data_2EX4
# 
_entry.id   2EX4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EX4         
RCSB  RCSB035200   
WWPDB D_1000035200 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EX4 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Min, J.R.'                            1  
'Wu, H.'                               2  
'Zeng, H.'                             3  
'Loppnau, P.'                          4  
'Sundstrom, M.'                        5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Plotnikov, A.N.'                      9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'The Crystal Structure of Human AD-003 protein in complex with S-adenosyl-L-homocysteine' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Min, J.'          1 
primary 'Wu, H.'           2 
primary 'Zeng, H.'         3 
primary 'Loppnau, P.'      4 
primary 'Sundstrom, M.'    5 
primary 'Arrowsmith, C.H.' 6 
primary 'Edwards, A.M.'    7 
primary 'Bochkarev, A.'    8 
primary 'Plotnikov, A.N.'  9 
# 
_cell.entry_id           2EX4 
_cell.length_a           43.922 
_cell.length_b           47.367 
_cell.length_c           64.734 
_cell.angle_alpha        105.72 
_cell.angle_beta         88.18 
_cell.angle_gamma        115.97 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2EX4 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'adrenal gland protein AD-003' 27320.074 2   ? ? ? ? 
2 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE      384.411   2   ? ? ? ? 
3 water       nat water                          18.015    555 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGT
SCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLT
DQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFAL
R
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGT
SCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLT
DQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFAL
R
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  THR n 
1 21  SER n 
1 22  GLU n 
1 23  VAL n 
1 24  ILE n 
1 25  GLU n 
1 26  ASP n 
1 27  GLU n 
1 28  LYS n 
1 29  GLN n 
1 30  PHE n 
1 31  TYR n 
1 32  SER n 
1 33  LYS n 
1 34  ALA n 
1 35  LYS n 
1 36  THR n 
1 37  TYR n 
1 38  TRP n 
1 39  LYS n 
1 40  GLN n 
1 41  ILE n 
1 42  PRO n 
1 43  PRO n 
1 44  THR n 
1 45  VAL n 
1 46  ASP n 
1 47  GLY n 
1 48  MET n 
1 49  LEU n 
1 50  GLY n 
1 51  GLY n 
1 52  TYR n 
1 53  GLY n 
1 54  HIS n 
1 55  ILE n 
1 56  SER n 
1 57  SER n 
1 58  ILE n 
1 59  ASP n 
1 60  ILE n 
1 61  ASN n 
1 62  SER n 
1 63  SER n 
1 64  ARG n 
1 65  LYS n 
1 66  PHE n 
1 67  LEU n 
1 68  GLN n 
1 69  ARG n 
1 70  PHE n 
1 71  LEU n 
1 72  ARG n 
1 73  GLU n 
1 74  GLY n 
1 75  PRO n 
1 76  ASN n 
1 77  LYS n 
1 78  THR n 
1 79  GLY n 
1 80  THR n 
1 81  SER n 
1 82  CYS n 
1 83  ALA n 
1 84  LEU n 
1 85  ASP n 
1 86  CYS n 
1 87  GLY n 
1 88  ALA n 
1 89  GLY n 
1 90  ILE n 
1 91  GLY n 
1 92  ARG n 
1 93  ILE n 
1 94  THR n 
1 95  LYS n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 PRO n 
1 101 LEU n 
1 102 PHE n 
1 103 ARG n 
1 104 GLU n 
1 105 VAL n 
1 106 ASP n 
1 107 MET n 
1 108 VAL n 
1 109 ASP n 
1 110 ILE n 
1 111 THR n 
1 112 GLU n 
1 113 ASP n 
1 114 PHE n 
1 115 LEU n 
1 116 VAL n 
1 117 GLN n 
1 118 ALA n 
1 119 LYS n 
1 120 THR n 
1 121 TYR n 
1 122 LEU n 
1 123 GLY n 
1 124 GLU n 
1 125 GLU n 
1 126 GLY n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 ARG n 
1 131 ASN n 
1 132 TYR n 
1 133 PHE n 
1 134 CYS n 
1 135 CYS n 
1 136 GLY n 
1 137 LEU n 
1 138 GLN n 
1 139 ASP n 
1 140 PHE n 
1 141 THR n 
1 142 PRO n 
1 143 GLU n 
1 144 PRO n 
1 145 ASP n 
1 146 SER n 
1 147 TYR n 
1 148 ASP n 
1 149 VAL n 
1 150 ILE n 
1 151 TRP n 
1 152 ILE n 
1 153 GLN n 
1 154 TRP n 
1 155 VAL n 
1 156 ILE n 
1 157 GLY n 
1 158 HIS n 
1 159 LEU n 
1 160 THR n 
1 161 ASP n 
1 162 GLN n 
1 163 HIS n 
1 164 LEU n 
1 165 ALA n 
1 166 GLU n 
1 167 PHE n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 CYS n 
1 172 LYS n 
1 173 GLY n 
1 174 SER n 
1 175 LEU n 
1 176 ARG n 
1 177 PRO n 
1 178 ASN n 
1 179 GLY n 
1 180 ILE n 
1 181 ILE n 
1 182 VAL n 
1 183 ILE n 
1 184 LYS n 
1 185 ASP n 
1 186 ASN n 
1 187 MET n 
1 188 ALA n 
1 189 GLN n 
1 190 GLU n 
1 191 GLY n 
1 192 VAL n 
1 193 ILE n 
1 194 LEU n 
1 195 ASP n 
1 196 ASP n 
1 197 VAL n 
1 198 ASP n 
1 199 SER n 
1 200 SER n 
1 201 VAL n 
1 202 CYS n 
1 203 ARG n 
1 204 ASP n 
1 205 LEU n 
1 206 ASP n 
1 207 VAL n 
1 208 VAL n 
1 209 ARG n 
1 210 ARG n 
1 211 ILE n 
1 212 ILE n 
1 213 CYS n 
1 214 SER n 
1 215 ALA n 
1 216 GLY n 
1 217 LEU n 
1 218 SER n 
1 219 LEU n 
1 220 LEU n 
1 221 ALA n 
1 222 GLU n 
1 223 GLU n 
1 224 ARG n 
1 225 GLN n 
1 226 GLU n 
1 227 ASN n 
1 228 LEU n 
1 229 PRO n 
1 230 ASP n 
1 231 GLU n 
1 232 ILE n 
1 233 TYR n 
1 234 HIS n 
1 235 VAL n 
1 236 TYR n 
1 237 SER n 
1 238 PHE n 
1 239 ALA n 
1 240 LEU n 
1 241 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'E.coli BL21 (DE3) codon plus RIL (Stratagene)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       p28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CI032_HUMAN 
_struct_ref.pdbx_db_accession          Q9BV86 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLL
LPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPN
GIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2EX4 A 20 ? 240 ? Q9BV86 2 ? 224 ? 2 223 
2 1 2EX4 B 20 ? 240 ? Q9BV86 2 ? 224 ? 2 223 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EX4 MET A 1  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -17 1  
1 2EX4 GLY A 2  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -16 2  
1 2EX4 SER A 3  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -15 3  
1 2EX4 SER A 4  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -14 4  
1 2EX4 HIS A 5  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -13 5  
1 2EX4 HIS A 6  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -12 6  
1 2EX4 HIS A 7  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -11 7  
1 2EX4 HIS A 8  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -10 8  
1 2EX4 HIS A 9  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -9  9  
1 2EX4 HIS A 10 ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -8  10 
1 2EX4 SER A 11 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -7  11 
1 2EX4 SER A 12 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -6  12 
1 2EX4 GLY A 13 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -5  13 
1 2EX4 LEU A 14 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -4  14 
1 2EX4 VAL A 15 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -3  15 
1 2EX4 PRO A 16 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -2  16 
1 2EX4 ARG A 17 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -1  17 
1 2EX4 GLY A 18 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' 0   18 
1 2EX4 SER A 19 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' 1   19 
1 2EX4 ?   A ?  ? UNP Q9BV86 SER 38 DELETION           ?   20 
2 2EX4 MET B 1  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -17 21 
2 2EX4 GLY B 2  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -16 22 
2 2EX4 SER B 3  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -15 23 
2 2EX4 SER B 4  ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -14 24 
2 2EX4 HIS B 5  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -13 25 
2 2EX4 HIS B 6  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -12 26 
2 2EX4 HIS B 7  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -11 27 
2 2EX4 HIS B 8  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -10 28 
2 2EX4 HIS B 9  ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -9  29 
2 2EX4 HIS B 10 ? UNP Q9BV86 ?   ?  'EXPRESSION TAG'   -8  30 
2 2EX4 SER B 11 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -7  31 
2 2EX4 SER B 12 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -6  32 
2 2EX4 GLY B 13 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -5  33 
2 2EX4 LEU B 14 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -4  34 
2 2EX4 VAL B 15 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -3  35 
2 2EX4 PRO B 16 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -2  36 
2 2EX4 ARG B 17 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' -1  37 
2 2EX4 GLY B 18 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' 0   38 
2 2EX4 SER B 19 ? UNP Q9BV86 ?   ?  'CLONING ARTIFACT' 1   39 
2 2EX4 ?   B ?  ? UNP Q9BV86 SER 38 DELETION           ?   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2EX4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.pdbx_details    
;Purified AD-003 was was complexed with S-adenosyl-L-homocysteine (SAH) (Sigma) at 1:5 molar ratio of protein:SAH and crystallized using the hanging drop vapor diffusion method at 20   C by mixing 1.5   l of the protein solution with 1.5   l of the reservoir solution containing 18% PEG 3350, 0.2 M KCl, 0.1 M glycine, pH 9.5., VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-09-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     2EX4 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            1.75 
_reflns.number_obs                   41514 
_reflns.number_all                   41514 
_reflns.percent_possible_obs         92.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   92.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2EX4 
_refine.ls_number_reflns_obs                     39433 
_refine.ls_number_reflns_all                     39433 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             62.02 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    91.85 
_refine.ls_R_factor_obs                          0.19731 
_refine.ls_R_factor_all                          0.19731 
_refine.ls_R_factor_R_work                       0.19398 
_refine.ls_R_factor_R_free                       0.25789 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2071 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.919 
_refine.B_iso_mean                               23.848 
_refine.aniso_B[1][1]                            -0.80 
_refine.aniso_B[2][2]                            0.38 
_refine.aniso_B[3][3]                            0.38 
_refine.aniso_B[1][2]                            -0.12 
_refine.aniso_B[1][3]                            -0.03 
_refine.aniso_B[2][3]                            0.10 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1XTP 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.151 
_refine.pdbx_overall_ESU_R_Free                  0.153 
_refine.overall_SU_ML                            0.099 
_refine.overall_SU_B                             3.016 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3528 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             555 
_refine_hist.number_atoms_total               4135 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        62.02 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.022  ? 3644 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.345  1.982  ? 4918 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.774  5.000  ? 438  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.778 23.647 ? 170  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   13.595 15.000 ? 640  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.363 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.091  0.200  ? 548  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 2732 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.197  0.200  ? 1801 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.303  0.200  ? 2488 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.141  0.200  ? 469  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.306  0.200  ? 49   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.165  0.200  ? 33   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.839  1.500  ? 2277 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.306  2.000  ? 3546 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.988  3.000  ? 1581 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.985  4.500  ? 1372 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.75 
_refine_ls_shell.d_res_low                        1.797 
_refine_ls_shell.number_reflns_R_work             2763 
_refine_ls_shell.R_factor_R_work                  0.238 
_refine_ls_shell.percent_reflns_obs               87.45 
_refine_ls_shell.R_factor_R_free                  0.277 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             150 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2EX4 
_struct.title                     'Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine' 
_struct.pdbx_descriptor           'adrenal gland protein AD-003' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EX4 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'methyltransferase, Structural Genomics, SGC, Structural Genomics Consortium, Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 19  ? ILE A 24  ? SER A 1   ILE A 6   1 ? 6  
HELX_P HELX_P2  2  ASP A 26  ? GLN A 40  ? ASP A 8   GLN A 22  1 ? 15 
HELX_P HELX_P3  3  THR A 44  ? LEU A 49  ? THR A 26  LEU A 31  1 ? 6  
HELX_P HELX_P4  4  TYR A 52  ? HIS A 54  ? TYR A 34  HIS A 36  5 ? 3  
HELX_P HELX_P5  5  ILE A 55  ? ARG A 69  ? ILE A 37  ARG A 51  1 ? 15 
HELX_P HELX_P6  6  PHE A 70  ? ARG A 72  ? PHE A 52  ARG A 54  5 ? 3  
HELX_P HELX_P7  7  GLY A 91  ? LEU A 97  ? GLY A 74  LEU A 80  1 ? 7  
HELX_P HELX_P8  8  THR A 111 ? LEU A 122 ? THR A 94  LEU A 105 1 ? 12 
HELX_P HELX_P9  9  GLY A 123 ? LYS A 127 ? GLY A 106 LYS A 110 5 ? 5  
HELX_P HELX_P10 10 GLY A 136 ? PHE A 140 ? GLY A 119 PHE A 123 5 ? 5  
HELX_P HELX_P11 11 VAL A 155 ? LEU A 159 ? VAL A 138 LEU A 142 5 ? 5  
HELX_P HELX_P12 12 THR A 160 ? SER A 174 ? THR A 143 SER A 157 1 ? 15 
HELX_P HELX_P13 13 ASP A 204 ? ALA A 215 ? ASP A 187 ALA A 198 1 ? 12 
HELX_P HELX_P14 14 SER B 19  ? VAL B 23  ? SER B 1   VAL B 5   5 ? 5  
HELX_P HELX_P15 15 ASP B 26  ? GLN B 40  ? ASP B 8   GLN B 22  1 ? 15 
HELX_P HELX_P16 16 THR B 44  ? LEU B 49  ? THR B 26  LEU B 31  1 ? 6  
HELX_P HELX_P17 17 TYR B 52  ? HIS B 54  ? TYR B 34  HIS B 36  5 ? 3  
HELX_P HELX_P18 18 ILE B 55  ? ARG B 72  ? ILE B 37  ARG B 54  1 ? 18 
HELX_P HELX_P19 19 GLY B 91  ? LEU B 97  ? GLY B 74  LEU B 80  1 ? 7  
HELX_P HELX_P20 20 LEU B 97  ? PHE B 102 ? LEU B 80  PHE B 85  1 ? 6  
HELX_P HELX_P21 21 THR B 111 ? LEU B 122 ? THR B 94  LEU B 105 1 ? 12 
HELX_P HELX_P22 22 GLY B 123 ? LYS B 127 ? GLY B 106 LYS B 110 5 ? 5  
HELX_P HELX_P23 23 GLY B 136 ? PHE B 140 ? GLY B 119 PHE B 123 5 ? 5  
HELX_P HELX_P24 24 VAL B 155 ? LEU B 159 ? VAL B 138 LEU B 142 5 ? 5  
HELX_P HELX_P25 25 THR B 160 ? SER B 174 ? THR B 143 SER B 157 1 ? 15 
HELX_P HELX_P26 26 LEU B 205 ? ALA B 215 ? LEU B 188 ALA B 198 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 7 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 129 ? CYS A 134 ? VAL A 112 CYS A 117 
A 2 GLU A 104 ? ASP A 109 ? GLU A 87  ASP A 92  
A 3 CYS A 82  ? CYS A 86  ? CYS A 65  CYS A 69  
A 4 TYR A 147 ? GLN A 153 ? TYR A 130 GLN A 136 
A 5 LEU A 175 ? MET A 187 ? LEU A 158 MET A 170 
A 6 HIS A 234 ? ARG A 241 ? HIS A 217 ARG A 224 
A 7 SER A 218 ? ARG A 224 ? SER A 201 ARG A 207 
B 1 VAL A 192 ? ASP A 195 ? VAL A 175 ASP A 178 
B 2 SER A 200 ? ARG A 203 ? SER A 183 ARG A 186 
C 1 VAL B 129 ? CYS B 134 ? VAL B 112 CYS B 117 
C 2 GLU B 104 ? ASP B 109 ? GLU B 87  ASP B 92  
C 3 CYS B 82  ? CYS B 86  ? CYS B 65  CYS B 69  
C 4 TYR B 147 ? GLN B 153 ? TYR B 130 GLN B 136 
C 5 LEU B 175 ? ALA B 188 ? LEU B 158 ALA B 171 
C 6 SER B 200 ? ASP B 204 ? SER B 183 ASP B 187 
C 7 VAL B 192 ? ASP B 195 ? VAL B 175 ASP B 178 
D 1 VAL B 129 ? CYS B 134 ? VAL B 112 CYS B 117 
D 2 GLU B 104 ? ASP B 109 ? GLU B 87  ASP B 92  
D 3 CYS B 82  ? CYS B 86  ? CYS B 65  CYS B 69  
D 4 TYR B 147 ? GLN B 153 ? TYR B 130 GLN B 136 
D 5 LEU B 175 ? ALA B 188 ? LEU B 158 ALA B 171 
D 6 HIS B 234 ? ARG B 241 ? HIS B 217 ARG B 224 
D 7 SER B 218 ? ARG B 224 ? SER B 201 ARG B 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 133 ? O PHE A 116 N MET A 107 ? N MET A 90  
A 2 3 O ASP A 106 ? O ASP A 89  N ASP A 85  ? N ASP A 68  
A 3 4 N LEU A 84  ? N LEU A 67  O TRP A 151 ? O TRP A 134 
A 4 5 N ILE A 152 ? N ILE A 135 O VAL A 182 ? O VAL A 165 
A 5 6 N ILE A 181 ? N ILE A 164 O LEU A 240 ? O LEU A 223 
A 6 7 O ARG A 241 ? O ARG A 224 N SER A 218 ? N SER A 201 
B 1 2 N ASP A 195 ? N ASP A 178 O SER A 200 ? O SER A 183 
C 1 2 O PHE B 133 ? O PHE B 116 N MET B 107 ? N MET B 90  
C 2 3 O ASP B 106 ? O ASP B 89  N ALA B 83  ? N ALA B 66  
C 3 4 N LEU B 84  ? N LEU B 67  O TRP B 151 ? O TRP B 134 
C 4 5 N ILE B 152 ? N ILE B 135 O VAL B 182 ? O VAL B 165 
C 5 6 N ALA B 188 ? N ALA B 171 O ARG B 203 ? O ARG B 186 
C 6 7 O SER B 200 ? O SER B 183 N ASP B 195 ? N ASP B 178 
D 1 2 O PHE B 133 ? O PHE B 116 N MET B 107 ? N MET B 90  
D 2 3 O ASP B 106 ? O ASP B 89  N ALA B 83  ? N ALA B 66  
D 3 4 N LEU B 84  ? N LEU B 67  O TRP B 151 ? O TRP B 134 
D 4 5 N ILE B 152 ? N ILE B 135 O VAL B 182 ? O VAL B 165 
D 5 6 N ILE B 181 ? N ILE B 164 O LEU B 240 ? O LEU B 223 
D 6 7 O ALA B 239 ? O ALA B 222 N LEU B 220 ? N LEU B 203 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE SAH A 1401' 
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE SAH B 1402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 TRP A 38  ? TRP A 20   . ? 1_555 ? 
2  AC1 21 MET A 48  ? MET A 30   . ? 1_555 ? 
3  AC1 21 GLY A 87  ? GLY A 70   . ? 1_555 ? 
4  AC1 21 GLY A 89  ? GLY A 72   . ? 1_555 ? 
5  AC1 21 ARG A 92  ? ARG A 75   . ? 1_555 ? 
6  AC1 21 ILE A 93  ? ILE A 76   . ? 1_555 ? 
7  AC1 21 ASP A 109 ? ASP A 92   . ? 1_555 ? 
8  AC1 21 ILE A 110 ? ILE A 93   . ? 1_555 ? 
9  AC1 21 THR A 111 ? THR A 94   . ? 1_555 ? 
10 AC1 21 PHE A 114 ? PHE A 97   . ? 1_555 ? 
11 AC1 21 CYS A 135 ? CYS A 118  . ? 1_555 ? 
12 AC1 21 GLY A 136 ? GLY A 119  . ? 1_555 ? 
13 AC1 21 LEU A 137 ? LEU A 120  . ? 1_555 ? 
14 AC1 21 GLN A 138 ? GLN A 121  . ? 1_555 ? 
15 AC1 21 GLN A 153 ? GLN A 136  . ? 1_555 ? 
16 AC1 21 TRP A 154 ? TRP A 137  . ? 1_555 ? 
17 AC1 21 VAL A 155 ? VAL A 138  . ? 1_555 ? 
18 AC1 21 HIS A 158 ? HIS A 141  . ? 1_555 ? 
19 AC1 21 HOH E .   ? HOH A 1404 . ? 1_555 ? 
20 AC1 21 HOH E .   ? HOH A 1408 . ? 1_555 ? 
21 AC1 21 HOH E .   ? HOH A 1410 . ? 1_555 ? 
22 AC2 20 TRP B 38  ? TRP B 20   . ? 1_555 ? 
23 AC2 20 MET B 48  ? MET B 30   . ? 1_555 ? 
24 AC2 20 GLY B 87  ? GLY B 70   . ? 1_555 ? 
25 AC2 20 GLY B 89  ? GLY B 72   . ? 1_555 ? 
26 AC2 20 ARG B 92  ? ARG B 75   . ? 1_555 ? 
27 AC2 20 ILE B 93  ? ILE B 76   . ? 1_555 ? 
28 AC2 20 ASP B 109 ? ASP B 92   . ? 1_555 ? 
29 AC2 20 ILE B 110 ? ILE B 93   . ? 1_555 ? 
30 AC2 20 THR B 111 ? THR B 94   . ? 1_555 ? 
31 AC2 20 PHE B 114 ? PHE B 97   . ? 1_555 ? 
32 AC2 20 GLY B 136 ? GLY B 119  . ? 1_555 ? 
33 AC2 20 LEU B 137 ? LEU B 120  . ? 1_555 ? 
34 AC2 20 GLN B 138 ? GLN B 121  . ? 1_555 ? 
35 AC2 20 GLN B 153 ? GLN B 136  . ? 1_555 ? 
36 AC2 20 TRP B 154 ? TRP B 137  . ? 1_555 ? 
37 AC2 20 VAL B 155 ? VAL B 138  . ? 1_555 ? 
38 AC2 20 HIS B 158 ? HIS B 141  . ? 1_555 ? 
39 AC2 20 HOH F .   ? HOH B 1404 . ? 1_555 ? 
40 AC2 20 HOH F .   ? HOH B 1409 . ? 1_555 ? 
41 AC2 20 HOH F .   ? HOH B 1411 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EX4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EX4 
_atom_sites.fract_transf_matrix[1][1]   0.022768 
_atom_sites.fract_transf_matrix[1][2]   0.011089 
_atom_sites.fract_transf_matrix[1][3]   0.002555 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023483 
_atom_sites.fract_transf_matrix[2][3]   0.007012 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016130 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 17  ? -19.650 -18.005 2.244   1.00 33.97 ? -1   ARG A N     1 
ATOM   2    C CA    . ARG A 1 17  ? -19.755 -16.671 1.585   1.00 33.90 ? -1   ARG A CA    1 
ATOM   3    C C     . ARG A 1 17  ? -18.535 -16.452 0.701   1.00 33.07 ? -1   ARG A C     1 
ATOM   4    O O     . ARG A 1 17  ? -17.411 -16.536 1.174   1.00 33.33 ? -1   ARG A O     1 
ATOM   5    C CB    . ARG A 1 17  ? -19.860 -15.568 2.640   1.00 34.50 ? -1   ARG A CB    1 
ATOM   6    C CG    . ARG A 1 17  ? -21.034 -15.718 3.603   1.00 36.22 ? -1   ARG A CG    1 
ATOM   7    C CD    . ARG A 1 17  ? -22.306 -15.170 3.001   1.00 39.69 ? -1   ARG A CD    1 
ATOM   8    N NE    . ARG A 1 17  ? -23.463 -15.347 3.873   1.00 42.52 ? -1   ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 17  ? -24.715 -15.054 3.525   1.00 44.36 ? -1   ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 17  ? -24.979 -14.562 2.316   1.00 45.12 ? -1   ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 17  ? -25.708 -15.252 4.386   1.00 44.62 ? -1   ARG A NH2   1 
ATOM   12   N N     . GLY A 1 18  ? -18.755 -16.185 -0.582  1.00 32.46 ? 0    GLY A N     1 
ATOM   13   C CA    . GLY A 1 18  ? -17.658 -16.138 -1.549  1.00 31.16 ? 0    GLY A CA    1 
ATOM   14   C C     . GLY A 1 18  ? -17.341 -14.772 -2.136  1.00 30.27 ? 0    GLY A C     1 
ATOM   15   O O     . GLY A 1 18  ? -16.497 -14.656 -3.025  1.00 30.02 ? 0    GLY A O     1 
ATOM   16   N N     . SER A 1 19  ? -18.017 -13.738 -1.643  1.00 29.45 ? 1    SER A N     1 
ATOM   17   C CA    . SER A 1 19  ? -17.863 -12.386 -2.173  1.00 28.51 ? 1    SER A CA    1 
ATOM   18   C C     . SER A 1 19  ? -18.121 -11.337 -1.096  1.00 27.81 ? 1    SER A C     1 
ATOM   19   O O     . SER A 1 19  ? -18.844 -11.596 -0.125  1.00 27.57 ? 1    SER A O     1 
ATOM   20   C CB    . SER A 1 19  ? -18.811 -12.160 -3.353  1.00 29.19 ? 1    SER A CB    1 
ATOM   21   O OG    . SER A 1 19  ? -20.156 -12.093 -2.913  1.00 30.11 ? 1    SER A OG    1 
ATOM   22   N N     . THR A 1 20  ? -17.534 -10.156 -1.265  1.00 25.96 ? 2    THR A N     1 
ATOM   23   C CA    . THR A 1 20  ? -17.823 -9.048  -0.355  1.00 24.73 ? 2    THR A CA    1 
ATOM   24   C C     . THR A 1 20  ? -19.301 -8.627  -0.407  1.00 25.36 ? 2    THR A C     1 
ATOM   25   O O     . THR A 1 20  ? -19.859 -8.257  0.621   1.00 24.48 ? 2    THR A O     1 
ATOM   26   C CB    . THR A 1 20  ? -16.911 -7.819  -0.580  1.00 24.51 ? 2    THR A CB    1 
ATOM   27   O OG1   . THR A 1 20  ? -17.063 -7.329  -1.920  1.00 23.70 ? 2    THR A OG1   1 
ATOM   28   C CG2   . THR A 1 20  ? -15.452 -8.182  -0.298  1.00 22.24 ? 2    THR A CG2   1 
ATOM   29   N N     . SER A 1 21  ? -19.924 -8.705  -1.589  1.00 25.95 ? 3    SER A N     1 
ATOM   30   C CA    . SER A 1 21  ? -21.340 -8.332  -1.765  1.00 27.42 ? 3    SER A CA    1 
ATOM   31   C C     . SER A 1 21  ? -22.254 -9.148  -0.838  1.00 28.16 ? 3    SER A C     1 
ATOM   32   O O     . SER A 1 21  ? -23.271 -8.650  -0.338  1.00 29.19 ? 3    SER A O     1 
ATOM   33   C CB    . SER A 1 21  ? -21.777 -8.492  -3.230  1.00 27.67 ? 3    SER A CB    1 
ATOM   34   O OG    . SER A 1 21  ? -21.632 -9.835  -3.654  1.00 29.00 ? 3    SER A OG    1 
ATOM   35   N N     . GLU A 1 22  ? -21.865 -10.386 -0.582  1.00 28.54 ? 4    GLU A N     1 
ATOM   36   C CA    . GLU A 1 22  ? -22.576 -11.245 0.371   1.00 29.49 ? 4    GLU A CA    1 
ATOM   37   C C     . GLU A 1 22  ? -22.451 -10.774 1.826   1.00 29.60 ? 4    GLU A C     1 
ATOM   38   O O     . GLU A 1 22  ? -23.437 -10.787 2.578   1.00 30.48 ? 4    GLU A O     1 
ATOM   39   C CB    . GLU A 1 22  ? -22.080 -12.681 0.232   1.00 29.18 ? 4    GLU A CB    1 
ATOM   40   C CG    . GLU A 1 22  ? -22.546 -13.339 -1.051  1.00 32.12 ? 4    GLU A CG    1 
ATOM   41   C CD    . GLU A 1 22  ? -21.892 -14.668 -1.312  1.00 33.82 ? 4    GLU A CD    1 
ATOM   42   O OE1   . GLU A 1 22  ? -21.139 -14.768 -2.298  1.00 35.24 ? 4    GLU A OE1   1 
ATOM   43   O OE2   . GLU A 1 22  ? -22.131 -15.611 -0.531  1.00 36.35 ? 4    GLU A OE2   1 
ATOM   44   N N     . VAL A 1 23  ? -21.255 -10.334 2.216   1.00 28.88 ? 5    VAL A N     1 
ATOM   45   C CA    . VAL A 1 23  ? -20.944 -10.090 3.631   1.00 28.09 ? 5    VAL A CA    1 
ATOM   46   C C     . VAL A 1 23  ? -21.055 -8.635  4.079   1.00 27.64 ? 5    VAL A C     1 
ATOM   47   O O     . VAL A 1 23  ? -21.236 -8.365  5.258   1.00 26.86 ? 5    VAL A O     1 
ATOM   48   C CB    . VAL A 1 23  ? -19.554 -10.691 4.038   1.00 28.40 ? 5    VAL A CB    1 
ATOM   49   C CG1   . VAL A 1 23  ? -19.470 -12.152 3.636   1.00 29.18 ? 5    VAL A CG1   1 
ATOM   50   C CG2   . VAL A 1 23  ? -18.384 -9.917  3.413   1.00 28.43 ? 5    VAL A CG2   1 
ATOM   51   N N     . ILE A 1 24  ? -20.943 -7.700  3.138   1.00 26.50 ? 6    ILE A N     1 
ATOM   52   C CA    . ILE A 1 24  ? -21.011 -6.291  3.470   1.00 25.98 ? 6    ILE A CA    1 
ATOM   53   C C     . ILE A 1 24  ? -22.449 -5.803  3.363   1.00 26.17 ? 6    ILE A C     1 
ATOM   54   O O     . ILE A 1 24  ? -23.042 -5.780  2.278   1.00 25.82 ? 6    ILE A O     1 
ATOM   55   C CB    . ILE A 1 24  ? -20.030 -5.456  2.592   1.00 25.80 ? 6    ILE A CB    1 
ATOM   56   C CG1   . ILE A 1 24  ? -18.580 -5.913  2.847   1.00 25.43 ? 6    ILE A CG1   1 
ATOM   57   C CG2   . ILE A 1 24  ? -20.239 -3.957  2.823   1.00 27.09 ? 6    ILE A CG2   1 
ATOM   58   C CD1   . ILE A 1 24  ? -17.542 -5.336  1.862   1.00 25.38 ? 6    ILE A CD1   1 
ATOM   59   N N     . GLU A 1 25  ? -23.016 -5.422  4.503   1.00 26.04 ? 7    GLU A N     1 
ATOM   60   C CA    . GLU A 1 25  ? -24.417 -5.008  4.550   1.00 26.53 ? 7    GLU A CA    1 
ATOM   61   C C     . GLU A 1 25  ? -24.664 -3.615  3.956   1.00 25.74 ? 7    GLU A C     1 
ATOM   62   O O     . GLU A 1 25  ? -25.716 -3.364  3.390   1.00 25.73 ? 7    GLU A O     1 
ATOM   63   C CB    . GLU A 1 25  ? -24.956 -5.093  5.984   1.00 26.34 ? 7    GLU A CB    1 
ATOM   64   C CG    . GLU A 1 25  ? -25.052 -6.522  6.523   1.00 28.72 ? 7    GLU A CG    1 
ATOM   65   C CD    . GLU A 1 25  ? -25.711 -6.602  7.903   1.00 28.90 ? 7    GLU A CD    1 
ATOM   66   O OE1   . GLU A 1 25  ? -26.262 -5.578  8.368   1.00 33.31 ? 7    GLU A OE1   1 
ATOM   67   O OE2   . GLU A 1 25  ? -25.682 -7.689  8.520   1.00 32.77 ? 7    GLU A OE2   1 
ATOM   68   N N     . ASP A 1 26  ? -23.686 -2.721  4.085   1.00 24.90 ? 8    ASP A N     1 
ATOM   69   C CA    . ASP A 1 26  ? -23.824 -1.321  3.676   1.00 24.98 ? 8    ASP A CA    1 
ATOM   70   C C     . ASP A 1 26  ? -22.435 -0.809  3.344   1.00 24.02 ? 8    ASP A C     1 
ATOM   71   O O     . ASP A 1 26  ? -21.606 -0.622  4.237   1.00 24.50 ? 8    ASP A O     1 
ATOM   72   C CB    . ASP A 1 26  ? -24.423 -0.486  4.819   1.00 25.02 ? 8    ASP A CB    1 
ATOM   73   C CG    . ASP A 1 26  ? -24.619 0.986   4.454   1.00 27.31 ? 8    ASP A CG    1 
ATOM   74   O OD1   . ASP A 1 26  ? -23.768 1.580   3.756   1.00 26.59 ? 8    ASP A OD1   1 
ATOM   75   O OD2   . ASP A 1 26  ? -25.631 1.570   4.912   1.00 29.52 ? 8    ASP A OD2   1 
ATOM   76   N N     . GLU A 1 27  ? -22.187 -0.587  2.062   1.00 23.80 ? 9    GLU A N     1 
ATOM   77   C CA    . GLU A 1 27  ? -20.840 -0.250  1.590   1.00 23.57 ? 9    GLU A CA    1 
ATOM   78   C C     . GLU A 1 27  ? -20.285 1.045   2.179   1.00 23.44 ? 9    GLU A C     1 
ATOM   79   O O     . GLU A 1 27  ? -19.096 1.133   2.503   1.00 21.58 ? 9    GLU A O     1 
ATOM   80   C CB    . GLU A 1 27  ? -20.825 -0.199  0.073   1.00 24.12 ? 9    GLU A CB    1 
ATOM   81   C CG    . GLU A 1 27  ? -19.450 -0.125  -0.514  1.00 26.18 ? 9    GLU A CG    1 
ATOM   82   C CD    . GLU A 1 27  ? -19.495 -0.003  -2.008  1.00 26.64 ? 9    GLU A CD    1 
ATOM   83   O OE1   . GLU A 1 27  ? -19.894 -0.984  -2.659  1.00 28.14 ? 9    GLU A OE1   1 
ATOM   84   O OE2   . GLU A 1 27  ? -19.136 1.075   -2.516  1.00 30.67 ? 9    GLU A OE2   1 
ATOM   85   N N     . LYS A 1 28  ? -21.140 2.056   2.305   1.00 23.19 ? 10   LYS A N     1 
ATOM   86   C CA    . LYS A 1 28  ? -20.716 3.317   2.923   1.00 24.10 ? 10   LYS A CA    1 
ATOM   87   C C     . LYS A 1 28  ? -20.212 3.097   4.365   1.00 23.37 ? 10   LYS A C     1 
ATOM   88   O O     . LYS A 1 28  ? -19.225 3.706   4.786   1.00 23.11 ? 10   LYS A O     1 
ATOM   89   C CB    . LYS A 1 28  ? -21.845 4.364   2.867   1.00 23.64 ? 10   LYS A CB    1 
ATOM   90   C CG    . LYS A 1 28  ? -21.982 5.088   1.524   1.00 26.82 ? 10   LYS A CG    1 
ATOM   91   C CD    . LYS A 1 28  ? -23.079 6.173   1.576   1.00 26.19 ? 10   LYS A CD    1 
ATOM   92   C CE    . LYS A 1 28  ? -23.407 6.739   0.201   1.00 29.51 ? 10   LYS A CE    1 
ATOM   93   N NZ    . LYS A 1 28  ? -22.179 7.164   -0.543  1.00 32.45 ? 10   LYS A NZ    1 
