data_2EUG
# 
_entry.id   2EUG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EUG         
RCSB  RCSB007029   
WWPDB D_1000007029 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EUG . unspecified 
PDB 3EUG . unspecified 
PDB 4EUG . unspecified 
PDB 5EUG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EUG 
_pdbx_database_status.recvd_initial_deposition_date   1998-10-13 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xiao, G.'        1 
'Tordova, M.'     2 
'Jagadeesh, J.'   3 
'Drohat, A.C.'    4 
'Stivers, J.T.'   5 
'Gilliland, G.L.' 6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of Escherichia coli uracil DNA glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited.
;
_citation.journal_abbrev            Proteins 
_citation.journal_volume            35 
_citation.page_first                13 
_citation.page_last                 24 
_citation.year                      1999 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10090282 
_citation.pdbx_database_id_DOI      '10.1002/(SICI)1097-0134(19990401)35:1<13::AID-PROT2>3.3.CO;2-U' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xiao, G.'        1 
primary 'Tordova, M.'     2 
primary 'Jagadeesh, J.'   3 
primary 'Drohat, A.C.'    4 
primary 'Stivers, J.T.'   5 
primary 'Gilliland, G.L.' 6 
# 
_cell.entry_id           2EUG 
_cell.length_a           53.830 
_cell.length_b           59.190 
_cell.length_c           63.910 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2EUG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (GLYCOSYLASE)' 25681.107 1   3.2.2.3 Y19H ? 'THE PROTEIN IS COMPLEXED WITH URACIL' 
2 non-polymer syn URACIL                  112.087   1   ?       ?    ? ?                                      
3 water       nat water                   18.015    277 ?       ?    ? ?                                      
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'UDG, UNG' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVR
PGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVV
FLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVR
PGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVV
FLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASN n 
1 4   GLU n 
1 5   LEU n 
1 6   THR n 
1 7   TRP n 
1 8   HIS n 
1 9   ASP n 
1 10  VAL n 
1 11  LEU n 
1 12  ALA n 
1 13  GLU n 
1 14  GLU n 
1 15  LYS n 
1 16  GLN n 
1 17  GLN n 
1 18  PRO n 
1 19  HIS n 
1 20  PHE n 
1 21  LEU n 
1 22  ASN n 
1 23  THR n 
1 24  LEU n 
1 25  GLN n 
1 26  THR n 
1 27  VAL n 
1 28  ALA n 
1 29  SER n 
1 30  GLU n 
1 31  ARG n 
1 32  GLN n 
1 33  SER n 
1 34  GLY n 
1 35  VAL n 
1 36  THR n 
1 37  ILE n 
1 38  TYR n 
1 39  PRO n 
1 40  PRO n 
1 41  GLN n 
1 42  LYS n 
1 43  ASP n 
1 44  VAL n 
1 45  PHE n 
1 46  ASN n 
1 47  ALA n 
1 48  PHE n 
1 49  ARG n 
1 50  PHE n 
1 51  THR n 
1 52  GLU n 
1 53  LEU n 
1 54  GLY n 
1 55  ASP n 
1 56  VAL n 
1 57  LYS n 
1 58  VAL n 
1 59  VAL n 
1 60  ILE n 
1 61  LEU n 
1 62  GLY n 
1 63  GLN n 
1 64  ASP n 
1 65  PRO n 
1 66  TYR n 
1 67  HIS n 
1 68  GLY n 
1 69  PRO n 
1 70  GLY n 
1 71  GLN n 
1 72  ALA n 
1 73  HIS n 
1 74  GLY n 
1 75  LEU n 
1 76  ALA n 
1 77  PHE n 
1 78  SER n 
1 79  VAL n 
1 80  ARG n 
1 81  PRO n 
1 82  GLY n 
1 83  ILE n 
1 84  ALA n 
1 85  ILE n 
1 86  PRO n 
1 87  PRO n 
1 88  SER n 
1 89  LEU n 
1 90  LEU n 
1 91  ASN n 
1 92  MET n 
1 93  TYR n 
1 94  LYS n 
1 95  GLU n 
1 96  LEU n 
1 97  GLU n 
1 98  ASN n 
1 99  THR n 
1 100 ILE n 
1 101 PRO n 
1 102 GLY n 
1 103 PHE n 
1 104 THR n 
1 105 ARG n 
1 106 PRO n 
1 107 ASN n 
1 108 HIS n 
1 109 GLY n 
1 110 TYR n 
1 111 LEU n 
1 112 GLU n 
1 113 SER n 
1 114 TRP n 
1 115 ALA n 
1 116 ARG n 
1 117 GLN n 
1 118 GLY n 
1 119 VAL n 
1 120 LEU n 
1 121 LEU n 
1 122 LEU n 
1 123 ASN n 
1 124 THR n 
1 125 VAL n 
1 126 LEU n 
1 127 THR n 
1 128 VAL n 
1 129 ARG n 
1 130 ALA n 
1 131 GLY n 
1 132 GLN n 
1 133 ALA n 
1 134 HIS n 
1 135 SER n 
1 136 HIS n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 GLY n 
1 141 TRP n 
1 142 GLU n 
1 143 THR n 
1 144 PHE n 
1 145 THR n 
1 146 ASP n 
1 147 LYS n 
1 148 VAL n 
1 149 ILE n 
1 150 SER n 
1 151 LEU n 
1 152 ILE n 
1 153 ASN n 
1 154 GLN n 
1 155 HIS n 
1 156 ARG n 
1 157 GLU n 
1 158 GLY n 
1 159 VAL n 
1 160 VAL n 
1 161 PHE n 
1 162 LEU n 
1 163 LEU n 
1 164 TRP n 
1 165 GLY n 
1 166 SER n 
1 167 HIS n 
1 168 ALA n 
1 169 GLN n 
1 170 LYS n 
1 171 LYS n 
1 172 GLY n 
1 173 ALA n 
1 174 ILE n 
1 175 ILE n 
1 176 ASP n 
1 177 LYS n 
1 178 GLN n 
1 179 ARG n 
1 180 HIS n 
1 181 HIS n 
1 182 VAL n 
1 183 LEU n 
1 184 LYS n 
1 185 ALA n 
1 186 PRO n 
1 187 HIS n 
1 188 PRO n 
1 189 SER n 
1 190 PRO n 
1 191 LEU n 
1 192 SER n 
1 193 ALA n 
1 194 HIS n 
1 195 ARG n 
1 196 GLY n 
1 197 PHE n 
1 198 PHE n 
1 199 GLY n 
1 200 CYS n 
1 201 ASN n 
1 202 HIS n 
1 203 PHE n 
1 204 VAL n 
1 205 LEU n 
1 206 ALA n 
1 207 ASN n 
1 208 GLN n 
1 209 TRP n 
1 210 LEU n 
1 211 GLU n 
1 212 GLN n 
1 213 HIS n 
1 214 GLY n 
1 215 GLU n 
1 216 THR n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 TRP n 
1 221 MET n 
1 222 PRO n 
1 223 VAL n 
1 224 LEU n 
1 225 PRO n 
1 226 ALA n 
1 227 GLU n 
1 228 SER n 
1 229 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 UNG 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    B 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     37762 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'SIGMA CHEMICAL' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UNG_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P12295 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EUG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 229 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12295 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  228 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       229 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EUG HIS A 19  ? UNP P12295 TYR 18  ENGINEERED            19  1 
1 2EUG HIS A 213 ? UNP P12295 ARG 212 'ENGINEERED MUTATION' 213 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
URA non-polymer         . URACIL          ? 'C4 H4 N2 O2'    112.087 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2EUG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   39.9 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;PROTEIN CONCENTRATION 14.9 MG/ML, 0.2 M SODIUM ACETATE, 30% PEG4000, 0.1 M 
TRIS BUFFER, PH 8.5 USING HANGING DROP AT 293K.
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   BRUKER 
_diffrn_detector.pdbx_collection_date   1997-08-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        BRUKER 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2EUG 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             99.0 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   32361 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.0 
_reflns.pdbx_Rmerge_I_obs            0.0850000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.59 
_reflns_shell.percent_possible_all   91.1 
_reflns_shell.Rmerge_I_obs           0.2900000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2EUG 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     28453 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             99 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    85.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.1970000 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     8464 
_refine.ls_number_restraints                     7489 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1EUG 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2EUG 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          0 
_refine_analyze.occupancy_sum_non_hydrogen      2086 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1788 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             277 
_refine_hist.number_atoms_total               2073 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.025 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.026 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.041 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.049 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.079 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    2EUG 
_pdbx_refine.R_factor_all_no_cutoff                      0.1970000 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1850000 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               25095 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  2EUG 
_struct.title                     
;CRYSTAL STRUCTURE OF ESCHERICHIA COLI URACIL DNA GLYCOSYLASE AND ITS COMPLEXES WITH URACIL AND GLYCEROL: STRUCTURE AND GLYCOSYLASE MECHANISM REVISITED
;
_struct.pdbx_descriptor           'PROTEIN (GLYCOSYLASE) (3.2.2.3) MUTANT (Y19H)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EUG 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'GLYCOSYLASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TRP A 7   ? LEU A 11  ? TRP A 7   LEU A 11  1 ? 5  
HELX_P HELX_P2  2  GLU A 14  ? GLN A 16  ? GLU A 14  GLN A 16  5 ? 3  
HELX_P HELX_P3  3  PRO A 18  ? GLN A 32  ? PRO A 18  GLN A 32  1 ? 15 
HELX_P HELX_P4  4  GLN A 41  ? ASP A 43  ? GLN A 41  ASP A 43  5 ? 3  
HELX_P HELX_P5  5  ASN A 46  ? PHE A 50  ? ASN A 46  PHE A 50  1 ? 5  
HELX_P HELX_P6  6  LEU A 53  ? ASP A 55  ? LEU A 53  ASP A 55  5 ? 3  
HELX_P HELX_P7  7  PRO A 87  ? THR A 99  ? PRO A 87  THR A 99  1 ? 13 
HELX_P HELX_P8  8  GLU A 112 ? GLN A 117 ? GLU A 112 GLN A 117 1 ? 6  
HELX_P HELX_P9  9  TRP A 141 ? HIS A 155 ? TRP A 141 HIS A 155 1 ? 15 
HELX_P HELX_P10 10 SER A 166 ? LYS A 171 ? SER A 166 LYS A 171 1 ? 6  
HELX_P HELX_P11 11 ALA A 193 ? ARG A 195 ? ALA A 193 ARG A 195 5 ? 3  
HELX_P HELX_P12 12 HIS A 202 ? HIS A 213 ? HIS A 202 HIS A 213 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           38 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            38 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    39 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     39 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.45 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 119 ? ASN A 123 ? VAL A 119 ASN A 123 
A 2 VAL A 58  ? GLY A 62  ? VAL A 58  GLY A 62  
A 3 VAL A 160 ? TRP A 164 ? VAL A 160 TRP A 164 
A 4 HIS A 181 ? ALA A 185 ? HIS A 181 ALA A 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 120 ? O LEU A 120 N VAL A 58  ? N VAL A 58  
A 2 3 O VAL A 59  ? O VAL A 59  N VAL A 160 ? N VAL A 160 
A 3 4 O PHE A 161 ? O PHE A 161 N HIS A 181 ? N HIS A 181 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'BINDING SITE FOR RESIDUE URA A 230' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLY A 62  ? GLY A 62  . ? 1_555 ? 
2  AC1 12 GLN A 63  ? GLN A 63  . ? 1_555 ? 
3  AC1 12 ASP A 64  ? ASP A 64  . ? 1_555 ? 
4  AC1 12 TYR A 66  ? TYR A 66  . ? 1_555 ? 
5  AC1 12 ALA A 76  ? ALA A 76  . ? 1_555 ? 
6  AC1 12 PHE A 77  ? PHE A 77  . ? 1_555 ? 
7  AC1 12 ASN A 123 ? ASN A 123 . ? 1_555 ? 
8  AC1 12 HOH C .   ? HOH A 305 . ? 1_555 ? 
9  AC1 12 HOH C .   ? HOH A 410 . ? 1_555 ? 
10 AC1 12 HOH C .   ? HOH A 497 . ? 1_555 ? 
11 AC1 12 HOH C .   ? HOH A 501 . ? 1_555 ? 
12 AC1 12 HOH C .   ? HOH A 559 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EUG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EUG 
_atom_sites.fract_transf_matrix[1][1]   0.018577 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016895 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015647 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 5   ? 20.439  24.348  34.696 1.00 18.47 ? 5   LEU A N   1 
ATOM   2    C CA  . LEU A 1 5   ? 20.183  24.478  33.259 1.00 20.47 ? 5   LEU A CA  1 
ATOM   3    C C   . LEU A 1 5   ? 19.215  23.424  32.740 1.00 24.27 ? 5   LEU A C   1 
ATOM   4    O O   . LEU A 1 5   ? 19.428  22.223  32.902 1.00 24.89 ? 5   LEU A O   1 
ATOM   5    C CB  . LEU A 1 5   ? 21.490  24.379  32.470 1.00 28.98 ? 5   LEU A CB  1 
ATOM   6    C CG  . LEU A 1 5   ? 21.272  24.695  30.980 1.00 37.77 ? 5   LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 5   ? 20.699  26.098  30.866 1.00 46.74 ? 5   LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 5   ? 22.551  24.537  30.181 1.00 23.39 ? 5   LEU A CD2 1 
ATOM   9    N N   . THR A 1 6   ? 18.127  23.841  32.112 1.00 18.78 ? 6   THR A N   1 
ATOM   10   C CA  . THR A 1 6   ? 17.040  22.916  31.813 1.00 12.30 ? 6   THR A CA  1 
ATOM   11   C C   . THR A 1 6   ? 16.819  22.803  30.325 1.00 12.38 ? 6   THR A C   1 
ATOM   12   O O   . THR A 1 6   ? 17.415  23.581  29.582 1.00 18.36 ? 6   THR A O   1 
ATOM   13   C CB  . THR A 1 6   ? 15.714  23.427  32.419 1.00 14.78 ? 6   THR A CB  1 
ATOM   14   O OG1 . THR A 1 6   ? 15.437  24.709  31.845 1.00 20.04 ? 6   THR A OG1 1 
ATOM   15   C CG2 . THR A 1 6   ? 15.812  23.642  33.915 1.00 24.00 ? 6   THR A CG2 1 
ATOM   16   N N   . TRP A 1 7   ? 15.928  21.870  29.951 1.00 10.53 ? 7   TRP A N   1 
ATOM   17   C CA  . TRP A 1 7   ? 15.597  21.813  28.529 1.00 6.76  ? 7   TRP A CA  1 
ATOM   18   C C   . TRP A 1 7   ? 15.050  23.153  28.067 1.00 10.78 ? 7   TRP A C   1 
ATOM   19   O O   . TRP A 1 7   ? 15.400  23.721  27.038 1.00 14.17 ? 7   TRP A O   1 
ATOM   20   C CB  . TRP A 1 7   ? 14.543  20.736  28.283 1.00 8.61  ? 7   TRP A CB  1 
ATOM   21   C CG  . TRP A 1 7   ? 15.046  19.332  28.333 1.00 16.95 ? 7   TRP A CG  1 
ATOM   22   C CD1 . TRP A 1 7   ? 14.644  18.349  29.194 1.00 17.01 ? 7   TRP A CD1 1 
ATOM   23   C CD2 . TRP A 1 7   ? 16.041  18.758  27.479 1.00 12.71 ? 7   TRP A CD2 1 
ATOM   24   N NE1 . TRP A 1 7   ? 15.349  17.202  28.908 1.00 12.16 ? 7   TRP A NE1 1 
ATOM   25   C CE2 . TRP A 1 7   ? 16.200  17.417  27.874 1.00 9.99  ? 7   TRP A CE2 1 
ATOM   26   C CE3 . TRP A 1 7   ? 16.803  19.256  26.420 1.00 15.17 ? 7   TRP A CE3 1 
ATOM   27   C CZ2 . TRP A 1 7   ? 17.095  16.541  27.255 1.00 15.00 ? 7   TRP A CZ2 1 
ATOM   28   C CZ3 . TRP A 1 7   ? 17.693  18.387  25.810 1.00 16.59 ? 7   TRP A CZ3 1 
ATOM   29   C CH2 . TRP A 1 7   ? 17.831  17.058  26.228 1.00 13.37 ? 7   TRP A CH2 1 
ATOM   30   N N   . HIS A 1 8   ? 14.135  23.696  28.888 1.00 11.26 ? 8   HIS A N   1 
ATOM   31   C CA  . HIS A 1 8   ? 13.522  24.935  28.441 1.00 15.85 ? 8   HIS A CA  1 
ATOM   32   C C   . HIS A 1 8   ? 14.486  26.097  28.247 1.00 18.46 ? 8   HIS A C   1 
ATOM   33   O O   . HIS A 1 8   ? 14.364  26.849  27.291 1.00 21.89 ? 8   HIS A O   1 
ATOM   34   C CB  . HIS A 1 8   ? 12.500  25.445  29.478 1.00 23.74 ? 8   HIS A CB  1 
ATOM   35   C CG  . HIS A 1 8   ? 11.795  26.606  28.823 1.00 29.42 ? 8   HIS A CG  1 
ATOM   36   N ND1 . HIS A 1 8   ? 11.002  26.402  27.710 1.00 29.02 ? 8   HIS A ND1 1 
ATOM   37   C CD2 . HIS A 1 8   ? 11.789  27.925  29.085 1.00 27.14 ? 8   HIS A CD2 1 
ATOM   38   C CE1 . HIS A 1 8   ? 10.517  27.569  27.322 1.00 28.01 ? 8   HIS A CE1 1 
ATOM   39   N NE2 . HIS A 1 8   ? 10.976  28.504  28.140 1.00 26.82 ? 8   HIS A NE2 1 
ATOM   40   N N   . ASP A 1 9   ? 15.409  26.229  29.195 1.00 13.56 ? 9   ASP A N   1 
ATOM   41   C CA  . ASP A 1 9   ? 16.510  27.144  28.996 1.00 15.26 ? 9   ASP A CA  1 
ATOM   42   C C   . ASP A 1 9   ? 17.136  26.999  27.617 1.00 20.43 ? 9   ASP A C   1 
ATOM   43   O O   . ASP A 1 9   ? 17.239  27.960  26.856 1.00 19.73 ? 9   ASP A O   1 
ATOM   44   C CB  . ASP A 1 9   ? 17.604  26.871  30.031 1.00 18.18 ? 9   ASP A CB  1 
ATOM   45   C CG  . ASP A 1 9   ? 17.268  27.370  31.411 1.00 29.40 ? 9   ASP A CG  1 
ATOM   46   O OD1 . ASP A 1 9   ? 16.334  28.187  31.553 1.00 34.70 ? 9   ASP A OD1 1 
ATOM   47   O OD2 . ASP A 1 9   ? 17.982  26.928  32.331 1.00 23.53 ? 9   ASP A OD2 1 
ATOM   48   N N   . VAL A 1 10  ? 17.590  25.800  27.258 1.00 13.48 ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 10  ? 18.382  25.670  26.024 1.00 14.24 ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 10  ? 17.484  25.535  24.811 1.00 13.88 ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 10  ? 17.945  25.780  23.683 1.00 13.54 ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 10  ? 19.350  24.480  26.085 1.00 10.45 ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 10  ? 20.295  24.632  27.275 1.00 15.65 ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 10  ? 18.563  23.184  26.214 1.00 11.52 ? 10  VAL A CG2 1 
ATOM   55   N N   . LEU A 1 11  ? 16.211  25.164  25.026 1.00 15.80 ? 11  LEU A N   1 
ATOM   56   C CA  . LEU A 1 11  ? 15.381  25.037  23.819 1.00 14.40 ? 11  LEU A CA  1 
ATOM   57   C C   . LEU A 1 11  ? 14.391  26.166  23.586 1.00 14.34 ? 11  LEU A C   1 
ATOM   58   O O   . LEU A 1 11  ? 13.704  26.115  22.556 1.00 14.30 ? 11  LEU A O   1 
ATOM   59   C CB  . LEU A 1 11  ? 14.611  23.711  23.882 1.00 13.20 ? 11  LEU A CB  1 
ATOM   60   C CG  . LEU A 1 11  ? 15.454  22.452  23.611 1.00 11.58 ? 11  LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 11  ? 14.681  21.269  24.196 1.00 15.31 ? 11  LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 11  ? 15.770  22.255  22.150 1.00 11.46 ? 11  LEU A CD2 1 
ATOM   63   N N   . ALA A 1 12  ? 14.253  27.156  24.461 1.00 17.05 ? 12  ALA A N   1 
ATOM   64   C CA  . ALA A 1 12  ? 13.260  28.214  24.303 1.00 17.04 ? 12  ALA A CA  1 
ATOM   65   C C   . ALA A 1 12  ? 13.319  28.919  22.952 1.00 16.99 ? 12  ALA A C   1 
ATOM   66   O O   . ALA A 1 12  ? 12.292  29.147  22.297 1.00 18.06 ? 12  ALA A O   1 
ATOM   67   C CB  . ALA A 1 12  ? 13.399  29.249  25.425 1.00 20.01 ? 12  ALA A CB  1 
ATOM   68   N N   . GLU A 1 13  ? 14.502  29.298  22.463 1.00 18.64 ? 13  GLU A N   1 
ATOM   69   C CA  . GLU A 1 13  ? 14.574  29.951  21.152 1.00 19.53 ? 13  GLU A CA  1 
ATOM   70   C C   . GLU A 1 13  ? 14.284  28.997  19.999 1.00 20.86 ? 13  GLU A C   1 
ATOM   71   O O   . GLU A 1 13  ? 13.625  29.355  19.016 1.00 18.37 ? 13  GLU A O   1 
ATOM   72   C CB  . GLU A 1 13  ? 15.936  30.616  20.976 1.00 26.17 ? 13  GLU A CB  1 
ATOM   73   C CG  . GLU A 1 13  ? 16.609  30.182  19.676 1.00 54.30 ? 13  GLU A CG  1 
ATOM   74   C CD  . GLU A 1 13  ? 17.548  31.263  19.176 1.00 70.89 ? 13  GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 13  ? 17.024  32.338  18.806 1.00 0.36  ? 13  GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 13  ? 18.777  31.024  19.166 1.00 56.41 ? 13  GLU A OE2 1 
ATOM   77   N N   . GLU A 1 14  ? 14.734  27.747  20.065 1.00 18.60 ? 14  GLU A N   1 
ATOM   78   C CA  . GLU A 1 14  ? 14.333  26.809  19.007 1.00 19.42 ? 14  GLU A CA  1 
ATOM   79   C C   . GLU A 1 14  ? 12.818  26.689  18.956 1.00 16.02 ? 14  GLU A C   1 
ATOM   80   O O   . GLU A 1 14  ? 12.226  26.652  17.882 1.00 18.17 ? 14  GLU A O   1 
ATOM   81   C CB  . GLU A 1 14  ? 14.943  25.430  19.257 1.00 14.07 ? 14  GLU A CB  1 
ATOM   82   C CG  . GLU A 1 14  ? 14.240  24.308  18.500 1.00 20.00 ? 14  GLU A CG  1 
ATOM   83   C CD  . GLU A 1 14  ? 14.688  24.241  17.057 1.00 25.29 ? 14  GLU A CD  1 
ATOM   84   O OE1 . GLU A 1 14  ? 15.629  24.996  16.690 1.00 21.58 ? 14  GLU A OE1 1 
ATOM   85   O OE2 . GLU A 1 14  ? 14.089  23.430  16.320 1.00 29.92 ? 14  GLU A OE2 1 
ATOM   86   N N   . LYS A 1 15  ? 12.190  26.665  20.140 1.00 20.83 ? 15  LYS A N   1 
ATOM   87   C CA  . LYS A 1 15  ? 10.736  26.456  20.171 1.00 18.99 ? 15  LYS A CA  1 
ATOM   88   C C   . LYS A 1 15  ? 9.960   27.661  19.670 1.00 29.14 ? 15  LYS A C   1 
ATOM   89   O O   . LYS A 1 15  ? 8.725   27.618  19.576 1.00 22.29 ? 15  LYS A O   1 
ATOM   90   C CB  . LYS A 1 15  ? 10.312  26.052  21.590 1.00 18.49 ? 15  LYS A CB  1 
ATOM   91   C CG  . LYS A 1 15  ? 10.684  24.601  21.859 1.00 16.41 ? 15  LYS A CG  1 
ATOM   92   C CD  . LYS A 1 15  ? 10.347  24.064  23.229 1.00 15.18 ? 15  LYS A CD  1 
ATOM   93   C CE  . LYS A 1 15  ? 10.675  25.027  24.353 1.00 27.45 ? 15  LYS A CE  1 
ATOM   94   N NZ  . LYS A 1 15  ? 10.214  24.505  25.671 1.00 30.06 ? 15  LYS A NZ  1 
ATOM   95   N N   . GLN A 1 16  ? 10.625  28.765  19.321 1.00 22.86 ? 16  GLN A N   1 
ATOM   96   C CA  . GLN A 1 16  ? 9.853   29.884  18.757 1.00 23.68 ? 16  GLN A CA  1 
ATOM   97   C C   . GLN A 1 16  ? 10.135  29.966  17.268 1.00 27.45 ? 16  GLN A C   1 
ATOM   98   O O   . GLN A 1 16  ? 9.771   30.885  16.539 1.00 25.49 ? 16  GLN A O   1 
ATOM   99   C CB  . GLN A 1 16  ? 10.194  31.189  19.467 1.00 26.68 ? 16  GLN A CB  1 
ATOM   100  C CG  . GLN A 1 16  ? 9.818   31.171  20.944 1.00 29.53 ? 16  GLN A CG  1 
ATOM   101  C CD  . GLN A 1 16  ? 8.321   31.273  21.156 1.00 40.21 ? 16  GLN A CD  1 
ATOM   102  O OE1 . GLN A 1 16  ? 7.671   32.021  20.423 1.00 74.98 ? 16  GLN A OE1 1 
ATOM   103  N NE2 . GLN A 1 16  ? 7.778   30.547  22.134 1.00 30.64 ? 16  GLN A NE2 1 
ATOM   104  N N   . GLN A 1 17  ? 10.827  28.931  16.768 1.00 27.33 ? 17  GLN A N   1 
ATOM   105  C CA  . GLN A 1 17  ? 11.076  28.942  15.327 1.00 31.91 ? 17  GLN A CA  1 
ATOM   106  C C   . GLN A 1 17  ? 9.898   28.410  14.519 1.00 25.05 ? 17  GLN A C   1 
ATOM   107  O O   . GLN A 1 17  ? 9.268   27.418  14.866 1.00 20.42 ? 17  GLN A O   1 
ATOM   108  C CB  . GLN A 1 17  ? 12.371  28.157  15.062 1.00 34.33 ? 17  GLN A CB  1 
ATOM   109  C CG  . GLN A 1 17  ? 13.506  28.805  15.875 1.00 45.56 ? 17  GLN A CG  1 
ATOM   110  C CD  . GLN A 1 17  ? 13.761  30.220  15.375 1.00 52.36 ? 17  GLN A CD  1 
ATOM   111  O OE1 . GLN A 1 17  ? 14.118  30.383  14.203 1.00 47.88 ? 17  GLN A OE1 1 
ATOM   112  N NE2 . GLN A 1 17  ? 13.582  31.207  16.240 1.00 51.58 ? 17  GLN A NE2 1 
ATOM   113  N N   . PRO A 1 18  ? 9.617   29.113  13.421 1.00 21.89 ? 18  PRO A N   1 
ATOM   114  C CA  . PRO A 1 18  ? 8.565   28.713  12.488 1.00 17.99 ? 18  PRO A CA  1 
ATOM   115  C C   . PRO A 1 18  ? 8.574   27.228  12.171 1.00 34.42 ? 18  PRO A C   1 
ATOM   116  O O   . PRO A 1 18  ? 7.504   26.601  12.248 1.00 50.11 ? 18  PRO A O   1 
ATOM   117  C CB  . PRO A 1 18  ? 8.880   29.565  11.244 1.00 28.33 ? 18  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 18  ? 9.447   30.821  11.829 1.00 32.62 ? 18  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 18  ? 10.280  30.370  13.007 1.00 27.83 ? 18  PRO A CD  1 
ATOM   120  N N   . HIS A 1 19  ? 9.713   26.622  11.862 1.00 22.29 ? 19  HIS A N   1 
ATOM   121  C CA  . HIS A 1 19  ? 9.702   25.187  11.564 1.00 26.54 ? 19  HIS A CA  1 
ATOM   122  C C   . HIS A 1 19  ? 9.134   24.357  12.716 1.00 19.61 ? 19  HIS A C   1 
ATOM   123  O O   . HIS A 1 19  ? 8.455   23.344  12.525 1.00 25.76 ? 19  HIS A O   1 
ATOM   124  C CB  . HIS A 1 19  ? 11.101  24.681  11.204 1.00 34.60 ? 19  HIS A CB  1 
ATOM   125  C CG  . HIS A 1 19  ? 12.137  24.662  12.290 1.00 34.18 ? 19  HIS A CG  1 
ATOM   126  N ND1 . HIS A 1 19  ? 13.193  25.552  12.302 1.00 30.44 ? 19  HIS A ND1 1 
ATOM   127  C CD2 . HIS A 1 19  ? 12.321  23.883  13.386 1.00 33.57 ? 19  HIS A CD2 1 
ATOM   128  C CE1 . HIS A 1 19  ? 13.961  25.319  13.353 1.00 31.42 ? 19  HIS A CE1 1 
ATOM   129  N NE2 . HIS A 1 19  ? 13.455  24.308  14.038 1.00 28.51 ? 19  HIS A NE2 1 
ATOM   130  N N   . PHE A 1 20  ? 9.462   24.759  13.942 1.00 18.18 ? 20  PHE A N   1 
ATOM   131  C CA  . PHE A 1 20  ? 8.965   24.042  15.102 1.00 15.73 ? 20  PHE A CA  1 
ATOM   132  C C   . PHE A 1 20  ? 7.485   24.325  15.330 1.00 17.67 ? 20  PHE A C   1 
ATOM   133  O O   . PHE A 1 20  ? 6.669   23.405  15.366 1.00 16.55 ? 20  PHE A O   1 
ATOM   134  C CB  . PHE A 1 20  ? 9.752   24.463  16.351 1.00 15.15 ? 20  PHE A CB  1 
ATOM   135  C CG  . PHE A 1 20  ? 9.278   23.752  17.607 1.00 11.51 ? 20  PHE A CG  1 
ATOM   136  C CD1 . PHE A 1 20  ? 9.683   22.456  17.884 1.00 16.24 ? 20  PHE A CD1 1 
ATOM   137  C CD2 . PHE A 1 20  ? 8.422   24.370  18.490 1.00 6.90  ? 20  PHE A CD2 1 
ATOM   138  C CE1 . PHE A 1 20  ? 9.223   21.833  19.032 1.00 13.78 ? 20  PHE A CE1 1 
ATOM   139  C CE2 . PHE A 1 20  ? 7.991   23.770  19.654 1.00 17.20 ? 20  PHE A CE2 1 
ATOM   140  C CZ  . PHE A 1 20  ? 8.407   22.474  19.950 1.00 12.58 ? 20  PHE A CZ  1 
ATOM   141  N N   . LEU A 1 21  ? 7.128   25.604  15.499 1.00 20.36 ? 21  LEU A N   1 
ATOM   142  C CA  . LEU A 1 21  ? 5.718   25.908  15.759 1.00 18.80 ? 21  LEU A CA  1 
ATOM   143  C C   . LEU A 1 21  ? 4.812   25.374  14.656 1.00 18.65 ? 21  LEU A C   1 
ATOM   144  O O   . LEU A 1 21  ? 3.663   24.976  14.877 1.00 19.86 ? 21  LEU A O   1 
ATOM   145  C CB  . LEU A 1 21  ? 5.520   27.415  15.931 1.00 19.25 ? 21  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 21  ? 6.076   28.022  17.224 1.00 22.11 ? 21  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 21  ? 5.911   29.541  17.238 1.00 20.68 ? 21  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 21  ? 5.394   27.382  18.424 1.00 20.21 ? 21  LEU A CD2 1 
ATOM   149  N N   . ASN A 1 22  ? 5.325   25.356  13.437 1.00 15.67 ? 22  ASN A N   1 
ATOM   150  C CA  . ASN A 1 22  ? 4.499   24.946  12.297 1.00 19.63 ? 22  ASN A CA  1 
ATOM   151  C C   . ASN A 1 22  ? 4.333   23.441  12.301 1.00 22.64 ? 22  ASN A C   1 
ATOM   152  O O   . ASN A 1 22  ? 3.343   22.841  11.865 1.00 17.70 ? 22  ASN A O   1 
ATOM   153  C CB  . ASN A 1 22  ? 5.149   25.484  11.021 1.00 22.52 ? 22  ASN A CB  1 
ATOM   154  C CG  . ASN A 1 22  ? 4.355   25.122  9.782  1.00 30.27 ? 22  ASN A CG  1 
ATOM   155  O OD1 . ASN A 1 22  ? 4.944   24.762  8.765  1.00 22.68 ? 22  ASN A OD1 1 
ATOM   156  N ND2 . ASN A 1 22  ? 3.039   25.244  9.883  1.00 54.42 ? 22  ASN A ND2 1 
ATOM   157  N N   . THR A 1 23  ? 5.367   22.776  12.837 1.00 19.56 ? 23  THR A N   1 
ATOM   158  C CA  . THR A 1 23  ? 5.275   21.315  12.975 1.00 12.17 ? 23  THR A CA  1 
ATOM   159  C C   . THR A 1 23  ? 4.068   21.019  13.869 1.00 14.27 ? 23  THR A C   1 
ATOM   160  O O   . THR A 1 23  ? 3.191   20.197  13.600 1.00 12.23 ? 23  THR A O   1 
