32  ILE ILE A . n 
A 1 24  GLN 24  33  33  GLN GLN A . n 
A 1 25  PHE 25  34  34  PHE PHE A . n 
A 1 26  ILE 26  35  35  ILE ILE A . n 
A 1 27  GLN 27  36  36  GLN GLN A . n 
A 1 28  SER 28  37  37  SER SER A . n 
A 1 29  TYR 29  38  38  TYR TYR A . n 
A 1 30  PHE 30  39  39  PHE PHE A . n 
A 1 31  VAL 31  40  40  VAL VAL A . n 
A 1 32  THR 32  41  41  THR THR A . n 
A 1 33  ASP 33  42  42  ASP ASP A . n 
A 1 34  TYR 34  43  43  TYR TYR A . n 
A 1 35  ASP 35  44  44  ASP ASP A . n 
A 1 36  PRO 36  45  45  PRO PRO A . n 
A 1 37  THR 37  46  46  THR THR A . n 
A 1 38  ILE 38  47  47  ILE ILE A . n 
A 1 39  GLU 39  48  48  GLU GLU A . n 
A 1 40  ASP 40  49  49  ASP ASP A . n 
A 1 41  SER 41  50  50  SER SER A . n 
A 1 42  TYR 42  51  51  TYR TYR A . n 
A 1 43  THR 43  52  52  THR THR A . n 
A 1 44  LYS 44  53  53  LYS LYS A . n 
A 1 45  GLN 45  54  54  GLN GLN A . n 
A 1 46  CYS 46  55  55  CYS CYS A . n 
A 1 47  VAL 47  56  56  VAL VAL A . n 
A 1 48  ILE 48  57  57  ILE ILE A . n 
A 1 49  ASP 49  58  58  ASP ASP A . n 
A 1 50  ASP 50  59  59  ASP ASP A . n 
A 1 51  ARG 51  60  60  ARG ARG A . n 
A 1 52  ALA 52  61  61  ALA ALA A . n 
A 1 53  ALA 53  62  62  ALA ALA A . n 
A 1 54  ARG 54  63  63  ARG ARG A . n 
A 1 55  LEU 55  64  64  LEU LEU A . n 
A 1 56  ASP 56  65  65  ASP ASP A . n 
A 1 57  ILE 57  66  66  ILE ILE A . n 
A 1 58  LEU 58  67  67  LEU LEU A . n 
A 1 59  ASP 59  68  68  ASP ASP A . n 
A 1 60  THR 60  69  69  THR THR A . n 
A 1 61  ALA 61  70  70  ALA ALA A . n 
A 1 62  GLY 62  71  ?   ?   ?   A . n 
A 1 63  GLN 63  72  ?   ?   ?   A . n 
A 1 64  GLU 64  73  ?   ?   ?   A . n 
A 1 65  GLU 65  74  ?   ?   ?   A . n 
A 1 66  PHE 66  75  75  PHE PHE A . n 
A 1 67  GLY 67  76  76  GLY GLY A . n 
A 1 68  ALA 68  77  77  ALA ALA A . n 
A 1 69  MET 69  78  78  MET MET A . n 
A 1 70  ARG 70  79  79  ARG ARG A . n 
A 1 71  GLU 71  80  80  GLU GLU A . n 
A 1 72  GLN 72  81  81  GLN GLN A . n 
A 1 73  TYR 73  82  82  TYR TYR A . n 
A 1 74  MET 74  83  83  MET MET A . n 
A 1 75  ARG 75  84  84  ARG ARG A . n 
A 1 76  THR 76  85  85  THR THR A . n 
A 1 77  GLY 77  86  86  GLY GLY A . n 
A 1 78  GLU 78  87  87  GLU GLU A . n 
A 1 79  GLY 79  88  88  GLY GLY A . n 
A 1 80  PHE 80  89  89  PHE PHE A . n 
A 1 81  LEU 81  90  90  LEU LEU A . n 
A 1 82  LEU 82  91  91  LEU LEU A . n 
A 1 83  VAL 83  92  92  VAL VAL A . n 
A 1 84  PHE 84  93  93  PHE PHE A . n 
A 1 85  SER 85  94  94  SER SER A . n 
A 1 86  VAL 86  95  95  VAL VAL A . n 
A 1 87  THR 87  96  96  THR THR A . n 
A 1 88  ASP 88  97  97  ASP ASP A . n 
A 1 89  ARG 89  98  98  ARG ARG A . n 
A 1 90  GLY 90  99  99  GLY GLY A . n 
A 1 91  SER 91  100 100 SER SER A . n 
A 1 92  PHE 92  101 101 PHE PHE A . n 
A 1 93  GLU 93  102 102 GLU GLU A . n 
A 1 94  GLU 94  103 103 GLU GLU A . n 
A 1 95  ILE 95  104 104 ILE ILE A . n 
A 1 96  TYR 96  105 105 TYR TYR A . n 
A 1 97  LYS 97  106 106 LYS LYS A . n 
A 1 98  PHE 98  107 107 PHE PHE A . n 
A 1 99  GLN 99  108 108 GLN GLN A . n 
A 1 100 ARG 100 109 109 ARG ARG A . n 
A 1 101 GLN 101 110 110 GLN GLN A . n 
A 1 102 ILE 102 111 111 ILE ILE A . n 
A 1 103 LEU 103 112 112 LEU LEU A . n 
A 1 104 ARG 104 113 113 ARG ARG A . n 
A 1 105 VAL 105 114 114 VAL VAL A . n 
A 1 106 LYS 106 115 115 LYS LYS A . n 
A 1 107 ASP 107 116 116 ASP ASP A . n 
A 1 108 ARG 108 117 117 ARG ARG A . n 
A 1 109 ASP 109 118 118 ASP ASP A . n 
A 1 110 GLU 110 119 119 GLU GLU A . n 
A 1 111 PHE 111 120 120 PHE PHE A . n 
A 1 112 PRO 112 121 121 PRO PRO A . n 
A 1 113 MET 113 122 122 MET MET A . n 
A 1 114 ILE 114 123 123 ILE ILE A . n 
A 1 115 LEU 115 124 124 LEU LEU A . n 
A 1 116 ILE 116 125 125 ILE ILE A . n 
A 1 117 GLY 117 126 126 GLY GLY A . n 
A 1 118 ASN 118 127 127 ASN ASN A . n 
A 1 119 LYS 119 128 128 LYS LYS A . n 