ATOM   94   N N     . GLN A 1 29  ? -20.895 2.232   5.120   1.00 23.09 ? 11   GLN A N     1 
ATOM   95   C CA    . GLN A 1 29  ? -20.532 1.944   6.510   1.00 23.31 ? 11   GLN A CA    1 
ATOM   96   C C     . GLN A 1 29  ? -19.262 1.106   6.592   1.00 22.60 ? 11   GLN A C     1 
ATOM   97   O O     . GLN A 1 29  ? -18.444 1.288   7.490   1.00 22.23 ? 11   GLN A O     1 
ATOM   98   C CB    . GLN A 1 29  ? -21.684 1.247   7.237   1.00 24.23 ? 11   GLN A CB    1 
ATOM   99   C CG    . GLN A 1 29  ? -22.611 2.221   7.931   1.00 26.89 ? 11   GLN A CG    1 
ATOM   100  C CD    . GLN A 1 29  ? -24.016 1.680   8.129   1.00 31.89 ? 11   GLN A CD    1 
ATOM   101  O OE1   . GLN A 1 29  ? -24.218 0.603   8.709   1.00 34.76 ? 11   GLN A OE1   1 
ATOM   102  N NE2   . GLN A 1 29  ? -25.008 2.438   7.655   1.00 33.56 ? 11   GLN A NE2   1 
ATOM   103  N N     . PHE A 1 30  ? -19.096 0.194   5.636   1.00 22.02 ? 12   PHE A N     1 
ATOM   104  C CA    . PHE A 1 30  ? -17.874 -0.607  5.520   1.00 21.63 ? 12   PHE A CA    1 
ATOM   105  C C     . PHE A 1 30  ? -16.637 0.300   5.484   1.00 20.55 ? 12   PHE A C     1 
ATOM   106  O O     . PHE A 1 30  ? -15.658 0.072   6.212   1.00 21.08 ? 12   PHE A O     1 
ATOM   107  C CB    . PHE A 1 30  ? -17.955 -1.466  4.253   1.00 21.50 ? 12   PHE A CB    1 
ATOM   108  C CG    . PHE A 1 30  ? -16.731 -2.298  3.988   1.00 21.73 ? 12   PHE A CG    1 
ATOM   109  C CD1   . PHE A 1 30  ? -16.390 -3.371  4.820   1.00 22.26 ? 12   PHE A CD1   1 
ATOM   110  C CD2   . PHE A 1 30  ? -15.921 -2.017  2.896   1.00 19.57 ? 12   PHE A CD2   1 
ATOM   111  C CE1   . PHE A 1 30  ? -15.256 -4.151  4.549   1.00 21.61 ? 12   PHE A CE1   1 
ATOM   112  C CE2   . PHE A 1 30  ? -14.789 -2.782  2.630   1.00 21.09 ? 12   PHE A CE2   1 
ATOM   113  C CZ    . PHE A 1 30  ? -14.455 -3.850  3.456   1.00 20.60 ? 12   PHE A CZ    1 
ATOM   114  N N     . TYR A 1 31  ? -16.706 1.344   4.662   1.00 20.92 ? 13   TYR A N     1 
ATOM   115  C CA    . TYR A 1 31  ? -15.605 2.293   4.524   1.00 19.94 ? 13   TYR A CA    1 
ATOM   116  C C     . TYR A 1 31  ? -15.521 3.263   5.706   1.00 20.11 ? 13   TYR A C     1 
ATOM   117  O O     . TYR A 1 31  ? -14.443 3.452   6.253   1.00 19.55 ? 13   TYR A O     1 
ATOM   118  C CB    . TYR A 1 31  ? -15.666 3.039   3.176   1.00 19.72 ? 13   TYR A CB    1 
ATOM   119  C CG    . TYR A 1 31  ? -15.275 2.173   1.994   1.00 18.83 ? 13   TYR A CG    1 
ATOM   120  C CD1   . TYR A 1 31  ? -13.961 1.724   1.845   1.00 19.29 ? 13   TYR A CD1   1 
ATOM   121  C CD2   . TYR A 1 31  ? -16.211 1.804   1.020   1.00 17.85 ? 13   TYR A CD2   1 
ATOM   122  C CE1   . TYR A 1 31  ? -13.594 0.913   0.767   1.00 17.50 ? 13   TYR A CE1   1 
ATOM   123  C CE2   . TYR A 1 31  ? -15.848 0.991   -0.078  1.00 18.68 ? 13   TYR A CE2   1 
ATOM   124  C CZ    . TYR A 1 31  ? -14.533 0.549   -0.186  1.00 18.77 ? 13   TYR A CZ    1 
ATOM   125  O OH    . TYR A 1 31  ? -14.122 -0.260  -1.236  1.00 21.08 ? 13   TYR A OH    1 
ATOM   126  N N     . SER A 1 32  ? -16.640 3.881   6.103   1.00 19.75 ? 14   SER A N     1 
ATOM   127  C CA    . SER A 1 32  ? -16.586 4.851   7.207   1.00 19.61 ? 14   SER A CA    1 
ATOM   128  C C     . SER A 1 32  ? -16.166 4.255   8.547   1.00 19.23 ? 14   SER A C     1 
ATOM   129  O O     . SER A 1 32  ? -15.418 4.892   9.289   1.00 19.38 ? 14   SER A O     1 
ATOM   130  C CB    . SER A 1 32  ? -17.893 5.649   7.343   1.00 20.70 ? 14   SER A CB    1 
ATOM   131  O OG    . SER A 1 32  ? -18.960 4.780   7.633   1.00 23.05 ? 14   SER A OG    1 
ATOM   132  N N     . LYS A 1 33  ? -16.613 3.033   8.848   1.00 18.72 ? 15   LYS A N     1 
ATOM   133  C CA    . LYS A 1 33  ? -16.175 2.356   10.078  1.00 19.97 ? 15   LYS A CA    1 
ATOM   134  C C     . LYS A 1 33  ? -14.660 2.063   10.075  1.00 18.86 ? 15   LYS A C     1 
ATOM   135  O O     . LYS A 1 33  ? -13.991 2.170   11.106  1.00 18.24 ? 15   LYS A O     1 
ATOM   136  C CB    . LYS A 1 33  ? -16.996 1.074   10.329  1.00 20.27 ? 15   LYS A CB    1 
ATOM   137  C CG    . LYS A 1 33  ? -18.434 1.366   10.746  1.00 23.11 ? 15   LYS A CG    1 
ATOM   138  C CD    . LYS A 1 33  ? -19.185 0.131   11.218  1.00 22.76 ? 15   LYS A CD    1 
ATOM   139  C CE    . LYS A 1 33  ? -18.802 -0.221  12.643  1.00 27.38 ? 15   LYS A CE    1 
ATOM   140  N NZ    . LYS A 1 33  ? -19.583 -1.377  13.137  1.00 27.06 ? 15   LYS A NZ    1 
ATOM   141  N N     . ALA A 1 34  ? -14.129 1.688   8.909   1.00 17.40 ? 16   ALA A N     1 
ATOM   142  C CA    . ALA A 1 34  ? -12.696 1.437   8.763   1.00 16.62 ? 16   ALA A CA    1 
ATOM   143  C C     . ALA A 1 34  ? -11.882 2.707   9.029   1.00 16.82 ? 16   ALA A C     1 
ATOM   144  O O     . ALA A 1 34  ? -10.877 2.688   9.759   1.00 16.67 ? 16   ALA A O     1 
ATOM   145  C CB    . ALA A 1 34  ? -12.398 0.866   7.361   1.00 17.17 ? 16   ALA A CB    1 
ATOM   146  N N     . LYS A 1 35  ? -12.326 3.813   8.452   1.00 16.41 ? 17   LYS A N     1 
ATOM   147  C CA    . LYS A 1 35  ? -11.685 5.099   8.684   1.00 17.10 ? 17   LYS A CA    1 
ATOM   148  C C     . LYS A 1 35  ? -11.723 5.458   10.177  1.00 17.26 ? 17   LYS A C     1 
ATOM   149  O O     . LYS A 1 35  ? -10.723 5.898   10.738  1.00 16.21 ? 17   LYS A O     1 
ATOM   150  C CB    . LYS A 1 35  ? -12.345 6.190   7.829   1.00 17.02 ? 17   LYS A CB    1 
ATOM   151  C CG    . LYS A 1 35  ? -11.634 7.542   7.898   1.00 17.69 ? 17   LYS A CG    1 
ATOM   152  C CD    . LYS A 1 35  ? -12.054 8.454   6.736   1.00 21.53 ? 17   LYS A CD    1 
ATOM   153  C CE    . LYS A 1 35  ? -11.275 9.760   6.788   1.00 23.07 ? 17   LYS A CE    1 
ATOM   154  N NZ    . LYS A 1 35  ? -11.985 10.868  6.072   1.00 23.58 ? 17   LYS A NZ    1 
ATOM   155  N N     . THR A 1 36  ? -12.883 5.271   10.810  1.00 18.03 ? 18   THR A N     1 
ATOM   156  C CA    . THR A 1 36  ? -13.036 5.561   12.239  1.00 19.07 ? 18   THR A CA    1 
ATOM   157  C C     . THR A 1 36  ? -12.127 4.666   13.095  1.00 18.31 ? 18   THR A C     1 
ATOM   158  O O     . THR A 1 36  ? -11.482 5.167   14.024  1.00 19.70 ? 18   THR A O     1 
ATOM   159  C CB    . THR A 1 36  ? -14.533 5.469   12.680  1.00 19.33 ? 18   THR A CB    1 
ATOM   160  O OG1   . THR A 1 36  ? -15.315 6.389   11.908  1.00 20.44 ? 18   THR A OG1   1 
ATOM   161  C CG2   . THR A 1 36  ? -14.687 5.789   14.169  1.00 21.43 ? 18   THR A CG2   1 
ATOM   162  N N     . TYR A 1 37  ? -12.034 3.370   12.763  1.00 16.99 ? 19   TYR A N     1 
ATOM   163  C CA    . TYR A 1 37  ? -11.164 2.442   13.499  1.00 17.24 ? 19   TYR A CA    1 
ATOM   164  C C     . TYR A 1 37  ? -9.729  2.954   13.423  1.00 16.60 ? 19   TYR A C     1 
ATOM   165  O O     . TYR A 1 37  ? -9.057  3.093   14.433  1.00 16.69 ? 19   TYR A O     1 
ATOM   166  C CB    . TYR A 1 37  ? -11.229 1.007   12.933  1.00 17.57 ? 19   TYR A CB    1 
ATOM   167  C CG    . TYR A 1 37  ? -10.079 0.118   13.407  1.00 18.31 ? 19   TYR A CG    1 
ATOM   168  C CD1   . TYR A 1 37  ? -10.152 -0.555  14.636  1.00 21.26 ? 19   TYR A CD1   1 
ATOM   169  C CD2   . TYR A 1 37  ? -8.904  -0.029  12.646  1.00 19.98 ? 19   TYR A CD2   1 
ATOM   170  C CE1   . TYR A 1 37  ? -9.104  -1.366  15.082  1.00 20.79 ? 19   TYR A CE1   1 
ATOM   171  C CE2   . TYR A 1 37  ? -7.838  -0.850  13.091  1.00 20.61 ? 19   TYR A CE2   1 
ATOM   172  C CZ    . TYR A 1 37  ? -7.955  -1.509  14.315  1.00 20.07 ? 19   TYR A CZ    1 
ATOM   173  O OH    . TYR A 1 37  ? -6.929  -2.317  14.767  1.00 20.18 ? 19   TYR A OH    1 
ATOM   174  N N     . TRP A 1 38  ? -9.262  3.242   12.207  1.00 16.21 ? 20   TRP A N     1 
ATOM   175  C CA    . TRP A 1 38  ? -7.860  3.603   12.035  1.00 16.95 ? 20   TRP A CA    1 
ATOM   176  C C     . TRP A 1 38  ? -7.506  4.942   12.675  1.00 17.85 ? 20   TRP A C     1 
ATOM   177  O O     . TRP A 1 38  ? -6.390  5.136   13.158  1.00 17.56 ? 20   TRP A O     1 
ATOM   178  C CB    . TRP A 1 38  ? -7.426  3.535   10.556  1.00 15.85 ? 20   TRP A CB    1 
ATOM   179  C CG    . TRP A 1 38  ? -7.200  2.114   10.137  1.00 15.70 ? 20   TRP A CG    1 
ATOM   180  C CD1   . TRP A 1 38  ? -7.977  1.372   9.299   1.00 15.86 ? 20   TRP A CD1   1 
ATOM   181  C CD2   . TRP A 1 38  ? -6.134  1.249   10.570  1.00 15.54 ? 20   TRP A CD2   1 
ATOM   182  N NE1   . TRP A 1 38  ? -7.456  0.111   9.167   1.00 14.80 ? 20   TRP A NE1   1 
ATOM   183  C CE2   . TRP A 1 38  ? -6.330  0.002   9.941   1.00 15.49 ? 20   TRP A CE2   1 
ATOM   184  C CE3   . TRP A 1 38  ? -5.035  1.409   11.428  1.00 16.98 ? 20   TRP A CE3   1 
ATOM   185  C CZ2   . TRP A 1 38  ? -5.467  -1.081  10.138  1.00 14.68 ? 20   TRP A CZ2   1 
ATOM   186  C CZ3   . TRP A 1 38  ? -4.169  0.338   11.619  1.00 16.87 ? 20   TRP A CZ3   1 
ATOM   187  C CH2   . TRP A 1 38  ? -4.397  -0.902  10.981  1.00 16.26 ? 20   TRP A CH2   1 
ATOM   188  N N     . LYS A 1 39  ? -8.479  5.843   12.706  1.00 19.68 ? 21   LYS A N     1 
ATOM   189  C CA    . LYS A 1 39  ? -8.293  7.138   13.362  1.00 21.50 ? 21   LYS A CA    1 
ATOM   190  C C     . LYS A 1 39  ? -7.879  7.001   14.849  1.00 21.52 ? 21   LYS A C     1 
ATOM   191  O O     . LYS A 1 39  ? -7.127  7.836   15.356  1.00 22.48 ? 21   LYS A O     1 
ATOM   192  C CB    . LYS A 1 39  ? -9.561  7.985   13.197  1.00 21.00 ? 21   LYS A CB    1 
ATOM   193  C CG    . LYS A 1 39  ? -9.541  9.368   13.862  1.00 22.26 ? 21   LYS A CG    1 
ATOM   194  C CD    . LYS A 1 39  ? -8.457  10.325  13.381  1.00 23.51 ? 21   LYS A CD    1 
ATOM   195  C CE    . LYS A 1 39  ? -8.422  11.558  14.320  1.00 26.36 ? 21   LYS A CE    1 
ATOM   196  N NZ    . LYS A 1 39  ? -7.742  12.768  13.723  1.00 29.34 ? 21   LYS A NZ    1 
ATOM   197  N N     . GLN A 1 40  ? -8.327  5.952   15.535  1.00 22.61 ? 22   GLN A N     1 
ATOM   198  C CA    . GLN A 1 40  ? -7.993  5.783   16.966  1.00 23.03 ? 22   GLN A CA    1 
ATOM   199  C C     . GLN A 1 40  ? -6.797  4.864   17.261  1.00 23.36 ? 22   GLN A C     1 
ATOM   200  O O     . GLN A 1 40  ? -6.535  4.519   18.423  1.00 24.16 ? 22   GLN A O     1 
ATOM   201  C CB    . GLN A 1 40  ? -9.237  5.403   17.804  1.00 23.17 ? 22   GLN A CB    1 
ATOM   202  C CG    . GLN A 1 40  ? -10.040 4.197   17.318  1.00 23.58 ? 22   GLN A CG    1 
ATOM   203  C CD    . GLN A 1 40  ? -9.569  2.875   17.900  1.00 26.06 ? 22   GLN A CD    1 
ATOM   204  O OE1   . GLN A 1 40  ? -9.427  2.728   19.126  1.00 24.95 ? 22   GLN A OE1   1 
ATOM   205  N NE2   . GLN A 1 40  ? -9.356  1.893   17.032  1.00 22.13 ? 22   GLN A NE2   1 
ATOM   206  N N     . ILE A 1 41  ? -6.048  4.503   16.216  1.00 22.02 ? 23   ILE A N     1 
ATOM   207  C CA    . ILE A 1 41  ? -4.886  3.619   16.366  1.00 21.84 ? 23   ILE A CA    1 
ATOM   208  C C     . ILE A 1 41  ? -3.594  4.430   16.531  1.00 21.12 ? 23   ILE A C     1 
ATOM   209  O O     . ILE A 1 41  ? -3.372  5.382   15.793  1.00 21.21 ? 23   ILE A O     1 
ATOM   210  C CB    . ILE A 1 41  ? -4.784  2.629   15.147  1.00 21.51 ? 23   ILE A CB    1 
ATOM   211  C CG1   . ILE A 1 41  ? -6.017  1.714   15.075  1.00 22.64 ? 23   ILE A CG1   1 
ATOM   212  C CG2   . ILE A 1 41  ? -3.480  1.833   15.171  1.00 22.17 ? 23   ILE A CG2   1 
ATOM   213  C CD1   . ILE A 1 41  ? -6.298  0.912   16.307  1.00 20.82 ? 23   ILE A CD1   1 
ATOM   214  N N     . PRO A 1 42  ? -2.741  4.065   17.507  1.00 21.56 ? 24   PRO A N     1 
ATOM   215  C CA    . PRO A 1 42  ? -1.464  4.792   17.660  1.00 21.42 ? 24   PRO A CA    1 
ATOM   216  C C     . PRO A 1 42  ? -0.655  4.790   16.364  1.00 20.04 ? 24   PRO A C     1 
ATOM   217  O O     . PRO A 1 42  ? -0.601  3.762   15.676  1.00 19.34 ? 24   PRO A O     1 
ATOM   218  C CB    . PRO A 1 42  ? -0.706  3.985   18.730  1.00 21.98 ? 24   PRO A CB    1 
ATOM   219  C CG    . PRO A 1 42  ? -1.763  3.246   19.486  1.00 22.42 ? 24   PRO A CG    1 
ATOM   220  C CD    . PRO A 1 42  ? -2.901  3.000   18.507  1.00 21.37 ? 24   PRO A CD    1 
ATOM   221  N N     . PRO A 1 43  ? -0.025  5.935   16.024  1.00 19.71 ? 25   PRO A N     1 
ATOM   222  C CA    . PRO A 1 43  ? 0.734   5.953   14.773  1.00 19.63 ? 25   PRO A CA    1 
ATOM   223  C C     . PRO A 1 43  ? 2.136   5.443   15.005  1.00 18.65 ? 25   PRO A C     1 
ATOM   224  O O     . PRO A 1 43  ? 3.101   6.190   14.950  1.00 18.66 ? 25   PRO A O     1 
ATOM   225  C CB    . PRO A 1 43  ? 0.715   7.435   14.357  1.00 18.93 ? 25   PRO A CB    1 
ATOM   226  C CG    . PRO A 1 43  ? 0.532   8.193   15.671  1.00 20.59 ? 25   PRO A CG    1 
ATOM   227  C CD    . PRO A 1 43  ? 0.012   7.239   16.719  1.00 20.07 ? 25   PRO A CD    1 
ATOM   228  N N     . THR A 1 44  ? 2.206   4.136   15.221  1.00 19.32 ? 26   THR A N     1 
ATOM   229  C CA    . THR A 1 44  ? 3.442   3.420   15.505  1.00 19.40 ? 26   THR A CA    1 
ATOM   230  C C     . THR A 1 44  ? 3.433   2.124   14.737  1.00 18.73 ? 26   THR A C     1 
ATOM   231  O O     . THR A 1 44  ? 2.369   1.654   14.331  1.00 17.30 ? 26   THR A O     1 
ATOM   232  C CB    . THR A 1 44  ? 3.515   3.001   16.985  1.00 18.85 ? 26   THR A CB    1 
ATOM   233  O OG1   . THR A 1 44  ? 2.510   2.017   17.252  1.00 20.21 ? 26   THR A OG1   1 
ATOM   234  C CG2   . THR A 1 44  ? 3.334   4.202   17.953  1.00 21.21 ? 26   THR A CG2   1 
ATOM   235  N N     . VAL A 1 45  ? 4.608   1.507   14.600  1.00 19.08 ? 27   VAL A N     1 
ATOM   236  C CA    . VAL A 1 45  ? 4.711   0.194   13.930  1.00 19.38 ? 27   VAL A CA    1 
ATOM   237  C C     . VAL A 1 45  ? 3.786   -0.844  14.587  1.00 18.94 ? 27   VAL A C     1 
ATOM   238  O O     . VAL A 1 45  ? 3.114   -1.645  13.908  1.00 18.40 ? 27   VAL A O     1 
ATOM   239  C CB    . VAL A 1 45  ? 6.187   -0.291  13.837  1.00 19.03 ? 27   VAL A CB    1 
ATOM   240  C CG1   . VAL A 1 45  ? 6.261   -1.798  13.524  1.00 20.89 ? 27   VAL A CG1   1 
ATOM   241  C CG2   . VAL A 1 45  ? 6.930   0.466   12.739  1.00 20.14 ? 27   VAL A CG2   1 
ATOM   242  N N     . ASP A 1 46  ? 3.713   -0.803  15.918  1.00 18.39 ? 28   ASP A N     1 
ATOM   243  C CA    . ASP A 1 46  ? 2.829   -1.714  16.634  1.00 18.53 ? 28   ASP A CA    1 
ATOM   244  C C     . ASP A 1 46  ? 1.382   -1.512  16.229  1.00 17.96 ? 28   ASP A C     1 
ATOM   245  O O     . ASP A 1 46  ? 0.657   -2.484  15.999  1.00 17.92 ? 28   ASP A O     1 
ATOM   246  C CB    . ASP A 1 46  ? 2.990   -1.605  18.151  1.00 18.39 ? 28   ASP A CB    1 
ATOM   247  C CG    . ASP A 1 46  ? 2.449   -2.835  18.879  1.00 19.57 ? 28   ASP A CG    1 
ATOM   248  O OD1   . ASP A 1 46  ? 2.901   -3.970  18.595  1.00 22.12 ? 28   ASP A OD1   1 
ATOM   249  O OD2   . ASP A 1 46  ? 1.533   -2.680  19.691  1.00 22.55 ? 28   ASP A OD2   1 
ATOM   250  N N     . GLY A 1 47  ? 0.977   -0.249  16.092  1.00 17.75 ? 29   GLY A N     1 
ATOM   251  C CA    . GLY A 1 47  ? -0.360  0.083   15.634  1.00 17.79 ? 29   GLY A CA    1 
ATOM   252  C C     . GLY A 1 47  ? -0.627  -0.429  14.222  1.00 18.22 ? 29   GLY A C     1 
ATOM   253  O O     . GLY A 1 47  ? -1.677  -1.046  13.967  1.00 17.80 ? 29   GLY A O     1 
ATOM   254  N N     . MET A 1 48  ? 0.326   -0.180  13.319  1.00 17.55 ? 30   MET A N     1 
ATOM   255  C CA    . MET A 1 48  ? 0.225   -0.619  11.907  1.00 17.35 ? 30   MET A CA    1 
ATOM   256  C C     . MET A 1 48  ? 0.005   -2.127  11.834  1.00 17.80 ? 30   MET A C     1 
ATOM   257  O O     . MET A 1 48  ? -0.661  -2.636  10.934  1.00 18.23 ? 30   MET A O     1 
ATOM   258  C CB    . MET A 1 48  ? 1.502   -0.296  11.126  1.00 16.29 ? 30   MET A CB    1 
ATOM   259  C CG    . MET A 1 48  ? 1.873   1.207   10.980  1.00 15.27 ? 30   MET A CG    1 
ATOM   260  S SD    . MET A 1 48  ? 0.614   2.332   10.309  1.00 15.89 ? 30   MET A SD    1 
ATOM   261  C CE    . MET A 1 48  ? -0.232  2.844   11.811  1.00 18.91 ? 30   MET A CE    1 
ATOM   262  N N     . LEU A 1 49  ? 0.591   -2.840  12.782  1.00 18.37 ? 31   LEU A N     1 
ATOM   263  C CA    . LEU A 1 49  ? 0.551   -4.290  12.748  1.00 18.56 ? 31   LEU A CA    1 
ATOM   264  C C     . LEU A 1 49  ? -0.346  -4.885  13.818  1.00 18.45 ? 31   LEU A C     1 
ATOM   265  O O     . LEU A 1 49  ? -0.209  -6.052  14.158  1.00 18.48 ? 31   LEU A O     1 
ATOM   266  C CB    . LEU A 1 49  ? 1.954   -4.864  12.832  1.00 18.52 ? 31   LEU A CB    1 
ATOM   267  C CG    . LEU A 1 49  ? 2.964   -4.364  11.795  1.00 20.22 ? 31   LEU A CG    1 
ATOM   268  C CD1   . LEU A 1 49  ? 4.214   -5.168  11.901  1.00 22.86 ? 31   LEU A CD1   1 
ATOM   269  C CD2   . LEU A 1 49  ? 2.363   -4.432  10.384  1.00 20.92 ? 31   LEU A CD2   1 
ATOM   270  N N     . GLY A 1 50  ? -1.274  -4.088  14.337  1.00 18.98 ? 32   GLY A N     1 
ATOM   271  C CA    . GLY A 1 50  ? -2.338  -4.618  15.193  1.00 19.31 ? 32   GLY A CA    1 
ATOM   272  C C     . GLY A 1 50  ? -1.831  -5.239  16.489  1.00 19.84 ? 32   GLY A C     1 
ATOM   273  O O     . GLY A 1 50  ? -2.431  -6.186  17.001  1.00 20.13 ? 32   GLY A O     1 
ATOM   274  N N     . GLY A 1 51  ? -0.725  -4.721  17.020  1.00 19.79 ? 33   GLY A N     1 
ATOM   275  C CA    . GLY A 1 51  ? -0.147  -5.277  18.258  1.00 19.55 ? 33   GLY A CA    1 
ATOM   276  C C     . GLY A 1 51  ? 0.912   -6.339  18.005  1.00 20.74 ? 33   GLY A C     1 
ATOM   277  O O     . GLY A 1 51  ? 1.401   -6.995  18.950  1.00 20.71 ? 33   GLY A O     1 
ATOM   278  N N     . TYR A 1 52  ? 1.267   -6.529  16.739  1.00 21.38 ? 34   TYR A N     1 
ATOM   279  C CA    . TYR A 1 52  ? 2.281   -7.515  16.343  1.00 22.59 ? 34   TYR A CA    1 
ATOM   280  C C     . TYR A 1 52  ? 3.520   -6.857  15.742  1.00 22.81 ? 34   TYR A C     1 
ATOM   281  O O     . TYR A 1 52  ? 4.113   -7.373  14.790  1.00 22.78 ? 34   TYR A O     1 
ATOM   282  C CB    . TYR A 1 52  ? 1.697   -8.540  15.371  1.00 24.25 ? 34   TYR A CB    1 
ATOM   283  C CG    . TYR A 1 52  ? 0.728   -9.507  16.005  1.00 26.16 ? 34   TYR A CG    1 
ATOM   284  C CD1   . TYR A 1 52  ? 1.089   -10.832 16.229  1.00 28.46 ? 34   TYR A CD1   1 
ATOM   285  C CD2   . TYR A 1 52  ? -0.551  -9.094  16.390  1.00 27.69 ? 34   TYR A CD2   1 
ATOM   286  C CE1   . TYR A 1 52  ? 0.194   -11.733 16.824  1.00 29.97 ? 34   TYR A CE1   1 
ATOM   287  C CE2   . TYR A 1 52  ? -1.448  -9.981  16.987  1.00 28.92 ? 34   TYR A CE2   1 
ATOM   288  C CZ    . TYR A 1 52  ? -1.068  -11.295 17.203  1.00 27.99 ? 34   TYR A CZ    1 
ATOM   289  O OH    . TYR A 1 52  ? -1.959  -12.174 17.782  1.00 29.64 ? 34   TYR A OH    1 
ATOM   290  N N     . GLY A 1 53  ? 3.908   -5.717  16.301  1.00 22.45 ? 35   GLY A N     1 
ATOM   291  C CA    . GLY A 1 53  ? 5.026   -4.941  15.776  1.00 22.59 ? 35   GLY A CA    1 
ATOM   292  C C     . GLY A 1 53  ? 6.283   -5.775  15.604  1.00 22.15 ? 35   GLY A C     1 
ATOM   293  O O     . GLY A 1 53  ? 7.017   -5.631  14.635  1.00 21.78 ? 35   GLY A O     1 
ATOM   294  N N     . HIS A 1 54  ? 6.517   -6.675  16.555  1.00 22.26 ? 36   HIS A N     1 
ATOM   295  C CA    . HIS A 1 54  ? 7.683   -7.537  16.540  1.00 22.39 ? 36   HIS A CA    1 
ATOM   296  C C     . HIS A 1 54  ? 7.884   -8.384  15.264  1.00 22.58 ? 36   HIS A C     1 
ATOM   297  O O     . HIS A 1 54  ? 9.010   -8.802  14.995  1.00 22.86 ? 36   HIS A O     1 
ATOM   298  C CB    . HIS A 1 54  ? 7.677   -8.424  17.798  1.00 22.77 ? 36   HIS A CB    1 
ATOM   299  C CG    . HIS A 1 54  ? 6.527   -9.368  17.846  1.00 23.68 ? 36   HIS A CG    1 
ATOM   300  N ND1   . HIS A 1 54  ? 5.375   -9.109  18.558  1.00 27.36 ? 36   HIS A ND1   1 
ATOM   301  C CD2   . HIS A 1 54  ? 6.338   -10.561 17.244  1.00 24.63 ? 36   HIS A CD2   1 
ATOM   302  C CE1   . HIS A 1 54  ? 4.528   -10.107 18.393  1.00 25.54 ? 36   HIS A CE1   1 
ATOM   303  N NE2   . HIS A 1 54  ? 5.087   -10.999 17.597  1.00 25.97 ? 36   HIS A NE2   1 
ATOM   304  N N     . ILE A 1 55  ? 6.830   -8.631  14.472  1.00 21.41 ? 37   ILE A N     1 
ATOM   305  C CA    . ILE A 1 55  ? 6.973   -9.395  13.219  1.00 21.40 ? 37   ILE A CA    1 
ATOM   306  C C     . ILE A 1 55  ? 7.532   -8.568  12.065  1.00 20.63 ? 37   ILE A C     1 
ATOM   307  O O     . ILE A 1 55  ? 7.765   -9.095  10.981  1.00 20.37 ? 37   ILE A O     1 
ATOM   308  C CB    . ILE A 1 55  ? 5.639   -10.062 12.743  1.00 21.81 ? 37   ILE A CB    1 
ATOM   309  C CG1   . ILE A 1 55  ? 4.633   -9.017  12.215  1.00 21.09 ? 37   ILE A CG1   1 
ATOM   310  C CG2   . ILE A 1 55  ? 5.026   -10.923 13.857  1.00 21.52 ? 37   ILE A CG2   1 
ATOM   311  C CD1   . ILE A 1 55  ? 3.364   -9.614  11.611  1.00 22.17 ? 37   ILE A CD1   1 
ATOM   312  N N     . SER A 1 56  ? 7.694   -7.268  12.282  1.00 20.19 ? 38   SER A N     1 
ATOM   313  C CA    . SER A 1 56  ? 8.078   -6.383  11.164  1.00 19.63 ? 38   SER A CA    1 
ATOM   314  C C     . SER A 1 56  ? 9.343   -6.807  10.424  1.00 19.04 ? 38   SER A C     1 
ATOM   315  O O     . SER A 1 56  ? 9.359   -6.814  9.213   1.00 18.63 ? 38   SER A O     1 
ATOM   316  C CB    . SER A 1 56  ? 8.203   -4.929  11.640  1.00 19.42 ? 38   SER A CB    1 
ATOM   317  O OG    . SER A 1 56  ? 8.393   -4.062  10.526  1.00 19.40 ? 38   SER A OG    1 
ATOM   318  N N     . SER A 1 57  ? 10.403  -7.160  11.156  1.00 19.61 ? 39   SER A N     1 
ATOM   319  C CA    . SER A 1 57  ? 11.697  -7.452  10.526  1.00 20.05 ? 39   SER A CA    1 
ATOM   320  C C     . SER A 1 57  ? 11.667  -8.699  9.648   1.00 20.30 ? 39   SER A C     1 
ATOM   321  O O     . SER A 1 57  ? 12.218  -8.686  8.535   1.00 21.62 ? 39   SER A O     1 
ATOM   322  C CB    . SER A 1 57  ? 12.827  -7.535  11.570  1.00 19.52 ? 39   SER A CB    1 
ATOM   323  O OG    . SER A 1 57  ? 13.222  -6.237  11.987  1.00 19.41 ? 39   SER A OG    1 
ATOM   324  N N     . ILE A 1 58  ? 11.020  -9.761  10.139  1.00 20.49 ? 40   ILE A N     1 
ATOM   325  C CA    . ILE A 1 58  ? 10.853  -10.987 9.363   1.00 20.99 ? 40   ILE A CA    1 
ATOM   326  C C     . ILE A 1 58  ? 10.002  -10.727 8.102   1.00 19.42 ? 40   ILE A C     1 
ATOM   327  O O     . ILE A 1 58  ? 10.313  -11.215 7.016   1.00 18.18 ? 40   ILE A O     1 
ATOM   328  C CB    . ILE A 1 58  ? 10.333  -12.198 10.215  1.00 21.38 ? 40   ILE A CB    1 
ATOM   329  C CG1   . ILE A 1 58  ? 8.934   -11.947 10.800  1.00 23.75 ? 40   ILE A CG1   1 
ATOM   330  C CG2   . ILE A 1 58  ? 11.338  -12.523 11.322  1.00 22.83 ? 40   ILE A CG2   1 
ATOM   331  C CD1   . ILE A 1 58  ? 8.416   -13.029 11.771  1.00 23.14 ? 40   ILE A CD1   1 
ATOM   332  N N     . ASP A 1 59  ? 8.973   -9.909  8.256   1.00 18.06 ? 41   ASP A N     1 
ATOM   333  C CA    . ASP A 1 59  ? 8.140   -9.525  7.125   1.00 17.51 ? 41   ASP A CA    1 
ATOM   334  C C     . ASP A 1 59  ? 8.942   -8.735  6.087   1.00 17.40 ? 41   ASP A C     1 
ATOM   335  O O     . ASP A 1 59  ? 8.925   -9.055  4.906   1.00 17.21 ? 41   ASP A O     1 
ATOM   336  C CB    . ASP A 1 59  ? 6.978   -8.681  7.614   1.00 17.45 ? 41   ASP A CB    1 
ATOM   337  C CG    . ASP A 1 59  ? 6.263   -7.962  6.479   1.00 17.68 ? 41   ASP A CG    1 
ATOM   338  O OD1   . ASP A 1 59  ? 5.674   -8.640  5.609   1.00 19.12 ? 41   ASP A OD1   1 
ATOM   339  O OD2   . ASP A 1 59  ? 6.317   -6.719  6.468   1.00 18.62 ? 41   ASP A OD2   1 
ATOM   340  N N     . ILE A 1 60  ? 9.635   -7.700  6.537   1.00 17.60 ? 42   ILE A N     1 
ATOM   341  C CA    . ILE A 1 60  ? 10.403  -6.831  5.642   1.00 17.94 ? 42   ILE A CA    1 
ATOM   342  C C     . ILE A 1 60  ? 11.522  -7.590  4.900   1.00 18.33 ? 42   ILE A C     1 
ATOM   343  O O     . ILE A 1 60  ? 11.702  -7.418  3.693   1.00 17.64 ? 42   ILE A O     1 
ATOM   344  C CB    . ILE A 1 60  ? 10.984  -5.601  6.410   1.00 17.74 ? 42   ILE A CB    1 
ATOM   345  C CG1   . ILE A 1 60  ? 9.854   -4.659  6.867   1.00 18.51 ? 42   ILE A CG1   1 
ATOM   346  C CG2   . ILE A 1 60  ? 12.028  -4.861  5.545   1.00 19.18 ? 42   ILE A CG2   1 
ATOM   347  C CD1   . ILE A 1 60  ? 9.267   -3.772  5.725   1.00 17.40 ? 42   ILE A CD1   1 
ATOM   348  N N     . ASN A 1 61  ? 12.263  -8.414  5.633   1.00 19.18 ? 43   ASN A N     1 
ATOM   349  C CA    . ASN A 1 61  ? 13.374  -9.182  5.040   1.00 20.13 ? 43   ASN A CA    1 
ATOM   350  C C     . ASN A 1 61  ? 12.889  -10.169 4.000   1.00 19.96 ? 43   ASN A C     1 
ATOM   351  O O     . ASN A 1 61  ? 13.549  -10.389 2.990   1.00 19.98 ? 43   ASN A O     1 
ATOM   352  C CB    . ASN A 1 61  ? 14.180  -9.887  6.119   1.00 20.16 ? 43   ASN A CB    1 
ATOM   353  C CG    . ASN A 1 61  ? 14.932  -8.913  6.989   1.00 22.10 ? 43   ASN A CG    1 
ATOM   354  O OD1   . ASN A 1 61  ? 15.473  -7.921  6.499   1.00 26.60 ? 43   ASN A OD1   1 
ATOM   355  N ND2   . ASN A 1 61  ? 14.961  -9.177  8.286   1.00 25.15 ? 43   ASN A ND2   1 
ATOM   356  N N     . SER A 1 62  ? 11.729  -10.760 4.259   1.00 19.91 ? 44   SER A N     1 
ATOM   357  C CA    . SER A 1 62  ? 11.113  -11.704 3.325   1.00 21.07 ? 44   SER A CA    1 
ATOM   358  C C     . SER A 1 62  ? 10.605  -10.921 2.103   1.00 20.08 ? 44   SER A C     1 
ATOM   359  O O     . SER A 1 62  ? 10.778  -11.342 0.963   1.00 19.80 ? 44   SER A O     1 
ATOM   360  C CB    . SER A 1 62  ? 10.035  -12.513 4.060   1.00 21.28 ? 44   SER A CB    1 
ATOM   361  O OG    . SER A 1 62  ? 9.308   -13.392 3.212   1.00 26.99 ? 44   SER A OG    1 
ATOM   362  N N     . SER A 1 63  ? 10.019  -9.756  2.354   1.00 19.59 ? 45   SER A N     1 
ATOM   363  C CA    . SER A 1 63  ? 9.577   -8.875  1.267   1.00 19.16 ? 45   SER A CA    1 
ATOM   364  C C     . SER A 1 63  ? 10.743  -8.413  0.398   1.00 19.60 ? 45   SER A C     1 
ATOM   365  O O     . SER A 1 63  ? 10.637  -8.391  -0.808  1.00 19.57 ? 45   SER A O     1 
ATOM   366  C CB    . SER A 1 63  ? 8.795   -7.691  1.821   1.00 19.33 ? 45   SER A CB    1 
ATOM   367  O OG    . SER A 1 63  ? 7.580   -8.143  2.385   1.00 19.17 ? 45   SER A OG    1 
ATOM   368  N N     . ARG A 1 64  ? 11.868  -8.074  1.021   1.00 20.20 ? 46   ARG A N     1 
ATOM   369  C CA    . ARG A 1 64  ? 13.031  -7.636  0.255   1.00 22.06 ? 46   ARG A CA    1 
ATOM   370  C C     . ARG A 1 64  ? 13.508  -8.729  -0.693  1.00 22.06 ? 46   ARG A C     1 
ATOM   371  O O     . ARG A 1 64  ? 13.771  -8.464  -1.868  1.00 23.07 ? 46   ARG A O     1 
ATOM   372  C CB    . ARG A 1 64  ? 14.157  -7.206  1.189   1.00 21.00 ? 46   ARG A CB    1 
ATOM   373  C CG    . ARG A 1 64  ? 15.324  -6.531  0.469   1.00 23.37 ? 46   ARG A CG    1 
ATOM   374  C CD    . ARG A 1 64  ? 16.413  -6.061  1.449   1.00 24.12 ? 46   ARG A CD    1 
ATOM   375  N NE    . ARG A 1 64  ? 15.945  -5.038  2.385   1.00 28.96 ? 46   ARG A NE    1 
ATOM   376  C CZ    . ARG A 1 64  ? 15.700  -5.228  3.682   1.00 29.82 ? 46   ARG A CZ    1 
ATOM   377  N NH1   . ARG A 1 64  ? 15.880  -6.420  4.242   1.00 31.83 ? 46   ARG A NH1   1 
ATOM   378  N NH2   . ARG A 1 64  ? 15.277  -4.212  4.427   1.00 28.99 ? 46   ARG A NH2   1 
ATOM   379  N N     . LYS A 1 65  ? 13.629  -9.952  -0.176  1.00 22.55 ? 47   LYS A N     1 
ATOM   380  C CA    . LYS A 1 65  ? 14.102  -11.097 -0.961  1.00 22.78 ? 47   LYS A CA    1 
ATOM   381  C C     . LYS A 1 65  ? 13.176  -11.389 -2.139  1.00 22.42 ? 47   LYS A C     1 
ATOM   382  O O     . LYS A 1 65  ? 13.634  -11.630 -3.252  1.00 22.60 ? 47   LYS A O     1 
ATOM   383  C CB    . LYS A 1 65  ? 14.263  -12.336 -0.069  1.00 23.09 ? 47   LYS A CB    1 
ATOM   384  C CG    . LYS A 1 65  ? 14.814  -13.570 -0.793  1.00 24.44 ? 47   LYS A CG    1 
ATOM   385  C CD    . LYS A 1 65  ? 15.446  -14.558 0.176   1.00 27.89 ? 47   LYS A CD    1 
ATOM   386  C CE    . LYS A 1 65  ? 15.691  -15.908 -0.494  1.00 29.05 ? 47   LYS A CE    1 
ATOM   387  N NZ    . LYS A 1 65  ? 16.694  -16.680 0.293   1.00 33.18 ? 47   LYS A NZ    1 
ATOM   388  N N     . PHE A 1 66  ? 11.872  -11.307 -1.886  1.00 22.28 ? 48   PHE A N     1 
ATOM   389  C CA    . PHE A 1 66  ? 10.853  -11.464 -2.928  1.00 21.86 ? 48   PHE A CA    1 
ATOM   390  C C     . PHE A 1 66  ? 10.967  -10.400 -4.035  1.00 21.64 ? 48   PHE A C     1 
ATOM   391  O O     . PHE A 1 66  ? 10.936  -10.722 -5.238  1.00 22.37 ? 48   PHE A O     1 
ATOM   392  C CB    . PHE A 1 66  ? 9.469   -11.447 -2.259  1.00 21.33 ? 48   PHE A CB    1 
ATOM   393  C CG    . PHE A 1 66  ? 8.335   -11.766 -3.185  1.00 22.02 ? 48   PHE A CG    1 
ATOM   394  C CD1   . PHE A 1 66  ? 8.075   -13.093 -3.560  1.00 22.85 ? 48   PHE A CD1   1 
ATOM   395  C CD2   . PHE A 1 66  ? 7.524   -10.745 -3.682  1.00 21.37 ? 48   PHE A CD2   1 
ATOM   396  C CE1   . PHE A 1 66  ? 7.011   -13.396 -4.420  1.00 22.81 ? 48   PHE A CE1   1 
ATOM   397  C CE2   . PHE A 1 66  ? 6.461   -11.032 -4.534  1.00 22.30 ? 48   PHE A CE2   1 
ATOM   398  C CZ    . PHE A 1 66  ? 6.204   -12.363 -4.908  1.00 21.75 ? 48   PHE A CZ    1 