ATOM   161  C CB  . THR A 1 23  ? 6.598   20.748  13.533 1.00 19.60 ? 23  THR A CB  1 
ATOM   162  O OG1 . THR A 1 23  ? 7.647   20.736  12.534 1.00 18.55 ? 23  THR A OG1 1 
ATOM   163  C CG2 . THR A 1 23  ? 6.448   19.297  13.975 1.00 18.08 ? 23  THR A CG2 1 
ATOM   164  N N   . LEU A 1 24  ? 3.992   21.718  15.006 1.00 16.70 ? 24  LEU A N   1 
ATOM   165  C CA  . LEU A 1 24  ? 2.922   21.534  15.971 1.00 20.98 ? 24  LEU A CA  1 
ATOM   166  C C   . LEU A 1 24  ? 1.567   21.915  15.397 1.00 16.22 ? 24  LEU A C   1 
ATOM   167  O O   . LEU A 1 24  ? 0.545   21.293  15.663 1.00 13.24 ? 24  LEU A O   1 
ATOM   168  C CB  . LEU A 1 24  ? 3.219   22.380  17.216 1.00 21.46 ? 24  LEU A CB  1 
ATOM   169  C CG  . LEU A 1 24  ? 4.195   21.784  18.234 1.00 26.38 ? 24  LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 24  ? 4.418   22.754  19.381 1.00 16.30 ? 24  LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 24  ? 3.697   20.436  18.740 1.00 27.52 ? 24  LEU A CD2 1 
ATOM   172  N N   . GLN A 1 25  ? 1.518   22.970  14.578 1.00 20.28 ? 25  GLN A N   1 
ATOM   173  C CA  . GLN A 1 25  ? 0.216   23.298  14.003 1.00 23.28 ? 25  GLN A CA  1 
ATOM   174  C C   . GLN A 1 25  ? -0.245  22.236  13.008 1.00 19.66 ? 25  GLN A C   1 
ATOM   175  O O   . GLN A 1 25  ? -1.431  21.975  12.892 1.00 15.02 ? 25  GLN A O   1 
ATOM   176  C CB  . GLN A 1 25  ? 0.235   24.614  13.235 1.00 28.26 ? 25  GLN A CB  1 
ATOM   177  C CG  . GLN A 1 25  ? 1.195   25.657  13.748 1.00 30.13 ? 25  GLN A CG  1 
ATOM   178  C CD  . GLN A 1 25  ? 1.300   26.786  12.732 1.00 26.20 ? 25  GLN A CD  1 
ATOM   179  O OE1 . GLN A 1 25  ? 1.339   26.548  11.531 1.00 53.26 ? 25  GLN A OE1 1 
ATOM   180  N NE2 . GLN A 1 25  ? 1.315   27.988  13.264 1.00 22.13 ? 25  GLN A NE2 1 
ATOM   181  N N   . THR A 1 26  ? 0.723   21.665  12.289 1.00 11.67 ? 26  THR A N   1 
ATOM   182  C CA  . THR A 1 26  ? 0.339   20.616  11.358 1.00 17.73 ? 26  THR A CA  1 
ATOM   183  C C   . THR A 1 26  ? -0.197  19.444  12.163 1.00 11.63 ? 26  THR A C   1 
ATOM   184  O O   . THR A 1 26  ? -1.179  18.807  11.793 1.00 14.85 ? 26  THR A O   1 
ATOM   185  C CB  . THR A 1 26  ? 1.502   20.152  10.457 1.00 16.66 ? 26  THR A CB  1 
ATOM   186  O OG1 . THR A 1 26  ? 1.782   21.206  9.528  1.00 29.11 ? 26  THR A OG1 1 
ATOM   187  C CG2 . THR A 1 26  ? 1.088   18.939  9.662  1.00 19.01 ? 26  THR A CG2 1 
ATOM   188  N N   . VAL A 1 27  ? 0.440   19.138  13.297 1.00 14.72 ? 27  VAL A N   1 
ATOM   189  C CA  . VAL A 1 27  ? -0.084  17.999  14.073 1.00 9.22  ? 27  VAL A CA  1 
ATOM   190  C C   . VAL A 1 27  ? -1.488  18.243  14.602 1.00 13.07 ? 27  VAL A C   1 
ATOM   191  O O   . VAL A 1 27  ? -2.346  17.367  14.502 1.00 13.83 ? 27  VAL A O   1 
ATOM   192  C CB  . VAL A 1 27  ? 0.873   17.670  15.237 1.00 11.38 ? 27  VAL A CB  1 
ATOM   193  C CG1 . VAL A 1 27  ? 0.268   16.629  16.146 1.00 10.14 ? 27  VAL A CG1 1 
ATOM   194  C CG2 . VAL A 1 27  ? 2.203   17.193  14.660 1.00 17.63 ? 27  VAL A CG2 1 
ATOM   195  N N   . ALA A 1 28  ? -1.682  19.424  15.168 1.00 14.37 ? 28  ALA A N   1 
ATOM   196  C CA  . ALA A 1 28  ? -2.957  19.818  15.751 1.00 17.30 ? 28  ALA A CA  1 
ATOM   197  C C   . ALA A 1 28  ? -4.041  19.783  14.676 1.00 15.73 ? 28  ALA A C   1 
ATOM   198  O O   . ALA A 1 28  ? -5.178  19.394  14.932 1.00 15.50 ? 28  ALA A O   1 
ATOM   199  C CB  . ALA A 1 28  ? -2.841  21.191  16.400 1.00 16.30 ? 28  ALA A CB  1 
ATOM   200  N N   . SER A 1 29  ? -3.702  20.173  13.444 1.00 10.29 ? 29  SER A N   1 
ATOM   201  C CA  . SER A 1 29  ? -4.634  20.054  12.329 1.00 19.11 ? 29  SER A CA  1 
ATOM   202  C C   . SER A 1 29  ? -5.011  18.599  12.055 1.00 25.85 ? 29  SER A C   1 
ATOM   203  O O   . SER A 1 29  ? -6.211  18.280  11.961 1.00 16.30 ? 29  SER A O   1 
ATOM   204  C CB  . SER A 1 29  ? -4.035  20.667  11.056 1.00 17.85 ? 29  SER A CB  1 
ATOM   205  O OG  . SER A 1 29  ? -4.770  20.378  9.872  1.00 16.39 ? 29  SER A OG  1 
ATOM   206  N N   . GLU A 1 30  ? -3.956  17.787  11.921 1.00 17.49 ? 30  GLU A N   1 
ATOM   207  C CA  . GLU A 1 30  ? -4.071  16.363  11.614 1.00 16.63 ? 30  GLU A CA  1 
ATOM   208  C C   . GLU A 1 30  ? -4.967  15.678  12.637 1.00 19.60 ? 30  GLU A C   1 
ATOM   209  O O   . GLU A 1 30  ? -5.806  14.856  12.271 1.00 18.09 ? 30  GLU A O   1 
ATOM   210  C CB  . GLU A 1 30  ? -2.735  15.642  11.602 1.00 15.62 ? 30  GLU A CB  1 
ATOM   211  C CG  . GLU A 1 30  ? -1.704  16.177  10.621 1.00 34.28 ? 30  GLU A CG  1 
ATOM   212  C CD  . GLU A 1 30  ? -1.397  15.182  9.520  1.00 27.94 ? 30  GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 30  ? -1.367  13.962  9.795  1.00 14.87 ? 30  GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 30  ? -1.196  15.615  8.369  1.00 31.38 ? 30  GLU A OE2 1 
ATOM   215  N N   . ARG A 1 31  ? -4.772  16.051  13.909 1.00 14.77 ? 31  ARG A N   1 
ATOM   216  C CA  . ARG A 1 31  ? -5.601  15.410  14.928 1.00 17.86 ? 31  ARG A CA  1 
ATOM   217  C C   . ARG A 1 31  ? -7.095  15.647  14.725 1.00 23.61 ? 31  ARG A C   1 
ATOM   218  O O   . ARG A 1 31  ? -7.907  14.920  15.299 1.00 20.07 ? 31  ARG A O   1 
ATOM   219  C CB  . ARG A 1 31  ? -5.173  15.925  16.301 1.00 13.99 ? 31  ARG A CB  1 
ATOM   220  C CG  . ARG A 1 31  ? -3.824  15.445  16.793 1.00 15.36 ? 31  ARG A CG  1 
ATOM   221  C CD  . ARG A 1 31  ? -3.611  15.814  18.271 1.00 18.76 ? 31  ARG A CD  1 
ATOM   222  N NE  . ARG A 1 31  ? -2.213  15.762  18.665 1.00 21.87 ? 31  ARG A NE  1 
ATOM   223  C CZ  . ARG A 1 31  ? -1.526  14.664  18.960 1.00 14.13 ? 31  ARG A CZ  1 
ATOM   224  N NH1 . ARG A 1 31  ? -2.144  13.505  18.902 1.00 13.25 ? 31  ARG A NH1 1 
ATOM   225  N NH2 . ARG A 1 31  ? -0.236  14.723  19.310 1.00 14.71 ? 31  ARG A NH2 1 
ATOM   226  N N   . GLN A 1 32  ? -7.476  16.656  13.953 1.00 19.13 ? 32  GLN A N   1 
ATOM   227  C CA  . GLN A 1 32  ? -8.877  17.000  13.750 1.00 22.29 ? 32  GLN A CA  1 
ATOM   228  C C   . GLN A 1 32  ? -9.370  16.647  12.343 1.00 24.78 ? 32  GLN A C   1 
ATOM   229  O O   . GLN A 1 32  ? -10.522 16.953  12.032 1.00 29.84 ? 32  GLN A O   1 
ATOM   230  C CB  . GLN A 1 32  ? -9.143  18.500  13.939 1.00 22.30 ? 32  GLN A CB  1 
ATOM   231  C CG  . GLN A 1 32  ? -9.045  19.021  15.349 1.00 32.48 ? 32  GLN A CG  1 
ATOM   232  C CD  . GLN A 1 32  ? -9.656  18.136  16.414 1.00 30.03 ? 32  GLN A CD  1 
ATOM   233  O OE1 . GLN A 1 32  ? -10.778 17.652  16.275 1.00 25.42 ? 32  GLN A OE1 1 
ATOM   234  N NE2 . GLN A 1 32  ? -8.899  17.948  17.495 1.00 54.68 ? 32  GLN A NE2 1 
ATOM   235  N N   . SER A 1 33  ? -8.516  16.052  11.523 1.00 19.28 ? 33  SER A N   1 
ATOM   236  C CA  . SER A 1 33  ? -8.799  15.905  10.107 1.00 27.56 ? 33  SER A CA  1 
ATOM   237  C C   . SER A 1 33  ? -9.496  14.601  9.746  1.00 29.25 ? 33  SER A C   1 
ATOM   238  O O   . SER A 1 33  ? -9.736  14.381  8.556  1.00 24.78 ? 33  SER A O   1 
ATOM   239  C CB  . SER A 1 33  ? -7.501  15.948  9.291  1.00 20.16 ? 33  SER A CB  1 
ATOM   240  O OG  . SER A 1 33  ? -6.724  14.793  9.574  1.00 25.55 ? 33  SER A OG  1 
ATOM   241  N N   . GLY A 1 34  ? -9.782  13.766  10.738 1.00 21.21 ? 34  GLY A N   1 
ATOM   242  C CA  . GLY A 1 34  ? -10.272 12.439  10.372 1.00 27.12 ? 34  GLY A CA  1 
ATOM   243  C C   . GLY A 1 34  ? -9.267  11.335  10.668 1.00 39.30 ? 34  GLY A C   1 
ATOM   244  O O   . GLY A 1 34  ? -9.617  10.149  10.614 1.00 34.47 ? 34  GLY A O   1 
ATOM   245  N N   . VAL A 1 35  ? -8.027  11.687  10.990 1.00 29.47 ? 35  VAL A N   1 
ATOM   246  C CA  . VAL A 1 35  ? -6.950  10.732  11.248 1.00 24.61 ? 35  VAL A CA  1 
ATOM   247  C C   . VAL A 1 35  ? -6.530  10.686  12.700 1.00 24.14 ? 35  VAL A C   1 
ATOM   248  O O   . VAL A 1 35  ? -6.538  11.709  13.397 1.00 24.76 ? 35  VAL A O   1 
ATOM   249  C CB  . VAL A 1 35  ? -5.727  11.139  10.389 1.00 33.79 ? 35  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 35  ? -4.470  11.154  11.234 1.00 48.05 ? 35  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 35  ? -5.594  10.205  9.197  1.00 34.52 ? 35  VAL A CG2 1 
ATOM   252  N N   . THR A 1 36  ? -6.128  9.515   13.238 1.00 15.67 ? 36  THR A N   1 
ATOM   253  C CA  . THR A 1 36  ? -5.646  9.607   14.619 1.00 12.69 ? 36  THR A CA  1 
ATOM   254  C C   . THR A 1 36  ? -4.126  9.756   14.600 1.00 17.72 ? 36  THR A C   1 
ATOM   255  O O   . THR A 1 36  ? -3.458  9.082   13.806 1.00 15.90 ? 36  THR A O   1 
ATOM   256  C CB  . THR A 1 36  ? -6.033  8.382   15.456 1.00 18.65 ? 36  THR A CB  1 
ATOM   257  O OG1 . THR A 1 36  ? -7.455  8.409   15.699 1.00 29.07 ? 36  THR A OG1 1 
ATOM   258  C CG2 . THR A 1 36  ? -5.405  8.392   16.842 1.00 27.60 ? 36  THR A CG2 1 
ATOM   259  N N   . ILE A 1 37  ? -3.602  10.605  15.466 1.00 15.02 ? 37  ILE A N   1 
ATOM   260  C CA  . ILE A 1 37  ? -2.165  10.824  15.615 1.00 11.68 ? 37  ILE A CA  1 
ATOM   261  C C   . ILE A 1 37  ? -1.646  10.286  16.943 1.00 17.24 ? 37  ILE A C   1 
ATOM   262  O O   . ILE A 1 37  ? -2.288  10.499  17.983 1.00 13.42 ? 37  ILE A O   1 
ATOM   263  C CB  . ILE A 1 37  ? -1.856  12.328  15.517 1.00 12.25 ? 37  ILE A CB  1 
ATOM   264  C CG1 . ILE A 1 37  ? -2.431  12.947  14.230 1.00 14.25 ? 37  ILE A CG1 1 
ATOM   265  C CG2 . ILE A 1 37  ? -0.363  12.600  15.628 1.00 11.46 ? 37  ILE A CG2 1 
ATOM   266  C CD1 . ILE A 1 37  ? -1.907  12.259  12.989 1.00 11.52 ? 37  ILE A CD1 1 
ATOM   267  N N   . TYR A 1 38  ? -0.508  9.602   16.911 1.00 14.12 ? 38  TYR A N   1 
ATOM   268  C CA  . TYR A 1 38  ? 0.117   9.027   18.103 1.00 13.55 ? 38  TYR A CA  1 
ATOM   269  C C   . TYR A 1 38  ? 1.464   9.704   18.337 1.00 11.96 ? 38  TYR A C   1 
ATOM   270  O O   . TYR A 1 38  ? 2.142   10.109  17.383 1.00 13.55 ? 38  TYR A O   1 
ATOM   271  C CB  . TYR A 1 38  ? 0.237   7.513   17.948 1.00 13.71 ? 38  TYR A CB  1 
ATOM   272  C CG  . TYR A 1 38  ? -1.096  6.781   17.907 1.00 9.58  ? 38  TYR A CG  1 
ATOM   273  C CD1 . TYR A 1 38  ? -2.080  7.004   18.874 1.00 12.01 ? 38  TYR A CD1 1 
ATOM   274  C CD2 . TYR A 1 38  ? -1.340  5.877   16.891 1.00 10.25 ? 38  TYR A CD2 1 
ATOM   275  C CE1 . TYR A 1 38  ? -3.300  6.330   18.835 1.00 12.22 ? 38  TYR A CE1 1 
ATOM   276  C CE2 . TYR A 1 38  ? -2.546  5.200   16.841 1.00 11.08 ? 38  TYR A CE2 1 
ATOM   277  C CZ  . TYR A 1 38  ? -3.500  5.437   17.798 1.00 17.56 ? 38  TYR A CZ  1 
ATOM   278  O OH  . TYR A 1 38  ? -4.678  4.741   17.698 1.00 21.95 ? 38  TYR A OH  1 
ATOM   279  N N   . PRO A 1 39  ? 1.895   9.880   19.569 1.00 13.99 ? 39  PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? 1.094   9.652   20.775 1.00 13.04 ? 39  PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? 0.144   10.821  21.027 1.00 11.89 ? 39  PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? 0.138   11.788  20.263 1.00 11.96 ? 39  PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? 2.172   9.587   21.868 1.00 7.01  ? 39  PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? 3.142   10.648  21.389 1.00 6.89  ? 39  PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? 3.269   10.342  19.911 1.00 13.55 ? 39  PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? -0.678  10.767  22.063 1.00 11.86 ? 40  PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? -1.522  11.916  22.423 1.00 13.15 ? 40  PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? -0.682  13.162  22.641 1.00 17.82 ? 40  PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? 0.470   13.090  23.035 1.00 9.73  ? 40  PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? -2.158  11.474  23.748 1.00 14.56 ? 40  PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? -2.268  9.983   23.576 1.00 15.86 ? 40  PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? -0.932  9.618   22.963 1.00 19.11 ? 40  PRO A CD  1 
ATOM   293  N N   . GLN A 1 41  ? -1.257  14.336  22.377 1.00 16.11 ? 41  GLN A N   1 
ATOM   294  C CA  . GLN A 1 41  ? -0.483  15.565  22.452 1.00 19.00 ? 41  GLN A CA  1 
ATOM   295  C C   . GLN A 1 41  ? 0.222   15.772  23.782 1.00 17.20 ? 41  GLN A C   1 
ATOM   296  O O   . GLN A 1 41  ? 1.299   16.358  23.830 1.00 13.63 ? 41  GLN A O   1 
ATOM   297  C CB  . GLN A 1 41  ? -1.376  16.800  22.225 1.00 16.45 ? 41  GLN A CB  1 
ATOM   298  C CG  . GLN A 1 41  ? -0.891  17.955  23.090 1.00 27.09 ? 41  GLN A CG  1 
ATOM   299  C CD  . GLN A 1 41  ? -1.789  19.175  23.020 1.00 46.48 ? 41  GLN A CD  1 
ATOM   300  O OE1 . GLN A 1 41  ? -2.482  19.404  22.026 1.00 38.89 ? 41  GLN A OE1 1 
ATOM   301  N NE2 . GLN A 1 41  ? -1.766  19.962  24.098 1.00 68.29 ? 41  GLN A NE2 1 
ATOM   302  N N   . LYS A 1 42  ? -0.372  15.330  24.882 1.00 17.09 ? 42  LYS A N   1 
ATOM   303  C CA  . LYS A 1 42  ? 0.227   15.567  26.188 1.00 22.54 ? 42  LYS A CA  1 
ATOM   304  C C   . LYS A 1 42  ? 1.452   14.692  26.413 1.00 15.06 ? 42  LYS A C   1 
ATOM   305  O O   . LYS A 1 42  ? 2.216   14.880  27.368 1.00 14.82 ? 42  LYS A O   1 
ATOM   306  C CB  . LYS A 1 42  ? -0.814  15.261  27.281 1.00 35.49 ? 42  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 42  ? -0.784  13.793  27.701 1.00 39.03 ? 42  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 42  ? -2.168  13.182  27.793 1.00 40.07 ? 42  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 42  ? -2.175  11.964  28.716 1.00 32.05 ? 42  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 42  ? -1.963  10.730  27.914 1.00 22.92 ? 42  LYS A NZ  1 
ATOM   311  N N   . ASP A 1 43  ? 1.601   13.689  25.527 1.00 11.33 ? 43  ASP A N   1 
ATOM   312  C CA  . ASP A 1 43  ? 2.707   12.753  25.712 1.00 10.17 ? 43  ASP A CA  1 
ATOM   313  C C   . ASP A 1 43  ? 3.879   13.017  24.777 1.00 10.04 ? 43  ASP A C   1 
ATOM   314  O O   . ASP A 1 43  ? 4.928   12.386  24.931 1.00 10.42 ? 43  ASP A O   1 
ATOM   315  C CB  . ASP A 1 43  ? 2.189   11.325  25.493 1.00 12.39 ? 43  ASP A CB  1 
ATOM   316  C CG  . ASP A 1 43  ? 1.181   10.897  26.561 1.00 16.44 ? 43  ASP A CG  1 
ATOM   317  O OD1 . ASP A 1 43  ? 1.422   11.054  27.777 1.00 12.96 ? 43  ASP A OD1 1 
ATOM   318  O OD2 . ASP A 1 43  ? 0.127   10.384  26.148 1.00 16.16 ? 43  ASP A OD2 1 
ATOM   319  N N   . VAL A 1 44  ? 3.748   13.890  23.778 1.00 10.35 ? 44  VAL A N   1 
ATOM   320  C CA  . VAL A 1 44  ? 4.734   14.011  22.686 1.00 5.69  ? 44  VAL A CA  1 
ATOM   321  C C   . VAL A 1 44  ? 6.138   14.269  23.213 1.00 7.31  ? 44  VAL A C   1 
ATOM   322  O O   . VAL A 1 44  ? 7.139   13.805  22.659 1.00 10.93 ? 44  VAL A O   1 
ATOM   323  C CB  . VAL A 1 44  ? 4.294   15.126  21.705 1.00 7.33  ? 44  VAL A CB  1 
ATOM   324  C CG1 . VAL A 1 44  ? 5.376   15.606  20.746 1.00 5.02  ? 44  VAL A CG1 1 
ATOM   325  C CG2 . VAL A 1 44  ? 3.085   14.657  20.887 1.00 7.88  ? 44  VAL A CG2 1 
ATOM   326  N N   . PHE A 1 45  ? 6.234   15.042  24.290 1.00 8.68  ? 45  PHE A N   1 
ATOM   327  C CA  . PHE A 1 45  ? 7.491   15.502  24.828 1.00 11.77 ? 45  PHE A CA  1 
ATOM   328  C C   . PHE A 1 45  ? 7.856   14.774  26.116 1.00 14.46 ? 45  PHE A C   1 
ATOM   329  O O   . PHE A 1 45  ? 8.692   15.256  26.882 1.00 11.30 ? 45  PHE A O   1 
ATOM   330  C CB  . PHE A 1 45  ? 7.406   17.021  25.086 1.00 14.31 ? 45  PHE A CB  1 
ATOM   331  C CG  . PHE A 1 45  ? 7.295   17.779  23.763 1.00 14.21 ? 45  PHE A CG  1 
ATOM   332  C CD1 . PHE A 1 45  ? 8.399   17.948  22.953 1.00 15.43 ? 45  PHE A CD1 1 
ATOM   333  C CD2 . PHE A 1 45  ? 6.083   18.313  23.363 1.00 13.64 ? 45  PHE A CD2 1 
ATOM   334  C CE1 . PHE A 1 45  ? 8.314   18.633  21.742 1.00 16.82 ? 45  PHE A CE1 1 
ATOM   335  C CE2 . PHE A 1 45  ? 5.986   18.961  22.137 1.00 13.77 ? 45  PHE A CE2 1 
ATOM   336  C CZ  . PHE A 1 45  ? 7.086   19.126  21.298 1.00 11.80 ? 45  PHE A CZ  1 
ATOM   337  N N   . ASN A 1 46  ? 7.240   13.611  26.350 1.00 10.93 ? 46  ASN A N   1 
ATOM   338  C CA  . ASN A 1 46  ? 7.504   12.904  27.606 1.00 12.53 ? 46  ASN A CA  1 
ATOM   339  C C   . ASN A 1 46  ? 8.961   12.543  27.815 1.00 13.16 ? 46  ASN A C   1 
ATOM   340  O O   . ASN A 1 46  ? 9.404   12.409  28.966 1.00 16.47 ? 46  ASN A O   1 
ATOM   341  C CB  . ASN A 1 46  ? 6.646   11.618  27.689 1.00 12.91 ? 46  ASN A CB  1 
ATOM   342  C CG  . ASN A 1 46  ? 5.273   11.978  28.242 1.00 15.08 ? 46  ASN A CG  1 
ATOM   343  O OD1 . ASN A 1 46  ? 5.061   13.122  28.618 1.00 12.15 ? 46  ASN A OD1 1 
ATOM   344  N ND2 . ASN A 1 46  ? 4.379   11.001  28.267 1.00 12.92 ? 46  ASN A ND2 1 
ATOM   345  N N   . ALA A 1 47  ? 9.748   12.373  26.740 1.00 13.52 ? 47  ALA A N   1 
ATOM   346  C CA  . ALA A 1 47  ? 11.150  12.024  26.990 1.00 11.61 ? 47  ALA A CA  1 
ATOM   347  C C   . ALA A 1 47  ? 11.821  13.153  27.792 1.00 13.68 ? 47  ALA A C   1 
ATOM   348  O O   . ALA A 1 47  ? 12.647  12.860  28.653 1.00 10.86 ? 47  ALA A O   1 
ATOM   349  C CB  . ALA A 1 47  ? 11.899  11.749  25.707 1.00 7.53  ? 47  ALA A CB  1 
ATOM   350  N N   . PHE A 1 48  ? 11.424  14.385  27.498 1.00 12.38 ? 48  PHE A N   1 
ATOM   351  C CA  . PHE A 1 48  ? 11.966  15.584  28.130 1.00 15.40 ? 48  PHE A CA  1 
ATOM   352  C C   . PHE A 1 48  ? 11.452  15.727  29.558 1.00 13.73 ? 48  PHE A C   1 
ATOM   353  O O   . PHE A 1 48  ? 12.192  16.139  30.461 1.00 14.61 ? 48  PHE A O   1 
ATOM   354  C CB  . PHE A 1 48  ? 11.576  16.830  27.323 1.00 7.72  ? 48  PHE A CB  1 
ATOM   355  C CG  . PHE A 1 48  ? 12.082  16.727  25.889 1.00 13.26 ? 48  PHE A CG  1 
ATOM   356  C CD1 . PHE A 1 48  ? 13.385  17.081  25.586 1.00 13.37 ? 48  PHE A CD1 1 
ATOM   357  C CD2 . PHE A 1 48  ? 11.252  16.277  24.872 1.00 9.48  ? 48  PHE A CD2 1 
ATOM   358  C CE1 . PHE A 1 48  ? 13.883  16.986  24.299 1.00 20.72 ? 48  PHE A CE1 1 
ATOM   359  C CE2 . PHE A 1 48  ? 11.748  16.163  23.590 1.00 12.25 ? 48  PHE A CE2 1 
ATOM   360  C CZ  . PHE A 1 48  ? 13.062  16.512  23.294 1.00 16.08 ? 48  PHE A CZ  1 
ATOM   361  N N   . ARG A 1 49  ? 10.172  15.367  29.702 1.00 12.13 ? 49  ARG A N   1 
ATOM   362  C CA  . ARG A 1 49  ? 9.563   15.415  31.033 1.00 16.97 ? 49  ARG A CA  1 
ATOM   363  C C   . ARG A 1 49  ? 10.267  14.498  32.032 1.00 19.54 ? 49  ARG A C   1 
ATOM   364  O O   . ARG A 1 49  ? 10.495  14.920  33.168 1.00 16.12 ? 49  ARG A O   1 
ATOM   365  C CB  . ARG A 1 49  ? 8.099   14.999  31.015 1.00 17.94 ? 49  ARG A CB  1 
ATOM   366  C CG  . ARG A 1 49  ? 7.098   15.890  30.321 1.00 27.19 ? 49  ARG A CG  1 
ATOM   367  C CD  . ARG A 1 49  ? 5.697   15.348  30.576 1.00 34.87 ? 49  ARG A CD  1 
ATOM   368  N NE  . ARG A 1 49  ? 4.635   15.921  29.770 1.00 31.79 ? 49  ARG A NE  1 
ATOM   369  C CZ  . ARG A 1 49  ? 3.938   17.018  30.058 1.00 35.60 ? 49  ARG A CZ  1 
ATOM   370  N NH1 . ARG A 1 49  ? 4.192   17.701  31.162 1.00 18.36 ? 49  ARG A NH1 1 
ATOM   371  N NH2 . ARG A 1 49  ? 2.980   17.441  29.240 1.00 45.83 ? 49  ARG A NH2 1 
ATOM   372  N N   . PHE A 1 50  ? 10.567  13.257  31.640 1.00 16.31 ? 50  PHE A N   1 
ATOM   373  C CA  . PHE A 1 50  ? 11.070  12.282  32.598 1.00 12.96 ? 50  PHE A CA  1 
ATOM   374  C C   . PHE A 1 50  ? 12.571  12.362  32.720 1.00 15.26 ? 50  PHE A C   1 
ATOM   375  O O   . PHE A 1 50  ? 13.134  11.849  33.690 1.00 17.40 ? 50  PHE A O   1 
ATOM   376  C CB  . PHE A 1 50  ? 10.752  10.824  32.224 1.00 16.22 ? 50  PHE A CB  1 
ATOM   377  C CG  . PHE A 1 50  ? 9.275   10.608  31.963 1.00 15.65 ? 50  PHE A CG  1 
ATOM   378  C CD1 . PHE A 1 50  ? 8.330   11.465  32.487 1.00 24.28 ? 50  PHE A CD1 1 
ATOM   379  C CD2 . PHE A 1 50  ? 8.850   9.538   31.190 1.00 24.63 ? 50  PHE A CD2 1 
ATOM   380  C CE1 . PHE A 1 50  ? 6.989   11.289  32.230 1.00 24.49 ? 50  PHE A CE1 1 
ATOM   381  C CE2 . PHE A 1 50  ? 7.504   9.359   30.934 1.00 16.96 ? 50  PHE A CE2 1 
ATOM   382  C CZ  . PHE A 1 50  ? 6.564   10.218  31.469 1.00 18.17 ? 50  PHE A CZ  1 
ATOM   383  N N   . THR A 1 51  ? 13.259  12.948  31.715 1.00 10.95 ? 51  THR A N   1 
ATOM   384  C CA  . THR A 1 51  ? 14.704  13.024  31.937 1.00 11.65 ? 51  THR A CA  1 
ATOM   385  C C   . THR A 1 51  ? 15.197  14.415  31.545 1.00 10.85 ? 51  THR A C   1 
ATOM   386  O O   . THR A 1 51  ? 15.396  14.725  30.382 1.00 10.98 ? 51  THR A O   1 
ATOM   387  C CB  . THR A 1 51  ? 15.573  11.968  31.237 1.00 16.35 ? 51  THR A CB  1 
ATOM   388  O OG1 . THR A 1 51  ? 16.086  12.488  30.011 1.00 57.24 ? 51  THR A OG1 1 
ATOM   389  C CG2 . THR A 1 51  ? 14.762  10.731  30.905 1.00 1.64  ? 51  THR A CG2 1 
ATOM   390  N N   . GLU A 1 52  ? 15.384  15.188  32.616 1.00 11.60 ? 52  GLU A N   1 
ATOM   391  C CA  . GLU A 1 52  ? 15.867  16.554  32.435 1.00 12.00 ? 52  GLU A CA  1 
ATOM   392  C C   . GLU A 1 52  ? 17.271  16.541  31.856 1.00 11.49 ? 52  GLU A C   1 
ATOM   393  O O   . GLU A 1 52  ? 18.039  15.574  31.970 1.00 11.48 ? 52  GLU A O   1 
ATOM   394  C CB  . GLU A 1 52  ? 15.838  17.320  33.756 1.00 12.35 ? 52  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 52  ? 15.028  18.574  33.848 1.00 21.26 ? 52  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 52  ? 14.802  19.528  32.717 1.00 28.26 ? 52  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 52  ? 15.695  19.893  31.925 1.00 12.45 ? 52  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 52  ? 13.632  20.007  32.596 1.00 31.11 ? 52  GLU A OE2 1 
ATOM   399  N N   . LEU A 1 53  ? 17.549  17.681  31.227 1.00 10.80 ? 53  LEU A N   1 
ATOM   400  C CA  . LEU A 1 53  ? 18.834  17.892  30.585 1.00 14.39 ? 53  LEU A CA  1 
ATOM   401  C C   . LEU A 1 53  ? 20.007  17.484  31.471 1.00 17.32 ? 53  LEU A C   1 
ATOM   402  O O   . LEU A 1 53  ? 20.892  16.731  31.040 1.00 16.05 ? 53  LEU A O   1 
ATOM   403  C CB  . LEU A 1 53  ? 18.983  19.359  30.142 1.00 13.71 ? 53  LEU A CB  1 
ATOM   404  C CG  . LEU A 1 53  ? 20.333  19.667  29.499 1.00 15.38 ? 53  LEU A CG  1 
ATOM   405  C CD1 . LEU A 1 53  ? 20.596  18.757  28.302 1.00 21.39 ? 53  LEU A CD1 1 
ATOM   406  C CD2 . LEU A 1 53  ? 20.434  21.117  29.040 1.00 19.28 ? 53  LEU A CD2 1 
ATOM   407  N N   . GLY A 1 54  ? 20.021  17.947  32.710 1.00 22.19 ? 54  GLY A N   1 
ATOM   408  C CA  . GLY A 1 54  ? 21.097  17.683  33.646 1.00 19.86 ? 54  GLY A CA  1 
ATOM   409  C C   . GLY A 1 54  ? 21.038  16.266  34.201 1.00 25.59 ? 54  GLY A C   1 
ATOM   410  O O   . GLY A 1 54  ? 21.953  15.832  34.900 1.00 22.97 ? 54  GLY A O   1 
ATOM   411  N N   . ASP A 1 55  ? 19.976  15.535  33.886 1.00 19.62 ? 55  ASP A N   1 
ATOM   412  C CA  . ASP A 1 55  ? 19.804  14.159  34.326 1.00 15.18 ? 55  ASP A CA  1 
ATOM   413  C C   . ASP A 1 55  ? 20.158  13.145  33.246 1.00 14.73 ? 55  ASP A C   1 
ATOM   414  O O   . ASP A 1 55  ? 20.187  11.928  33.502 1.00 20.09 ? 55  ASP A O   1 
ATOM   415  C CB  . ASP A 1 55  ? 18.349  13.978  34.774 1.00 14.63 ? 55  ASP A CB  1 
ATOM   416  C CG  . ASP A 1 55  ? 18.119  14.704  36.091 1.00 24.88 ? 55  ASP A CG  1 
ATOM   417  O OD1 . ASP A 1 55  ? 19.092  14.918  36.841 1.00 19.23 ? 55  ASP A OD1 1 
ATOM   418  O OD2 . ASP A 1 55  ? 16.951  15.027  36.352 1.00 25.47 ? 55  ASP A OD2 1 
ATOM   419  N N   . VAL A 1 56  ? 20.447  13.592  32.036 1.00 13.18 ? 56  VAL A N   1 
ATOM   420  C CA  . VAL A 1 56  ? 20.737  12.623  30.958 1.00 20.00 ? 56  VAL A CA  1 
ATOM   421  C C   . VAL A 1 56  ? 22.031  11.846  31.141 1.00 17.78 ? 56  VAL A C   1 
ATOM   422  O O   . VAL A 1 56  ? 23.146  12.382  31.172 1.00 11.84 ? 56  VAL A O   1 
ATOM   423  C CB  . VAL A 1 56  ? 20.760  13.371  29.599 1.00 14.06 ? 56  VAL A CB  1 
ATOM   424  C CG1 . VAL A 1 56  ? 21.206  12.464  28.462 1.00 10.15 ? 56  VAL A CG1 1 
ATOM   425  C CG2 . VAL A 1 56  ? 19.380  13.964  29.344 1.00 12.56 ? 56  VAL A CG2 1 
ATOM   426  N N   . LYS A 1 57  ? 21.914  10.510  31.250 1.00 20.50 ? 57  LYS A N   1 
ATOM   427  C CA  . LYS A 1 57  ? 23.100  9.662   31.338 1.00 12.43 ? 57  LYS A CA  1 
ATOM   428  C C   . LYS A 1 57  ? 23.339  8.827   30.078 1.00 14.45 ? 57  LYS A C   1 
ATOM   429  O O   . LYS A 1 57  ? 24.494  8.669   29.637 1.00 13.65 ? 57  LYS A O   1 
ATOM   430  C CB  . LYS A 1 57  ? 23.002  8.690   32.520 1.00 12.72 ? 57  LYS A CB  1 
ATOM   431  C CG  . LYS A 1 57  ? 23.330  9.337   33.870 1.00 18.39 ? 57  LYS A CG  1 
ATOM   432  C CD  . LYS A 1 57  ? 22.755  8.443   34.957 1.00 23.19 ? 57  LYS A CD  1 
ATOM   433  C CE  . LYS A 1 57  ? 23.248  8.755   36.353 1.00 39.06 ? 57  LYS A CE  1 
ATOM   434  N NZ  . LYS A 1 57  ? 22.889  7.640   37.290 1.00 44.64 ? 57  LYS A NZ  1 
ATOM   435  N N   . VAL A 1 58  ? 22.238  8.310   29.547 1.00 7.41  ? 58  VAL A N   1 
ATOM   436  C CA  . VAL A 1 58  ? 22.215  7.499   28.330 1.00 15.59 ? 58  VAL A CA  1 
ATOM   437  C C   . VAL A 1 58  ? 21.173  8.050   27.358 1.00 11.31 ? 58  VAL A C   1 
ATOM   438  O O   . VAL A 1 58  ? 20.044  8.344   27.741 1.00 13.88 ? 58  VAL A O   1 
ATOM   439  C CB  . VAL A 1 58  ? 21.922  6.008   28.631 1.00 13.88 ? 58  VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 58  ? 22.030  5.142   27.394 1.00 8.10  ? 58  VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 58  ? 22.891  5.550   29.745 1.00 8.09  ? 58  VAL A CG2 1 
ATOM   442  N N   . VAL A 1 59  ? 21.581  8.170   26.101 1.00 10.44 ? 59  VAL A N   1 
ATOM   443  C CA  . VAL A 1 59  ? 20.651  8.544   25.049 1.00 7.88  ? 59  VAL A CA  1 
ATOM   444  C C   . VAL A 1 59  ? 20.427  7.310   24.174 1.00 9.81  ? 59  VAL A C   1 
ATOM   445  O O   . VAL A 1 59  ? 21.391  6.768   23.656 1.00 11.42 ? 59  VAL A O   1 
ATOM   446  C CB  . VAL A 1 59  ? 21.118  9.711   24.179 1.00 8.37  ? 59  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 59  ? 20.043  10.040  23.156 1.00 14.45 ? 59  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 59  ? 21.438  10.898  25.075 1.00 10.18 ? 59  VAL A CG2 1 
ATOM   449  N N   . ILE A 1 60  ? 19.170  6.894   24.047 1.00 13.31 ? 60  ILE A N   1 
ATOM   450  C CA  . ILE A 1 60  ? 18.869  5.830   23.071 1.00 10.51 ? 60  ILE A CA  1 