A 1 120 ALA 120 129 129 ALA ALA A . n 
A 1 121 ASP 121 130 130 ASP ASP A . n 
A 1 122 LEU 122 131 131 LEU LEU A . n 
A 1 123 ASP 123 132 132 ASP ASP A . n 
A 1 124 HIS 124 133 133 HIS HIS A . n 
A 1 125 GLN 125 134 134 GLN GLN A . n 
A 1 126 ARG 126 135 135 ARG ARG A . n 
A 1 127 GLN 127 136 136 GLN GLN A . n 
A 1 128 VAL 128 137 137 VAL VAL A . n 
A 1 129 THR 129 138 138 THR THR A . n 
A 1 130 GLN 130 139 139 GLN GLN A . n 
A 1 131 GLU 131 140 140 GLU GLU A . n 
A 1 132 GLU 132 141 141 GLU GLU A . n 
A 1 133 GLY 133 142 142 GLY GLY A . n 
A 1 134 GLN 134 143 143 GLN GLN A . n 
A 1 135 GLN 135 144 144 GLN GLN A . n 
A 1 136 LEU 136 145 145 LEU LEU A . n 
A 1 137 ALA 137 146 146 ALA ALA A . n 
A 1 138 ARG 138 147 147 ARG ARG A . n 
A 1 139 GLN 139 148 148 GLN GLN A . n 
A 1 140 LEU 140 149 149 LEU LEU A . n 
A 1 141 LYS 141 150 150 LYS LYS A . n 
A 1 142 VAL 142 151 151 VAL VAL A . n 
A 1 143 THR 143 152 152 THR THR A . n 
A 1 144 TYR 144 153 153 TYR TYR A . n 
A 1 145 MET 145 154 154 MET MET A . n 
A 1 146 GLU 146 155 155 GLU GLU A . n 
A 1 147 ALA 147 156 156 ALA ALA A . n 
A 1 148 SER 148 157 157 SER SER A . n 
A 1 149 ALA 149 158 158 ALA ALA A . n 
A 1 150 LYS 150 159 159 LYS LYS A . n 
A 1 151 ILE 151 160 160 ILE ILE A . n 
A 1 152 ARG 152 161 161 ARG ARG A . n 
A 1 153 MET 153 162 162 MET MET A . n 
A 1 154 ASN 154 163 163 ASN ASN A . n 
A 1 155 VAL 155 164 164 VAL VAL A . n 
A 1 156 ASP 156 165 165 ASP ASP A . n 
A 1 157 GLN 157 166 166 GLN GLN A . n 
A 1 158 ALA 158 167 167 ALA ALA A . n 
A 1 159 PHE 159 168 168 PHE PHE A . n 
A 1 160 HIS 160 169 169 HIS HIS A . n 
A 1 161 GLU 161 170 170 GLU GLU A . n 
A 1 162 LEU 162 171 171 LEU LEU A . n 
A 1 163 VAL 163 172 172 VAL VAL A . n 
A 1 164 ARG 164 173 173 ARG ARG A . n 
A 1 165 VAL 165 174 174 VAL VAL A . n 
A 1 166 ILE 166 175 175 ILE ILE A . n 
A 1 167 ARG 167 176 176 ARG ARG A . n 
A 1 168 LYS 168 177 177 LYS LYS A . n 
A 1 169 PHE 169 178 178 PHE PHE A . n 
A 1 170 GLN 170 179 179 GLN GLN A . n 
A 1 171 GLU 171 180 180 GLU GLU A . n 
A 1 172 GLN 172 181 ?   ?   ?   A . n 
B 1 1   SER 1   10  ?   ?   ?   B . n 
B 1 2   MET 2   11  ?   ?   ?   B . n 
B 1 3   GLN 3   12  ?   ?   ?   B . n 
B 1 4   GLU 4   13  13  GLU GLU B . n 
B 1 5   LYS 5   14  14  LYS LYS B . n 
B 1 6   TYR 6   15  15  TYR TYR B . n 
B 1 7   ARG 7   16  16  ARG ARG B . n 
B 1 8   LEU 8   17  17  LEU LEU B . n 
B 1 9   VAL 9   18  18  VAL VAL B . n 
B 1 10  VAL 10  19  19  VAL VAL B . n 
B 1 11  VAL 11  20  20  VAL VAL B . n 
B 1 12  GLY 12  21  21  GLY GLY B . n 
B 1 13  GLY 13  22  22  GLY GLY B . n 
B 1 14  GLY 14  23  23  GLY GLY B . n 
B 1 15  GLY 15  24  24  GLY GLY B . n 
B 1 16  VAL 16  25  25  VAL VAL B . n 
B 1 17  GLY 17  26  26  GLY GLY B . n 
B 1 18  LYS 18  27  27  LYS LYS B . n 
B 1 19  SER 19  28  28  SER SER B . n 
B 1 20  ALA 20  29  29  ALA ALA B . n 
B 1 21  LEU 21  30  30  LEU LEU B . n 
B 1 22  THR 22  31  31  THR THR B . n 
B 1 23  ILE 23  32  32  ILE ILE B . n 
B 1 24  GLN 24  33  33  GLN GLN B . n 
B 1 25  PHE 25  34  34  PHE PHE B . n 
B 1 26  ILE 26  35  35  ILE ILE B . n 
B 1 27  GLN 27  36  36  GLN GLN B . n 
B 1 28  SER 28  37  37  SER SER B . n 
B 1 29  TYR 29  38  38  TYR TYR B . n 
B 1 30  PHE 30  39  39  PHE PHE B . n 
B 1 31  VAL 31  40  40  VAL VAL B . n 
B 1 32  THR 32  41  41  THR THR B . n 
B 1 33  ASP 33  42  42  ASP ASP B . n 
B 1 34  TYR 34  43  43  TYR TYR B . n 
B 1 35  ASP 35  44  44  ASP ASP B . n 
B 1 36  PRO 36  45  45  PRO PRO B . n 
B 1 37  THR 37  46  46  THR THR B . n 
B 1 38  ILE 38  47  47  ILE ILE B . n 
B 1 39  GLU 39  48  48  GLU GLU B . n 
B 1 40  ASP 40  49  49  ASP ASP B . n 
B 1 41  SER 41  50  50  SER SER B . n 
B 1 42  TYR 42  51  51  TYR TYR B . n 
B 1 43  THR 43  52  52  THR THR B . n 