ATOM   399  N N     . LEU A 1 67  ? 11.122  -9.137  -3.628  1.00 21.30 ? 49   LEU A N     1 
ATOM   400  C CA    . LEU A 1 67  ? 11.215  -8.024  -4.542  1.00 20.59 ? 49   LEU A CA    1 
ATOM   401  C C     . LEU A 1 67  ? 12.531  -8.031  -5.320  1.00 21.97 ? 49   LEU A C     1 
ATOM   402  O O     . LEU A 1 67  ? 12.527  -7.742  -6.498  1.00 20.99 ? 49   LEU A O     1 
ATOM   403  C CB    . LEU A 1 67  ? 11.044  -6.681  -3.811  1.00 20.38 ? 49   LEU A CB    1 
ATOM   404  C CG    . LEU A 1 67  ? 11.045  -5.418  -4.673  1.00 19.84 ? 49   LEU A CG    1 
ATOM   405  C CD1   . LEU A 1 67  ? 10.047  -5.489  -5.829  1.00 16.79 ? 49   LEU A CD1   1 
ATOM   406  C CD2   . LEU A 1 67  ? 10.770  -4.200  -3.820  1.00 19.28 ? 49   LEU A CD2   1 
ATOM   407  N N     . GLN A 1 68  ? 13.630  -8.364  -4.648  1.00 23.97 ? 50   GLN A N     1 
ATOM   408  C CA    . GLN A 1 68  ? 14.972  -8.368  -5.276  1.00 27.44 ? 50   GLN A CA    1 
ATOM   409  C C     . GLN A 1 68  ? 15.065  -9.192  -6.552  1.00 28.19 ? 50   GLN A C     1 
ATOM   410  O O     . GLN A 1 68  ? 15.869  -8.880  -7.442  1.00 29.54 ? 50   GLN A O     1 
ATOM   411  C CB    . GLN A 1 68  ? 16.027  -8.870  -4.288  1.00 27.69 ? 50   GLN A CB    1 
ATOM   412  C CG    . GLN A 1 68  ? 16.570  -7.812  -3.355  1.00 29.33 ? 50   GLN A CG    1 
ATOM   413  C CD    . GLN A 1 68  ? 17.437  -8.422  -2.251  1.00 29.71 ? 50   GLN A CD    1 
ATOM   414  O OE1   . GLN A 1 68  ? 17.398  -9.630  -2.006  1.00 34.56 ? 50   GLN A OE1   1 
ATOM   415  N NE2   . GLN A 1 68  ? 18.213  -7.585  -1.574  1.00 32.94 ? 50   GLN A NE2   1 
ATOM   416  N N     . ARG A 1 69  ? 14.255  -10.246 -6.638  1.00 28.76 ? 51   ARG A N     1 
ATOM   417  C CA    . ARG A 1 69  ? 14.201  -11.099 -7.839  1.00 29.42 ? 51   ARG A CA    1 
ATOM   418  C C     . ARG A 1 69  ? 13.888  -10.309 -9.110  1.00 29.18 ? 51   ARG A C     1 
ATOM   419  O O     . ARG A 1 69  ? 14.393  -10.630 -10.199 1.00 29.58 ? 51   ARG A O     1 
ATOM   420  C CB    . ARG A 1 69  ? 13.157  -12.206 -7.661  1.00 29.65 ? 51   ARG A CB    1 
ATOM   421  C CG    . ARG A 1 69  ? 13.295  -12.986 -6.358  1.00 31.05 ? 51   ARG A CG    1 
ATOM   422  N NE    . ARG A 1 69  ? 14.093  -16.327 -6.310  1.00 74.16 ? 51   ARG A NE    1 
ATOM   423  C CZ    . ARG A 1 69  ? 14.939  -16.028 -7.290  1.00 74.08 ? 51   ARG A CZ    1 
ATOM   424  N NH1   . ARG A 1 69  ? 16.214  -16.386 -7.204  1.00 73.96 ? 51   ARG A NH1   1 
ATOM   425  N NH2   . ARG A 1 69  ? 14.510  -15.370 -8.357  1.00 74.21 ? 51   ARG A NH2   1 
ATOM   426  N N     . PHE A 1 70  ? 13.056  -9.285  -8.969  1.00 28.39 ? 52   PHE A N     1 
ATOM   427  C CA    . PHE A 1 70  ? 12.593  -8.493  -10.101 1.00 28.49 ? 52   PHE A CA    1 
ATOM   428  C C     . PHE A 1 70  ? 13.559  -7.359  -10.450 1.00 28.83 ? 52   PHE A C     1 
ATOM   429  O O     . PHE A 1 70  ? 13.506  -6.794  -11.555 1.00 27.96 ? 52   PHE A O     1 
ATOM   430  C CB    . PHE A 1 70  ? 11.169  -7.978  -9.836  1.00 28.09 ? 52   PHE A CB    1 
ATOM   431  C CG    . PHE A 1 70  ? 10.148  -9.081  -9.739  1.00 27.45 ? 52   PHE A CG    1 
ATOM   432  C CD1   . PHE A 1 70  ? 9.563   -9.605  -10.895 1.00 27.46 ? 52   PHE A CD1   1 
ATOM   433  C CD2   . PHE A 1 70  ? 9.800   -9.619  -8.503  1.00 27.33 ? 52   PHE A CD2   1 
ATOM   434  C CE1   . PHE A 1 70  ? 8.637   -10.659 -10.819 1.00 26.94 ? 52   PHE A CE1   1 
ATOM   435  C CE2   . PHE A 1 70  ? 8.877   -10.664 -8.409  1.00 27.06 ? 52   PHE A CE2   1 
ATOM   436  C CZ    . PHE A 1 70  ? 8.299   -11.192 -9.569  1.00 27.90 ? 52   PHE A CZ    1 
ATOM   437  N N     . LEU A 1 71  ? 14.429  -7.030  -9.496  1.00 29.68 ? 53   LEU A N     1 
ATOM   438  C CA    . LEU A 1 71  ? 15.404  -5.961  -9.663  1.00 31.20 ? 53   LEU A CA    1 
ATOM   439  C C     . LEU A 1 71  ? 16.790  -6.486  -10.059 1.00 32.13 ? 53   LEU A C     1 
ATOM   440  O O     . LEU A 1 71  ? 17.754  -5.717  -10.098 1.00 32.99 ? 53   LEU A O     1 
ATOM   441  C CB    . LEU A 1 71  ? 15.512  -5.121  -8.384  1.00 31.35 ? 53   LEU A CB    1 
ATOM   442  C CG    . LEU A 1 71  ? 14.250  -4.618  -7.658  1.00 31.20 ? 53   LEU A CG    1 
ATOM   443  C CD1   . LEU A 1 71  ? 14.625  -4.083  -6.277  1.00 31.25 ? 53   LEU A CD1   1 
ATOM   444  C CD2   . LEU A 1 71  ? 13.483  -3.566  -8.456  1.00 32.25 ? 53   LEU A CD2   1 
ATOM   445  N N     . ARG A 1 72  ? 16.892  -7.784  -10.340 1.00 32.85 ? 54   ARG A N     1 
ATOM   446  C CA    . ARG A 1 72  ? 18.158  -8.385  -10.791 1.00 33.59 ? 54   ARG A CA    1 
ATOM   447  C C     . ARG A 1 72  ? 18.563  -7.942  -12.199 1.00 33.94 ? 54   ARG A C     1 
ATOM   448  O O     . ARG A 1 72  ? 17.711  -7.587  -13.026 1.00 34.13 ? 54   ARG A O     1 
ATOM   449  C CB    . ARG A 1 72  ? 18.116  -9.914  -10.703 1.00 33.80 ? 54   ARG A CB    1 
ATOM   450  C CG    . ARG A 1 72  ? 17.293  -10.601 -11.799 1.00 34.46 ? 54   ARG A CG    1 
ATOM   451  N NE    . ARG A 1 72  ? 16.311  -13.257 -9.992  1.00 61.46 ? 54   ARG A NE    1 
ATOM   452  C CZ    . ARG A 1 72  ? 16.205  -14.149 -10.973 1.00 61.47 ? 54   ARG A CZ    1 
ATOM   453  N NH1   . ARG A 1 72  ? 15.010  -14.571 -11.365 1.00 61.27 ? 54   ARG A NH1   1 
ATOM   454  N NH2   . ARG A 1 72  ? 17.296  -14.622 -11.563 1.00 61.27 ? 54   ARG A NH2   1 
ATOM   455  N N     . LYS A 1 77  ? 14.438  -6.278  -16.445 1.00 25.07 ? 60   LYS A N     1 
ATOM   456  C CA    . LYS A 1 77  ? 14.630  -5.779  -15.071 1.00 25.77 ? 60   LYS A CA    1 
ATOM   457  C C     . LYS A 1 77  ? 13.604  -4.694  -14.709 1.00 24.76 ? 60   LYS A C     1 
ATOM   458  O O     . LYS A 1 77  ? 13.309  -3.816  -15.530 1.00 24.66 ? 60   LYS A O     1 
ATOM   459  C CB    . LYS A 1 77  ? 16.064  -5.263  -14.926 1.00 25.75 ? 60   LYS A CB    1 
ATOM   460  C CG    . LYS A 1 77  ? 16.387  -4.418  -13.721 1.00 29.03 ? 60   LYS A CG    1 
ATOM   461  C CD    . LYS A 1 77  ? 17.508  -3.427  -14.068 1.00 31.69 ? 60   LYS A CD    1 
ATOM   462  C CE    . LYS A 1 77  ? 17.877  -2.510  -12.907 1.00 31.34 ? 60   LYS A CE    1 
ATOM   463  N NZ    . LYS A 1 77  ? 16.710  -1.945  -12.153 1.00 31.99 ? 60   LYS A NZ    1 
ATOM   464  N N     . THR A 1 78  ? 13.059  -4.770  -13.488 1.00 23.94 ? 61   THR A N     1 
ATOM   465  C CA    . THR A 1 78  ? 12.190  -3.721  -12.960 1.00 23.27 ? 61   THR A CA    1 
ATOM   466  C C     . THR A 1 78  ? 13.044  -2.501  -12.561 1.00 22.67 ? 61   THR A C     1 
ATOM   467  O O     . THR A 1 78  ? 14.136  -2.646  -12.010 1.00 21.70 ? 61   THR A O     1 
ATOM   468  C CB    . THR A 1 78  ? 11.327  -4.207  -11.744 1.00 23.30 ? 61   THR A CB    1 
ATOM   469  O OG1   . THR A 1 78  ? 10.495  -5.316  -12.129 1.00 22.03 ? 61   THR A OG1   1 
ATOM   470  C CG2   . THR A 1 78  ? 10.444  -3.073  -11.190 1.00 23.60 ? 61   THR A CG2   1 
ATOM   471  N N     . GLY A 1 79  ? 12.529  -1.315  -12.865 1.00 22.41 ? 62   GLY A N     1 
ATOM   472  C CA    . GLY A 1 79  ? 13.208  -0.059  -12.587 1.00 22.76 ? 62   GLY A CA    1 
ATOM   473  C C     . GLY A 1 79  ? 13.276  0.319   -11.117 1.00 23.28 ? 62   GLY A C     1 
ATOM   474  O O     . GLY A 1 79  ? 12.558  -0.225  -10.272 1.00 22.47 ? 62   GLY A O     1 
ATOM   475  N N     . THR A 1 80  ? 14.151  1.271   -10.810 1.00 23.32 ? 63   THR A N     1 
ATOM   476  C CA    . THR A 1 80  ? 14.370  1.657   -9.425  1.00 23.25 ? 63   THR A CA    1 
ATOM   477  C C     . THR A 1 80  ? 14.082  3.130   -9.177  1.00 23.29 ? 63   THR A C     1 
ATOM   478  O O     . THR A 1 80  ? 14.496  3.673   -8.159  1.00 23.97 ? 63   THR A O     1 
ATOM   479  C CB    . THR A 1 80  ? 15.795  1.302   -8.953  1.00 24.05 ? 63   THR A CB    1 
ATOM   480  O OG1   . THR A 1 80  ? 16.753  1.893   -9.846  1.00 22.48 ? 63   THR A OG1   1 
ATOM   481  C CG2   . THR A 1 80  ? 15.995  -0.219  -8.896  1.00 23.55 ? 63   THR A CG2   1 
ATOM   482  N N     . SER A 1 81  ? 13.368  3.776   -10.095 1.00 22.15 ? 64   SER A N     1 
ATOM   483  C CA    . SER A 1 81  ? 13.129  5.219   -10.001 1.00 22.27 ? 64   SER A CA    1 
ATOM   484  C C     . SER A 1 81  ? 12.041  5.649   -9.020  1.00 21.28 ? 64   SER A C     1 
ATOM   485  O O     . SER A 1 81  ? 12.211  6.638   -8.293  1.00 20.69 ? 64   SER A O     1 
ATOM   486  C CB    . SER A 1 81  ? 12.813  5.814   -11.376 1.00 21.93 ? 64   SER A CB    1 
ATOM   487  O OG    . SER A 1 81  ? 13.718  5.316   -12.341 1.00 27.05 ? 64   SER A OG    1 
ATOM   488  N N     . CYS A 1 82  ? 10.908  4.939   -9.025  1.00 21.36 ? 65   CYS A N     1 
ATOM   489  C CA    . CYS A 1 82  ? 9.758   5.356   -8.238  1.00 20.28 ? 65   CYS A CA    1 
ATOM   490  C C     . CYS A 1 82  ? 8.918   4.159   -7.805  1.00 18.95 ? 65   CYS A C     1 
ATOM   491  O O     . CYS A 1 82  ? 8.697   3.225   -8.579  1.00 17.80 ? 65   CYS A O     1 
ATOM   492  C CB    . CYS A 1 82  ? 8.884   6.328   -9.032  1.00 20.92 ? 65   CYS A CB    1 
ATOM   493  S SG    . CYS A 1 82  ? 7.747   7.336   -8.051  1.00 24.43 ? 65   CYS A SG    1 
ATOM   494  N N     . ALA A 1 83  ? 8.516   4.181   -6.537  1.00 17.60 ? 66   ALA A N     1 
ATOM   495  C CA    . ALA A 1 83  ? 7.540   3.235   -6.014  1.00 16.73 ? 66   ALA A CA    1 
ATOM   496  C C     . ALA A 1 83  ? 6.343   3.950   -5.366  1.00 16.14 ? 66   ALA A C     1 
ATOM   497  O O     . ALA A 1 83  ? 6.414   5.126   -4.960  1.00 16.09 ? 66   ALA A O     1 
ATOM   498  C CB    . ALA A 1 83  ? 8.196   2.291   -5.023  1.00 17.14 ? 66   ALA A CB    1 
ATOM   499  N N     . LEU A 1 84  ? 5.229   3.233   -5.287  1.00 14.82 ? 67   LEU A N     1 
ATOM   500  C CA    . LEU A 1 84  ? 4.016   3.711   -4.646  1.00 14.48 ? 67   LEU A CA    1 
ATOM   501  C C     . LEU A 1 84  ? 3.701   2.747   -3.510  1.00 13.69 ? 67   LEU A C     1 
ATOM   502  O O     . LEU A 1 84  ? 3.574   1.539   -3.752  1.00 14.28 ? 67   LEU A O     1 
ATOM   503  C CB    . LEU A 1 84  ? 2.830   3.757   -5.646  1.00 14.65 ? 67   LEU A CB    1 
ATOM   504  C CG    . LEU A 1 84  ? 1.458   4.139   -5.038  1.00 14.56 ? 67   LEU A CG    1 
ATOM   505  C CD1   . LEU A 1 84  ? 1.455   5.544   -4.412  1.00 15.44 ? 67   LEU A CD1   1 
ATOM   506  C CD2   . LEU A 1 84  ? 0.275   4.000   -6.020  1.00 15.89 ? 67   LEU A CD2   1 
ATOM   507  N N     . ASP A 1 85  ? 3.657   3.267   -2.285  1.00 12.40 ? 68   ASP A N     1 
ATOM   508  C CA    . ASP A 1 85  ? 3.231   2.495   -1.097  1.00 12.91 ? 68   ASP A CA    1 
ATOM   509  C C     . ASP A 1 85  ? 1.739   2.714   -0.823  1.00 12.58 ? 68   ASP A C     1 
ATOM   510  O O     . ASP A 1 85  ? 1.315   3.818   -0.489  1.00 13.20 ? 68   ASP A O     1 
ATOM   511  C CB    . ASP A 1 85  ? 4.113   2.900   0.118   1.00 11.58 ? 68   ASP A CB    1 
ATOM   512  C CG    . ASP A 1 85  ? 3.983   1.952   1.307   1.00 13.08 ? 68   ASP A CG    1 
ATOM   513  O OD1   . ASP A 1 85  ? 3.120   1.049   1.313   1.00 13.73 ? 68   ASP A OD1   1 
ATOM   514  O OD2   . ASP A 1 85  ? 4.779   2.134   2.253   1.00 15.02 ? 68   ASP A OD2   1 
ATOM   515  N N     . CYS A 1 86  ? 0.934   1.653   -0.964  1.00 12.46 ? 69   CYS A N     1 
ATOM   516  C CA    . CYS A 1 86  ? -0.522  1.748   -0.832  1.00 12.33 ? 69   CYS A CA    1 
ATOM   517  C C     . CYS A 1 86  ? -1.008  1.289   0.551   1.00 12.63 ? 69   CYS A C     1 
ATOM   518  O O     . CYS A 1 86  ? -0.627  0.210   1.030   1.00 13.91 ? 69   CYS A O     1 
ATOM   519  C CB    . CYS A 1 86  ? -1.212  0.895   -1.888  1.00 12.89 ? 69   CYS A CB    1 
ATOM   520  S SG    . CYS A 1 86  ? -0.867  1.418   -3.576  1.00 14.95 ? 69   CYS A SG    1 
ATOM   521  N N     . GLY A 1 87  ? -1.897  2.078   1.151   1.00 13.02 ? 70   GLY A N     1 
ATOM   522  C CA    . GLY A 1 87  ? -2.224  1.891   2.587   1.00 12.09 ? 70   GLY A CA    1 
ATOM   523  C C     . GLY A 1 87  ? -0.923  1.973   3.385   1.00 12.51 ? 70   GLY A C     1 
ATOM   524  O O     . GLY A 1 87  ? -0.654  1.155   4.238   1.00 13.42 ? 70   GLY A O     1 
ATOM   525  N N     . ALA A 1 88  ? -0.115  2.980   3.095   1.00 13.15 ? 71   ALA A N     1 
ATOM   526  C CA    . ALA A 1 88  ? 1.242   3.064   3.632   1.00 13.62 ? 71   ALA A CA    1 
ATOM   527  C C     . ALA A 1 88  ? 1.330   3.273   5.147   1.00 13.15 ? 71   ALA A C     1 
ATOM   528  O O     . ALA A 1 88  ? 2.386   3.012   5.726   1.00 13.77 ? 71   ALA A O     1 
ATOM   529  C CB    . ALA A 1 88  ? 1.991   4.156   2.938   1.00 13.39 ? 71   ALA A CB    1 
ATOM   530  N N     . GLY A 1 89  ? 0.270   3.792   5.770   1.00 13.45 ? 72   GLY A N     1 
ATOM   531  C CA    . GLY A 1 89  ? 0.307   4.127   7.193   1.00 13.86 ? 72   GLY A CA    1 
ATOM   532  C C     . GLY A 1 89  ? 1.430   5.122   7.467   1.00 13.75 ? 72   GLY A C     1 
ATOM   533  O O     . GLY A 1 89  ? 1.620   6.059   6.690   1.00 14.23 ? 72   GLY A O     1 
ATOM   534  N N     . ILE A 1 90  ? 2.186   4.903   8.549   1.00 13.40 ? 73   ILE A N     1 
ATOM   535  C CA    . ILE A 1 90  ? 3.287   5.807   8.936   1.00 14.34 ? 73   ILE A CA    1 
ATOM   536  C C     . ILE A 1 90  ? 4.581   5.568   8.122   1.00 15.24 ? 73   ILE A C     1 
ATOM   537  O O     . ILE A 1 90  ? 5.576   6.285   8.295   1.00 15.60 ? 73   ILE A O     1 
ATOM   538  C CB    . ILE A 1 90  ? 3.610   5.691   10.460  1.00 14.00 ? 73   ILE A CB    1 
ATOM   539  C CG1   . ILE A 1 90  ? 4.086   4.264   10.801  1.00 14.48 ? 73   ILE A CG1   1 
ATOM   540  C CG2   . ILE A 1 90  ? 2.411   6.181   11.289  1.00 15.58 ? 73   ILE A CG2   1 
ATOM   541  C CD1   . ILE A 1 90  ? 4.812   4.133   12.172  1.00 15.71 ? 73   ILE A CD1   1 
ATOM   542  N N     . GLY A 1 91  ? 4.563   4.563   7.243   1.00 15.43 ? 74   GLY A N     1 
ATOM   543  C CA    . GLY A 1 91  ? 5.704   4.287   6.374   1.00 14.75 ? 74   GLY A CA    1 
ATOM   544  C C     . GLY A 1 91  ? 6.660   3.213   6.868   1.00 15.41 ? 74   GLY A C     1 
ATOM   545  O O     . GLY A 1 91  ? 7.850   3.268   6.585   1.00 14.57 ? 74   GLY A O     1 
ATOM   546  N N     . ARG A 1 92  ? 6.135   2.219   7.580   1.00 14.51 ? 75   ARG A N     1 
ATOM   547  C CA    . ARG A 1 92  ? 6.946   1.062   8.004   1.00 15.30 ? 75   ARG A CA    1 
ATOM   548  C C     . ARG A 1 92  ? 7.655   0.469   6.797   1.00 15.47 ? 75   ARG A C     1 
ATOM   549  O O     . ARG A 1 92  ? 8.854   0.259   6.819   1.00 15.17 ? 75   ARG A O     1 
ATOM   550  C CB    . ARG A 1 92  ? 6.053   0.014   8.677   1.00 15.62 ? 75   ARG A CB    1 
ATOM   551  C CG    . ARG A 1 92  ? 6.775   -1.243  9.188   1.00 15.27 ? 75   ARG A CG    1 
ATOM   552  C CD    . ARG A 1 92  ? 5.732   -2.229  9.657   1.00 14.98 ? 75   ARG A CD    1 
ATOM   553  N NE    . ARG A 1 92  ? 4.990   -2.835  8.553   1.00 15.51 ? 75   ARG A NE    1 
ATOM   554  C CZ    . ARG A 1 92  ? 5.376   -3.947  7.928   1.00 15.43 ? 75   ARG A CZ    1 
ATOM   555  N NH1   . ARG A 1 92  ? 6.514   -4.525  8.269   1.00 17.27 ? 75   ARG A NH1   1 
ATOM   556  N NH2   . ARG A 1 92  ? 4.653   -4.461  6.948   1.00 15.76 ? 75   ARG A NH2   1 
ATOM   557  N N     . ILE A 1 93  ? 6.900   0.237   5.730   1.00 13.91 ? 76   ILE A N     1 
ATOM   558  C CA    . ILE A 1 93  ? 7.437   -0.396  4.536   1.00 14.28 ? 76   ILE A CA    1 
ATOM   559  C C     . ILE A 1 93  ? 8.255   0.593   3.725   1.00 14.30 ? 76   ILE A C     1 
ATOM   560  O O     . ILE A 1 93  ? 9.284   0.231   3.147   1.00 13.72 ? 76   ILE A O     1 
ATOM   561  C CB    . ILE A 1 93  ? 6.318   -1.006  3.662   1.00 13.45 ? 76   ILE A CB    1 
ATOM   562  C CG1   . ILE A 1 93  ? 5.471   -1.986  4.484   1.00 13.33 ? 76   ILE A CG1   1 
ATOM   563  C CG2   . ILE A 1 93  ? 6.898   -1.682  2.411   1.00 14.76 ? 76   ILE A CG2   1 
ATOM   564  C CD1   . ILE A 1 93  ? 4.214   -2.447  3.751   1.00 14.29 ? 76   ILE A CD1   1 
ATOM   565  N N     . THR A 1 94  ? 7.763   1.824   3.630   1.00 14.32 ? 77   THR A N     1 
ATOM   566  C CA    . THR A 1 94  ? 8.484   2.891   2.900   1.00 15.12 ? 77   THR A CA    1 
ATOM   567  C C     . THR A 1 94  ? 9.904   3.099   3.491   1.00 15.53 ? 77   THR A C     1 
ATOM   568  O O     . THR A 1 94  ? 10.875  3.243   2.748   1.00 15.46 ? 77   THR A O     1 
ATOM   569  C CB    . THR A 1 94  ? 7.681   4.216   2.906   1.00 16.00 ? 77   THR A CB    1 
ATOM   570  O OG1   . THR A 1 94  ? 6.508   4.073   2.083   1.00 17.98 ? 77   THR A OG1   1 
ATOM   571  C CG2   . THR A 1 94  ? 8.521   5.351   2.332   1.00 14.26 ? 77   THR A CG2   1 
ATOM   572  N N     . LYS A 1 95  ? 10.018  3.071   4.815   1.00 15.67 ? 78   LYS A N     1 
ATOM   573  C CA    . LYS A 1 95  ? 11.315  3.255   5.488   1.00 15.65 ? 78   LYS A CA    1 
ATOM   574  C C     . LYS A 1 95  ? 12.289  2.147   5.182   1.00 15.95 ? 78   LYS A C     1 
ATOM   575  O O     . LYS A 1 95  ? 13.446  2.392   4.854   1.00 15.51 ? 78   LYS A O     1 
ATOM   576  C CB    . LYS A 1 95  ? 11.135  3.295   7.005   1.00 16.13 ? 78   LYS A CB    1 
ATOM   577  C CG    . LYS A 1 95  ? 12.408  3.683   7.792   1.00 18.31 ? 78   LYS A CG    1 
ATOM   578  C CD    . LYS A 1 95  ? 11.963  4.531   9.000   1.00 23.87 ? 78   LYS A CD    1 
ATOM   579  C CE    . LYS A 1 95  ? 13.096  5.257   9.687   1.00 26.81 ? 78   LYS A CE    1 
ATOM   580  N NZ    . LYS A 1 95  ? 13.299  4.543   10.983  1.00 29.56 ? 78   LYS A NZ    1 
ATOM   581  N N     . ARG A 1 96  ? 11.833  0.915   5.350   1.00 15.84 ? 79   ARG A N     1 
ATOM   582  C CA    . ARG A 1 96  ? 12.766  -0.207  5.368   1.00 16.74 ? 79   ARG A CA    1 
ATOM   583  C C     . ARG A 1 96  ? 12.876  -0.963  4.056   1.00 16.77 ? 79   ARG A C     1 
ATOM   584  O O     . ARG A 1 96  ? 13.937  -1.506  3.753   1.00 16.19 ? 79   ARG A O     1 
ATOM   585  C CB    . ARG A 1 96  ? 12.410  -1.139  6.529   1.00 16.57 ? 79   ARG A CB    1 
ATOM   586  C CG    . ARG A 1 96  ? 12.795  -0.584  7.875   1.00 18.76 ? 79   ARG A CG    1 
ATOM   587  C CD    . ARG A 1 96  ? 12.507  -1.592  8.984   1.00 21.18 ? 79   ARG A CD    1 
ATOM   588  N NE    . ARG A 1 96  ? 13.456  -2.708  8.970   1.00 20.40 ? 79   ARG A NE    1 
ATOM   589  C CZ    . ARG A 1 96  ? 13.396  -3.744  9.801   1.00 23.20 ? 79   ARG A CZ    1 
ATOM   590  N NH1   . ARG A 1 96  ? 12.420  -3.812  10.710  1.00 19.74 ? 79   ARG A NH1   1 
ATOM   591  N NH2   . ARG A 1 96  ? 14.309  -4.721  9.718   1.00 23.25 ? 79   ARG A NH2   1 
ATOM   592  N N     . LEU A 1 97  ? 11.799  -0.990  3.273   1.00 16.28 ? 80   LEU A N     1 
ATOM   593  C CA    . LEU A 1 97  ? 11.838  -1.688  1.980   1.00 16.01 ? 80   LEU A CA    1 
ATOM   594  C C     . LEU A 1 97  ? 12.026  -0.745  0.817   1.00 16.20 ? 80   LEU A C     1 
ATOM   595  O O     . LEU A 1 97  ? 12.916  -0.966  -0.023  1.00 15.67 ? 80   LEU A O     1 
ATOM   596  C CB    . LEU A 1 97  ? 10.559  -2.513  1.763   1.00 16.82 ? 80   LEU A CB    1 
ATOM   597  C CG    . LEU A 1 97  ? 10.389  -3.271  0.427   1.00 16.92 ? 80   LEU A CG    1 
ATOM   598  C CD1   . LEU A 1 97  ? 11.470  -4.338  0.318   1.00 19.82 ? 80   LEU A CD1   1 
ATOM   599  C CD2   . LEU A 1 97  ? 8.988   -3.877  0.331   1.00 16.30 ? 80   LEU A CD2   1 
ATOM   600  N N     . LEU A 1 98  ? 11.187  0.298   0.742   1.00 15.31 ? 81   LEU A N     1 
ATOM   601  C CA    . LEU A 1 98  ? 11.090  1.035   -0.507  1.00 15.81 ? 81   LEU A CA    1 
ATOM   602  C C     . LEU A 1 98  ? 12.137  2.104   -0.642  1.00 15.86 ? 81   LEU A C     1 
ATOM   603  O O     . LEU A 1 98  ? 12.812  2.151   -1.674  1.00 16.11 ? 81   LEU A O     1 
ATOM   604  C CB    . LEU A 1 98  ? 9.671   1.598   -0.715  1.00 15.64 ? 81   LEU A CB    1 
ATOM   605  C CG    . LEU A 1 98  ? 8.620   0.483   -0.784  1.00 15.89 ? 81   LEU A CG    1 
ATOM   606  C CD1   . LEU A 1 98  ? 7.228   1.088   -0.874  1.00 16.22 ? 81   LEU A CD1   1 
ATOM   607  C CD2   . LEU A 1 98  ? 8.866   -0.514  -1.952  1.00 14.88 ? 81   LEU A CD2   1 
ATOM   608  N N     . LEU A 1 99  ? 12.260  2.985   0.357   1.00 16.03 ? 82   LEU A N     1 
ATOM   609  C CA    . LEU A 1 99  ? 13.237  4.098   0.246   1.00 17.10 ? 82   LEU A CA    1 
ATOM   610  C C     . LEU A 1 99  ? 14.680  3.665   -0.017  1.00 17.54 ? 82   LEU A C     1 
ATOM   611  O O     . LEU A 1 99  ? 15.371  4.349   -0.762  1.00 18.75 ? 82   LEU A O     1 
ATOM   612  C CB    . LEU A 1 99  ? 13.185  5.093   1.419   1.00 16.37 ? 82   LEU A CB    1 
ATOM   613  C CG    . LEU A 1 99  ? 12.028  6.112   1.443   1.00 16.90 ? 82   LEU A CG    1 
ATOM   614  C CD1   . LEU A 1 99  ? 11.906  6.765   2.807   1.00 20.02 ? 82   LEU A CD1   1 
ATOM   615  C CD2   . LEU A 1 99  ? 12.195  7.187   0.354   1.00 18.92 ? 82   LEU A CD2   1 
ATOM   616  N N     . PRO A 1 100 ? 15.160  2.571   0.619   1.00 18.44 ? 83   PRO A N     1 
ATOM   617  C CA    . PRO A 1 100 ? 16.514  2.061   0.294   1.00 18.71 ? 83   PRO A CA    1 
ATOM   618  C C     . PRO A 1 100 ? 16.695  1.559   -1.144  1.00 19.69 ? 83   PRO A C     1 
ATOM   619  O O     . PRO A 1 100 ? 17.819  1.482   -1.629  1.00 19.43 ? 83   PRO A O     1 
ATOM   620  C CB    . PRO A 1 100 ? 16.689  0.900   1.277   1.00 18.90 ? 83   PRO A CB    1 
ATOM   621  C CG    . PRO A 1 100 ? 15.746  1.257   2.443   1.00 18.29 ? 83   PRO A CG    1 
ATOM   622  C CD    . PRO A 1 100 ? 14.551  1.779   1.706   1.00 18.28 ? 83   PRO A CD    1 
ATOM   623  N N     . LEU A 1 101 ? 15.597  1.243   -1.828  1.00 19.31 ? 84   LEU A N     1 
ATOM   624  C CA    . LEU A 1 101 ? 15.676  0.622   -3.156  1.00 19.10 ? 84   LEU A CA    1 
ATOM   625  C C     . LEU A 1 101 ? 15.239  1.535   -4.308  1.00 19.13 ? 84   LEU A C     1 
ATOM   626  O O     . LEU A 1 101 ? 15.606  1.301   -5.459  1.00 19.92 ? 84   LEU A O     1 
ATOM   627  C CB    . LEU A 1 101 ? 14.868  -0.682  -3.168  1.00 18.96 ? 84   LEU A CB    1 
ATOM   628  C CG    . LEU A 1 101 ? 15.422  -1.819  -2.295  1.00 20.16 ? 84   LEU A CG    1 
ATOM   629  C CD1   . LEU A 1 101 ? 14.458  -3.013  -2.293  1.00 20.10 ? 84   LEU A CD1   1 
ATOM   630  C CD2   . LEU A 1 101 ? 16.796  -2.246  -2.818  1.00 23.68 ? 84   LEU A CD2   1 
ATOM   631  N N     . PHE A 1 102 ? 14.442  2.552   -3.996  1.00 18.65 ? 85   PHE A N     1 
ATOM   632  C CA    . PHE A 1 102 ? 13.847  3.426   -5.000  1.00 18.64 ? 85   PHE A CA    1 
ATOM   633  C C     . PHE A 1 102 ? 14.207  4.884   -4.757  1.00 18.42 ? 85   PHE A C     1 
ATOM   634  O O     . PHE A 1 102 ? 14.158  5.347   -3.626  1.00 18.36 ? 85   PHE A O     1 
ATOM   635  C CB    . PHE A 1 102 ? 12.319  3.225   -5.086  1.00 18.48 ? 85   PHE A CB    1 
ATOM   636  C CG    . PHE A 1 102 ? 11.945  1.834   -5.497  1.00 18.38 ? 85   PHE A CG    1 
ATOM   637  C CD1   . PHE A 1 102 ? 11.751  1.519   -6.839  1.00 18.41 ? 85   PHE A CD1   1 
ATOM   638  C CD2   . PHE A 1 102 ? 11.850  0.825   -4.544  1.00 16.43 ? 85   PHE A CD2   1 
ATOM   639  C CE1   . PHE A 1 102 ? 11.455  0.214   -7.239  1.00 17.65 ? 85   PHE A CE1   1 
ATOM   640  C CE2   . PHE A 1 102 ? 11.577  -0.497  -4.928  1.00 17.28 ? 85   PHE A CE2   1 
ATOM   641  C CZ    . PHE A 1 102 ? 11.381  -0.797  -6.272  1.00 18.06 ? 85   PHE A CZ    1 
ATOM   642  N N     . ARG A 1 103 ? 14.553  5.584   -5.842  1.00 18.30 ? 86   ARG A N     1 
ATOM   643  C CA    . ARG A 1 103 ? 15.031  6.958   -5.741  1.00 18.70 ? 86   ARG A CA    1 
ATOM   644  C C     . ARG A 1 103 ? 13.952  7.868   -5.135  1.00 17.44 ? 86   ARG A C     1 
ATOM   645  O O     . ARG A 1 103 ? 14.271  8.763   -4.360  1.00 16.26 ? 86   ARG A O     1 
ATOM   646  C CB    . ARG A 1 103 ? 15.535  7.497   -7.095  1.00 19.65 ? 86   ARG A CB    1 
ATOM   647  C CG    . ARG A 1 103 ? 16.540  8.654   -6.951  1.00 23.94 ? 86   ARG A CG    1 
ATOM   648  C CD    . ARG A 1 103 ? 16.519  9.547   -8.197  1.00 30.50 ? 86   ARG A CD    1 
ATOM   649  N NE    . ARG A 1 103 ? 16.862  10.945  -7.903  1.00 33.22 ? 86   ARG A NE    1 
ATOM   650  C CZ    . ARG A 1 103 ? 18.105  11.430  -7.915  1.00 34.31 ? 86   ARG A CZ    1 
ATOM   651  N NH1   . ARG A 1 103 ? 19.128  10.645  -8.211  1.00 34.88 ? 86   ARG A NH1   1 
ATOM   652  N NH2   . ARG A 1 103 ? 18.322  12.707  -7.640  1.00 36.02 ? 86   ARG A NH2   1 
ATOM   653  N N     . GLU A 1 104 ? 12.685  7.614   -5.487  1.00 17.62 ? 87   GLU A N     1 
ATOM   654  C CA    . GLU A 1 104 ? 11.562  8.336   -4.926  1.00 17.64 ? 87   GLU A CA    1 
ATOM   655  C C     . GLU A 1 104 ? 10.433  7.378   -4.580  1.00 16.90 ? 87   GLU A C     1 
ATOM   656  O O     . GLU A 1 104 ? 10.329  6.297   -5.165  1.00 16.76 ? 87   GLU A O     1 
ATOM   657  C CB    . GLU A 1 104 ? 11.048  9.390   -5.895  1.00 18.67 ? 87   GLU A CB    1 
ATOM   658  C CG    . GLU A 1 104 ? 11.886  10.661  -5.956  1.00 19.41 ? 87   GLU A CG    1 
ATOM   659  C CD    . GLU A 1 104 ? 11.295  11.660  -6.903  1.00 21.61 ? 87   GLU A CD    1 
ATOM   660  O OE1   . GLU A 1 104 ? 11.306  11.400  -8.121  1.00 26.19 ? 87   GLU A OE1   1 
ATOM   661  O OE2   . GLU A 1 104 ? 10.789  12.700  -6.429  1.00 21.99 ? 87   GLU A OE2   1 
ATOM   662  N N     . VAL A 1 105 ? 9.604   7.793   -3.628  1.00 15.42 ? 88   VAL A N     1 
ATOM   663  C CA    . VAL A 1 105 ? 8.443   7.000   -3.203  1.00 14.85 ? 88   VAL A CA    1 
ATOM   664  C C     . VAL A 1 105 ? 7.235   7.932   -3.017  1.00 14.90 ? 88   VAL A C     1 
ATOM   665  O O     . VAL A 1 105 ? 7.385   9.059   -2.510  1.00 14.94 ? 88   VAL A O     1 
ATOM   666  C CB    . VAL A 1 105 ? 8.750   6.193   -1.876  1.00 14.55 ? 88   VAL A CB    1 
ATOM   667  C CG1   . VAL A 1 105 ? 7.497   5.401   -1.367  1.00 15.77 ? 88   VAL A CG1   1 
ATOM   668  C CG2   . VAL A 1 105 ? 9.902   5.231   -2.050  1.00 16.48 ? 88   VAL A CG2   1 
ATOM   669  N N     . ASP A 1 106 ? 6.049   7.465   -3.432  1.00 14.35 ? 89   ASP A N     1 
ATOM   670  C CA    . ASP A 1 106 ? 4.784   8.117   -3.120  1.00 15.70 ? 89   ASP A CA    1 
ATOM   671  C C     . ASP A 1 106 ? 4.071   7.236   -2.082  1.00 15.29 ? 89   ASP A C     1 
ATOM   672  O O     . ASP A 1 106 ? 4.203   5.994   -2.105  1.00 16.55 ? 89   ASP A O     1 
ATOM   673  C CB    . ASP A 1 106 ? 3.920   8.249   -4.385  1.00 16.77 ? 89   ASP A CB    1 
ATOM   674  C CG    . ASP A 1 106 ? 4.348   9.391   -5.285  1.00 19.35 ? 89   ASP A CG    1 
ATOM   675  O OD1   . ASP A 1 106 ? 5.123   10.266  -4.843  1.00 20.95 ? 89   ASP A OD1   1 
ATOM   676  O OD2   . ASP A 1 106 ? 3.889   9.416   -6.450  1.00 19.24 ? 89   ASP A OD2   1 
ATOM   677  N N     . MET A 1 107 ? 3.376   7.871   -1.152  1.00 15.08 ? 90   MET A N     1 
ATOM   678  C CA    . MET A 1 107 ? 2.586   7.124   -0.164  1.00 15.08 ? 90   MET A CA    1 
ATOM   679  C C     . MET A 1 107 ? 1.124   7.521   -0.286  1.00 15.03 ? 90   MET A C     1 
ATOM   680  O O     . MET A 1 107 ? 0.810   8.702   -0.463  1.00 15.29 ? 90   MET A O     1 
ATOM   681  C CB    . MET A 1 107 ? 3.080   7.431   1.236   1.00 15.30 ? 90   MET A CB    1 
ATOM   682  C CG    . MET A 1 107 ? 4.509   7.041   1.476   1.00 14.03 ? 90   MET A CG    1 
ATOM   683  S SD    . MET A 1 107 ? 5.105   7.675   3.056   1.00 17.61 ? 90   MET A SD    1 
ATOM   684  C CE    . MET A 1 107 ? 4.159   6.715   4.234   1.00 15.79 ? 90   MET A CE    1 
ATOM   685  N N     . VAL A 1 108 ? 0.230   6.542   -0.193  1.00 14.34 ? 91   VAL A N     1 
ATOM   686  C CA    . VAL A 1 108 ? -1.194  6.834   -0.149  1.00 14.59 ? 91   VAL A CA    1 
ATOM   687  C C     . VAL A 1 108 ? -1.829  6.108   1.031   1.00 14.08 ? 91   VAL A C     1 
ATOM   688  O O     . VAL A 1 108 ? -1.575  4.929   1.258   1.00 13.10 ? 91   VAL A O     1 
ATOM   689  C CB    . VAL A 1 108 ? -1.904  6.584   -1.509  1.00 15.53 ? 91   VAL A CB    1 
ATOM   690  C CG1   . VAL A 1 108 ? -1.665  5.180   -2.010  1.00 16.03 ? 91   VAL A CG1   1 
ATOM   691  C CG2   . VAL A 1 108 ? -3.414  6.966   -1.450  1.00 16.61 ? 91   VAL A CG2   1 
ATOM   692  N N     . ASP A 1 109 ? -2.623  6.838   1.796   1.00 13.60 ? 92   ASP A N     1 
ATOM   693  C CA    . ASP A 1 109 ? -3.336  6.246   2.939   1.00 13.87 ? 92   ASP A CA    1 
ATOM   694  C C     . ASP A 1 109 ? -4.552  7.083   3.276   1.00 14.43 ? 92   ASP A C     1 
ATOM   695  O O     . ASP A 1 109 ? -4.514  8.290   3.069   1.00 16.04 ? 92   ASP A O     1 
ATOM   696  C CB    . ASP A 1 109 ? -2.400  6.181   4.139   1.00 13.08 ? 92   ASP A CB    1 
ATOM   697  C CG    . ASP A 1 109 ? -2.872  5.192   5.195   1.00 13.31 ? 92   ASP A CG    1 
ATOM   698  O OD1   . ASP A 1 109 ? -2.428  4.019   5.140   1.00 12.06 ? 92   ASP A OD1   1 
ATOM   699  O OD2   . ASP A 1 109 ? -3.676  5.603   6.062   1.00 14.86 ? 92   ASP A OD2   1 
ATOM   700  N N     . ILE A 1 110 ? -5.629  6.448   3.764   1.00 15.91 ? 93   ILE A N     1 
ATOM   701  C CA    . ILE A 1 110 ? -6.845  7.188   4.210   1.00 17.49 ? 93   ILE A CA    1 
ATOM   702  C C     . ILE A 1 110 ? -6.645  8.027   5.463   1.00 16.93 ? 93   ILE A C     1 
ATOM   703  O O     . ILE A 1 110 ? -7.366  9.015   5.662   1.00 17.81 ? 93   ILE A O     1 