ATOM   451  C C   . ILE A 1 60  ? 17.961  6.465   22.018 1.00 9.42  ? 60  ILE A C   1 
ATOM   452  O O   . ILE A 1 60  ? 16.877  6.937   22.346 1.00 8.88  ? 60  ILE A O   1 
ATOM   453  C CB  . ILE A 1 60  ? 18.227  4.569   23.671 1.00 11.52 ? 60  ILE A CB  1 
ATOM   454  C CG1 . ILE A 1 60  ? 18.988  3.927   24.831 1.00 11.39 ? 60  ILE A CG1 1 
ATOM   455  C CG2 . ILE A 1 60  ? 18.019  3.551   22.558 1.00 11.81 ? 60  ILE A CG2 1 
ATOM   456  C CD1 . ILE A 1 60  ? 18.246  2.798   25.526 1.00 17.85 ? 60  ILE A CD1 1 
ATOM   457  N N   . LEU A 1 61  ? 18.436  6.519   20.764 1.00 13.75 ? 61  LEU A N   1 
ATOM   458  C CA  . LEU A 1 61  ? 17.671  7.228   19.747 1.00 10.73 ? 61  LEU A CA  1 
ATOM   459  C C   . LEU A 1 61  ? 16.679  6.277   19.090 1.00 16.47 ? 61  LEU A C   1 
ATOM   460  O O   . LEU A 1 61  ? 17.102  5.168   18.764 1.00 15.80 ? 61  LEU A O   1 
ATOM   461  C CB  . LEU A 1 61  ? 18.582  7.796   18.672 1.00 16.33 ? 61  LEU A CB  1 
ATOM   462  C CG  . LEU A 1 61  ? 19.335  9.099   18.911 1.00 20.73 ? 61  LEU A CG  1 
ATOM   463  C CD1 . LEU A 1 61  ? 19.933  9.586   17.598 1.00 10.18 ? 61  LEU A CD1 1 
ATOM   464  C CD2 . LEU A 1 61  ? 18.440  10.179  19.515 1.00 20.41 ? 61  LEU A CD2 1 
ATOM   465  N N   . GLY A 1 62  ? 15.416  6.649   18.872 1.00 10.92 ? 62  GLY A N   1 
ATOM   466  C CA  . GLY A 1 62  ? 14.585  5.789   18.023 1.00 9.56  ? 62  GLY A CA  1 
ATOM   467  C C   . GLY A 1 62  ? 14.272  6.664   16.812 1.00 10.35 ? 62  GLY A C   1 
ATOM   468  O O   . GLY A 1 62  ? 14.778  7.777   16.728 1.00 13.08 ? 62  GLY A O   1 
ATOM   469  N N   . GLN A 1 63  ? 13.461  6.188   15.898 1.00 9.95  ? 63  GLN A N   1 
ATOM   470  C CA  . GLN A 1 63  ? 13.178  7.043   14.739 1.00 12.18 ? 63  GLN A CA  1 
ATOM   471  C C   . GLN A 1 63  ? 11.728  7.495   14.783 1.00 11.23 ? 63  GLN A C   1 
ATOM   472  O O   . GLN A 1 63  ? 11.455  8.671   15.027 1.00 17.38 ? 63  GLN A O   1 
ATOM   473  C CB  . GLN A 1 63  ? 13.517  6.274   13.465 1.00 14.31 ? 63  GLN A CB  1 
ATOM   474  C CG  . GLN A 1 63  ? 12.956  6.935   12.202 1.00 14.34 ? 63  GLN A CG  1 
ATOM   475  C CD  . GLN A 1 63  ? 13.501  6.183   10.986 1.00 21.17 ? 63  GLN A CD  1 
ATOM   476  O OE1 . GLN A 1 63  ? 13.820  5.004   11.128 1.00 19.73 ? 63  GLN A OE1 1 
ATOM   477  N NE2 . GLN A 1 63  ? 13.616  6.864   9.860  1.00 20.75 ? 63  GLN A NE2 1 
ATOM   478  N N   . ASP A 1 64  ? 10.805  6.573   14.576 1.00 11.37 ? 64  ASP A N   1 
ATOM   479  C CA  . ASP A 1 64  ? 9.371   6.782   14.583 1.00 13.07 ? 64  ASP A CA  1 
ATOM   480  C C   . ASP A 1 64  ? 8.651   6.256   15.816 1.00 11.85 ? 64  ASP A C   1 
ATOM   481  O O   . ASP A 1 64  ? 8.975   5.176   16.302 1.00 18.53 ? 64  ASP A O   1 
ATOM   482  C CB  . ASP A 1 64  ? 8.757   6.011   13.393 1.00 18.15 ? 64  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 64  ? 7.733   6.789   12.608 1.00 22.59 ? 64  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 64  ? 7.835   8.024   12.493 1.00 17.27 ? 64  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 64  ? 6.795   6.154   12.078 1.00 24.24 ? 64  ASP A OD2 1 
ATOM   486  N N   . PRO A 1 65  ? 7.634   6.918   16.319 1.00 9.57  ? 65  PRO A N   1 
ATOM   487  C CA  . PRO A 1 65  ? 6.834   6.376   17.406 1.00 10.30 ? 65  PRO A CA  1 
ATOM   488  C C   . PRO A 1 65  ? 6.022   5.169   16.956 1.00 9.39  ? 65  PRO A C   1 
ATOM   489  O O   . PRO A 1 65  ? 5.609   5.109   15.796 1.00 13.13 ? 65  PRO A O   1 
ATOM   490  C CB  . PRO A 1 65  ? 5.858   7.511   17.746 1.00 15.70 ? 65  PRO A CB  1 
ATOM   491  C CG  . PRO A 1 65  ? 6.485   8.726   17.146 1.00 14.06 ? 65  PRO A CG  1 
ATOM   492  C CD  . PRO A 1 65  ? 7.138   8.250   15.874 1.00 7.72  ? 65  PRO A CD  1 
ATOM   493  N N   . TYR A 1 66  ? 5.771   4.215   17.852 1.00 9.33  ? 66  TYR A N   1 
ATOM   494  C CA  . TYR A 1 66  ? 4.834   3.136   17.515 1.00 14.39 ? 66  TYR A CA  1 
ATOM   495  C C   . TYR A 1 66  ? 3.513   3.659   16.955 1.00 13.49 ? 66  TYR A C   1 
ATOM   496  O O   . TYR A 1 66  ? 3.030   4.686   17.462 1.00 10.70 ? 66  TYR A O   1 
ATOM   497  C CB  . TYR A 1 66  ? 4.505   2.320   18.763 1.00 11.24 ? 66  TYR A CB  1 
ATOM   498  C CG  . TYR A 1 66  ? 5.659   1.482   19.277 1.00 10.02 ? 66  TYR A CG  1 
ATOM   499  C CD1 . TYR A 1 66  ? 6.315   0.549   18.491 1.00 11.07 ? 66  TYR A CD1 1 
ATOM   500  C CD2 . TYR A 1 66  ? 6.066   1.647   20.587 1.00 9.53  ? 66  TYR A CD2 1 
ATOM   501  C CE1 . TYR A 1 66  ? 7.362   -0.196  19.008 1.00 16.27 ? 66  TYR A CE1 1 
ATOM   502  C CE2 . TYR A 1 66  ? 7.103   0.922   21.120 1.00 5.53  ? 66  TYR A CE2 1 
ATOM   503  C CZ  . TYR A 1 66  ? 7.738   0.002   20.321 1.00 14.44 ? 66  TYR A CZ  1 
ATOM   504  O OH  . TYR A 1 66  ? 8.774   -0.720  20.850 1.00 14.11 ? 66  TYR A OH  1 
ATOM   505  N N   . HIS A 1 67  ? 2.888   3.010   15.961 1.00 10.18 ? 67  HIS A N   1 
ATOM   506  C CA  . HIS A 1 67  ? 1.732   3.701   15.370 1.00 8.68  ? 67  HIS A CA  1 
ATOM   507  C C   . HIS A 1 67  ? 0.389   3.039   15.607 1.00 12.92 ? 67  HIS A C   1 
ATOM   508  O O   . HIS A 1 67  ? -0.598  3.381   14.941 1.00 13.53 ? 67  HIS A O   1 
ATOM   509  C CB  . HIS A 1 67  ? 1.975   3.864   13.858 1.00 13.54 ? 67  HIS A CB  1 
ATOM   510  C CG  . HIS A 1 67  ? 2.295   2.588   13.144 1.00 15.34 ? 67  HIS A CG  1 
ATOM   511  N ND1 . HIS A 1 67  ? 1.340   1.608   12.954 1.00 13.74 ? 67  HIS A ND1 1 
ATOM   512  C CD2 . HIS A 1 67  ? 3.448   2.123   12.604 1.00 13.25 ? 67  HIS A CD2 1 
ATOM   513  C CE1 . HIS A 1 67  ? 1.898   0.586   12.308 1.00 19.22 ? 67  HIS A CE1 1 
ATOM   514  N NE2 . HIS A 1 67  ? 3.171   0.873   12.078 1.00 17.41 ? 67  HIS A NE2 1 
ATOM   515  N N   . GLY A 1 68  ? 0.301   2.107   16.554 1.00 10.36 ? 68  GLY A N   1 
ATOM   516  C CA  . GLY A 1 68  ? -0.947  1.489   16.940 1.00 8.66  ? 68  GLY A CA  1 
ATOM   517  C C   . GLY A 1 68  ? -1.533  2.033   18.225 1.00 12.75 ? 68  GLY A C   1 
ATOM   518  O O   . GLY A 1 68  ? -0.888  2.657   19.085 1.00 9.89  ? 68  GLY A O   1 
ATOM   519  N N   . PRO A 1 69  ? -2.826  1.759   18.410 1.00 11.77 ? 69  PRO A N   1 
ATOM   520  C CA  . PRO A 1 69  ? -3.519  2.253   19.596 1.00 13.53 ? 69  PRO A CA  1 
ATOM   521  C C   . PRO A 1 69  ? -2.903  1.717   20.883 1.00 12.73 ? 69  PRO A C   1 
ATOM   522  O O   . PRO A 1 69  ? -2.644  0.523   21.051 1.00 14.65 ? 69  PRO A O   1 
ATOM   523  C CB  . PRO A 1 69  ? -4.931  1.686   19.407 1.00 14.93 ? 69  PRO A CB  1 
ATOM   524  C CG  . PRO A 1 69  ? -4.747  0.495   18.523 1.00 14.75 ? 69  PRO A CG  1 
ATOM   525  C CD  . PRO A 1 69  ? -3.678  0.933   17.542 1.00 11.48 ? 69  PRO A CD  1 
ATOM   526  N N   . GLY A 1 70  ? -2.675  2.652   21.805 1.00 16.34 ? 70  GLY A N   1 
ATOM   527  C CA  . GLY A 1 70  ? -2.227  2.344   23.131 1.00 18.35 ? 70  GLY A CA  1 
ATOM   528  C C   . GLY A 1 70  ? -0.736  2.123   23.282 1.00 14.03 ? 70  GLY A C   1 
ATOM   529  O O   . GLY A 1 70  ? -0.278  1.911   24.404 1.00 15.64 ? 70  GLY A O   1 
ATOM   530  N N   . GLN A 1 71  ? 0.004   2.183   22.196 1.00 10.20 ? 71  GLN A N   1 
ATOM   531  C CA  . GLN A 1 71  ? 1.422   1.847   22.155 1.00 16.99 ? 71  GLN A CA  1 
ATOM   532  C C   . GLN A 1 71  ? 2.291   3.058   22.521 1.00 12.41 ? 71  GLN A C   1 
ATOM   533  O O   . GLN A 1 71  ? 2.802   3.059   23.650 1.00 10.72 ? 71  GLN A O   1 
ATOM   534  C CB  . GLN A 1 71  ? 1.850   1.268   20.803 1.00 12.18 ? 71  GLN A CB  1 
ATOM   535  C CG  . GLN A 1 71  ? 1.173   -0.046  20.420 1.00 12.07 ? 71  GLN A CG  1 
ATOM   536  C CD  . GLN A 1 71  ? 1.770   -0.586  19.131 1.00 15.74 ? 71  GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 71  ? 1.874   0.156   18.151 1.00 15.18 ? 71  GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 71  ? 2.206   -1.833  19.111 1.00 12.05 ? 71  GLN A NE2 1 
ATOM   539  N N   . ALA A 1 72  ? 2.435   4.025   21.634 1.00 10.78 ? 72  ALA A N   1 
ATOM   540  C CA  . ALA A 1 72  ? 3.294   5.177   21.868 1.00 5.74  ? 72  ALA A CA  1 
ATOM   541  C C   . ALA A 1 72  ? 2.798   6.042   23.029 1.00 11.92 ? 72  ALA A C   1 
ATOM   542  O O   . ALA A 1 72  ? 1.623   6.335   23.221 1.00 10.74 ? 72  ALA A O   1 
ATOM   543  C CB  . ALA A 1 72  ? 3.445   6.032   20.610 1.00 4.53  ? 72  ALA A CB  1 
ATOM   544  N N   . HIS A 1 73  ? 3.790   6.453   23.837 1.00 9.52  ? 73  HIS A N   1 
ATOM   545  C CA  . HIS A 1 73  ? 3.421   7.386   24.893 1.00 8.01  ? 73  HIS A CA  1 
ATOM   546  C C   . HIS A 1 73  ? 4.587   8.325   25.136 1.00 11.03 ? 73  HIS A C   1 
ATOM   547  O O   . HIS A 1 73  ? 4.778   8.754   26.269 1.00 14.77 ? 73  HIS A O   1 
ATOM   548  C CB  . HIS A 1 73  ? 3.004   6.649   26.186 1.00 9.07  ? 73  HIS A CB  1 
ATOM   549  C CG  . HIS A 1 73  ? 4.123   5.842   26.772 1.00 13.40 ? 73  HIS A CG  1 
ATOM   550  N ND1 . HIS A 1 73  ? 4.807   6.281   27.880 1.00 14.48 ? 73  HIS A ND1 1 
ATOM   551  C CD2 . HIS A 1 73  ? 4.697   4.649   26.433 1.00 10.90 ? 73  HIS A CD2 1 
ATOM   552  C CE1 . HIS A 1 73  ? 5.742   5.403   28.208 1.00 11.87 ? 73  HIS A CE1 1 
ATOM   553  N NE2 . HIS A 1 73  ? 5.698   4.411   27.354 1.00 12.77 ? 73  HIS A NE2 1 
ATOM   554  N N   . GLY A 1 74  ? 5.364   8.660   24.108 1.00 11.23 ? 74  GLY A N   1 
ATOM   555  C CA  . GLY A 1 74  ? 6.412   9.647   24.153 1.00 8.78  ? 74  GLY A CA  1 
ATOM   556  C C   . GLY A 1 74  ? 7.803   9.205   24.541 1.00 12.52 ? 74  GLY A C   1 
ATOM   557  O O   . GLY A 1 74  ? 8.709   10.051  24.716 1.00 12.17 ? 74  GLY A O   1 
ATOM   558  N N   . LEU A 1 75  ? 8.064   7.924   24.708 1.00 5.67  ? 75  LEU A N   1 
ATOM   559  C CA  . LEU A 1 75  ? 9.398   7.392   25.025 1.00 6.43  ? 75  LEU A CA  1 
ATOM   560  C C   . LEU A 1 75  ? 9.775   6.369   23.964 1.00 13.80 ? 75  LEU A C   1 
ATOM   561  O O   . LEU A 1 75  ? 8.969   5.445   23.728 1.00 12.81 ? 75  LEU A O   1 
ATOM   562  C CB  . LEU A 1 75  ? 9.422   6.702   26.380 1.00 9.68  ? 75  LEU A CB  1 
ATOM   563  C CG  . LEU A 1 75  ? 8.874   7.440   27.585 1.00 15.22 ? 75  LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 75  ? 8.948   6.546   28.831 1.00 21.28 ? 75  LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 75  ? 9.624   8.743   27.818 1.00 13.09 ? 75  LEU A CD2 1 
ATOM   566  N N   . ALA A 1 76  ? 10.928  6.543   23.326 1.00 10.16 ? 76  ALA A N   1 
ATOM   567  C CA  . ALA A 1 76  ? 11.326  5.580   22.303 1.00 10.01 ? 76  ALA A CA  1 
ATOM   568  C C   . ALA A 1 76  ? 11.280  4.149   22.837 1.00 9.06  ? 76  ALA A C   1 
ATOM   569  O O   . ALA A 1 76  ? 11.701  3.864   23.959 1.00 9.95  ? 76  ALA A O   1 
ATOM   570  C CB  . ALA A 1 76  ? 12.689  5.913   21.717 1.00 16.46 ? 76  ALA A CB  1 
ATOM   571  N N   . PHE A 1 77  ? 10.738  3.279   21.985 1.00 6.17  ? 77  PHE A N   1 
ATOM   572  C CA  . PHE A 1 77  ? 10.651  1.840   22.192 1.00 7.92  ? 77  PHE A CA  1 
ATOM   573  C C   . PHE A 1 77  ? 9.689   1.349   23.262 1.00 13.36 ? 77  PHE A C   1 
ATOM   574  O O   . PHE A 1 77  ? 9.384   0.141   23.316 1.00 11.00 ? 77  PHE A O   1 
ATOM   575  C CB  . PHE A 1 77  ? 12.060  1.302   22.525 1.00 9.18  ? 77  PHE A CB  1 
ATOM   576  C CG  . PHE A 1 77  ? 12.939  1.487   21.284 1.00 11.75 ? 77  PHE A CG  1 
ATOM   577  C CD1 . PHE A 1 77  ? 12.735  0.753   20.125 1.00 7.55  ? 77  PHE A CD1 1 
ATOM   578  C CD2 . PHE A 1 77  ? 13.966  2.412   21.330 1.00 13.37 ? 77  PHE A CD2 1 
ATOM   579  C CE1 . PHE A 1 77  ? 13.566  0.931   19.023 1.00 13.39 ? 77  PHE A CE1 1 
ATOM   580  C CE2 . PHE A 1 77  ? 14.794  2.592   20.235 1.00 12.59 ? 77  PHE A CE2 1 
ATOM   581  C CZ  . PHE A 1 77  ? 14.616  1.847   19.094 1.00 13.00 ? 77  PHE A CZ  1 
ATOM   582  N N   . SER A 1 78  ? 9.196   2.227   24.114 1.00 8.65  ? 78  SER A N   1 
ATOM   583  C CA  . SER A 1 78  ? 8.353   1.814   25.239 1.00 10.07 ? 78  SER A CA  1 
ATOM   584  C C   . SER A 1 78  ? 6.891   1.713   24.830 1.00 11.98 ? 78  SER A C   1 
ATOM   585  O O   . SER A 1 78  ? 6.455   2.420   23.917 1.00 9.32  ? 78  SER A O   1 
ATOM   586  C CB  . SER A 1 78  ? 8.513   2.844   26.354 1.00 11.02 ? 78  SER A CB  1 
ATOM   587  O OG  . SER A 1 78  ? 7.674   2.641   27.456 1.00 9.68  ? 78  SER A OG  1 
ATOM   588  N N   . VAL A 1 79  ? 6.129   0.862   25.513 1.00 15.71 ? 79  VAL A N   1 
ATOM   589  C CA  . VAL A 1 79  ? 4.686   0.868   25.395 1.00 7.96  ? 79  VAL A CA  1 
ATOM   590  C C   . VAL A 1 79  ? 3.987   0.960   26.737 1.00 11.81 ? 79  VAL A C   1 
ATOM   591  O O   . VAL A 1 79  ? 4.598   0.695   27.774 1.00 13.69 ? 79  VAL A O   1 
ATOM   592  C CB  . VAL A 1 79  ? 4.141   -0.400  24.710 1.00 9.74  ? 79  VAL A CB  1 
ATOM   593  C CG1 . VAL A 1 79  ? 4.463   -0.408  23.223 1.00 6.12  ? 79  VAL A CG1 1 
ATOM   594  C CG2 . VAL A 1 79  ? 4.698   -1.637  25.412 1.00 11.41 ? 79  VAL A CG2 1 
ATOM   595  N N   . ARG A 1 80  ? 2.693   1.290   26.704 1.00 9.87  ? 80  ARG A N   1 
ATOM   596  C CA  . ARG A 1 80  ? 2.027   1.524   27.993 1.00 12.05 ? 80  ARG A CA  1 
ATOM   597  C C   . ARG A 1 80  ? 1.828   0.181   28.692 1.00 11.25 ? 80  ARG A C   1 
ATOM   598  O O   . ARG A 1 80  ? 1.909   -0.858  28.039 1.00 11.98 ? 80  ARG A O   1 
ATOM   599  C CB  . ARG A 1 80  ? 0.699   2.239   27.788 1.00 15.70 ? 80  ARG A CB  1 
ATOM   600  C CG  . ARG A 1 80  ? 0.781   3.598   27.106 1.00 19.35 ? 80  ARG A CG  1 
ATOM   601  C CD  . ARG A 1 80  ? -0.640  4.170   26.994 1.00 17.01 ? 80  ARG A CD  1 
ATOM   602  N NE  . ARG A 1 80  ? -0.630  5.424   26.257 1.00 21.01 ? 80  ARG A NE  1 
ATOM   603  C CZ  . ARG A 1 80  ? -0.312  6.633   26.708 1.00 32.62 ? 80  ARG A CZ  1 
ATOM   604  N NH1 . ARG A 1 80  ? 0.044   6.851   27.972 1.00 15.02 ? 80  ARG A NH1 1 
ATOM   605  N NH2 . ARG A 1 80  ? -0.374  7.627   25.821 1.00 21.33 ? 80  ARG A NH2 1 
ATOM   606  N N   . PRO A 1 81  ? 1.583   0.223   29.990 1.00 17.64 ? 81  PRO A N   1 
ATOM   607  C CA  . PRO A 1 81  ? 1.223   -0.963  30.758 1.00 22.23 ? 81  PRO A CA  1 
ATOM   608  C C   . PRO A 1 81  ? 0.021   -1.677  30.154 1.00 13.77 ? 81  PRO A C   1 
ATOM   609  O O   . PRO A 1 81  ? -0.963  -1.061  29.738 1.00 14.71 ? 81  PRO A O   1 
ATOM   610  C CB  . PRO A 1 81  ? 0.829   -0.390  32.130 1.00 17.40 ? 81  PRO A CB  1 
ATOM   611  C CG  . PRO A 1 81  ? 1.654   0.857   32.228 1.00 15.40 ? 81  PRO A CG  1 
ATOM   612  C CD  . PRO A 1 81  ? 1.649   1.436   30.835 1.00 16.51 ? 81  PRO A CD  1 
ATOM   613  N N   . GLY A 1 82  ? 0.106   -2.997  30.109 1.00 14.39 ? 82  GLY A N   1 
ATOM   614  C CA  . GLY A 1 82  ? -0.997  -3.796  29.585 1.00 21.07 ? 82  GLY A CA  1 
ATOM   615  C C   . GLY A 1 82  ? -0.822  -4.033  28.096 1.00 13.92 ? 82  GLY A C   1 
ATOM   616  O O   . GLY A 1 82  ? -1.501  -4.870  27.518 1.00 18.28 ? 82  GLY A O   1 
ATOM   617  N N   . ILE A 1 83  ? 0.104   -3.317  27.470 1.00 12.35 ? 83  ILE A N   1 
ATOM   618  C CA  . ILE A 1 83  ? 0.296   -3.519  26.024 1.00 18.83 ? 83  ILE A CA  1 
ATOM   619  C C   . ILE A 1 83  ? 1.381   -4.517  25.692 1.00 9.34  ? 83  ILE A C   1 
ATOM   620  O O   . ILE A 1 83  ? 2.390   -4.607  26.401 1.00 15.26 ? 83  ILE A O   1 
ATOM   621  C CB  . ILE A 1 83  ? 0.623   -2.144  25.397 1.00 12.60 ? 83  ILE A CB  1 
ATOM   622  C CG1 . ILE A 1 83  ? -0.525  -1.163  25.683 1.00 17.90 ? 83  ILE A CG1 1 
ATOM   623  C CG2 . ILE A 1 83  ? 0.938   -2.269  23.930 1.00 15.86 ? 83  ILE A CG2 1 
ATOM   624  C CD1 . ILE A 1 83  ? -1.813  -1.616  24.991 1.00 21.28 ? 83  ILE A CD1 1 
ATOM   625  N N   . ALA A 1 84  ? 1.180   -5.290  24.630 1.00 12.18 ? 84  ALA A N   1 
ATOM   626  C CA  . ALA A 1 84  ? 2.161   -6.333  24.319 1.00 10.65 ? 84  ALA A CA  1 
ATOM   627  C C   . ALA A 1 84  ? 3.518   -5.709  24.002 1.00 11.29 ? 84  ALA A C   1 
ATOM   628  O O   . ALA A 1 84  ? 3.568   -4.641  23.376 1.00 16.68 ? 84  ALA A O   1 
ATOM   629  C CB  . ALA A 1 84  ? 1.686   -7.189  23.160 1.00 7.71  ? 84  ALA A CB  1 
ATOM   630  N N   . ILE A 1 85  ? 4.589   -6.376  24.417 1.00 7.97  ? 85  ILE A N   1 
ATOM   631  C CA  . ILE A 1 85  ? 5.932   -5.841  24.148 1.00 11.53 ? 85  ILE A CA  1 
ATOM   632  C C   . ILE A 1 85  ? 6.246   -5.919  22.675 1.00 12.31 ? 85  ILE A C   1 
ATOM   633  O O   . ILE A 1 85  ? 6.289   -7.052  22.144 1.00 12.44 ? 85  ILE A O   1 
ATOM   634  C CB  . ILE A 1 85  ? 6.994   -6.643  24.928 1.00 10.84 ? 85  ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 85  ? 6.633   -6.782  26.416 1.00 11.97 ? 85  ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 85  ? 8.390   -6.070  24.714 1.00 8.42  ? 85  ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 85  ? 7.113   -8.100  26.986 1.00 15.75 ? 85  ILE A CD1 1 
ATOM   638  N N   . PRO A 1 86  ? 6.423   -4.817  21.955 1.00 9.86  ? 86  PRO A N   1 
ATOM   639  C CA  . PRO A 1 86  ? 6.602   -4.941  20.491 1.00 3.99  ? 86  PRO A CA  1 
ATOM   640  C C   . PRO A 1 86  ? 7.913   -5.620  20.143 1.00 6.67  ? 86  PRO A C   1 
ATOM   641  O O   . PRO A 1 86  ? 8.870   -5.613  20.929 1.00 11.02 ? 86  PRO A O   1 
ATOM   642  C CB  . PRO A 1 86  ? 6.510   -3.480  20.043 1.00 13.27 ? 86  PRO A CB  1 
ATOM   643  C CG  . PRO A 1 86  ? 5.834   -2.724  21.154 1.00 8.22  ? 86  PRO A CG  1 
ATOM   644  C CD  . PRO A 1 86  ? 6.409   -3.408  22.389 1.00 17.86 ? 86  PRO A CD  1 
ATOM   645  N N   . PRO A 1 87  ? 8.038   -6.259  18.982 1.00 9.04  ? 87  PRO A N   1 
ATOM   646  C CA  . PRO A 1 87  ? 9.232   -6.977  18.553 1.00 15.57 ? 87  PRO A CA  1 
ATOM   647  C C   . PRO A 1 87  ? 10.552  -6.232  18.734 1.00 19.60 ? 87  PRO A C   1 
ATOM   648  O O   . PRO A 1 87  ? 11.509  -6.913  19.149 1.00 16.84 ? 87  PRO A O   1 
ATOM   649  C CB  . PRO A 1 87  ? 8.971   -7.210  17.051 1.00 15.38 ? 87  PRO A CB  1 
ATOM   650  C CG  . PRO A 1 87  ? 7.484   -7.402  17.038 1.00 17.08 ? 87  PRO A CG  1 
ATOM   651  C CD  . PRO A 1 87  ? 6.936   -6.367  17.982 1.00 12.86 ? 87  PRO A CD  1 
ATOM   652  N N   . SER A 1 88  ? 10.682  -4.928  18.477 1.00 9.88  ? 88  SER A N   1 
ATOM   653  C CA  . SER A 1 88  ? 11.951  -4.252  18.741 1.00 10.61 ? 88  SER A CA  1 
ATOM   654  C C   . SER A 1 88  ? 12.313  -4.322  20.229 1.00 18.53 ? 88  SER A C   1 
ATOM   655  O O   . SER A 1 88  ? 13.475  -4.555  20.567 1.00 9.32  ? 88  SER A O   1 
ATOM   656  C CB  . SER A 1 88  ? 11.922  -2.790  18.267 1.00 8.02  ? 88  SER A CB  1 
ATOM   657  O OG  . SER A 1 88  ? 12.090  -2.723  16.868 1.00 12.19 ? 88  SER A OG  1 
ATOM   658  N N   . LEU A 1 89  ? 11.346  -4.118  21.129 1.00 11.26 ? 89  LEU A N   1 
ATOM   659  C CA  . LEU A 1 89  ? 11.625  -4.178  22.553 1.00 9.66  ? 89  LEU A CA  1 
ATOM   660  C C   . LEU A 1 89  ? 11.958  -5.601  23.018 1.00 6.73  ? 89  LEU A C   1 
ATOM   661  O O   . LEU A 1 89  ? 12.860  -5.793  23.856 1.00 10.20 ? 89  LEU A O   1 
ATOM   662  C CB  . LEU A 1 89  ? 10.443  -3.678  23.380 1.00 13.49 ? 89  LEU A CB  1 
ATOM   663  C CG  . LEU A 1 89  ? 10.768  -2.822  24.609 1.00 10.78 ? 89  LEU A CG  1 
ATOM   664  C CD1 . LEU A 1 89  ? 9.540   -2.748  25.513 1.00 13.77 ? 89  LEU A CD1 1 
ATOM   665  C CD2 . LEU A 1 89  ? 12.030  -3.245  25.323 1.00 13.88 ? 89  LEU A CD2 1 
ATOM   666  N N   . LEU A 1 90  ? 11.236  -6.576  22.470 1.00 8.34  ? 90  LEU A N   1 
ATOM   667  C CA  . LEU A 1 90  ? 11.528  -7.984  22.759 1.00 11.32 ? 90  LEU A CA  1 
ATOM   668  C C   . LEU A 1 90  ? 13.001  -8.238  22.455 1.00 17.44 ? 90  LEU A C   1 
ATOM   669  O O   . LEU A 1 90  ? 13.670  -8.813  23.311 1.00 9.81  ? 90  LEU A O   1 
ATOM   670  C CB  . LEU A 1 90  ? 10.596  -8.922  21.990 1.00 11.53 ? 90  LEU A CB  1 
ATOM   671  C CG  . LEU A 1 90  ? 9.175   -9.033  22.573 1.00 20.99 ? 90  LEU A CG  1 
ATOM   672  C CD1 . LEU A 1 90  ? 8.181   -9.586  21.556 1.00 16.39 ? 90  LEU A CD1 1 
ATOM   673  C CD2 . LEU A 1 90  ? 9.156   -9.892  23.828 1.00 15.08 ? 90  LEU A CD2 1 
ATOM   674  N N   . ASN A 1 91  ? 13.512  -7.817  21.304 1.00 10.29 ? 91  ASN A N   1 
ATOM   675  C CA  . ASN A 1 91  ? 14.911  -8.083  20.942 1.00 10.99 ? 91  ASN A CA  1 
ATOM   676  C C   . ASN A 1 91  ? 15.894  -7.352  21.849 1.00 7.13  ? 91  ASN A C   1 
ATOM   677  O O   . ASN A 1 91  ? 16.938  -7.917  22.216 1.00 10.99 ? 91  ASN A O   1 
ATOM   678  C CB  . ASN A 1 91  ? 15.126  -7.757  19.459 1.00 11.50 ? 91  ASN A CB  1 
ATOM   679  C CG  . ASN A 1 91  ? 14.456  -8.848  18.609 1.00 9.92  ? 91  ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 91  ? 14.307  -9.947  19.119 1.00 18.26 ? 91  ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 91  ? 14.051  -8.519  17.405 1.00 9.81  ? 91  ASN A ND2 1 
ATOM   682  N N   . MET A 1 92  ? 15.535  -6.147  22.276 1.00 7.57  ? 92  MET A N   1 
ATOM   683  C CA  . MET A 1 92  ? 16.243  -5.430  23.322 1.00 9.68  ? 92  MET A CA  1 
ATOM   684  C C   . MET A 1 92  ? 16.288  -6.241  24.620 1.00 12.47 ? 92  MET A C   1 
ATOM   685  O O   . MET A 1 92  ? 17.379  -6.352  25.213 1.00 9.45  ? 92  MET A O   1 
ATOM   686  C CB  . MET A 1 92  ? 15.617  -4.051  23.578 1.00 6.80  ? 92  MET A CB  1 
ATOM   687  C CG  . MET A 1 92  ? 15.906  -3.066  22.435 1.00 10.16 ? 92  MET A CG  1 
ATOM   688  S SD  . MET A 1 92  ? 14.768  -1.683  22.427 1.00 10.37 ? 92  MET A SD  1 
ATOM   689  C CE  . MET A 1 92  ? 15.153  -0.849  23.967 1.00 8.89  ? 92  MET A CE  1 
ATOM   690  N N   . TYR A 1 93  ? 15.156  -6.793  25.060 1.00 12.08 ? 93  TYR A N   1 
ATOM   691  C CA  . TYR A 1 93  ? 15.108  -7.606  26.273 1.00 9.86  ? 93  TYR A CA  1 
ATOM   692  C C   . TYR A 1 93  ? 15.954  -8.874  26.113 1.00 9.71  ? 93  TYR A C   1 
ATOM   693  O O   . TYR A 1 93  ? 16.523  -9.391  27.067 1.00 11.64 ? 93  TYR A O   1 
ATOM   694  C CB  . TYR A 1 93  ? 13.676  -8.012  26.597 1.00 8.75  ? 93  TYR A CB  1 
ATOM   695  C CG  . TYR A 1 93  ? 12.754  -6.994  27.205 1.00 7.37  ? 93  TYR A CG  1 
ATOM   696  C CD1 . TYR A 1 93  ? 13.256  -5.776  27.662 1.00 8.60  ? 93  TYR A CD1 1 
ATOM   697  C CD2 . TYR A 1 93  ? 11.381  -7.214  27.315 1.00 12.89 ? 93  TYR A CD2 1 
ATOM   698  C CE1 . TYR A 1 93  ? 12.430  -4.809  28.235 1.00 9.51  ? 93  TYR A CE1 1 
ATOM   699  C CE2 . TYR A 1 93  ? 10.539  -6.255  27.872 1.00 5.91  ? 93  TYR A CE2 1 
ATOM   700  C CZ  . TYR A 1 93  ? 11.072  -5.066  28.335 1.00 10.34 ? 93  TYR A CZ  1 
ATOM   701  O OH  . TYR A 1 93  ? 10.258  -4.097  28.906 1.00 11.27 ? 93  TYR A OH  1 
ATOM   702  N N   . LYS A 1 94  ? 15.986  -9.418  24.889 1.00 9.77  ? 94  LYS A N   1 
ATOM   703  C CA  . LYS A 1 94  ? 16.791  -10.621 24.666 1.00 11.06 ? 94  LYS A CA  1 
ATOM   704  C C   . LYS A 1 94  ? 18.280  -10.390 24.890 1.00 10.24 ? 94  LYS A C   1 
ATOM   705  O O   . LYS A 1 94  ? 18.946  -11.184 25.558 1.00 11.90 ? 94  LYS A O   1 
ATOM   706  C CB  . LYS A 1 94  ? 16.578  -11.155 23.239 1.00 14.85 ? 94  LYS A CB  1 
ATOM   707  C CG  . LYS A 1 94  ? 15.175  -11.717 23.032 1.00 14.82 ? 94  LYS A CG  1 
ATOM   708  C CD  . LYS A 1 94  ? 15.064  -12.394 21.666 1.00 25.78 ? 94  LYS A CD  1 
ATOM   709  C CE  . LYS A 1 94  ? 13.611  -12.732 21.342 1.00 33.26 ? 94  LYS A CE  1 
ATOM   710  N NZ  . LYS A 1 94  ? 13.265  -12.601 19.895 1.00 29.15 ? 94  LYS A NZ  1 
ATOM   711  N N   . GLU A 1 95  ? 18.812  -9.305  24.346 1.00 11.20 ? 95  GLU A N   1 
ATOM   712  C CA  . GLU A 1 95  ? 20.209  -8.929  24.485 1.00 11.16 ? 95  GLU A CA  1 
ATOM   713  C C   . GLU A 1 95  ? 20.506  -8.668  25.962 1.00 13.92 ? 95  GLU A C   1 
ATOM   714  O O   . GLU A 1 95  ? 21.521  -9.088  26.525 1.00 10.42 ? 95  GLU A O   1 
ATOM   715  C CB  . GLU A 1 95  ? 20.513  -7.705  23.620 1.00 8.21  ? 95  GLU A CB  1 
ATOM   716  C CG  . GLU A 1 95  ? 21.913  -7.149  23.809 1.00 6.23  ? 95  GLU A CG  1 
ATOM   717  C CD  . GLU A 1 95  ? 23.006  -8.057  23.249 1.00 8.42  ? 95  GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 95  ? 22.708  -9.073  22.609 1.00 16.08 ? 95  GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 95  ? 24.185  -7.718  23.448 1.00 13.43 ? 95  GLU A OE2 1 
ATOM   720  N N   . LEU A 1 96  ? 19.583  -7.968  26.607 1.00 8.73  ? 96  LEU A N   1 
ATOM   721  C CA  . LEU A 1 96  ? 19.677  -7.732  28.030 1.00 8.38  ? 96  LEU A CA  1 
ATOM   722  C C   . LEU A 1 96  ? 19.718  -9.043  28.817 1.00 10.76 ? 96  LEU A C   1 
ATOM   723  O O   . LEU A 1 96  ? 20.511  -9.157  29.753 1.00 11.22 ? 96  LEU A O   1 
ATOM   724  C CB  . LEU A 1 96  ? 18.478  -6.911  28.544 1.00 13.42 ? 96  LEU A CB  1 
ATOM   725  C CG  . LEU A 1 96  ? 18.641  -5.400  28.305 1.00 12.30 ? 96  LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 96  ? 17.300  -4.707  28.492 1.00 6.01  ? 96  LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 96  ? 19.707  -4.854  29.244 1.00 10.44 ? 96  LEU A CD2 1 
ATOM   728  N N   . GLU A 1 97  ? 18.859  -9.985  28.454 1.00 13.18 ? 97  GLU A N   1 
ATOM   729  C CA  . GLU A 1 97  ? 18.810  -11.229 29.229 1.00 20.87 ? 97  GLU A CA  1 
ATOM   730  C C   . GLU A 1 97  ? 20.111  -11.999 29.065 1.00 17.89 ? 97  GLU A C   1 
ATOM   731  O O   . GLU A 1 97  ? 20.605  -12.742 29.913 1.00 14.63 ? 97  GLU A O   1 
ATOM   732  C CB  . GLU A 1 97  ? 17.602  -12.059 28.800 1.00 24.84 ? 97  GLU A CB  1 
ATOM   733  C CG  . GLU A 1 97  ? 17.685  -13.505 29.262 1.00 50.18 ? 97  GLU A CG  1 
ATOM   734  C CD  . GLU A 1 97  ? 16.692  -13.856 30.351 1.00 59.56 ? 97  GLU A CD  1 
ATOM   735  O OE1 . GLU A 1 97  ? 15.499  -13.511 30.199 1.00 81.86 ? 97  GLU A OE1 1 
ATOM   736  O OE2 . GLU A 1 97  ? 17.106  -14.479 31.352 1.00 45.61 ? 97  GLU A OE2 1 
ATOM   737  N N   . ASN A 1 98  ? 20.720  -11.798 27.896 1.00 10.69 ? 98  ASN A N   1 
ATOM   738  C CA  . ASN A 1 98  ? 21.948  -12.564 27.661 1.00 11.35 ? 98  ASN A CA  1 
ATOM   739  C C   . ASN A 1 98  ? 23.176  -11.847 28.163 1.00 12.77 ? 98  ASN A C   1 
ATOM   740  O O   . ASN A 1 98  ? 24.253  -12.449 28.081 1.00 15.28 ? 98  ASN A O   1 
ATOM   741  C CB  . ASN A 1 98  ? 22.152  -12.807 26.156 1.00 16.22 ? 98  ASN A CB  1 