B 1 44  LYS 44  53  53  LYS LYS B . n 
B 1 45  GLN 45  54  54  GLN GLN B . n 
B 1 46  CYS 46  55  55  CYS CYS B . n 
B 1 47  VAL 47  56  56  VAL VAL B . n 
B 1 48  ILE 48  57  57  ILE ILE B . n 
B 1 49  ASP 49  58  58  ASP ASP B . n 
B 1 50  ASP 50  59  59  ASP ASP B . n 
B 1 51  ARG 51  60  60  ARG ARG B . n 
B 1 52  ALA 52  61  61  ALA ALA B . n 
B 1 53  ALA 53  62  62  ALA ALA B . n 
B 1 54  ARG 54  63  63  ARG ARG B . n 
B 1 55  LEU 55  64  64  LEU LEU B . n 
B 1 56  ASP 56  65  65  ASP ASP B . n 
B 1 57  ILE 57  66  66  ILE ILE B . n 
B 1 58  LEU 58  67  67  LEU LEU B . n 
B 1 59  ASP 59  68  68  ASP ASP B . n 
B 1 60  THR 60  69  69  THR THR B . n 
B 1 61  ALA 61  70  70  ALA ALA B . n 
B 1 62  GLY 62  71  71  GLY GLY B . n 
B 1 63  GLN 63  72  72  GLN GLN B . n 
B 1 64  GLU 64  73  73  GLU GLU B . n 
B 1 65  GLU 65  74  74  GLU GLU B . n 
B 1 66  PHE 66  75  75  PHE PHE B . n 
B 1 67  GLY 67  76  76  GLY GLY B . n 
B 1 68  ALA 68  77  77  ALA ALA B . n 
B 1 69  MET 69  78  78  MET MET B . n 
B 1 70  ARG 70  79  79  ARG ARG B . n 
B 1 71  GLU 71  80  80  GLU GLU B . n 
B 1 72  GLN 72  81  81  GLN GLN B . n 
B 1 73  TYR 73  82  82  TYR TYR B . n 
B 1 74  MET 74  83  83  MET MET B . n 
B 1 75  ARG 75  84  84  ARG ARG B . n 
B 1 76  THR 76  85  85  THR THR B . n 
B 1 77  GLY 77  86  86  GLY GLY B . n 
B 1 78  GLU 78  87  87  GLU GLU B . n 
B 1 79  GLY 79  88  88  GLY GLY B . n 
B 1 80  PHE 80  89  89  PHE PHE B . n 
B 1 81  LEU 81  90  90  LEU LEU B . n 
B 1 82  LEU 82  91  91  LEU LEU B . n 
B 1 83  VAL 83  92  92  VAL VAL B . n 
B 1 84  PHE 84  93  93  PHE PHE B . n 
B 1 85  SER 85  94  94  SER SER B . n 
B 1 86  VAL 86  95  95  VAL VAL B . n 
B 1 87  THR 87  96  96  THR THR B . n 
B 1 88  ASP 88  97  97  ASP ASP B . n 
B 1 89  ARG 89  98  98  ARG ARG B . n 
B 1 90  GLY 90  99  99  GLY GLY B . n 
B 1 91  SER 91  100 100 SER SER B . n 
B 1 92  PHE 92  101 101 PHE PHE B . n 
B 1 93  GLU 93  102 102 GLU GLU B . n 
B 1 94  GLU 94  103 103 GLU GLU B . n 
B 1 95  ILE 95  104 104 ILE ILE B . n 
B 1 96  TYR 96  105 105 TYR TYR B . n 
B 1 97  LYS 97  106 106 LYS LYS B . n 
B 1 98  PHE 98  107 107 PHE PHE B . n 
B 1 99  GLN 99  108 108 GLN GLN B . n 
B 1 100 ARG 100 109 109 ARG ARG B . n 
B 1 101 GLN 101 110 110 GLN GLN B . n 
B 1 102 ILE 102 111 111 ILE ILE B . n 
B 1 103 LEU 103 112 112 LEU LEU B . n 
B 1 104 ARG 104 113 113 ARG ARG B . n 
B 1 105 VAL 105 114 114 VAL VAL B . n 
B 1 106 LYS 106 115 115 LYS LYS B . n 
B 1 107 ASP 107 116 116 ASP ASP B . n 
B 1 108 ARG 108 117 117 ARG ARG B . n 
B 1 109 ASP 109 118 118 ASP ASP B . n 
B 1 110 GLU 110 119 119 GLU GLU B . n 
B 1 111 PHE 111 120 120 PHE PHE B . n 
B 1 112 PRO 112 121 121 PRO PRO B . n 
B 1 113 MET 113 122 122 MET MET B . n 
B 1 114 ILE 114 123 123 ILE ILE B . n 
B 1 115 LEU 115 124 124 LEU LEU B . n 
B 1 116 ILE 116 125 125 ILE ILE B . n 
B 1 117 GLY 117 126 126 GLY GLY B . n 
B 1 118 ASN 118 127 127 ASN ASN B . n 
B 1 119 LYS 119 128 128 LYS LYS B . n 
B 1 120 ALA 120 129 129 ALA ALA B . n 
B 1 121 ASP 121 130 130 ASP ASP B . n 
B 1 122 LEU 122 131 131 LEU LEU B . n 
B 1 123 ASP 123 132 132 ASP ASP B . n 
B 1 124 HIS 124 133 133 HIS HIS B . n 
B 1 125 GLN 125 134 134 GLN GLN B . n 
B 1 126 ARG 126 135 135 ARG ARG B . n 
B 1 127 GLN 127 136 136 GLN GLN B . n 
B 1 128 VAL 128 137 137 VAL VAL B . n 
B 1 129 THR 129 138 138 THR THR B . n 
B 1 130 GLN 130 139 139 GLN GLN B . n 
B 1 131 GLU 131 140 140 GLU GLU B . n 
B 1 132 GLU 132 141 141 GLU GLU B . n 
B 1 133 GLY 133 142 142 GLY GLY B . n 
B 1 134 GLN 134 143 143 GLN GLN B . n 
B 1 135 GLN 135 144 144 GLN GLN B . n 
B 1 136 LEU 136 145 145 LEU LEU B . n 
B 1 137 ALA 137 146 146 ALA ALA B . n 
B 1 138 ARG 138 147 147 ARG ARG B . n 
B 1 139 GLN 139 148 148 GLN GLN B . n 