ATOM   704  C CB    . ILE A 1 110 ? -8.082  6.302   4.515   1.00 17.16 ? 93   ILE A CB    1 
ATOM   705  C CG1   . ILE A 1 110 ? -7.767  5.252   5.595   1.00 17.23 ? 93   ILE A CG1   1 
ATOM   706  C CG2   . ILE A 1 110 ? -8.603  5.669   3.290   1.00 20.22 ? 93   ILE A CG2   1 
ATOM   707  C CD1   . ILE A 1 110 ? -8.995  4.596   6.192   1.00 19.84 ? 93   ILE A CD1   1 
ATOM   708  N N     . THR A 1 111 ? -5.669  7.658   6.297   1.00 16.28 ? 94   THR A N     1 
ATOM   709  C CA    . THR A 1 111 ? -5.524  8.267   7.624   1.00 16.42 ? 94   THR A CA    1 
ATOM   710  C C     . THR A 1 111 ? -4.480  9.392   7.658   1.00 17.02 ? 94   THR A C     1 
ATOM   711  O O     . THR A 1 111 ? -3.266  9.133   7.639   1.00 16.88 ? 94   THR A O     1 
ATOM   712  C CB    . THR A 1 111 ? -5.187  7.190   8.689   1.00 16.19 ? 94   THR A CB    1 
ATOM   713  O OG1   . THR A 1 111 ? -6.145  6.128   8.618   1.00 16.48 ? 94   THR A OG1   1 
ATOM   714  C CG2   . THR A 1 111 ? -5.168  7.792   10.123  1.00 15.42 ? 94   THR A CG2   1 
ATOM   715  N N     . GLU A 1 112 ? -4.959  10.637  7.686   1.00 17.11 ? 95   GLU A N     1 
ATOM   716  C CA    . GLU A 1 112 ? -4.070  11.798  7.601   1.00 18.77 ? 95   GLU A CA    1 
ATOM   717  C C     . GLU A 1 112 ? -3.010  11.804  8.693   1.00 18.41 ? 95   GLU A C     1 
ATOM   718  O O     . GLU A 1 112 ? -1.832  12.128  8.434   1.00 18.36 ? 95   GLU A O     1 
ATOM   719  C CB    . GLU A 1 112 ? -4.873  13.108  7.611   1.00 19.94 ? 95   GLU A CB    1 
ATOM   720  C CG    . GLU A 1 112 ? -4.009  14.362  7.424   1.00 23.86 ? 95   GLU A CG    1 
ATOM   721  C CD    . GLU A 1 112 ? -4.804  15.553  6.913   1.00 30.13 ? 95   GLU A CD    1 
ATOM   722  O OE1   . GLU A 1 112 ? -6.030  15.622  7.154   1.00 32.93 ? 95   GLU A OE1   1 
ATOM   723  O OE2   . GLU A 1 112 ? -4.192  16.423  6.256   1.00 33.78 ? 95   GLU A OE2   1 
ATOM   724  N N     . ASP A 1 113 ? -3.421  11.448  9.908   1.00 18.72 ? 96   ASP A N     1 
ATOM   725  C CA    . ASP A 1 113 ? -2.508  11.458  11.066  1.00 18.81 ? 96   ASP A CA    1 
ATOM   726  C C     . ASP A 1 113 ? -1.313  10.531  10.860  1.00 18.31 ? 96   ASP A C     1 
ATOM   727  O O     . ASP A 1 113 ? -0.228  10.815  11.357  1.00 18.40 ? 96   ASP A O     1 
ATOM   728  C CB    . ASP A 1 113 ? -3.221  11.044  12.363  1.00 19.65 ? 96   ASP A CB    1 
ATOM   729  C CG    . ASP A 1 113 ? -4.138  12.130  12.918  1.00 22.60 ? 96   ASP A CG    1 
ATOM   730  O OD1   . ASP A 1 113 ? -4.218  13.226  12.328  1.00 26.03 ? 96   ASP A OD1   1 
ATOM   731  O OD2   . ASP A 1 113 ? -4.778  11.871  13.957  1.00 28.57 ? 96   ASP A OD2   1 
ATOM   732  N N     . PHE A 1 114 ? -1.520  9.411   10.168  1.00 17.56 ? 97   PHE A N     1 
ATOM   733  C CA    . PHE A 1 114 ? -0.400  8.510   9.845   1.00 16.09 ? 97   PHE A CA    1 
ATOM   734  C C     . PHE A 1 114 ? 0.595   9.156   8.881   1.00 16.44 ? 97   PHE A C     1 
ATOM   735  O O     . PHE A 1 114 ? 1.818   8.994   9.026   1.00 16.08 ? 97   PHE A O     1 
ATOM   736  C CB    . PHE A 1 114 ? -0.900  7.178   9.260   1.00 15.73 ? 97   PHE A CB    1 
ATOM   737  C CG    . PHE A 1 114 ? -1.740  6.357   10.218  1.00 15.29 ? 97   PHE A CG    1 
ATOM   738  C CD1   . PHE A 1 114 ? -1.743  6.629   11.594  1.00 10.91 ? 97   PHE A CD1   1 
ATOM   739  C CD2   . PHE A 1 114 ? -2.482  5.264   9.744   1.00 15.39 ? 97   PHE A CD2   1 
ATOM   740  C CE1   . PHE A 1 114 ? -2.537  5.863   12.487  1.00 14.07 ? 97   PHE A CE1   1 
ATOM   741  C CE2   . PHE A 1 114 ? -3.247  4.484   10.600  1.00 15.70 ? 97   PHE A CE2   1 
ATOM   742  C CZ    . PHE A 1 114 ? -3.276  4.784   11.998  1.00 14.28 ? 97   PHE A CZ    1 
ATOM   743  N N     . LEU A 1 115 ? 0.075   9.854   7.877   1.00 16.72 ? 98   LEU A N     1 
ATOM   744  C CA    . LEU A 1 115 ? 0.960   10.462  6.875   1.00 17.22 ? 98   LEU A CA    1 
ATOM   745  C C     . LEU A 1 115 ? 1.722   11.632  7.474   1.00 18.21 ? 98   LEU A C     1 
ATOM   746  O O     . LEU A 1 115 ? 2.901   11.859  7.147   1.00 18.28 ? 98   LEU A O     1 
ATOM   747  C CB    . LEU A 1 115 ? 0.191   10.889  5.639   1.00 17.64 ? 98   LEU A CB    1 
ATOM   748  C CG    . LEU A 1 115 ? -0.509  9.781   4.865   1.00 17.24 ? 98   LEU A CG    1 
ATOM   749  C CD1   . LEU A 1 115 ? -1.528  10.393  3.918   1.00 18.95 ? 98   LEU A CD1   1 
ATOM   750  C CD2   . LEU A 1 115 ? 0.478   8.869   4.122   1.00 17.87 ? 98   LEU A CD2   1 
ATOM   751  N N     . VAL A 1 116 ? 1.060   12.356  8.376   1.00 17.85 ? 99   VAL A N     1 
ATOM   752  C CA    . VAL A 1 116 ? 1.742   13.426  9.112   1.00 18.72 ? 99   VAL A CA    1 
ATOM   753  C C     . VAL A 1 116 ? 2.900   12.834  9.940   1.00 19.04 ? 99   VAL A C     1 
ATOM   754  O O     . VAL A 1 116 ? 4.058   13.273  9.811   1.00 18.45 ? 99   VAL A O     1 
ATOM   755  C CB    . VAL A 1 116 ? 0.757   14.260  9.972   1.00 18.80 ? 99   VAL A CB    1 
ATOM   756  C CG1   . VAL A 1 116 ? 1.517   15.252  10.845  1.00 20.33 ? 99   VAL A CG1   1 
ATOM   757  C CG2   . VAL A 1 116 ? -0.241  15.004  9.072   1.00 20.03 ? 99   VAL A CG2   1 
ATOM   758  N N     . GLN A 1 117 ? 2.600   11.794  10.718  1.00 19.39 ? 100  GLN A N     1 
ATOM   759  C CA    . GLN A 1 117 ? 3.642   11.073  11.479  1.00 19.78 ? 100  GLN A CA    1 
ATOM   760  C C     . GLN A 1 117 ? 4.756   10.549  10.580  1.00 19.09 ? 100  GLN A C     1 
ATOM   761  O O     . GLN A 1 117 ? 5.924   10.607  10.953  1.00 19.60 ? 100  GLN A O     1 
ATOM   762  C CB    . GLN A 1 117 ? 3.065   9.915   12.278  1.00 20.30 ? 100  GLN A CB    1 
ATOM   763  C CG    . GLN A 1 117 ? 4.039   9.350   13.313  1.00 22.08 ? 100  GLN A CG    1 
ATOM   764  C CD    . GLN A 1 117 ? 4.422   10.412  14.360  1.00 27.27 ? 100  GLN A CD    1 
ATOM   765  O OE1   . GLN A 1 117 ? 3.563   11.135  14.867  1.00 27.48 ? 100  GLN A OE1   1 
ATOM   766  N NE2   . GLN A 1 117 ? 5.710   10.517  14.658  1.00 28.78 ? 100  GLN A NE2   1 
ATOM   767  N N     . ALA A 1 118 ? 4.400   10.037  9.398   1.00 19.13 ? 101  ALA A N     1 
ATOM   768  C CA    . ALA A 1 118 ? 5.399   9.526   8.442   1.00 18.65 ? 101  ALA A CA    1 
ATOM   769  C C     . ALA A 1 118 ? 6.545   10.513  8.236   1.00 19.27 ? 101  ALA A C     1 
ATOM   770  O O     . ALA A 1 118 ? 7.704   10.115  8.121   1.00 18.01 ? 101  ALA A O     1 
ATOM   771  C CB    . ALA A 1 118 ? 4.741   9.196   7.081   1.00 17.99 ? 101  ALA A CB    1 
ATOM   772  N N     . LYS A 1 119 ? 6.201   11.796  8.168   1.00 20.22 ? 102  LYS A N     1 
ATOM   773  C CA    . LYS A 1 119 ? 7.188   12.851  7.929   1.00 21.83 ? 102  LYS A CA    1 
ATOM   774  C C     . LYS A 1 119 ? 8.257   12.850  9.031   1.00 22.14 ? 102  LYS A C     1 
ATOM   775  O O     . LYS A 1 119 ? 9.431   13.091  8.754   1.00 23.16 ? 102  LYS A O     1 
ATOM   776  C CB    . LYS A 1 119 ? 6.504   14.226  7.806   1.00 21.88 ? 102  LYS A CB    1 
ATOM   777  C CG    . LYS A 1 119 ? 5.500   14.337  6.635   1.00 23.75 ? 102  LYS A CG    1 
ATOM   778  C CD    . LYS A 1 119 ? 4.765   15.685  6.665   1.00 23.74 ? 102  LYS A CD    1 
ATOM   779  C CE    . LYS A 1 119 ? 3.832   15.868  5.467   1.00 26.79 ? 102  LYS A CE    1 
ATOM   780  N NZ    . LYS A 1 119 ? 4.537   16.506  4.290   1.00 30.01 ? 102  LYS A NZ    1 
ATOM   781  N N     . THR A 1 120 ? 7.851   12.557  10.270  1.00 21.52 ? 103  THR A N     1 
ATOM   782  C CA    . THR A 1 120 ? 8.793   12.433  11.393  1.00 21.59 ? 103  THR A CA    1 
ATOM   783  C C     . THR A 1 120 ? 9.479   11.054  11.366  1.00 21.17 ? 103  THR A C     1 
ATOM   784  O O     . THR A 1 120 ? 10.729  10.962  11.414  1.00 20.77 ? 103  THR A O     1 
ATOM   785  C CB    . THR A 1 120 ? 8.083   12.708  12.760  1.00 21.76 ? 103  THR A CB    1 
ATOM   786  O OG1   . THR A 1 120 ? 7.635   14.069  12.798  1.00 23.10 ? 103  THR A OG1   1 
ATOM   787  C CG2   . THR A 1 120 ? 9.029   12.459  13.947  1.00 21.91 ? 103  THR A CG2   1 
ATOM   788  N N     . TYR A 1 121 ? 8.658   10.003  11.276  1.00 20.02 ? 104  TYR A N     1 
ATOM   789  C CA    . TYR A 1 121 ? 9.118   8.607   11.328  1.00 19.83 ? 104  TYR A CA    1 
ATOM   790  C C     . TYR A 1 121 ? 10.220  8.311   10.305  1.00 19.56 ? 104  TYR A C     1 
ATOM   791  O O     . TYR A 1 121 ? 11.192  7.622   10.609  1.00 18.90 ? 104  TYR A O     1 
ATOM   792  C CB    . TYR A 1 121 ? 7.927   7.648   11.102  1.00 20.44 ? 104  TYR A CB    1 
ATOM   793  C CG    . TYR A 1 121 ? 8.291   6.189   11.189  1.00 20.79 ? 104  TYR A CG    1 
ATOM   794  C CD1   . TYR A 1 121 ? 8.673   5.621   12.408  1.00 22.52 ? 104  TYR A CD1   1 
ATOM   795  C CD2   . TYR A 1 121 ? 8.264   5.369   10.062  1.00 21.34 ? 104  TYR A CD2   1 
ATOM   796  C CE1   . TYR A 1 121 ? 9.019   4.273   12.494  1.00 21.93 ? 104  TYR A CE1   1 
ATOM   797  C CE2   . TYR A 1 121 ? 8.615   4.012   10.140  1.00 20.40 ? 104  TYR A CE2   1 
ATOM   798  C CZ    . TYR A 1 121 ? 8.989   3.485   11.354  1.00 20.77 ? 104  TYR A CZ    1 
ATOM   799  O OH    . TYR A 1 121 ? 9.324   2.162   11.451  1.00 22.11 ? 104  TYR A OH    1 
ATOM   800  N N     . LEU A 1 122 ? 10.051  8.844   9.089   1.00 18.64 ? 105  LEU A N     1 
ATOM   801  C CA    . LEU A 1 122 ? 10.933  8.553   7.956   1.00 18.66 ? 105  LEU A CA    1 
ATOM   802  C C     . LEU A 1 122 ? 12.253  9.351   7.963   1.00 19.31 ? 105  LEU A C     1 
ATOM   803  O O     . LEU A 1 122 ? 13.216  8.992   7.268   1.00 19.55 ? 105  LEU A O     1 
ATOM   804  C CB    . LEU A 1 122 ? 10.194  8.788   6.639   1.00 18.37 ? 105  LEU A CB    1 
ATOM   805  C CG    . LEU A 1 122 ? 9.011   7.857   6.372   1.00 17.69 ? 105  LEU A CG    1 
ATOM   806  C CD1   . LEU A 1 122 ? 8.336   8.235   5.066   1.00 18.77 ? 105  LEU A CD1   1 
ATOM   807  C CD2   . LEU A 1 122 ? 9.410   6.379   6.379   1.00 17.74 ? 105  LEU A CD2   1 
ATOM   808  N N     . GLY A 1 123 ? 12.273  10.438  8.735   1.00 19.64 ? 106  GLY A N     1 
ATOM   809  C CA    . GLY A 1 123 ? 13.510  11.169  9.011   1.00 20.48 ? 106  GLY A CA    1 
ATOM   810  C C     . GLY A 1 123 ? 14.131  11.741  7.752   1.00 20.40 ? 106  GLY A C     1 
ATOM   811  O O     . GLY A 1 123 ? 13.423  12.085  6.811   1.00 21.04 ? 106  GLY A O     1 
ATOM   812  N N     . GLU A 1 124 ? 15.461  11.830  7.725   1.00 21.30 ? 107  GLU A N     1 
ATOM   813  C CA    . GLU A 1 124 ? 16.171  12.382  6.559   1.00 21.72 ? 107  GLU A CA    1 
ATOM   814  C C     . GLU A 1 124 ? 15.822  11.690  5.231   1.00 21.21 ? 107  GLU A C     1 
ATOM   815  O O     . GLU A 1 124 ? 15.591  12.345  4.217   1.00 21.16 ? 107  GLU A O     1 
ATOM   816  C CB    . GLU A 1 124 ? 17.691  12.369  6.787   1.00 22.42 ? 107  GLU A CB    1 
ATOM   817  C CG    . GLU A 1 124 ? 18.476  13.170  5.725   1.00 27.02 ? 107  GLU A CG    1 
ATOM   818  C CD    . GLU A 1 124 ? 18.291  14.687  5.842   1.00 31.46 ? 107  GLU A CD    1 
ATOM   819  O OE1   . GLU A 1 124 ? 17.743  15.175  6.865   1.00 35.36 ? 107  GLU A OE1   1 
ATOM   820  O OE2   . GLU A 1 124 ? 18.695  15.394  4.897   1.00 34.66 ? 107  GLU A OE2   1 
ATOM   821  N N     . GLU A 1 125 ? 15.752  10.366  5.243   1.00 20.41 ? 108  GLU A N     1 
ATOM   822  C CA    . GLU A 1 125 ? 15.490  9.639   3.981   1.00 21.02 ? 108  GLU A CA    1 
ATOM   823  C C     . GLU A 1 125 ? 14.097  9.939   3.421   1.00 20.02 ? 108  GLU A C     1 
ATOM   824  O O     . GLU A 1 125 ? 13.875  9.889   2.214   1.00 19.27 ? 108  GLU A O     1 
ATOM   825  C CB    . GLU A 1 125 ? 15.703  8.140   4.176   1.00 20.46 ? 108  GLU A CB    1 
ATOM   826  C CG    . GLU A 1 125 ? 17.184  7.764   4.361   1.00 21.38 ? 108  GLU A CG    1 
ATOM   827  C CD    . GLU A 1 125 ? 18.029  8.201   3.189   1.00 24.39 ? 108  GLU A CD    1 
ATOM   828  O OE1   . GLU A 1 125 ? 17.919  7.569   2.111   1.00 26.76 ? 108  GLU A OE1   1 
ATOM   829  O OE2   . GLU A 1 125 ? 18.802  9.169   3.350   1.00 24.20 ? 108  GLU A OE2   1 
ATOM   830  N N     . GLY A 1 126 ? 13.171  10.257  4.314   1.00 21.35 ? 109  GLY A N     1 
ATOM   831  C CA    . GLY A 1 126 ? 11.807  10.619  3.946   1.00 21.00 ? 109  GLY A CA    1 
ATOM   832  C C     . GLY A 1 126 ? 11.646  11.878  3.107   1.00 21.32 ? 109  GLY A C     1 
ATOM   833  O O     . GLY A 1 126 ? 10.572  12.120  2.543   1.00 21.26 ? 109  GLY A O     1 
ATOM   834  N N     . LYS A 1 127 ? 12.703  12.688  3.012   1.00 21.25 ? 110  LYS A N     1 
ATOM   835  C CA    . LYS A 1 127 ? 12.674  13.831  2.121   1.00 22.06 ? 110  LYS A CA    1 
ATOM   836  C C     . LYS A 1 127 ? 12.563  13.362  0.662   1.00 20.97 ? 110  LYS A C     1 
ATOM   837  O O     . LYS A 1 127 ? 12.162  14.142  -0.200  1.00 21.39 ? 110  LYS A O     1 
ATOM   838  C CB    . LYS A 1 127 ? 13.894  14.749  2.330   1.00 21.74 ? 110  LYS A CB    1 
ATOM   839  C CG    . LYS A 1 127 ? 14.098  15.139  3.805   1.00 24.84 ? 110  LYS A CG    1 
ATOM   840  C CD    . LYS A 1 127 ? 14.981  16.372  4.023   1.00 24.72 ? 110  LYS A CD    1 
ATOM   841  C CE    . LYS A 1 127 ? 16.262  16.343  3.239   1.00 29.56 ? 110  LYS A CE    1 
ATOM   842  N NZ    . LYS A 1 127 ? 17.232  17.296  3.859   1.00 32.91 ? 110  LYS A NZ    1 
ATOM   843  N N     . ARG A 1 128 ? 12.885  12.091  0.392   1.00 19.97 ? 111  ARG A N     1 
ATOM   844  C CA    . ARG A 1 128 ? 12.650  11.531  -0.949  1.00 18.84 ? 111  ARG A CA    1 
ATOM   845  C C     . ARG A 1 128 ? 11.238  11.021  -1.210  1.00 18.84 ? 111  ARG A C     1 
ATOM   846  O O     . ARG A 1 128 ? 10.952  10.539  -2.319  1.00 17.91 ? 111  ARG A O     1 
ATOM   847  C CB    . ARG A 1 128 ? 13.705  10.491  -1.327  1.00 18.76 ? 111  ARG A CB    1 
ATOM   848  C CG    . ARG A 1 128 ? 15.096  11.086  -1.297  1.00 19.35 ? 111  ARG A CG    1 
ATOM   849  C CD    . ARG A 1 128 ? 16.138  10.149  -1.789  1.00 18.26 ? 111  ARG A CD    1 
ATOM   850  N NE    . ARG A 1 128 ? 16.427  9.073   -0.832  1.00 18.72 ? 111  ARG A NE    1 
ATOM   851  C CZ    . ARG A 1 128 ? 16.004  7.816   -0.958  1.00 18.99 ? 111  ARG A CZ    1 
ATOM   852  N NH1   . ARG A 1 128 ? 15.275  7.457   -2.020  1.00 18.31 ? 111  ARG A NH1   1 
ATOM   853  N NH2   . ARG A 1 128 ? 16.355  6.909   -0.039  1.00 19.58 ? 111  ARG A NH2   1 
ATOM   854  N N     . VAL A 1 129 ? 10.358  11.117  -0.209  1.00 18.96 ? 112  VAL A N     1 
ATOM   855  C CA    . VAL A 1 129 ? 8.941   10.907  -0.486  1.00 18.78 ? 112  VAL A CA    1 
ATOM   856  C C     . VAL A 1 129 ? 8.459   12.096  -1.313  1.00 19.19 ? 112  VAL A C     1 
ATOM   857  O O     . VAL A 1 129 ? 8.624   13.256  -0.919  1.00 19.68 ? 112  VAL A O     1 
ATOM   858  C CB    . VAL A 1 129 ? 8.096   10.736  0.790   1.00 18.68 ? 112  VAL A CB    1 
ATOM   859  C CG1   . VAL A 1 129 ? 6.636   10.542  0.415   1.00 18.37 ? 112  VAL A CG1   1 
ATOM   860  C CG2   . VAL A 1 129 ? 8.605   9.551   1.623   1.00 18.67 ? 112  VAL A CG2   1 
ATOM   861  N N     . ARG A 1 130 ? 7.907   11.809  -2.480  1.00 19.85 ? 113  ARG A N     1 
ATOM   862  C CA    . ARG A 1 130 ? 7.499   12.862  -3.407  1.00 20.78 ? 113  ARG A CA    1 
ATOM   863  C C     . ARG A 1 130 ? 6.094   13.379  -3.082  1.00 20.86 ? 113  ARG A C     1 
ATOM   864  O O     . ARG A 1 130 ? 5.886   14.582  -2.905  1.00 21.37 ? 113  ARG A O     1 
ATOM   865  C CB    . ARG A 1 130 ? 7.572   12.332  -4.830  1.00 20.56 ? 113  ARG A CB    1 
ATOM   866  C CG    . ARG A 1 130 ? 7.346   13.342  -5.919  1.00 22.12 ? 113  ARG A CG    1 
ATOM   867  C CD    . ARG A 1 130 ? 7.485   12.657  -7.276  1.00 26.50 ? 113  ARG A CD    1 
ATOM   868  N NE    . ARG A 1 130 ? 6.470   11.621  -7.490  1.00 28.15 ? 113  ARG A NE    1 
ATOM   869  C CZ    . ARG A 1 130 ? 6.279   10.976  -8.642  1.00 30.47 ? 113  ARG A CZ    1 
ATOM   870  N NH1   . ARG A 1 130 ? 7.032   11.249  -9.708  1.00 32.69 ? 113  ARG A NH1   1 
ATOM   871  N NH2   . ARG A 1 130 ? 5.334   10.048  -8.730  1.00 32.62 ? 113  ARG A NH2   1 
ATOM   872  N N     . ASN A 1 131 ? 5.131   12.468  -3.004  1.00 21.12 ? 114  ASN A N     1 
ATOM   873  C CA    . ASN A 1 131 ? 3.755   12.811  -2.682  1.00 20.98 ? 114  ASN A CA    1 
ATOM   874  C C     . ASN A 1 131 ? 3.277   12.020  -1.460  1.00 21.47 ? 114  ASN A C     1 
ATOM   875  O O     . ASN A 1 131 ? 3.582   10.828  -1.347  1.00 20.13 ? 114  ASN A O     1 
ATOM   876  C CB    . ASN A 1 131 ? 2.846   12.469  -3.864  1.00 21.40 ? 114  ASN A CB    1 
ATOM   877  C CG    . ASN A 1 131 ? 3.173   13.257  -5.118  1.00 22.96 ? 114  ASN A CG    1 
ATOM   878  O OD1   . ASN A 1 131 ? 3.585   12.692  -6.149  1.00 26.88 ? 114  ASN A OD1   1 
ATOM   879  N ND2   . ASN A 1 131 ? 2.960   14.565  -5.054  1.00 23.91 ? 114  ASN A ND2   1 
ATOM   880  N N     . TYR A 1 132 ? 2.555   12.697  -0.564  1.00 20.34 ? 115  TYR A N     1 
ATOM   881  C CA    . TYR A 1 132 ? 1.794   12.051  0.525   1.00 20.93 ? 115  TYR A CA    1 
ATOM   882  C C     . TYR A 1 132 ? 0.340   12.215  0.152   1.00 20.92 ? 115  TYR A C     1 
ATOM   883  O O     . TYR A 1 132 ? -0.210  13.304  0.297   1.00 22.28 ? 115  TYR A O     1 
ATOM   884  C CB    . TYR A 1 132 ? 2.033   12.734  1.869   1.00 21.16 ? 115  TYR A CB    1 
ATOM   885  C CG    . TYR A 1 132 ? 3.408   12.552  2.453   1.00 22.43 ? 115  TYR A CG    1 
ATOM   886  C CD1   . TYR A 1 132 ? 3.689   11.489  3.320   1.00 22.00 ? 115  TYR A CD1   1 
ATOM   887  C CD2   . TYR A 1 132 ? 4.434   13.458  2.156   1.00 23.95 ? 115  TYR A CD2   1 
ATOM   888  C CE1   . TYR A 1 132 ? 4.982   11.336  3.871   1.00 22.73 ? 115  TYR A CE1   1 
ATOM   889  C CE2   . TYR A 1 132 ? 5.711   13.304  2.693   1.00 22.86 ? 115  TYR A CE2   1 
ATOM   890  C CZ    . TYR A 1 132 ? 5.977   12.251  3.546   1.00 23.00 ? 115  TYR A CZ    1 
ATOM   891  O OH    . TYR A 1 132 ? 7.254   12.120  4.075   1.00 23.20 ? 115  TYR A OH    1 
ATOM   892  N N     . PHE A 1 133 ? -0.279  11.160  -0.366  1.00 19.82 ? 116  PHE A N     1 
ATOM   893  C CA    . PHE A 1 133 ? -1.657  11.272  -0.839  1.00 19.68 ? 116  PHE A CA    1 
ATOM   894  C C     . PHE A 1 133 ? -2.626  10.831  0.262   1.00 19.63 ? 116  PHE A C     1 
ATOM   895  O O     . PHE A 1 133 ? -2.653  9.656   0.612   1.00 19.75 ? 116  PHE A O     1 
ATOM   896  C CB    . PHE A 1 133 ? -1.876  10.399  -2.075  1.00 19.42 ? 116  PHE A CB    1 
ATOM   897  C CG    . PHE A 1 133 ? -1.111  10.839  -3.316  1.00 18.57 ? 116  PHE A CG    1 
ATOM   898  C CD1   . PHE A 1 133 ? -1.349  12.087  -3.905  1.00 21.33 ? 116  PHE A CD1   1 
ATOM   899  C CD2   . PHE A 1 133 ? -0.216  9.970   -3.929  1.00 20.79 ? 116  PHE A CD2   1 
ATOM   900  C CE1   . PHE A 1 133 ? -0.668  12.465  -5.076  1.00 19.83 ? 116  PHE A CE1   1 
ATOM   901  C CE2   . PHE A 1 133 ? 0.470   10.333  -5.093  1.00 19.25 ? 116  PHE A CE2   1 
ATOM   902  C CZ    . PHE A 1 133 ? 0.228   11.590  -5.671  1.00 16.66 ? 116  PHE A CZ    1 
ATOM   903  N N     . CYS A 1 134 ? -3.426  11.751  0.806   1.00 19.35 ? 117  CYS A N     1 
ATOM   904  C CA    . CYS A 1 134 ? -4.441  11.333  1.788   1.00 19.23 ? 117  CYS A CA    1 
ATOM   905  C C     . CYS A 1 134 ? -5.728  10.977  1.081   1.00 19.35 ? 117  CYS A C     1 
ATOM   906  O O     . CYS A 1 134 ? -6.512  11.872  0.721   1.00 18.58 ? 117  CYS A O     1 
ATOM   907  C CB    . CYS A 1 134 ? -4.700  12.394  2.856   1.00 19.13 ? 117  CYS A CB    1 
ATOM   908  S SG    . CYS A 1 134 ? -5.745  11.742  4.155   1.00 20.29 ? 117  CYS A SG    1 
ATOM   909  N N     . CYS A 1 135 ? -5.943  9.675   0.882   1.00 19.11 ? 118  CYS A N     1 
ATOM   910  C CA    . CYS A 1 135 ? -7.000  9.201   -0.013  1.00 19.27 ? 118  CYS A CA    1 
ATOM   911  C C     . CYS A 1 135 ? -7.264  7.726   0.185   1.00 18.72 ? 118  CYS A C     1 
ATOM   912  O O     . CYS A 1 135 ? -6.321  6.952   0.427   1.00 17.93 ? 118  CYS A O     1 
ATOM   913  C CB    . CYS A 1 135 ? -6.611  9.467   -1.486  1.00 18.86 ? 118  CYS A CB    1 
ATOM   914  S SG    . CYS A 1 135 ? -7.949  9.305   -2.693  1.00 23.08 ? 118  CYS A SG    1 
ATOM   915  N N     . GLY A 1 136 ? -8.542  7.335   0.090   1.00 17.29 ? 119  GLY A N     1 
ATOM   916  C CA    . GLY A 1 136 ? -8.902  5.910   -0.039  1.00 16.71 ? 119  GLY A CA    1 
ATOM   917  C C     . GLY A 1 136 ? -8.448  5.327   -1.363  1.00 16.34 ? 119  GLY A C     1 
ATOM   918  O O     . GLY A 1 136 ? -8.519  6.018   -2.396  1.00 16.14 ? 119  GLY A O     1 
ATOM   919  N N     . LEU A 1 137 ? -8.007  4.064   -1.357  1.00 15.93 ? 120  LEU A N     1 
ATOM   920  C CA    . LEU A 1 137 ? -7.558  3.415   -2.604  1.00 15.69 ? 120  LEU A CA    1 
ATOM   921  C C     . LEU A 1 137 ? -8.738  3.355   -3.581  1.00 16.50 ? 120  LEU A C     1 
ATOM   922  O O     . LEU A 1 137 ? -8.554  3.475   -4.815  1.00 16.39 ? 120  LEU A O     1 
ATOM   923  C CB    . LEU A 1 137 ? -7.011  2.011   -2.361  1.00 15.33 ? 120  LEU A CB    1 
ATOM   924  C CG    . LEU A 1 137 ? -5.850  1.881   -1.358  1.00 13.30 ? 120  LEU A CG    1 
ATOM   925  C CD1   . LEU A 1 137 ? -5.268  0.460   -1.337  1.00 10.44 ? 120  LEU A CD1   1 
ATOM   926  C CD2   . LEU A 1 137 ? -4.795  2.913   -1.709  1.00 12.87 ? 120  LEU A CD2   1 
ATOM   927  N N     . GLN A 1 138 ? -9.937  3.160   -3.022  1.00 17.20 ? 121  GLN A N     1 
ATOM   928  C CA    . GLN A 1 138 ? -11.178 3.115   -3.825  1.00 18.17 ? 121  GLN A CA    1 
ATOM   929  C C     . GLN A 1 138 ? -11.485 4.455   -4.537  1.00 19.23 ? 121  GLN A C     1 
ATOM   930  O O     . GLN A 1 138 ? -12.289 4.495   -5.467  1.00 20.53 ? 121  GLN A O     1 
ATOM   931  C CB    . GLN A 1 138 ? -12.358 2.611   -2.969  1.00 17.97 ? 121  GLN A CB    1 
ATOM   932  C CG    . GLN A 1 138 ? -12.945 3.640   -2.003  1.00 18.60 ? 121  GLN A CG    1 
ATOM   933  C CD    . GLN A 1 138 ? -12.159 3.785   -0.700  1.00 18.38 ? 121  GLN A CD    1 
ATOM   934  O OE1   . GLN A 1 138 ? -11.047 3.256   -0.543  1.00 17.91 ? 121  GLN A OE1   1 
ATOM   935  N NE2   . GLN A 1 138 ? -12.742 4.503   0.244   1.00 20.16 ? 121  GLN A NE2   1 
ATOM   936  N N     . ASP A 1 139 ? -10.818 5.533   -4.121  1.00 18.82 ? 122  ASP A N     1 
ATOM   937  C CA    . ASP A 1 139 ? -11.006 6.882   -4.674  1.00 20.15 ? 122  ASP A CA    1 
ATOM   938  C C     . ASP A 1 139 ? -9.709  7.419   -5.325  1.00 20.12 ? 122  ASP A C     1 
ATOM   939  O O     . ASP A 1 139 ? -9.637  8.596   -5.705  1.00 21.51 ? 122  ASP A O     1 
ATOM   940  C CB    . ASP A 1 139 ? -11.453 7.852   -3.561  1.00 19.72 ? 122  ASP A CB    1 
ATOM   941  C CG    . ASP A 1 139 ? -12.854 7.554   -3.031  1.00 22.19 ? 122  ASP A CG    1 
ATOM   942  O OD1   . ASP A 1 139 ? -13.743 7.185   -3.828  1.00 23.13 ? 122  ASP A OD1   1 
ATOM   943  O OD2   . ASP A 1 139 ? -13.066 7.673   -1.803  1.00 22.39 ? 122  ASP A OD2   1 
ATOM   944  N N     . PHE A 1 140 ? -8.698  6.562   -5.452  1.00 19.23 ? 123  PHE A N     1 
ATOM   945  C CA    . PHE A 1 140 ? -7.349  6.988   -5.864  1.00 18.80 ? 123  PHE A CA    1 
ATOM   946  C C     . PHE A 1 140 ? -6.988  6.525   -7.254  1.00 19.51 ? 123  PHE A C     1 
ATOM   947  O O     . PHE A 1 140 ? -7.113  5.346   -7.563  1.00 18.36 ? 123  PHE A O     1 
ATOM   948  C CB    . PHE A 1 140 ? -6.299  6.448   -4.871  1.00 18.67 ? 123  PHE A CB    1 
ATOM   949  C CG    . PHE A 1 140 ? -4.907  6.930   -5.141  1.00 18.42 ? 123  PHE A CG    1 
ATOM   950  C CD1   . PHE A 1 140 ? -4.584  8.273   -4.980  1.00 18.76 ? 123  PHE A CD1   1 
ATOM   951  C CD2   . PHE A 1 140 ? -3.919  6.035   -5.532  1.00 18.01 ? 123  PHE A CD2   1 
ATOM   952  C CE1   . PHE A 1 140 ? -3.281  8.723   -5.240  1.00 19.10 ? 123  PHE A CE1   1 
ATOM   953  C CE2   . PHE A 1 140 ? -2.611  6.465   -5.794  1.00 19.26 ? 123  PHE A CE2   1 
ATOM   954  C CZ    . PHE A 1 140 ? -2.302  7.819   -5.653  1.00 19.27 ? 123  PHE A CZ    1 
ATOM   955  N N     . THR A 1 141 ? -6.509  7.462   -8.084  1.00 21.35 ? 124  THR A N     1 
ATOM   956  C CA    . THR A 1 141 ? -6.119  7.151   -9.452  1.00 22.49 ? 124  THR A CA    1 
ATOM   957  C C     . THR A 1 141 ? -4.627  7.452   -9.633  1.00 23.19 ? 124  THR A C     1 
ATOM   958  O O     . THR A 1 141 ? -4.243  8.620   -9.794  1.00 22.52 ? 124  THR A O     1 
ATOM   959  C CB    . THR A 1 141 ? -6.941  7.953   -10.478 1.00 22.91 ? 124  THR A CB    1 
ATOM   960  O OG1   . THR A 1 141 ? -8.331  7.648   -10.309 1.00 23.85 ? 124  THR A OG1   1 
ATOM   961  C CG2   . THR A 1 141 ? -6.531  7.568   -11.916 1.00 23.53 ? 124  THR A CG2   1 
ATOM   962  N N     . PRO A 1 142 ? -3.789  6.405   -9.568  1.00 23.99 ? 125  PRO A N     1 
ATOM   963  C CA    . PRO A 1 142 ? -2.359  6.645   -9.732  1.00 24.75 ? 125  PRO A CA    1 
ATOM   964  C C     . PRO A 1 142 ? -2.110  7.157   -11.149 1.00 25.72 ? 125  PRO A C     1 
ATOM   965  O O     . PRO A 1 142 ? -2.795  6.722   -12.072 1.00 25.78 ? 125  PRO A O     1 
ATOM   966  C CB    . PRO A 1 142 ? -1.741  5.269   -9.506  1.00 24.68 ? 125  PRO A CB    1 
ATOM   967  C CG    . PRO A 1 142 ? -2.861  4.282   -9.748  1.00 24.76 ? 125  PRO A CG    1 
ATOM   968  C CD    . PRO A 1 142 ? -4.104  4.985   -9.330  1.00 23.74 ? 125  PRO A CD    1 
ATOM   969  N N     . GLU A 1 143 ? -1.197  8.114   -11.309 1.00 26.49 ? 126  GLU A N     1 
ATOM   970  C CA    . GLU A 1 143 ? -0.910  8.661   -12.642 1.00 27.55 ? 126  GLU A CA    1 
ATOM   971  C C     . GLU A 1 143 ? -0.369  7.584   -13.600 1.00 27.38 ? 126  GLU A C     1 
ATOM   972  O O     . GLU A 1 143 ? 0.437   6.747   -13.197 1.00 26.86 ? 126  GLU A O     1 
ATOM   973  C CB    . GLU A 1 143 ? 0.079   9.834   -12.552 1.00 28.08 ? 126  GLU A CB    1 
ATOM   974  C CG    . GLU A 1 143 ? -0.493  11.130  -11.959 1.00 29.49 ? 126  GLU A CG    1 
ATOM   975  C CD    . GLU A 1 143 ? -1.635  11.731  -12.770 1.00 32.92 ? 126  GLU A CD    1 
ATOM   976  O OE1   . GLU A 1 143 ? -1.573  11.720  -14.021 1.00 31.97 ? 126  GLU A OE1   1 
ATOM   977  O OE2   . GLU A 1 143 ? -2.600  12.225  -12.146 1.00 33.67 ? 126  GLU A OE2   1 
ATOM   978  N N     . PRO A 1 144 ? -0.832  7.584   -14.868 1.00 27.23 ? 127  PRO A N     1 
ATOM   979  C CA    . PRO A 1 144 ? -0.304  6.694   -15.907 1.00 27.32 ? 127  PRO A CA    1 
ATOM   980  C C     . PRO A 1 144 ? 1.218   6.674   -15.998 1.00 26.85 ? 127  PRO A C     1 
ATOM   981  O O     . PRO A 1 144 ? 1.854   7.708   -15.801 1.00 27.00 ? 127  PRO A O     1 
ATOM   982  C CB    . PRO A 1 144 ? -0.881  7.289   -17.195 1.00 27.64 ? 127  PRO A CB    1 
ATOM   983  C CG    . PRO A 1 144 ? -2.181  7.877   -16.763 1.00 28.25 ? 127  PRO A CG    1 
ATOM   984  C CD    . PRO A 1 144 ? -1.949  8.409   -15.375 1.00 28.53 ? 127  PRO A CD    1 
ATOM   985  N N     . ASP A 1 145 ? 1.775   5.498   -16.265 1.00 26.58 ? 128  ASP A N     1 
ATOM   986  C CA    . ASP A 1 145 ? 3.220   5.296   -16.441 1.00 27.13 ? 128  ASP A CA    1 
ATOM   987  C C     . ASP A 1 145 ? 4.087   6.089   -15.451 1.00 26.67 ? 128  ASP A C     1 
ATOM   988  O O     . ASP A 1 145 ? 4.839   6.993   -15.833 1.00 26.00 ? 128  ASP A O     1 
ATOM   989  C CB    . ASP A 1 145 ? 3.613   5.571   -17.901 1.00 28.32 ? 128  ASP A CB    1 
ATOM   990  C CG    . ASP A 1 145 ? 4.952   4.974   -18.258 1.00 30.61 ? 128  ASP A CG    1 
ATOM   991  O OD1   . ASP A 1 145 ? 4.981   3.814   -18.721 1.00 35.40 ? 128  ASP A OD1   1 
ATOM   992  O OD2   . ASP A 1 145 ? 5.980   5.649   -18.045 1.00 36.84 ? 128  ASP A OD2   1 
ATOM   993  N N     . SER A 1 146 ? 3.976   5.748   -14.165 1.00 24.77 ? 129  SER A N     1 
ATOM   994  C CA    . SER A 1 146 ? 4.606   6.538   -13.108 1.00 23.83 ? 129  SER A CA    1 
ATOM   995  C C     . SER A 1 146 ? 5.478   5.731   -12.160 1.00 22.34 ? 129  SER A C     1 
ATOM   996  O O     . SER A 1 146 ? 6.418   6.281   -11.578 1.00 21.96 ? 129  SER A O     1 
ATOM   997  C CB    . SER A 1 146 ? 3.551   7.272   -12.271 1.00 24.29 ? 129  SER A CB    1 
ATOM   998  O OG    . SER A 1 146 ? 2.895   8.270   -13.008 1.00 26.66 ? 129  SER A OG    1 
ATOM   999  N N     . TYR A 1 147 ? 5.147   4.441   -11.998 1.00 20.94 ? 130  TYR A N     1 
ATOM   1000 C CA    . TYR A 1 147 ? 5.740   3.624   -10.942 1.00 19.33 ? 130  TYR A CA    1 
ATOM   1001 C C     . TYR A 1 147 ? 6.380   2.344   -11.435 1.00 19.50 ? 130  TYR A C     1 
ATOM   1002 O O     . TYR A 1 147 ? 5.797   1.589   -12.229 1.00 19.61 ? 130  TYR A O     1 
ATOM   1003 C CB    . TYR A 1 147 ? 4.691   3.289   -9.870  1.00 19.01 ? 130  TYR A CB    1 
ATOM   1004 C CG    . TYR A 1 147 ? 4.028   4.492   -9.259  1.00 18.21 ? 130  TYR A CG    1 
ATOM   1005 C CD1   . TYR A 1 147 ? 4.750   5.377   -8.469  1.00 17.51 ? 130  TYR A CD1   1 
ATOM   1006 C CD2   . TYR A 1 147 ? 2.671   4.730   -9.455  1.00 19.81 ? 130  TYR A CD2   1 
ATOM   1007 C CE1   . TYR A 1 147 ? 4.161   6.476   -7.898  1.00 17.85 ? 130  TYR A CE1   1 
ATOM   1008 C CE2   . TYR A 1 147 ? 2.057   5.823   -8.890  1.00 19.27 ? 130  TYR A CE2   1 