ATOM   742  C CG  . ASN A 1 98  ? 21.048  -13.707 25.616 1.00 29.33 ? 98  ASN A CG  1 
ATOM   743  O OD1 . ASN A 1 98  ? 20.665  -14.654 26.301 1.00 49.46 ? 98  ASN A OD1 1 
ATOM   744  N ND2 . ASN A 1 98  ? 20.564  -13.374 24.426 1.00 28.97 ? 98  ASN A ND2 1 
ATOM   745  N N   . THR A 1 99  ? 23.059  -10.612 28.633 1.00 11.10 ? 99  THR A N   1 
ATOM   746  C CA  . THR A 1 99  ? 24.246  -9.864  29.023 1.00 8.89  ? 99  THR A CA  1 
ATOM   747  C C   . THR A 1 99  ? 24.207  -9.337  30.452 1.00 14.45 ? 99  THR A C   1 
ATOM   748  O O   . THR A 1 99  ? 25.292  -9.276  31.042 1.00 13.59 ? 99  THR A O   1 
ATOM   749  C CB  . THR A 1 99  ? 24.536  -8.635  28.135 1.00 10.38 ? 99  THR A CB  1 
ATOM   750  O OG1 . THR A 1 99  ? 23.382  -7.775  28.089 1.00 14.04 ? 99  THR A OG1 1 
ATOM   751  C CG2 . THR A 1 99  ? 24.808  -9.071  26.717 1.00 17.79 ? 99  THR A CG2 1 
ATOM   752  N N   . ILE A 1 100 ? 23.039  -8.947  30.948 1.00 7.89  ? 100 ILE A N   1 
ATOM   753  C CA  . ILE A 1 100 ? 23.026  -8.293  32.259 1.00 10.39 ? 100 ILE A CA  1 
ATOM   754  C C   . ILE A 1 100 ? 22.764  -9.356  33.320 1.00 19.55 ? 100 ILE A C   1 
ATOM   755  O O   . ILE A 1 100 ? 21.776  -10.093 33.238 1.00 17.19 ? 100 ILE A O   1 
ATOM   756  C CB  . ILE A 1 100 ? 21.933  -7.226  32.356 1.00 12.41 ? 100 ILE A CB  1 
ATOM   757  C CG1 . ILE A 1 100 ? 22.201  -5.962  31.550 1.00 8.59  ? 100 ILE A CG1 1 
ATOM   758  C CG2 . ILE A 1 100 ? 21.630  -6.927  33.829 1.00 12.95 ? 100 ILE A CG2 1 
ATOM   759  C CD1 . ILE A 1 100 ? 23.468  -5.225  31.920 1.00 14.63 ? 100 ILE A CD1 1 
ATOM   760  N N   . PRO A 1 101 ? 23.651  -9.457  34.295 1.00 13.30 ? 101 PRO A N   1 
ATOM   761  C CA  . PRO A 1 101 ? 23.509  -10.489 35.327 1.00 17.08 ? 101 PRO A CA  1 
ATOM   762  C C   . PRO A 1 101 ? 22.183  -10.416 36.069 1.00 18.64 ? 101 PRO A C   1 
ATOM   763  O O   . PRO A 1 101 ? 21.786  -9.353  36.553 1.00 14.52 ? 101 PRO A O   1 
ATOM   764  C CB  . PRO A 1 101 ? 24.661  -10.140 36.285 1.00 24.69 ? 101 PRO A CB  1 
ATOM   765  C CG  . PRO A 1 101 ? 25.675  -9.467  35.400 1.00 21.57 ? 101 PRO A CG  1 
ATOM   766  C CD  . PRO A 1 101 ? 24.843  -8.614  34.473 1.00 16.78 ? 101 PRO A CD  1 
ATOM   767  N N   . GLY A 1 102 ? 21.491  -11.557 36.179 1.00 12.69 ? 102 GLY A N   1 
ATOM   768  C CA  . GLY A 1 102 ? 20.227  -11.564 36.881 1.00 15.03 ? 102 GLY A CA  1 
ATOM   769  C C   . GLY A 1 102 ? 19.041  -11.069 36.086 1.00 13.77 ? 102 GLY A C   1 
ATOM   770  O O   . GLY A 1 102 ? 17.902  -11.074 36.595 1.00 13.14 ? 102 GLY A O   1 
ATOM   771  N N   . PHE A 1 103 ? 19.208  -10.609 34.840 1.00 9.47  ? 103 PHE A N   1 
ATOM   772  C CA  . PHE A 1 103 ? 18.047  -10.008 34.164 1.00 15.98 ? 103 PHE A CA  1 
ATOM   773  C C   . PHE A 1 103 ? 17.119  -11.120 33.667 1.00 14.74 ? 103 PHE A C   1 
ATOM   774  O O   . PHE A 1 103 ? 17.633  -12.074 33.103 1.00 17.31 ? 103 PHE A O   1 
ATOM   775  C CB  . PHE A 1 103 ? 18.470  -9.123  33.001 1.00 13.97 ? 103 PHE A CB  1 
ATOM   776  C CG  . PHE A 1 103 ? 17.422  -8.381  32.195 1.00 16.99 ? 103 PHE A CG  1 
ATOM   777  C CD1 . PHE A 1 103 ? 16.661  -8.990  31.205 1.00 11.95 ? 103 PHE A CD1 1 
ATOM   778  C CD2 . PHE A 1 103 ? 17.205  -7.012  32.418 1.00 15.01 ? 103 PHE A CD2 1 
ATOM   779  C CE1 . PHE A 1 103 ? 15.727  -8.275  30.479 1.00 15.86 ? 103 PHE A CE1 1 
ATOM   780  C CE2 . PHE A 1 103 ? 16.285  -6.300  31.681 1.00 7.33  ? 103 PHE A CE2 1 
ATOM   781  C CZ  . PHE A 1 103 ? 15.517  -6.932  30.710 1.00 9.10  ? 103 PHE A CZ  1 
ATOM   782  N N   . THR A 1 104 ? 15.808  -10.995 33.804 1.00 10.70 ? 104 THR A N   1 
ATOM   783  C CA  . THR A 1 104 ? 14.862  -11.922 33.192 1.00 12.74 ? 104 THR A CA  1 
ATOM   784  C C   . THR A 1 104 ? 13.799  -11.132 32.421 1.00 14.19 ? 104 THR A C   1 
ATOM   785  O O   . THR A 1 104 ? 13.689  -9.929  32.647 1.00 12.19 ? 104 THR A O   1 
ATOM   786  C CB  . THR A 1 104 ? 14.176  -12.828 34.211 1.00 14.39 ? 104 THR A CB  1 
ATOM   787  O OG1 . THR A 1 104 ? 13.551  -12.008 35.201 1.00 13.07 ? 104 THR A OG1 1 
ATOM   788  C CG2 . THR A 1 104 ? 15.229  -13.690 34.909 1.00 16.14 ? 104 THR A CG2 1 
ATOM   789  N N   . ARG A 1 105 ? 13.099  -11.856 31.560 1.00 14.94 ? 105 ARG A N   1 
ATOM   790  C CA  . ARG A 1 105 ? 12.154  -11.227 30.638 1.00 14.96 ? 105 ARG A CA  1 
ATOM   791  C C   . ARG A 1 105 ? 11.083  -10.479 31.406 1.00 15.59 ? 105 ARG A C   1 
ATOM   792  O O   . ARG A 1 105 ? 10.327  -11.138 32.122 1.00 11.15 ? 105 ARG A O   1 
ATOM   793  C CB  . ARG A 1 105 ? 11.522  -12.312 29.767 1.00 28.01 ? 105 ARG A CB  1 
ATOM   794  C CG  . ARG A 1 105 ? 10.300  -11.870 28.975 1.00 28.97 ? 105 ARG A CG  1 
ATOM   795  C CD  . ARG A 1 105 ? 10.724  -11.142 27.707 1.00 23.95 ? 105 ARG A CD  1 
ATOM   796  N NE  . ARG A 1 105 ? 11.703  -11.918 26.952 1.00 24.47 ? 105 ARG A NE  1 
ATOM   797  C CZ  . ARG A 1 105 ? 11.503  -12.811 25.989 1.00 23.52 ? 105 ARG A CZ  1 
ATOM   798  N NH1 . ARG A 1 105 ? 10.288  -13.142 25.551 1.00 18.76 ? 105 ARG A NH1 1 
ATOM   799  N NH2 . ARG A 1 105 ? 12.590  -13.378 25.466 1.00 17.51 ? 105 ARG A NH2 1 
ATOM   800  N N   . PRO A 1 106 ? 10.990  -9.170  31.303 1.00 12.09 ? 106 PRO A N   1 
ATOM   801  C CA  . PRO A 1 106 ? 9.856   -8.470  31.913 1.00 12.47 ? 106 PRO A CA  1 
ATOM   802  C C   . PRO A 1 106 ? 8.506   -8.914  31.341 1.00 10.89 ? 106 PRO A C   1 
ATOM   803  O O   . PRO A 1 106 ? 8.392   -9.446  30.234 1.00 10.01 ? 106 PRO A O   1 
ATOM   804  C CB  . PRO A 1 106 ? 10.110  -7.000  31.521 1.00 12.05 ? 106 PRO A CB  1 
ATOM   805  C CG  . PRO A 1 106 ? 11.604  -6.950  31.355 1.00 16.71 ? 106 PRO A CG  1 
ATOM   806  C CD  . PRO A 1 106 ? 11.933  -8.244  30.638 1.00 15.97 ? 106 PRO A CD  1 
ATOM   807  N N   . ASN A 1 107 ? 7.454   -8.662  32.133 1.00 12.62 ? 107 ASN A N   1 
ATOM   808  C CA  . ASN A 1 107 ? 6.106   -9.057  31.701 1.00 17.05 ? 107 ASN A CA  1 
ATOM   809  C C   . ASN A 1 107 ? 5.379   -7.844  31.119 1.00 21.15 ? 107 ASN A C   1 
ATOM   810  O O   . ASN A 1 107 ? 4.168   -7.841  30.886 1.00 19.55 ? 107 ASN A O   1 
ATOM   811  C CB  . ASN A 1 107 ? 5.359   -9.692  32.868 1.00 14.05 ? 107 ASN A CB  1 
ATOM   812  C CG  . ASN A 1 107 ? 4.915   -8.718  33.931 1.00 30.88 ? 107 ASN A CG  1 
ATOM   813  O OD1 . ASN A 1 107 ? 5.227   -7.528  33.892 1.00 50.75 ? 107 ASN A OD1 1 
ATOM   814  N ND2 . ASN A 1 107 ? 4.175   -9.219  34.921 1.00 40.45 ? 107 ASN A ND2 1 
ATOM   815  N N   . HIS A 1 108 ? 6.152   -6.768  30.897 1.00 16.01 ? 108 HIS A N   1 
ATOM   816  C CA  . HIS A 1 108 ? 5.542   -5.542  30.338 1.00 13.27 ? 108 HIS A CA  1 
ATOM   817  C C   . HIS A 1 108 ? 6.568   -4.835  29.459 1.00 9.25  ? 108 HIS A C   1 
ATOM   818  O O   . HIS A 1 108 ? 7.734   -5.236  29.517 1.00 7.47  ? 108 HIS A O   1 
ATOM   819  C CB  . HIS A 1 108 ? 5.053   -4.678  31.508 1.00 16.80 ? 108 HIS A CB  1 
ATOM   820  C CG  . HIS A 1 108 ? 6.204   -4.043  32.244 1.00 13.59 ? 108 HIS A CG  1 
ATOM   821  N ND1 . HIS A 1 108 ? 6.839   -4.632  33.308 1.00 17.84 ? 108 HIS A ND1 1 
ATOM   822  C CD2 . HIS A 1 108 ? 6.821   -2.840  32.053 1.00 6.78  ? 108 HIS A CD2 1 
ATOM   823  C CE1 . HIS A 1 108 ? 7.800   -3.849  33.747 1.00 9.29  ? 108 HIS A CE1 1 
ATOM   824  N NE2 . HIS A 1 108 ? 7.812   -2.760  32.999 1.00 21.77 ? 108 HIS A NE2 1 
ATOM   825  N N   . GLY A 1 109 ? 6.196   -3.805  28.707 1.00 11.49 ? 109 GLY A N   1 
ATOM   826  C CA  . GLY A 1 109 ? 7.111   -3.057  27.868 1.00 11.49 ? 109 GLY A CA  1 
ATOM   827  C C   . GLY A 1 109 ? 7.184   -1.580  28.238 1.00 15.41 ? 109 GLY A C   1 
ATOM   828  O O   . GLY A 1 109 ? 7.471   -0.733  27.399 1.00 9.84  ? 109 GLY A O   1 
ATOM   829  N N   . TYR A 1 110 ? 6.947   -1.229  29.489 1.00 8.58  ? 110 TYR A N   1 
ATOM   830  C CA  . TYR A 1 110 ? 6.926   0.161   29.949 1.00 13.28 ? 110 TYR A CA  1 
ATOM   831  C C   . TYR A 1 110 ? 8.273   0.594   30.503 1.00 11.64 ? 110 TYR A C   1 
ATOM   832  O O   . TYR A 1 110 ? 8.736   -0.010  31.473 1.00 9.50  ? 110 TYR A O   1 
ATOM   833  C CB  . TYR A 1 110 ? 5.826   0.270   31.004 1.00 12.57 ? 110 TYR A CB  1 
ATOM   834  C CG  . TYR A 1 110 ? 5.477   1.680   31.395 1.00 14.18 ? 110 TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 110 ? 4.899   2.548   30.468 1.00 12.14 ? 110 TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 110 ? 5.728   2.116   32.693 1.00 20.97 ? 110 TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 110 ? 4.584   3.834   30.859 1.00 12.88 ? 110 TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 110 ? 5.417   3.405   33.076 1.00 24.94 ? 110 TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 110 ? 4.844   4.252   32.140 1.00 18.07 ? 110 TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 110 ? 4.538   5.538   32.532 1.00 21.44 ? 110 TYR A OH  1 
ATOM   841  N N   . LEU A 1 111 ? 8.904   1.599   29.883 1.00 14.46 ? 111 LEU A N   1 
ATOM   842  C CA  . LEU A 1 111 ? 10.297  1.964   30.149 1.00 13.95 ? 111 LEU A CA  1 
ATOM   843  C C   . LEU A 1 111 ? 10.478  3.276   30.908 1.00 11.33 ? 111 LEU A C   1 
ATOM   844  O O   . LEU A 1 111 ? 11.574  3.833   30.967 1.00 9.16  ? 111 LEU A O   1 
ATOM   845  C CB  . LEU A 1 111 ? 11.097  2.023   28.820 1.00 4.00  ? 111 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 111 ? 10.896  0.763   27.963 1.00 9.22  ? 111 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 111 ? 11.691  0.877   26.664 1.00 8.64  ? 111 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 111 ? 11.289  -0.490  28.720 1.00 9.57  ? 111 LEU A CD2 1 
ATOM   849  N N   . GLU A 1 112 ? 9.414   3.797   31.504 1.00 14.50 ? 112 GLU A N   1 
ATOM   850  C CA  . GLU A 1 112 ? 9.528   5.006   32.304 1.00 14.43 ? 112 GLU A CA  1 
ATOM   851  C C   . GLU A 1 112 ? 10.619  4.947   33.352 1.00 10.15 ? 112 GLU A C   1 
ATOM   852  O O   . GLU A 1 112 ? 11.350  5.879   33.677 1.00 13.41 ? 112 GLU A O   1 
ATOM   853  C CB  . GLU A 1 112 ? 8.200   5.290   33.045 1.00 14.35 ? 112 GLU A CB  1 
ATOM   854  C CG  . GLU A 1 112 ? 8.459   6.569   33.846 1.00 25.60 ? 112 GLU A CG  1 
ATOM   855  C CD  . GLU A 1 112 ? 7.299   6.979   34.719 1.00 29.55 ? 112 GLU A CD  1 
ATOM   856  O OE1 . GLU A 1 112 ? 6.190   6.437   34.555 1.00 36.06 ? 112 GLU A OE1 1 
ATOM   857  O OE2 . GLU A 1 112 ? 7.536   7.857   35.574 1.00 32.38 ? 112 GLU A OE2 1 
ATOM   858  N N   . SER A 1 113 ? 10.779  3.772   33.980 1.00 10.54 ? 113 SER A N   1 
ATOM   859  C CA  . SER A 1 113 ? 11.836  3.723   35.003 1.00 11.42 ? 113 SER A CA  1 
ATOM   860  C C   . SER A 1 113 ? 13.227  3.762   34.398 1.00 15.00 ? 113 SER A C   1 
ATOM   861  O O   . SER A 1 113 ? 14.170  4.144   35.106 1.00 11.14 ? 113 SER A O   1 
ATOM   862  C CB  . SER A 1 113 ? 11.626  2.485   35.886 1.00 11.52 ? 113 SER A CB  1 
ATOM   863  O OG  . SER A 1 113 ? 11.947  1.310   35.153 1.00 13.68 ? 113 SER A OG  1 
ATOM   864  N N   . TRP A 1 114 ? 13.413  3.416   33.124 1.00 10.20 ? 114 TRP A N   1 
ATOM   865  C CA  . TRP A 1 114 ? 14.695  3.727   32.480 1.00 11.93 ? 114 TRP A CA  1 
ATOM   866  C C   . TRP A 1 114 ? 14.892  5.248   32.411 1.00 10.27 ? 114 TRP A C   1 
ATOM   867  O O   . TRP A 1 114 ? 15.942  5.763   32.787 1.00 11.84 ? 114 TRP A O   1 
ATOM   868  C CB  . TRP A 1 114 ? 14.798  3.154   31.072 1.00 8.40  ? 114 TRP A CB  1 
ATOM   869  C CG  . TRP A 1 114 ? 14.880  1.660   30.954 1.00 12.13 ? 114 TRP A CG  1 
ATOM   870  C CD1 . TRP A 1 114 ? 14.712  0.712   31.930 1.00 14.62 ? 114 TRP A CD1 1 
ATOM   871  C CD2 . TRP A 1 114 ? 15.146  0.933   29.741 1.00 12.55 ? 114 TRP A CD2 1 
ATOM   872  N NE1 . TRP A 1 114 ? 14.868  -0.563  31.409 1.00 9.82  ? 114 TRP A NE1 1 
ATOM   873  C CE2 . TRP A 1 114 ? 15.132  -0.435  30.072 1.00 13.61 ? 114 TRP A CE2 1 
ATOM   874  C CE3 . TRP A 1 114 ? 15.400  1.322   28.424 1.00 14.13 ? 114 TRP A CE3 1 
ATOM   875  C CZ2 . TRP A 1 114 ? 15.365  -1.413  29.100 1.00 15.20 ? 114 TRP A CZ2 1 
ATOM   876  C CZ3 . TRP A 1 114 ? 15.633  0.357   27.459 1.00 11.09 ? 114 TRP A CZ3 1 
ATOM   877  C CH2 . TRP A 1 114 ? 15.612  -1.000  27.820 1.00 11.63 ? 114 TRP A CH2 1 
ATOM   878  N N   . ALA A 1 115 ? 13.877  5.938   31.910 1.00 9.02  ? 115 ALA A N   1 
ATOM   879  C CA  . ALA A 1 115 ? 13.955  7.396   31.797 1.00 20.33 ? 115 ALA A CA  1 
ATOM   880  C C   . ALA A 1 115 ? 14.212  8.076   33.149 1.00 14.80 ? 115 ALA A C   1 
ATOM   881  O O   . ALA A 1 115 ? 14.966  9.056   33.200 1.00 10.96 ? 115 ALA A O   1 
ATOM   882  C CB  . ALA A 1 115 ? 12.691  7.934   31.164 1.00 7.69  ? 115 ALA A CB  1 
ATOM   883  N N   . ARG A 1 116 ? 13.595  7.560   34.216 1.00 15.88 ? 116 ARG A N   1 
ATOM   884  C CA  . ARG A 1 116 ? 13.786  8.173   35.534 1.00 12.31 ? 116 ARG A CA  1 
ATOM   885  C C   . ARG A 1 116 ? 15.210  7.962   36.029 1.00 14.80 ? 116 ARG A C   1 
ATOM   886  O O   . ARG A 1 116 ? 15.633  8.669   36.951 1.00 15.00 ? 116 ARG A O   1 
ATOM   887  C CB  . ARG A 1 116 ? 12.828  7.595   36.567 1.00 17.04 ? 116 ARG A CB  1 
ATOM   888  C CG  . ARG A 1 116 ? 11.353  7.784   36.255 1.00 16.65 ? 116 ARG A CG  1 
ATOM   889  C CD  . ARG A 1 116 ? 11.055  9.278   36.306 1.00 35.62 ? 116 ARG A CD  1 
ATOM   890  N NE  . ARG A 1 116 ? 9.611   9.477   36.155 1.00 39.88 ? 116 ARG A NE  1 
ATOM   891  C CZ  . ARG A 1 116 ? 9.101   10.684  35.940 1.00 37.68 ? 116 ARG A CZ  1 
ATOM   892  N NH1 . ARG A 1 116 ? 9.911   11.731  35.861 1.00 32.70 ? 116 ARG A NH1 1 
ATOM   893  N NH2 . ARG A 1 116 ? 7.791   10.786  35.809 1.00 26.93 ? 116 ARG A NH2 1 
ATOM   894  N N   . GLN A 1 117 ? 15.942  7.028   35.429 1.00 18.27 ? 117 GLN A N   1 
ATOM   895  C CA  . GLN A 1 117 ? 17.349  6.862   35.795 1.00 20.07 ? 117 GLN A CA  1 
ATOM   896  C C   . GLN A 1 117 ? 18.287  7.643   34.881 1.00 10.09 ? 117 GLN A C   1 
ATOM   897  O O   . GLN A 1 117 ? 19.512  7.538   34.992 1.00 18.59 ? 117 GLN A O   1 
ATOM   898  C CB  . GLN A 1 117 ? 17.725  5.379   35.770 1.00 12.84 ? 117 GLN A CB  1 
ATOM   899  C CG  . GLN A 1 117 ? 16.980  4.575   36.849 1.00 12.50 ? 117 GLN A CG  1 
ATOM   900  C CD  . GLN A 1 117 ? 17.383  3.110   36.682 1.00 23.12 ? 117 GLN A CD  1 
ATOM   901  O OE1 . GLN A 1 117 ? 18.476  2.707   37.072 1.00 18.42 ? 117 GLN A OE1 1 
ATOM   902  N NE2 . GLN A 1 117 ? 16.523  2.308   36.071 1.00 18.69 ? 117 GLN A NE2 1 
ATOM   903  N N   . GLY A 1 118 ? 17.709  8.429   33.946 1.00 7.06  ? 118 GLY A N   1 
ATOM   904  C CA  . GLY A 1 118 ? 18.577  9.231   33.118 1.00 8.62  ? 118 GLY A CA  1 
ATOM   905  C C   . GLY A 1 118 ? 18.777  8.672   31.712 1.00 20.31 ? 118 GLY A C   1 
ATOM   906  O O   . GLY A 1 118 ? 19.695  9.170   31.045 1.00 11.86 ? 118 GLY A O   1 
ATOM   907  N N   . VAL A 1 119 ? 17.950  7.704   31.321 1.00 11.20 ? 119 VAL A N   1 
ATOM   908  C CA  . VAL A 1 119 ? 17.976  7.178   29.957 1.00 14.56 ? 119 VAL A CA  1 
ATOM   909  C C   . VAL A 1 119 ? 17.012  8.010   29.105 1.00 17.50 ? 119 VAL A C   1 
ATOM   910  O O   . VAL A 1 119 ? 15.795  7.899   29.312 1.00 10.80 ? 119 VAL A O   1 
ATOM   911  C CB  . VAL A 1 119 ? 17.626  5.687   29.847 1.00 10.69 ? 119 VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 119 ? 17.798  5.171   28.416 1.00 12.08 ? 119 VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 119 ? 18.505  4.866   30.784 1.00 12.37 ? 119 VAL A CG2 1 
ATOM   914  N N   . LEU A 1 120 ? 17.564  8.839   28.207 1.00 8.04  ? 120 LEU A N   1 
ATOM   915  C CA  . LEU A 1 120 ? 16.764  9.689   27.344 1.00 7.88  ? 120 LEU A CA  1 
ATOM   916  C C   . LEU A 1 120 ? 16.309  8.876   26.132 1.00 5.31  ? 120 LEU A C   1 
ATOM   917  O O   . LEU A 1 120 ? 17.153  8.513   25.318 1.00 7.64  ? 120 LEU A O   1 
ATOM   918  C CB  . LEU A 1 120 ? 17.537  10.942  26.880 1.00 7.73  ? 120 LEU A CB  1 
ATOM   919  C CG  . LEU A 1 120 ? 16.688  11.922  26.050 1.00 10.35 ? 120 LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 120 ? 15.608  12.572  26.939 1.00 6.13  ? 120 LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 120 ? 17.513  12.993  25.371 1.00 11.24 ? 120 LEU A CD2 1 
ATOM   922  N N   . LEU A 1 121 ? 15.010  8.604   26.088 1.00 13.50 ? 121 LEU A N   1 
ATOM   923  C CA  . LEU A 1 121 ? 14.403  7.728   25.098 1.00 10.87 ? 121 LEU A CA  1 
ATOM   924  C C   . LEU A 1 121 ? 13.712  8.555   24.026 1.00 6.29  ? 121 LEU A C   1 
ATOM   925  O O   . LEU A 1 121 ? 12.510  8.745   24.043 1.00 9.79  ? 121 LEU A O   1 
ATOM   926  C CB  . LEU A 1 121 ? 13.413  6.790   25.792 1.00 14.29 ? 121 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 121 ? 14.080  5.790   26.743 1.00 10.78 ? 121 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 121 ? 13.022  5.187   27.658 1.00 13.17 ? 121 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 121 ? 14.803  4.706   25.943 1.00 8.73  ? 121 LEU A CD2 1 
ATOM   930  N N   . LEU A 1 122 ? 14.580  9.038   23.135 1.00 7.99  ? 122 LEU A N   1 
ATOM   931  C CA  . LEU A 1 122 ? 14.282  10.064  22.185 1.00 9.94  ? 122 LEU A CA  1 
ATOM   932  C C   . LEU A 1 122 ? 14.135  9.526   20.765 1.00 15.82 ? 122 LEU A C   1 
ATOM   933  O O   . LEU A 1 122 ? 15.121  9.122   20.149 1.00 11.61 ? 122 LEU A O   1 
ATOM   934  C CB  . LEU A 1 122 ? 15.423  11.099  22.142 1.00 9.08  ? 122 LEU A CB  1 
ATOM   935  C CG  . LEU A 1 122 ? 15.218  12.271  21.180 1.00 10.99 ? 122 LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 122 ? 14.073  13.142  21.693 1.00 9.47  ? 122 LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 122 ? 16.506  13.066  21.036 1.00 12.75 ? 122 LEU A CD2 1 
ATOM   938  N N   . ASN A 1 123 ? 12.909  9.567   20.264 1.00 5.75  ? 123 ASN A N   1 
ATOM   939  C CA  . ASN A 1 123 ? 12.665  9.387   18.847 1.00 6.13  ? 123 ASN A CA  1 
ATOM   940  C C   . ASN A 1 123 ? 13.060  10.625  18.039 1.00 9.91  ? 123 ASN A C   1 
ATOM   941  O O   . ASN A 1 123 ? 12.791  11.725  18.553 1.00 11.21 ? 123 ASN A O   1 
ATOM   942  C CB  . ASN A 1 123 ? 11.177  9.102   18.622 1.00 5.65  ? 123 ASN A CB  1 
ATOM   943  C CG  . ASN A 1 123 ? 10.845  7.643   18.921 1.00 15.64 ? 123 ASN A CG  1 
ATOM   944  O OD1 . ASN A 1 123 ? 11.639  6.752   18.599 1.00 12.65 ? 123 ASN A OD1 1 
ATOM   945  N ND2 . ASN A 1 123 ? 9.685   7.383   19.523 1.00 9.46  ? 123 ASN A ND2 1 
ATOM   946  N N   . THR A 1 124 ? 13.621  10.468  16.853 1.00 10.33 ? 124 THR A N   1 
ATOM   947  C CA  . THR A 1 124 ? 13.947  11.603  15.989 1.00 11.40 ? 124 THR A CA  1 
ATOM   948  C C   . THR A 1 124 ? 12.689  12.263  15.418 1.00 9.55  ? 124 THR A C   1 
ATOM   949  O O   . THR A 1 124 ? 12.681  13.471  15.163 1.00 11.20 ? 124 THR A O   1 
ATOM   950  C CB  . THR A 1 124 ? 14.909  11.259  14.824 1.00 14.76 ? 124 THR A CB  1 
ATOM   951  O OG1 . THR A 1 124 ? 14.345  10.312  13.932 1.00 14.26 ? 124 THR A OG1 1 
ATOM   952  C CG2 . THR A 1 124 ? 16.174  10.625  15.397 1.00 14.78 ? 124 THR A CG2 1 
ATOM   953  N N   . VAL A 1 125 ? 11.621  11.500  15.255 1.00 9.26  ? 125 VAL A N   1 
ATOM   954  C CA  . VAL A 1 125 ? 10.318  12.021  14.821 1.00 5.48  ? 125 VAL A CA  1 
ATOM   955  C C   . VAL A 1 125 ? 9.322   11.819  15.943 1.00 12.50 ? 125 VAL A C   1 
ATOM   956  O O   . VAL A 1 125 ? 9.230   10.708  16.465 1.00 10.60 ? 125 VAL A O   1 
ATOM   957  C CB  . VAL A 1 125 ? 9.914   11.319  13.511 1.00 8.01  ? 125 VAL A CB  1 
ATOM   958  C CG1 . VAL A 1 125 ? 8.443   11.533  13.165 1.00 9.32  ? 125 VAL A CG1 1 
ATOM   959  C CG2 . VAL A 1 125 ? 10.828  11.823  12.384 1.00 11.05 ? 125 VAL A CG2 1 
ATOM   960  N N   . LEU A 1 126 ? 8.567   12.827  16.386 1.00 7.46  ? 126 LEU A N   1 
ATOM   961  C CA  . LEU A 1 126 ? 7.845   12.658  17.650 1.00 10.94 ? 126 LEU A CA  1 
ATOM   962  C C   . LEU A 1 126 ? 6.355   12.376  17.494 1.00 17.66 ? 126 LEU A C   1 
ATOM   963  O O   . LEU A 1 126 ? 5.681   12.125  18.497 1.00 11.38 ? 126 LEU A O   1 
ATOM   964  C CB  . LEU A 1 126 ? 8.087   13.895  18.525 1.00 9.25  ? 126 LEU A CB  1 
ATOM   965  C CG  . LEU A 1 126 ? 9.522   14.076  19.031 1.00 10.99 ? 126 LEU A CG  1 
ATOM   966  C CD1 . LEU A 1 126 ? 9.601   15.330  19.891 1.00 8.63  ? 126 LEU A CD1 1 
ATOM   967  C CD2 . LEU A 1 126 ? 10.001  12.847  19.794 1.00 12.96 ? 126 LEU A CD2 1 
ATOM   968  N N   . THR A 1 127 ? 5.805   12.356  16.278 1.00 11.94 ? 127 THR A N   1 
ATOM   969  C CA  . THR A 1 127 ? 4.403   11.970  16.106 1.00 6.28  ? 127 THR A CA  1 
ATOM   970  C C   . THR A 1 127 ? 4.295   11.083  14.855 1.00 12.37 ? 127 THR A C   1 
ATOM   971  O O   . THR A 1 127 ? 5.229   11.044  14.051 1.00 9.88  ? 127 THR A O   1 
ATOM   972  C CB  . THR A 1 127 ? 3.474   13.163  15.912 1.00 9.79  ? 127 THR A CB  1 
ATOM   973  O OG1 . THR A 1 127 ? 4.048   14.030  14.908 1.00 10.31 ? 127 THR A OG1 1 
ATOM   974  C CG2 . THR A 1 127 ? 3.338   13.994  17.180 1.00 10.23 ? 127 THR A CG2 1 
ATOM   975  N N   . VAL A 1 128 ? 3.154   10.418  14.735 1.00 6.73  ? 128 VAL A N   1 
ATOM   976  C CA  . VAL A 1 128 ? 2.907   9.512   13.613 1.00 9.00  ? 128 VAL A CA  1 
ATOM   977  C C   . VAL A 1 128 ? 1.404   9.348   13.407 1.00 9.85  ? 128 VAL A C   1 
ATOM   978  O O   . VAL A 1 128 ? 0.620   9.371   14.365 1.00 12.28 ? 128 VAL A O   1 
ATOM   979  C CB  . VAL A 1 128 ? 3.603   8.156   13.838 1.00 14.49 ? 128 VAL A CB  1 
ATOM   980  C CG1 . VAL A 1 128 ? 2.996   7.398   15.006 1.00 9.86  ? 128 VAL A CG1 1 
ATOM   981  C CG2 . VAL A 1 128 ? 3.535   7.308   12.562 1.00 14.68 ? 128 VAL A CG2 1 
ATOM   982  N N   . ARG A 1 129 ? 0.978   9.232   12.152 1.00 10.90 ? 129 ARG A N   1 
ATOM   983  C CA  . ARG A 1 129 ? -0.384  8.894   11.775 1.00 13.92 ? 129 ARG A CA  1 
ATOM   984  C C   . ARG A 1 129 ? -0.668  7.428   12.125 1.00 15.77 ? 129 ARG A C   1 
ATOM   985  O O   . ARG A 1 129 ? 0.202   6.599   11.848 1.00 16.11 ? 129 ARG A O   1 
ATOM   986  C CB  . ARG A 1 129 ? -0.623  9.062   10.272 1.00 12.63 ? 129 ARG A CB  1 
ATOM   987  C CG  . ARG A 1 129 ? -0.568  10.510  9.788  1.00 10.30 ? 129 ARG A CG  1 
ATOM   988  C CD  . ARG A 1 129 ? -1.077  10.615  8.370  1.00 13.00 ? 129 ARG A CD  1 
ATOM   989  N NE  . ARG A 1 129 ? -1.130  11.980  7.850  1.00 23.42 ? 129 ARG A NE  1 
ATOM   990  C CZ  . ARG A 1 129 ? -1.178  12.208  6.535  1.00 25.87 ? 129 ARG A CZ  1 
ATOM   991  N NH1 . ARG A 1 129 ? -1.174  11.153  5.722  1.00 13.05 ? 129 ARG A NH1 1 
ATOM   992  N NH2 . ARG A 1 129 ? -1.230  13.439  6.042  1.00 22.93 ? 129 ARG A NH2 1 
ATOM   993  N N   . ALA A 1 130 ? -1.835  7.152   12.699 1.00 17.17 ? 130 ALA A N   1 
ATOM   994  C CA  . ALA A 1 130 ? -2.203  5.776   13.020 1.00 13.06 ? 130 ALA A CA  1 
ATOM   995  C C   . ALA A 1 130 ? -1.987  4.875   11.808 1.00 13.63 ? 130 ALA A C   1 
ATOM   996  O O   . ALA A 1 130 ? -2.405  5.203   10.700 1.00 15.49 ? 130 ALA A O   1 
ATOM   997  C CB  . ALA A 1 130 ? -3.627  5.596   13.514 1.00 17.59 ? 130 ALA A CB  1 
ATOM   998  N N   . GLY A 1 131 ? -1.300  3.788   12.133 1.00 11.55 ? 131 GLY A N   1 
ATOM   999  C CA  . GLY A 1 131 ? -1.005  2.736   11.199 1.00 17.55 ? 131 GLY A CA  1 
ATOM   1000 C C   . GLY A 1 131 ? -0.072  3.086   10.071 1.00 18.82 ? 131 GLY A C   1 
ATOM   1001 O O   . GLY A 1 131 ? 0.134   2.212   9.225  1.00 16.31 ? 131 GLY A O   1 
ATOM   1002 N N   . GLN A 1 132 ? 0.496   4.281   9.995  1.00 9.51  ? 132 GLN A N   1 
ATOM   1003 C CA  . GLN A 1 132 ? 1.302   4.667   8.847  1.00 12.90 ? 132 GLN A CA  1 
ATOM   1004 C C   . GLN A 1 132 ? 2.705   5.089   9.265  1.00 20.28 ? 132 GLN A C   1 
ATOM   1005 O O   . GLN A 1 132 ? 2.959   6.267   9.531  1.00 15.93 ? 132 GLN A O   1 
ATOM   1006 C CB  . GLN A 1 132 ? 0.622   5.820   8.108  1.00 16.47 ? 132 GLN A CB  1 
ATOM   1007 C CG  . GLN A 1 132 ? -0.831  5.520   7.749  1.00 25.84 ? 132 GLN A CG  1 
ATOM   1008 C CD  . GLN A 1 132 ? -0.878  4.319   6.807  1.00 31.70 ? 132 GLN A CD  1 
ATOM   1009 O OE1 . GLN A 1 132 ? 0.009   4.177   5.971  1.00 52.80 ? 132 GLN A OE1 1 
ATOM   1010 N NE2 . GLN A 1 132 ? -1.903  3.503   6.984  1.00 46.34 ? 132 GLN A NE2 1 
ATOM   1011 N N   . ALA A 1 133 ? 3.633   4.143   9.335  1.00 17.17 ? 133 ALA A N   1 
ATOM   1012 C CA  . ALA A 1 133 ? 4.972   4.502   9.775  1.00 21.98 ? 133 ALA A CA  1 
ATOM   1013 C C   . ALA A 1 133 ? 5.590   5.585   8.898  1.00 21.16 ? 133 ALA A C   1 
ATOM   1014 O O   . ALA A 1 133 ? 5.422   5.646   7.681  1.00 17.00 ? 133 ALA A O   1 
ATOM   1015 C CB  . ALA A 1 133 ? 5.828   3.248   9.820  1.00 14.30 ? 133 ALA A CB  1 
ATOM   1016 N N   . HIS A 1 134 ? 6.318   6.486   9.565  1.00 14.51 ? 134 HIS A N   1 
ATOM   1017 C CA  . HIS A 1 134 ? 7.083   7.543   8.941  1.00 7.55  ? 134 HIS A CA  1 
ATOM   1018 C C   . HIS A 1 134 ? 6.223   8.656   8.334  1.00 8.58  ? 134 HIS A C   1 
ATOM   1019 O O   . HIS A 1 134 ? 6.729   9.555   7.657  1.00 10.88 ? 134 HIS A O   1 
ATOM   1020 C CB  . HIS A 1 134 ? 7.991   6.937   7.854  1.00 15.28 ? 134 HIS A CB  1 
ATOM   1021 C CG  . HIS A 1 134 ? 8.913   5.908   8.432  1.00 22.17 ? 134 HIS A CG  1 
ATOM   1022 N ND1 . HIS A 1 134 ? 9.992   6.216   9.234  1.00 19.72 ? 134 HIS A ND1 1 
ATOM   1023 C CD2 . HIS A 1 134 ? 8.906   4.559   8.308  1.00 19.63 ? 134 HIS A CD2 1 
ATOM   1024 C CE1 . HIS A 1 134 ? 10.615  5.095   9.575  1.00 13.99 ? 134 HIS A CE1 1 
ATOM   1025 N NE2 . HIS A 1 134 ? 9.972   4.079   9.028  1.00 25.23 ? 134 HIS A NE2 1 
ATOM   1026 N N   . SER A 1 135 ? 4.934   8.617   8.602  1.00 15.65 ? 135 SER A N   1 
ATOM   1027 C CA  . SER A 1 135 ? 4.008   9.583   7.994  1.00 17.15 ? 135 SER A CA  1 
ATOM   1028 C C   . SER A 1 135 ? 4.321   11.012  8.397  1.00 11.79 ? 135 SER A C   1 
ATOM   1029 O O   . SER A 1 135 ? 4.025   11.923  7.591  1.00 12.62 ? 135 SER A O   1 
ATOM   1030 C CB  . SER A 1 135 ? 2.551   9.217   8.300  1.00 18.94 ? 135 SER A CB  1 
ATOM   1031 O OG  . SER A 1 135 ? 2.323   8.827   9.654  1.00 9.28  ? 135 SER A OG  1 
ATOM   1032 N N   . HIS A 1 136 ? 4.903   11.275  9.561  1.00 7.43  ? 136 HIS A N   1 