B 1 140 LEU 140 149 149 LEU LEU B . n 
B 1 141 LYS 141 150 150 LYS LYS B . n 
B 1 142 VAL 142 151 151 VAL VAL B . n 
B 1 143 THR 143 152 152 THR THR B . n 
B 1 144 TYR 144 153 153 TYR TYR B . n 
B 1 145 MET 145 154 154 MET MET B . n 
B 1 146 GLU 146 155 155 GLU GLU B . n 
B 1 147 ALA 147 156 156 ALA ALA B . n 
B 1 148 SER 148 157 157 SER SER B . n 
B 1 149 ALA 149 158 158 ALA ALA B . n 
B 1 150 LYS 150 159 159 LYS LYS B . n 
B 1 151 ILE 151 160 160 ILE ILE B . n 
B 1 152 ARG 152 161 161 ARG ARG B . n 
B 1 153 MET 153 162 162 MET MET B . n 
B 1 154 ASN 154 163 163 ASN ASN B . n 
B 1 155 VAL 155 164 164 VAL VAL B . n 
B 1 156 ASP 156 165 165 ASP ASP B . n 
B 1 157 GLN 157 166 166 GLN GLN B . n 
B 1 158 ALA 158 167 167 ALA ALA B . n 
B 1 159 PHE 159 168 168 PHE PHE B . n 
B 1 160 HIS 160 169 169 HIS HIS B . n 
B 1 161 GLU 161 170 170 GLU GLU B . n 
B 1 162 LEU 162 171 171 LEU LEU B . n 
B 1 163 VAL 163 172 172 VAL VAL B . n 
B 1 164 ARG 164 173 173 ARG ARG B . n 
B 1 165 VAL 165 174 174 VAL VAL B . n 
B 1 166 ILE 166 175 175 ILE ILE B . n 
B 1 167 ARG 167 176 176 ARG ARG B . n 
B 1 168 LYS 168 177 177 LYS LYS B . n 
B 1 169 PHE 169 178 178 PHE PHE B . n 
B 1 170 GLN 170 179 179 GLN GLN B . n 
B 1 171 GLU 171 180 180 GLU GLU B . n 
B 1 172 GLN 172 181 181 GLN GLN B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1   3   1   MG  MG  A . 
D 3 GDP 1   1   1   GDP GDP A . 
E 2 MG  1   4   2   MG  MG  B . 
F 3 GDP 1   2   2   GDP GDP B . 
G 4 HOH 1   182 11  HOH HOH A . 
G 4 HOH 2   183 14  HOH HOH A . 
G 4 HOH 3   184 15  HOH HOH A . 
G 4 HOH 4   185 18  HOH HOH A . 
G 4 HOH 5   186 19  HOH HOH A . 
G 4 HOH 6   187 21  HOH HOH A . 
G 4 HOH 7   188 24  HOH HOH A . 
G 4 HOH 8   189 25  HOH HOH A . 
G 4 HOH 9   190 28  HOH HOH A . 
G 4 HOH 10  191 29  HOH HOH A . 
G 4 HOH 11  192 31  HOH HOH A . 
G 4 HOH 12  193 32  HOH HOH A . 
G 4 HOH 13  194 33  HOH HOH A . 
G 4 HOH 14  195 36  HOH HOH A . 
G 4 HOH 15  196 39  HOH HOH A . 
G 4 HOH 16  197 42  HOH HOH A . 
G 4 HOH 17  198 43  HOH HOH A . 
G 4 HOH 18  199 45  HOH HOH A . 
G 4 HOH 19  200 46  HOH HOH A . 
G 4 HOH 20  201 47  HOH HOH A . 
G 4 HOH 21  202 53  HOH HOH A . 
G 4 HOH 22  203 55  HOH HOH A . 
G 4 HOH 23  204 57  HOH HOH A . 
G 4 HOH 24  205 59  HOH HOH A . 
G 4 HOH 25  206 62  HOH HOH A . 
G 4 HOH 26  207 65  HOH HOH A . 
G 4 HOH 27  208 67  HOH HOH A . 
G 4 HOH 28  209 68  HOH HOH A . 
G 4 HOH 29  210 72  HOH HOH A . 
G 4 HOH 30  211 73  HOH HOH A . 
G 4 HOH 31  212 75  HOH HOH A . 
G 4 HOH 32  213 77  HOH HOH A . 
G 4 HOH 33  214 83  HOH HOH A . 
G 4 HOH 34  215 84  HOH HOH A . 
G 4 HOH 35  216 88  HOH HOH A . 
G 4 HOH 36  217 89  HOH HOH A . 
G 4 HOH 37  218 93  HOH HOH A . 
G 4 HOH 38  219 94  HOH HOH A . 
G 4 HOH 39  220 95  HOH HOH A . 
G 4 HOH 40  221 96  HOH HOH A . 
G 4 HOH 41  222 102 HOH HOH A . 
G 4 HOH 42  223 103 HOH HOH A . 
G 4 HOH 43  224 104 HOH HOH A . 
G 4 HOH 44  225 106 HOH HOH A . 
G 4 HOH 45  226 107 HOH HOH A . 
G 4 HOH 46  227 108 HOH HOH A . 
G 4 HOH 47  228 110 HOH HOH A . 
G 4 HOH 48  229 111 HOH HOH A . 
G 4 HOH 49  230 112 HOH HOH A . 
G 4 HOH 50  231 115 HOH HOH A . 
G 4 HOH 51  232 118 HOH HOH A . 
G 4 HOH 52  233 122 HOH HOH A . 
G 4 HOH 53  234 123 HOH HOH A . 
G 4 HOH 54  235 124 HOH HOH A . 
G 4 HOH 55  236 125 HOH HOH A . 
G 4 HOH 56  237 127 HOH HOH A . 
G 4 HOH 57  238 128 HOH HOH A . 
G 4 HOH 58  239 135 HOH HOH A . 
G 4 HOH 59  240 136 HOH HOH A . 
G 4 HOH 60  241 139 HOH HOH A . 
G 4 HOH 61  242 141 HOH HOH A . 
G 4 HOH 62  243 143 HOH HOH A . 
G 4 HOH 63  244 148 HOH HOH A . 
G 4 HOH 64  245 149 HOH HOH A . 
G 4 HOH 65  246 151 HOH HOH A . 
G 4 HOH 66  247 152 HOH HOH A . 
G 4 HOH 67  248 153 HOH HOH A . 
G 4 HOH 68  249 154 HOH HOH A . 
G 4 HOH 69  250 155 HOH HOH A . 
G 4 HOH 70  251 156 HOH HOH A . 