ATOM   1009 C CZ    . TYR A 1 147 ? 2.815   6.702   -8.107  1.00 16.89 ? 130  TYR A CZ    1 
ATOM   1010 O OH    . TYR A 1 147 ? 2.208   7.784   -7.543  1.00 17.22 ? 130  TYR A OH    1 
ATOM   1011 N N     . ASP A 1 148 ? 7.581   2.083   -10.934 1.00 18.83 ? 131  ASP A N     1 
ATOM   1012 C CA    . ASP A 1 148 ? 8.240   0.810   -11.147 1.00 18.20 ? 131  ASP A CA    1 
ATOM   1013 C C     . ASP A 1 148 ? 7.648   -0.285  -10.268 1.00 18.13 ? 131  ASP A C     1 
ATOM   1014 O O     . ASP A 1 148 ? 7.548   -1.429  -10.695 1.00 18.39 ? 131  ASP A O     1 
ATOM   1015 C CB    . ASP A 1 148 ? 9.726   0.955   -10.875 1.00 19.33 ? 131  ASP A CB    1 
ATOM   1016 C CG    . ASP A 1 148 ? 10.390  1.876   -11.868 1.00 19.81 ? 131  ASP A CG    1 
ATOM   1017 O OD1   . ASP A 1 148 ? 10.376  1.546   -13.075 1.00 22.17 ? 131  ASP A OD1   1 
ATOM   1018 O OD2   . ASP A 1 148 ? 10.900  2.922   -11.433 1.00 22.13 ? 131  ASP A OD2   1 
ATOM   1019 N N     . VAL A 1 149 ? 7.282   0.069   -9.041  1.00 16.54 ? 132  VAL A N     1 
ATOM   1020 C CA    . VAL A 1 149 ? 6.721   -0.898  -8.082  1.00 16.34 ? 132  VAL A CA    1 
ATOM   1021 C C     . VAL A 1 149 ? 5.572   -0.268  -7.317  1.00 16.09 ? 132  VAL A C     1 
ATOM   1022 O O     . VAL A 1 149 ? 5.671   0.870   -6.805  1.00 16.07 ? 132  VAL A O     1 
ATOM   1023 C CB    . VAL A 1 149 ? 7.783   -1.471  -7.103  1.00 16.61 ? 132  VAL A CB    1 
ATOM   1024 C CG1   . VAL A 1 149 ? 7.128   -2.293  -5.976  1.00 15.73 ? 132  VAL A CG1   1 
ATOM   1025 C CG2   . VAL A 1 149 ? 8.805   -2.369  -7.848  1.00 16.68 ? 132  VAL A CG2   1 
ATOM   1026 N N     . ILE A 1 150 ? 4.475   -1.009  -7.231  1.00 14.66 ? 133  ILE A N     1 
ATOM   1027 C CA    . ILE A 1 150 ? 3.296   -0.532  -6.478  1.00 14.77 ? 133  ILE A CA    1 
ATOM   1028 C C     . ILE A 1 150 ? 3.091   -1.595  -5.409  1.00 13.98 ? 133  ILE A C     1 
ATOM   1029 O O     . ILE A 1 150 ? 2.818   -2.760  -5.733  1.00 14.36 ? 133  ILE A O     1 
ATOM   1030 C CB    . ILE A 1 150 ? 2.041   -0.392  -7.382  1.00 14.59 ? 133  ILE A CB    1 
ATOM   1031 C CG1   . ILE A 1 150 ? 2.255   0.698   -8.446  1.00 16.60 ? 133  ILE A CG1   1 
ATOM   1032 C CG2   . ILE A 1 150 ? 0.791   -0.017  -6.524  1.00 15.38 ? 133  ILE A CG2   1 
ATOM   1033 C CD1   . ILE A 1 150 ? 1.147   0.807   -9.521  1.00 15.03 ? 133  ILE A CD1   1 
ATOM   1034 N N     . TRP A 1 151 ? 3.312   -1.220  -4.150  1.00 13.20 ? 134  TRP A N     1 
ATOM   1035 C CA    . TRP A 1 151 ? 3.300   -2.182  -3.046  1.00 13.05 ? 134  TRP A CA    1 
ATOM   1036 C C     . TRP A 1 151 ? 1.989   -2.056  -2.290  1.00 13.18 ? 134  TRP A C     1 
ATOM   1037 O O     . TRP A 1 151 ? 1.651   -0.969  -1.844  1.00 13.62 ? 134  TRP A O     1 
ATOM   1038 C CB    . TRP A 1 151 ? 4.483   -1.922  -2.102  1.00 12.76 ? 134  TRP A CB    1 
ATOM   1039 C CG    . TRP A 1 151 ? 4.760   -3.078  -1.217  1.00 12.99 ? 134  TRP A CG    1 
ATOM   1040 C CD1   . TRP A 1 151 ? 4.225   -3.316  0.014   1.00 14.36 ? 134  TRP A CD1   1 
ATOM   1041 C CD2   . TRP A 1 151 ? 5.645   -4.169  -1.490  1.00 12.49 ? 134  TRP A CD2   1 
ATOM   1042 N NE1   . TRP A 1 151 ? 4.706   -4.485  0.518   1.00 13.14 ? 134  TRP A NE1   1 
ATOM   1043 C CE2   . TRP A 1 151 ? 5.583   -5.038  -0.382  1.00 13.39 ? 134  TRP A CE2   1 
ATOM   1044 C CE3   . TRP A 1 151 ? 6.462   -4.508  -2.575  1.00 14.51 ? 134  TRP A CE3   1 
ATOM   1045 C CZ2   . TRP A 1 151 ? 6.334   -6.232  -0.317  1.00 14.20 ? 134  TRP A CZ2   1 
ATOM   1046 C CZ3   . TRP A 1 151 ? 7.211   -5.701  -2.505  1.00 14.32 ? 134  TRP A CZ3   1 
ATOM   1047 C CH2   . TRP A 1 151 ? 7.137   -6.531  -1.393  1.00 14.03 ? 134  TRP A CH2   1 
ATOM   1048 N N     . ILE A 1 152 ? 1.276   -3.170  -2.101  1.00 12.72 ? 135  ILE A N     1 
ATOM   1049 C CA    . ILE A 1 152 ? -0.063  -3.118  -1.496  1.00 12.90 ? 135  ILE A CA    1 
ATOM   1050 C C     . ILE A 1 152 ? -0.118  -4.172  -0.410  1.00 13.79 ? 135  ILE A C     1 
ATOM   1051 O O     . ILE A 1 152 ? -0.346  -5.358  -0.682  1.00 14.23 ? 135  ILE A O     1 
ATOM   1052 C CB    . ILE A 1 152 ? -1.201  -3.398  -2.528  1.00 13.33 ? 135  ILE A CB    1 
ATOM   1053 C CG1   . ILE A 1 152 ? -1.065  -2.537  -3.778  1.00 14.06 ? 135  ILE A CG1   1 
ATOM   1054 C CG2   . ILE A 1 152 ? -2.563  -3.110  -1.899  1.00 13.23 ? 135  ILE A CG2   1 
ATOM   1055 C CD1   . ILE A 1 152 ? -1.989  -2.971  -4.939  1.00 13.24 ? 135  ILE A CD1   1 
ATOM   1056 N N     . GLN A 1 153 ? 0.114   -3.732  0.812   1.00 12.92 ? 136  GLN A N     1 
ATOM   1057 C CA    . GLN A 1 153 ? 0.274   -4.651  1.916   1.00 14.72 ? 136  GLN A CA    1 
ATOM   1058 C C     . GLN A 1 153 ? -0.703  -4.410  3.083   1.00 14.59 ? 136  GLN A C     1 
ATOM   1059 O O     . GLN A 1 153 ? -0.862  -3.260  3.608   1.00 15.09 ? 136  GLN A O     1 
ATOM   1060 C CB    . GLN A 1 153 ? 1.736   -4.710  2.373   1.00 14.32 ? 136  GLN A CB    1 
ATOM   1061 C CG    . GLN A 1 153 ? 1.915   -5.667  3.565   1.00 16.17 ? 136  GLN A CG    1 
ATOM   1062 C CD    . GLN A 1 153 ? 3.321   -6.220  3.741   1.00 14.77 ? 136  GLN A CD    1 
ATOM   1063 O OE1   . GLN A 1 153 ? 4.232   -5.933  2.952   1.00 16.88 ? 136  GLN A OE1   1 
ATOM   1064 N NE2   . GLN A 1 153 ? 3.490   -7.078  4.756   1.00 15.51 ? 136  GLN A NE2   1 
ATOM   1065 N N     . TRP A 1 154 ? -1.380  -5.492  3.477   1.00 14.92 ? 137  TRP A N     1 
ATOM   1066 C CA    . TRP A 1 154 ? -2.297  -5.456  4.622   1.00 14.65 ? 137  TRP A CA    1 
ATOM   1067 C C     . TRP A 1 154 ? -3.380  -4.361  4.520   1.00 14.78 ? 137  TRP A C     1 
ATOM   1068 O O     . TRP A 1 154 ? -3.768  -3.735  5.522   1.00 14.28 ? 137  TRP A O     1 
ATOM   1069 C CB    . TRP A 1 154 ? -1.527  -5.437  5.960   1.00 16.54 ? 137  TRP A CB    1 
ATOM   1070 C CG    . TRP A 1 154 ? -0.896  -6.798  6.272   1.00 16.64 ? 137  TRP A CG    1 
ATOM   1071 C CD1   . TRP A 1 154 ? -1.458  -8.029  6.064   1.00 18.78 ? 137  TRP A CD1   1 
ATOM   1072 C CD2   . TRP A 1 154 ? 0.390   -7.042  6.859   1.00 18.08 ? 137  TRP A CD2   1 
ATOM   1073 N NE1   . TRP A 1 154 ? -0.591  -9.024  6.458   1.00 18.83 ? 137  TRP A NE1   1 
ATOM   1074 C CE2   . TRP A 1 154 ? 0.548   -8.446  6.953   1.00 19.29 ? 137  TRP A CE2   1 
ATOM   1075 C CE3   . TRP A 1 154 ? 1.431   -6.209  7.297   1.00 17.98 ? 137  TRP A CE3   1 
ATOM   1076 C CZ2   . TRP A 1 154 ? 1.708   -9.046  7.476   1.00 18.31 ? 137  TRP A CZ2   1 
ATOM   1077 C CZ3   . TRP A 1 154 ? 2.579   -6.803  7.830   1.00 18.38 ? 137  TRP A CZ3   1 
ATOM   1078 C CH2   . TRP A 1 154 ? 2.708   -8.210  7.908   1.00 18.70 ? 137  TRP A CH2   1 
ATOM   1079 N N     . VAL A 1 155 ? -3.890  -4.182  3.295   1.00 13.66 ? 138  VAL A N     1 
ATOM   1080 C CA    . VAL A 1 155 ? -4.950  -3.208  3.031   1.00 13.09 ? 138  VAL A CA    1 
ATOM   1081 C C     . VAL A 1 155 ? -6.028  -3.694  2.030   1.00 12.21 ? 138  VAL A C     1 
ATOM   1082 O O     . VAL A 1 155 ? -7.130  -3.119  2.000   1.00 11.09 ? 138  VAL A O     1 
ATOM   1083 C CB    . VAL A 1 155 ? -4.350  -1.839  2.613   1.00 14.13 ? 138  VAL A CB    1 
ATOM   1084 C CG1   . VAL A 1 155 ? -3.599  -1.947  1.282   1.00 13.50 ? 138  VAL A CG1   1 
ATOM   1085 C CG2   . VAL A 1 155 ? -5.387  -0.736  2.570   1.00 13.60 ? 138  VAL A CG2   1 
ATOM   1086 N N     . ILE A 1 156 ? -5.747  -4.750  1.254   1.00 13.53 ? 139  ILE A N     1 
ATOM   1087 C CA    . ILE A 1 156 ? -6.752  -5.195  0.251   1.00 14.02 ? 139  ILE A CA    1 
ATOM   1088 C C     . ILE A 1 156 ? -8.077  -5.593  0.890   1.00 13.52 ? 139  ILE A C     1 
ATOM   1089 O O     . ILE A 1 156 ? -9.129  -5.483  0.246   1.00 12.93 ? 139  ILE A O     1 
ATOM   1090 C CB    . ILE A 1 156 ? -6.280  -6.305  -0.735  1.00 14.48 ? 139  ILE A CB    1 
ATOM   1091 C CG1   . ILE A 1 156 ? -6.105  -7.652  -0.053  1.00 15.52 ? 139  ILE A CG1   1 
ATOM   1092 C CG2   . ILE A 1 156 ? -5.015  -5.871  -1.512  1.00 15.30 ? 139  ILE A CG2   1 
ATOM   1093 C CD1   . ILE A 1 156 ? -6.133  -8.807  -1.053  1.00 16.66 ? 139  ILE A CD1   1 
ATOM   1094 N N     . GLY A 1 157 ? -8.032  -6.055  2.142   1.00 13.19 ? 140  GLY A N     1 
ATOM   1095 C CA    . GLY A 1 157 ? -9.279  -6.376  2.871   1.00 13.74 ? 140  GLY A CA    1 
ATOM   1096 C C     . GLY A 1 157 ? -10.169 -5.168  3.138   1.00 14.09 ? 140  GLY A C     1 
ATOM   1097 O O     . GLY A 1 157 ? -11.328 -5.311  3.537   1.00 14.89 ? 140  GLY A O     1 
ATOM   1098 N N     . HIS A 1 158 ? -9.639  -3.965  2.941   1.00 13.35 ? 141  HIS A N     1 
ATOM   1099 C CA    . HIS A 1 158 ? -10.432 -2.771  3.182   1.00 13.51 ? 141  HIS A CA    1 
ATOM   1100 C C     . HIS A 1 158 ? -11.204 -2.326  1.950   1.00 14.01 ? 141  HIS A C     1 
ATOM   1101 O O     . HIS A 1 158 ? -11.919 -1.326  1.995   1.00 13.37 ? 141  HIS A O     1 
ATOM   1102 C CB    . HIS A 1 158 ? -9.562  -1.624  3.749   1.00 13.46 ? 141  HIS A CB    1 
ATOM   1103 C CG    . HIS A 1 158 ? -9.349  -1.731  5.228   1.00 14.30 ? 141  HIS A CG    1 
ATOM   1104 N ND1   . HIS A 1 158 ? -10.392 -1.694  6.130   1.00 13.91 ? 141  HIS A ND1   1 
ATOM   1105 C CD2   . HIS A 1 158 ? -8.222  -1.915  5.957   1.00 13.80 ? 141  HIS A CD2   1 
ATOM   1106 C CE1   . HIS A 1 158 ? -9.914  -1.824  7.357   1.00 16.33 ? 141  HIS A CE1   1 
ATOM   1107 N NE2   . HIS A 1 158 ? -8.598  -1.956  7.281   1.00 15.96 ? 141  HIS A NE2   1 
ATOM   1108 N N     . LEU A 1 159 ? -11.039 -3.049  0.841   1.00 13.84 ? 142  LEU A N     1 
ATOM   1109 C CA    . LEU A 1 159 ? -11.779 -2.714  -0.374  1.00 15.57 ? 142  LEU A CA    1 
ATOM   1110 C C     . LEU A 1 159 ? -12.790 -3.804  -0.714  1.00 15.84 ? 142  LEU A C     1 
ATOM   1111 O O     . LEU A 1 159 ? -12.550 -4.982  -0.442  1.00 15.00 ? 142  LEU A O     1 
ATOM   1112 C CB    . LEU A 1 159 ? -10.819 -2.564  -1.547  1.00 16.00 ? 142  LEU A CB    1 
ATOM   1113 C CG    . LEU A 1 159 ? -10.228 -1.221  -1.983  1.00 16.93 ? 142  LEU A CG    1 
ATOM   1114 C CD1   . LEU A 1 159 ? -9.938  -0.234  -0.865  1.00 19.78 ? 142  LEU A CD1   1 
ATOM   1115 C CD2   . LEU A 1 159 ? -8.983  -1.538  -2.836  1.00 18.14 ? 142  LEU A CD2   1 
ATOM   1116 N N     . THR A 1 160 ? -13.903 -3.392  -1.328  1.00 16.58 ? 143  THR A N     1 
ATOM   1117 C CA    . THR A 1 160 ? -14.857 -4.341  -1.888  1.00 17.22 ? 143  THR A CA    1 
ATOM   1118 C C     . THR A 1 160 ? -14.184 -5.097  -3.034  1.00 17.72 ? 143  THR A C     1 
ATOM   1119 O O     . THR A 1 160 ? -13.130 -4.664  -3.560  1.00 16.76 ? 143  THR A O     1 
ATOM   1120 C CB    . THR A 1 160 ? -16.130 -3.650  -2.457  1.00 17.87 ? 143  THR A CB    1 
ATOM   1121 O OG1   . THR A 1 160 ? -15.783 -2.843  -3.593  1.00 17.59 ? 143  THR A OG1   1 
ATOM   1122 C CG2   . THR A 1 160 ? -16.855 -2.797  -1.412  1.00 18.70 ? 143  THR A CG2   1 
ATOM   1123 N N     . ASP A 1 161 ? -14.796 -6.207  -3.447  1.00 18.00 ? 144  ASP A N     1 
ATOM   1124 C CA    . ASP A 1 161 ? -14.262 -6.978  -4.561  1.00 19.23 ? 144  ASP A CA    1 
ATOM   1125 C C     . ASP A 1 161 ? -14.183 -6.126  -5.818  1.00 19.15 ? 144  ASP A C     1 
ATOM   1126 O O     . ASP A 1 161 ? -13.151 -6.118  -6.490  1.00 18.64 ? 144  ASP A O     1 
ATOM   1127 C CB    . ASP A 1 161 ? -15.089 -8.259  -4.827  1.00 19.15 ? 144  ASP A CB    1 
ATOM   1128 C CG    . ASP A 1 161 ? -14.989 -9.265  -3.703  1.00 20.65 ? 144  ASP A CG    1 
ATOM   1129 O OD1   . ASP A 1 161 ? -13.996 -9.229  -2.939  1.00 21.66 ? 144  ASP A OD1   1 
ATOM   1130 O OD2   . ASP A 1 161 ? -15.900 -10.126 -3.607  1.00 19.20 ? 144  ASP A OD2   1 
ATOM   1131 N N     . GLN A 1 162 ? -15.261 -5.400  -6.119  1.00 19.90 ? 145  GLN A N     1 
ATOM   1132 C CA    . GLN A 1 162 ? -15.287 -4.558  -7.326  1.00 20.51 ? 145  GLN A CA    1 
ATOM   1133 C C     . GLN A 1 162 ? -14.267 -3.432  -7.215  1.00 19.11 ? 145  GLN A C     1 
ATOM   1134 O O     . GLN A 1 162 ? -13.546 -3.161  -8.178  1.00 18.96 ? 145  GLN A O     1 
ATOM   1135 C CB    . GLN A 1 162 ? -16.679 -3.982  -7.591  1.00 20.65 ? 145  GLN A CB    1 
ATOM   1136 C CG    . GLN A 1 162 ? -16.849 -3.475  -9.034  1.00 24.00 ? 145  GLN A CG    1 
ATOM   1137 C CD    . GLN A 1 162 ? -18.114 -2.650  -9.238  1.00 23.98 ? 145  GLN A CD    1 
ATOM   1138 O OE1   . GLN A 1 162 ? -19.071 -2.754  -8.465  1.00 29.36 ? 145  GLN A OE1   1 
ATOM   1139 N NE2   . GLN A 1 162 ? -18.123 -1.823  -10.281 1.00 25.62 ? 145  GLN A NE2   1 
ATOM   1140 N N     . HIS A 1 163 ? -14.180 -2.793  -6.043  1.00 18.22 ? 146  HIS A N     1 
ATOM   1141 C CA    . HIS A 1 163 ? -13.212 -1.697  -5.897  1.00 17.69 ? 146  HIS A CA    1 
ATOM   1142 C C     . HIS A 1 163 ? -11.779 -2.201  -5.983  1.00 17.04 ? 146  HIS A C     1 
ATOM   1143 O O     . HIS A 1 163 ? -10.908 -1.495  -6.493  1.00 15.95 ? 146  HIS A O     1 
ATOM   1144 C CB    . HIS A 1 163 ? -13.429 -0.859  -4.625  1.00 18.83 ? 146  HIS A CB    1 
ATOM   1145 C CG    . HIS A 1 163 ? -14.628 0.043   -4.687  1.00 20.14 ? 146  HIS A CG    1 
ATOM   1146 N ND1   . HIS A 1 163 ? -15.243 0.541   -3.557  1.00 23.18 ? 146  HIS A ND1   1 
ATOM   1147 C CD2   . HIS A 1 163 ? -15.340 0.517   -5.742  1.00 23.14 ? 146  HIS A CD2   1 
ATOM   1148 C CE1   . HIS A 1 163 ? -16.273 1.291   -3.912  1.00 24.27 ? 146  HIS A CE1   1 
ATOM   1149 N NE2   . HIS A 1 163 ? -16.358 1.287   -5.232  1.00 24.90 ? 146  HIS A NE2   1 
ATOM   1150 N N     . LEU A 1 164 ? -11.540 -3.411  -5.483  1.00 16.32 ? 147  LEU A N     1 
ATOM   1151 C CA    . LEU A 1 164 ? -10.203 -4.015  -5.549  1.00 15.77 ? 147  LEU A CA    1 
ATOM   1152 C C     . LEU A 1 164 ? -9.817  -4.288  -7.010  1.00 15.99 ? 147  LEU A C     1 
ATOM   1153 O O     . LEU A 1 164 ? -8.733  -3.884  -7.475  1.00 15.48 ? 147  LEU A O     1 
ATOM   1154 C CB    . LEU A 1 164 ? -10.149 -5.311  -4.724  1.00 15.11 ? 147  LEU A CB    1 
ATOM   1155 C CG    . LEU A 1 164 ? -8.828  -6.090  -4.768  1.00 13.47 ? 147  LEU A CG    1 
ATOM   1156 C CD1   . LEU A 1 164 ? -7.630  -5.155  -4.439  1.00 15.88 ? 147  LEU A CD1   1 
ATOM   1157 C CD2   . LEU A 1 164 ? -8.846  -7.325  -3.862  1.00 15.68 ? 147  LEU A CD2   1 
ATOM   1158 N N     . ALA A 1 165 ? -10.699 -4.981  -7.730  1.00 16.67 ? 148  ALA A N     1 
ATOM   1159 C CA    . ALA A 1 165 ? -10.465 -5.249  -9.162  1.00 17.32 ? 148  ALA A CA    1 
ATOM   1160 C C     . ALA A 1 165 ? -10.163 -3.958  -9.948  1.00 18.04 ? 148  ALA A C     1 
ATOM   1161 O O     . ALA A 1 165 ? -9.214  -3.908  -10.751 1.00 18.10 ? 148  ALA A O     1 
ATOM   1162 C CB    . ALA A 1 165 ? -11.672 -6.001  -9.779  1.00 17.90 ? 148  ALA A CB    1 
ATOM   1163 N N     . GLU A 1 166 ? -10.975 -2.928  -9.716  1.00 18.51 ? 149  GLU A N     1 
ATOM   1164 C CA    . GLU A 1 166 ? -10.874 -1.658  -10.423 1.00 19.56 ? 149  GLU A CA    1 
ATOM   1165 C C     . GLU A 1 166 ? -9.583  -0.947  -10.057 1.00 18.62 ? 149  GLU A C     1 
ATOM   1166 O O     . GLU A 1 166 ? -8.878  -0.461  -10.936 1.00 18.52 ? 149  GLU A O     1 
ATOM   1167 C CB    . GLU A 1 166 ? -12.088 -0.788  -10.121 1.00 20.04 ? 149  GLU A CB    1 
ATOM   1168 C CG    . GLU A 1 166 ? -13.350 -1.330  -10.794 1.00 21.70 ? 149  GLU A CG    1 
ATOM   1169 C CD    . GLU A 1 166 ? -14.646 -0.619  -10.408 1.00 22.51 ? 149  GLU A CD    1 
ATOM   1170 O OE1   . GLU A 1 166 ? -14.694 0.193   -9.443  1.00 26.85 ? 149  GLU A OE1   1 
ATOM   1171 O OE2   . GLU A 1 166 ? -15.659 -0.900  -11.094 1.00 25.65 ? 149  GLU A OE2   1 
ATOM   1172 N N     . PHE A 1 167 ? -9.271  -0.903  -8.767  1.00 16.92 ? 150  PHE A N     1 
ATOM   1173 C CA    . PHE A 1 167 ? -7.993  -0.336  -8.326  1.00 16.02 ? 150  PHE A CA    1 
ATOM   1174 C C     . PHE A 1 167 ? -6.792  -1.051  -8.961  1.00 16.07 ? 150  PHE A C     1 
ATOM   1175 O O     . PHE A 1 167 ? -5.823  -0.410  -9.416  1.00 16.87 ? 150  PHE A O     1 
ATOM   1176 C CB    . PHE A 1 167 ? -7.864  -0.431  -6.798  1.00 15.49 ? 150  PHE A CB    1 
ATOM   1177 C CG    . PHE A 1 167 ? -6.615  0.186   -6.283  1.00 14.13 ? 150  PHE A CG    1 
ATOM   1178 C CD1   . PHE A 1 167 ? -6.371  1.547   -6.485  1.00 15.71 ? 150  PHE A CD1   1 
ATOM   1179 C CD2   . PHE A 1 167 ? -5.667  -0.587  -5.598  1.00 16.53 ? 150  PHE A CD2   1 
ATOM   1180 C CE1   . PHE A 1 167 ? -5.175  2.138   -6.023  1.00 16.94 ? 150  PHE A CE1   1 
ATOM   1181 C CE2   . PHE A 1 167 ? -4.482  -0.009  -5.152  1.00 17.22 ? 150  PHE A CE2   1 
ATOM   1182 C CZ    . PHE A 1 167 ? -4.241  1.361   -5.356  1.00 15.78 ? 150  PHE A CZ    1 
ATOM   1183 N N     . LEU A 1 168 ? -6.848  -2.372  -9.002  1.00 15.28 ? 151  LEU A N     1 
ATOM   1184 C CA    . LEU A 1 168 ? -5.753  -3.138  -9.610  1.00 16.00 ? 151  LEU A CA    1 
ATOM   1185 C C     . LEU A 1 168 ? -5.561  -2.788  -11.098 1.00 16.88 ? 151  LEU A C     1 
ATOM   1186 O O     . LEU A 1 168 ? -4.419  -2.604  -11.561 1.00 17.25 ? 151  LEU A O     1 
ATOM   1187 C CB    . LEU A 1 168 ? -5.921  -4.641  -9.393  1.00 15.94 ? 151  LEU A CB    1 
ATOM   1188 C CG    . LEU A 1 168 ? -5.652  -5.124  -7.948  1.00 14.91 ? 151  LEU A CG    1 
ATOM   1189 C CD1   . LEU A 1 168 ? -5.921  -6.581  -7.828  1.00 15.06 ? 151  LEU A CD1   1 
ATOM   1190 C CD2   . LEU A 1 168 ? -4.212  -4.826  -7.522  1.00 14.86 ? 151  LEU A CD2   1 
ATOM   1191 N N     . ARG A 1 169 ? -6.666  -2.652  -11.826 1.00 18.38 ? 152  ARG A N     1 
ATOM   1192 C CA    . ARG A 1 169 ? -6.606  -2.187  -13.221 1.00 19.03 ? 152  ARG A CA    1 
ATOM   1193 C C     . ARG A 1 169 ? -6.020  -0.771  -13.350 1.00 19.00 ? 152  ARG A C     1 
ATOM   1194 O O     . ARG A 1 169 ? -5.233  -0.487  -14.275 1.00 18.42 ? 152  ARG A O     1 
ATOM   1195 C CB    . ARG A 1 169 ? -7.999  -2.257  -13.879 1.00 19.17 ? 152  ARG A CB    1 
ATOM   1196 C CG    . ARG A 1 169 ? -8.411  -3.679  -14.285 1.00 20.27 ? 152  ARG A CG    1 
ATOM   1197 C CD    . ARG A 1 169 ? -9.763  -3.701  -15.024 1.00 22.19 ? 152  ARG A CD    1 
ATOM   1198 N NE    . ARG A 1 169 ? -10.176 -5.070  -15.359 1.00 25.48 ? 152  ARG A NE    1 
ATOM   1199 C CZ    . ARG A 1 169 ? -9.803  -5.746  -16.452 1.00 27.64 ? 152  ARG A CZ    1 
ATOM   1200 N NH1   . ARG A 1 169 ? -9.001  -5.199  -17.356 1.00 30.06 ? 152  ARG A NH1   1 
ATOM   1201 N NH2   . ARG A 1 169 ? -10.231 -6.986  -16.638 1.00 27.90 ? 152  ARG A NH2   1 
ATOM   1202 N N     . ARG A 1 170 ? -6.403  0.133   -12.454 1.00 19.01 ? 153  ARG A N     1 
ATOM   1203 C CA    . ARG A 1 170 ? -5.810  1.476   -12.458 1.00 18.48 ? 153  ARG A CA    1 
ATOM   1204 C C     . ARG A 1 170 ? -4.321  1.388   -12.124 1.00 18.65 ? 153  ARG A C     1 
ATOM   1205 O O     . ARG A 1 170 ? -3.499  2.043   -12.764 1.00 19.36 ? 153  ARG A O     1 
ATOM   1206 C CB    . ARG A 1 170 ? -6.518  2.423   -11.493 1.00 18.64 ? 153  ARG A CB    1 
ATOM   1207 C CG    . ARG A 1 170 ? -7.981  2.705   -11.842 1.00 18.73 ? 153  ARG A CG    1 
ATOM   1208 C CD    . ARG A 1 170 ? -8.454  3.951   -11.152 1.00 20.30 ? 153  ARG A CD    1 
ATOM   1209 N NE    . ARG A 1 170 ? -8.541  3.867   -9.679  1.00 19.67 ? 153  ARG A NE    1 
ATOM   1210 C CZ    . ARG A 1 170 ? -9.428  3.147   -8.981  1.00 20.23 ? 153  ARG A CZ    1 
ATOM   1211 N NH1   . ARG A 1 170 ? -10.337 2.361   -9.579  1.00 19.17 ? 153  ARG A NH1   1 
ATOM   1212 N NH2   . ARG A 1 170 ? -9.406  3.212   -7.650  1.00 19.11 ? 153  ARG A NH2   1 
ATOM   1213 N N     . CYS A 1 171 ? -3.972  0.557   -11.141 1.00 18.34 ? 154  CYS A N     1 
ATOM   1214 C CA    . CYS A 1 171 ? -2.553  0.273   -10.865 1.00 17.97 ? 154  CYS A CA    1 
ATOM   1215 C C     . CYS A 1 171 ? -1.779  -0.205  -12.094 1.00 18.02 ? 154  CYS A C     1 
ATOM   1216 O O     . CYS A 1 171 ? -0.687  0.308   -12.379 1.00 17.09 ? 154  CYS A O     1 
ATOM   1217 C CB    . CYS A 1 171 ? -2.389  -0.703  -9.706  1.00 17.61 ? 154  CYS A CB    1 
ATOM   1218 S SG    . CYS A 1 171 ? -2.713  0.070   -8.123  1.00 16.49 ? 154  CYS A SG    1 
ATOM   1219 N N     . LYS A 1 172 ? -2.326  -1.185  -12.814 1.00 17.36 ? 155  LYS A N     1 
ATOM   1220 C CA    . LYS A 1 172 ? -1.663  -1.702  -14.012 1.00 19.21 ? 155  LYS A CA    1 
ATOM   1221 C C     . LYS A 1 172 ? -1.356  -0.579  -15.025 1.00 19.58 ? 155  LYS A C     1 
ATOM   1222 O O     . LYS A 1 172 ? -0.245  -0.533  -15.571 1.00 19.77 ? 155  LYS A O     1 
ATOM   1223 C CB    . LYS A 1 172 ? -2.496  -2.811  -14.634 1.00 18.91 ? 155  LYS A CB    1 
ATOM   1224 C CG    . LYS A 1 172 ? -1.884  -3.450  -15.893 1.00 21.84 ? 155  LYS A CG    1 
ATOM   1225 C CD    . LYS A 1 172 ? -2.911  -4.389  -16.499 1.00 23.73 ? 155  LYS A CD    1 
ATOM   1226 C CE    . LYS A 1 172 ? -2.827  -4.384  -18.027 1.00 29.04 ? 155  LYS A CE    1 
ATOM   1227 N NZ    . LYS A 1 172 ? -1.712  -5.233  -18.506 1.00 31.57 ? 155  LYS A NZ    1 
ATOM   1228 N N     . GLY A 1 173 ? -2.311  0.327   -15.243 1.00 20.53 ? 156  GLY A N     1 
ATOM   1229 C CA    . GLY A 1 173 ? -2.113  1.499   -16.124 1.00 22.09 ? 156  GLY A CA    1 
ATOM   1230 C C     . GLY A 1 173 ? -1.158  2.567   -15.592 1.00 22.97 ? 156  GLY A C     1 
ATOM   1231 O O     . GLY A 1 173 ? -0.742  3.476   -16.326 1.00 23.37 ? 156  GLY A O     1 
ATOM   1232 N N     . SER A 1 174 ? -0.799  2.444   -14.318 1.00 22.93 ? 157  SER A N     1 
ATOM   1233 C CA    . SER A 1 174 ? 0.173   3.327   -13.659 1.00 23.40 ? 157  SER A CA    1 
ATOM   1234 C C     . SER A 1 174 ? 1.607   2.789   -13.686 1.00 23.16 ? 157  SER A C     1 
ATOM   1235 O O     . SER A 1 174 ? 2.554   3.481   -13.270 1.00 23.56 ? 157  SER A O     1 
ATOM   1236 C CB    . SER A 1 174 ? -0.215  3.510   -12.190 1.00 23.72 ? 157  SER A CB    1 
ATOM   1237 O OG    . SER A 1 174 ? 0.537   4.569   -11.642 1.00 26.00 ? 157  SER A OG    1 
ATOM   1238 N N     . LEU A 1 175 ? 1.769   1.546   -14.116 1.00 23.25 ? 158  LEU A N     1 
ATOM   1239 C CA    . LEU A 1 175 ? 3.080   0.916   -14.133 1.00 23.14 ? 158  LEU A CA    1 
ATOM   1240 C C     . LEU A 1 175 ? 3.952   1.404   -15.290 1.00 24.61 ? 158  LEU A C     1 
ATOM   1241 O O     . LEU A 1 175 ? 3.471   1.606   -16.406 1.00 24.25 ? 158  LEU A O     1 
ATOM   1242 C CB    . LEU A 1 175 ? 2.954   -0.612  -14.195 1.00 23.13 ? 158  LEU A CB    1 
ATOM   1243 C CG    . LEU A 1 175 ? 2.437   -1.411  -12.992 1.00 22.45 ? 158  LEU A CG    1 
ATOM   1244 C CD1   . LEU A 1 175 ? 2.314   -2.888  -13.353 1.00 23.40 ? 158  LEU A CD1   1 
ATOM   1245 C CD2   . LEU A 1 175 ? 3.362   -1.248  -11.785 1.00 22.46 ? 158  LEU A CD2   1 
ATOM   1246 N N     . ARG A 1 176 ? 5.235   1.593   -15.004 1.00 24.87 ? 159  ARG A N     1 
ATOM   1247 C CA    . ARG A 1 176 ? 6.233   1.766   -16.051 1.00 25.76 ? 159  ARG A CA    1 
ATOM   1248 C C     . ARG A 1 176 ? 6.534   0.423   -16.717 1.00 25.66 ? 159  ARG A C     1 
ATOM   1249 O O     . ARG A 1 176 ? 6.282   -0.637  -16.137 1.00 26.13 ? 159  ARG A O     1 
ATOM   1250 C CB    . ARG A 1 176 ? 7.512   2.313   -15.430 1.00 25.89 ? 159  ARG A CB    1 
ATOM   1251 C CG    . ARG A 1 176 ? 7.464   3.785   -15.262 1.00 27.51 ? 159  ARG A CG    1 
ATOM   1252 C CD    . ARG A 1 176 ? 8.714   4.271   -14.619 1.00 29.27 ? 159  ARG A CD    1 
ATOM   1253 N NE    . ARG A 1 176 ? 8.718   5.728   -14.551 1.00 30.24 ? 159  ARG A NE    1 
ATOM   1254 C CZ    . ARG A 1 176 ? 9.300   6.407   -13.573 1.00 32.15 ? 159  ARG A CZ    1 
ATOM   1255 N NH1   . ARG A 1 176 ? 9.890   5.753   -12.578 1.00 32.74 ? 159  ARG A NH1   1 
ATOM   1256 N NH2   . ARG A 1 176 ? 9.264   7.728   -13.567 1.00 31.20 ? 159  ARG A NH2   1 
ATOM   1257 N N     . PRO A 1 177 ? 7.083   0.454   -17.949 1.00 26.20 ? 160  PRO A N     1 
ATOM   1258 C CA    . PRO A 1 177 ? 7.596   -0.773  -18.544 1.00 25.56 ? 160  PRO A CA    1 
ATOM   1259 C C     . PRO A 1 177 ? 8.382   -1.597  -17.538 1.00 24.64 ? 160  PRO A C     1 
ATOM   1260 O O     . PRO A 1 177 ? 9.226   -1.048  -16.818 1.00 24.37 ? 160  PRO A O     1 
ATOM   1261 C CB    . PRO A 1 177 ? 8.550   -0.253  -19.626 1.00 25.80 ? 160  PRO A CB    1 
ATOM   1262 C CG    . PRO A 1 177 ? 7.954   1.035   -20.044 1.00 25.81 ? 160  PRO A CG    1 
ATOM   1263 C CD    . PRO A 1 177 ? 7.221   1.609   -18.859 1.00 26.23 ? 160  PRO A CD    1 
ATOM   1264 N N     . ASN A 1 178 ? 8.079   -2.893  -17.490 1.00 23.70 ? 161  ASN A N     1 
ATOM   1265 C CA    . ASN A 1 178 ? 8.691   -3.858  -16.566 1.00 24.06 ? 161  ASN A CA    1 
ATOM   1266 C C     . ASN A 1 178 ? 8.322   -3.656  -15.091 1.00 23.27 ? 161  ASN A C     1 
ATOM   1267 O O     . ASN A 1 178 ? 8.814   -4.379  -14.233 1.00 23.81 ? 161  ASN A O     1 
ATOM   1268 C CB    . ASN A 1 178 ? 10.215  -3.895  -16.736 1.00 24.34 ? 161  ASN A CB    1 
ATOM   1269 C CG    . ASN A 1 178 ? 10.625  -4.076  -18.171 1.00 26.25 ? 161  ASN A CG    1 
ATOM   1270 O OD1   . ASN A 1 178 ? 10.092  -4.934  -18.861 1.00 27.02 ? 161  ASN A OD1   1 
ATOM   1271 N ND2   . ASN A 1 178 ? 11.577  -3.263  -18.635 1.00 26.96 ? 161  ASN A ND2   1 
ATOM   1272 N N     . GLY A 1 179 ? 7.456   -2.678  -14.813 1.00 22.73 ? 162  GLY A N     1 
ATOM   1273 C CA    . GLY A 1 179 ? 6.998   -2.401  -13.452 1.00 21.81 ? 162  GLY A CA    1 
ATOM   1274 C C     . GLY A 1 179 ? 6.112   -3.522  -12.941 1.00 21.34 ? 162  GLY A C     1 
ATOM   1275 O O     . GLY A 1 179 ? 5.501   -4.245  -13.730 1.00 21.84 ? 162  GLY A O     1 
ATOM   1276 N N     . ILE A 1 180 ? 6.045   -3.675  -11.625 1.00 20.24 ? 163  ILE A N     1 
ATOM   1277 C CA    . ILE A 1 180 ? 5.198   -4.724  -11.026 1.00 19.55 ? 163  ILE A CA    1 
ATOM   1278 C C     . ILE A 1 180 ? 4.344   -4.172  -9.883  1.00 18.98 ? 163  ILE A C     1 
ATOM   1279 O O     . ILE A 1 180 ? 4.652   -3.121  -9.296  1.00 18.46 ? 163  ILE A O     1 
ATOM   1280 C CB    . ILE A 1 180 ? 6.012   -5.952  -10.530 1.00 19.75 ? 163  ILE A CB    1 
ATOM   1281 C CG1   . ILE A 1 180 ? 6.943   -5.576  -9.360  1.00 19.64 ? 163  ILE A CG1   1 
ATOM   1282 C CG2   . ILE A 1 180 ? 6.799   -6.582  -11.681 1.00 20.75 ? 163  ILE A CG2   1 
ATOM   1283 C CD1   . ILE A 1 180 ? 7.621   -6.751  -8.666  1.00 19.68 ? 163  ILE A CD1   1 
ATOM   1284 N N     . ILE A 1 181 ? 3.243   -4.871  -9.613  1.00 17.74 ? 164  ILE A N     1 
ATOM   1285 C CA    . ILE A 1 181 ? 2.419   -4.629  -8.435  1.00 16.33 ? 164  ILE A CA    1 
ATOM   1286 C C     . ILE A 1 181 ? 2.673   -5.784  -7.476  1.00 16.59 ? 164  ILE A C     1 
ATOM   1287 O O     . ILE A 1 181 ? 2.688   -6.936  -7.886  1.00 16.53 ? 164  ILE A O     1 
ATOM   1288 C CB    . ILE A 1 181 ? 0.905   -4.603  -8.790  1.00 15.53 ? 164  ILE A CB    1 
ATOM   1289 C CG1   . ILE A 1 181 ? 0.566   -3.409  -9.681  1.00 15.39 ? 164  ILE A CG1   1 
ATOM   1290 C CG2   . ILE A 1 181 ? 0.066   -4.556  -7.521  1.00 16.00 ? 164  ILE A CG2   1 
ATOM   1291 C CD1   . ILE A 1 181 ? -0.632  -3.637  -10.578 1.00 17.41 ? 164  ILE A CD1   1 
ATOM   1292 N N     . VAL A 1 182 ? 2.844   -5.497  -6.187  1.00 15.68 ? 165  VAL A N     1 
ATOM   1293 C CA    . VAL A 1 182 ? 2.933   -6.583  -5.220  1.00 15.81 ? 165  VAL A CA    1 
ATOM   1294 C C     . VAL A 1 182 ? 1.792   -6.473  -4.204  1.00 15.75 ? 165  VAL A C     1 
ATOM   1295 O O     . VAL A 1 182 ? 1.632   -5.446  -3.531  1.00 15.17 ? 165  VAL A O     1 
ATOM   1296 C CB    . VAL A 1 182 ? 4.292   -6.625  -4.502  1.00 16.04 ? 165  VAL A CB    1 
ATOM   1297 C CG1   . VAL A 1 182 ? 4.312   -7.743  -3.408  1.00 15.46 ? 165  VAL A CG1   1 
ATOM   1298 C CG2   . VAL A 1 182 ? 5.412   -6.820  -5.521  1.00 16.36 ? 165  VAL A CG2   1 
ATOM   1299 N N     . ILE A 1 183 ? 0.988   -7.528  -4.120  1.00 14.63 ? 166  ILE A N     1 
ATOM   1300 C CA    . ILE A 1 183 ? 0.020   -7.669  -3.023  1.00 14.31 ? 166  ILE A CA    1 
ATOM   1301 C C     . ILE A 1 183 ? 0.644   -8.579  -1.964  1.00 15.05 ? 166  ILE A C     1 
ATOM   1302 O O     . ILE A 1 183 ? 1.112   -9.695  -2.277  1.00 14.47 ? 166  ILE A O     1 
ATOM   1303 C CB    . ILE A 1 183 ? -1.338  -8.268  -3.493  1.00 15.13 ? 166  ILE A CB    1 
ATOM   1304 C CG1   . ILE A 1 183 ? -2.074  -7.290  -4.409  1.00 15.22 ? 166  ILE A CG1   1 
ATOM   1305 C CG2   . ILE A 1 183 ? -2.200  -8.696  -2.291  1.00 14.70 ? 166  ILE A CG2   1 
ATOM   1306 C CD1   . ILE A 1 183 ? -3.283  -7.920  -5.186  1.00 15.24 ? 166  ILE A CD1   1 
ATOM   1307 N N     . LYS A 1 184 ? 0.674   -8.101  -0.726  1.00 13.93 ? 167  LYS A N     1 
ATOM   1308 C CA    . LYS A 1 184 ? 1.073   -8.960  0.399   1.00 15.23 ? 167  LYS A CA    1 
ATOM   1309 C C     . LYS A 1 184 ? 0.016   -8.887  1.471   1.00 15.58 ? 167  LYS A C     1 
ATOM   1310 O O     . LYS A 1 184 ? -0.274  -7.822  1.985   1.00 15.90 ? 167  LYS A O     1 
ATOM   1311 C CB    . LYS A 1 184 ? 2.438   -8.554  0.966   1.00 14.37 ? 167  LYS A CB    1 
ATOM   1312 C CG    . LYS A 1 184 ? 3.008   -9.650  1.886   1.00 16.35 ? 167  LYS A CG    1 
ATOM   1313 C CD    . LYS A 1 184 ? 4.495   -9.448  2.128   1.00 14.47 ? 167  LYS A CD    1 