ATOM   1033 C CA  . HIS A 1 136 ? 5.245   12.672  9.839  1.00 9.56  ? 136 HIS A CA  1 
ATOM   1034 C C   . HIS A 1 136 ? 6.732   12.948  9.713  1.00 12.21 ? 136 HIS A C   1 
ATOM   1035 O O   . HIS A 1 136 ? 7.261   13.901  10.309 1.00 14.90 ? 136 HIS A O   1 
ATOM   1036 C CB  . HIS A 1 136 ? 4.784   13.033  11.252 1.00 12.39 ? 136 HIS A CB  1 
ATOM   1037 C CG  . HIS A 1 136 ? 3.303   13.224  11.365 1.00 11.90 ? 136 HIS A CG  1 
ATOM   1038 N ND1 . HIS A 1 136 ? 2.677   13.476  12.569 1.00 11.30 ? 136 HIS A ND1 1 
ATOM   1039 C CD2 . HIS A 1 136 ? 2.333   13.210  10.421 1.00 12.80 ? 136 HIS A CD2 1 
ATOM   1040 C CE1 . HIS A 1 136 ? 1.380   13.606  12.361 1.00 12.25 ? 136 HIS A CE1 1 
ATOM   1041 N NE2 . HIS A 1 136 ? 1.150   13.453  11.088 1.00 12.65 ? 136 HIS A NE2 1 
ATOM   1042 N N   . ALA A 1 137 ? 7.470   12.115  8.989  1.00 15.73 ? 137 ALA A N   1 
ATOM   1043 C CA  . ALA A 1 137 ? 8.922   12.250  8.961  1.00 10.18 ? 137 ALA A CA  1 
ATOM   1044 C C   . ALA A 1 137 ? 9.340   13.493  8.191  1.00 16.33 ? 137 ALA A C   1 
ATOM   1045 O O   . ALA A 1 137 ? 10.493  13.911  8.309  1.00 28.63 ? 137 ALA A O   1 
ATOM   1046 C CB  . ALA A 1 137 ? 9.633   11.048  8.346  1.00 9.06  ? 137 ALA A CB  1 
ATOM   1047 N N   . SER A 1 138 ? 8.426   14.082  7.422  1.00 13.50 ? 138 SER A N   1 
ATOM   1048 C CA  . SER A 1 138 ? 8.908   15.248  6.656  1.00 17.35 ? 138 SER A CA  1 
ATOM   1049 C C   . SER A 1 138 ? 8.238   16.521  7.156  1.00 21.67 ? 138 SER A C   1 
ATOM   1050 O O   . SER A 1 138 ? 8.271   17.519  6.440  1.00 22.80 ? 138 SER A O   1 
ATOM   1051 C CB  . SER A 1 138 ? 8.779   15.019  5.153  1.00 21.25 ? 138 SER A CB  1 
ATOM   1052 O OG  . SER A 1 138 ? 7.484   14.682  4.685  1.00 18.59 ? 138 SER A OG  1 
ATOM   1053 N N   . LEU A 1 139 ? 7.680   16.498  8.368  1.00 14.38 ? 139 LEU A N   1 
ATOM   1054 C CA  . LEU A 1 139 ? 7.292   17.713  9.079  1.00 16.53 ? 139 LEU A CA  1 
ATOM   1055 C C   . LEU A 1 139 ? 8.576   18.354  9.556  1.00 16.53 ? 139 LEU A C   1 
ATOM   1056 O O   . LEU A 1 139 ? 9.641   18.155  8.932  1.00 41.03 ? 139 LEU A O   1 
ATOM   1057 C CB  . LEU A 1 139 ? 6.313   17.399  10.207 1.00 21.67 ? 139 LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 139 ? 4.980   16.807  9.736  1.00 23.44 ? 139 LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 139 ? 3.845   16.998  10.713 1.00 24.07 ? 139 LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 139 ? 4.627   17.453  8.400  1.00 36.89 ? 139 LEU A CD2 1 
ATOM   1061 N N   . GLY A 1 140 ? 8.644   19.124  10.635 1.00 26.06 ? 140 GLY A N   1 
ATOM   1062 C CA  . GLY A 1 140 ? 10.011  19.555  10.975 1.00 23.09 ? 140 GLY A CA  1 
ATOM   1063 C C   . GLY A 1 140 ? 10.580  18.863  12.195 1.00 19.90 ? 140 GLY A C   1 
ATOM   1064 O O   . GLY A 1 140 ? 11.400  19.458  12.908 1.00 13.36 ? 140 GLY A O   1 
ATOM   1065 N N   . TRP A 1 141 ? 10.181  17.627  12.513 1.00 11.19 ? 141 TRP A N   1 
ATOM   1066 C CA  . TRP A 1 141 ? 10.650  17.066  13.785 1.00 11.32 ? 141 TRP A CA  1 
ATOM   1067 C C   . TRP A 1 141 ? 12.151  16.768  13.767 1.00 18.80 ? 141 TRP A C   1 
ATOM   1068 O O   . TRP A 1 141 ? 12.873  16.971  14.743 1.00 17.51 ? 141 TRP A O   1 
ATOM   1069 C CB  . TRP A 1 141 ? 9.920   15.760  14.110 1.00 9.93  ? 141 TRP A CB  1 
ATOM   1070 C CG  . TRP A 1 141 ? 8.526   15.862  14.660 1.00 9.67  ? 141 TRP A CG  1 
ATOM   1071 C CD1 . TRP A 1 141 ? 7.425   15.246  14.128 1.00 8.34  ? 141 TRP A CD1 1 
ATOM   1072 C CD2 . TRP A 1 141 ? 8.064   16.592  15.803 1.00 10.04 ? 141 TRP A CD2 1 
ATOM   1073 N NE1 . TRP A 1 141 ? 6.308   15.545  14.876 1.00 6.56  ? 141 TRP A NE1 1 
ATOM   1074 C CE2 . TRP A 1 141 ? 6.681   16.371  15.908 1.00 7.78  ? 141 TRP A CE2 1 
ATOM   1075 C CE3 . TRP A 1 141 ? 8.708   17.407  16.747 1.00 14.70 ? 141 TRP A CE3 1 
ATOM   1076 C CZ2 . TRP A 1 141 ? 5.919   16.945  16.925 1.00 10.18 ? 141 TRP A CZ2 1 
ATOM   1077 C CZ3 . TRP A 1 141 ? 7.957   17.983  17.767 1.00 10.88 ? 141 TRP A CZ3 1 
ATOM   1078 C CH2 . TRP A 1 141 ? 6.567   17.738  17.835 1.00 12.75 ? 141 TRP A CH2 1 
ATOM   1079 N N   . GLU A 1 142 ? 12.638  16.228  12.641 1.00 13.22 ? 142 GLU A N   1 
ATOM   1080 C CA  . GLU A 1 142 ? 14.060  15.934  12.542 1.00 13.35 ? 142 GLU A CA  1 
ATOM   1081 C C   . GLU A 1 142 ? 14.843  17.237  12.758 1.00 20.94 ? 142 GLU A C   1 
ATOM   1082 O O   . GLU A 1 142 ? 15.937  17.212  13.326 1.00 15.68 ? 142 GLU A O   1 
ATOM   1083 C CB  . GLU A 1 142 ? 14.427  15.288  11.214 1.00 17.46 ? 142 GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 142 ? 13.905  13.914  10.853 1.00 22.49 ? 142 GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 142 ? 14.522  12.759  11.612 1.00 18.22 ? 142 GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 142 ? 15.699  12.809  12.045 1.00 23.10 ? 142 GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 142 ? 13.826  11.744  11.824 1.00 14.91 ? 142 GLU A OE2 1 
ATOM   1088 N N   . THR A 1 143 ? 14.353  18.415  12.352 1.00 15.83 ? 143 THR A N   1 
ATOM   1089 C CA  . THR A 1 143 ? 15.142  19.636  12.616 1.00 10.70 ? 143 THR A CA  1 
ATOM   1090 C C   . THR A 1 143 ? 15.191  19.932  14.104 1.00 15.03 ? 143 THR A C   1 
ATOM   1091 O O   . THR A 1 143 ? 16.246  20.258  14.665 1.00 16.69 ? 143 THR A O   1 
ATOM   1092 C CB  . THR A 1 143 ? 14.577  20.832  11.841 1.00 14.82 ? 143 THR A CB  1 
ATOM   1093 O OG1 . THR A 1 143 ? 14.696  20.547  10.434 1.00 29.37 ? 143 THR A OG1 1 
ATOM   1094 C CG2 . THR A 1 143 ? 15.383  22.091  12.100 1.00 23.05 ? 143 THR A CG2 1 
ATOM   1095 N N   . PHE A 1 144 ? 14.054  19.755  14.776 1.00 15.22 ? 144 PHE A N   1 
ATOM   1096 C CA  . PHE A 1 144 ? 13.963  19.909  16.219 1.00 16.31 ? 144 PHE A CA  1 
ATOM   1097 C C   . PHE A 1 144 ? 14.858  18.898  16.925 1.00 20.15 ? 144 PHE A C   1 
ATOM   1098 O O   . PHE A 1 144 ? 15.644  19.283  17.778 1.00 14.62 ? 144 PHE A O   1 
ATOM   1099 C CB  . PHE A 1 144 ? 12.519  19.731  16.710 1.00 10.69 ? 144 PHE A CB  1 
ATOM   1100 C CG  . PHE A 1 144 ? 12.376  19.720  18.212 1.00 10.30 ? 144 PHE A CG  1 
ATOM   1101 C CD1 . PHE A 1 144 ? 12.642  20.851  18.956 1.00 14.22 ? 144 PHE A CD1 1 
ATOM   1102 C CD2 . PHE A 1 144 ? 11.983  18.562  18.886 1.00 14.74 ? 144 PHE A CD2 1 
ATOM   1103 C CE1 . PHE A 1 144 ? 12.540  20.842  20.327 1.00 14.10 ? 144 PHE A CE1 1 
ATOM   1104 C CE2 . PHE A 1 144 ? 11.880  18.544  20.258 1.00 14.02 ? 144 PHE A CE2 1 
ATOM   1105 C CZ  . PHE A 1 144 ? 12.164  19.684  20.994 1.00 18.46 ? 144 PHE A CZ  1 
ATOM   1106 N N   . THR A 1 145 ? 14.767  17.608  16.579 1.00 14.39 ? 145 THR A N   1 
ATOM   1107 C CA  . THR A 1 145 ? 15.620  16.668  17.331 1.00 9.10  ? 145 THR A CA  1 
ATOM   1108 C C   . THR A 1 145 ? 17.079  16.769  16.893 1.00 15.57 ? 145 THR A C   1 
ATOM   1109 O O   . THR A 1 145 ? 17.945  16.372  17.692 1.00 10.70 ? 145 THR A O   1 
ATOM   1110 C CB  . THR A 1 145 ? 15.090  15.231  17.215 1.00 11.13 ? 145 THR A CB  1 
ATOM   1111 O OG1 . THR A 1 145 ? 15.026  14.849  15.851 1.00 12.66 ? 145 THR A OG1 1 
ATOM   1112 C CG2 . THR A 1 145 ? 13.645  15.159  17.737 1.00 13.06 ? 145 THR A CG2 1 
ATOM   1113 N N   . ASP A 1 146 ? 17.365  17.289  15.695 1.00 12.91 ? 146 ASP A N   1 
ATOM   1114 C CA  . ASP A 1 146 ? 18.748  17.628  15.366 1.00 13.13 ? 146 ASP A CA  1 
ATOM   1115 C C   . ASP A 1 146 ? 19.259  18.618  16.417 1.00 15.60 ? 146 ASP A C   1 
ATOM   1116 O O   . ASP A 1 146 ? 20.355  18.538  16.959 1.00 15.18 ? 146 ASP A O   1 
ATOM   1117 C CB  . ASP A 1 146 ? 18.922  18.263  13.996 1.00 14.48 ? 146 ASP A CB  1 
ATOM   1118 C CG  . ASP A 1 146 ? 18.947  17.281  12.844 1.00 16.63 ? 146 ASP A CG  1 
ATOM   1119 O OD1 . ASP A 1 146 ? 19.023  16.055  13.069 1.00 17.78 ? 146 ASP A OD1 1 
ATOM   1120 O OD2 . ASP A 1 146 ? 18.880  17.746  11.680 1.00 19.88 ? 146 ASP A OD2 1 
ATOM   1121 N N   . LYS A 1 147 ? 18.396  19.605  16.689 1.00 13.47 ? 147 LYS A N   1 
ATOM   1122 C CA  . LYS A 1 147 ? 18.839  20.643  17.609 1.00 14.13 ? 147 LYS A CA  1 
ATOM   1123 C C   . LYS A 1 147 ? 18.998  20.091  19.014 1.00 13.56 ? 147 LYS A C   1 
ATOM   1124 O O   . LYS A 1 147 ? 19.909  20.476  19.753 1.00 12.93 ? 147 LYS A O   1 
ATOM   1125 C CB  . LYS A 1 147 ? 17.849  21.805  17.604 1.00 15.78 ? 147 LYS A CB  1 
ATOM   1126 C CG  . LYS A 1 147 ? 18.196  22.933  18.578 1.00 20.13 ? 147 LYS A CG  1 
ATOM   1127 C CD  . LYS A 1 147 ? 19.451  23.668  18.124 1.00 15.98 ? 147 LYS A CD  1 
ATOM   1128 C CE  . LYS A 1 147 ? 19.552  25.026  18.810 1.00 26.31 ? 147 LYS A CE  1 
ATOM   1129 N NZ  . LYS A 1 147 ? 20.984  25.326  19.131 1.00 32.55 ? 147 LYS A NZ  1 
ATOM   1130 N N   . VAL A 1 148 ? 18.100  19.191  19.401 1.00 10.33 ? 148 VAL A N   1 
ATOM   1131 C CA  . VAL A 1 148 ? 18.179  18.588  20.721 1.00 12.33 ? 148 VAL A CA  1 
ATOM   1132 C C   . VAL A 1 148 ? 19.485  17.846  20.905 1.00 16.51 ? 148 VAL A C   1 
ATOM   1133 O O   . VAL A 1 148 ? 20.208  18.003  21.886 1.00 12.22 ? 148 VAL A O   1 
ATOM   1134 C CB  . VAL A 1 148 ? 16.972  17.638  20.926 1.00 9.34  ? 148 VAL A CB  1 
ATOM   1135 C CG1 . VAL A 1 148 ? 17.207  16.795  22.167 1.00 9.15  ? 148 VAL A CG1 1 
ATOM   1136 C CG2 . VAL A 1 148 ? 15.686  18.454  21.016 1.00 9.00  ? 148 VAL A CG2 1 
ATOM   1137 N N   . ILE A 1 149 ? 19.830  16.998  19.932 1.00 10.89 ? 149 ILE A N   1 
ATOM   1138 C CA  . ILE A 1 149 ? 21.072  16.226  20.040 1.00 16.38 ? 149 ILE A CA  1 
ATOM   1139 C C   . ILE A 1 149 ? 22.272  17.163  20.070 1.00 10.52 ? 149 ILE A C   1 
ATOM   1140 O O   . ILE A 1 149 ? 23.246  16.940  20.774 1.00 10.94 ? 149 ILE A O   1 
ATOM   1141 C CB  . ILE A 1 149 ? 21.111  15.252  18.843 1.00 12.50 ? 149 ILE A CB  1 
ATOM   1142 C CG1 . ILE A 1 149 ? 20.077  14.129  19.008 1.00 10.50 ? 149 ILE A CG1 1 
ATOM   1143 C CG2 . ILE A 1 149 ? 22.513  14.729  18.564 1.00 10.15 ? 149 ILE A CG2 1 
ATOM   1144 C CD1 . ILE A 1 149 ? 19.867  13.328  17.758 1.00 13.22 ? 149 ILE A CD1 1 
ATOM   1145 N N   . SER A 1 150 ? 22.207  18.256  19.308 1.00 7.35  ? 150 SER A N   1 
ATOM   1146 C CA  . SER A 1 150 ? 23.325  19.202  19.267 1.00 11.57 ? 150 SER A CA  1 
ATOM   1147 C C   . SER A 1 150 ? 23.518  19.876  20.614 1.00 16.88 ? 150 SER A C   1 
ATOM   1148 O O   . SER A 1 150 ? 24.639  20.102  21.097 1.00 13.68 ? 150 SER A O   1 
ATOM   1149 C CB  . SER A 1 150 ? 23.066  20.248  18.172 1.00 17.96 ? 150 SER A CB  1 
ATOM   1150 O OG  . SER A 1 150 ? 24.119  21.200  18.186 1.00 20.18 ? 150 SER A OG  1 
ATOM   1151 N N   . LEU A 1 151 ? 22.404  20.210  21.259 1.00 13.44 ? 151 LEU A N   1 
ATOM   1152 C CA  . LEU A 1 151 ? 22.512  20.849  22.578 1.00 12.44 ? 151 LEU A CA  1 
ATOM   1153 C C   . LEU A 1 151 ? 23.061  19.888  23.630 1.00 16.78 ? 151 LEU A C   1 
ATOM   1154 O O   . LEU A 1 151 ? 23.816  20.353  24.496 1.00 14.66 ? 151 LEU A O   1 
ATOM   1155 C CB  . LEU A 1 151 ? 21.144  21.376  23.029 1.00 20.70 ? 151 LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 151 ? 20.619  22.625  22.324 1.00 20.14 ? 151 LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 151 ? 19.111  22.743  22.464 1.00 10.95 ? 151 LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 151 ? 21.324  23.869  22.871 1.00 19.63 ? 151 LEU A CD2 1 
ATOM   1159 N N   . ILE A 1 152 ? 22.679  18.605  23.571 1.00 12.27 ? 152 ILE A N   1 
ATOM   1160 C CA  . ILE A 1 152 ? 23.175  17.627  24.545 1.00 12.10 ? 152 ILE A CA  1 
ATOM   1161 C C   . ILE A 1 152 ? 24.690  17.487  24.355 1.00 13.16 ? 152 ILE A C   1 
ATOM   1162 O O   . ILE A 1 152 ? 25.452  17.416  25.309 1.00 14.54 ? 152 ILE A O   1 
ATOM   1163 C CB  . ILE A 1 152 ? 22.543  16.233  24.440 1.00 12.86 ? 152 ILE A CB  1 
ATOM   1164 C CG1 . ILE A 1 152 ? 21.066  16.100  24.836 1.00 17.88 ? 152 ILE A CG1 1 
ATOM   1165 C CG2 . ILE A 1 152 ? 23.337  15.219  25.271 1.00 15.00 ? 152 ILE A CG2 1 
ATOM   1166 C CD1 . ILE A 1 152 ? 20.452  14.835  24.232 1.00 9.62  ? 152 ILE A CD1 1 
ATOM   1167 N N   . ASN A 1 153 ? 25.095  17.460  23.090 1.00 11.66 ? 153 ASN A N   1 
ATOM   1168 C CA  . ASN A 1 153 ? 26.486  17.354  22.691 1.00 13.21 ? 153 ASN A CA  1 
ATOM   1169 C C   . ASN A 1 153 ? 27.292  18.484  23.330 1.00 21.16 ? 153 ASN A C   1 
ATOM   1170 O O   . ASN A 1 153 ? 28.369  18.244  23.867 1.00 12.94 ? 153 ASN A O   1 
ATOM   1171 C CB  . ASN A 1 153 ? 26.646  17.418  21.174 1.00 18.00 ? 153 ASN A CB  1 
ATOM   1172 C CG  . ASN A 1 153 ? 28.093  17.184  20.771 1.00 15.12 ? 153 ASN A CG  1 
ATOM   1173 O OD1 . ASN A 1 153 ? 28.683  16.254  21.324 1.00 15.31 ? 153 ASN A OD1 1 
ATOM   1174 N ND2 . ASN A 1 153 ? 28.613  17.992  19.864 1.00 15.76 ? 153 ASN A ND2 1 
ATOM   1175 N N   . GLN A 1 154 ? 26.698  19.671  23.236 1.00 20.63 ? 154 GLN A N   1 
ATOM   1176 C CA  . GLN A 1 154 ? 27.308  20.883  23.723 1.00 18.08 ? 154 GLN A CA  1 
ATOM   1177 C C   . GLN A 1 154 ? 27.217  21.101  25.222 1.00 20.35 ? 154 GLN A C   1 
ATOM   1178 O O   . GLN A 1 154 ? 28.216  21.548  25.798 1.00 17.27 ? 154 GLN A O   1 
ATOM   1179 C CB  . GLN A 1 154 ? 26.626  22.104  23.063 1.00 16.99 ? 154 GLN A CB  1 
ATOM   1180 C CG  . GLN A 1 154 ? 26.774  22.056  21.555 1.00 27.74 ? 154 GLN A CG  1 
ATOM   1181 C CD  . GLN A 1 154 ? 26.162  23.294  20.915 1.00 29.85 ? 154 GLN A CD  1 
ATOM   1182 O OE1 . GLN A 1 154 ? 25.350  23.970  21.544 1.00 27.76 ? 154 GLN A OE1 1 
ATOM   1183 N NE2 . GLN A 1 154 ? 26.554  23.563  19.678 1.00 34.89 ? 154 GLN A NE2 1 
ATOM   1184 N N   . HIS A 1 155 ? 26.044  20.834  25.801 1.00 18.31 ? 155 HIS A N   1 
ATOM   1185 C CA  . HIS A 1 155 ? 25.858  21.284  27.182 1.00 19.53 ? 155 HIS A CA  1 
ATOM   1186 C C   . HIS A 1 155 ? 26.134  20.192  28.194 1.00 27.31 ? 155 HIS A C   1 
ATOM   1187 O O   . HIS A 1 155 ? 26.203  20.516  29.384 1.00 30.68 ? 155 HIS A O   1 
ATOM   1188 C CB  . HIS A 1 155 ? 24.456  21.876  27.385 1.00 20.52 ? 155 HIS A CB  1 
ATOM   1189 C CG  . HIS A 1 155 ? 24.364  23.281  26.871 1.00 25.96 ? 155 HIS A CG  1 
ATOM   1190 N ND1 . HIS A 1 155 ? 24.718  24.392  27.600 1.00 31.23 ? 155 HIS A ND1 1 
ATOM   1191 C CD2 . HIS A 1 155 ? 23.930  23.756  25.678 1.00 30.65 ? 155 HIS A CD2 1 
ATOM   1192 C CE1 . HIS A 1 155 ? 24.526  25.498  26.895 1.00 25.39 ? 155 HIS A CE1 1 
ATOM   1193 N NE2 . HIS A 1 155 ? 24.044  25.122  25.721 1.00 33.67 ? 155 HIS A NE2 1 
ATOM   1194 N N   . ARG A 1 156 ? 26.309  18.950  27.755 1.00 20.66 ? 156 ARG A N   1 
ATOM   1195 C CA  . ARG A 1 156 ? 26.650  17.874  28.677 1.00 19.77 ? 156 ARG A CA  1 
ATOM   1196 C C   . ARG A 1 156 ? 28.013  17.276  28.339 1.00 15.33 ? 156 ARG A C   1 
ATOM   1197 O O   . ARG A 1 156 ? 28.561  17.494  27.264 1.00 15.89 ? 156 ARG A O   1 
ATOM   1198 C CB  . ARG A 1 156 ? 25.561  16.788  28.661 1.00 16.36 ? 156 ARG A CB  1 
ATOM   1199 C CG  . ARG A 1 156 ? 24.281  17.322  29.320 1.00 25.09 ? 156 ARG A CG  1 
ATOM   1200 C CD  . ARG A 1 156 ? 24.551  17.486  30.832 1.00 26.70 ? 156 ARG A CD  1 
ATOM   1201 N NE  . ARG A 1 156 ? 23.973  16.344  31.524 1.00 29.72 ? 156 ARG A NE  1 
ATOM   1202 C CZ  . ARG A 1 156 ? 24.474  15.237  32.000 1.00 31.06 ? 156 ARG A CZ  1 
ATOM   1203 N NH1 . ARG A 1 156 ? 25.761  14.930  31.936 1.00 25.14 ? 156 ARG A NH1 1 
ATOM   1204 N NH2 . ARG A 1 156 ? 23.661  14.364  32.597 1.00 77.00 ? 156 ARG A NH2 1 
ATOM   1205 N N   . GLU A 1 157 ? 28.531  16.531  29.301 1.00 17.01 ? 157 GLU A N   1 
ATOM   1206 C CA  . GLU A 1 157 ? 29.777  15.807  29.301 1.00 21.31 ? 157 GLU A CA  1 
ATOM   1207 C C   . GLU A 1 157 ? 29.569  14.320  29.613 1.00 17.04 ? 157 GLU A C   1 
ATOM   1208 O O   . GLU A 1 157 ? 28.751  14.008  30.490 1.00 26.35 ? 157 GLU A O   1 
ATOM   1209 C CB  . GLU A 1 157 ? 30.711  16.404  30.368 1.00 23.59 ? 157 GLU A CB  1 
ATOM   1210 C CG  . GLU A 1 157 ? 31.080  17.844  30.040 1.00 31.94 ? 157 GLU A CG  1 
ATOM   1211 C CD  . GLU A 1 157 ? 31.938  17.887  28.784 1.00 34.48 ? 157 GLU A CD  1 
ATOM   1212 O OE1 . GLU A 1 157 ? 32.701  16.917  28.552 1.00 21.46 ? 157 GLU A OE1 1 
ATOM   1213 O OE2 . GLU A 1 157 ? 31.841  18.889  28.045 1.00 22.65 ? 157 GLU A OE2 1 
ATOM   1214 N N   . GLY A 1 158 ? 30.319  13.472  28.927 1.00 21.32 ? 158 GLY A N   1 
ATOM   1215 C CA  . GLY A 1 158 ? 30.353  12.050  29.214 1.00 22.54 ? 158 GLY A CA  1 
ATOM   1216 C C   . GLY A 1 158 ? 29.021  11.358  29.125 1.00 20.54 ? 158 GLY A C   1 
ATOM   1217 O O   . GLY A 1 158 ? 28.685  10.424  29.842 1.00 22.10 ? 158 GLY A O   1 
ATOM   1218 N N   . VAL A 1 159 ? 28.153  11.769  28.205 1.00 14.37 ? 159 VAL A N   1 
ATOM   1219 C CA  . VAL A 1 159 ? 26.917  11.020  28.010 1.00 15.18 ? 159 VAL A CA  1 
ATOM   1220 C C   . VAL A 1 159 ? 27.139  9.816   27.120 1.00 15.63 ? 159 VAL A C   1 
ATOM   1221 O O   . VAL A 1 159 ? 27.931  9.875   26.166 1.00 12.60 ? 159 VAL A O   1 
ATOM   1222 C CB  . VAL A 1 159 ? 25.910  12.002  27.378 1.00 15.27 ? 159 VAL A CB  1 
ATOM   1223 C CG1 . VAL A 1 159 ? 24.712  11.273  26.797 1.00 19.26 ? 159 VAL A CG1 1 
ATOM   1224 C CG2 . VAL A 1 159 ? 25.500  13.033  28.418 1.00 15.79 ? 159 VAL A CG2 1 
ATOM   1225 N N   . VAL A 1 160 ? 26.462  8.692   27.370 1.00 11.45 ? 160 VAL A N   1 
ATOM   1226 C CA  . VAL A 1 160 ? 26.625  7.574   26.444 1.00 11.69 ? 160 VAL A CA  1 
ATOM   1227 C C   . VAL A 1 160 ? 25.532  7.622   25.385 1.00 13.35 ? 160 VAL A C   1 
ATOM   1228 O O   . VAL A 1 160 ? 24.355  7.729   25.740 1.00 16.62 ? 160 VAL A O   1 
ATOM   1229 C CB  . VAL A 1 160 ? 26.461  6.235   27.183 1.00 15.68 ? 160 VAL A CB  1 
ATOM   1230 C CG1 . VAL A 1 160 ? 26.591  5.056   26.234 1.00 9.45  ? 160 VAL A CG1 1 
ATOM   1231 C CG2 . VAL A 1 160 ? 27.464  6.124   28.314 1.00 13.99 ? 160 VAL A CG2 1 
ATOM   1232 N N   . PHE A 1 161 ? 25.848  7.532   24.107 1.00 7.83  ? 161 PHE A N   1 
ATOM   1233 C CA  . PHE A 1 161 ? 24.814  7.501   23.076 1.00 12.24 ? 161 PHE A CA  1 
ATOM   1234 C C   . PHE A 1 161 ? 24.700  6.113   22.503 1.00 10.97 ? 161 PHE A C   1 
ATOM   1235 O O   . PHE A 1 161 ? 25.734  5.617   22.024 1.00 14.55 ? 161 PHE A O   1 
ATOM   1236 C CB  . PHE A 1 161 ? 25.216  8.483   21.963 1.00 10.12 ? 161 PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 161 ? 24.948  9.936   22.347 1.00 17.69 ? 161 PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 161 ? 25.880  10.652  23.076 1.00 15.77 ? 161 PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 161 ? 23.761  10.544  21.956 1.00 12.89 ? 161 PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 161 ? 25.622  11.979  23.404 1.00 18.76 ? 161 PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 161 ? 23.493  11.858  22.276 1.00 14.03 ? 161 PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 161 ? 24.438  12.569  22.999 1.00 16.96 ? 161 PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 162 ? 23.537  5.475   22.533 1.00 10.47 ? 162 LEU A N   1 
ATOM   1244 C CA  . LEU A 1 162 ? 23.410  4.178   21.859 1.00 7.88  ? 162 LEU A CA  1 
ATOM   1245 C C   . LEU A 1 162 ? 22.696  4.395   20.539 1.00 11.66 ? 162 LEU A C   1 
ATOM   1246 O O   . LEU A 1 162 ? 21.507  4.746   20.525 1.00 16.41 ? 162 LEU A O   1 
ATOM   1247 C CB  . LEU A 1 162 ? 22.682  3.146   22.711 1.00 11.36 ? 162 LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 162 ? 23.254  2.983   24.132 1.00 16.42 ? 162 LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 162 ? 22.542  1.883   24.906 1.00 11.38 ? 162 LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 162 ? 24.752  2.718   24.044 1.00 18.86 ? 162 LEU A CD2 1 
ATOM   1251 N N   . LEU A 1 163 ? 23.428  4.210   19.446 1.00 17.31 ? 163 LEU A N   1 
ATOM   1252 C CA  . LEU A 1 163 ? 22.987  4.501   18.075 1.00 15.47 ? 163 LEU A CA  1 
ATOM   1253 C C   . LEU A 1 163 ? 22.724  3.223   17.280 1.00 13.59 ? 163 LEU A C   1 
ATOM   1254 O O   . LEU A 1 163 ? 23.644  2.538   16.810 1.00 13.33 ? 163 LEU A O   1 
ATOM   1255 C CB  . LEU A 1 163 ? 24.014  5.374   17.323 1.00 10.00 ? 163 LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 163 ? 24.400  6.679   18.026 1.00 16.11 ? 163 LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 163 ? 25.236  7.553   17.110 1.00 14.92 ? 163 LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 163 ? 23.191  7.480   18.507 1.00 15.01 ? 163 LEU A CD2 1 
ATOM   1259 N N   . TRP A 1 164 ? 21.433  2.910   17.168 1.00 10.68 ? 164 TRP A N   1 
ATOM   1260 C CA  . TRP A 1 164 ? 20.935  1.649   16.654 1.00 8.85  ? 164 TRP A CA  1 
ATOM   1261 C C   . TRP A 1 164 ? 20.419  1.867   15.233 1.00 17.33 ? 164 TRP A C   1 
ATOM   1262 O O   . TRP A 1 164 ? 19.374  2.514   15.039 1.00 10.72 ? 164 TRP A O   1 
ATOM   1263 C CB  . TRP A 1 164 ? 19.862  1.104   17.594 1.00 10.93 ? 164 TRP A CB  1 
ATOM   1264 C CG  . TRP A 1 164 ? 20.363  0.723   18.967 1.00 15.97 ? 164 TRP A CG  1 
ATOM   1265 C CD1 . TRP A 1 164 ? 21.677  0.581   19.335 1.00 19.75 ? 164 TRP A CD1 1 
ATOM   1266 C CD2 . TRP A 1 164 ? 19.604  0.436   20.157 1.00 6.51  ? 164 TRP A CD2 1 
ATOM   1267 N NE1 . TRP A 1 164 ? 21.783  0.223   20.660 1.00 10.82 ? 164 TRP A NE1 1 
ATOM   1268 C CE2 . TRP A 1 164 ? 20.517  0.130   21.177 1.00 7.87  ? 164 TRP A CE2 1 
ATOM   1269 C CE3 . TRP A 1 164 ? 18.238  0.402   20.450 1.00 13.92 ? 164 TRP A CE3 1 
ATOM   1270 C CZ2 . TRP A 1 164 ? 20.139  -0.207  22.487 1.00 9.17  ? 164 TRP A CZ2 1 
ATOM   1271 C CZ3 . TRP A 1 164 ? 17.835  0.072   21.742 1.00 7.95  ? 164 TRP A CZ3 1 
ATOM   1272 C CH2 . TRP A 1 164 ? 18.778  -0.228  22.744 1.00 10.69 ? 164 TRP A CH2 1 
ATOM   1273 N N   . GLY A 1 165 ? 21.153  1.344   14.235 1.00 9.28  ? 165 GLY A N   1 
ATOM   1274 C CA  . GLY A 1 165 ? 20.630  1.512   12.869 1.00 12.28 ? 165 GLY A CA  1 
ATOM   1275 C C   . GLY A 1 165 ? 21.157  2.724   12.151 1.00 9.64  ? 165 GLY A C   1 
ATOM   1276 O O   . GLY A 1 165 ? 21.619  3.681   12.748 1.00 10.56 ? 165 GLY A O   1 
ATOM   1277 N N   . SER A 1 166 ? 21.119  2.751   10.799 1.00 14.59 ? 166 SER A N   1 
ATOM   1278 C CA  . SER A 1 166 ? 21.788  3.809   10.043 1.00 10.73 ? 166 SER A CA  1 
ATOM   1279 C C   . SER A 1 166 ? 21.262  5.209   10.287 1.00 8.28  ? 166 SER A C   1 
ATOM   1280 O O   . SER A 1 166 ? 22.027  6.173   10.393 1.00 13.46 ? 166 SER A O   1 
ATOM   1281 C CB  . SER A 1 166 ? 21.642  3.549   8.521  1.00 16.40 ? 166 SER A CB  1 
ATOM   1282 O OG  . SER A 1 166 ? 22.496  2.462   8.175  1.00 24.67 ? 166 SER A OG  1 
ATOM   1283 N N   . HIS A 1 167 ? 19.934  5.299   10.342 1.00 13.05 ? 167 HIS A N   1 
ATOM   1284 C CA  . HIS A 1 167 ? 19.319  6.611   10.587 1.00 14.50 ? 167 HIS A CA  1 
ATOM   1285 C C   . HIS A 1 167 ? 19.862  7.235   11.862 1.00 17.60 ? 167 HIS A C   1 
ATOM   1286 O O   . HIS A 1 167 ? 20.316  8.384   11.887 1.00 14.29 ? 167 HIS A O   1 
ATOM   1287 C CB  . HIS A 1 167 ? 17.800  6.445   10.645 1.00 21.16 ? 167 HIS A CB  1 
ATOM   1288 C CG  . HIS A 1 167 ? 17.105  7.756   10.857 1.00 21.20 ? 167 HIS A CG  1 
ATOM   1289 N ND1 . HIS A 1 167 ? 16.718  8.586   9.823  1.00 28.11 ? 167 HIS A ND1 1 
ATOM   1290 C CD2 . HIS A 1 167 ? 16.702  8.370   11.996 1.00 23.87 ? 167 HIS A CD2 1 
ATOM   1291 C CE1 . HIS A 1 167 ? 16.115  9.658   10.320 1.00 30.76 ? 167 HIS A CE1 1 
ATOM   1292 N NE2 . HIS A 1 167 ? 16.091  9.554   11.637 1.00 31.21 ? 167 HIS A NE2 1 
ATOM   1293 N N   . ALA A 1 168 ? 19.836  6.450   12.952 1.00 16.14 ? 168 ALA A N   1 
ATOM   1294 C CA  . ALA A 1 168 ? 20.296  7.008   14.237 1.00 9.31  ? 168 ALA A CA  1 
ATOM   1295 C C   . ALA A 1 168 ? 21.793  7.281   14.146 1.00 14.93 ? 168 ALA A C   1 
ATOM   1296 O O   . ALA A 1 168 ? 22.258  8.294   14.652 1.00 12.66 ? 168 ALA A O   1 
ATOM   1297 C CB  . ALA A 1 168 ? 19.964  6.094   15.396 1.00 10.72 ? 168 ALA A CB  1 
ATOM   1298 N N   . GLN A 1 169 ? 22.521  6.390   13.457 1.00 16.22 ? 169 GLN A N   1 
ATOM   1299 C CA  . GLN A 1 169 ? 23.971  6.631   13.369 1.00 18.24 ? 169 GLN A CA  1 
ATOM   1300 C C   . GLN A 1 169 ? 24.278  7.929   12.643 1.00 13.17 ? 169 GLN A C   1 
ATOM   1301 O O   . GLN A 1 169 ? 25.162  8.694   13.020 1.00 13.74 ? 169 GLN A O   1 
ATOM   1302 C CB  . GLN A 1 169 ? 24.614  5.401   12.725 1.00 16.50 ? 169 GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 169 ? 24.862  4.304   13.765 1.00 20.07 ? 169 GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 169 ? 24.967  2.931   13.124 1.00 18.30 ? 169 GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 169 ? 25.260  2.819   11.941 1.00 16.65 ? 169 GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 169 ? 24.756  1.875   13.887 1.00 18.80 ? 169 GLN A NE2 1 
ATOM   1307 N N   . LYS A 1 170 ? 23.544  8.262   11.585 1.00 15.28 ? 170 LYS A N   1 
ATOM   1308 C CA  . LYS A 1 170 ? 23.789  9.505   10.864 1.00 14.32 ? 170 LYS A CA  1 
ATOM   1309 C C   . LYS A 1 170 ? 23.457  10.696  11.742 1.00 14.12 ? 170 LYS A C   1 
ATOM   1310 O O   . LYS A 1 170 ? 24.152  11.712  11.806 1.00 17.91 ? 170 LYS A O   1 
ATOM   1311 C CB  . LYS A 1 170 ? 22.937  9.524   9.598  1.00 26.99 ? 170 LYS A CB  1 
ATOM   1312 C CG  . LYS A 1 170 ? 23.519  10.272  8.412  1.00 46.03 ? 170 LYS A CG  1 
ATOM   1313 C CD  . LYS A 1 170 ? 22.429  10.445  7.346  1.00 61.57 ? 170 LYS A CD  1 
ATOM   1314 C CE  . LYS A 1 170 ? 22.658  11.699  6.528  1.00 64.90 ? 170 LYS A CE  1 
ATOM   1315 N NZ  . LYS A 1 170 ? 22.159  12.929  7.246  1.00 84.60 ? 170 LYS A NZ  1 
ATOM   1316 N N   . LYS A 1 171 ? 22.327  10.524  12.426 1.00 19.50 ? 171 LYS A N   1 
ATOM   1317 C CA  . LYS A 1 171 ? 21.855  11.558  13.339 1.00 19.96 ? 171 LYS A CA  1 
ATOM   1318 C C   . LYS A 1 171 ? 22.921  11.910  14.356 1.00 20.01 ? 171 LYS A C   1 
ATOM   1319 O O   . LYS A 1 171 ? 23.069  13.016  14.859 1.00 19.56 ? 171 LYS A O   1 
ATOM   1320 C CB  . LYS A 1 171 ? 20.579  11.035  14.018 1.00 19.72 ? 171 LYS A CB  1 
ATOM   1321 C CG  . LYS A 1 171 ? 19.777  12.139  14.683 1.00 29.17 ? 171 LYS A CG  1 
ATOM   1322 C CD  . LYS A 1 171 ? 18.775  12.766  13.709 1.00 28.45 ? 171 LYS A CD  1 