G 4 HOH 71  252 158 HOH HOH A . 
G 4 HOH 72  253 159 HOH HOH A . 
G 4 HOH 73  254 161 HOH HOH A . 
G 4 HOH 74  255 164 HOH HOH A . 
G 4 HOH 75  256 165 HOH HOH A . 
G 4 HOH 76  257 166 HOH HOH A . 
G 4 HOH 77  258 167 HOH HOH A . 
G 4 HOH 78  259 170 HOH HOH A . 
G 4 HOH 79  260 172 HOH HOH A . 
G 4 HOH 80  261 173 HOH HOH A . 
G 4 HOH 81  262 175 HOH HOH A . 
G 4 HOH 82  263 176 HOH HOH A . 
G 4 HOH 83  264 181 HOH HOH A . 
G 4 HOH 84  265 182 HOH HOH A . 
G 4 HOH 85  266 185 HOH HOH A . 
G 4 HOH 86  267 187 HOH HOH A . 
G 4 HOH 87  268 189 HOH HOH A . 
G 4 HOH 88  269 198 HOH HOH A . 
G 4 HOH 89  270 200 HOH HOH A . 
G 4 HOH 90  271 206 HOH HOH A . 
G 4 HOH 91  272 207 HOH HOH A . 
G 4 HOH 92  273 208 HOH HOH A . 
G 4 HOH 93  274 209 HOH HOH A . 
G 4 HOH 94  275 210 HOH HOH A . 
G 4 HOH 95  276 211 HOH HOH A . 
G 4 HOH 96  277 214 HOH HOH A . 
G 4 HOH 97  278 216 HOH HOH A . 
G 4 HOH 98  279 217 HOH HOH A . 
G 4 HOH 99  280 218 HOH HOH A . 
G 4 HOH 100 281 220 HOH HOH A . 
G 4 HOH 101 282 221 HOH HOH A . 
G 4 HOH 102 283 222 HOH HOH A . 
G 4 HOH 103 284 226 HOH HOH A . 
G 4 HOH 104 285 227 HOH HOH A . 
G 4 HOH 105 286 228 HOH HOH A . 
G 4 HOH 106 287 230 HOH HOH A . 
G 4 HOH 107 288 231 HOH HOH A . 
G 4 HOH 108 289 233 HOH HOH A . 
G 4 HOH 109 290 235 HOH HOH A . 
G 4 HOH 110 291 237 HOH HOH A . 
G 4 HOH 111 292 246 HOH HOH A . 
G 4 HOH 112 293 247 HOH HOH A . 
G 4 HOH 113 294 249 HOH HOH A . 
G 4 HOH 114 295 252 HOH HOH A . 
G 4 HOH 115 296 257 HOH HOH A . 
G 4 HOH 116 297 258 HOH HOH A . 
G 4 HOH 117 298 263 HOH HOH A . 
G 4 HOH 118 299 264 HOH HOH A . 
G 4 HOH 119 300 271 HOH HOH A . 
G 4 HOH 120 301 272 HOH HOH A . 
G 4 HOH 121 302 273 HOH HOH A . 
G 4 HOH 122 303 275 HOH HOH A . 
G 4 HOH 123 304 276 HOH HOH A . 
G 4 HOH 124 305 277 HOH HOH A . 
G 4 HOH 125 306 280 HOH HOH A . 
G 4 HOH 126 307 286 HOH HOH A . 
G 4 HOH 127 308 288 HOH HOH A . 
G 4 HOH 128 309 290 HOH HOH A . 
G 4 HOH 129 310 301 HOH HOH A . 
G 4 HOH 130 311 302 HOH HOH A . 
G 4 HOH 131 312 305 HOH HOH A . 
G 4 HOH 132 313 306 HOH HOH A . 
G 4 HOH 133 314 308 HOH HOH A . 
G 4 HOH 134 315 315 HOH HOH A . 
G 4 HOH 135 316 319 HOH HOH A . 
G 4 HOH 136 317 322 HOH HOH A . 
G 4 HOH 137 318 323 HOH HOH A . 
G 4 HOH 138 319 327 HOH HOH A . 
G 4 HOH 139 320 329 HOH HOH A . 
G 4 HOH 140 321 331 HOH HOH A . 
G 4 HOH 141 322 339 HOH HOH A . 
G 4 HOH 142 323 348 HOH HOH A . 
G 4 HOH 143 324 349 HOH HOH A . 
G 4 HOH 144 325 350 HOH HOH A . 
G 4 HOH 145 326 362 HOH HOH A . 
G 4 HOH 146 327 364 HOH HOH A . 
G 4 HOH 147 328 374 HOH HOH A . 
G 4 HOH 148 329 377 HOH HOH A . 
G 4 HOH 149 330 379 HOH HOH A . 
G 4 HOH 150 331 381 HOH HOH A . 
G 4 HOH 151 332 383 HOH HOH A . 
G 4 HOH 152 333 401 HOH HOH A . 
G 4 HOH 153 334 402 HOH HOH A . 
G 4 HOH 154 335 403 HOH HOH A . 
G 4 HOH 155 336 404 HOH HOH A . 
G 4 HOH 156 337 407 HOH HOH A . 
G 4 HOH 157 338 409 HOH HOH A . 
G 4 HOH 158 339 410 HOH HOH A . 
G 4 HOH 159 340 414 HOH HOH A . 
G 4 HOH 160 341 418 HOH HOH A . 
G 4 HOH 161 342 419 HOH HOH A . 
G 4 HOH 162 343 420 HOH HOH A . 
G 4 HOH 163 344 421 HOH HOH A . 
H 4 HOH 1   182 10  HOH HOH B . 
H 4 HOH 2   183 12  HOH HOH B . 
H 4 HOH 3   184 13  HOH HOH B . 
H 4 HOH 4   185 16  HOH HOH B . 
H 4 HOH 5   186 17  HOH HOH B . 
H 4 HOH 6   187 20  HOH HOH B . 
H 4 HOH 7   188 22  HOH HOH B . 
H 4 HOH 8   189 23  HOH HOH B . 
H 4 HOH 9   190 26  HOH HOH B . 
H 4 HOH 10  191 27  HOH HOH B . 
H 4 HOH 11  192 30  HOH HOH B . 
H 4 HOH 12  193 35  HOH HOH B . 
H 4 HOH 13  194 37  HOH HOH B . 
H 4 HOH 14  195 38  HOH HOH B . 
H 4 HOH 15  196 40  HOH HOH B . 