ATOM   1314 C CE    . LYS A 1 184 ? 5.031   -10.539 3.063   1.00 15.67 ? 167  LYS A CE    1 
ATOM   1315 N NZ    . LYS A 1 184 ? 6.471   -10.318 3.364   1.00 17.56 ? 167  LYS A NZ    1 
ATOM   1316 N N     . ASP A 1 185 ? -0.592  -10.009 1.819   1.00 16.98 ? 168  ASP A N     1 
ATOM   1317 C CA    . ASP A 1 185 ? -1.715  -9.934  2.747   1.00 17.96 ? 168  ASP A CA    1 
ATOM   1318 C C     . ASP A 1 185 ? -2.066  -11.266 3.379   1.00 19.52 ? 168  ASP A C     1 
ATOM   1319 O O     . ASP A 1 185 ? -1.524  -12.299 2.991   1.00 17.58 ? 168  ASP A O     1 
ATOM   1320 C CB    . ASP A 1 185 ? -2.938  -9.319  2.042   1.00 19.15 ? 168  ASP A CB    1 
ATOM   1321 C CG    . ASP A 1 185 ? -3.707  -8.343  2.931   1.00 19.29 ? 168  ASP A CG    1 
ATOM   1322 O OD1   . ASP A 1 185 ? -4.120  -8.750  4.046   1.00 21.92 ? 168  ASP A OD1   1 
ATOM   1323 O OD2   . ASP A 1 185 ? -3.906  -7.190  2.485   1.00 24.23 ? 168  ASP A OD2   1 
ATOM   1324 N N     . ASN A 1 186 ? -2.928  -11.193 4.400   1.00 20.70 ? 169  ASN A N     1 
ATOM   1325 C CA    . ASN A 1 186 ? -3.536  -12.346 5.052   1.00 23.01 ? 169  ASN A CA    1 
ATOM   1326 C C     . ASN A 1 186 ? -4.509  -13.034 4.109   1.00 22.93 ? 169  ASN A C     1 
ATOM   1327 O O     . ASN A 1 186 ? -5.305  -12.367 3.450   1.00 24.19 ? 169  ASN A O     1 
ATOM   1328 C CB    . ASN A 1 186 ? -4.327  -11.894 6.290   1.00 23.57 ? 169  ASN A CB    1 
ATOM   1329 C CG    . ASN A 1 186 ? -3.570  -10.909 7.148   1.00 26.67 ? 169  ASN A CG    1 
ATOM   1330 O OD1   . ASN A 1 186 ? -2.367  -11.055 7.365   1.00 28.88 ? 169  ASN A OD1   1 
ATOM   1331 N ND2   . ASN A 1 186 ? -4.278  -9.891  7.644   1.00 28.70 ? 169  ASN A ND2   1 
ATOM   1332 N N     . MET A 1 187 ? -4.442  -14.359 4.040   1.00 23.25 ? 170  MET A N     1 
ATOM   1333 C CA    . MET A 1 187 ? -5.424  -15.155 3.303   1.00 23.66 ? 170  MET A CA    1 
ATOM   1334 C C     . MET A 1 187 ? -6.311  -15.900 4.291   1.00 23.80 ? 170  MET A C     1 
ATOM   1335 O O     . MET A 1 187 ? -5.813  -16.419 5.277   1.00 24.47 ? 170  MET A O     1 
ATOM   1336 C CB    . MET A 1 187 ? -4.717  -16.178 2.409   1.00 23.31 ? 170  MET A CB    1 
ATOM   1337 C CG    . MET A 1 187 ? -3.784  -15.582 1.354   1.00 25.38 ? 170  MET A CG    1 
ATOM   1338 S SD    . MET A 1 187 ? -4.657  -14.560 0.152   1.00 25.98 ? 170  MET A SD    1 
ATOM   1339 C CE    . MET A 1 187 ? -3.944  -12.940 0.455   1.00 26.59 ? 170  MET A CE    1 
ATOM   1340 N N     . ALA A 1 188 ? -7.618  -15.945 4.027   1.00 24.40 ? 171  ALA A N     1 
ATOM   1341 C CA    . ALA A 1 188 ? -8.548  -16.734 4.845   1.00 24.60 ? 171  ALA A CA    1 
ATOM   1342 C C     . ALA A 1 188 ? -8.415  -18.237 4.557   1.00 25.35 ? 171  ALA A C     1 
ATOM   1343 O O     . ALA A 1 188 ? -7.982  -18.636 3.482   1.00 24.58 ? 171  ALA A O     1 
ATOM   1344 C CB    . ALA A 1 188 ? -9.996  -16.258 4.627   1.00 24.76 ? 171  ALA A CB    1 
ATOM   1345 N N     . GLN A 1 189 ? -8.799  -19.068 5.527   1.00 25.47 ? 172  GLN A N     1 
ATOM   1346 C CA    . GLN A 1 189 ? -8.828  -20.510 5.306   1.00 26.66 ? 172  GLN A CA    1 
ATOM   1347 C C     . GLN A 1 189 ? -9.837  -20.827 4.207   1.00 26.12 ? 172  GLN A C     1 
ATOM   1348 O O     . GLN A 1 189 ? -9.554  -21.614 3.310   1.00 26.70 ? 172  GLN A O     1 
ATOM   1349 C CB    . GLN A 1 189 ? -9.170  -21.242 6.605   1.00 27.30 ? 172  GLN A CB    1 
ATOM   1350 C CG    . GLN A 1 189 ? -8.021  -21.243 7.592   1.00 31.01 ? 172  GLN A CG    1 
ATOM   1351 C CD    . GLN A 1 189 ? -7.307  -22.577 7.645   1.00 34.90 ? 172  GLN A CD    1 
ATOM   1352 O OE1   . GLN A 1 189 ? -7.772  -23.510 8.305   1.00 37.11 ? 172  GLN A OE1   1 
ATOM   1353 N NE2   . GLN A 1 189 ? -6.172  -22.676 6.961   1.00 37.25 ? 172  GLN A NE2   1 
ATOM   1354 N N     . GLU A 1 190 ? -10.991 -20.168 4.249   1.00 25.76 ? 173  GLU A N     1 
ATOM   1355 C CA    . GLU A 1 190 ? -12.014 -20.408 3.251   1.00 25.58 ? 173  GLU A CA    1 
ATOM   1356 C C     . GLU A 1 190 ? -13.000 -19.259 3.142   1.00 24.86 ? 173  GLU A C     1 
ATOM   1357 O O     . GLU A 1 190 ? -13.391 -18.677 4.147   1.00 24.60 ? 173  GLU A O     1 
ATOM   1358 C CB    . GLU A 1 190 ? -12.717 -21.736 3.581   1.00 26.23 ? 173  GLU A CB    1 
ATOM   1359 C CG    . GLU A 1 190 ? -14.217 -21.764 3.481   1.00 29.02 ? 173  GLU A CG    1 
ATOM   1360 C CD    . GLU A 1 190 ? -14.762 -23.018 4.134   1.00 32.51 ? 173  GLU A CD    1 
ATOM   1361 O OE1   . GLU A 1 190 ? -15.407 -22.917 5.205   1.00 34.26 ? 173  GLU A OE1   1 
ATOM   1362 O OE2   . GLU A 1 190 ? -14.492 -24.108 3.593   1.00 34.87 ? 173  GLU A OE2   1 
ATOM   1363 N N     . GLY A 1 191 ? -13.384 -18.942 1.909   1.00 23.54 ? 174  GLY A N     1 
ATOM   1364 C CA    . GLY A 1 191 ? -14.398 -17.937 1.629   1.00 23.29 ? 174  GLY A CA    1 
ATOM   1365 C C     . GLY A 1 191 ? -13.958 -16.510 1.907   1.00 22.77 ? 174  GLY A C     1 
ATOM   1366 O O     . GLY A 1 191 ? -12.779 -16.189 1.792   1.00 22.21 ? 174  GLY A O     1 
ATOM   1367 N N     . VAL A 1 192 ? -14.931 -15.663 2.253   1.00 23.26 ? 175  VAL A N     1 
ATOM   1368 C CA    . VAL A 1 192 ? -14.714 -14.239 2.547   1.00 22.79 ? 175  VAL A CA    1 
ATOM   1369 C C     . VAL A 1 192 ? -15.318 -13.980 3.938   1.00 23.78 ? 175  VAL A C     1 
ATOM   1370 O O     . VAL A 1 192 ? -16.505 -14.271 4.166   1.00 23.54 ? 175  VAL A O     1 
ATOM   1371 C CB    . VAL A 1 192 ? -15.371 -13.321 1.469   1.00 22.46 ? 175  VAL A CB    1 
ATOM   1372 C CG1   . VAL A 1 192 ? -15.174 -11.847 1.799   1.00 21.34 ? 175  VAL A CG1   1 
ATOM   1373 C CG2   . VAL A 1 192 ? -14.820 -13.636 0.078   1.00 22.18 ? 175  VAL A CG2   1 
ATOM   1374 N N     . ILE A 1 193 ? -14.488 -13.476 4.860   1.00 24.15 ? 176  ILE A N     1 
ATOM   1375 C CA    . ILE A 1 193 ? -14.890 -13.294 6.265   1.00 24.84 ? 176  ILE A CA    1 
ATOM   1376 C C     . ILE A 1 193 ? -14.801 -11.836 6.702   1.00 23.94 ? 176  ILE A C     1 
ATOM   1377 O O     . ILE A 1 193 ? -13.745 -11.227 6.556   1.00 24.35 ? 176  ILE A O     1 
ATOM   1378 C CB    . ILE A 1 193 ? -13.960 -14.072 7.236   1.00 24.56 ? 176  ILE A CB    1 
ATOM   1379 C CG1   . ILE A 1 193 ? -13.535 -15.429 6.656   1.00 26.49 ? 176  ILE A CG1   1 
ATOM   1380 C CG2   . ILE A 1 193 ? -14.629 -14.153 8.641   1.00 26.58 ? 176  ILE A CG2   1 
ATOM   1381 C CD1   . ILE A 1 193 ? -12.512 -16.211 7.491   1.00 26.74 ? 176  ILE A CD1   1 
ATOM   1382 N N     . LEU A 1 194 ? -15.873 -11.303 7.288   1.00 23.96 ? 177  LEU A N     1 
ATOM   1383 C CA    . LEU A 1 194 ? -15.865 -9.917  7.800   1.00 23.49 ? 177  LEU A CA    1 
ATOM   1384 C C     . LEU A 1 194 ? -15.180 -9.819  9.160   1.00 23.62 ? 177  LEU A C     1 
ATOM   1385 O O     . LEU A 1 194 ? -15.472 -10.595 10.071  1.00 24.04 ? 177  LEU A O     1 
ATOM   1386 C CB    . LEU A 1 194 ? -17.290 -9.372  7.924   1.00 23.44 ? 177  LEU A CB    1 
ATOM   1387 C CG    . LEU A 1 194 ? -17.417 -7.891  8.303   1.00 23.19 ? 177  LEU A CG    1 
ATOM   1388 C CD1   . LEU A 1 194 ? -16.979 -7.049  7.124   1.00 19.85 ? 177  LEU A CD1   1 
ATOM   1389 C CD2   . LEU A 1 194 ? -18.846 -7.509  8.733   1.00 23.91 ? 177  LEU A CD2   1 
ATOM   1390 N N     . ASP A 1 195 ? -14.286 -8.851  9.302   1.00 22.47 ? 178  ASP A N     1 
ATOM   1391 C CA    . ASP A 1 195 ? -13.699 -8.535  10.589  1.00 22.51 ? 178  ASP A CA    1 
ATOM   1392 C C     . ASP A 1 195 ? -14.444 -7.294  11.051  1.00 22.02 ? 178  ASP A C     1 
ATOM   1393 O O     . ASP A 1 195 ? -14.256 -6.210  10.502  1.00 21.02 ? 178  ASP A O     1 
ATOM   1394 C CB    . ASP A 1 195 ? -12.193 -8.256  10.430  1.00 22.93 ? 178  ASP A CB    1 
ATOM   1395 C CG    . ASP A 1 195 ? -11.460 -8.190  11.756  1.00 25.05 ? 178  ASP A CG    1 
ATOM   1396 O OD1   . ASP A 1 195 ? -12.035 -7.673  12.741  1.00 26.43 ? 178  ASP A OD1   1 
ATOM   1397 O OD2   . ASP A 1 195 ? -10.302 -8.655  11.813  1.00 27.42 ? 178  ASP A OD2   1 
ATOM   1398 N N     . ASP A 1 196 ? -15.346 -7.461  12.017  1.00 22.76 ? 179  ASP A N     1 
ATOM   1399 C CA    . ASP A 1 196 ? -16.059 -6.308  12.513  1.00 22.88 ? 179  ASP A CA    1 
ATOM   1400 C C     . ASP A 1 196 ? -15.214 -5.486  13.509  1.00 23.05 ? 179  ASP A C     1 
ATOM   1401 O O     . ASP A 1 196 ? -15.669 -4.451  13.960  1.00 24.61 ? 179  ASP A O     1 
ATOM   1402 C CB    . ASP A 1 196 ? -17.472 -6.657  13.033  1.00 23.46 ? 179  ASP A CB    1 
ATOM   1403 C CG    . ASP A 1 196 ? -17.460 -7.551  14.263  1.00 23.78 ? 179  ASP A CG    1 
ATOM   1404 O OD1   . ASP A 1 196 ? -16.368 -7.880  14.785  1.00 26.80 ? 179  ASP A OD1   1 
ATOM   1405 O OD2   . ASP A 1 196 ? -18.574 -7.936  14.704  1.00 26.33 ? 179  ASP A OD2   1 
ATOM   1406 N N     . VAL A 1 197 ? -13.984 -5.919  13.813  1.00 23.07 ? 180  VAL A N     1 
ATOM   1407 C CA    . VAL A 1 197 ? -13.075 -5.080  14.620  1.00 23.39 ? 180  VAL A CA    1 
ATOM   1408 C C     . VAL A 1 197 ? -12.637 -3.866  13.796  1.00 22.73 ? 180  VAL A C     1 
ATOM   1409 O O     . VAL A 1 197 ? -12.817 -2.716  14.207  1.00 23.83 ? 180  VAL A O     1 
ATOM   1410 C CB    . VAL A 1 197 ? -11.823 -5.863  15.161  1.00 23.24 ? 180  VAL A CB    1 
ATOM   1411 C CG1   . VAL A 1 197 ? -10.862 -4.931  15.878  1.00 24.12 ? 180  VAL A CG1   1 
ATOM   1412 C CG2   . VAL A 1 197 ? -12.261 -6.991  16.091  1.00 24.61 ? 180  VAL A CG2   1 
ATOM   1413 N N     . ASP A 1 198 ? -12.077 -4.119  12.618  1.00 22.08 ? 181  ASP A N     1 
ATOM   1414 C CA    . ASP A 1 198 ? -11.495 -3.025  11.849  1.00 20.99 ? 181  ASP A CA    1 
ATOM   1415 C C     . ASP A 1 198 ? -12.258 -2.693  10.558  1.00 19.88 ? 181  ASP A C     1 
ATOM   1416 O O     . ASP A 1 198 ? -11.826 -1.855  9.763   1.00 19.34 ? 181  ASP A O     1 
ATOM   1417 C CB    . ASP A 1 198 ? -10.004 -3.291  11.595  1.00 20.89 ? 181  ASP A CB    1 
ATOM   1418 C CG    . ASP A 1 198 ? -9.756  -4.561  10.814  1.00 21.87 ? 181  ASP A CG    1 
ATOM   1419 O OD1   . ASP A 1 198 ? -10.733 -5.147  10.295  1.00 23.68 ? 181  ASP A OD1   1 
ATOM   1420 O OD2   . ASP A 1 198 ? -8.586  -4.985  10.721  1.00 21.42 ? 181  ASP A OD2   1 
ATOM   1421 N N     . SER A 1 199 ? -13.411 -3.340  10.372  1.00 18.78 ? 182  SER A N     1 
ATOM   1422 C CA    . SER A 1 199 ? -14.233 -3.173  9.178   1.00 18.44 ? 182  SER A CA    1 
ATOM   1423 C C     . SER A 1 199 ? -13.431 -3.520  7.913   1.00 18.70 ? 182  SER A C     1 
ATOM   1424 O O     . SER A 1 199 ? -13.194 -2.678  7.041   1.00 16.79 ? 182  SER A O     1 
ATOM   1425 C CB    . SER A 1 199 ? -14.840 -1.765  9.098   1.00 18.79 ? 182  SER A CB    1 
ATOM   1426 O OG    . SER A 1 199 ? -15.915 -1.754  8.191   1.00 19.59 ? 182  SER A OG    1 
ATOM   1427 N N     . SER A 1 200 ? -13.014 -4.780  7.840   1.00 18.76 ? 183  SER A N     1 
ATOM   1428 C CA    . SER A 1 200 ? -12.295 -5.284  6.689   1.00 19.55 ? 183  SER A CA    1 
ATOM   1429 C C     . SER A 1 200 ? -12.781 -6.707  6.424   1.00 19.93 ? 183  SER A C     1 
ATOM   1430 O O     . SER A 1 200 ? -13.513 -7.293  7.256   1.00 20.85 ? 183  SER A O     1 
ATOM   1431 C CB    . SER A 1 200 ? -10.772 -5.255  6.914   1.00 19.52 ? 183  SER A CB    1 
ATOM   1432 O OG    . SER A 1 200 ? -10.349 -6.204  7.902   1.00 21.47 ? 183  SER A OG    1 
ATOM   1433 N N     . VAL A 1 201 ? -12.437 -7.230  5.255   1.00 19.29 ? 184  VAL A N     1 
ATOM   1434 C CA    . VAL A 1 201 ? -12.669 -8.648  4.972   1.00 19.19 ? 184  VAL A CA    1 
ATOM   1435 C C     . VAL A 1 201 ? -11.345 -9.374  4.861   1.00 20.40 ? 184  VAL A C     1 
ATOM   1436 O O     . VAL A 1 201 ? -10.290 -8.754  4.664   1.00 19.58 ? 184  VAL A O     1 
ATOM   1437 C CB    . VAL A 1 201 ? -13.507 -8.877  3.680   1.00 18.83 ? 184  VAL A CB    1 
ATOM   1438 C CG1   . VAL A 1 201 ? -14.886 -8.274  3.839   1.00 19.00 ? 184  VAL A CG1   1 
ATOM   1439 C CG2   . VAL A 1 201 ? -12.786 -8.270  2.432   1.00 16.84 ? 184  VAL A CG2   1 
ATOM   1440 N N     . CYS A 1 202 ? -11.402 -10.697 4.966   1.00 21.48 ? 185  CYS A N     1 
ATOM   1441 C CA    . CYS A 1 202 ? -10.276 -11.526 4.589   1.00 21.74 ? 185  CYS A CA    1 
ATOM   1442 C C     . CYS A 1 202 ? -10.809 -12.542 3.590   1.00 21.37 ? 185  CYS A C     1 
ATOM   1443 O O     . CYS A 1 202 ? -11.901 -13.077 3.785   1.00 21.31 ? 185  CYS A O     1 
ATOM   1444 C CB    . CYS A 1 202 ? -9.646  -12.234 5.785   1.00 22.56 ? 185  CYS A CB    1 
ATOM   1445 S SG    . CYS A 1 202 ? -8.021  -12.882 5.369   1.00 27.24 ? 185  CYS A SG    1 
ATOM   1446 N N     . ARG A 1 203 ? -10.039 -12.802 2.540   1.00 20.80 ? 186  ARG A N     1 
ATOM   1447 C CA    . ARG A 1 203 ? -10.460 -13.669 1.441   1.00 20.71 ? 186  ARG A CA    1 
ATOM   1448 C C     . ARG A 1 203 ? -9.521  -14.862 1.282   1.00 20.38 ? 186  ARG A C     1 
ATOM   1449 O O     . ARG A 1 203 ? -8.323  -14.735 1.514   1.00 21.23 ? 186  ARG A O     1 
ATOM   1450 C CB    . ARG A 1 203 ? -10.438 -12.893 0.118   1.00 20.37 ? 186  ARG A CB    1 
ATOM   1451 C CG    . ARG A 1 203 ? -11.192 -11.585 0.095   1.00 18.87 ? 186  ARG A CG    1 
ATOM   1452 C CD    . ARG A 1 203 ? -10.860 -10.831 -1.199  1.00 16.86 ? 186  ARG A CD    1 
ATOM   1453 N NE    . ARG A 1 203 ? -11.680 -9.649  -1.499  1.00 16.11 ? 186  ARG A NE    1 
ATOM   1454 C CZ    . ARG A 1 203 ? -11.406 -8.387  -1.157  1.00 14.98 ? 186  ARG A CZ    1 
ATOM   1455 N NH1   . ARG A 1 203 ? -10.368 -8.098  -0.392  1.00 17.96 ? 186  ARG A NH1   1 
ATOM   1456 N NH2   . ARG A 1 203 ? -12.210 -7.407  -1.548  1.00 13.08 ? 186  ARG A NH2   1 
ATOM   1457 N N     . ASP A 1 204 ? -10.045 -16.005 0.832   1.00 20.75 ? 187  ASP A N     1 
ATOM   1458 C CA    . ASP A 1 204 ? -9.178  -17.169 0.620   1.00 20.55 ? 187  ASP A CA    1 
ATOM   1459 C C     . ASP A 1 204 ? -8.327  -17.004 -0.653  1.00 20.14 ? 187  ASP A C     1 
ATOM   1460 O O     . ASP A 1 204 ? -8.591  -16.105 -1.460  1.00 18.89 ? 187  ASP A O     1 
ATOM   1461 C CB    . ASP A 1 204 ? -9.943  -18.528 0.731   1.00 21.00 ? 187  ASP A CB    1 
ATOM   1462 C CG    . ASP A 1 204 ? -10.773 -18.897 -0.500  1.00 22.83 ? 187  ASP A CG    1 
ATOM   1463 O OD1   . ASP A 1 204 ? -10.438 -18.530 -1.648  1.00 22.12 ? 187  ASP A OD1   1 
ATOM   1464 O OD2   . ASP A 1 204 ? -11.768 -19.650 -0.314  1.00 23.02 ? 187  ASP A OD2   1 
ATOM   1465 N N     . LEU A 1 205 ? -7.287  -17.829 -0.786  1.00 20.24 ? 188  LEU A N     1 
ATOM   1466 C CA    . LEU A 1 205 ? -6.361  -17.781 -1.924  1.00 21.23 ? 188  LEU A CA    1 
ATOM   1467 C C     . LEU A 1 205 ? -7.064  -17.860 -3.273  1.00 20.83 ? 188  LEU A C     1 
ATOM   1468 O O     . LEU A 1 205 ? -6.682  -17.164 -4.221  1.00 20.83 ? 188  LEU A O     1 
ATOM   1469 C CB    . LEU A 1 205 ? -5.350  -18.931 -1.845  1.00 21.43 ? 188  LEU A CB    1 
ATOM   1470 C CG    . LEU A 1 205 ? -4.174  -18.847 -0.872  1.00 24.46 ? 188  LEU A CG    1 
ATOM   1471 C CD1   . LEU A 1 205 ? -3.563  -20.233 -0.659  1.00 27.03 ? 188  LEU A CD1   1 
ATOM   1472 C CD2   . LEU A 1 205 ? -3.101  -17.869 -1.383  1.00 26.47 ? 188  LEU A CD2   1 
ATOM   1473 N N     . ASP A 1 206 ? -8.058  -18.741 -3.388  1.00 21.07 ? 189  ASP A N     1 
ATOM   1474 C CA    . ASP A 1 206 ? -8.750  -18.907 -4.663  1.00 20.90 ? 189  ASP A CA    1 
ATOM   1475 C C     . ASP A 1 206 ? -9.520  -17.635 -5.016  1.00 19.77 ? 189  ASP A C     1 
ATOM   1476 O O     . ASP A 1 206 ? -9.525  -17.217 -6.179  1.00 19.97 ? 189  ASP A O     1 
ATOM   1477 C CB    . ASP A 1 206 ? -9.676  -20.139 -4.652  1.00 21.96 ? 189  ASP A CB    1 
ATOM   1478 C CG    . ASP A 1 206 ? -8.909  -21.456 -4.569  1.00 24.85 ? 189  ASP A CG    1 
ATOM   1479 O OD1   . ASP A 1 206 ? -7.822  -21.580 -5.172  1.00 28.68 ? 189  ASP A OD1   1 
ATOM   1480 O OD2   . ASP A 1 206 ? -9.396  -22.380 -3.873  1.00 32.13 ? 189  ASP A OD2   1 
ATOM   1481 N N     . VAL A 1 207 ? -10.134 -17.009 -4.004  1.00 17.97 ? 190  VAL A N     1 
ATOM   1482 C CA    . VAL A 1 207 ? -10.893 -15.772 -4.186  1.00 17.01 ? 190  VAL A CA    1 
ATOM   1483 C C     . VAL A 1 207 ? -9.937  -14.671 -4.667  1.00 16.98 ? 190  VAL A C     1 
ATOM   1484 O O     . VAL A 1 207 ? -10.215 -13.971 -5.647  1.00 16.52 ? 190  VAL A O     1 
ATOM   1485 C CB    . VAL A 1 207 ? -11.639 -15.335 -2.889  1.00 16.87 ? 190  VAL A CB    1 
ATOM   1486 C CG1   . VAL A 1 207 ? -12.243 -13.944 -3.040  1.00 16.28 ? 190  VAL A CG1   1 
ATOM   1487 C CG2   . VAL A 1 207 ? -12.774 -16.355 -2.515  1.00 16.78 ? 190  VAL A CG2   1 
ATOM   1488 N N     . VAL A 1 208 ? -8.799  -14.535 -3.991  1.00 16.50 ? 191  VAL A N     1 
ATOM   1489 C CA    . VAL A 1 208 ? -7.819  -13.505 -4.387  1.00 17.15 ? 191  VAL A CA    1 
ATOM   1490 C C     . VAL A 1 208 ? -7.268  -13.745 -5.801  1.00 17.20 ? 191  VAL A C     1 
ATOM   1491 O O     . VAL A 1 208 ? -7.245  -12.834 -6.630  1.00 16.43 ? 191  VAL A O     1 
ATOM   1492 C CB    . VAL A 1 208 ? -6.684  -13.388 -3.354  1.00 17.06 ? 191  VAL A CB    1 
ATOM   1493 C CG1   . VAL A 1 208 ? -5.592  -12.409 -3.841  1.00 17.81 ? 191  VAL A CG1   1 
ATOM   1494 C CG2   . VAL A 1 208 ? -7.259  -12.988 -1.995  1.00 16.57 ? 191  VAL A CG2   1 
ATOM   1495 N N     . ARG A 1 209 ? -6.848  -14.975 -6.077  1.00 17.78 ? 192  ARG A N     1 
ATOM   1496 C CA    . ARG A 1 209 ? -6.388  -15.338 -7.413  1.00 18.27 ? 192  ARG A CA    1 
ATOM   1497 C C     . ARG A 1 209 ? -7.442  -15.032 -8.502  1.00 17.69 ? 192  ARG A C     1 
ATOM   1498 O O     . ARG A 1 209 ? -7.097  -14.585 -9.608  1.00 17.21 ? 192  ARG A O     1 
ATOM   1499 C CB    . ARG A 1 209 ? -5.937  -16.815 -7.438  1.00 19.16 ? 192  ARG A CB    1 
ATOM   1500 C CG    . ARG A 1 209 ? -4.538  -17.034 -6.846  1.00 20.36 ? 192  ARG A CG    1 
ATOM   1501 C CD    . ARG A 1 209 ? -3.953  -18.459 -7.046  1.00 22.35 ? 192  ARG A CD    1 
ATOM   1502 N NE    . ARG A 1 209 ? -3.823  -19.174 -5.777  1.00 30.52 ? 192  ARG A NE    1 
ATOM   1503 C CZ    . ARG A 1 209 ? -2.947  -20.145 -5.527  1.00 32.21 ? 192  ARG A CZ    1 
ATOM   1504 N NH1   . ARG A 1 209 ? -2.087  -20.543 -6.452  1.00 35.76 ? 192  ARG A NH1   1 
ATOM   1505 N NH2   . ARG A 1 209 ? -2.916  -20.712 -4.333  1.00 33.43 ? 192  ARG A NH2   1 
ATOM   1506 N N     . ARG A 1 210 ? -8.716  -15.261 -8.192  1.00 16.60 ? 193  ARG A N     1 
ATOM   1507 C CA    . ARG A 1 210 ? -9.779  -14.966 -9.162  1.00 17.46 ? 193  ARG A CA    1 
ATOM   1508 C C     . ARG A 1 210 ? -9.926  -13.465 -9.434  1.00 17.15 ? 193  ARG A C     1 
ATOM   1509 O O     . ARG A 1 210 ? -10.108 -13.048 -10.585 1.00 17.12 ? 193  ARG A O     1 
ATOM   1510 C CB    . ARG A 1 210 ? -11.117 -15.548 -8.703  1.00 18.02 ? 193  ARG A CB    1 
ATOM   1511 C CG    . ARG A 1 210 ? -12.223 -15.412 -9.755  1.00 21.26 ? 193  ARG A CG    1 
ATOM   1512 C CD    . ARG A 1 210 ? -13.563 -15.886 -9.183  1.00 27.81 ? 193  ARG A CD    1 
ATOM   1513 N NE    . ARG A 1 210 ? -14.161 -14.913 -8.266  1.00 32.47 ? 193  ARG A NE    1 
ATOM   1514 C CZ    . ARG A 1 210 ? -14.298 -15.105 -6.957  1.00 35.52 ? 193  ARG A CZ    1 
ATOM   1515 N NH1   . ARG A 1 210 ? -13.889 -16.240 -6.386  1.00 35.79 ? 193  ARG A NH1   1 
ATOM   1516 N NH2   . ARG A 1 210 ? -14.859 -14.162 -6.213  1.00 38.10 ? 193  ARG A NH2   1 
ATOM   1517 N N     . ILE A 1 211 ? -9.862  -12.658 -8.373  1.00 16.30 ? 194  ILE A N     1 
ATOM   1518 C CA    . ILE A 1 211 ? -9.957  -11.208 -8.505  1.00 16.27 ? 194  ILE A CA    1 
ATOM   1519 C C     . ILE A 1 211 ? -8.784  -10.686 -9.360  1.00 15.69 ? 194  ILE A C     1 
ATOM   1520 O O     . ILE A 1 211 ? -8.999  -9.941  -10.301 1.00 15.88 ? 194  ILE A O     1 
ATOM   1521 C CB    . ILE A 1 211 ? -10.025 -10.507 -7.120  1.00 16.23 ? 194  ILE A CB    1 
ATOM   1522 C CG1   . ILE A 1 211 ? -11.307 -10.930 -6.385  1.00 15.98 ? 194  ILE A CG1   1 
ATOM   1523 C CG2   . ILE A 1 211 ? -9.930  -8.972  -7.278  1.00 16.29 ? 194  ILE A CG2   1 
ATOM   1524 C CD1   . ILE A 1 211 ? -11.401 -10.417 -4.928  1.00 17.04 ? 194  ILE A CD1   1 
ATOM   1525 N N     . ILE A 1 212 ? -7.565  -11.136 -9.055  1.00 16.00 ? 195  ILE A N     1 
ATOM   1526 C CA    . ILE A 1 212 ? -6.374  -10.796 -9.854  1.00 17.05 ? 195  ILE A CA    1 
ATOM   1527 C C     . ILE A 1 212 ? -6.567  -11.177 -11.326 1.00 17.51 ? 195  ILE A C     1 
ATOM   1528 O O     . ILE A 1 212 ? -6.321  -10.382 -12.218 1.00 18.10 ? 195  ILE A O     1 
ATOM   1529 C CB    . ILE A 1 212 ? -5.090  -11.483 -9.312  1.00 16.03 ? 195  ILE A CB    1 
ATOM   1530 C CG1   . ILE A 1 212 ? -4.710  -10.912 -7.937  1.00 16.55 ? 195  ILE A CG1   1 
ATOM   1531 C CG2   . ILE A 1 212 ? -3.924  -11.345 -10.329 1.00 17.34 ? 195  ILE A CG2   1 
ATOM   1532 C CD1   . ILE A 1 212 ? -3.710  -11.734 -7.148  1.00 17.65 ? 195  ILE A CD1   1 
ATOM   1533 N N     . CYS A 1 213 ? -7.033  -12.394 -11.560 1.00 18.49 ? 196  CYS A N     1 
ATOM   1534 C CA    . CYS A 1 213 ? -7.220  -12.892 -12.936 1.00 19.70 ? 196  CYS A CA    1 
ATOM   1535 C C     . CYS A 1 213 ? -8.265  -12.026 -13.655 1.00 20.25 ? 196  CYS A C     1 
ATOM   1536 O O     . CYS A 1 213 ? -8.050  -11.559 -14.796 1.00 19.94 ? 196  CYS A O     1 
ATOM   1537 C CB    . CYS A 1 213 ? -7.582  -14.392 -12.886 1.00 20.08 ? 196  CYS A CB    1 
ATOM   1538 S SG    . CYS A 1 213 ? -7.848  -15.184 -14.501 1.00 20.51 ? 196  CYS A SG    1 
ATOM   1539 N N     . SER A 1 214 ? -9.364  -11.734 -12.951 1.00 20.48 ? 197  SER A N     1 
ATOM   1540 C CA    . SER A 1 214 ? -10.441 -10.933 -13.514 1.00 21.44 ? 197  SER A CA    1 
ATOM   1541 C C     . SER A 1 214 ? -10.045 -9.472  -13.785 1.00 21.17 ? 197  SER A C     1 
ATOM   1542 O O     . SER A 1 214 ? -10.662 -8.810  -14.607 1.00 22.32 ? 197  SER A O     1 
ATOM   1543 C CB    . SER A 1 214 ? -11.709 -11.043 -12.667 1.00 21.61 ? 197  SER A CB    1 
ATOM   1544 O OG    . SER A 1 214 ? -12.311 -12.318 -12.853 1.00 24.44 ? 197  SER A OG    1 
ATOM   1545 N N     . ALA A 1 215 ? -8.994  -9.003  -13.123 1.00 21.53 ? 198  ALA A N     1 
ATOM   1546 C CA    . ALA A 1 215 ? -8.394  -7.692  -13.379 1.00 22.57 ? 198  ALA A CA    1 
ATOM   1547 C C     . ALA A 1 215 ? -7.457  -7.682  -14.595 1.00 23.07 ? 198  ALA A C     1 
ATOM   1548 O O     . ALA A 1 215 ? -6.946  -6.629  -14.983 1.00 24.28 ? 198  ALA A O     1 
ATOM   1549 C CB    . ALA A 1 215 ? -7.654  -7.199  -12.141 1.00 22.09 ? 198  ALA A CB    1 
ATOM   1550 N N     . GLY A 1 216 ? -7.244  -8.852  -15.194 1.00 23.24 ? 199  GLY A N     1 
ATOM   1551 C CA    . GLY A 1 216 ? -6.428  -8.980  -16.404 1.00 23.30 ? 199  GLY A CA    1 
ATOM   1552 C C     . GLY A 1 216 ? -4.945  -8.855  -16.129 1.00 23.71 ? 199  GLY A C     1 
ATOM   1553 O O     . GLY A 1 216 ? -4.168  -8.506  -17.032 1.00 24.43 ? 199  GLY A O     1 
ATOM   1554 N N     . LEU A 1 217 ? -4.554  -9.143  -14.885 1.00 22.84 ? 200  LEU A N     1 
ATOM   1555 C CA    . LEU A 1 217 ? -3.154  -9.137  -14.464 1.00 23.21 ? 200  LEU A CA    1 
ATOM   1556 C C     . LEU A 1 217 ? -2.530  -10.531 -14.503 1.00 23.10 ? 200  LEU A C     1 
ATOM   1557 O O     . LEU A 1 217 ? -3.188  -11.532 -14.198 1.00 23.13 ? 200  LEU A O     1 
ATOM   1558 C CB    . LEU A 1 217 ? -3.013  -8.573  -13.028 1.00 23.17 ? 200  LEU A CB    1 
ATOM   1559 C CG    . LEU A 1 217 ? -3.112  -7.068  -12.785 1.00 24.07 ? 200  LEU A CG    1 
ATOM   1560 C CD1   . LEU A 1 217 ? -3.349  -6.785  -11.325 1.00 23.38 ? 200  LEU A CD1   1 
ATOM   1561 C CD2   . LEU A 1 217 ? -1.825  -6.377  -13.243 1.00 25.99 ? 200  LEU A CD2   1 
ATOM   1562 N N     . SER A 1 218 ? -1.252  -10.579 -14.880 1.00 22.62 ? 201  SER A N     1 
ATOM   1563 C CA    . SER A 1 218 ? -0.457  -11.802 -14.871 1.00 21.91 ? 201  SER A CA    1 
ATOM   1564 C C     . SER A 1 218 ? 0.161   -12.007 -13.503 1.00 22.17 ? 201  SER A C     1 
ATOM   1565 O O     . SER A 1 218 ? 0.654   -11.062 -12.889 1.00 21.47 ? 201  SER A O     1 
ATOM   1566 C CB    . SER A 1 218 ? 0.663   -11.739 -15.923 1.00 22.03 ? 201  SER A CB    1 
ATOM   1567 O OG    . SER A 1 218 ? 0.138   -11.857 -17.243 1.00 24.23 ? 201  SER A OG    1 
ATOM   1568 N N     . LEU A 1 219 ? 0.161   -13.247 -13.042 1.00 21.97 ? 202  LEU A N     1 
ATOM   1569 C CA    . LEU A 1 219 ? 0.768   -13.594 -11.772 1.00 22.78 ? 202  LEU A CA    1 
ATOM   1570 C C     . LEU A 1 219 ? 2.200   -14.055 -12.015 1.00 23.22 ? 202  LEU A C     1 
ATOM   1571 O O     . LEU A 1 219 ? 2.433   -15.162 -12.518 1.00 23.55 ? 202  LEU A O     1 
ATOM   1572 C CB    . LEU A 1 219 ? -0.043  -14.697 -11.090 1.00 22.63 ? 202  LEU A CB    1 
ATOM   1573 C CG    . LEU A 1 219 ? 0.464   -15.280 -9.767  1.00 22.46 ? 202  LEU A CG    1 
ATOM   1574 C CD1   . LEU A 1 219 ? 0.428   -14.245 -8.625  1.00 21.13 ? 202  LEU A CD1   1 
ATOM   1575 C CD2   . LEU A 1 219 ? -0.359  -16.517 -9.443  1.00 22.67 ? 202  LEU A CD2   1 
ATOM   1576 N N     . LEU A 1 220 ? 3.148   -13.191 -11.667 1.00 23.31 ? 203  LEU A N     1 
ATOM   1577 C CA    . LEU A 1 220 ? 4.563   -13.403 -11.974 1.00 24.19 ? 203  LEU A CA    1 
ATOM   1578 C C     . LEU A 1 220 ? 5.269   -14.211 -10.913 1.00 24.63 ? 203  LEU A C     1 
ATOM   1579 O O     . LEU A 1 220 ? 6.215   -14.942 -11.217 1.00 24.87 ? 203  LEU A O     1 
ATOM   1580 C CB    . LEU A 1 220 ? 5.281   -12.063 -12.158 1.00 24.54 ? 203  LEU A CB    1 
ATOM   1581 C CG    . LEU A 1 220 ? 4.554   -10.970 -12.944 1.00 24.68 ? 203  LEU A CG    1 
ATOM   1582 C CD1   . LEU A 1 220 ? 5.258   -9.649  -12.739 1.00 24.71 ? 203  LEU A CD1   1 
ATOM   1583 C CD2   . LEU A 1 220 ? 4.437   -11.325 -14.446 1.00 24.72 ? 203  LEU A CD2   1 
ATOM   1584 N N     . ALA A 1 221 ? 4.832   -14.056 -9.660  1.00 24.56 ? 204  ALA A N     1 
ATOM   1585 C CA    . ALA A 1 221 ? 5.310   -14.876 -8.558  1.00 25.04 ? 204  ALA A CA    1 
ATOM   1586 C C     . ALA A 1 221 ? 4.262   -14.944 -7.453  1.00 25.55 ? 204  ALA A C     1 
ATOM   1587 O O     . ALA A 1 221 ? 3.458   -14.013 -7.279  1.00 24.93 ? 204  ALA A O     1 
ATOM   1588 C CB    . ALA A 1 221 ? 6.652   -14.364 -8.007  1.00 24.59 ? 204  ALA A CB    1 
ATOM   1589 N N     . GLU A 1 222 ? 4.255   -16.075 -6.760  1.00 26.06 ? 205  GLU A N     1 
ATOM   1590 C CA    . GLU A 1 222 ? 3.402   -16.300 -5.610  1.00 27.87 ? 205  GLU A CA    1 
ATOM   1591 C C     . GLU A 1 222 ? 4.246   -16.982 -4.539  1.00 28.23 ? 205  GLU A C     1 
ATOM   1592 O O     . GLU A 1 222 ? 4.945   -17.952 -4.833  1.00 28.38 ? 205  GLU A O     1 
ATOM   1593 C CB    . GLU A 1 222 ? 2.205   -17.172 -5.994  1.00 27.65 ? 205  GLU A CB    1 
ATOM   1594 C CG    . GLU A 1 222 ? 1.288   -17.495 -4.826  1.00 29.68 ? 205  GLU A CG    1 
ATOM   1595 C CD    . GLU A 1 222 ? 0.111   -18.373 -5.219  1.00 30.09 ? 205  GLU A CD    1 
ATOM   1596 O OE1   . GLU A 1 222 ? -0.707  -17.922 -6.044  1.00 31.24 ? 205  GLU A OE1   1 
ATOM   1597 O OE2   . GLU A 1 222 ? 0.003   -19.505 -4.676  1.00 33.46 ? 205  GLU A OE2   1 
ATOM   1598 N N     . GLU A 1 223 ? 4.191   -16.471 -3.311  1.00 28.13 ? 206  GLU A N     1 
ATOM   1599 C CA    . GLU A 1 223 ? 5.025   -16.983 -2.225  1.00 28.35 ? 206  GLU A CA    1 
ATOM   1600 C C     . GLU A 1 223 ? 4.364   -16.865 -0.865  1.00 29.13 ? 206  GLU A C     1 
ATOM   1601 O O     . GLU A 1 223 ? 3.963   -15.778 -0.443  1.00 27.28 ? 206  GLU A O     1 
ATOM   1602 C CB    . GLU A 1 223 ? 6.367   -16.255 -2.209  1.00 28.18 ? 206  GLU A CB    1 
ATOM   1603 C CG    . GLU A 1 223 ? 7.388   -16.829 -1.265  1.00 29.96 ? 206  GLU A CG    1 
ATOM   1604 C CD    . GLU A 1 223 ? 8.693   -16.078 -1.356  1.00 30.76 ? 206  GLU A CD    1 
ATOM   1605 O OE1   . GLU A 1 223 ? 9.431   -16.277 -2.348  1.00 33.13 ? 206  GLU A OE1   1 
ATOM   1606 O OE2   . GLU A 1 223 ? 8.965   -15.273 -0.445  1.00 30.39 ? 206  GLU A OE2   1 
ATOM   1607 N N     . ARG A 1 224 ? 4.275   -17.994 -0.170  1.00 30.09 ? 207  ARG A N     1 
ATOM   1608 C CA    . ARG A 1 224 ? 3.781   -18.012 1.199   1.00 31.49 ? 207  ARG A CA    1 
ATOM   1609 C C     . ARG A 1 224 ? 4.863   -17.549 2.171   1.00 32.75 ? 207  ARG A C     1 
ATOM   1610 O O     . ARG A 1 224 ? 6.009   -18.004 2.092   1.00 33.06 ? 207  ARG A O     1 
ATOM   1611 C CB    . ARG A 1 224 ? 3.301   -19.414 1.582   1.00 32.04 ? 207  ARG A CB    1 
ATOM   1612 C CG    . ARG A 1 224 ? 2.500   -19.431 2.877   1.00 33.00 ? 207  ARG A CG    1 
ATOM   1613 C CD    . ARG A 1 224 ? 2.461   -20.812 3.516   1.00 35.85 ? 207  ARG A CD    1 
ATOM   1614 N NE    . ARG A 1 224 ? 1.950   -20.715 4.884   1.00 37.01 ? 207  ARG A NE    1 
ATOM   1615 C CZ    . ARG A 1 224 ? 1.990   -21.704 5.772   1.00 38.44 ? 207  ARG A CZ    1 
ATOM   1616 N NH2   . ARG A 1 224 ? 1.498   -21.503 6.986   1.00 39.34 ? 207  ARG A NH2   1 
ATOM   1617 N N     . GLN A 1 225 ? 4.486   -16.647 3.078   1.00 33.98 ? 208  GLN A N     1 
ATOM   1618 C CA    . GLN A 1 225 ? 5.383   -16.106 4.107   1.00 35.76 ? 208  GLN A CA    1 