ATOM   1323 C CE  . LYS A 1 171 ? 17.818  13.626  14.529 1.00 21.70 ? 171 LYS A CE  1 
ATOM   1324 N NZ  . LYS A 1 171 ? 17.088  14.624  13.715 1.00 18.41 ? 171 LYS A NZ  1 
ATOM   1325 N N   . GLY A 1 172 ? 23.749  10.917  14.717 1.00 19.63 ? 172 GLY A N   1 
ATOM   1326 C CA  . GLY A 1 172 ? 24.649  11.178  15.828 1.00 17.32 ? 172 GLY A CA  1 
ATOM   1327 C C   . GLY A 1 172 ? 26.067  11.409  15.357 1.00 27.06 ? 172 GLY A C   1 
ATOM   1328 O O   . GLY A 1 172 ? 26.992  11.450  16.167 1.00 20.83 ? 172 GLY A O   1 
ATOM   1329 N N   . ALA A 1 173 ? 26.228  11.569  14.047 1.00 18.35 ? 173 ALA A N   1 
ATOM   1330 C CA  . ALA A 1 173 ? 27.545  11.860  13.484 1.00 22.21 ? 173 ALA A CA  1 
ATOM   1331 C C   . ALA A 1 173 ? 28.252  13.066  14.077 1.00 23.76 ? 173 ALA A C   1 
ATOM   1332 O O   . ALA A 1 173 ? 29.481  13.068  14.164 1.00 26.69 ? 173 ALA A O   1 
ATOM   1333 C CB  . ALA A 1 173 ? 27.384  12.067  11.973 1.00 45.59 ? 173 ALA A CB  1 
ATOM   1334 N N   . ILE A 1 174 ? 27.546  14.114  14.467 1.00 21.80 ? 174 ILE A N   1 
ATOM   1335 C CA  . ILE A 1 174 ? 28.074  15.363  14.988 1.00 24.53 ? 174 ILE A CA  1 
ATOM   1336 C C   . ILE A 1 174 ? 28.601  15.231  16.418 1.00 19.84 ? 174 ILE A C   1 
ATOM   1337 O O   . ILE A 1 174 ? 29.298  16.115  16.918 1.00 22.88 ? 174 ILE A O   1 
ATOM   1338 C CB  . ILE A 1 174 ? 27.000  16.475  15.074 1.00 24.22 ? 174 ILE A CB  1 
ATOM   1339 C CG1 . ILE A 1 174 ? 25.830  16.062  15.968 1.00 33.71 ? 174 ILE A CG1 1 
ATOM   1340 C CG2 . ILE A 1 174 ? 26.516  16.926  13.714 1.00 43.09 ? 174 ILE A CG2 1 
ATOM   1341 C CD1 . ILE A 1 174 ? 25.423  17.098  16.986 1.00 34.57 ? 174 ILE A CD1 1 
ATOM   1342 N N   . ILE A 1 175 ? 28.247  14.148  17.096 1.00 18.07 ? 175 ILE A N   1 
ATOM   1343 C CA  . ILE A 1 175 ? 28.598  14.044  18.506 1.00 13.01 ? 175 ILE A CA  1 
ATOM   1344 C C   . ILE A 1 175 ? 30.088  13.811  18.650 1.00 14.55 ? 175 ILE A C   1 
ATOM   1345 O O   . ILE A 1 175 ? 30.666  12.972  17.963 1.00 17.08 ? 175 ILE A O   1 
ATOM   1346 C CB  . ILE A 1 175 ? 27.842  12.890  19.176 1.00 13.93 ? 175 ILE A CB  1 
ATOM   1347 C CG1 . ILE A 1 175 ? 26.335  13.184  19.353 1.00 14.35 ? 175 ILE A CG1 1 
ATOM   1348 C CG2 . ILE A 1 175 ? 28.449  12.464  20.503 1.00 16.73 ? 175 ILE A CG2 1 
ATOM   1349 C CD1 . ILE A 1 175 ? 25.536  11.900  19.236 1.00 10.84 ? 175 ILE A CD1 1 
ATOM   1350 N N   . ASP A 1 176 ? 30.644  14.580  19.561 1.00 17.71 ? 176 ASP A N   1 
ATOM   1351 C CA  . ASP A 1 176 ? 32.012  14.560  20.007 1.00 13.69 ? 176 ASP A CA  1 
ATOM   1352 C C   . ASP A 1 176 ? 32.344  13.203  20.618 1.00 20.83 ? 176 ASP A C   1 
ATOM   1353 O O   . ASP A 1 176 ? 31.867  12.841  21.695 1.00 14.41 ? 176 ASP A O   1 
ATOM   1354 C CB  . ASP A 1 176 ? 32.161  15.708  21.008 1.00 15.04 ? 176 ASP A CB  1 
ATOM   1355 C CG  . ASP A 1 176 ? 33.593  15.964  21.418 1.00 16.83 ? 176 ASP A CG  1 
ATOM   1356 O OD1 . ASP A 1 176 ? 34.429  15.047  21.259 1.00 24.52 ? 176 ASP A OD1 1 
ATOM   1357 O OD2 . ASP A 1 176 ? 33.877  17.079  21.896 1.00 36.03 ? 176 ASP A OD2 1 
ATOM   1358 N N   . LYS A 1 177 ? 33.165  12.395  19.960 1.00 15.19 ? 177 LYS A N   1 
ATOM   1359 C CA  . LYS A 1 177 ? 33.362  11.020  20.408 1.00 25.32 ? 177 LYS A CA  1 
ATOM   1360 C C   . LYS A 1 177 ? 34.441  10.959  21.479 1.00 23.00 ? 177 LYS A C   1 
ATOM   1361 O O   . LYS A 1 177 ? 34.784  9.871   21.960 1.00 16.61 ? 177 LYS A O   1 
ATOM   1362 C CB  . LYS A 1 177 ? 33.717  10.103  19.236 1.00 28.30 ? 177 LYS A CB  1 
ATOM   1363 C CG  . LYS A 1 177 ? 32.501  9.397   18.647 1.00 36.52 ? 177 LYS A CG  1 
ATOM   1364 C CD  . LYS A 1 177 ? 32.765  8.764   17.295 1.00 38.70 ? 177 LYS A CD  1 
ATOM   1365 C CE  . LYS A 1 177 ? 33.036  9.812   16.222 1.00 49.97 ? 177 LYS A CE  1 
ATOM   1366 N NZ  . LYS A 1 177 ? 31.798  10.342  15.586 1.00 81.56 ? 177 LYS A NZ  1 
ATOM   1367 N N   . GLN A 1 178 ? 34.928  12.149  21.821 1.00 17.79 ? 178 GLN A N   1 
ATOM   1368 C CA  . GLN A 1 178 ? 35.971  12.240  22.841 1.00 23.73 ? 178 GLN A CA  1 
ATOM   1369 C C   . GLN A 1 178 ? 35.375  12.717  24.164 1.00 29.69 ? 178 GLN A C   1 
ATOM   1370 O O   . GLN A 1 178 ? 35.804  12.330  25.252 1.00 37.26 ? 178 GLN A O   1 
ATOM   1371 C CB  . GLN A 1 178 ? 37.102  13.168  22.394 1.00 39.23 ? 178 GLN A CB  1 
ATOM   1372 C CG  . GLN A 1 178 ? 37.411  13.142  20.906 1.00 55.80 ? 178 GLN A CG  1 
ATOM   1373 C CD  . GLN A 1 178 ? 36.873  14.321  20.125 1.00 57.47 ? 178 GLN A CD  1 
ATOM   1374 O OE1 . GLN A 1 178 ? 37.385  15.439  20.243 1.00 39.05 ? 178 GLN A OE1 1 
ATOM   1375 N NE2 . GLN A 1 178 ? 35.851  14.137  19.294 1.00 53.26 ? 178 GLN A NE2 1 
ATOM   1376 N N   . ARG A 1 179 ? 34.379  13.577  24.040 1.00 16.99 ? 179 ARG A N   1 
ATOM   1377 C CA  . ARG A 1 179 ? 33.679  14.163  25.172 1.00 15.00 ? 179 ARG A CA  1 
ATOM   1378 C C   . ARG A 1 179 ? 32.530  13.266  25.614 1.00 21.50 ? 179 ARG A C   1 
ATOM   1379 O O   . ARG A 1 179 ? 32.148  13.246  26.787 1.00 15.81 ? 179 ARG A O   1 
ATOM   1380 C CB  . ARG A 1 179 ? 33.223  15.582  24.797 1.00 17.90 ? 179 ARG A CB  1 
ATOM   1381 C CG  . ARG A 1 179 ? 34.283  16.625  25.161 1.00 19.06 ? 179 ARG A CG  1 
ATOM   1382 C CD  . ARG A 1 179 ? 33.857  18.025  24.789 1.00 28.97 ? 179 ARG A CD  1 
ATOM   1383 N NE  . ARG A 1 179 ? 32.706  18.482  25.569 1.00 32.04 ? 179 ARG A NE  1 
ATOM   1384 C CZ  . ARG A 1 179 ? 31.465  18.575  25.099 1.00 41.17 ? 179 ARG A CZ  1 
ATOM   1385 N NH1 . ARG A 1 179 ? 31.171  18.247  23.842 1.00 29.22 ? 179 ARG A NH1 1 
ATOM   1386 N NH2 . ARG A 1 179 ? 30.521  19.007  25.930 1.00 29.92 ? 179 ARG A NH2 1 
ATOM   1387 N N   . HIS A 1 180 ? 31.981  12.522  24.658 1.00 26.69 ? 180 HIS A N   1 
ATOM   1388 C CA  . HIS A 1 180 ? 30.882  11.601  24.962 1.00 17.57 ? 180 HIS A CA  1 
ATOM   1389 C C   . HIS A 1 180 ? 31.272  10.195  24.554 1.00 18.46 ? 180 HIS A C   1 
ATOM   1390 O O   . HIS A 1 180 ? 32.305  9.955   23.934 1.00 16.11 ? 180 HIS A O   1 
ATOM   1391 C CB  . HIS A 1 180 ? 29.590  12.033  24.263 1.00 13.42 ? 180 HIS A CB  1 
ATOM   1392 C CG  . HIS A 1 180 ? 29.111  13.364  24.763 1.00 13.05 ? 180 HIS A CG  1 
ATOM   1393 N ND1 . HIS A 1 180 ? 29.260  14.554  24.081 1.00 14.45 ? 180 HIS A ND1 1 
ATOM   1394 C CD2 . HIS A 1 180 ? 28.476  13.669  25.916 1.00 12.29 ? 180 HIS A CD2 1 
ATOM   1395 C CE1 . HIS A 1 180 ? 28.731  15.533  24.791 1.00 13.93 ? 180 HIS A CE1 1 
ATOM   1396 N NE2 . HIS A 1 180 ? 28.243  15.034  25.920 1.00 21.45 ? 180 HIS A NE2 1 
ATOM   1397 N N   . HIS A 1 181 ? 30.428  9.231   24.903 1.00 21.07 ? 181 HIS A N   1 
ATOM   1398 C CA  . HIS A 1 181 ? 30.763  7.846   24.554 1.00 18.08 ? 181 HIS A CA  1 
ATOM   1399 C C   . HIS A 1 181 ? 29.749  7.317   23.551 1.00 12.38 ? 181 HIS A C   1 
ATOM   1400 O O   . HIS A 1 181 ? 28.606  7.148   24.007 1.00 14.60 ? 181 HIS A O   1 
ATOM   1401 C CB  . HIS A 1 181 ? 30.747  6.992   25.821 1.00 18.28 ? 181 HIS A CB  1 
ATOM   1402 C CG  . HIS A 1 181 ? 31.428  5.681   25.605 1.00 29.67 ? 181 HIS A CG  1 
ATOM   1403 N ND1 . HIS A 1 181 ? 32.737  5.579   25.191 1.00 33.57 ? 181 HIS A ND1 1 
ATOM   1404 C CD2 . HIS A 1 181 ? 30.962  4.421   25.763 1.00 21.42 ? 181 HIS A CD2 1 
ATOM   1405 C CE1 . HIS A 1 181 ? 33.052  4.292   25.094 1.00 31.94 ? 181 HIS A CE1 1 
ATOM   1406 N NE2 . HIS A 1 181 ? 31.998  3.570   25.436 1.00 33.40 ? 181 HIS A NE2 1 
ATOM   1407 N N   . VAL A 1 182 ? 30.109  7.080   22.307 1.00 16.82 ? 182 VAL A N   1 
ATOM   1408 C CA  . VAL A 1 182 ? 29.161  6.674   21.264 1.00 18.04 ? 182 VAL A CA  1 
ATOM   1409 C C   . VAL A 1 182 ? 29.299  5.205   20.878 1.00 17.81 ? 182 VAL A C   1 
ATOM   1410 O O   . VAL A 1 182 ? 30.370  4.756   20.476 1.00 17.06 ? 182 VAL A O   1 
ATOM   1411 C CB  . VAL A 1 182 ? 29.340  7.541   19.999 1.00 12.62 ? 182 VAL A CB  1 
ATOM   1412 C CG1 . VAL A 1 182 ? 28.349  7.136   18.915 1.00 16.37 ? 182 VAL A CG1 1 
ATOM   1413 C CG2 . VAL A 1 182 ? 29.198  9.019   20.348 1.00 23.25 ? 182 VAL A CG2 1 
ATOM   1414 N N   . LEU A 1 183 ? 28.226  4.425   20.993 1.00 12.29 ? 183 LEU A N   1 
ATOM   1415 C CA  . LEU A 1 183 ? 28.247  3.011   20.648 1.00 12.23 ? 183 LEU A CA  1 
ATOM   1416 C C   . LEU A 1 183 ? 27.298  2.745   19.481 1.00 17.29 ? 183 LEU A C   1 
ATOM   1417 O O   . LEU A 1 183 ? 26.155  3.221   19.506 1.00 14.33 ? 183 LEU A O   1 
ATOM   1418 C CB  . LEU A 1 183 ? 27.890  2.157   21.868 1.00 10.77 ? 183 LEU A CB  1 
ATOM   1419 C CG  . LEU A 1 183 ? 28.858  2.332   23.049 1.00 14.15 ? 183 LEU A CG  1 
ATOM   1420 C CD1 . LEU A 1 183 ? 28.344  1.646   24.301 1.00 11.75 ? 183 LEU A CD1 1 
ATOM   1421 C CD2 . LEU A 1 183 ? 30.231  1.772   22.703 1.00 18.30 ? 183 LEU A CD2 1 
ATOM   1422 N N   . LYS A 1 184 ? 27.758  1.995   18.477 1.00 13.62 ? 184 LYS A N   1 
ATOM   1423 C CA  . LYS A 1 184 ? 26.911  1.706   17.329 1.00 15.41 ? 184 LYS A CA  1 
ATOM   1424 C C   . LYS A 1 184 ? 26.558  0.231   17.171 1.00 11.12 ? 184 LYS A C   1 
ATOM   1425 O O   . LYS A 1 184 ? 27.402  -0.626  17.436 1.00 13.41 ? 184 LYS A O   1 
ATOM   1426 C CB  . LYS A 1 184 ? 27.622  2.158   16.042 1.00 13.78 ? 184 LYS A CB  1 
ATOM   1427 C CG  . LYS A 1 184 ? 27.989  3.651   16.157 1.00 16.28 ? 184 LYS A CG  1 
ATOM   1428 C CD  . LYS A 1 184 ? 28.733  4.021   14.871 1.00 22.07 ? 184 LYS A CD  1 
ATOM   1429 C CE  . LYS A 1 184 ? 30.083  3.313   14.788 1.00 39.24 ? 184 LYS A CE  1 
ATOM   1430 N NZ  . LYS A 1 184 ? 31.215  4.245   15.095 1.00 76.16 ? 184 LYS A NZ  1 
ATOM   1431 N N   . ALA A 1 185 ? 25.338  -0.017  16.731 1.00 12.75 ? 185 ALA A N   1 
ATOM   1432 C CA  . ALA A 1 185 ? 24.920  -1.374  16.354 1.00 11.94 ? 185 ALA A CA  1 
ATOM   1433 C C   . ALA A 1 185 ? 23.782  -1.320  15.350 1.00 13.19 ? 185 ALA A C   1 
ATOM   1434 O O   . ALA A 1 185 ? 23.089  -0.314  15.210 1.00 15.15 ? 185 ALA A O   1 
ATOM   1435 C CB  . ALA A 1 185 ? 24.506  -2.172  17.588 1.00 14.16 ? 185 ALA A CB  1 
ATOM   1436 N N   . PRO A 1 186 ? 23.549  -2.382  14.610 1.00 15.17 ? 186 PRO A N   1 
ATOM   1437 C CA  . PRO A 1 186 ? 22.313  -2.500  13.819 1.00 17.24 ? 186 PRO A CA  1 
ATOM   1438 C C   . PRO A 1 186 ? 21.074  -2.393  14.704 1.00 15.97 ? 186 PRO A C   1 
ATOM   1439 O O   . PRO A 1 186 ? 21.120  -2.611  15.920 1.00 15.03 ? 186 PRO A O   1 
ATOM   1440 C CB  . PRO A 1 186 ? 22.446  -3.905  13.226 1.00 13.67 ? 186 PRO A CB  1 
ATOM   1441 C CG  . PRO A 1 186 ? 23.938  -4.058  13.096 1.00 22.06 ? 186 PRO A CG  1 
ATOM   1442 C CD  . PRO A 1 186 ? 24.459  -3.536  14.428 1.00 17.35 ? 186 PRO A CD  1 
ATOM   1443 N N   . HIS A 1 187 ? 19.926  -2.040  14.158 1.00 17.62 ? 187 HIS A N   1 
ATOM   1444 C CA  . HIS A 1 187 ? 18.668  -1.809  14.868 1.00 13.75 ? 187 HIS A CA  1 
ATOM   1445 C C   . HIS A 1 187 ? 18.092  -3.085  15.454 1.00 10.45 ? 187 HIS A C   1 
ATOM   1446 O O   . HIS A 1 187 ? 18.238  -4.196  14.903 1.00 15.28 ? 187 HIS A O   1 
ATOM   1447 C CB  . HIS A 1 187 ? 17.720  -1.131  13.861 1.00 13.77 ? 187 HIS A CB  1 
ATOM   1448 C CG  . HIS A 1 187 ? 16.486  -0.572  14.488 1.00 8.12  ? 187 HIS A CG  1 
ATOM   1449 N ND1 . HIS A 1 187 ? 15.444  -1.404  14.841 1.00 18.59 ? 187 HIS A ND1 1 
ATOM   1450 C CD2 . HIS A 1 187 ? 16.111  0.674   14.844 1.00 11.03 ? 187 HIS A CD2 1 
ATOM   1451 C CE1 . HIS A 1 187 ? 14.480  -0.677  15.387 1.00 18.86 ? 187 HIS A CE1 1 
ATOM   1452 N NE2 . HIS A 1 187 ? 14.863  0.588   15.396 1.00 16.44 ? 187 HIS A NE2 1 
ATOM   1453 N N   . PRO A 1 188 ? 17.428  -3.046  16.614 1.00 9.80  ? 188 PRO A N   1 
ATOM   1454 C CA  . PRO A 1 188 ? 16.865  -4.250  17.237 1.00 9.16  ? 188 PRO A CA  1 
ATOM   1455 C C   . PRO A 1 188 ? 15.605  -4.803  16.599 1.00 15.73 ? 188 PRO A C   1 
ATOM   1456 O O   . PRO A 1 188 ? 15.035  -5.800  17.061 1.00 15.06 ? 188 PRO A O   1 
ATOM   1457 C CB  . PRO A 1 188 ? 16.504  -3.739  18.639 1.00 11.08 ? 188 PRO A CB  1 
ATOM   1458 C CG  . PRO A 1 188 ? 16.080  -2.329  18.342 1.00 14.03 ? 188 PRO A CG  1 
ATOM   1459 C CD  . PRO A 1 188 ? 17.200  -1.841  17.448 1.00 13.52 ? 188 PRO A CD  1 
ATOM   1460 N N   . SER A 1 189 ? 15.157  -4.165  15.505 1.00 14.40 ? 189 SER A N   1 
ATOM   1461 C CA  . SER A 1 189 ? 13.901  -4.706  14.946 1.00 14.12 ? 189 SER A CA  1 
ATOM   1462 C C   . SER A 1 189 ? 14.193  -6.052  14.317 1.00 9.29  ? 189 SER A C   1 
ATOM   1463 O O   . SER A 1 189 ? 15.340  -6.329  13.974 1.00 13.95 ? 189 SER A O   1 
ATOM   1464 C CB  . SER A 1 189 ? 13.288  -3.704  13.974 1.00 24.56 ? 189 SER A CB  1 
ATOM   1465 O OG  . SER A 1 189 ? 13.378  -4.186  12.641 1.00 42.98 ? 189 SER A OG  1 
ATOM   1466 N N   . PRO A 1 190 ? 13.192  -6.910  14.200 1.00 16.92 ? 190 PRO A N   1 
ATOM   1467 C CA  . PRO A 1 190 ? 13.403  -8.254  13.642 1.00 20.47 ? 190 PRO A CA  1 
ATOM   1468 C C   . PRO A 1 190 ? 14.171  -8.261  12.326 1.00 21.41 ? 190 PRO A C   1 
ATOM   1469 O O   . PRO A 1 190 ? 14.885  -9.247  12.096 1.00 20.85 ? 190 PRO A O   1 
ATOM   1470 C CB  . PRO A 1 190 ? 11.973  -8.758  13.411 1.00 20.33 ? 190 PRO A CB  1 
ATOM   1471 C CG  . PRO A 1 190 ? 11.228  -8.102  14.537 1.00 23.62 ? 190 PRO A CG  1 
ATOM   1472 C CD  . PRO A 1 190 ? 11.788  -6.698  14.606 1.00 17.35 ? 190 PRO A CD  1 
ATOM   1473 N N   . LEU A 1 191 ? 14.061  -7.233  11.499 1.00 20.43 ? 191 LEU A N   1 
ATOM   1474 C CA  . LEU A 1 191 ? 14.702  -7.181  10.188 1.00 30.40 ? 191 LEU A CA  1 
ATOM   1475 C C   . LEU A 1 191 ? 16.229  -7.135  10.240 1.00 24.20 ? 191 LEU A C   1 
ATOM   1476 O O   . LEU A 1 191 ? 16.932  -7.551  9.314  1.00 17.24 ? 191 LEU A O   1 
ATOM   1477 C CB  . LEU A 1 191 ? 14.177  -5.953  9.436  1.00 34.31 ? 191 LEU A CB  1 
ATOM   1478 C CG  . LEU A 1 191 ? 12.660  -5.858  9.271  1.00 45.41 ? 191 LEU A CG  1 
ATOM   1479 C CD1 . LEU A 1 191 ? 12.250  -4.418  8.992  1.00 61.31 ? 191 LEU A CD1 1 
ATOM   1480 C CD2 . LEU A 1 191 ? 12.170  -6.772  8.161  1.00 27.86 ? 191 LEU A CD2 1 
ATOM   1481 N N   . SER A 1 192 ? 16.788  -6.627  11.333 1.00 17.37 ? 192 SER A N   1 
ATOM   1482 C CA  . SER A 1 192 ? 18.221  -6.406  11.454 1.00 20.36 ? 192 SER A CA  1 
ATOM   1483 C C   . SER A 1 192 ? 18.800  -6.911  12.763 1.00 12.80 ? 192 SER A C   1 
ATOM   1484 O O   . SER A 1 192 ? 20.025  -6.906  12.943 1.00 11.95 ? 192 SER A O   1 
ATOM   1485 C CB  . SER A 1 192 ? 18.512  -4.894  11.355 1.00 25.23 ? 192 SER A CB  1 
ATOM   1486 O OG  . SER A 1 192 ? 17.670  -4.204  12.286 1.00 26.10 ? 192 SER A OG  1 
ATOM   1487 N N   . ALA A 1 193 ? 17.949  -7.323  13.722 1.00 10.37 ? 193 ALA A N   1 
ATOM   1488 C CA  . ALA A 1 193 ? 18.557  -7.639  15.020 1.00 14.55 ? 193 ALA A CA  1 
ATOM   1489 C C   . ALA A 1 193 ? 19.587  -8.778  14.971 1.00 15.10 ? 193 ALA A C   1 
ATOM   1490 O O   . ALA A 1 193 ? 20.600  -8.763  15.678 1.00 13.23 ? 193 ALA A O   1 
ATOM   1491 C CB  . ALA A 1 193 ? 17.503  -7.968  16.063 1.00 6.94  ? 193 ALA A CB  1 
ATOM   1492 N N   . HIS A 1 194 ? 19.400  -9.804  14.171 1.00 9.58  ? 194 HIS A N   1 
ATOM   1493 C CA  . HIS A 1 194 ? 20.347  -10.914 14.139 1.00 16.68 ? 194 HIS A CA  1 
ATOM   1494 C C   . HIS A 1 194 ? 21.584  -10.643 13.280 1.00 12.25 ? 194 HIS A C   1 
ATOM   1495 O O   . HIS A 1 194 ? 22.391  -11.560 13.125 1.00 11.36 ? 194 HIS A O   1 
ATOM   1496 C CB  . HIS A 1 194 ? 19.668  -12.153 13.551 1.00 14.61 ? 194 HIS A CB  1 
ATOM   1497 C CG  . HIS A 1 194 ? 18.746  -12.808 14.515 1.00 30.01 ? 194 HIS A CG  1 
ATOM   1498 N ND1 . HIS A 1 194 ? 19.168  -13.793 15.383 1.00 31.48 ? 194 HIS A ND1 1 
ATOM   1499 C CD2 . HIS A 1 194 ? 17.419  -12.621 14.742 1.00 44.45 ? 194 HIS A CD2 1 
ATOM   1500 C CE1 . HIS A 1 194 ? 18.133  -14.186 16.115 1.00 41.20 ? 194 HIS A CE1 1 
ATOM   1501 N NE2 . HIS A 1 194 ? 17.066  -13.492 15.750 1.00 47.83 ? 194 HIS A NE2 1 
ATOM   1502 N N   . ARG A 1 195 ? 21.681  -9.449  12.741 1.00 12.76 ? 195 ARG A N   1 
ATOM   1503 C CA  . ARG A 1 195 ? 22.804  -8.986  11.940 1.00 20.34 ? 195 ARG A CA  1 
ATOM   1504 C C   . ARG A 1 195 ? 23.639  -7.950  12.685 1.00 16.17 ? 195 ARG A C   1 
ATOM   1505 O O   . ARG A 1 195 ? 24.117  -6.993  12.072 1.00 21.90 ? 195 ARG A O   1 
ATOM   1506 C CB  . ARG A 1 195 ? 22.319  -8.377  10.614 1.00 21.37 ? 195 ARG A CB  1 
ATOM   1507 C CG  . ARG A 1 195 ? 21.361  -9.324  9.904  1.00 48.14 ? 195 ARG A CG  1 
ATOM   1508 C CD  . ARG A 1 195 ? 20.753  -8.730  8.649  1.00 59.51 ? 195 ARG A CD  1 
ATOM   1509 N NE  . ARG A 1 195 ? 21.677  -7.844  7.960  1.00 71.36 ? 195 ARG A NE  1 
ATOM   1510 C CZ  . ARG A 1 195 ? 21.314  -7.220  6.839  1.00 79.90 ? 195 ARG A CZ  1 
ATOM   1511 N NH1 . ARG A 1 195 ? 20.088  -7.419  6.380  1.00 94.73 ? 195 ARG A NH1 1 
ATOM   1512 N NH2 . ARG A 1 195 ? 22.164  -6.422  6.214  1.00 90.21 ? 195 ARG A NH2 1 
ATOM   1513 N N   . GLY A 1 196 ? 23.790  -8.160  13.989 1.00 16.18 ? 196 GLY A N   1 
ATOM   1514 C CA  . GLY A 1 196 ? 24.654  -7.398  14.831 1.00 14.53 ? 196 GLY A CA  1 
ATOM   1515 C C   . GLY A 1 196 ? 24.037  -6.712  16.030 1.00 11.88 ? 196 GLY A C   1 
ATOM   1516 O O   . GLY A 1 196 ? 24.791  -6.164  16.839 1.00 13.82 ? 196 GLY A O   1 
ATOM   1517 N N   . PHE A 1 197 ? 22.714  -6.668  16.164 1.00 14.42 ? 197 PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 22.179  -6.084  17.391 1.00 11.89 ? 197 PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 22.526  -7.050  18.524 1.00 12.88 ? 197 PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 23.039  -6.730  19.593 1.00 12.10 ? 197 PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 20.668  -5.791  17.316 1.00 11.02 ? 197 PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 20.180  -5.337  18.717 1.00 10.15 ? 197 PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 20.385  -4.024  19.093 1.00 7.44  ? 197 PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 19.549  -6.191  19.599 1.00 13.04 ? 197 PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 19.984  -3.554  20.335 1.00 7.75  ? 197 PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 19.152  -5.753  20.862 1.00 16.13 ? 197 PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 19.362  -4.437  21.209 1.00 7.63  ? 197 PHE A CZ  1 
ATOM   1528 N N   . PHE A 1 198 ? 22.201  -8.324  18.302 1.00 13.52 ? 198 PHE A N   1 
ATOM   1529 C CA  . PHE A 1 198 ? 22.564  -9.371  19.251 1.00 14.65 ? 198 PHE A CA  1 
ATOM   1530 C C   . PHE A 1 198 ? 24.082  -9.528  19.258 1.00 16.20 ? 198 PHE A C   1 
ATOM   1531 O O   . PHE A 1 198 ? 24.688  -9.731  18.198 1.00 16.48 ? 198 PHE A O   1 
ATOM   1532 C CB  . PHE A 1 198 ? 21.885  -10.698 18.913 1.00 14.68 ? 198 PHE A CB  1 
ATOM   1533 C CG  . PHE A 1 198 ? 20.364  -10.640 18.993 1.00 16.99 ? 198 PHE A CG  1 
ATOM   1534 C CD1 . PHE A 1 198 ? 19.745  -10.002 20.063 1.00 14.61 ? 198 PHE A CD1 1 
ATOM   1535 C CD2 . PHE A 1 198 ? 19.586  -11.222 18.003 1.00 15.76 ? 198 PHE A CD2 1 
ATOM   1536 C CE1 . PHE A 1 198 ? 18.367  -9.949  20.150 1.00 19.11 ? 198 PHE A CE1 1 
ATOM   1537 C CE2 . PHE A 1 198 ? 18.203  -11.168 18.094 1.00 16.22 ? 198 PHE A CE2 1 
ATOM   1538 C CZ  . PHE A 1 198 ? 17.590  -10.540 19.167 1.00 19.87 ? 198 PHE A CZ  1 
ATOM   1539 N N   . GLY A 1 199 ? 24.638  -9.423  20.472 1.00 11.65 ? 199 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 199 ? 26.081  -9.439  20.567 1.00 15.58 ? 199 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 199 ? 26.644  -8.048  20.753 1.00 16.57 ? 199 GLY A C   1 
ATOM   1542 O O   . GLY A 1 199 ? 27.843  -7.939  21.022 1.00 19.52 ? 199 GLY A O   1 
ATOM   1543 N N   . CYS A 1 200 ? 25.817  -7.001  20.632 1.00 14.96 ? 200 CYS A N   1 
ATOM   1544 C CA  . CYS A 1 200 ? 26.367  -5.650  20.693 1.00 15.24 ? 200 CYS A CA  1 
ATOM   1545 C C   . CYS A 1 200 ? 26.725  -5.299  22.139 1.00 14.63 ? 200 CYS A C   1 
ATOM   1546 O O   . CYS A 1 200 ? 27.588  -4.430  22.324 1.00 14.67 ? 200 CYS A O   1 
ATOM   1547 C CB  . CYS A 1 200 ? 25.458  -4.598  20.071 1.00 13.89 ? 200 CYS A CB  1 
ATOM   1548 S SG  . CYS A 1 200 ? 24.043  -4.067  21.095 1.00 14.91 ? 200 CYS A SG  1 
ATOM   1549 N N   . ASN A 1 201 ? 26.119  -5.947  23.125 1.00 16.99 ? 201 ASN A N   1 
ATOM   1550 C CA  . ASN A 1 201 ? 26.498  -5.749  24.532 1.00 15.76 ? 201 ASN A CA  1 
ATOM   1551 C C   . ASN A 1 201 ? 26.447  -4.303  24.977 1.00 13.58 ? 201 ASN A C   1 
ATOM   1552 O O   . ASN A 1 201 ? 27.149  -3.867  25.895 1.00 11.62 ? 201 ASN A O   1 
ATOM   1553 C CB  . ASN A 1 201 ? 27.909  -6.332  24.713 1.00 18.99 ? 201 ASN A CB  1 
ATOM   1554 C CG  . ASN A 1 201 ? 28.291  -6.541  26.163 1.00 24.80 ? 201 ASN A CG  1 
ATOM   1555 O OD1 . ASN A 1 201 ? 29.468  -6.493  26.502 1.00 13.03 ? 201 ASN A OD1 1 
ATOM   1556 N ND2 . ASN A 1 201 ? 27.313  -6.750  27.036 1.00 26.38 ? 201 ASN A ND2 1 
ATOM   1557 N N   . HIS A 1 202 ? 25.604  -3.488  24.334 1.00 13.55 ? 202 HIS A N   1 
ATOM   1558 C CA  . HIS A 1 202 ? 25.549  -2.069  24.618 1.00 12.91 ? 202 HIS A CA  1 
ATOM   1559 C C   . HIS A 1 202 ? 25.129  -1.753  26.054 1.00 13.02 ? 202 HIS A C   1 
ATOM   1560 O O   . HIS A 1 202 ? 25.563  -0.739  26.626 1.00 9.30  ? 202 HIS A O   1 
ATOM   1561 C CB  . HIS A 1 202 ? 24.578  -1.366  23.647 1.00 15.09 ? 202 HIS A CB  1 
ATOM   1562 C CG  . HIS A 1 202 ? 25.222  -1.016  22.323 1.00 19.26 ? 202 HIS A CG  1 
ATOM   1563 N ND1 . HIS A 1 202 ? 26.382  -1.565  21.825 1.00 16.97 ? 202 HIS A ND1 1 
ATOM   1564 C CD2 . HIS A 1 202 ? 24.795  -0.147  21.381 1.00 8.86  ? 202 HIS A CD2 1 
ATOM   1565 C CE1 . HIS A 1 202 ? 26.651  -1.031  20.624 1.00 4.41  ? 202 HIS A CE1 1 
ATOM   1566 N NE2 . HIS A 1 202 ? 25.700  -0.165  20.336 1.00 11.58 ? 202 HIS A NE2 1 
ATOM   1567 N N   . PHE A 1 203 ? 24.284  -2.574  26.671 1.00 10.95 ? 203 PHE A N   1 
ATOM   1568 C CA  . PHE A 1 203 ? 23.760  -2.219  27.992 1.00 7.09  ? 203 PHE A CA  1 
ATOM   1569 C C   . PHE A 1 203 ? 24.854  -2.345  29.041 1.00 14.12 ? 203 PHE A C   1 
ATOM   1570 O O   . PHE A 1 203 ? 24.965  -1.506  29.930 1.00 16.15 ? 203 PHE A O   1 
ATOM   1571 C CB  . PHE A 1 203 ? 22.538  -3.112  28.302 1.00 10.44 ? 203 PHE A CB  1 
ATOM   1572 C CG  . PHE A 1 203 ? 21.485  -2.936  27.193 1.00 10.95 ? 203 PHE A CG  1 
ATOM   1573 C CD1 . PHE A 1 203 ? 20.658  -1.820  27.188 1.00 9.17  ? 203 PHE A CD1 1 
ATOM   1574 C CD2 . PHE A 1 203 ? 21.367  -3.890  26.193 1.00 7.92  ? 203 PHE A CD2 1 
ATOM   1575 C CE1 . PHE A 1 203 ? 19.709  -1.652  26.177 1.00 15.18 ? 203 PHE A CE1 1 
ATOM   1576 C CE2 . PHE A 1 203 ? 20.416  -3.724  25.196 1.00 7.98  ? 203 PHE A CE2 1 
ATOM   1577 C CZ  . PHE A 1 203 ? 19.595  -2.600  25.166 1.00 13.88 ? 203 PHE A CZ  1 
ATOM   1578 N N   . VAL A 1 204 ? 25.658  -3.413  28.936 1.00 8.37  ? 204 VAL A N   1 
ATOM   1579 C CA  . VAL A 1 204 ? 26.769  -3.563  29.870 1.00 12.06 ? 204 VAL A CA  1 
ATOM   1580 C C   . VAL A 1 204 ? 27.780  -2.457  29.590 1.00 14.54 ? 204 VAL A C   1 
ATOM   1581 O O   . VAL A 1 204 ? 28.281  -1.809  30.516 1.00 15.15 ? 204 VAL A O   1 
ATOM   1582 C CB  . VAL A 1 204 ? 27.440  -4.949  29.790 1.00 12.69 ? 204 VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 204 ? 28.657  -5.047  30.712 1.00 18.83 ? 204 VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 204 ? 26.489  -6.083  30.150 1.00 12.72 ? 204 VAL A CG2 1 
ATOM   1585 N N   . LEU A 1 205 ? 28.086  -2.269  28.299 1.00 15.00 ? 205 LEU A N   1 
ATOM   1586 C CA  . LEU A 1 205 ? 29.112  -1.279  27.965 1.00 12.57 ? 205 LEU A CA  1 
ATOM   1587 C C   . LEU A 1 205 ? 28.727  0.096   28.455 1.00 17.33 ? 205 LEU A C   1 
ATOM   1588 O O   . LEU A 1 205 ? 29.558  0.863   28.972 1.00 19.54 ? 205 LEU A O   1 
ATOM   1589 C CB  . LEU A 1 205 ? 29.362  -1.360  26.457 1.00 12.46 ? 205 LEU A CB  1 
ATOM   1590 C CG  . LEU A 1 205 ? 30.030  -2.672  26.029 1.00 18.81 ? 205 LEU A CG  1 
ATOM   1591 C CD1 . LEU A 1 205 ? 30.048  -2.817  24.513 1.00 24.07 ? 205 LEU A CD1 1 
ATOM   1592 C CD2 . LEU A 1 205 ? 31.437  -2.753  26.606 1.00 25.05 ? 205 LEU A CD2 1 
ATOM   1593 N N   . ALA A 1 206 ? 27.454  0.474   28.355 1.00 14.19 ? 206 ALA A N   1 
ATOM   1594 C CA  . ALA A 1 206 ? 27.028  1.777   28.868 1.00 16.50 ? 206 ALA A CA  1 
ATOM   1595 C C   . ALA A 1 206 ? 27.267  1.926   30.367 1.00 12.24 ? 206 ALA A C   1 
ATOM   1596 O O   . ALA A 1 206 ? 27.676  2.964   30.879 1.00 15.52 ? 206 ALA A O   1 
ATOM   1597 C CB  . ALA A 1 206 ? 25.544  2.005   28.584 1.00 10.78 ? 206 ALA A CB  1 
ATOM   1598 N N   . ASN A 1 207 ? 26.981  0.863   31.103 1.00 16.70 ? 207 ASN A N   1 
ATOM   1599 C CA  . ASN A 1 207 ? 27.040  0.867   32.558 1.00 22.86 ? 207 ASN A CA  1 
ATOM   1600 C C   . ASN A 1 207 ? 28.498  0.993   33.002 1.00 15.02 ? 207 ASN A C   1 
ATOM   1601 O O   . ASN A 1 207 ? 28.816  1.735   33.929 1.00 20.43 ? 207 ASN A O   1 
ATOM   1602 C CB  . ASN A 1 207 ? 26.368  -0.382  33.150 1.00 15.18 ? 207 ASN A CB  1 
ATOM   1603 C CG  . ASN A 1 207 ? 24.869  -0.181  33.317 1.00 15.47 ? 207 ASN A CG  1 
ATOM   1604 O OD1 . ASN A 1 207 ? 24.384  0.946   33.199 1.00 13.55 ? 207 ASN A OD1 1 
ATOM   1605 N ND2 . ASN A 1 207 ? 24.111  -1.238  33.585 1.00 17.39 ? 207 ASN A ND2 1 
ATOM   1606 N N   . GLN A 1 208 ? 29.348  0.243   32.297 1.00 13.81 ? 208 GLN A N   1 
ATOM   1607 C CA  . GLN A 1 208 ? 30.757  0.300   32.672 1.00 20.07 ? 208 GLN A CA  1 
ATOM   1608 C C   . GLN A 1 208 ? 31.275  1.721   32.483 1.00 26.43 ? 208 GLN A C   1 
ATOM   1609 O O   . GLN A 1 208 ? 31.920  2.240   33.396 1.00 25.33 ? 208 GLN A O   1 
ATOM   1610 C CB  . GLN A 1 208 ? 31.585  -0.685  31.862 1.00 22.07 ? 208 GLN A CB  1 
ATOM   1611 C CG  . GLN A 1 208 ? 31.311  -2.143  32.202 1.00 33.89 ? 208 GLN A CG  1 
ATOM   1612 C CD  . GLN A 1 208 ? 32.160  -3.075  31.352 1.00 53.46 ? 208 GLN A CD  1 
ATOM   1613 O OE1 . GLN A 1 208 ? 31.922  -3.222  30.152 1.00 73.71 ? 208 GLN A OE1 1 
ATOM   1614 N NE2 . GLN A 1 208 ? 33.164  -3.695  31.974 1.00 86.50 ? 208 GLN A NE2 1 