H 4 HOH 16  197 41  HOH HOH B . 
H 4 HOH 17  198 44  HOH HOH B . 
H 4 HOH 18  199 48  HOH HOH B . 
H 4 HOH 19  200 49  HOH HOH B . 
H 4 HOH 20  201 50  HOH HOH B . 
H 4 HOH 21  202 51  HOH HOH B . 
H 4 HOH 22  203 52  HOH HOH B . 
H 4 HOH 23  204 54  HOH HOH B . 
H 4 HOH 24  205 56  HOH HOH B . 
H 4 HOH 25  206 58  HOH HOH B . 
H 4 HOH 26  207 61  HOH HOH B . 
H 4 HOH 27  208 63  HOH HOH B . 
H 4 HOH 28  209 64  HOH HOH B . 
H 4 HOH 29  210 69  HOH HOH B . 
H 4 HOH 30  211 70  HOH HOH B . 
H 4 HOH 31  212 71  HOH HOH B . 
H 4 HOH 32  213 74  HOH HOH B . 
H 4 HOH 33  214 76  HOH HOH B . 
H 4 HOH 34  215 78  HOH HOH B . 
H 4 HOH 35  216 79  HOH HOH B . 
H 4 HOH 36  217 80  HOH HOH B . 
H 4 HOH 37  218 81  HOH HOH B . 
H 4 HOH 38  219 82  HOH HOH B . 
H 4 HOH 39  220 85  HOH HOH B . 
H 4 HOH 40  221 86  HOH HOH B . 
H 4 HOH 41  222 87  HOH HOH B . 
H 4 HOH 42  223 90  HOH HOH B . 
H 4 HOH 43  224 92  HOH HOH B . 
H 4 HOH 44  225 97  HOH HOH B . 
H 4 HOH 45  226 98  HOH HOH B . 
H 4 HOH 46  227 99  HOH HOH B . 
H 4 HOH 47  228 100 HOH HOH B . 
H 4 HOH 48  229 105 HOH HOH B . 
H 4 HOH 49  230 109 HOH HOH B . 
H 4 HOH 50  231 113 HOH HOH B . 
H 4 HOH 51  232 114 HOH HOH B . 
H 4 HOH 52  233 116 HOH HOH B . 
H 4 HOH 53  234 117 HOH HOH B . 
H 4 HOH 54  235 119 HOH HOH B . 
H 4 HOH 55  236 120 HOH HOH B . 
H 4 HOH 56  237 121 HOH HOH B . 
H 4 HOH 57  238 131 HOH HOH B . 
H 4 HOH 58  239 133 HOH HOH B . 
H 4 HOH 59  240 134 HOH HOH B . 
H 4 HOH 60  241 137 HOH HOH B . 
H 4 HOH 61  242 138 HOH HOH B . 
H 4 HOH 62  243 140 HOH HOH B . 
H 4 HOH 63  244 142 HOH HOH B . 
H 4 HOH 64  245 144 HOH HOH B . 
H 4 HOH 65  246 145 HOH HOH B . 
H 4 HOH 66  247 147 HOH HOH B . 
H 4 HOH 67  248 157 HOH HOH B . 
H 4 HOH 68  249 160 HOH HOH B . 
H 4 HOH 69  250 162 HOH HOH B . 
H 4 HOH 70  251 169 HOH HOH B . 
H 4 HOH 71  252 174 HOH HOH B . 
H 4 HOH 72  253 177 HOH HOH B . 
H 4 HOH 73  254 178 HOH HOH B . 
H 4 HOH 74  255 179 HOH HOH B . 
H 4 HOH 75  256 180 HOH HOH B . 
H 4 HOH 76  257 183 HOH HOH B . 
H 4 HOH 77  258 184 HOH HOH B . 
H 4 HOH 78  259 188 HOH HOH B . 
H 4 HOH 79  260 190 HOH HOH B . 
H 4 HOH 80  261 191 HOH HOH B . 
H 4 HOH 81  262 194 HOH HOH B . 
H 4 HOH 82  263 201 HOH HOH B . 
H 4 HOH 83  264 202 HOH HOH B . 
H 4 HOH 84  265 203 HOH HOH B . 
H 4 HOH 85  266 204 HOH HOH B . 
H 4 HOH 86  267 205 HOH HOH B . 
H 4 HOH 87  268 213 HOH HOH B . 
H 4 HOH 88  269 215 HOH HOH B . 
H 4 HOH 89  270 224 HOH HOH B . 
H 4 HOH 90  271 239 HOH HOH B . 
H 4 HOH 91  272 241 HOH HOH B . 
H 4 HOH 92  273 242 HOH HOH B . 
H 4 HOH 93  274 244 HOH HOH B . 
H 4 HOH 94  275 245 HOH HOH B . 
H 4 HOH 95  276 250 HOH HOH B . 
H 4 HOH 96  277 251 HOH HOH B . 
H 4 HOH 97  278 253 HOH HOH B . 
H 4 HOH 98  279 261 HOH HOH B . 
H 4 HOH 99  280 262 HOH HOH B . 
H 4 HOH 100 281 265 HOH HOH B . 
H 4 HOH 101 282 269 HOH HOH B . 
H 4 HOH 102 283 289 HOH HOH B . 
H 4 HOH 103 284 295 HOH HOH B . 
H 4 HOH 104 285 300 HOH HOH B . 
H 4 HOH 105 286 304 HOH HOH B . 
H 4 HOH 106 287 309 HOH HOH B . 
H 4 HOH 107 288 324 HOH HOH B . 
H 4 HOH 108 289 325 HOH HOH B . 
H 4 HOH 109 290 332 HOH HOH B . 
H 4 HOH 110 291 334 HOH HOH B . 
H 4 HOH 111 292 335 HOH HOH B . 
H 4 HOH 112 293 338 HOH HOH B . 
H 4 HOH 113 294 346 HOH HOH B . 
H 4 HOH 114 295 351 HOH HOH B . 
H 4 HOH 115 296 358 HOH HOH B . 
H 4 HOH 116 297 360 HOH HOH B . 
H 4 HOH 117 298 368 HOH HOH B . 
H 4 HOH 118 299 373 HOH HOH B . 
H 4 HOH 119 300 384 HOH HOH B . 
H 4 HOH 120 301 391 HOH HOH B . 
H 4 HOH 121 302 394 HOH HOH B . 
H 4 HOH 122 303 406 HOH HOH B . 