ATOM   1619 C C     . GLN A 1 225 ? 5.554   -17.106 5.245   1.00 37.51 ? 208  GLN A C     1 
ATOM   1620 O O     . GLN A 1 225 ? 4.573   -17.564 5.840   1.00 37.27 ? 208  GLN A O     1 
ATOM   1621 C CB    . GLN A 1 225 ? 4.834   -14.785 4.658   1.00 35.38 ? 208  GLN A CB    1 
ATOM   1622 C CG    . GLN A 1 225 ? 5.510   -14.273 5.943   1.00 34.67 ? 208  GLN A CG    1 
ATOM   1623 C CD    . GLN A 1 225 ? 6.798   -13.525 5.671   1.00 32.97 ? 208  GLN A CD    1 
ATOM   1624 O OE1   . GLN A 1 225 ? 6.849   -12.679 4.785   1.00 31.20 ? 208  GLN A OE1   1 
ATOM   1625 N NE2   . GLN A 1 225 ? 7.847   -13.829 6.437   1.00 31.91 ? 208  GLN A NE2   1 
ATOM   1626 N N     . GLU A 1 226 ? 6.806   -17.430 5.551   1.00 39.48 ? 209  GLU A N     1 
ATOM   1627 C CA    . GLU A 1 226 ? 7.102   -18.382 6.615   1.00 41.78 ? 209  GLU A CA    1 
ATOM   1628 C C     . GLU A 1 226 ? 7.636   -17.678 7.869   1.00 42.40 ? 209  GLU A C     1 
ATOM   1629 O O     . GLU A 1 226 ? 7.843   -16.449 7.862   1.00 43.18 ? 209  GLU A O     1 
ATOM   1630 C CB    . GLU A 1 226 ? 8.060   -19.459 6.095   1.00 41.67 ? 209  GLU A CB    1 
ATOM   1631 C CG    . GLU A 1 226 ? 7.535   -20.157 4.833   1.00 42.81 ? 209  GLU A CG    1 
ATOM   1632 C CD    . GLU A 1 226 ? 8.229   -21.471 4.512   1.00 43.45 ? 209  GLU A CD    1 
ATOM   1633 O OE1   . GLU A 1 226 ? 8.642   -21.649 3.342   1.00 46.00 ? 209  GLU A OE1   1 
ATOM   1634 O OE2   . GLU A 1 226 ? 8.345   -22.338 5.414   1.00 46.24 ? 209  GLU A OE2   1 
ATOM   1635 N N     . ASN A 1 227 ? 7.831   -18.449 8.942   1.00 43.21 ? 210  ASN A N     1 
ATOM   1636 C CA    . ASN A 1 227 ? 8.364   -17.947 10.228  1.00 43.78 ? 210  ASN A CA    1 
ATOM   1637 C C     . ASN A 1 227 ? 7.403   -17.006 10.954  1.00 43.93 ? 210  ASN A C     1 
ATOM   1638 O O     . ASN A 1 227 ? 7.823   -16.013 11.542  1.00 43.74 ? 210  ASN A O     1 
ATOM   1639 C CB    . ASN A 1 227 ? 9.733   -17.266 10.050  1.00 44.00 ? 210  ASN A CB    1 
ATOM   1640 C CG    . ASN A 1 227 ? 10.765  -18.166 9.379   1.00 44.76 ? 210  ASN A CG    1 
ATOM   1641 O OD1   . ASN A 1 227 ? 10.460  -18.894 8.437   1.00 45.90 ? 210  ASN A OD1   1 
ATOM   1642 N ND2   . ASN A 1 227 ? 12.002  -18.102 9.859   1.00 45.80 ? 210  ASN A ND2   1 
ATOM   1643 N N     . LEU A 1 228 ? 6.119   -17.351 10.933  1.00 44.21 ? 211  LEU A N     1 
ATOM   1644 C CA    . LEU A 1 228 ? 5.054   -16.463 11.386  1.00 44.73 ? 211  LEU A CA    1 
ATOM   1645 C C     . LEU A 1 228 ? 4.264   -17.079 12.557  1.00 45.03 ? 211  LEU A C     1 
ATOM   1646 O O     . LEU A 1 228 ? 4.136   -18.308 12.631  1.00 44.91 ? 211  LEU A O     1 
ATOM   1647 C CB    . LEU A 1 228 ? 4.121   -16.212 10.205  1.00 44.68 ? 211  LEU A CB    1 
ATOM   1648 C CG    . LEU A 1 228 ? 3.562   -14.839 9.842   1.00 44.58 ? 211  LEU A CG    1 
ATOM   1649 C CD1   . LEU A 1 228 ? 4.630   -13.756 9.778   1.00 44.40 ? 211  LEU A CD1   1 
ATOM   1650 C CD2   . LEU A 1 228 ? 2.875   -14.960 8.505   1.00 44.62 ? 211  LEU A CD2   1 
ATOM   1651 N N     . PRO A 1 229 ? 3.734   -16.233 13.474  1.00 45.32 ? 212  PRO A N     1 
ATOM   1652 C CA    . PRO A 1 229 ? 2.811   -16.714 14.520  1.00 45.73 ? 212  PRO A CA    1 
ATOM   1653 C C     . PRO A 1 229 ? 1.662   -17.555 13.950  1.00 45.97 ? 212  PRO A C     1 
ATOM   1654 O O     . PRO A 1 229 ? 1.146   -17.239 12.874  1.00 46.12 ? 212  PRO A O     1 
ATOM   1655 C CB    . PRO A 1 229 ? 2.256   -15.415 15.119  1.00 45.68 ? 212  PRO A CB    1 
ATOM   1656 C CG    . PRO A 1 229 ? 3.327   -14.420 14.902  1.00 45.60 ? 212  PRO A CG    1 
ATOM   1657 C CD    . PRO A 1 229 ? 3.983   -14.783 13.597  1.00 45.48 ? 212  PRO A CD    1 
ATOM   1658 N N     . ASP A 1 230 ? 1.265   -18.601 14.673  1.00 46.12 ? 213  ASP A N     1 
ATOM   1659 C CA    . ASP A 1 230 ? 0.273   -19.561 14.175  1.00 46.49 ? 213  ASP A CA    1 
ATOM   1660 C C     . ASP A 1 230 ? -1.181  -19.093 14.283  1.00 46.36 ? 213  ASP A C     1 
ATOM   1661 O O     . ASP A 1 230 ? -2.030  -19.516 13.490  1.00 46.45 ? 213  ASP A O     1 
ATOM   1662 C CB    . ASP A 1 230 ? 0.434   -20.919 14.879  1.00 46.89 ? 213  ASP A CB    1 
ATOM   1663 C CG    . ASP A 1 230 ? 1.549   -21.768 14.282  1.00 48.34 ? 213  ASP A CG    1 
ATOM   1664 O OD1   . ASP A 1 230 ? 2.262   -21.290 13.366  1.00 50.32 ? 213  ASP A OD1   1 
ATOM   1665 O OD2   . ASP A 1 230 ? 1.709   -22.927 14.730  1.00 49.71 ? 213  ASP A OD2   1 
ATOM   1666 N N     . GLU A 1 231 ? -1.464  -18.225 15.255  1.00 45.97 ? 214  GLU A N     1 
ATOM   1667 C CA    . GLU A 1 231 ? -2.845  -17.814 15.545  1.00 45.61 ? 214  GLU A CA    1 
ATOM   1668 C C     . GLU A 1 231 ? -3.361  -16.699 14.626  1.00 44.79 ? 214  GLU A C     1 
ATOM   1669 O O     . GLU A 1 231 ? -4.532  -16.330 14.695  1.00 44.84 ? 214  GLU A O     1 
ATOM   1670 C CB    . GLU A 1 231 ? -3.014  -17.429 17.025  1.00 46.02 ? 214  GLU A CB    1 
ATOM   1671 C CG    . GLU A 1 231 ? -2.891  -18.600 18.006  1.00 47.91 ? 214  GLU A CG    1 
ATOM   1672 C CD    . GLU A 1 231 ? -1.586  -18.592 18.807  1.00 50.20 ? 214  GLU A CD    1 
ATOM   1673 O OE1   . GLU A 1 231 ? -1.463  -17.757 19.735  1.00 50.97 ? 214  GLU A OE1   1 
ATOM   1674 O OE2   . GLU A 1 231 ? -0.697  -19.435 18.530  1.00 50.40 ? 214  GLU A OE2   1 
ATOM   1675 N N     . ILE A 1 232 ? -2.482  -16.185 13.765  1.00 43.86 ? 215  ILE A N     1 
ATOM   1676 C CA    . ILE A 1 232 ? -2.817  -15.152 12.784  1.00 42.61 ? 215  ILE A CA    1 
ATOM   1677 C C     . ILE A 1 232 ? -3.002  -15.778 11.388  1.00 41.56 ? 215  ILE A C     1 
ATOM   1678 O O     . ILE A 1 232 ? -2.477  -16.864 11.117  1.00 41.08 ? 215  ILE A O     1 
ATOM   1679 C CB    . ILE A 1 232 ? -1.719  -14.034 12.771  1.00 43.00 ? 215  ILE A CB    1 
ATOM   1680 C CG1   . ILE A 1 232 ? -2.297  -12.675 12.354  1.00 43.94 ? 215  ILE A CG1   1 
ATOM   1681 C CG2   . ILE A 1 232 ? -0.498  -14.438 11.917  1.00 43.03 ? 215  ILE A CG2   1 
ATOM   1682 C CD1   . ILE A 1 232 ? -2.790  -11.807 13.517  1.00 45.56 ? 215  ILE A CD1   1 
ATOM   1683 N N     . TYR A 1 233 ? -3.751  -15.101 10.512  1.00 40.02 ? 216  TYR A N     1 
ATOM   1684 C CA    . TYR A 1 233 ? -3.931  -15.554 9.120   1.00 38.39 ? 216  TYR A CA    1 
ATOM   1685 C C     . TYR A 1 233 ? -2.600  -15.826 8.418   1.00 37.06 ? 216  TYR A C     1 
ATOM   1686 O O     . TYR A 1 233 ? -1.608  -15.161 8.697   1.00 36.80 ? 216  TYR A O     1 
ATOM   1687 C CB    . TYR A 1 233 ? -4.674  -14.498 8.299   1.00 38.98 ? 216  TYR A CB    1 
ATOM   1688 C CG    . TYR A 1 233 ? -6.125  -14.254 8.648   1.00 39.80 ? 216  TYR A CG    1 
ATOM   1689 C CD1   . TYR A 1 233 ? -6.543  -13.002 9.114   1.00 40.41 ? 216  TYR A CD1   1 
ATOM   1690 C CD2   . TYR A 1 233 ? -7.090  -15.248 8.468   1.00 39.95 ? 216  TYR A CD2   1 
ATOM   1691 C CE1   . TYR A 1 233 ? -7.877  -12.755 9.420   1.00 41.29 ? 216  TYR A CE1   1 
ATOM   1692 C CE2   . TYR A 1 233 ? -8.430  -15.009 8.770   1.00 40.77 ? 216  TYR A CE2   1 
ATOM   1693 C CZ    . TYR A 1 233 ? -8.814  -13.762 9.245   1.00 40.60 ? 216  TYR A CZ    1 
ATOM   1694 O OH    . TYR A 1 233 ? -10.135 -13.512 9.553   1.00 41.38 ? 216  TYR A OH    1 
ATOM   1695 N N     . HIS A 1 234 ? -2.598  -16.809 7.512   1.00 35.29 ? 217  HIS A N     1 
ATOM   1696 C CA    . HIS A 1 234 ? -1.492  -17.058 6.577   1.00 33.74 ? 217  HIS A CA    1 
ATOM   1697 C C     . HIS A 1 234 ? -1.271  -15.833 5.697   1.00 31.88 ? 217  HIS A C     1 
ATOM   1698 O O     . HIS A 1 234 ? -2.210  -15.074 5.453   1.00 31.51 ? 217  HIS A O     1 
ATOM   1699 C CB    . HIS A 1 234 ? -1.816  -18.243 5.672   1.00 33.74 ? 217  HIS A CB    1 
ATOM   1700 C CG    . HIS A 1 234 ? -1.894  -19.561 6.383   1.00 36.24 ? 217  HIS A CG    1 
ATOM   1701 N ND1   . HIS A 1 234 ? -1.822  -20.763 5.715   1.00 37.14 ? 217  HIS A ND1   1 
ATOM   1702 C CD2   . HIS A 1 234 ? -2.024  -19.867 7.696   1.00 37.45 ? 217  HIS A CD2   1 
ATOM   1703 C CE1   . HIS A 1 234 ? -1.915  -21.755 6.583   1.00 38.53 ? 217  HIS A CE1   1 
ATOM   1704 N NE2   . HIS A 1 234 ? -2.036  -21.238 7.792   1.00 39.51 ? 217  HIS A NE2   1 
ATOM   1705 N N     . VAL A 1 235 ? -0.037  -15.656 5.223   1.00 29.70 ? 218  VAL A N     1 
ATOM   1706 C CA    . VAL A 1 235 ? 0.356   -14.469 4.444   1.00 27.74 ? 218  VAL A CA    1 
ATOM   1707 C C     . VAL A 1 235 ? 0.939   -14.914 3.110   1.00 25.85 ? 218  VAL A C     1 
ATOM   1708 O O     . VAL A 1 235 ? 1.846   -15.762 3.059   1.00 25.38 ? 218  VAL A O     1 
ATOM   1709 C CB    . VAL A 1 235 ? 1.419   -13.593 5.197   1.00 28.44 ? 218  VAL A CB    1 
ATOM   1710 C CG1   . VAL A 1 235 ? 1.853   -12.373 4.361   1.00 28.26 ? 218  VAL A CG1   1 
ATOM   1711 C CG2   . VAL A 1 235 ? 0.908   -13.161 6.563   1.00 28.14 ? 218  VAL A CG2   1 
ATOM   1712 N N     . TYR A 1 236 ? 0.408   -14.358 2.026   1.00 23.65 ? 219  TYR A N     1 
ATOM   1713 C CA    . TYR A 1 236 ? 0.947   -14.626 0.694   1.00 22.65 ? 219  TYR A CA    1 
ATOM   1714 C C     . TYR A 1 236 ? 1.371   -13.328 0.035   1.00 21.16 ? 219  TYR A C     1 
ATOM   1715 O O     . TYR A 1 236 ? 0.712   -12.295 0.219   1.00 20.56 ? 219  TYR A O     1 
ATOM   1716 C CB    . TYR A 1 236 ? -0.076  -15.333 -0.188  1.00 23.64 ? 219  TYR A CB    1 
ATOM   1717 C CG    . TYR A 1 236 ? -0.163  -16.820 0.086   1.00 25.45 ? 219  TYR A CG    1 
ATOM   1718 C CD1   . TYR A 1 236 ? -0.777  -17.286 1.250   1.00 26.54 ? 219  TYR A CD1   1 
ATOM   1719 C CD2   . TYR A 1 236 ? 0.376   -17.757 -0.807  1.00 27.73 ? 219  TYR A CD2   1 
ATOM   1720 C CE1   . TYR A 1 236 ? -0.865  -18.632 1.529   1.00 28.20 ? 219  TYR A CE1   1 
ATOM   1721 C CE2   . TYR A 1 236 ? 0.282   -19.146 -0.535  1.00 27.52 ? 219  TYR A CE2   1 
ATOM   1722 C CZ    . TYR A 1 236 ? -0.338  -19.554 0.648   1.00 27.67 ? 219  TYR A CZ    1 
ATOM   1723 O OH    . TYR A 1 236 ? -0.458  -20.885 0.988   1.00 29.49 ? 219  TYR A OH    1 
ATOM   1724 N N     . SER A 1 237 ? 2.476   -13.395 -0.711  1.00 19.69 ? 220  SER A N     1 
ATOM   1725 C CA    . SER A 1 237 ? 2.888   -12.335 -1.652  1.00 18.63 ? 220  SER A CA    1 
ATOM   1726 C C     . SER A 1 237 ? 2.609   -12.745 -3.105  1.00 19.04 ? 220  SER A C     1 
ATOM   1727 O O     . SER A 1 237 ? 2.869   -13.890 -3.477  1.00 17.21 ? 220  SER A O     1 
ATOM   1728 C CB    . SER A 1 237 ? 4.382   -12.039 -1.519  1.00 19.37 ? 220  SER A CB    1 
ATOM   1729 O OG    . SER A 1 237 ? 4.722   -11.724 -0.175  1.00 18.17 ? 220  SER A OG    1 
ATOM   1730 N N     . PHE A 1 238 ? 2.092   -11.800 -3.891  1.00 17.84 ? 221  PHE A N     1 
ATOM   1731 C CA    . PHE A 1 238 ? 1.804   -11.981 -5.319  1.00 19.28 ? 221  PHE A CA    1 
ATOM   1732 C C     . PHE A 1 238 ? 2.420   -10.811 -6.088  1.00 19.05 ? 221  PHE A C     1 
ATOM   1733 O O     . PHE A 1 238 ? 2.083   -9.663  -5.831  1.00 19.01 ? 221  PHE A O     1 
ATOM   1734 C CB    . PHE A 1 238 ? 0.296   -11.952 -5.604  1.00 19.31 ? 221  PHE A CB    1 
ATOM   1735 C CG    . PHE A 1 238 ? -0.532  -12.826 -4.694  1.00 19.21 ? 221  PHE A CG    1 
ATOM   1736 C CD1   . PHE A 1 238 ? -0.971  -12.357 -3.471  1.00 20.10 ? 221  PHE A CD1   1 
ATOM   1737 C CD2   . PHE A 1 238 ? -0.926  -14.102 -5.100  1.00 19.52 ? 221  PHE A CD2   1 
ATOM   1738 C CE1   . PHE A 1 238 ? -1.765  -13.168 -2.628  1.00 19.32 ? 221  PHE A CE1   1 
ATOM   1739 C CE2   . PHE A 1 238 ? -1.718  -14.911 -4.276  1.00 18.99 ? 221  PHE A CE2   1 
ATOM   1740 C CZ    . PHE A 1 238 ? -2.150  -14.428 -3.045  1.00 19.74 ? 221  PHE A CZ    1 
ATOM   1741 N N     . ALA A 1 239 ? 3.319   -11.108 -7.020  1.00 19.59 ? 222  ALA A N     1 
ATOM   1742 C CA    . ALA A 1 239 ? 3.839   -10.092 -7.932  1.00 19.40 ? 222  ALA A CA    1 
ATOM   1743 C C     . ALA A 1 239 ? 3.087   -10.160 -9.245  1.00 19.78 ? 222  ALA A C     1 
ATOM   1744 O O     . ALA A 1 239 ? 2.883   -11.250 -9.800  1.00 19.93 ? 222  ALA A O     1 
ATOM   1745 C CB    . ALA A 1 239 ? 5.317   -10.267 -8.150  1.00 19.76 ? 222  ALA A CB    1 
ATOM   1746 N N     . LEU A 1 240 ? 2.674   -8.990  -9.721  1.00 19.93 ? 223  LEU A N     1 
ATOM   1747 C CA    . LEU A 1 240 ? 1.735   -8.888  -10.840 1.00 20.37 ? 223  LEU A CA    1 
ATOM   1748 C C     . LEU A 1 240 ? 2.117   -7.822  -11.832 1.00 21.09 ? 223  LEU A C     1 
ATOM   1749 O O     . LEU A 1 240 ? 2.792   -6.855  -11.472 1.00 20.36 ? 223  LEU A O     1 
ATOM   1750 C CB    . LEU A 1 240 ? 0.342   -8.554  -10.330 1.00 20.11 ? 223  LEU A CB    1 
ATOM   1751 C CG    . LEU A 1 240 ? -0.149  -9.245  -9.061  1.00 19.11 ? 223  LEU A CG    1 
ATOM   1752 C CD1   . LEU A 1 240 ? -1.310  -8.459  -8.479  1.00 20.47 ? 223  LEU A CD1   1 
ATOM   1753 C CD2   . LEU A 1 240 ? -0.502  -10.708 -9.389  1.00 18.76 ? 223  LEU A CD2   1 
ATOM   1754 N N     . ARG A 1 241 ? 1.654   -8.000  -13.078 1.00 21.36 ? 224  ARG A N     1 
ATOM   1755 C CA    . ARG A 1 241 ? 1.698   -6.930  -14.088 1.00 22.12 ? 224  ARG A CA    1 
ATOM   1756 C C     . ARG A 1 241 ? 0.798   -7.236  -15.287 1.00 22.70 ? 224  ARG A C     1 
ATOM   1757 O O     . ARG A 1 241 ? 0.339   -8.380  -15.429 1.00 23.51 ? 224  ARG A O     1 
ATOM   1758 C CB    . ARG A 1 241 ? 3.136   -6.636  -14.531 1.00 22.49 ? 224  ARG A CB    1 
ATOM   1759 C CG    . ARG A 1 241 ? 3.679   -7.499  -15.655 1.00 24.33 ? 224  ARG A CG    1 
ATOM   1760 C CD    . ARG A 1 241 ? 4.843   -6.767  -16.331 1.00 23.97 ? 224  ARG A CD    1 
ATOM   1761 N NE    . ARG A 1 241 ? 6.023   -6.664  -15.469 1.00 25.33 ? 224  ARG A NE    1 
ATOM   1762 C CZ    . ARG A 1 241 ? 7.007   -7.555  -15.425 1.00 26.28 ? 224  ARG A CZ    1 
ATOM   1763 N NH1   . ARG A 1 241 ? 6.964   -8.646  -16.196 1.00 26.73 ? 224  ARG A NH1   1 
ATOM   1764 N NH2   . ARG A 1 241 ? 8.045   -7.354  -14.620 1.00 25.00 ? 224  ARG A NH2   1 
ATOM   1765 N N     . ARG B 1 17  ? -43.619 30.570  -30.392 1.00 31.76 ? -1   ARG B N     1 
ATOM   1766 C CA    . ARG B 1 17  ? -43.748 29.243  -29.721 1.00 31.85 ? -1   ARG B CA    1 
ATOM   1767 C C     . ARG B 1 17  ? -42.558 29.025  -28.792 1.00 30.76 ? -1   ARG B C     1 
ATOM   1768 O O     . ARG B 1 17  ? -41.410 29.078  -29.241 1.00 31.15 ? -1   ARG B O     1 
ATOM   1769 C CB    . ARG B 1 17  ? -43.822 28.125  -30.765 1.00 32.52 ? -1   ARG B CB    1 
ATOM   1770 C CG    . ARG B 1 17  ? -44.868 28.331  -31.839 1.00 34.97 ? -1   ARG B CG    1 
ATOM   1771 C CD    . ARG B 1 17  ? -46.167 27.644  -31.500 1.00 38.89 ? -1   ARG B CD    1 
ATOM   1772 N NE    . ARG B 1 17  ? -46.984 27.452  -32.697 1.00 43.05 ? -1   ARG B NE    1 
ATOM   1773 C CZ    . ARG B 1 17  ? -48.172 26.852  -32.714 1.00 44.20 ? -1   ARG B CZ    1 
ATOM   1774 N NH1   . ARG B 1 17  ? -48.704 26.380  -31.590 1.00 45.09 ? -1   ARG B NH1   1 
ATOM   1775 N NH2   . ARG B 1 17  ? -48.830 26.724  -33.860 1.00 44.05 ? -1   ARG B NH2   1 
ATOM   1776 N N     . GLY B 1 18  ? -42.823 28.768  -27.512 1.00 29.77 ? 0    GLY B N     1 
ATOM   1777 C CA    . GLY B 1 18  ? -41.772 28.740  -26.487 1.00 28.15 ? 0    GLY B CA    1 
ATOM   1778 C C     . GLY B 1 18  ? -41.446 27.403  -25.824 1.00 27.00 ? 0    GLY B C     1 
ATOM   1779 O O     . GLY B 1 18  ? -40.647 27.350  -24.897 1.00 26.57 ? 0    GLY B O     1 
ATOM   1780 N N     . SER B 1 19  ? -42.073 26.319  -26.275 1.00 26.12 ? 1    SER B N     1 
ATOM   1781 C CA    . SER B 1 19  ? -41.795 24.989  -25.713 1.00 24.87 ? 1    SER B CA    1 
ATOM   1782 C C     . SER B 1 19  ? -42.092 23.903  -26.734 1.00 24.01 ? 1    SER B C     1 
ATOM   1783 O O     . SER B 1 19  ? -42.847 24.116  -27.681 1.00 23.41 ? 1    SER B O     1 
ATOM   1784 C CB    . SER B 1 19  ? -42.637 24.746  -24.456 1.00 25.30 ? 1    SER B CB    1 
ATOM   1785 O OG    . SER B 1 19  ? -44.012 24.673  -24.795 1.00 26.10 ? 1    SER B OG    1 
ATOM   1786 N N     . THR B 1 20  ? -41.516 22.719  -26.550 1.00 23.17 ? 2    THR B N     1 
ATOM   1787 C CA    . THR B 1 20  ? -41.819 21.625  -27.483 1.00 22.66 ? 2    THR B CA    1 
ATOM   1788 C C     . THR B 1 20  ? -43.292 21.222  -27.412 1.00 23.72 ? 2    THR B C     1 
ATOM   1789 O O     . THR B 1 20  ? -43.856 20.811  -28.422 1.00 23.18 ? 2    THR B O     1 
ATOM   1790 C CB    . THR B 1 20  ? -40.944 20.387  -27.263 1.00 22.70 ? 2    THR B CB    1 
ATOM   1791 O OG1   . THR B 1 20  ? -41.061 19.960  -25.894 1.00 19.13 ? 2    THR B OG1   1 
ATOM   1792 C CG2   . THR B 1 20  ? -39.484 20.717  -27.626 1.00 22.54 ? 2    THR B CG2   1 
ATOM   1793 N N     . SER B 1 21  ? -43.903 21.373  -26.236 1.00 24.71 ? 3    SER B N     1 
ATOM   1794 C CA    . SER B 1 21  ? -45.333 21.042  -26.043 1.00 26.47 ? 3    SER B CA    1 
ATOM   1795 C C     . SER B 1 21  ? -46.266 21.856  -26.940 1.00 26.76 ? 3    SER B C     1 
ATOM   1796 O O     . SER B 1 21  ? -47.389 21.421  -27.232 1.00 27.14 ? 3    SER B O     1 
ATOM   1797 C CB    . SER B 1 21  ? -45.756 21.222  -24.585 1.00 26.83 ? 3    SER B CB    1 
ATOM   1798 O OG    . SER B 1 21  ? -45.701 22.591  -24.203 1.00 28.97 ? 3    SER B OG    1 
ATOM   1799 N N     . GLU B 1 22  ? -45.803 23.029  -27.361 1.00 26.74 ? 4    GLU B N     1 
ATOM   1800 C CA    . GLU B 1 22  ? -46.559 23.902  -28.262 1.00 28.21 ? 4    GLU B CA    1 
ATOM   1801 C C     . GLU B 1 22  ? -46.247 23.668  -29.741 1.00 28.07 ? 4    GLU B C     1 
ATOM   1802 O O     . GLU B 1 22  ? -46.907 24.245  -30.621 1.00 28.40 ? 4    GLU B O     1 
ATOM   1803 C CB    . GLU B 1 22  ? -46.272 25.371  -27.955 1.00 28.93 ? 4    GLU B CB    1 
ATOM   1804 C CG    . GLU B 1 22  ? -46.467 25.798  -26.518 1.00 30.69 ? 4    GLU B CG    1 
ATOM   1805 C CD    . GLU B 1 22  ? -45.788 27.135  -26.237 1.00 36.29 ? 4    GLU B CD    1 
ATOM   1806 O OE1   . GLU B 1 22  ? -45.024 27.224  -25.248 1.00 37.48 ? 4    GLU B OE1   1 
ATOM   1807 O OE2   . GLU B 1 22  ? -46.015 28.091  -27.017 1.00 37.77 ? 4    GLU B OE2   1 
ATOM   1808 N N     . VAL B 1 23  ? -45.231 22.857  -30.030 1.00 27.09 ? 5    VAL B N     1 
ATOM   1809 C CA    . VAL B 1 23  ? -44.873 22.604  -31.423 1.00 26.43 ? 5    VAL B CA    1 
ATOM   1810 C C     . VAL B 1 23  ? -44.997 21.140  -31.828 1.00 25.73 ? 5    VAL B C     1 
ATOM   1811 O O     . VAL B 1 23  ? -45.201 20.838  -32.996 1.00 25.47 ? 5    VAL B O     1 
ATOM   1812 C CB    . VAL B 1 23  ? -43.443 23.117  -31.798 1.00 27.16 ? 5    VAL B CB    1 
ATOM   1813 C CG1   . VAL B 1 23  ? -43.219 24.522  -31.308 1.00 26.80 ? 5    VAL B CG1   1 
ATOM   1814 C CG2   . VAL B 1 23  ? -42.376 22.193  -31.257 1.00 27.19 ? 5    VAL B CG2   1 
ATOM   1815 N N     . ILE B 1 24  ? -44.835 20.228  -30.882 1.00 25.15 ? 6    ILE B N     1 
ATOM   1816 C CA    . ILE B 1 24  ? -44.895 18.819  -31.226 1.00 25.03 ? 6    ILE B CA    1 
ATOM   1817 C C     . ILE B 1 24  ? -46.340 18.329  -31.080 1.00 25.58 ? 6    ILE B C     1 
ATOM   1818 O O     . ILE B 1 24  ? -46.891 18.286  -29.977 1.00 26.02 ? 6    ILE B O     1 
ATOM   1819 C CB    . ILE B 1 24  ? -43.922 17.966  -30.374 1.00 24.69 ? 6    ILE B CB    1 
ATOM   1820 C CG1   . ILE B 1 24  ? -42.469 18.390  -30.629 1.00 23.93 ? 6    ILE B CG1   1 
ATOM   1821 C CG2   . ILE B 1 24  ? -44.129 16.492  -30.670 1.00 25.81 ? 6    ILE B CG2   1 
ATOM   1822 C CD1   . ILE B 1 24  ? -41.435 17.650  -29.708 1.00 24.37 ? 6    ILE B CD1   1 
ATOM   1823 N N     . GLU B 1 25  ? -46.931 17.960  -32.209 1.00 26.03 ? 7    GLU B N     1 
ATOM   1824 C CA    . GLU B 1 25  ? -48.312 17.480  -32.266 1.00 27.46 ? 7    GLU B CA    1 
ATOM   1825 C C     . GLU B 1 25  ? -48.513 16.070  -31.693 1.00 27.08 ? 7    GLU B C     1 
ATOM   1826 O O     . GLU B 1 25  ? -49.507 15.814  -31.009 1.00 27.13 ? 7    GLU B O     1 
ATOM   1827 C CB    . GLU B 1 25  ? -48.853 17.583  -33.704 1.00 26.94 ? 7    GLU B CB    1 
ATOM   1828 C CG    . GLU B 1 25  ? -49.317 18.988  -34.061 1.00 30.05 ? 7    GLU B CG    1 
ATOM   1829 C CD    . GLU B 1 25  ? -49.639 19.181  -35.545 1.00 29.61 ? 7    GLU B CD    1 
ATOM   1830 O OE1   . GLU B 1 25  ? -49.867 18.194  -36.277 1.00 34.48 ? 7    GLU B OE1   1 
ATOM   1831 O OE2   . GLU B 1 25  ? -49.669 20.343  -35.981 1.00 33.90 ? 7    GLU B OE2   1 
ATOM   1832 N N     . ASP B 1 26  ? -47.573 15.159  -31.964 1.00 26.90 ? 8    ASP B N     1 
ATOM   1833 C CA    . ASP B 1 26  ? -47.671 13.773  -31.503 1.00 26.82 ? 8    ASP B CA    1 
ATOM   1834 C C     . ASP B 1 26  ? -46.273 13.331  -31.084 1.00 25.84 ? 8    ASP B C     1 
ATOM   1835 O O     . ASP B 1 26  ? -45.402 13.166  -31.932 1.00 26.12 ? 8    ASP B O     1 
ATOM   1836 C CB    . ASP B 1 26  ? -48.184 12.883  -32.641 1.00 27.36 ? 8    ASP B CB    1 
ATOM   1837 C CG    . ASP B 1 26  ? -48.478 11.434  -32.215 1.00 29.60 ? 8    ASP B CG    1 
ATOM   1838 O OD1   . ASP B 1 26  ? -47.753 10.836  -31.385 1.00 30.27 ? 8    ASP B OD1   1 
ATOM   1839 O OD2   . ASP B 1 26  ? -49.475 10.870  -32.736 1.00 32.74 ? 8    ASP B OD2   1 
ATOM   1840 N N     . GLU B 1 27  ? -46.066 13.162  -29.784 1.00 25.38 ? 9    GLU B N     1 
ATOM   1841 C CA    . GLU B 1 27  ? -44.740 12.826  -29.257 1.00 24.67 ? 9    GLU B CA    1 
ATOM   1842 C C     . GLU B 1 27  ? -44.190 11.519  -29.838 1.00 24.39 ? 9    GLU B C     1 
ATOM   1843 O O     . GLU B 1 27  ? -43.027 11.461  -30.239 1.00 23.42 ? 9    GLU B O     1 
ATOM   1844 C CB    . GLU B 1 27  ? -44.779 12.760  -27.731 1.00 25.07 ? 9    GLU B CB    1 
ATOM   1845 C CG    . GLU B 1 27  ? -43.443 12.461  -27.133 1.00 26.11 ? 9    GLU B CG    1 
ATOM   1846 C CD    . GLU B 1 27  ? -43.484 12.388  -25.639 1.00 27.01 ? 9    GLU B CD    1 
ATOM   1847 O OE1   . GLU B 1 27  ? -43.887 13.389  -25.011 1.00 28.99 ? 9    GLU B OE1   1 
ATOM   1848 O OE2   . GLU B 1 27  ? -43.123 11.327  -25.106 1.00 29.65 ? 9    GLU B OE2   1 
ATOM   1849 N N     . LYS B 1 28  ? -45.016 10.472  -29.877 1.00 24.30 ? 10   LYS B N     1 
ATOM   1850 C CA    . LYS B 1 28  ? -44.575 9.181   -30.443 1.00 24.57 ? 10   LYS B CA    1 
ATOM   1851 C C     . LYS B 1 28  ? -44.094 9.320   -31.887 1.00 24.18 ? 10   LYS B C     1 
ATOM   1852 O O     . LYS B 1 28  ? -43.086 8.727   -32.290 1.00 24.19 ? 10   LYS B O     1 
ATOM   1853 C CB    . LYS B 1 28  ? -45.681 8.124   -30.336 1.00 24.91 ? 10   LYS B CB    1 
ATOM   1854 C CG    . LYS B 1 28  ? -45.859 7.619   -28.917 1.00 27.50 ? 10   LYS B CG    1 
ATOM   1855 C CD    . LYS B 1 28  ? -46.850 6.479   -28.803 1.00 30.00 ? 10   LYS B CD    1 
ATOM   1856 C CE    . LYS B 1 28  ? -46.996 6.027   -27.354 1.00 32.99 ? 10   LYS B CE    1 
ATOM   1857 N NZ    . LYS B 1 28  ? -47.785 4.770   -27.236 1.00 34.46 ? 10   LYS B NZ    1 
ATOM   1858 N N     . GLN B 1 29  ? -44.814 10.117  -32.662 1.00 23.54 ? 11   GLN B N     1 
ATOM   1859 C CA    . GLN B 1 29  ? -44.462 10.368  -34.051 1.00 23.37 ? 11   GLN B CA    1 
ATOM   1860 C C     . GLN B 1 29  ? -43.213 11.240  -34.168 1.00 21.79 ? 11   GLN B C     1 
ATOM   1861 O O     . GLN B 1 29  ? -42.432 11.086  -35.097 1.00 21.14 ? 11   GLN B O     1 
ATOM   1862 C CB    . GLN B 1 29  ? -45.632 11.022  -34.772 1.00 24.24 ? 11   GLN B CB    1 
ATOM   1863 C CG    . GLN B 1 29  ? -46.690 10.025  -35.169 1.00 27.78 ? 11   GLN B CG    1 
ATOM   1864 C CD    . GLN B 1 29  ? -47.879 10.675  -35.805 1.00 32.63 ? 11   GLN B CD    1 
ATOM   1865 O OE1   . GLN B 1 29  ? -47.744 11.519  -36.702 1.00 35.43 ? 11   GLN B OE1   1 
ATOM   1866 N NE2   . GLN B 1 29  ? -49.070 10.289  -35.350 1.00 36.08 ? 11   GLN B NE2   1 
ATOM   1867 N N     . PHE B 1 30  ? -43.033 12.170  -33.236 1.00 20.17 ? 12   PHE B N     1 
ATOM   1868 C CA    . PHE B 1 30  ? -41.839 13.029  -33.241 1.00 18.59 ? 12   PHE B CA    1 
ATOM   1869 C C     . PHE B 1 30  ? -40.582 12.145  -33.164 1.00 17.90 ? 12   PHE B C     1 
ATOM   1870 O O     . PHE B 1 30  ? -39.592 12.356  -33.898 1.00 18.12 ? 12   PHE B O     1 
ATOM   1871 C CB    . PHE B 1 30  ? -41.904 13.975  -32.039 1.00 18.81 ? 12   PHE B CB    1 
ATOM   1872 C CG    . PHE B 1 30  ? -40.644 14.762  -31.787 1.00 17.70 ? 12   PHE B CG    1 
ATOM   1873 C CD1   . PHE B 1 30  ? -40.279 15.822  -32.626 1.00 17.02 ? 12   PHE B CD1   1 
ATOM   1874 C CD2   . PHE B 1 30  ? -39.857 14.466  -30.668 1.00 16.98 ? 12   PHE B CD2   1 
ATOM   1875 C CE1   . PHE B 1 30  ? -39.104 16.568  -32.371 1.00 17.31 ? 12   PHE B CE1   1 
ATOM   1876 C CE2   . PHE B 1 30  ? -38.688 15.187  -30.394 1.00 17.12 ? 12   PHE B CE2   1 
ATOM   1877 C CZ    . PHE B 1 30  ? -38.318 16.253  -31.238 1.00 18.09 ? 12   PHE B CZ    1 
ATOM   1878 N N     . TYR B 1 31  ? -40.626 11.164  -32.267 1.00 17.53 ? 13   TYR B N     1 
ATOM   1879 C CA    . TYR B 1 31  ? -39.513 10.203  -32.101 1.00 16.66 ? 13   TYR B CA    1 
ATOM   1880 C C     . TYR B 1 31  ? -39.426 9.194   -33.258 1.00 17.68 ? 13   TYR B C     1 
ATOM   1881 O O     . TYR B 1 31  ? -38.340 8.952   -33.803 1.00 16.30 ? 13   TYR B O     1 
ATOM   1882 C CB    . TYR B 1 31  ? -39.609 9.466   -30.753 1.00 16.55 ? 13   TYR B CB    1 
ATOM   1883 C CG    . TYR B 1 31  ? -39.208 10.333  -29.569 1.00 15.27 ? 13   TYR B CG    1 
ATOM   1884 C CD1   . TYR B 1 31  ? -37.919 10.859  -29.475 1.00 16.92 ? 13   TYR B CD1   1 
ATOM   1885 C CD2   . TYR B 1 31  ? -40.128 10.657  -28.560 1.00 14.65 ? 13   TYR B CD2   1 
ATOM   1886 C CE1   . TYR B 1 31  ? -37.554 11.671  -28.412 1.00 16.51 ? 13   TYR B CE1   1 
ATOM   1887 C CE2   . TYR B 1 31  ? -39.773 11.471  -27.491 1.00 13.23 ? 13   TYR B CE2   1 
ATOM   1888 C CZ    . TYR B 1 31  ? -38.478 11.981  -27.420 1.00 15.43 ? 13   TYR B CZ    1 
ATOM   1889 O OH    . TYR B 1 31  ? -38.119 12.808  -26.356 1.00 17.49 ? 13   TYR B OH    1 
ATOM   1890 N N     . SER B 1 32  ? -40.556 8.605   -33.647 1.00 17.83 ? 14   SER B N     1 
ATOM   1891 C CA    . SER B 1 32  ? -40.489 7.569   -34.689 1.00 17.99 ? 14   SER B CA    1 
ATOM   1892 C C     . SER B 1 32  ? -40.010 8.115   -36.050 1.00 17.59 ? 14   SER B C     1 
ATOM   1893 O O     . SER B 1 32  ? -39.266 7.432   -36.772 1.00 17.53 ? 14   SER B O     1 
ATOM   1894 C CB    . SER B 1 32  ? -41.834 6.832   -34.802 1.00 18.89 ? 14   SER B CB    1 
ATOM   1895 O OG    . SER B 1 32  ? -42.843 7.723   -35.261 1.00 20.84 ? 14   SER B OG    1 
ATOM   1896 N N     . LYS B 1 33  ? -40.412 9.346   -36.383 1.00 17.55 ? 15   LYS B N     1 
ATOM   1897 C CA    . LYS B 1 33  ? -40.012 9.980   -37.647 1.00 17.52 ? 15   LYS B CA    1 
ATOM   1898 C C     . LYS B 1 33  ? -38.529 10.317  -37.678 1.00 16.96 ? 15   LYS B C     1 
ATOM   1899 O O     . LYS B 1 33  ? -37.892 10.187  -38.717 1.00 17.32 ? 15   LYS B O     1 
ATOM   1900 C CB    . LYS B 1 33  ? -40.859 11.219  -37.953 1.00 18.45 ? 15   LYS B CB    1 
ATOM   1901 C CG    . LYS B 1 33  ? -42.258 10.864  -38.436 1.00 22.44 ? 15   LYS B CG    1 
ATOM   1902 C CD    . LYS B 1 33  ? -43.072 12.101  -38.784 1.00 24.34 ? 15   LYS B CD    1 
ATOM   1903 C CE    . LYS B 1 33  ? -42.851 12.520  -40.236 1.00 27.15 ? 15   LYS B CE    1 
ATOM   1904 N NZ    . LYS B 1 33  ? -43.894 13.502  -40.650 1.00 27.14 ? 15   LYS B NZ    1 
ATOM   1905 N N     . ALA B 1 34  ? -37.979 10.743  -36.540 1.00 15.51 ? 16   ALA B N     1 
ATOM   1906 C CA    . ALA B 1 34  ? -36.541 10.995  -36.437 1.00 14.53 ? 16   ALA B CA    1 
ATOM   1907 C C     . ALA B 1 34  ? -35.756 9.692   -36.622 1.00 14.62 ? 16   ALA B C     1 
ATOM   1908 O O     . ALA B 1 34  ? -34.685 9.664   -37.262 1.00 13.68 ? 16   ALA B O     1 
ATOM   1909 C CB    . ALA B 1 34  ? -36.202 11.632  -35.075 1.00 14.89 ? 16   ALA B CB    1 
ATOM   1910 N N     . LYS B 1 35  ? -36.285 8.611   -36.061 1.00 14.72 ? 17   LYS B N     1 
ATOM   1911 C CA    . LYS B 1 35  ? -35.608 7.319   -36.191 1.00 15.41 ? 17   LYS B CA    1 
ATOM   1912 C C     . LYS B 1 35  ? -35.597 6.886   -37.670 1.00 15.60 ? 17   LYS B C     1 
ATOM   1913 O O     . LYS B 1 35  ? -34.575 6.450   -38.209 1.00 14.28 ? 17   LYS B O     1 
ATOM   1914 C CB    . LYS B 1 35  ? -36.248 6.284   -35.277 1.00 15.48 ? 17   LYS B CB    1 
ATOM   1915 C CG    . LYS B 1 35  ? -35.479 4.983   -35.208 1.00 17.35 ? 17   LYS B CG    1 
ATOM   1916 C CD    . LYS B 1 35  ? -36.010 4.071   -34.124 1.00 19.19 ? 17   LYS B CD    1 
ATOM   1917 C CE    . LYS B 1 35  ? -35.433 2.672   -34.366 1.00 21.33 ? 17   LYS B CE    1 
ATOM   1918 N NZ    . LYS B 1 35  ? -35.799 1.699   -33.314 1.00 24.50 ? 17   LYS B NZ    1 
ATOM   1919 N N     . THR B 1 36  ? -36.741 7.028   -38.321 1.00 15.75 ? 18   THR B N     1 
ATOM   1920 C CA    . THR B 1 36  ? -36.848 6.781   -39.756 1.00 17.30 ? 18   THR B CA    1 
ATOM   1921 C C     . THR B 1 36  ? -35.907 7.654   -40.611 1.00 17.44 ? 18   THR B C     1 
ATOM   1922 O O     . THR B 1 36  ? -35.230 7.141   -41.518 1.00 18.88 ? 18   THR B O     1 