ATOM   1615 N N   . TRP A 1 209 ? 30.992  2.310   31.316 1.00 20.04 ? 209 TRP A N   1 
ATOM   1616 C CA  . TRP A 1 209 ? 31.412  3.700   31.111 1.00 28.79 ? 209 TRP A CA  1 
ATOM   1617 C C   . TRP A 1 209 ? 30.876  4.557   32.256 1.00 19.49 ? 209 TRP A C   1 
ATOM   1618 O O   . TRP A 1 209 ? 31.626  5.349   32.836 1.00 22.79 ? 209 TRP A O   1 
ATOM   1619 C CB  . TRP A 1 209 ? 30.984  4.267   29.760 1.00 33.40 ? 209 TRP A CB  1 
ATOM   1620 C CG  . TRP A 1 209 ? 31.162  5.746   29.573 1.00 27.95 ? 209 TRP A CG  1 
ATOM   1621 C CD1 . TRP A 1 209 ? 30.284  6.751   29.892 1.00 35.99 ? 209 TRP A CD1 1 
ATOM   1622 C CD2 . TRP A 1 209 ? 32.297  6.412   29.011 1.00 28.60 ? 209 TRP A CD2 1 
ATOM   1623 N NE1 . TRP A 1 209 ? 30.790  7.979   29.574 1.00 47.11 ? 209 TRP A NE1 1 
ATOM   1624 C CE2 . TRP A 1 209 ? 32.036  7.798   29.027 1.00 36.56 ? 209 TRP A CE2 1 
ATOM   1625 C CE3 . TRP A 1 209 ? 33.516  5.966   28.494 1.00 30.28 ? 209 TRP A CE3 1 
ATOM   1626 C CZ2 . TRP A 1 209 ? 32.922  8.768   28.558 1.00 32.84 ? 209 TRP A CZ2 1 
ATOM   1627 C CZ3 . TRP A 1 209 ? 34.394  6.921   28.029 1.00 33.66 ? 209 TRP A CZ3 1 
ATOM   1628 C CH2 . TRP A 1 209 ? 34.104  8.290   28.061 1.00 40.74 ? 209 TRP A CH2 1 
ATOM   1629 N N   . LEU A 1 210 ? 29.592  4.409   32.591 1.00 19.72 ? 210 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 210 ? 29.047  5.288   33.616 1.00 17.26 ? 210 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 210 ? 29.787  5.128   34.944 1.00 30.61 ? 210 LEU A C   1 
ATOM   1632 O O   . LEU A 1 210 ? 30.051  6.115   35.623 1.00 28.77 ? 210 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 210 ? 27.572  5.018   33.883 1.00 25.89 ? 210 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 210 ? 26.566  5.375   32.789 1.00 28.93 ? 210 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 210 ? 25.208  4.817   33.190 1.00 19.06 ? 210 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 210 ? 26.482  6.868   32.534 1.00 23.66 ? 210 LEU A CD2 1 
ATOM   1637 N N   . GLU A 1 211 ? 30.067  3.873   35.270 1.00 30.73 ? 211 GLU A N   1 
ATOM   1638 C CA  . GLU A 1 211 ? 30.750  3.484   36.494 1.00 31.92 ? 211 GLU A CA  1 
ATOM   1639 C C   . GLU A 1 211 ? 32.152  4.087   36.524 1.00 32.52 ? 211 GLU A C   1 
ATOM   1640 O O   . GLU A 1 211 ? 32.569  4.669   37.524 1.00 33.47 ? 211 GLU A O   1 
ATOM   1641 C CB  . GLU A 1 211 ? 30.838  1.960   36.609 1.00 22.27 ? 211 GLU A CB  1 
ATOM   1642 C CG  . GLU A 1 211 ? 29.690  1.264   37.305 1.00 34.41 ? 211 GLU A CG  1 
ATOM   1643 C CD  . GLU A 1 211 ? 29.345  -0.089  36.706 1.00 39.91 ? 211 GLU A CD  1 
ATOM   1644 O OE1 . GLU A 1 211 ? 30.198  -0.734  36.052 1.00 50.49 ? 211 GLU A OE1 1 
ATOM   1645 O OE2 . GLU A 1 211 ? 28.191  -0.547  36.873 1.00 60.26 ? 211 GLU A OE2 1 
ATOM   1646 N N   . GLN A 1 212 ? 32.866  3.957   35.401 1.00 35.84 ? 212 GLN A N   1 
ATOM   1647 C CA  . GLN A 1 212 ? 34.232  4.444   35.291 1.00 41.84 ? 212 GLN A CA  1 
ATOM   1648 C C   . GLN A 1 212 ? 34.346  5.959   35.393 1.00 40.31 ? 212 GLN A C   1 
ATOM   1649 O O   . GLN A 1 212 ? 35.484  6.433   35.356 1.00 58.68 ? 212 GLN A O   1 
ATOM   1650 C CB  . GLN A 1 212 ? 34.857  3.953   33.980 1.00 44.88 ? 212 GLN A CB  1 
ATOM   1651 C CG  . GLN A 1 212 ? 35.045  2.444   33.978 1.00 49.98 ? 212 GLN A CG  1 
ATOM   1652 C CD  . GLN A 1 212 ? 35.456  1.867   32.640 1.00 68.29 ? 212 GLN A CD  1 
ATOM   1653 O OE1 . GLN A 1 212 ? 35.430  0.643   32.451 1.00 93.51 ? 212 GLN A OE1 1 
ATOM   1654 N NE2 . GLN A 1 212 ? 35.836  2.721   31.697 1.00 84.88 ? 212 GLN A NE2 1 
ATOM   1655 N N   . HIS A 1 213 ? 33.250  6.687   35.525 1.00 46.69 ? 213 HIS A N   1 
ATOM   1656 C CA  . HIS A 1 213 ? 33.195  8.130   35.735 1.00 37.87 ? 213 HIS A CA  1 
ATOM   1657 C C   . HIS A 1 213 ? 32.407  8.507   36.983 1.00 35.35 ? 213 HIS A C   1 
ATOM   1658 O O   . HIS A 1 213 ? 32.040  9.667   37.200 1.00 45.41 ? 213 HIS A O   1 
ATOM   1659 C CB  . HIS A 1 213 ? 32.587  8.822   34.509 1.00 32.18 ? 213 HIS A CB  1 
ATOM   1660 C CG  . HIS A 1 213 ? 33.407  8.641   33.270 1.00 30.49 ? 213 HIS A CG  1 
ATOM   1661 N ND1 . HIS A 1 213 ? 33.391  7.484   32.522 1.00 33.13 ? 213 HIS A ND1 1 
ATOM   1662 C CD2 . HIS A 1 213 ? 34.267  9.467   32.636 1.00 31.52 ? 213 HIS A CD2 1 
ATOM   1663 C CE1 . HIS A 1 213 ? 34.202  7.594   31.488 1.00 40.71 ? 213 HIS A CE1 1 
ATOM   1664 N NE2 . HIS A 1 213 ? 34.752  8.800   31.533 1.00 41.91 ? 213 HIS A NE2 1 
ATOM   1665 N N   . GLY A 1 214 ? 32.126  7.534   37.842 1.00 33.02 ? 214 GLY A N   1 
ATOM   1666 C CA  . GLY A 1 214 ? 31.496  7.803   39.119 1.00 31.25 ? 214 GLY A CA  1 
ATOM   1667 C C   . GLY A 1 214 ? 29.992  7.927   39.071 1.00 32.20 ? 214 GLY A C   1 
ATOM   1668 O O   . GLY A 1 214 ? 29.386  8.411   40.033 1.00 28.12 ? 214 GLY A O   1 
ATOM   1669 N N   . GLU A 1 215 ? 29.372  7.504   37.966 1.00 24.93 ? 215 GLU A N   1 
ATOM   1670 C CA  . GLU A 1 215 ? 27.918  7.609   37.846 1.00 27.75 ? 215 GLU A CA  1 
ATOM   1671 C C   . GLU A 1 215 ? 27.281  6.262   38.173 1.00 24.40 ? 215 GLU A C   1 
ATOM   1672 O O   . GLU A 1 215 ? 27.856  5.195   37.961 1.00 38.57 ? 215 GLU A O   1 
ATOM   1673 C CB  . GLU A 1 215 ? 27.503  8.126   36.455 1.00 20.16 ? 215 GLU A CB  1 
ATOM   1674 C CG  . GLU A 1 215 ? 27.910  9.586   36.276 1.00 19.53 ? 215 GLU A CG  1 
ATOM   1675 C CD  . GLU A 1 215 ? 26.926  10.500  35.597 1.00 28.39 ? 215 GLU A CD  1 
ATOM   1676 O OE1 . GLU A 1 215 ? 25.882  10.790  36.209 1.00 52.31 ? 215 GLU A OE1 1 
ATOM   1677 O OE2 . GLU A 1 215 ? 27.161  10.980  34.459 1.00 40.32 ? 215 GLU A OE2 1 
ATOM   1678 N N   . THR A 1 216 ? 26.083  6.339   38.741 1.00 27.29 ? 216 THR A N   1 
ATOM   1679 C CA  . THR A 1 216 ? 25.363  5.103   39.040 1.00 31.00 ? 216 THR A CA  1 
ATOM   1680 C C   . THR A 1 216 ? 25.086  4.393   37.723 1.00 32.48 ? 216 THR A C   1 
ATOM   1681 O O   . THR A 1 216 ? 24.693  5.036   36.747 1.00 36.25 ? 216 THR A O   1 
ATOM   1682 C CB  . THR A 1 216 ? 24.045  5.366   39.777 1.00 40.89 ? 216 THR A CB  1 
ATOM   1683 O OG1 . THR A 1 216 ? 24.291  5.427   41.193 1.00 73.72 ? 216 THR A OG1 1 
ATOM   1684 C CG2 . THR A 1 216 ? 23.060  4.222   39.572 1.00 57.68 ? 216 THR A CG2 1 
ATOM   1685 N N   . PRO A 1 217 ? 25.280  3.093   37.656 1.00 23.53 ? 217 PRO A N   1 
ATOM   1686 C CA  . PRO A 1 217 ? 24.845  2.417   36.430 1.00 12.48 ? 217 PRO A CA  1 
ATOM   1687 C C   . PRO A 1 217 ? 23.326  2.322   36.398 1.00 17.77 ? 217 PRO A C   1 
ATOM   1688 O O   . PRO A 1 217 ? 22.592  2.485   37.371 1.00 18.67 ? 217 PRO A O   1 
ATOM   1689 C CB  . PRO A 1 217 ? 25.465  1.034   36.559 1.00 15.72 ? 217 PRO A CB  1 
ATOM   1690 C CG  . PRO A 1 217 ? 25.630  0.819   38.033 1.00 16.15 ? 217 PRO A CG  1 
ATOM   1691 C CD  . PRO A 1 217 ? 25.875  2.172   38.639 1.00 18.00 ? 217 PRO A CD  1 
ATOM   1692 N N   . ILE A 1 218 ? 22.846  2.007   35.195 1.00 15.34 ? 218 ILE A N   1 
ATOM   1693 C CA  . ILE A 1 218 ? 21.418  1.851   34.977 1.00 12.67 ? 218 ILE A CA  1 
ATOM   1694 C C   . ILE A 1 218 ? 20.964  0.463   35.394 1.00 10.15 ? 218 ILE A C   1 
ATOM   1695 O O   . ILE A 1 218 ? 21.621  -0.521  35.028 1.00 12.88 ? 218 ILE A O   1 
ATOM   1696 C CB  . ILE A 1 218 ? 21.102  2.098   33.480 1.00 18.07 ? 218 ILE A CB  1 
ATOM   1697 C CG1 . ILE A 1 218 ? 21.708  3.395   32.928 1.00 18.56 ? 218 ILE A CG1 1 
ATOM   1698 C CG2 . ILE A 1 218 ? 19.601  2.043   33.232 1.00 12.03 ? 218 ILE A CG2 1 
ATOM   1699 C CD1 . ILE A 1 218 ? 21.159  4.648   33.606 1.00 16.41 ? 218 ILE A CD1 1 
ATOM   1700 N N   . ASP A 1 219 ? 19.884  0.392   36.156 1.00 10.68 ? 219 ASP A N   1 
ATOM   1701 C CA  . ASP A 1 219 ? 19.160  -0.849  36.427 1.00 9.54  ? 219 ASP A CA  1 
ATOM   1702 C C   . ASP A 1 219 ? 18.228  -1.075  35.233 1.00 18.04 ? 219 ASP A C   1 
ATOM   1703 O O   . ASP A 1 219 ? 17.147  -0.483  35.143 1.00 12.61 ? 219 ASP A O   1 
ATOM   1704 C CB  . ASP A 1 219 ? 18.400  -0.746  37.739 1.00 15.64 ? 219 ASP A CB  1 
ATOM   1705 C CG  . ASP A 1 219 ? 17.447  -1.889  37.998 1.00 23.52 ? 219 ASP A CG  1 
ATOM   1706 O OD1 . ASP A 1 219 ? 17.447  -2.871  37.210 1.00 15.68 ? 219 ASP A OD1 1 
ATOM   1707 O OD2 . ASP A 1 219 ? 16.691  -1.857  38.994 1.00 18.00 ? 219 ASP A OD2 1 
ATOM   1708 N N   . TRP A 1 220 ? 18.632  -1.921  34.280 1.00 11.84 ? 220 TRP A N   1 
ATOM   1709 C CA  . TRP A 1 220 ? 17.856  -2.036  33.049 1.00 12.77 ? 220 TRP A CA  1 
ATOM   1710 C C   . TRP A 1 220 ? 16.590  -2.873  33.153 1.00 18.22 ? 220 TRP A C   1 
ATOM   1711 O O   . TRP A 1 220 ? 15.863  -2.974  32.154 1.00 12.98 ? 220 TRP A O   1 
ATOM   1712 C CB  . TRP A 1 220 ? 18.777  -2.668  32.005 1.00 14.92 ? 220 TRP A CB  1 
ATOM   1713 C CG  . TRP A 1 220 ? 19.938  -1.829  31.577 1.00 14.53 ? 220 TRP A CG  1 
ATOM   1714 C CD1 . TRP A 1 220 ? 21.251  -1.984  31.922 1.00 7.29  ? 220 TRP A CD1 1 
ATOM   1715 C CD2 . TRP A 1 220 ? 19.859  -0.697  30.704 1.00 11.24 ? 220 TRP A CD2 1 
ATOM   1716 N NE1 . TRP A 1 220 ? 22.005  -1.005  31.294 1.00 10.95 ? 220 TRP A NE1 1 
ATOM   1717 C CE2 . TRP A 1 220 ? 21.172  -0.204  30.555 1.00 8.16  ? 220 TRP A CE2 1 
ATOM   1718 C CE3 . TRP A 1 220 ? 18.781  -0.076  30.045 1.00 12.92 ? 220 TRP A CE3 1 
ATOM   1719 C CZ2 . TRP A 1 220 ? 21.451  0.912   29.760 1.00 9.17  ? 220 TRP A CZ2 1 
ATOM   1720 C CZ3 . TRP A 1 220 ? 19.079  1.035   29.258 1.00 8.15  ? 220 TRP A CZ3 1 
ATOM   1721 C CH2 . TRP A 1 220 ? 20.395  1.504   29.129 1.00 10.61 ? 220 TRP A CH2 1 
ATOM   1722 N N   . MET A 1 221 ? 16.305  -3.471  34.310 1.00 13.39 ? 221 MET A N   1 
ATOM   1723 C CA  . MET A 1 221 ? 15.039  -4.187  34.504 1.00 15.71 ? 221 MET A CA  1 
ATOM   1724 C C   . MET A 1 221 ? 13.905  -3.195  34.706 1.00 6.19  ? 221 MET A C   1 
ATOM   1725 O O   . MET A 1 221 ? 13.862  -2.575  35.773 1.00 11.89 ? 221 MET A O   1 
ATOM   1726 C CB  . MET A 1 221 ? 15.168  -5.159  35.690 1.00 11.18 ? 221 MET A CB  1 
ATOM   1727 C CG  . MET A 1 221 ? 13.981  -6.089  35.830 1.00 16.94 ? 221 MET A CG  1 
ATOM   1728 S SD  . MET A 1 221 ? 13.953  -7.419  34.612 1.00 18.15 ? 221 MET A SD  1 
ATOM   1729 C CE  . MET A 1 221 ? 12.513  -8.332  35.187 1.00 20.79 ? 221 MET A CE  1 
ATOM   1730 N N   . PRO A 1 222 ? 13.019  -2.993  33.737 1.00 12.59 ? 222 PRO A N   1 
ATOM   1731 C CA  . PRO A 1 222 ? 12.026  -1.896  33.830 1.00 10.96 ? 222 PRO A CA  1 
ATOM   1732 C C   . PRO A 1 222 ? 10.923  -2.251  34.809 1.00 18.96 ? 222 PRO A C   1 
ATOM   1733 O O   . PRO A 1 222 ? 10.590  -3.431  35.007 1.00 13.06 ? 222 PRO A O   1 
ATOM   1734 C CB  . PRO A 1 222 ? 11.489  -1.816  32.390 1.00 12.05 ? 222 PRO A CB  1 
ATOM   1735 C CG  . PRO A 1 222 ? 11.567  -3.243  31.939 1.00 10.18 ? 222 PRO A CG  1 
ATOM   1736 C CD  . PRO A 1 222 ? 12.849  -3.779  32.491 1.00 7.77  ? 222 PRO A CD  1 
ATOM   1737 N N   . VAL A 1 223 ? 10.322  -1.256  35.473 1.00 16.85 ? 223 VAL A N   1 
ATOM   1738 C CA  . VAL A 1 223 ? 9.321   -1.605  36.478 1.00 20.07 ? 223 VAL A CA  1 
ATOM   1739 C C   . VAL A 1 223 ? 8.040   -0.800  36.337 1.00 17.15 ? 223 VAL A C   1 
ATOM   1740 O O   . VAL A 1 223 ? 8.050   0.396   36.049 1.00 21.07 ? 223 VAL A O   1 
ATOM   1741 C CB  . VAL A 1 223 ? 9.833   -1.387  37.916 1.00 20.50 ? 223 VAL A CB  1 
ATOM   1742 C CG1 . VAL A 1 223 ? 11.170  -2.066  38.129 1.00 27.00 ? 223 VAL A CG1 1 
ATOM   1743 C CG2 . VAL A 1 223 ? 9.895   0.106   38.165 1.00 21.61 ? 223 VAL A CG2 1 
ATOM   1744 N N   . LEU A 1 224 ? 6.936   -1.509  36.546 1.00 18.18 ? 224 LEU A N   1 
ATOM   1745 C CA  . LEU A 1 224 ? 5.608   -0.928  36.424 1.00 15.10 ? 224 LEU A CA  1 
ATOM   1746 C C   . LEU A 1 224 ? 5.316   -0.047  37.624 1.00 16.20 ? 224 LEU A C   1 
ATOM   1747 O O   . LEU A 1 224 ? 5.720   -0.447  38.719 1.00 18.16 ? 224 LEU A O   1 
ATOM   1748 C CB  . LEU A 1 224 ? 4.538   -2.016  36.377 1.00 18.46 ? 224 LEU A CB  1 
ATOM   1749 C CG  . LEU A 1 224 ? 4.301   -2.729  35.053 1.00 19.05 ? 224 LEU A CG  1 
ATOM   1750 C CD1 . LEU A 1 224 ? 3.120   -3.676  35.192 1.00 34.48 ? 224 LEU A CD1 1 
ATOM   1751 C CD2 . LEU A 1 224 ? 4.061   -1.713  33.944 1.00 18.29 ? 224 LEU A CD2 1 
ATOM   1752 N N   . PRO A 1 225 ? 4.660   1.072   37.435 1.00 25.12 ? 225 PRO A N   1 
ATOM   1753 C CA  . PRO A 1 225 ? 4.072   1.795   38.575 1.00 26.62 ? 225 PRO A CA  1 
ATOM   1754 C C   . PRO A 1 225 ? 3.358   0.823   39.506 1.00 21.39 ? 225 PRO A C   1 
ATOM   1755 O O   . PRO A 1 225 ? 2.690   -0.117  39.044 1.00 16.39 ? 225 PRO A O   1 
ATOM   1756 C CB  . PRO A 1 225 ? 3.059   2.730   37.917 1.00 38.99 ? 225 PRO A CB  1 
ATOM   1757 C CG  . PRO A 1 225 ? 3.025   2.321   36.475 1.00 40.35 ? 225 PRO A CG  1 
ATOM   1758 C CD  . PRO A 1 225 ? 4.415   1.807   36.179 1.00 30.45 ? 225 PRO A CD  1 
ATOM   1759 N N   . ALA A 1 226 ? 3.494   1.020   40.817 1.00 19.67 ? 226 ALA A N   1 
ATOM   1760 C CA  . ALA A 1 226 ? 2.863   0.137   41.788 1.00 15.83 ? 226 ALA A CA  1 
ATOM   1761 C C   . ALA A 1 226 ? 1.419   0.533   42.102 1.00 17.82 ? 226 ALA A C   1 
ATOM   1762 O O   . ALA A 1 226 ? 1.010   1.643   41.765 1.00 25.39 ? 226 ALA A O   1 
ATOM   1763 C CB  . ALA A 1 226 ? 3.624   0.143   43.110 1.00 10.61 ? 226 ALA A CB  1 
ATOM   1764 N N   . GLU A 1 227 ? 0.721   -0.363  42.771 1.00 17.69 ? 227 GLU A N   1 
ATOM   1765 C CA  . GLU A 1 227 ? -0.603  -0.185  43.334 1.00 18.80 ? 227 GLU A CA  1 
ATOM   1766 C C   . GLU A 1 227 ? -0.518  0.543   44.685 1.00 29.96 ? 227 GLU A C   1 
ATOM   1767 O O   . GLU A 1 227 ? 0.519   0.437   45.364 1.00 15.97 ? 227 GLU A O   1 
ATOM   1768 C CB  . GLU A 1 227 ? -1.314  -1.532  43.509 1.00 21.46 ? 227 GLU A CB  1 
ATOM   1769 C CG  . GLU A 1 227 ? -1.794  -2.143  42.199 1.00 47.55 ? 227 GLU A CG  1 
ATOM   1770 C CD  . GLU A 1 227 ? -2.764  -3.304  42.290 1.00 65.02 ? 227 GLU A CD  1 
ATOM   1771 O OE1 . GLU A 1 227 ? -2.445  -4.336  42.938 1.00 55.25 ? 227 GLU A OE1 1 
ATOM   1772 O OE2 . GLU A 1 227 ? -3.869  -3.229  41.700 1.00 62.44 ? 227 GLU A OE2 1 
ATOM   1773 N N   . SER A 1 228 ? -1.593  1.243   45.040 1.00 27.73 ? 228 SER A N   1 
ATOM   1774 C CA  . SER A 1 228 ? -1.777  1.979   46.290 1.00 25.24 ? 228 SER A CA  1 
ATOM   1775 C C   . SER A 1 228 ? -3.009  1.434   46.997 1.00 26.38 ? 228 SER A C   1 
ATOM   1776 O O   . SER A 1 228 ? -3.723  0.638   46.380 1.00 30.64 ? 228 SER A O   1 
ATOM   1777 C CB  . SER A 1 228 ? -1.975  3.478   46.080 1.00 25.35 ? 228 SER A CB  1 
ATOM   1778 O OG  . SER A 1 228 ? -0.727  4.111   45.870 1.00 31.02 ? 228 SER A OG  1 
ATOM   1779 N N   . GLU A 1 229 ? -3.265  1.850   48.229 1.00 23.21 ? 229 GLU A N   1 
ATOM   1780 C CA  . GLU A 1 229 ? -4.508  1.381   48.853 1.00 38.35 ? 229 GLU A CA  1 
ATOM   1781 C C   . GLU A 1 229 ? -5.750  1.999   48.222 1.00 49.15 ? 229 GLU A C   1 
ATOM   1782 O O   . GLU A 1 229 ? -5.753  3.105   47.674 1.00 48.95 ? 229 GLU A O   1 
ATOM   1783 C CB  . GLU A 1 229 ? -4.494  1.671   50.360 1.00 33.51 ? 229 GLU A CB  1 
ATOM   1784 C CG  . GLU A 1 229 ? -3.719  0.599   51.139 1.00 30.51 ? 229 GLU A CG  1 
ATOM   1785 C CD  . GLU A 1 229 ? -4.234  -0.783  50.767 1.00 30.18 ? 229 GLU A CD  1 
ATOM   1786 O OE1 . GLU A 1 229 ? -5.436  -1.052  50.987 1.00 36.67 ? 229 GLU A OE1 1 
ATOM   1787 O OE2 . GLU A 1 229 ? -3.445  -1.595  50.249 1.00 22.96 ? 229 GLU A OE2 1 
ATOM   1788 O OXT . GLU A 1 229 ? -6.955  1.964   47.945 1.00 46.15 ? 229 GLU A OXT 1 
HETATM 1789 N N1  . URA B 2 .   ? 10.751  2.263   16.896 1.00 20.73 ? 230 URA A N1  1 
HETATM 1790 C C2  . URA B 2 .   ? 11.432  3.441   17.186 1.00 25.61 ? 230 URA A C2  1 
HETATM 1791 O O2  . URA B 2 .   ? 12.425  3.839   16.584 1.00 27.90 ? 230 URA A O2  1 
HETATM 1792 N N3  . URA B 2 .   ? 10.972  4.103   18.298 1.00 14.01 ? 230 URA A N3  1 
HETATM 1793 C C4  . URA B 2 .   ? 9.806   3.856   19.022 1.00 16.37 ? 230 URA A C4  1 
HETATM 1794 O O4  . URA B 2 .   ? 9.315   4.565   19.917 1.00 16.46 ? 230 URA A O4  1 
HETATM 1795 C C5  . URA B 2 .   ? 9.150   2.623   18.618 1.00 23.94 ? 230 URA A C5  1 
HETATM 1796 C C6  . URA B 2 .   ? 9.642   1.877   17.614 1.00 25.92 ? 230 URA A C6  1 
HETATM 1797 O O   . HOH C 3 .   ? 6.528   11.651  20.960 1.00 8.92  ? 301 HOH A O   1 
HETATM 1798 O O   . HOH C 3 .   ? 6.301   5.040   23.474 1.00 9.31  ? 302 HOH A O   1 
HETATM 1799 O O   . HOH C 3 .   ? 13.414  9.799   28.356 1.00 9.72  ? 303 HOH A O   1 
HETATM 1800 O O   . HOH C 3 .   ? 10.940  10.454  22.282 1.00 10.00 ? 304 HOH A O   1 
HETATM 1801 O O   . HOH C 3 .   ? 6.823   5.141   20.535 1.00 10.24 ? 305 HOH A O   1 
HETATM 1802 O O   . HOH C 3 .   ? 8.453   9.504   21.043 1.00 10.63 ? 306 HOH A O   1 
HETATM 1803 O O   . HOH C 3 .   ? 5.973   9.693   11.583 1.00 10.69 ? 307 HOH A O   1 
HETATM 1804 O O   . HOH C 3 .   ? 3.308   -3.182  28.520 1.00 10.82 ? 308 HOH A O   1 
HETATM 1805 O O   . HOH C 3 .   ? -0.350  6.247   21.358 1.00 10.85 ? 309 HOH A O   1 
HETATM 1806 O O   . HOH C 3 .   ? 8.845   -3.236  16.978 1.00 10.94 ? 310 HOH A O   1 
HETATM 1807 O O   . HOH C 3 .   ? 6.402   7.835   21.454 1.00 11.33 ? 311 HOH A O   1 
HETATM 1808 O O   . HOH C 3 .   ? 20.059  -1.672  11.268 1.00 11.62 ? 312 HOH A O   1 
HETATM 1809 O O   . HOH C 3 .   ? 5.264   3.418   41.562 1.00 12.19 ? 313 HOH A O   1 
HETATM 1810 O O   . HOH C 3 .   ? 0.860   4.336   19.239 1.00 12.26 ? 314 HOH A O   1 
HETATM 1811 O O   . HOH C 3 .   ? 2.089   -4.116  21.119 1.00 12.88 ? 315 HOH A O   1 
HETATM 1812 O O   . HOH C 3 .   ? -3.570  23.987  12.822 1.00 13.27 ? 316 HOH A O   1 
HETATM 1813 O O   . HOH C 3 .   ? 16.080  11.307  34.611 1.00 13.30 ? 317 HOH A O   1 
HETATM 1814 O O   . HOH C 3 .   ? -1.656  0.570   13.646 1.00 13.49 ? 318 HOH A O   1 
HETATM 1815 O O   . HOH C 3 .   ? 15.198  13.833  35.073 1.00 13.84 ? 319 HOH A O   1 
HETATM 1816 O O   . HOH C 3 .   ? 9.249   12.463  23.711 1.00 13.86 ? 320 HOH A O   1 
HETATM 1817 O O   . HOH C 3 .   ? 5.637   14.029  6.949  1.00 14.60 ? 321 HOH A O   1 
HETATM 1818 O O   . HOH C 3 .   ? 3.267   0.303   15.690 1.00 14.67 ? 322 HOH A O   1 
HETATM 1819 O O   . HOH C 3 .   ? -1.731  18.353  18.651 1.00 15.29 ? 323 HOH A O   1 
HETATM 1820 O O   . HOH C 3 .   ? 17.077  3.845   16.362 1.00 15.53 ? 324 HOH A O   1 
HETATM 1821 O O   . HOH C 3 .   ? -5.516  3.385   15.647 1.00 15.60 ? 325 HOH A O   1 
HETATM 1822 O O   . HOH C 3 .   ? 14.453  0.273   35.893 1.00 15.80 ? 326 HOH A O   1 
HETATM 1823 O O   . HOH C 3 .   ? 9.157   1.573   33.759 1.00 16.09 ? 327 HOH A O   1 
HETATM 1824 O O   . HOH C 3 .   ? 8.218   -7.808  34.806 1.00 16.15 ? 328 HOH A O   1 
HETATM 1825 O O   . HOH C 3 .   ? 16.904  27.089  21.499 1.00 16.47 ? 329 HOH A O   1 
HETATM 1826 O O   . HOH C 3 .   ? 24.687  -5.676  27.159 1.00 16.57 ? 330 HOH A O   1 
HETATM 1827 O O   . HOH C 3 .   ? 6.089   3.821   13.467 1.00 16.86 ? 331 HOH A O   1 
HETATM 1828 O O   . HOH C 3 .   ? 7.324   -4.306  36.880 1.00 16.88 ? 332 HOH A O   1 
HETATM 1829 O O   . HOH C 3 .   ? 20.833  21.670  15.159 1.00 17.03 ? 333 HOH A O   1 
HETATM 1830 O O   . HOH C 3 .   ? 20.265  4.230   38.147 1.00 17.13 ? 334 HOH A O   1 
HETATM 1831 O O   . HOH C 3 .   ? 19.580  4.447   18.635 1.00 17.21 ? 335 HOH A O   1 
HETATM 1832 O O   . HOH C 3 .   ? -6.036  19.576  17.692 1.00 17.47 ? 336 HOH A O   1 
HETATM 1833 O O   . HOH C 3 .   ? 18.347  4.056   13.011 1.00 17.58 ? 337 HOH A O   1 
HETATM 1834 O O   . HOH C 3 .   ? 18.253  21.947  13.922 1.00 17.71 ? 338 HOH A O   1 
HETATM 1835 O O   . HOH C 3 .   ? 14.439  -3.255  38.276 1.00 17.82 ? 339 HOH A O   1 
HETATM 1836 O O   . HOH C 3 .   ? 10.412  8.507   10.864 1.00 18.00 ? 340 HOH A O   1 
HETATM 1837 O O   . HOH C 3 .   ? -1.762  27.709  17.525 1.00 18.36 ? 341 HOH A O   1 
HETATM 1838 O O   . HOH C 3 .   ? 17.518  -10.139 11.991 1.00 18.42 ? 342 HOH A O   1 
HETATM 1839 O O   . HOH C 3 .   ? 10.298  -6.055  35.406 1.00 18.46 ? 343 HOH A O   1 
HETATM 1840 O O   . HOH C 3 .   ? 19.725  0.727   9.100  1.00 18.60 ? 344 HOH A O   1 
HETATM 1841 O O   . HOH C 3 .   ? 9.180   15.566  10.875 1.00 18.68 ? 345 HOH A O   1 
HETATM 1842 O O   . HOH C 3 .   ? 6.768   -11.048 28.772 1.00 18.95 ? 346 HOH A O   1 
HETATM 1843 O O   . HOH C 3 .   ? 2.098   25.656  17.279 1.00 18.97 ? 347 HOH A O   1 
HETATM 1844 O O   . HOH C 3 .   ? 25.628  -3.565  34.309 1.00 19.08 ? 348 HOH A O   1 
HETATM 1845 O O   . HOH C 3 .   ? 11.562  18.169  32.153 1.00 19.22 ? 349 HOH A O   1 
HETATM 1846 O O   . HOH C 3 .   ? 11.190  -11.855 34.774 1.00 19.30 ? 350 HOH A O   1 
HETATM 1847 O O   . HOH C 3 .   ? 18.075  3.234   9.267  1.00 19.37 ? 351 HOH A O   1 
HETATM 1848 O O   . HOH C 3 .   ? 0.858   8.908   29.137 1.00 19.38 ? 352 HOH A O   1 
HETATM 1849 O O   . HOH C 3 .   ? 28.288  -3.297  17.725 1.00 19.43 ? 353 HOH A O   1 
HETATM 1850 O O   . HOH C 3 .   ? 23.792  -10.401 15.787 1.00 19.65 ? 354 HOH A O   1 
HETATM 1851 O O   . HOH C 3 .   ? 22.663  -13.714 35.706 1.00 19.78 ? 355 HOH A O   1 
HETATM 1852 O O   . HOH C 3 .   ? 13.605  5.516   7.188  1.00 19.78 ? 356 HOH A O   1 
HETATM 1853 O O   . HOH C 3 .   ? 23.041  -7.095  37.479 1.00 19.81 ? 357 HOH A O   1 
HETATM 1854 O O   . HOH C 3 .   ? 3.609   -3.397  17.042 1.00 19.81 ? 358 HOH A O   1 
HETATM 1855 O O   . HOH C 3 .   ? 12.440  9.872   10.047 1.00 20.12 ? 359 HOH A O   1 
HETATM 1856 O O   . HOH C 3 .   ? 0.352   19.953  18.314 1.00 20.38 ? 360 HOH A O   1 
HETATM 1857 O O   . HOH C 3 .   ? 18.380  20.172  33.730 1.00 20.56 ? 361 HOH A O   1 
HETATM 1858 O O   . HOH C 3 .   ? 7.093   -7.403  39.312 1.00 20.63 ? 362 HOH A O   1 
HETATM 1859 O O   . HOH C 3 .   ? 29.321  -2.950  20.298 1.00 21.00 ? 363 HOH A O   1 
HETATM 1860 O O   . HOH C 3 .   ? -6.752  5.402   19.454 1.00 21.17 ? 364 HOH A O   1 
HETATM 1861 O O   . HOH C 3 .   ? 6.542   17.880  33.136 1.00 21.18 ? 365 HOH A O   1 
HETATM 1862 O O   . HOH C 3 .   ? 0.739   17.381  19.575 1.00 21.18 ? 366 HOH A O   1 
HETATM 1863 O O   . HOH C 3 .   ? 19.503  -7.513  36.449 1.00 21.23 ? 367 HOH A O   1 
HETATM 1864 O O   . HOH C 3 .   ? -0.971  -5.326  22.838 1.00 21.48 ? 368 HOH A O   1 
HETATM 1865 O O   . HOH C 3 .   ? -5.047  12.268  17.556 1.00 21.69 ? 369 HOH A O   1 
HETATM 1866 O O   . HOH C 3 .   ? -4.345  19.603  19.502 1.00 21.77 ? 370 HOH A O   1 
HETATM 1867 O O   . HOH C 3 .   ? -4.074  14.209  21.644 1.00 21.86 ? 371 HOH A O   1 
HETATM 1868 O O   . HOH C 3 .   ? 12.649  22.486  31.079 1.00 21.88 ? 372 HOH A O   1 
HETATM 1869 O O   . HOH C 3 .   ? 20.192  27.263  23.148 1.00 22.05 ? 373 HOH A O   1 
HETATM 1870 O O   . HOH C 3 .   ? -3.650  2.319   14.173 1.00 22.07 ? 374 HOH A O   1 
HETATM 1871 O O   . HOH C 3 .   ? 16.829  -7.894  37.336 1.00 22.29 ? 375 HOH A O   1 
HETATM 1872 O O   . HOH C 3 .   ? 7.642   31.752  14.980 1.00 22.31 ? 376 HOH A O   1 
HETATM 1873 O O   . HOH C 3 .   ? 14.325  -11.137 28.105 1.00 22.34 ? 377 HOH A O   1 
HETATM 1874 O O   . HOH C 3 .   ? 10.931  -6.281  38.022 1.00 22.41 ? 378 HOH A O   1 
HETATM 1875 O O   . HOH C 3 .   ? 19.915  10.376  9.930  1.00 22.58 ? 379 HOH A O   1 
HETATM 1876 O O   . HOH C 3 .   ? 2.078   18.105  21.522 1.00 22.66 ? 380 HOH A O   1 
HETATM 1877 O O   . HOH C 3 .   ? 27.093  19.913  18.404 1.00 22.72 ? 381 HOH A O   1 
HETATM 1878 O O   . HOH C 3 .   ? 21.790  -12.617 32.009 1.00 22.82 ? 382 HOH A O   1 
HETATM 1879 O O   . HOH C 3 .   ? 5.968   -0.685  14.881 1.00 22.83 ? 383 HOH A O   1 
HETATM 1880 O O   . HOH C 3 .   ? 23.024  23.489  19.391 1.00 22.84 ? 384 HOH A O   1 
HETATM 1881 O O   . HOH C 3 .   ? 32.999  7.605   21.559 1.00 22.86 ? 385 HOH A O   1 
HETATM 1882 O O   . HOH C 3 .   ? 27.190  -5.291  16.637 1.00 23.15 ? 386 HOH A O   1 
HETATM 1883 O O   . HOH C 3 .   ? 2.009   13.029  29.976 1.00 23.49 ? 387 HOH A O   1 
HETATM 1884 O O   . HOH C 3 .   ? 7.880   2.895   37.139 1.00 24.06 ? 388 HOH A O   1 
HETATM 1885 O O   . HOH C 3 .   ? 8.592   -4.931  39.103 1.00 24.18 ? 389 HOH A O   1 
HETATM 1886 O O   . HOH C 3 .   ? 11.764  22.169  26.625 1.00 24.19 ? 390 HOH A O   1 
HETATM 1887 O O   . HOH C 3 .   ? 13.105  9.817   7.088  1.00 24.19 ? 391 HOH A O   1 
HETATM 1888 O O   . HOH C 3 .   ? 22.604  17.608  15.613 1.00 24.22 ? 392 HOH A O   1 
HETATM 1889 O O   . HOH C 3 .   ? 17.005  29.549  24.331 1.00 24.45 ? 393 HOH A O   1 
HETATM 1890 O O   . HOH C 3 .   ? 11.687  7.533   7.247  1.00 24.53 ? 394 HOH A O   1 
HETATM 1891 O O   . HOH C 3 .   ? 26.025  4.110   9.769  1.00 24.67 ? 395 HOH A O   1 
HETATM 1892 O O   . HOH C 3 .   ? 25.956  -9.610  23.672 1.00 24.75 ? 396 HOH A O   1 
HETATM 1893 O O   . HOH C 3 .   ? 27.940  13.972  32.974 1.00 25.13 ? 397 HOH A O   1 
HETATM 1894 O O   . HOH C 3 .   ? 10.181  28.954  23.970 1.00 25.64 ? 398 HOH A O   1 
HETATM 1895 O O   . HOH C 3 .   ? 20.255  11.022  35.997 1.00 25.78 ? 399 HOH A O   1 
HETATM 1896 O O   . HOH C 3 .   ? 32.813  0.750   25.806 1.00 25.82 ? 400 HOH A O   1 
HETATM 1897 O O   . HOH C 3 .   ? 21.244  -3.520  35.023 1.00 26.00 ? 401 HOH A O   1 
HETATM 1898 O O   . HOH C 3 .   ? 3.050   1.745   8.270  1.00 26.11 ? 402 HOH A O   1 
HETATM 1899 O O   . HOH C 3 .   ? -3.319  14.527  25.072 1.00 26.13 ? 403 HOH A O   1 
HETATM 1900 O O   . HOH C 3 .   ? 13.576  -10.978 15.614 1.00 26.38 ? 404 HOH A O   1 
HETATM 1901 O O   . HOH C 3 .   ? 4.687   31.593  20.307 1.00 26.43 ? 405 HOH A O   1 
HETATM 1902 O O   . HOH C 3 .   ? 17.568  10.508  36.926 1.00 26.53 ? 406 HOH A O   1 
HETATM 1903 O O   . HOH C 3 .   ? -4.158  7.090   9.747  1.00 26.61 ? 407 HOH A O   1 
HETATM 1904 O O   . HOH C 3 .   ? 4.163   -8.854  25.712 1.00 27.22 ? 408 HOH A O   1 
HETATM 1905 O O   . HOH C 3 .   ? 4.904   29.250  21.061 1.00 27.33 ? 409 HOH A O   1 
HETATM 1906 O O   . HOH C 3 .   ? 14.466  3.047   15.628 1.00 27.37 ? 410 HOH A O   1 
HETATM 1907 O O   . HOH C 3 .   ? 12.123  28.089  11.094 1.00 27.43 ? 411 HOH A O   1 
HETATM 1908 O O   . HOH C 3 .   ? 15.043  -11.358 37.436 1.00 27.70 ? 412 HOH A O   1 