H 4 HOH 123 304 408 HOH HOH B . 
H 4 HOH 124 305 415 HOH HOH B . 
H 4 HOH 125 306 416 HOH HOH B . 
H 4 HOH 126 307 417 HOH HOH B . 
H 4 HOH 127 308 422 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? G HOH .  ? A HOH 324 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 332 ? 1_555 91.4  ? 
2  O   ? G HOH .  ? A HOH 324 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O2B ? D GDP .  ? A GDP 1   ? 1_555 91.3  ? 
3  O   ? G HOH .  ? A HOH 332 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O2B ? D GDP .  ? A GDP 1   ? 1_555 93.1  ? 
4  O   ? G HOH .  ? A HOH 324 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 OG  ? A SER 19 ? A SER 28  ? 1_555 177.9 ? 
5  O   ? G HOH .  ? A HOH 332 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 OG  ? A SER 19 ? A SER 28  ? 1_555 86.7  ? 
6  O2B ? D GDP .  ? A GDP 1   ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 OG  ? A SER 19 ? A SER 28  ? 1_555 89.6  ? 
7  O   ? G HOH .  ? A HOH 324 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 328 ? 1_555 87.5  ? 
8  O   ? G HOH .  ? A HOH 332 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 328 ? 1_555 95.2  ? 
9  O2B ? D GDP .  ? A GDP 1   ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 328 ? 1_555 171.6 ? 
10 OG  ? A SER 19 ? A SER 28  ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 328 ? 1_555 91.8  ? 
11 O   ? G HOH .  ? A HOH 324 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 333 ? 1_555 94.0  ? 
12 O   ? G HOH .  ? A HOH 332 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 333 ? 1_555 174.5 ? 
13 O2B ? D GDP .  ? A GDP 1   ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 333 ? 1_555 86.5  ? 
14 OG  ? A SER 19 ? A SER 28  ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 333 ? 1_555 87.9  ? 
15 O   ? G HOH .  ? A HOH 328 ? 1_555 MG ? C MG . ? A MG 3 ? 1_555 O   ? G HOH .  ? A HOH 333 ? 1_555 85.3  ? 
16 O2B ? F GDP .  ? B GDP 2   ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 299 ? 1_555 97.0  ? 
17 O2B ? F GDP .  ? B GDP 2   ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 300 ? 1_555 88.2  ? 
18 O   ? H HOH .  ? B HOH 299 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 300 ? 1_555 91.4  ? 
19 O2B ? F GDP .  ? B GDP 2   ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 OG  ? B SER 19 ? B SER 28  ? 1_555 94.2  ? 
20 O   ? H HOH .  ? B HOH 299 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 OG  ? B SER 19 ? B SER 28  ? 1_555 81.3  ? 
21 O   ? H HOH .  ? B HOH 300 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 OG  ? B SER 19 ? B SER 28  ? 1_555 172.5 ? 
22 O2B ? F GDP .  ? B GDP 2   ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 291 ? 1_555 81.7  ? 
23 O   ? H HOH .  ? B HOH 299 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 291 ? 1_555 175.6 ? 
24 O   ? H HOH .  ? B HOH 300 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 291 ? 1_555 92.8  ? 
25 OG  ? B SER 19 ? B SER 28  ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 291 ? 1_555 94.6  ? 
26 O2B ? F GDP .  ? B GDP 2   ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 206 ? 1_555 168.6 ? 
27 O   ? H HOH .  ? B HOH 299 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 206 ? 1_555 93.7  ? 
28 O   ? H HOH .  ? B HOH 300 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 206 ? 1_555 87.3  ? 
29 OG  ? B SER 19 ? B SER 28  ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 206 ? 1_555 91.6  ? 
30 O   ? H HOH .  ? B HOH 291 ? 1_555 MG ? E MG . ? B MG 4 ? 1_555 O   ? H HOH .  ? B HOH 206 ? 1_555 88.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-11-08 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Refinement description'    
4 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 10.9806  4.1165  4.4665  0.0515  -0.0593 0.0578 0.0045  0.0261  0.0109 4.3458 0.9035 5.0393 0.7753 
0.2308  -0.2135 0.0107  -0.0464 0.0357  0.0763  -0.1705 -0.1524 0.0819  -0.0615 -0.1299 
'X-RAY DIFFRACTION' 2 ? refined 10.5332  1.9229  1.4539  0.0294  -0.0259 0.0487 -0.0093 0.0068  0.0223 2.4293 0.6122 3.8656 0.0495 
-0.0709 -0.1866 0.0125  0.0112  -0.0237 0.1553  -0.0147 0.0068  -0.0235 -0.0913 0.0455  
'X-RAY DIFFRACTION' 3 ? refined 9.1819   2.4380  4.5989  0.0083  0.0173  0.0309 0.0038  0.0023  0.0274 5.8086 1.1036 2.9896 0.5189 
2.2373  0.1194  0.0270  0.0154  -0.0424 0.2764  -0.0910 -0.0275 0.0493  -0.0597 0.2491  
'X-RAY DIFFRACTION' 4 ? refined 11.0695  2.3153  4.2519  0.0127  -0.0107 0.0407 0.0067  -0.0002 0.0198 2.5792 1.1657 4.5240 0.5417 
0.1217  0.2007  0.0220  -0.0260 0.0040  0.0689  0.0436  -0.0243 0.0816  -0.1599 -0.0619 
'X-RAY DIFFRACTION' 5 ? refined -18.5258 -5.5036 -6.0650 0.0577  0.0263  0.1095 0.0267  -0.0297 0.0360 4.7353 1.3217 4.0982 0.4734 
0.5176  1.3359  -0.0202 -0.1040 0.1242  0.0846  0.0826  0.0956  -0.1258 -0.2261 -0.0853 
'X-RAY DIFFRACTION' 6 ? refined -16.9412 -2.7390 -5.2904 0.0053  0.1030  0.0508 0.0283  -0.0024 0.0298 3.8159 0.7865 1.7643 0.1279 
0.1130  -0.2370 0.0051  -0.0171 0.0120  0.0750  -0.0024 -0.0540 0.0297  0.0581  0.1259  
'X-RAY DIFFRACTION' 7 ? refined -20.5889 -3.8597 -6.4762 -0.0063 0.1966  0.0194 0.0276  -0.0098 0.0187 4.6206 1.3274 2.4278 
-0.3896 -1.4042 0.4481  0.0028  0.0550  -0.0579 -0.1888 0.0449  0.0064  -0.0056 0.0479  0.4072  
'X-RAY DIFFRACTION' 8 ? refined -17.8316 -3.9272 -5.8076 0.0215  0.0517  0.0469 -0.0036 -0.0092 0.0315 5.7999 0.7325 3.0903 
-0.0127 1.4897  0.2031  0.0590  -0.0412 -0.0178 -0.0050 -0.2143 -0.0512 -0.0787 0.0472  -0.1357 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 22  A 51  ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 52  A 100 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 101 A 133 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 A 134 A 180 ? . . . . ? 