HETATM 1909 O O   . HOH C 3 .   ? 19.249  -4.818  36.403 1.00 27.73 ? 413 HOH A O   1 
HETATM 1910 O O   . HOH C 3 .   ? 29.306  10.400  16.488 1.00 27.74 ? 414 HOH A O   1 
HETATM 1911 O O   . HOH C 3 .   ? 16.264  1.661   11.381 1.00 27.89 ? 415 HOH A O   1 
HETATM 1912 O O   . HOH C 3 .   ? 6.037   -3.140  16.077 1.00 28.14 ? 416 HOH A O   1 
HETATM 1913 O O   . HOH C 3 .   ? -2.375  -0.746  11.746 1.00 28.19 ? 417 HOH A O   1 
HETATM 1914 O O   . HOH C 3 .   ? 16.250  12.787  38.460 1.00 28.34 ? 418 HOH A O   1 
HETATM 1915 O O   . HOH C 3 .   ? 21.271  27.239  20.709 1.00 28.39 ? 419 HOH A O   1 
HETATM 1916 O O   . HOH C 3 .   ? 1.278   27.967  16.292 1.00 28.55 ? 420 HOH A O   1 
HETATM 1917 O O   . HOH C 3 .   ? 17.731  19.395  36.272 1.00 28.58 ? 421 HOH A O   1 
HETATM 1918 O O   . HOH C 3 .   ? 20.662  6.508   37.240 1.00 28.59 ? 422 HOH A O   1 
HETATM 1919 O O   . HOH C 3 .   ? 32.292  0.786   28.253 1.00 28.73 ? 423 HOH A O   1 
HETATM 1920 O O   . HOH C 3 .   ? 13.733  -14.775 31.321 1.00 28.87 ? 424 HOH A O   1 
HETATM 1921 O O   . HOH C 3 .   ? 17.375  27.159  17.221 1.00 28.94 ? 425 HOH A O   1 
HETATM 1922 O O   . HOH C 3 .   ? 22.759  -11.922 22.597 1.00 29.00 ? 426 HOH A O   1 
HETATM 1923 O O   . HOH C 3 .   ? 15.253  -13.228 27.186 1.00 29.04 ? 427 HOH A O   1 
HETATM 1924 O O   . HOH C 3 .   ? 4.908   15.733  26.965 1.00 29.46 ? 428 HOH A O   1 
HETATM 1925 O O   . HOH C 3 .   ? 11.700  16.044  9.919  1.00 29.72 ? 429 HOH A O   1 
HETATM 1926 O O   . HOH C 3 .   ? -2.119  25.223  16.933 1.00 29.83 ? 430 HOH A O   1 
HETATM 1927 O O   . HOH C 3 .   ? 14.201  1.241   38.635 1.00 29.85 ? 431 HOH A O   1 
HETATM 1928 O O   . HOH C 3 .   ? 24.046  6.352   8.839  1.00 29.94 ? 432 HOH A O   1 
HETATM 1929 O O   . HOH C 3 .   ? 1.637   4.083   41.030 1.00 30.02 ? 433 HOH A O   1 
HETATM 1930 O O   . HOH C 3 .   ? 2.621   2.391   5.714  1.00 30.38 ? 434 HOH A O   1 
HETATM 1931 O O   . HOH C 3 .   ? 16.825  24.373  14.274 1.00 30.45 ? 435 HOH A O   1 
HETATM 1932 O O   . HOH C 3 .   ? -0.186  23.953  17.678 1.00 30.57 ? 436 HOH A O   1 
HETATM 1933 O O   . HOH C 3 .   ? -6.472  7.281   11.816 1.00 30.61 ? 437 HOH A O   1 
HETATM 1934 O O   . HOH C 3 .   ? 7.239   13.820  2.166  1.00 30.62 ? 438 HOH A O   1 
HETATM 1935 O O   . HOH C 3 .   ? 0.266   2.336   4.326  1.00 30.80 ? 439 HOH A O   1 
HETATM 1936 O O   . HOH C 3 .   ? 18.901  20.886  11.448 1.00 30.84 ? 440 HOH A O   1 
HETATM 1937 O O   . HOH C 3 .   ? 28.037  -9.537  28.128 1.00 30.85 ? 441 HOH A O   1 
HETATM 1938 O O   . HOH C 3 .   ? 6.705   27.138  21.478 1.00 31.15 ? 442 HOH A O   1 
HETATM 1939 O O   . HOH C 3 .   ? -4.041  10.488  20.090 1.00 31.29 ? 443 HOH A O   1 
HETATM 1940 O O   . HOH C 3 .   ? 23.365  -5.249  9.980  1.00 31.37 ? 444 HOH A O   1 
HETATM 1941 O O   . HOH C 3 .   ? 4.022   8.236   29.676 1.00 31.43 ? 445 HOH A O   1 
HETATM 1942 O O   . HOH C 3 .   ? 21.932  20.599  33.313 1.00 31.75 ? 446 HOH A O   1 
HETATM 1943 O O   . HOH C 3 .   ? 31.371  -6.454  24.344 1.00 31.78 ? 447 HOH A O   1 
HETATM 1944 O O   . HOH C 3 .   ? 27.686  -9.664  30.932 1.00 32.02 ? 448 HOH A O   1 
HETATM 1945 O O   . HOH C 3 .   ? 5.815   -6.653  36.301 1.00 32.06 ? 449 HOH A O   1 
HETATM 1946 O O   . HOH C 3 .   ? 12.481  11.924  36.247 1.00 32.49 ? 450 HOH A O   1 
HETATM 1947 O O   . HOH C 3 .   ? 22.033  17.125  37.432 1.00 32.58 ? 451 HOH A O   1 
HETATM 1948 O O   . HOH C 3 .   ? 7.339   3.741   39.606 1.00 32.78 ? 452 HOH A O   1 
HETATM 1949 O O   . HOH C 3 .   ? 14.006  -1.478  40.032 1.00 32.80 ? 453 HOH A O   1 
HETATM 1950 O O   . HOH C 3 .   ? 3.423   16.958  25.452 1.00 33.05 ? 454 HOH A O   1 
HETATM 1951 O O   . HOH C 3 .   ? 16.727  2.226   40.041 1.00 33.21 ? 455 HOH A O   1 
HETATM 1952 O O   . HOH C 3 .   ? 15.253  3.272   9.355  1.00 33.32 ? 456 HOH A O   1 
HETATM 1953 O O   . HOH C 3 .   ? 5.829   3.308   6.076  1.00 33.42 ? 457 HOH A O   1 
HETATM 1954 O O   . HOH C 3 .   ? -4.019  3.617   8.902  1.00 33.54 ? 458 HOH A O   1 
HETATM 1955 O O   . HOH C 3 .   ? 7.935   -12.311 26.550 1.00 33.55 ? 459 HOH A O   1 
HETATM 1956 O O   . HOH C 3 .   ? 5.106   20.985  9.630  1.00 33.62 ? 460 HOH A O   1 
HETATM 1957 O O   . HOH C 3 .   ? 15.633  -3.097  8.093  1.00 33.82 ? 461 HOH A O   1 
HETATM 1958 O O   . HOH C 3 .   ? 10.229  19.474  30.125 1.00 33.92 ? 462 HOH A O   1 
HETATM 1959 O O   . HOH C 3 .   ? 24.288  11.400  38.033 1.00 33.99 ? 463 HOH A O   1 
HETATM 1960 O O   . HOH C 3 .   ? 22.977  13.345  35.707 1.00 34.02 ? 464 HOH A O   1 
HETATM 1961 O O   . HOH C 3 .   ? 27.495  7.545   14.111 1.00 34.10 ? 465 HOH A O   1 
HETATM 1962 O O   . HOH C 3 .   ? 1.275   6.198   4.812  1.00 34.10 ? 466 HOH A O   1 
HETATM 1963 O O   . HOH C 3 .   ? 22.439  29.348  21.225 1.00 34.24 ? 467 HOH A O   1 
HETATM 1964 O O   . HOH C 3 .   ? 19.554  29.877  22.993 1.00 34.25 ? 468 HOH A O   1 
HETATM 1965 O O   . HOH C 3 .   ? 24.760  21.610  31.751 1.00 34.30 ? 469 HOH A O   1 
HETATM 1966 O O   . HOH C 3 .   ? 9.101   -10.368 35.946 1.00 34.44 ? 470 HOH A O   1 
HETATM 1967 O O   . HOH C 3 .   ? 21.617  -14.022 15.816 1.00 34.81 ? 471 HOH A O   1 
HETATM 1968 O O   . HOH C 3 .   ? 1.675   15.903  7.154  1.00 35.05 ? 472 HOH A O   1 
HETATM 1969 O O   . HOH C 3 .   ? 17.079  27.113  34.922 1.00 35.24 ? 473 HOH A O   1 
HETATM 1970 O O   . HOH C 3 .   ? 1.980   18.088  5.713  1.00 35.35 ? 474 HOH A O   1 
HETATM 1971 O O   . HOH C 3 .   ? 2.655   19.671  31.142 1.00 35.58 ? 475 HOH A O   1 
HETATM 1972 O O   . HOH C 3 .   ? 17.434  -1.304  10.408 1.00 35.60 ? 476 HOH A O   1 
HETATM 1973 O O   . HOH C 3 .   ? 14.718  -11.887 13.419 1.00 35.61 ? 477 HOH A O   1 
HETATM 1974 O O   . HOH C 3 .   ? -2.318  10.479  2.895  1.00 35.63 ? 478 HOH A O   1 
HETATM 1975 O O   . HOH C 3 .   ? 27.585  17.188  31.977 1.00 35.66 ? 479 HOH A O   1 
HETATM 1976 O O   . HOH C 3 .   ? 14.802  3.500   12.864 1.00 36.00 ? 480 HOH A O   1 
HETATM 1977 O O   . HOH C 3 .   ? -6.229  4.020   22.080 1.00 36.01 ? 481 HOH A O   1 
HETATM 1978 O O   . HOH C 3 .   ? 21.330  15.047  10.918 1.00 36.58 ? 482 HOH A O   1 
HETATM 1979 O O   . HOH C 3 .   ? 21.792  15.344  14.367 1.00 37.04 ? 483 HOH A O   1 
HETATM 1980 O O   . HOH C 3 .   ? 8.888   18.964  26.959 1.00 37.11 ? 484 HOH A O   1 
HETATM 1981 O O   . HOH C 3 .   ? -0.008  5.623   1.939  1.00 37.24 ? 485 HOH A O   1 
HETATM 1982 O O   . HOH C 3 .   ? 16.334  -9.567  7.832  1.00 37.25 ? 486 HOH A O   1 
HETATM 1983 O O   . HOH C 3 .   ? 23.691  24.354  34.732 1.00 37.27 ? 487 HOH A O   1 
HETATM 1984 O O   . HOH C 3 .   ? 16.457  31.912  24.796 1.00 37.28 ? 488 HOH A O   1 
HETATM 1985 O O   . HOH C 3 .   ? 24.354  26.331  21.412 1.00 37.31 ? 489 HOH A O   1 
HETATM 1986 O O   . HOH C 3 .   ? 18.685  27.936  19.666 1.00 37.55 ? 490 HOH A O   1 
HETATM 1987 O O   . HOH C 3 .   ? -4.746  18.621  8.189  1.00 37.76 ? 491 HOH A O   1 
HETATM 1988 O O   . HOH C 3 .   ? 34.124  -2.016  29.057 1.00 37.89 ? 492 HOH A O   1 
HETATM 1989 O O   . HOH C 3 .   ? -4.396  5.600   48.576 1.00 37.91 ? 493 HOH A O   1 
HETATM 1990 O O   . HOH C 3 .   ? 5.055   -2.827  12.794 1.00 38.19 ? 494 HOH A O   1 
HETATM 1991 O O   . HOH C 3 .   ? 26.671  9.942   31.357 1.00 38.58 ? 495 HOH A O   1 
HETATM 1992 O O   . HOH C 3 .   ? 30.780  20.870  29.241 1.00 38.82 ? 496 HOH A O   1 
HETATM 1993 O O   . HOH C 3 .   ? 8.817   2.743   15.007 1.00 39.04 ? 497 HOH A O   1 
HETATM 1994 O O   . HOH C 3 .   ? -3.107  21.642  20.000 1.00 39.05 ? 498 HOH A O   1 
HETATM 1995 O O   . HOH C 3 .   ? -1.977  0.363   8.026  1.00 39.12 ? 499 HOH A O   1 
HETATM 1996 O O   . HOH C 3 .   ? 25.178  -13.027 32.085 1.00 39.56 ? 500 HOH A O   1 
HETATM 1997 O O   . HOH C 3 .   ? 11.366  3.470   13.794 1.00 40.00 ? 501 HOH A O   1 
HETATM 1998 O O   . HOH C 3 .   ? 2.393   13.696  6.241  1.00 40.20 ? 502 HOH A O   1 
HETATM 1999 O O   . HOH C 3 .   ? 5.442   21.066  6.711  1.00 40.22 ? 503 HOH A O   1 
HETATM 2000 O O   . HOH C 3 .   ? 7.425   33.871  18.177 1.00 40.39 ? 504 HOH A O   1 
HETATM 2001 O O   . HOH C 3 .   ? -1.204  -6.775  43.728 1.00 40.43 ? 505 HOH A O   1 
HETATM 2002 O O   . HOH C 3 .   ? 36.262  17.415  21.824 1.00 40.46 ? 506 HOH A O   1 
HETATM 2003 O O   . HOH C 3 .   ? 33.231  14.452  28.776 1.00 40.68 ? 507 HOH A O   1 
HETATM 2004 O O   . HOH C 3 .   ? 10.771  31.092  27.760 1.00 41.22 ? 508 HOH A O   1 
HETATM 2005 O O   . HOH C 3 .   ? 3.940   4.327   4.673  1.00 41.40 ? 509 HOH A O   1 
HETATM 2006 O O   . HOH C 3 .   ? 2.000   -7.065  28.337 1.00 41.42 ? 510 HOH A O   1 
HETATM 2007 O O   . HOH C 3 .   ? 0.079   -3.846  33.487 1.00 41.77 ? 511 HOH A O   1 
HETATM 2008 O O   . HOH C 3 .   ? 24.855  14.343  12.702 1.00 41.85 ? 512 HOH A O   1 
HETATM 2009 O O   . HOH C 3 .   ? 17.166  -14.316 25.973 1.00 42.02 ? 513 HOH A O   1 
HETATM 2010 O O   . HOH C 3 .   ? -9.496  10.776  16.741 1.00 42.16 ? 514 HOH A O   1 
HETATM 2011 O O   . HOH C 3 .   ? 18.814  7.758   39.212 1.00 42.25 ? 515 HOH A O   1 
HETATM 2012 O O   . HOH C 3 .   ? 11.488  -14.292 35.523 1.00 42.33 ? 516 HOH A O   1 
HETATM 2013 O O   . HOH C 3 .   ? 7.989   22.770  9.670  1.00 42.60 ? 517 HOH A O   1 
HETATM 2014 O O   . HOH C 3 .   ? -7.838  21.374  18.572 1.00 42.60 ? 518 HOH A O   1 
HETATM 2015 O O   . HOH C 3 .   ? -0.884  8.231   6.417  1.00 42.63 ? 519 HOH A O   1 
HETATM 2016 O O   . HOH C 3 .   ? 9.807   31.319  25.308 1.00 42.79 ? 520 HOH A O   1 
HETATM 2017 O O   . HOH C 3 .   ? 34.680  12.587  17.550 1.00 43.03 ? 521 HOH A O   1 
HETATM 2018 O O   . HOH C 3 .   ? 15.885  -5.194  6.715  1.00 43.13 ? 522 HOH A O   1 
HETATM 2019 O O   . HOH C 3 .   ? -1.796  17.304  6.603  1.00 43.17 ? 523 HOH A O   1 
HETATM 2020 O O   . HOH C 3 .   ? 12.573  25.838  32.802 1.00 43.29 ? 524 HOH A O   1 
HETATM 2021 O O   . HOH C 3 .   ? -9.530  13.496  13.630 1.00 43.40 ? 525 HOH A O   1 
HETATM 2022 O O   . HOH C 3 .   ? 1.802   -2.206  10.667 1.00 43.40 ? 526 HOH A O   1 
HETATM 2023 O O   . HOH C 3 .   ? 13.914  18.038  36.743 1.00 43.99 ? 527 HOH A O   1 
HETATM 2024 O O   . HOH C 3 .   ? 13.347  17.767  8.604  1.00 44.14 ? 528 HOH A O   1 
HETATM 2025 O O   . HOH C 3 .   ? 0.391   4.816   30.099 1.00 44.36 ? 529 HOH A O   1 
HETATM 2026 O O   . HOH C 3 .   ? 34.501  7.846   40.003 1.00 44.66 ? 530 HOH A O   1 
HETATM 2027 O O   . HOH C 3 .   ? 31.573  -3.111  21.393 1.00 44.75 ? 531 HOH A O   1 
HETATM 2028 O O   . HOH C 3 .   ? 34.204  7.599   24.323 1.00 44.79 ? 532 HOH A O   1 
HETATM 2029 O O   . HOH C 3 .   ? -1.792  6.189   24.130 1.00 44.80 ? 533 HOH A O   1 
HETATM 2030 O O   . HOH C 3 .   ? 17.083  13.001  7.530  1.00 44.86 ? 534 HOH A O   1 
HETATM 2031 O O   . HOH C 3 .   ? 11.284  17.195  4.200  1.00 45.02 ? 535 HOH A O   1 
HETATM 2032 O O   . HOH C 3 .   ? 30.508  -7.065  21.127 1.00 45.30 ? 536 HOH A O   1 
HETATM 2033 O O   . HOH C 3 .   ? -8.565  9.230   19.549 1.00 45.30 ? 537 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? 28.850  -9.402  24.517 1.00 45.53 ? 538 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? -6.089  0.560   24.585 1.00 46.00 ? 539 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? 17.886  13.575  10.276 1.00 46.18 ? 540 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? 2.019   6.414   31.682 1.00 46.19 ? 541 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? -4.860  -0.956  22.416 1.00 46.23 ? 542 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? -5.730  8.041   21.252 1.00 46.27 ? 543 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? -0.488  -7.903  41.569 1.00 46.70 ? 544 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? 2.026   25.542  20.169 1.00 46.78 ? 545 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? 33.010  -0.777  35.891 1.00 46.79 ? 546 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 13.520  -15.808 20.785 1.00 46.99 ? 547 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 8.681   33.968  13.944 1.00 47.40 ? 548 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 30.797  4.151   40.100 1.00 47.67 ? 549 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 36.542  5.487   31.433 1.00 47.80 ? 550 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 17.357  16.555  10.149 1.00 48.11 ? 551 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? -5.721  16.568  6.995  1.00 48.13 ? 552 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 13.923  11.323  38.087 1.00 48.58 ? 553 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 14.835  24.621  9.616  1.00 48.69 ? 554 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 17.410  -0.192  40.746 1.00 48.99 ? 555 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 16.485  29.418  16.260 1.00 49.74 ? 556 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? -5.213  17.887  21.769 1.00 50.12 ? 557 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 37.609  7.554   34.834 1.00 50.41 ? 558 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 11.177  0.212   15.083 1.00 50.87 ? 559 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? 13.739  -1.687  11.055 1.00 50.99 ? 560 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? 10.503  17.356  34.564 1.00 51.03 ? 561 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? -7.372  12.513  16.707 1.00 51.14 ? 562 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? 21.286  0.861   39.434 1.00 51.33 ? 563 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? 10.153  19.497  6.020  1.00 51.53 ? 564 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 12.864  20.751  35.195 1.00 52.19 ? 565 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? -3.889  8.163   6.875  1.00 52.65 ? 566 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 16.425  5.020   14.285 1.00 52.97 ? 567 HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 28.413  19.927  31.364 1.00 53.17 ? 568 HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? -8.008  13.281  7.156  1.00 53.19 ? 569 HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? -3.861  8.840   27.771 1.00 53.46 ? 570 HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? -2.157  1.403   30.042 1.00 53.58 ? 571 HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 36.698  9.692   26.095 1.00 53.92 ? 572 HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? 9.280   14.666  36.012 1.00 54.05 ? 573 HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? 2.058   -6.482  31.543 1.00 54.23 ? 574 HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? -0.457  -1.183  9.958  1.00 54.35 ? 575 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 20.548  25.460  37.573 1.00 55.39 ? 576 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 19.634  17.525  37.273 1.00 57.04 ? 577 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 HIS 136 136 136 HIS HIS A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 HIS 155 155 155 HIS HIS A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 HIS 194 194 194 HIS HIS A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 CYS 200 200 200 CYS CYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ASN 207 207 207 ASN ASN A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 GLN 212 212 212 GLN GLN A . n 
A 1 213 HIS 213 213 213 HIS HIS A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 TRP 220 220 220 TRP TRP A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 URA 1   230 230 URA URA A . 
C 3 HOH 1   301 301 HOH HOH A . 
C 3 HOH 2   302 302 HOH HOH A . 
C 3 HOH 3   303 303 HOH HOH A . 
C 3 HOH 4   304 304 HOH HOH A . 
C 3 HOH 5   305 305 HOH HOH A . 
C 3 HOH 6   306 306 HOH HOH A . 
C 3 HOH 7   307 307 HOH HOH A . 
C 3 HOH 8   308 308 HOH HOH A . 
C 3 HOH 9   309 309 HOH HOH A . 
C 3 HOH 10  310 310 HOH HOH A . 
C 3 HOH 11  311 311 HOH HOH A . 
C 3 HOH 12  312 312 HOH HOH A . 
C 3 HOH 13  313 313 HOH HOH A . 
C 3 HOH 14  314 314 HOH HOH A . 
C 3 HOH 15  315 315 HOH HOH A . 
C 3 HOH 16  316 316 HOH HOH A . 
C 3 HOH 17  317 317 HOH HOH A . 
C 3 HOH 18  318 318 HOH HOH A . 
C 3 HOH 19  319 319 HOH HOH A . 
C 3 HOH 20  320 320 HOH HOH A . 
C 3 HOH 21  321 321 HOH HOH A . 
C 3 HOH 22  322 322 HOH HOH A . 
C 3 HOH 23  323 323 HOH HOH A . 
C 3 HOH 24  324 324 HOH HOH A . 
C 3 HOH 25  325 325 HOH HOH A . 
C 3 HOH 26  326 326 HOH HOH A . 
C 3 HOH 27  327 327 HOH HOH A . 
C 3 HOH 28  328 328 HOH HOH A . 
C 3 HOH 29  329 329 HOH HOH A . 
C 3 HOH 30  330 330 HOH HOH A . 
C 3 HOH 31  331 331 HOH HOH A . 
C 3 HOH 32  332 332 HOH HOH A . 
C 3 HOH 33  333 333 HOH HOH A . 
C 3 HOH 34  334 334 HOH HOH A . 
C 3 HOH 35  335 335 HOH HOH A . 
C 3 HOH 36  336 336 HOH HOH A . 
C 3 HOH 37  337 337 HOH HOH A . 
C 3 HOH 38  338 338 HOH HOH A . 
C 3 HOH 39  339 339 HOH HOH A . 
C 3 HOH 40  340 340 HOH HOH A . 
C 3 HOH 41  341 341 HOH HOH A . 
C 3 HOH 42  342 342 HOH HOH A . 
C 3 HOH 43  343 343 HOH HOH A . 
C 3 HOH 44  344 344 HOH HOH A . 
C 3 HOH 45  345 345 HOH HOH A . 
C 3 HOH 46  346 346 HOH HOH A . 
C 3 HOH 47  347 347 HOH HOH A . 
C 3 HOH 48  348 348 HOH HOH A . 
C 3 HOH 49  349 349 HOH HOH A . 
C 3 HOH 50  350 350 HOH HOH A . 
C 3 HOH 51  351 351 HOH HOH A . 
C 3 HOH 52  352 352 HOH HOH A . 
C 3 HOH 53  353 353 HOH HOH A . 
C 3 HOH 54  354 354 HOH HOH A . 
C 3 HOH 55  355 355 HOH HOH A . 
C 3 HOH 56  356 356 HOH HOH A . 
C 3 HOH 57  357 357 HOH HOH A . 
C 3 HOH 58  358 358 HOH HOH A . 
C 3 HOH 59  359 359 HOH HOH A . 
C 3 HOH 60  360 360 HOH HOH A . 
C 3 HOH 61  361 361 HOH HOH A . 
C 3 HOH 62  362 362 HOH HOH A . 
C 3 HOH 63  363 363 HOH HOH A . 
C 3 HOH 64  364 364 HOH HOH A . 
C 3 HOH 65  365 365 HOH HOH A . 
C 3 HOH 66  366 366 HOH HOH A . 
C 3 HOH 67  367 367 HOH HOH A . 
C 3 HOH 68  368 368 HOH HOH A . 
C 3 HOH 69  369 369 HOH HOH A . 
C 3 HOH 70  370 370 HOH HOH A . 
C 3 HOH 71  371 371 HOH HOH A . 
C 3 HOH 72  372 372 HOH HOH A . 
C 3 HOH 73  373 373 HOH HOH A . 
C 3 HOH 74  374 374 HOH HOH A . 
C 3 HOH 75  375 375 HOH HOH A . 
C 3 HOH 76  376 376 HOH HOH A . 
C 3 HOH 77  377 377 HOH HOH A . 
C 3 HOH 78  378 378 HOH HOH A . 
C 3 HOH 79  379 379 HOH HOH A . 
C 3 HOH 80  380 380 HOH HOH A . 
C 3 HOH 81  381 381 HOH HOH A . 
C 3 HOH 82  382 382 HOH HOH A . 
C 3 HOH 83  383 383 HOH HOH A . 
C 3 HOH 84  384 384 HOH HOH A . 
C 3 HOH 85  385 385 HOH HOH A . 
C 3 HOH 86  386 386 HOH HOH A . 
C 3 HOH 87  387 387 HOH HOH A . 
C 3 HOH 88  388 388 HOH HOH A . 
C 3 HOH 89  389 389 HOH HOH A . 
C 3 HOH 90  390 390 HOH HOH A . 
C 3 HOH 91  391 391 HOH HOH A . 
C 3 HOH 92  392 392 HOH HOH A . 
C 3 HOH 93  393 393 HOH HOH A . 
C 3 HOH 94  394 394 HOH HOH A . 
C 3 HOH 95  395 395 HOH HOH A . 
C 3 HOH 96  396 396 HOH HOH A . 
C 3 HOH 97  397 397 HOH HOH A . 
C 3 HOH 98  398 398 HOH HOH A . 
C 3 HOH 99  399 399 HOH HOH A . 
C 3 HOH 100 400 400 HOH HOH A . 
C 3 HOH 101 401 401 HOH HOH A . 
C 3 HOH 102 402 402 HOH HOH A . 
C 3 HOH 103 403 403 HOH HOH A . 
C 3 HOH 104 404 404 HOH HOH A . 
C 3 HOH 105 405 405 HOH HOH A . 
C 3 HOH 106 406 406 HOH HOH A . 
C 3 HOH 107 407 407 HOH HOH A . 
C 3 HOH 108 408 408 HOH HOH A . 
C 3 HOH 109 409 409 HOH HOH A . 
C 3 HOH 110 410 410 HOH HOH A . 
C 3 HOH 111 411 411 HOH HOH A . 
C 3 HOH 112 412 412 HOH HOH A . 
C 3 HOH 113 413 413 HOH HOH A . 
C 3 HOH 114 414 414 HOH HOH A . 
C 3 HOH 115 415 415 HOH HOH A . 
C 3 HOH 116 416 416 HOH HOH A . 
C 3 HOH 117 417 417 HOH HOH A . 
C 3 HOH 118 418 418 HOH HOH A . 
C 3 HOH 119 419 419 HOH HOH A . 
C 3 HOH 120 420 420 HOH HOH A . 
C 3 HOH 121 421 421 HOH HOH A . 
C 3 HOH 122 422 422 HOH HOH A . 
C 3 HOH 123 423 423 HOH HOH A . 
C 3 HOH 124 424 424 HOH HOH A . 
C 3 HOH 125 425 425 HOH HOH A . 
C 3 HOH 126 426 426 HOH HOH A . 
C 3 HOH 127 427 427 HOH HOH A . 
C 3 HOH 128 428 428 HOH HOH A . 
C 3 HOH 129 429 429 HOH HOH A . 
C 3 HOH 130 430 430 HOH HOH A . 
C 3 HOH 131 431 431 HOH HOH A . 
C 3 HOH 132 432 432 HOH HOH A . 
C 3 HOH 133 433 433 HOH HOH A . 
C 3 HOH 134 434 434 HOH HOH A . 
C 3 HOH 135 435 435 HOH HOH A . 
C 3 HOH 136 436 436 HOH HOH A . 
C 3 HOH 137 437 437 HOH HOH A . 
C 3 HOH 138 438 438 HOH HOH A . 
C 3 HOH 139 439 439 HOH HOH A . 
C 3 HOH 140 440 440 HOH HOH A . 
C 3 HOH 141 441 441 HOH HOH A . 
C 3 HOH 142 442 442 HOH HOH A . 
C 3 HOH 143 443 443 HOH HOH A . 
C 3 HOH 144 444 444 HOH HOH A . 
C 3 HOH 145 445 445 HOH HOH A . 
C 3 HOH 146 446 446 HOH HOH A . 
C 3 HOH 147 447 447 HOH HOH A . 
C 3 HOH 148 448 448 HOH HOH A . 
C 3 HOH 149 449 449 HOH HOH A . 
C 3 HOH 150 450 450 HOH HOH A . 
C 3 HOH 151 451 451 HOH HOH A . 
C 3 HOH 152 452 452 HOH HOH A . 
C 3 HOH 153 453 453 HOH HOH A . 
C 3 HOH 154 454 454 HOH HOH A . 
C 3 HOH 155 455 455 HOH HOH A . 
C 3 HOH 156 456 456 HOH HOH A . 
C 3 HOH 157 457 457 HOH HOH A . 
C 3 HOH 158 458 458 HOH HOH A . 
C 3 HOH 159 459 459 HOH HOH A . 
C 3 HOH 160 460 460 HOH HOH A . 
C 3 HOH 161 461 461 HOH HOH A . 
C 3 HOH 162 462 462 HOH HOH A . 
C 3 HOH 163 463 463 HOH HOH A . 
C 3 HOH 164 464 464 HOH HOH A . 
C 3 HOH 165 465 465 HOH HOH A . 
C 3 HOH 166 466 466 HOH HOH A . 
C 3 HOH 167 467 467 HOH HOH A . 
C 3 HOH 168 468 468 HOH HOH A . 
C 3 HOH 169 469 469 HOH HOH A . 
C 3 HOH 170 470 470 HOH HOH A . 
C 3 HOH 171 471 471 HOH HOH A . 
C 3 HOH 172 472 472 HOH HOH A . 
C 3 HOH 173 473 473 HOH HOH A . 
C 3 HOH 174 474 474 HOH HOH A . 
C 3 HOH 175 475 475 HOH HOH A . 
C 3 HOH 176 476 476 HOH HOH A . 
C 3 HOH 177 477 477 HOH HOH A . 
C 3 HOH 178 478 478 HOH HOH A . 
C 3 HOH 179 479 479 HOH HOH A . 
C 3 HOH 180 480 480 HOH HOH A . 
C 3 HOH 181 481 481 HOH HOH A . 
C 3 HOH 182 482 482 HOH HOH A . 
C 3 HOH 183 483 483 HOH HOH A . 
C 3 HOH 184 484 484 HOH HOH A . 
C 3 HOH 185 485 485 HOH HOH A . 
C 3 HOH 186 486 486 HOH HOH A . 
C 3 HOH 187 487 487 HOH HOH A . 
C 3 HOH 188 488 488 HOH HOH A . 
C 3 HOH 189 489 489 HOH HOH A . 
C 3 HOH 190 490 490 HOH HOH A . 
C 3 HOH 191 491 491 HOH HOH A . 
C 3 HOH 192 492 492 HOH HOH A . 
C 3 HOH 193 493 493 HOH HOH A . 
C 3 HOH 194 494 494 HOH HOH A . 
C 3 HOH 195 495 495 HOH HOH A . 
C 3 HOH 196 496 496 HOH HOH A . 
C 3 HOH 197 497 497 HOH HOH A . 
C 3 HOH 198 498 498 HOH HOH A . 
C 3 HOH 199 499 499 HOH HOH A . 
C 3 HOH 200 500 500 HOH HOH A . 
C 3 HOH 201 501 501 HOH HOH A . 
C 3 HOH 202 502 502 HOH HOH A . 
C 3 HOH 203 503 503 HOH HOH A . 
C 3 HOH 204 504 504 HOH HOH A . 
C 3 HOH 205 505 505 HOH HOH A . 
C 3 HOH 206 506 506 HOH HOH A . 
C 3 HOH 207 507 507 HOH HOH A . 
C 3 HOH 208 508 508 HOH HOH A . 
C 3 HOH 209 509 509 HOH HOH A . 
C 3 HOH 210 510 510 HOH HOH A . 
C 3 HOH 211 511 511 HOH HOH A . 
C 3 HOH 212 512 512 HOH HOH A . 
C 3 HOH 213 513 513 HOH HOH A . 
C 3 HOH 214 514 514 HOH HOH A . 
C 3 HOH 215 515 515 HOH HOH A . 
C 3 HOH 216 516 516 HOH HOH A . 
C 3 HOH 217 517 517 HOH HOH A . 
C 3 HOH 218 518 518 HOH HOH A . 
C 3 HOH 219 519 519 HOH HOH A . 
C 3 HOH 220 520 520 HOH HOH A . 
C 3 HOH 221 521 521 HOH HOH A . 
C 3 HOH 222 522 522 HOH HOH A . 
C 3 HOH 223 523 523 HOH HOH A . 
C 3 HOH 224 524 524 HOH HOH A . 
C 3 HOH 225 525 525 HOH HOH A . 
C 3 HOH 226 526 526 HOH HOH A . 
C 3 HOH 227 527 527 HOH HOH A . 
C 3 HOH 228 528 528 HOH HOH A . 
C 3 HOH 229 529 529 HOH HOH A . 
C 3 HOH 230 530 530 HOH HOH A . 
C 3 HOH 231 531 531 HOH HOH A . 
C 3 HOH 232 532 532 HOH HOH A . 
C 3 HOH 233 533 533 HOH HOH A . 
C 3 HOH 234 534 534 HOH HOH A . 
C 3 HOH 235 535 535 HOH HOH A . 
C 3 HOH 236 536 536 HOH HOH A . 
C 3 HOH 237 537 537 HOH HOH A . 
C 3 HOH 238 538 538 HOH HOH A . 
C 3 HOH 239 539 539 HOH HOH A . 
C 3 HOH 240 540 540 HOH HOH A . 
C 3 HOH 241 541 541 HOH HOH A . 
C 3 HOH 242 542 542 HOH HOH A . 
C 3 HOH 243 543 543 HOH HOH A . 
C 3 HOH 244 544 544 HOH HOH A . 
C 3 HOH 245 545 545 HOH HOH A . 
C 3 HOH 246 546 546 HOH HOH A . 
C 3 HOH 247 547 547 HOH HOH A . 
C 3 HOH 248 548 548 HOH HOH A . 
C 3 HOH 249 549 549 HOH HOH A . 
C 3 HOH 250 550 550 HOH HOH A . 
C 3 HOH 251 551 551 HOH HOH A . 
C 3 HOH 252 552 552 HOH HOH A . 
C 3 HOH 253 553 553 HOH HOH A . 
C 3 HOH 254 554 554 HOH HOH A . 
C 3 HOH 255 555 555 HOH HOH A . 
C 3 HOH 256 556 556 HOH HOH A . 
C 3 HOH 257 557 557 HOH HOH A . 
C 3 HOH 258 558 558 HOH HOH A . 
C 3 HOH 259 559 559 HOH HOH A . 
C 3 HOH 260 560 560 HOH HOH A . 
C 3 HOH 261 561 561 HOH HOH A . 
C 3 HOH 262 562 562 HOH HOH A . 
C 3 HOH 263 563 563 HOH HOH A . 
C 3 HOH 264 564 564 HOH HOH A . 
C 3 HOH 265 565 565 HOH HOH A . 
C 3 HOH 266 566 566 HOH HOH A . 
C 3 HOH 267 567 567 HOH HOH A . 
C 3 HOH 268 568 568 HOH HOH A . 
C 3 HOH 269 569 569 HOH HOH A . 
C 3 HOH 270 570 570 HOH HOH A . 
C 3 HOH 271 571 571 HOH HOH A . 
C 3 HOH 272 572 572 HOH HOH A . 
C 3 HOH 273 573 573 HOH HOH A . 
C 3 HOH 274 574 574 HOH HOH A . 
C 3 HOH 275 575 575 HOH HOH A . 
C 3 HOH 276 576 576 HOH HOH A . 
C 3 HOH 277 577 577 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-10-13 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' struct_ref_seq_dif 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-GEN     'data scaling'   . ? 1 
X-GEN     'data reduction' . ? 2 
SHELXL-97 'model building' . ? 3 
SHELXL-97 refinement       . ? 4 
SHELXL-97 phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH2 A ARG 80  ? ? 116.18 120.30 -4.12 0.50 N 
2 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH2 A ARG 105 ? ? 116.59 120.30 -3.71 0.50 N 
3 1 CD A ARG 156 ? ? NE A ARG 156 ? ? CZ  A ARG 156 ? ? 133.37 123.60 9.77  1.40 N 
4 1 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.50 120.30 3.20  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 71  ? ? -86.65  -74.58  
2 1 HIS A 73  ? ? -146.95 32.74   
3 1 PHE A 77  ? ? 70.18   -13.34  
4 1 LEU A 121 ? ? -102.33 79.28   
5 1 LEU A 139 ? ? -73.68  -152.25 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 A ASN 3 ? A ASN 3 
4 1 Y 1 A GLU 4 ? A GLU 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 URACIL URA 
3 water  HOH 
#