'X-RAY DIFFRACTION' 5 5 B 25  B 55  ? . . . . ? 
'X-RAY DIFFRACTION' 6 6 B 56  B 95  ? . . . . ? 
'X-RAY DIFFRACTION' 7 7 B 96  B 142 ? . . . . ? 
'X-RAY DIFFRACTION' 8 8 B 143 B 181 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PHASER    phasing          .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              84 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              84 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              84 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.09 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            17.09 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 42  ? ? -147.89 58.66   
2 1 ASP A 44  ? ? -38.71  113.80  
3 1 ASP B 42  ? ? -145.41 51.98   
4 1 ASP B 44  ? ? -38.16  122.61  
5 1 ARG B 84  ? ? -24.82  -77.47  
6 1 GLU B 180 ? ? -111.82 -114.00 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 22 ? ? GLY A 23 ? ? 66.09  
2 1 MET B 83 ? ? ARG B 84 ? ? 114.68 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 10  ? OG  ? A SER 1   OG  
2  1 Y 1 A GLN 12  ? CG  ? A GLN 3   CG  
3  1 Y 1 A GLN 12  ? CD  ? A GLN 3   CD  
4  1 Y 1 A GLN 12  ? OE1 ? A GLN 3   OE1 
5  1 Y 1 A GLN 12  ? NE2 ? A GLN 3   NE2 
6  1 Y 1 A LYS 14  ? CE  ? A LYS 5   CE  
7  1 Y 1 A LYS 14  ? NZ  ? A LYS 5   NZ  
8  1 Y 1 A ASP 42  ? OD1 ? A ASP 33  OD1 
9  1 Y 1 A ASP 42  ? OD2 ? A ASP 33  OD2 
10 1 Y 1 A ARG 63  ? CZ  ? A ARG 54  CZ  
11 1 Y 1 A ARG 63  ? NH1 ? A ARG 54  NH1 
12 1 Y 1 A ARG 63  ? NH2 ? A ARG 54  NH2 
13 1 Y 1 A LYS 106 ? CE  ? A LYS 97  CE  
14 1 Y 1 A LYS 106 ? NZ  ? A LYS 97  NZ  
15 1 Y 1 A GLU 180 ? CG  ? A GLU 171 CG  
16 1 Y 1 A GLU 180 ? CD  ? A GLU 171 CD  
17 1 Y 1 A GLU 180 ? OE1 ? A GLU 171 OE1 
18 1 Y 1 A GLU 180 ? OE2 ? A GLU 171 OE2 
19 1 Y 1 B LYS 14  ? CD  ? B LYS 5   CD  
20 1 Y 1 B LYS 14  ? CE  ? B LYS 5   CE  
21 1 Y 1 B LYS 14  ? NZ  ? B LYS 5   NZ  
22 1 Y 1 B ASP 42  ? CG  ? B ASP 33  CG  
23 1 Y 1 B ASP 42  ? OD1 ? B ASP 33  OD1 
24 1 Y 1 B ASP 42  ? OD2 ? B ASP 33  OD2 
25 1 Y 1 B ILE 47  ? CD1 ? B ILE 38  CD1 
26 1 Y 1 B ARG 63  ? NE  ? B ARG 54  NE  
27 1 Y 1 B ARG 63  ? CZ  ? B ARG 54  CZ  
28 1 Y 1 B ARG 63  ? NH1 ? B ARG 54  NH1 
29 1 Y 1 B ARG 63  ? NH2 ? B ARG 54  NH2 
30 1 Y 1 B GLN 72  ? CG  ? B GLN 63  CG  
31 1 Y 1 B GLN 72  ? CD  ? B GLN 63  CD  
32 1 Y 1 B GLN 72  ? OE1 ? B GLN 63  OE1 
33 1 Y 1 B GLN 72  ? NE2 ? B GLN 63  NE2 
34 1 Y 1 B LYS 106 ? CE  ? B LYS 97  CE  
35 1 Y 1 B LYS 106 ? NZ  ? B LYS 97  NZ  
36 1 Y 1 B GLN 110 ? CD  ? B GLN 101 CD  
37 1 Y 1 B GLN 110 ? OE1 ? B GLN 101 OE1 
38 1 Y 1 B GLN 110 ? NE2 ? B GLN 101 NE2 
39 1 Y 1 B GLU 140 ? CD  ? B GLU 131 CD  
40 1 Y 1 B GLU 140 ? OE1 ? B GLU 131 OE1 
41 1 Y 1 B GLU 140 ? OE2 ? B GLU 131 OE2 
42 1 Y 1 B LYS 150 ? CD  ? B LYS 141 CD  
43 1 Y 1 B LYS 150 ? CE  ? B LYS 141 CE  
44 1 Y 1 B LYS 150 ? NZ  ? B LYS 141 NZ  
45 1 Y 1 B LYS 177 ? CD  ? B LYS 168 CD  
46 1 Y 1 B LYS 177 ? CE  ? B LYS 168 CE  
47 1 Y 1 B LYS 177 ? NZ  ? B LYS 168 NZ  
48 1 Y 1 B GLN 181 ? CB  ? B GLN 172 CB  
49 1 Y 1 B GLN 181 ? CG  ? B GLN 172 CG  
50 1 Y 1 B GLN 181 ? CD  ? B GLN 172 CD  
51 1 Y 1 B GLN 181 ? OE1 ? B GLN 172 OE1 
52 1 Y 1 B GLN 181 ? NE2 ? B GLN 172 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 71  ? A GLY 62  
2 1 Y 1 A GLN 72  ? A GLN 63  
3 1 Y 1 A GLU 73  ? A GLU 64  
4 1 Y 1 A GLU 74  ? A GLU 65  
5 1 Y 1 A GLN 181 ? A GLN 172 
6 1 Y 1 B SER 10  ? B SER 1   
7 1 Y 1 B MET 11  ? B MET 2   
8 1 Y 1 B GLN 12  ? B GLN 3   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 water                      HOH 
#