ATOM   1923 C CB    . THR B 1 36  ? -38.303 6.968   -40.172 1.00 16.64 ? 18   THR B CB    1 
ATOM   1924 O OG1   . THR B 1 36  ? -39.084 5.995   -39.483 1.00 16.30 ? 18   THR B OG1   1 
ATOM   1925 C CG2   . THR B 1 36  ? -38.469 6.788   -41.662 1.00 18.97 ? 18   THR B CG2   1 
ATOM   1926 N N     . TYR B 1 37  ? -35.862 8.960   -40.320 1.00 17.37 ? 19   TYR B N     1 
ATOM   1927 C CA    . TYR B 1 37  ? -34.949 9.868   -41.025 1.00 17.28 ? 19   TYR B CA    1 
ATOM   1928 C C     . TYR B 1 37  ? -33.507 9.364   -40.954 1.00 17.10 ? 19   TYR B C     1 
ATOM   1929 O O     . TYR B 1 37  ? -32.818 9.259   -41.982 1.00 16.77 ? 19   TYR B O     1 
ATOM   1930 C CB    . TYR B 1 37  ? -35.030 11.317  -40.481 1.00 17.33 ? 19   TYR B CB    1 
ATOM   1931 C CG    . TYR B 1 37  ? -33.870 12.182  -40.976 1.00 19.19 ? 19   TYR B CG    1 
ATOM   1932 C CD1   . TYR B 1 37  ? -33.928 12.809  -42.238 1.00 22.78 ? 19   TYR B CD1   1 
ATOM   1933 C CD2   . TYR B 1 37  ? -32.710 12.344  -40.215 1.00 20.50 ? 19   TYR B CD2   1 
ATOM   1934 C CE1   . TYR B 1 37  ? -32.847 13.578  -42.709 1.00 21.43 ? 19   TYR B CE1   1 
ATOM   1935 C CE2   . TYR B 1 37  ? -31.627 13.113  -40.676 1.00 22.55 ? 19   TYR B CE2   1 
ATOM   1936 C CZ    . TYR B 1 37  ? -31.716 13.737  -41.920 1.00 21.21 ? 19   TYR B CZ    1 
ATOM   1937 O OH    . TYR B 1 37  ? -30.661 14.503  -42.387 1.00 21.81 ? 19   TYR B OH    1 
ATOM   1938 N N     . TRP B 1 38  ? -33.045 9.055   -39.732 1.00 16.66 ? 20   TRP B N     1 
ATOM   1939 C CA    . TRP B 1 38  ? -31.632 8.708   -39.519 1.00 16.65 ? 20   TRP B CA    1 
ATOM   1940 C C     . TRP B 1 38  ? -31.256 7.352   -40.134 1.00 17.11 ? 20   TRP B C     1 
ATOM   1941 O O     . TRP B 1 38  ? -30.122 7.139   -40.548 1.00 16.70 ? 20   TRP B O     1 
ATOM   1942 C CB    . TRP B 1 38  ? -31.248 8.815   -38.017 1.00 16.49 ? 20   TRP B CB    1 
ATOM   1943 C CG    . TRP B 1 38  ? -31.062 10.241  -37.637 1.00 16.28 ? 20   TRP B CG    1 
ATOM   1944 C CD1   . TRP B 1 38  ? -31.894 11.001  -36.865 1.00 13.97 ? 20   TRP B CD1   1 
ATOM   1945 C CD2   . TRP B 1 38  ? -30.004 11.105  -38.065 1.00 14.34 ? 20   TRP B CD2   1 
ATOM   1946 N NE1   . TRP B 1 38  ? -31.407 12.285  -36.778 1.00 16.57 ? 20   TRP B NE1   1 
ATOM   1947 C CE2   . TRP B 1 38  ? -30.253 12.380  -37.508 1.00 15.47 ? 20   TRP B CE2   1 
ATOM   1948 C CE3   . TRP B 1 38  ? -28.873 10.929  -38.887 1.00 15.47 ? 20   TRP B CE3   1 
ATOM   1949 C CZ2   . TRP B 1 38  ? -29.402 13.478  -37.727 1.00 16.13 ? 20   TRP B CZ2   1 
ATOM   1950 C CZ3   . TRP B 1 38  ? -28.030 12.004  -39.099 1.00 16.32 ? 20   TRP B CZ3   1 
ATOM   1951 C CH2   . TRP B 1 38  ? -28.305 13.274  -38.532 1.00 15.95 ? 20   TRP B CH2   1 
ATOM   1952 N N     . LYS B 1 39  ? -32.235 6.465   -40.220 1.00 18.07 ? 21   LYS B N     1 
ATOM   1953 C CA    . LYS B 1 39  ? -32.046 5.143   -40.804 1.00 19.78 ? 21   LYS B CA    1 
ATOM   1954 C C     . LYS B 1 39  ? -31.581 5.204   -42.273 1.00 20.65 ? 21   LYS B C     1 
ATOM   1955 O O     . LYS B 1 39  ? -30.847 4.319   -42.728 1.00 21.02 ? 21   LYS B O     1 
ATOM   1956 C CB    . LYS B 1 39  ? -33.342 4.345   -40.700 1.00 19.86 ? 21   LYS B CB    1 
ATOM   1957 C CG    . LYS B 1 39  ? -33.321 2.996   -41.412 1.00 22.22 ? 21   LYS B CG    1 
ATOM   1958 C CD    . LYS B 1 39  ? -32.384 2.002   -40.735 1.00 26.62 ? 21   LYS B CD    1 
ATOM   1959 C CE    . LYS B 1 39  ? -32.242 0.731   -41.589 1.00 29.27 ? 21   LYS B CE    1 
ATOM   1960 N NZ    . LYS B 1 39  ? -31.424 -0.311  -40.909 1.00 33.47 ? 21   LYS B NZ    1 
ATOM   1961 N N     . GLN B 1 40  ? -31.997 6.240   -43.000 1.00 21.05 ? 22   GLN B N     1 
ATOM   1962 C CA    . GLN B 1 40  ? -31.652 6.349   -44.431 1.00 23.06 ? 22   GLN B CA    1 
ATOM   1963 C C     . GLN B 1 40  ? -30.489 7.286   -44.731 1.00 22.82 ? 22   GLN B C     1 
ATOM   1964 O O     . GLN B 1 40  ? -30.215 7.606   -45.901 1.00 23.11 ? 22   GLN B O     1 
ATOM   1965 C CB    . GLN B 1 40  ? -32.882 6.693   -45.272 1.00 23.48 ? 22   GLN B CB    1 
ATOM   1966 C CG    . GLN B 1 40  ? -33.870 7.533   -44.556 1.00 27.14 ? 22   GLN B CG    1 
ATOM   1967 C CD    . GLN B 1 40  ? -35.066 7.826   -45.388 1.00 31.32 ? 22   GLN B CD    1 
ATOM   1968 O OE1   . GLN B 1 40  ? -35.938 6.965   -45.594 1.00 35.99 ? 22   GLN B OE1   1 
ATOM   1969 N NE2   . GLN B 1 40  ? -35.133 9.046   -45.878 1.00 33.84 ? 22   GLN B NE2   1 
ATOM   1970 N N     . ILE B 1 41  ? -29.809 7.726   -43.671 1.00 22.14 ? 23   ILE B N     1 
ATOM   1971 C CA    . ILE B 1 41  ? -28.641 8.587   -43.793 1.00 21.32 ? 23   ILE B CA    1 
ATOM   1972 C C     . ILE B 1 41  ? -27.377 7.743   -43.914 1.00 21.54 ? 23   ILE B C     1 
ATOM   1973 O O     . ILE B 1 41  ? -27.160 6.818   -43.120 1.00 20.16 ? 23   ILE B O     1 
ATOM   1974 C CB    . ILE B 1 41  ? -28.535 9.596   -42.610 1.00 21.47 ? 23   ILE B CB    1 
ATOM   1975 C CG1   . ILE B 1 41  ? -29.677 10.629  -42.631 1.00 21.46 ? 23   ILE B CG1   1 
ATOM   1976 C CG2   . ILE B 1 41  ? -27.141 10.238  -42.514 1.00 21.90 ? 23   ILE B CG2   1 
ATOM   1977 C CD1   . ILE B 1 41  ? -29.891 11.401  -43.966 1.00 23.65 ? 23   ILE B CD1   1 
ATOM   1978 N N     . PRO B 1 42  ? -26.527 8.059   -44.903 1.00 21.78 ? 24   PRO B N     1 
ATOM   1979 C CA    . PRO B 1 42  ? -25.243 7.353   -45.036 1.00 21.69 ? 24   PRO B CA    1 
ATOM   1980 C C     . PRO B 1 42  ? -24.402 7.470   -43.754 1.00 20.86 ? 24   PRO B C     1 
ATOM   1981 O O     . PRO B 1 42  ? -24.332 8.560   -43.144 1.00 20.30 ? 24   PRO B O     1 
ATOM   1982 C CB    . PRO B 1 42  ? -24.554 8.067   -46.216 1.00 22.36 ? 24   PRO B CB    1 
ATOM   1983 C CG    . PRO B 1 42  ? -25.322 9.325   -46.410 1.00 22.86 ? 24   PRO B CG    1 
ATOM   1984 C CD    . PRO B 1 42  ? -26.704 9.090   -45.939 1.00 22.20 ? 24   PRO B CD    1 
ATOM   1985 N N     . PRO B 1 43  ? -23.773 6.362   -43.336 1.00 20.39 ? 25   PRO B N     1 
ATOM   1986 C CA    . PRO B 1 43  ? -22.959 6.301   -42.119 1.00 20.22 ? 25   PRO B CA    1 
ATOM   1987 C C     . PRO B 1 43  ? -21.550 6.879   -42.337 1.00 20.00 ? 25   PRO B C     1 
ATOM   1988 O O     . PRO B 1 43  ? -20.531 6.164   -42.249 1.00 20.79 ? 25   PRO B O     1 
ATOM   1989 C CB    . PRO B 1 43  ? -22.908 4.811   -41.821 1.00 20.72 ? 25   PRO B CB    1 
ATOM   1990 C CG    . PRO B 1 43  ? -22.951 4.185   -43.198 1.00 20.97 ? 25   PRO B CG    1 
ATOM   1991 C CD    . PRO B 1 43  ? -23.845 5.051   -44.017 1.00 20.81 ? 25   PRO B CD    1 
ATOM   1992 N N     . THR B 1 44  ? -21.508 8.184   -42.589 1.00 19.20 ? 26   THR B N     1 
ATOM   1993 C CA    . THR B 1 44  ? -20.267 8.909   -42.901 1.00 19.19 ? 26   THR B CA    1 
ATOM   1994 C C     . THR B 1 44  ? -20.287 10.234  -42.148 1.00 18.96 ? 26   THR B C     1 
ATOM   1995 O O     . THR B 1 44  ? -21.340 10.638  -41.671 1.00 19.42 ? 26   THR B O     1 
ATOM   1996 C CB    . THR B 1 44  ? -20.143 9.199   -44.415 1.00 18.50 ? 26   THR B CB    1 
ATOM   1997 O OG1   . THR B 1 44  ? -21.202 10.063  -44.821 1.00 19.11 ? 26   THR B OG1   1 
ATOM   1998 C CG2   . THR B 1 44  ? -20.214 7.881   -45.256 1.00 19.28 ? 26   THR B CG2   1 
ATOM   1999 N N     . VAL B 1 45  ? -19.146 10.913  -42.075 1.00 19.23 ? 27   VAL B N     1 
ATOM   2000 C CA    . VAL B 1 45  ? -19.070 12.221  -41.431 1.00 19.32 ? 27   VAL B CA    1 
ATOM   2001 C C     . VAL B 1 45  ? -20.003 13.224  -42.102 1.00 19.17 ? 27   VAL B C     1 
ATOM   2002 O O     . VAL B 1 45  ? -20.673 14.002  -41.422 1.00 18.77 ? 27   VAL B O     1 
ATOM   2003 C CB    . VAL B 1 45  ? -17.597 12.740  -41.329 1.00 19.41 ? 27   VAL B CB    1 
ATOM   2004 C CG1   . VAL B 1 45  ? -17.560 14.222  -40.981 1.00 19.68 ? 27   VAL B CG1   1 
ATOM   2005 C CG2   . VAL B 1 45  ? -16.839 11.949  -40.268 1.00 19.91 ? 27   VAL B CG2   1 
ATOM   2006 N N     . ASP B 1 46  ? -20.059 13.205  -43.437 1.00 18.82 ? 28   ASP B N     1 
ATOM   2007 C CA    . ASP B 1 46  ? -20.967 14.097  -44.171 1.00 19.73 ? 28   ASP B CA    1 
ATOM   2008 C C     . ASP B 1 46  ? -22.434 13.825  -43.845 1.00 19.26 ? 28   ASP B C     1 
ATOM   2009 O O     . ASP B 1 46  ? -23.238 14.742  -43.770 1.00 19.17 ? 28   ASP B O     1 
ATOM   2010 C CB    . ASP B 1 46  ? -20.722 14.025  -45.684 1.00 20.48 ? 28   ASP B CB    1 
ATOM   2011 C CG    . ASP B 1 46  ? -21.282 15.229  -46.424 1.00 21.35 ? 28   ASP B CG    1 
ATOM   2012 O OD1   . ASP B 1 46  ? -20.839 16.379  -46.170 1.00 21.62 ? 28   ASP B OD1   1 
ATOM   2013 O OD2   . ASP B 1 46  ? -22.177 15.016  -47.250 1.00 25.04 ? 28   ASP B OD2   1 
ATOM   2014 N N     . GLY B 1 47  ? -22.773 12.552  -43.635 1.00 18.65 ? 29   GLY B N     1 
ATOM   2015 C CA    . GLY B 1 47  ? -24.115 12.165  -43.216 1.00 18.03 ? 29   GLY B CA    1 
ATOM   2016 C C     . GLY B 1 47  ? -24.417 12.658  -41.820 1.00 18.06 ? 29   GLY B C     1 
ATOM   2017 O O     . GLY B 1 47  ? -25.504 13.217  -41.583 1.00 17.67 ? 29   GLY B O     1 
ATOM   2018 N N     . MET B 1 48  ? -23.464 12.450  -40.907 1.00 17.29 ? 30   MET B N     1 
ATOM   2019 C CA    . MET B 1 48  ? -23.569 12.946  -39.507 1.00 17.46 ? 30   MET B CA    1 
ATOM   2020 C C     . MET B 1 48  ? -23.844 14.445  -39.464 1.00 18.32 ? 30   MET B C     1 
ATOM   2021 O O     . MET B 1 48  ? -24.642 14.915  -38.636 1.00 18.53 ? 30   MET B O     1 
ATOM   2022 C CB    . MET B 1 48  ? -22.297 12.654  -38.703 1.00 17.42 ? 30   MET B CB    1 
ATOM   2023 C CG    . MET B 1 48  ? -21.913 11.171  -38.554 1.00 16.01 ? 30   MET B CG    1 
ATOM   2024 S SD    . MET B 1 48  ? -23.191 10.105  -37.830 1.00 17.59 ? 30   MET B SD    1 
ATOM   2025 C CE    . MET B 1 48  ? -24.035 9.458   -39.289 1.00 18.20 ? 30   MET B CE    1 
ATOM   2026 N N     . LEU B 1 49  ? -23.193 15.189  -40.365 1.00 18.12 ? 31   LEU B N     1 
ATOM   2027 C CA    . LEU B 1 49  ? -23.271 16.646  -40.339 1.00 17.84 ? 31   LEU B CA    1 
ATOM   2028 C C     . LEU B 1 49  ? -24.216 17.234  -41.381 1.00 17.43 ? 31   LEU B C     1 
ATOM   2029 O O     . LEU B 1 49  ? -24.117 18.426  -41.715 1.00 17.31 ? 31   LEU B O     1 
ATOM   2030 C CB    . LEU B 1 49  ? -21.873 17.265  -40.432 1.00 17.71 ? 31   LEU B CB    1 
ATOM   2031 C CG    . LEU B 1 49  ? -20.890 16.807  -39.345 1.00 17.88 ? 31   LEU B CG    1 
ATOM   2032 C CD1   . LEU B 1 49  ? -19.541 17.476  -39.436 1.00 18.60 ? 31   LEU B CD1   1 
ATOM   2033 C CD2   . LEU B 1 49  ? -21.508 17.055  -37.972 1.00 17.10 ? 31   LEU B CD2   1 
ATOM   2034 N N     . GLY B 1 50  ? -25.142 16.401  -41.859 1.00 17.59 ? 32   GLY B N     1 
ATOM   2035 C CA    . GLY B 1 50  ? -26.189 16.827  -42.774 1.00 18.77 ? 32   GLY B CA    1 
ATOM   2036 C C     . GLY B 1 50  ? -25.694 17.497  -44.043 1.00 19.56 ? 32   GLY B C     1 
ATOM   2037 O O     . GLY B 1 50  ? -26.315 18.451  -44.517 1.00 19.71 ? 32   GLY B O     1 
ATOM   2038 N N     . GLY B 1 51  ? -24.593 16.999  -44.602 1.00 19.94 ? 33   GLY B N     1 
ATOM   2039 C CA    . GLY B 1 51  ? -24.019 17.598  -45.825 1.00 20.16 ? 33   GLY B CA    1 
ATOM   2040 C C     . GLY B 1 51  ? -22.929 18.627  -45.568 1.00 20.97 ? 33   GLY B C     1 
ATOM   2041 O O     . GLY B 1 51  ? -22.382 19.207  -46.514 1.00 21.41 ? 33   GLY B O     1 
ATOM   2042 N N     . TYR B 1 52  ? -22.605 18.858  -44.298 1.00 20.59 ? 34   TYR B N     1 
ATOM   2043 C CA    . TYR B 1 52  ? -21.547 19.801  -43.915 1.00 21.83 ? 34   TYR B CA    1 
ATOM   2044 C C     . TYR B 1 52  ? -20.317 19.109  -43.310 1.00 21.52 ? 34   TYR B C     1 
ATOM   2045 O O     . TYR B 1 52  ? -19.666 19.640  -42.397 1.00 21.29 ? 34   TYR B O     1 
ATOM   2046 C CB    . TYR B 1 52  ? -22.083 20.849  -42.939 1.00 22.72 ? 34   TYR B CB    1 
ATOM   2047 C CG    . TYR B 1 52  ? -23.033 21.849  -43.560 1.00 24.11 ? 34   TYR B CG    1 
ATOM   2048 C CD1   . TYR B 1 52  ? -22.582 23.118  -43.931 1.00 27.05 ? 34   TYR B CD1   1 
ATOM   2049 C CD2   . TYR B 1 52  ? -24.372 21.534  -43.780 1.00 24.67 ? 34   TYR B CD2   1 
ATOM   2050 C CE1   . TYR B 1 52  ? -23.441 24.059  -44.493 1.00 26.56 ? 34   TYR B CE1   1 
ATOM   2051 C CE2   . TYR B 1 52  ? -25.253 22.473  -44.354 1.00 26.38 ? 34   TYR B CE2   1 
ATOM   2052 C CZ    . TYR B 1 52  ? -24.767 23.730  -44.715 1.00 26.34 ? 34   TYR B CZ    1 
ATOM   2053 O OH    . TYR B 1 52  ? -25.597 24.684  -45.270 1.00 27.77 ? 34   TYR B OH    1 
ATOM   2054 N N     . GLY B 1 53  ? -20.004 17.926  -43.824 1.00 21.77 ? 35   GLY B N     1 
ATOM   2055 C CA    . GLY B 1 53  ? -18.844 17.153  -43.372 1.00 22.08 ? 35   GLY B CA    1 
ATOM   2056 C C     . GLY B 1 53  ? -17.609 18.019  -43.229 1.00 22.36 ? 35   GLY B C     1 
ATOM   2057 O O     . GLY B 1 53  ? -16.832 17.869  -42.287 1.00 21.75 ? 35   GLY B O     1 
ATOM   2058 N N     . HIS B 1 54  ? -17.447 18.957  -44.162 1.00 22.27 ? 36   HIS B N     1 
ATOM   2059 C CA    . HIS B 1 54  ? -16.284 19.844  -44.166 1.00 22.87 ? 36   HIS B CA    1 
ATOM   2060 C C     . HIS B 1 54  ? -16.084 20.731  -42.924 1.00 22.34 ? 36   HIS B C     1 
ATOM   2061 O O     . HIS B 1 54  ? -14.979 21.224  -42.719 1.00 21.60 ? 36   HIS B O     1 
ATOM   2062 C CB    . HIS B 1 54  ? -16.263 20.681  -45.455 1.00 23.15 ? 36   HIS B CB    1 
ATOM   2063 C CG    . HIS B 1 54  ? -17.498 21.499  -45.651 1.00 24.56 ? 36   HIS B CG    1 
ATOM   2064 N ND1   . HIS B 1 54  ? -17.677 22.720  -45.048 1.00 25.77 ? 36   HIS B ND1   1 
ATOM   2065 C CD2   . HIS B 1 54  ? -18.630 21.255  -46.351 1.00 26.35 ? 36   HIS B CD2   1 
ATOM   2066 C CE1   . HIS B 1 54  ? -18.861 23.203  -45.375 1.00 24.07 ? 36   HIS B CE1   1 
ATOM   2067 N NE2   . HIS B 1 54  ? -19.461 22.332  -46.163 1.00 26.70 ? 36   HIS B NE2   1 
ATOM   2068 N N     . ILE B 1 55  ? -17.111 20.922  -42.078 1.00 22.13 ? 37   ILE B N     1 
ATOM   2069 C CA    . ILE B 1 55  ? -16.941 21.735  -40.853 1.00 21.08 ? 37   ILE B CA    1 
ATOM   2070 C C     . ILE B 1 55  ? -16.380 20.949  -39.677 1.00 20.80 ? 37   ILE B C     1 
ATOM   2071 O O     . ILE B 1 55  ? -16.138 21.508  -38.587 1.00 20.01 ? 37   ILE B O     1 
ATOM   2072 C CB    . ILE B 1 55  ? -18.251 22.449  -40.390 1.00 21.52 ? 37   ILE B CB    1 
ATOM   2073 C CG1   . ILE B 1 55  ? -19.225 21.435  -39.748 1.00 20.27 ? 37   ILE B CG1   1 
ATOM   2074 C CG2   . ILE B 1 55  ? -18.845 23.256  -41.551 1.00 21.18 ? 37   ILE B CG2   1 
ATOM   2075 C CD1   . ILE B 1 55  ? -20.636 21.944  -39.517 1.00 21.13 ? 37   ILE B CD1   1 
ATOM   2076 N N     . SER B 1 56  ? -16.175 19.652  -39.884 1.00 20.03 ? 38   SER B N     1 
ATOM   2077 C CA    . SER B 1 56  ? -15.813 18.783  -38.767 1.00 19.21 ? 38   SER B CA    1 
ATOM   2078 C C     . SER B 1 56  ? -14.549 19.232  -38.038 1.00 19.17 ? 38   SER B C     1 
ATOM   2079 O O     . SER B 1 56  ? -14.505 19.210  -36.827 1.00 18.24 ? 38   SER B O     1 
ATOM   2080 C CB    . SER B 1 56  ? -15.657 17.330  -39.213 1.00 19.05 ? 38   SER B CB    1 
ATOM   2081 O OG    . SER B 1 56  ? -15.353 16.518  -38.074 1.00 19.32 ? 38   SER B OG    1 
ATOM   2082 N N     . SER B 1 57  ? -13.515 19.629  -38.779 1.00 19.56 ? 39   SER B N     1 
ATOM   2083 C CA    . SER B 1 57  ? -12.248 19.990  -38.136 1.00 21.01 ? 39   SER B CA    1 
ATOM   2084 C C     . SER B 1 57  ? -12.324 21.270  -37.290 1.00 20.94 ? 39   SER B C     1 
ATOM   2085 O O     . SER B 1 57  ? -11.756 21.316  -36.211 1.00 21.90 ? 39   SER B O     1 
ATOM   2086 C CB    . SER B 1 57  ? -11.108 20.069  -39.168 1.00 21.25 ? 39   SER B CB    1 
ATOM   2087 O OG    . SER B 1 57  ? -10.706 18.770  -39.589 1.00 21.37 ? 39   SER B OG    1 
ATOM   2088 N N     . ILE B 1 58  ? -12.999 22.301  -37.796 1.00 21.12 ? 40   ILE B N     1 
ATOM   2089 C CA    . ILE B 1 58  ? -13.180 23.561  -37.075 1.00 22.35 ? 40   ILE B CA    1 
ATOM   2090 C C     . ILE B 1 58  ? -13.971 23.285  -35.796 1.00 20.61 ? 40   ILE B C     1 
ATOM   2091 O O     . ILE B 1 58  ? -13.662 23.813  -34.725 1.00 21.11 ? 40   ILE B O     1 
ATOM   2092 C CB    . ILE B 1 58  ? -13.911 24.610  -37.958 1.00 22.75 ? 40   ILE B CB    1 
ATOM   2093 C CG1   . ILE B 1 58  ? -12.988 25.097  -39.078 1.00 24.68 ? 40   ILE B CG1   1 
ATOM   2094 C CG2   . ILE B 1 58  ? -14.496 25.773  -37.109 1.00 24.09 ? 40   ILE B CG2   1 
ATOM   2095 C CD1   . ILE B 1 58  ? -13.693 26.046  -40.068 1.00 25.01 ? 40   ILE B CD1   1 
ATOM   2096 N N     . ASP B 1 59  ? -14.976 22.432  -35.922 1.00 19.94 ? 41   ASP B N     1 
ATOM   2097 C CA    . ASP B 1 59  ? -15.792 21.997  -34.775 1.00 18.08 ? 41   ASP B CA    1 
ATOM   2098 C C     . ASP B 1 59  ? -14.979 21.265  -33.702 1.00 17.81 ? 41   ASP B C     1 
ATOM   2099 O O     . ASP B 1 59  ? -14.966 21.653  -32.532 1.00 16.43 ? 41   ASP B O     1 
ATOM   2100 C CB    . ASP B 1 59  ? -16.920 21.096  -35.283 1.00 18.24 ? 41   ASP B CB    1 
ATOM   2101 C CG    . ASP B 1 59  ? -17.684 20.416  -34.145 1.00 17.60 ? 41   ASP B CG    1 
ATOM   2102 O OD1   . ASP B 1 59  ? -18.247 21.119  -33.284 1.00 16.65 ? 41   ASP B OD1   1 
ATOM   2103 O OD2   . ASP B 1 59  ? -17.713 19.177  -34.117 1.00 18.45 ? 41   ASP B OD2   1 
ATOM   2104 N N     . ILE B 1 60  ? -14.296 20.196  -34.114 1.00 17.95 ? 42   ILE B N     1 
ATOM   2105 C CA    . ILE B 1 60  ? -13.533 19.363  -33.198 1.00 17.87 ? 42   ILE B CA    1 
ATOM   2106 C C     . ILE B 1 60  ? -12.438 20.148  -32.495 1.00 18.02 ? 42   ILE B C     1 
ATOM   2107 O O     . ILE B 1 60  ? -12.257 20.026  -31.273 1.00 18.37 ? 42   ILE B O     1 
ATOM   2108 C CB    . ILE B 1 60  ? -12.932 18.134  -33.966 1.00 17.54 ? 42   ILE B CB    1 
ATOM   2109 C CG1   . ILE B 1 60  ? -14.048 17.140  -34.345 1.00 18.29 ? 42   ILE B CG1   1 
ATOM   2110 C CG2   . ILE B 1 60  ? -11.818 17.488  -33.152 1.00 18.34 ? 42   ILE B CG2   1 
ATOM   2111 C CD1   . ILE B 1 60  ? -14.721 16.473  -33.162 1.00 18.81 ? 42   ILE B CD1   1 
ATOM   2112 N N     . ASN B 1 61  ? -11.726 20.962  -33.268 1.00 19.35 ? 43   ASN B N     1 
ATOM   2113 C CA    . ASN B 1 61  ? -10.617 21.754  -32.743 1.00 19.98 ? 43   ASN B CA    1 
ATOM   2114 C C     . ASN B 1 61  ? -11.117 22.756  -31.689 1.00 19.63 ? 43   ASN B C     1 
ATOM   2115 O O     . ASN B 1 61  ? -10.491 22.915  -30.637 1.00 18.79 ? 43   ASN B O     1 
ATOM   2116 C CB    . ASN B 1 61  ? -9.813  22.394  -33.883 1.00 20.97 ? 43   ASN B CB    1 
ATOM   2117 C CG    . ASN B 1 61  ? -9.014  21.351  -34.700 1.00 23.24 ? 43   ASN B CG    1 
ATOM   2118 O OD1   . ASN B 1 61  ? -8.574  20.331  -34.171 1.00 25.98 ? 43   ASN B OD1   1 
ATOM   2119 N ND2   . ASN B 1 61  ? -8.833  21.618  -35.986 1.00 26.89 ? 43   ASN B ND2   1 
ATOM   2120 N N     . SER B 1 62  ? -12.290 23.337  -31.936 1.00 19.14 ? 44   SER B N     1 
ATOM   2121 C CA    . SER B 1 62  ? -12.922 24.269  -30.995 1.00 19.31 ? 44   SER B CA    1 
ATOM   2122 C C     . SER B 1 62  ? -13.390 23.527  -29.739 1.00 18.66 ? 44   SER B C     1 
ATOM   2123 O O     . SER B 1 62  ? -13.232 24.008  -28.611 1.00 18.72 ? 44   SER B O     1 
ATOM   2124 C CB    . SER B 1 62  ? -14.098 24.983  -31.661 1.00 19.59 ? 44   SER B CB    1 
ATOM   2125 O OG    . SER B 1 62  ? -13.631 25.954  -32.577 1.00 24.21 ? 44   SER B OG    1 
ATOM   2126 N N     . SER B 1 63  ? -13.963 22.342  -29.948 1.00 16.94 ? 45   SER B N     1 
ATOM   2127 C CA    . SER B 1 63  ? -14.388 21.498  -28.842 1.00 16.87 ? 45   SER B CA    1 
ATOM   2128 C C     . SER B 1 63  ? -13.221 21.098  -27.967 1.00 17.33 ? 45   SER B C     1 
ATOM   2129 O O     . SER B 1 63  ? -13.341 21.079  -26.755 1.00 15.64 ? 45   SER B O     1 
ATOM   2130 C CB    . SER B 1 63  ? -15.133 20.264  -29.353 1.00 16.47 ? 45   SER B CB    1 
ATOM   2131 O OG    . SER B 1 63  ? -16.338 20.658  -29.969 1.00 17.99 ? 45   SER B OG    1 
ATOM   2132 N N     . ARG B 1 64  ? -12.083 20.778  -28.588 1.00 18.50 ? 46   ARG B N     1 
ATOM   2133 C CA    . ARG B 1 64  ? -10.918 20.367  -27.804 1.00 20.07 ? 46   ARG B CA    1 
ATOM   2134 C C     . ARG B 1 64  ? -10.443 21.485  -26.904 1.00 20.49 ? 46   ARG B C     1 
ATOM   2135 O O     . ARG B 1 64  ? -10.181 21.262  -25.718 1.00 20.59 ? 46   ARG B O     1 
ATOM   2136 C CB    . ARG B 1 64  ? -9.781  19.887  -28.703 1.00 20.72 ? 46   ARG B CB    1 
ATOM   2137 C CG    . ARG B 1 64  ? -8.610  19.279  -27.928 1.00 22.39 ? 46   ARG B CG    1 
ATOM   2138 C CD    . ARG B 1 64  ? -7.496  18.867  -28.895 1.00 26.58 ? 46   ARG B CD    1 
ATOM   2139 N NE    . ARG B 1 64  ? -7.972  17.876  -29.857 1.00 29.92 ? 46   ARG B NE    1 
ATOM   2140 C CZ    . ARG B 1 64  ? -8.218  18.109  -31.146 1.00 31.02 ? 46   ARG B CZ    1 
ATOM   2141 N NH1   . ARG B 1 64  ? -8.001  19.307  -31.674 1.00 31.48 ? 46   ARG B NH1   1 
ATOM   2142 N NH2   . ARG B 1 64  ? -8.655  17.120  -31.923 1.00 32.33 ? 46   ARG B NH2   1 
ATOM   2143 N N     . LYS B 1 65  ? -10.348 22.691  -27.463 1.00 21.75 ? 47   LYS B N     1 
ATOM   2144 C CA    . LYS B 1 65  ? -9.908  23.855  -26.686 1.00 22.26 ? 47   LYS B CA    1 
ATOM   2145 C C     . LYS B 1 65  ? -10.849 24.111  -25.520 1.00 21.91 ? 47   LYS B C     1 
ATOM   2146 O O     . LYS B 1 65  ? -10.400 24.315  -24.393 1.00 21.87 ? 47   LYS B O     1 
ATOM   2147 C CB    . LYS B 1 65  ? -9.786  25.113  -27.549 1.00 22.62 ? 47   LYS B CB    1 
ATOM   2148 C CG    . LYS B 1 65  ? -9.183  26.298  -26.769 1.00 23.71 ? 47   LYS B CG    1 
ATOM   2149 C CD    . LYS B 1 65  ? -9.021  27.564  -27.579 1.00 25.65 ? 47   LYS B CD    1 
ATOM   2150 C CE    . LYS B 1 65  ? -7.919  28.443  -26.965 1.00 30.77 ? 47   LYS B CE    1 
ATOM   2151 N NZ    . LYS B 1 65  ? -7.753  29.738  -27.694 1.00 33.52 ? 47   LYS B NZ    1 
ATOM   2152 N N     . PHE B 1 66  ? -12.151 24.072  -25.808 1.00 20.42 ? 48   PHE B N     1 
ATOM   2153 C CA    . PHE B 1 66  ? -13.202 24.223  -24.796 1.00 20.69 ? 48   PHE B CA    1 
ATOM   2154 C C     . PHE B 1 66  ? -13.072 23.222  -23.642 1.00 20.95 ? 48   PHE B C     1 
ATOM   2155 O O     . PHE B 1 66  ? -13.102 23.593  -22.466 1.00 21.97 ? 48   PHE B O     1 
ATOM   2156 C CB    . PHE B 1 66  ? -14.580 24.147  -25.481 1.00 19.39 ? 48   PHE B CB    1 
ATOM   2157 C CG    . PHE B 1 66  ? -15.739 24.422  -24.551 1.00 19.32 ? 48   PHE B CG    1 
ATOM   2158 C CD1   . PHE B 1 66  ? -16.099 25.733  -24.229 1.00 20.65 ? 48   PHE B CD1   1 
ATOM   2159 C CD2   . PHE B 1 66  ? -16.467 23.369  -23.998 1.00 18.40 ? 48   PHE B CD2   1 
ATOM   2160 C CE1   . PHE B 1 66  ? -17.183 25.987  -23.364 1.00 20.04 ? 48   PHE B CE1   1 
ATOM   2161 C CE2   . PHE B 1 66  ? -17.542 23.604  -23.133 1.00 19.24 ? 48   PHE B CE2   1 
ATOM   2162 C CZ    . PHE B 1 66  ? -17.901 24.939  -22.808 1.00 18.01 ? 48   PHE B CZ    1 
ATOM   2163 N N     . LEU B 1 67  ? -12.908 21.949  -23.984 1.00 21.14 ? 49   LEU B N     1 
ATOM   2164 C CA    . LEU B 1 67  ? -12.840 20.892  -23.013 1.00 21.66 ? 49   LEU B CA    1 
ATOM   2165 C C     . LEU B 1 67  ? -11.541 20.910  -22.211 1.00 22.39 ? 49   LEU B C     1 
ATOM   2166 O O     . LEU B 1 67  ? -11.552 20.609  -21.022 1.00 22.15 ? 49   LEU B O     1 
ATOM   2167 C CB    . LEU B 1 67  ? -12.996 19.546  -23.727 1.00 21.50 ? 49   LEU B CB    1 
ATOM   2168 C CG    . LEU B 1 67  ? -12.992 18.273  -22.892 1.00 21.32 ? 49   LEU B CG    1 
ATOM   2169 C CD1   . LEU B 1 67  ? -14.007 18.332  -21.748 1.00 19.64 ? 49   LEU B CD1   1 
ATOM   2170 C CD2   . LEU B 1 67  ? -13.275 17.093  -23.823 1.00 21.40 ? 49   LEU B CD2   1 
ATOM   2171 N N     . GLN B 1 68  ? -10.433 21.247  -22.864 1.00 24.70 ? 50   GLN B N     1 
ATOM   2172 C CA    . GLN B 1 68  ? -9.114  21.166  -22.206 1.00 27.10 ? 50   GLN B CA    1 
ATOM   2173 C C     . GLN B 1 68  ? -8.989  22.127  -21.018 1.00 27.45 ? 50   GLN B C     1 
ATOM   2174 O O     . GLN B 1 68  ? -8.278  21.831  -20.055 1.00 28.53 ? 50   GLN B O     1 
ATOM   2175 C CB    . GLN B 1 68  ? -7.952  21.263  -23.217 1.00 27.26 ? 50   GLN B CB    1 
ATOM   2176 C CG    . GLN B 1 68  ? -7.900  20.030  -24.134 1.00 28.43 ? 50   GLN B CG    1 
ATOM   2177 C CD    . GLN B 1 68  ? -6.599  19.842  -24.887 1.00 29.00 ? 50   GLN B CD    1 
ATOM   2178 O OE1   . GLN B 1 68  ? -6.160  20.716  -25.642 1.00 31.43 ? 50   GLN B OE1   1 
ATOM   2179 N NE2   . GLN B 1 68  ? -5.988  18.670  -24.714 1.00 30.30 ? 50   GLN B NE2   1 
ATOM   2180 N N     . ARG B 1 69  ? -9.744  23.228  -21.068 1.00 27.78 ? 51   ARG B N     1 
ATOM   2181 C CA    . ARG B 1 69  ? -9.934  24.156  -19.939 1.00 28.33 ? 51   ARG B CA    1 
ATOM   2182 C C     . ARG B 1 69  ? -10.385 23.482  -18.638 1.00 28.33 ? 51   ARG B C     1 
ATOM   2183 O O     . ARG B 1 69  ? -10.115 23.994  -17.534 1.00 29.28 ? 51   ARG B O     1 
ATOM   2184 C CB    . ARG B 1 69  ? -10.979 25.212  -20.310 1.00 28.43 ? 51   ARG B CB    1 
ATOM   2185 C CG    . ARG B 1 69  ? -10.656 26.020  -21.556 1.00 28.70 ? 51   ARG B CG    1 
ATOM   2186 N NE    . ARG B 1 69  ? -10.170 29.931  -19.651 1.00 58.39 ? 51   ARG B NE    1 
ATOM   2187 C CZ    . ARG B 1 69  ? -10.336 30.510  -18.465 1.00 58.85 ? 51   ARG B CZ    1 
ATOM   2188 N NH1   . ARG B 1 69  ? -9.503  30.233  -17.471 1.00 58.57 ? 51   ARG B NH1   1 
ATOM   2189 N NH2   . ARG B 1 69  ? -11.335 31.363  -18.273 1.00 58.33 ? 51   ARG B NH2   1 
ATOM   2190 N N     . PHE B 1 70  ? -11.086 22.356  -18.763 1.00 27.72 ? 52   PHE B N     1 
ATOM   2191 C CA    . PHE B 1 70  ? -11.539 21.572  -17.606 1.00 27.77 ? 52   PHE B CA    1 
ATOM   2192 C C     . PHE B 1 70  ? -10.597 20.425  -17.254 1.00 28.27 ? 52   PHE B C     1 
ATOM   2193 O O     . PHE B 1 70  ? -10.596 19.931  -16.116 1.00 28.05 ? 52   PHE B O     1 
ATOM   2194 C CB    . PHE B 1 70  ? -12.948 21.026  -17.842 1.00 26.99 ? 52   PHE B CB    1 
ATOM   2195 C CG    . PHE B 1 70  ? -13.983 22.098  -17.942 1.00 25.84 ? 52   PHE B CG    1 
ATOM   2196 C CD1   . PHE B 1 70  ? -14.619 22.572  -16.805 1.00 24.02 ? 52   PHE B CD1   1 
ATOM   2197 C CD2   . PHE B 1 70  ? -14.294 22.664  -19.177 1.00 24.62 ? 52   PHE B CD2   1 
ATOM   2198 C CE1   . PHE B 1 70  ? -15.567 23.590  -16.905 1.00 25.58 ? 52   PHE B CE1   1 
ATOM   2199 C CE2   . PHE B 1 70  ? -15.232 23.669  -19.283 1.00 24.61 ? 52   PHE B CE2   1 
ATOM   2200 C CZ    . PHE B 1 70  ? -15.871 24.130  -18.150 1.00 23.73 ? 52   PHE B CZ    1 
ATOM   2201 N N     . LEU B 1 71  ? -9.823  19.998  -18.245 1.00 29.29 ? 53   LEU B N     1 
ATOM   2202 C CA    . LEU B 1 71  ? -8.858  18.924  -18.070 1.00 30.53 ? 53   LEU B CA    1 
ATOM   2203 C C     . LEU B 1 71  ? -7.524  19.433  -17.541 1.00 31.31 ? 53   LEU B C     1 
ATOM   2204 O O     . LEU B 1 71  ? -6.703  18.641  -17.088 1.00 31.59 ? 53   LEU B O     1 
ATOM   2205 C CB    . LEU B 1 71  ? -8.620  18.204  -19.397 1.00 30.53 ? 53   LEU B CB    1 
ATOM   2206 C CG    . LEU B 1 71  ? -9.846  17.615  -20.095 1.00 30.34 ? 53   LEU B CG    1 
ATOM   2207 C CD1   . LEU B 1 71  ? -9.391  16.891  -21.371 1.00 29.42 ? 53   LEU B CD1   1 
ATOM   2208 C CD2   . LEU B 1 71  ? -10.640 16.693  -19.168 1.00 29.05 ? 53   LEU B CD2   1 
ATOM   2209 N N     . ARG B 1 72  ? -7.308  20.745  -17.610 1.00 32.21 ? 54   ARG B N     1 
ATOM   2210 C CA    . ARG B 1 72  ? -6.056  21.350  -17.136 1.00 33.25 ? 54   ARG B CA    1 
ATOM   2211 C C     . ARG B 1 72  ? -6.152  21.817  -15.690 1.00 33.38 ? 54   ARG B C     1 
ATOM   2212 O O     . ARG B 1 72  ? -6.545  21.057  -14.794 1.00 33.55 ? 54   ARG B O     1 
ATOM   2213 C CB    . ARG B 1 72  ? -5.635  22.512  -18.046 1.00 33.31 ? 54   ARG B CB    1 
ATOM   2214 C CG    . ARG B 1 72  ? -6.490  23.789  -17.897 1.00 35.21 ? 54   ARG B CG    1 
ATOM   2215 N NE    . ARG B 1 72  ? -8.010  26.296  -16.215 1.00 65.72 ? 54   ARG B NE    1 
ATOM   2216 C CZ    . ARG B 1 72  ? -6.837  26.522  -15.629 1.00 65.88 ? 54   ARG B CZ    1 
ATOM   2217 N NH1   . ARG B 1 72  ? -6.718  26.411  -14.311 1.00 65.84 ? 54   ARG B NH1   1 
ATOM   2218 N NH2   . ARG B 1 72  ? -5.783  26.860  -16.359 1.00 65.54 ? 54   ARG B NH2   1 
ATOM   2219 N N     . LYS B 1 77  ? -9.803  19.362  -11.073 1.00 28.18 ? 60   LYS B N     1 
ATOM   2220 C CA    . LYS B 1 77  ? -9.583  18.972  -12.454 1.00 28.81 ? 60   LYS B CA    1 
ATOM   2221 C C     . LYS B 1 77  ? -10.580 17.874  -12.821 1.00 27.83 ? 60   LYS B C     1 
ATOM   2222 O O     . LYS B 1 77  ? -10.839 16.969  -12.026 1.00 27.68 ? 60   LYS B O     1 
ATOM   2223 C CB    . LYS B 1 77  ? -8.148  18.464  -12.616 1.00 28.86 ? 60   LYS B CB    1 
ATOM   2224 C CG    . LYS B 1 77  ? -7.761  18.039  -14.017 1.00 30.53 ? 60   LYS B CG    1 
ATOM   2225 C CD    . LYS B 1 77  ? -6.388  17.349  -13.996 1.00 30.72 ? 60   LYS B CD    1 
ATOM   2226 C CE    . LYS B 1 77  ? -6.046  16.694  -15.337 1.00 32.34 ? 60   LYS B CE    1 
ATOM   2227 N NZ    . LYS B 1 77  ? -7.164  15.861  -15.930 1.00 32.33 ? 60   LYS B NZ    1 
ATOM   2228 N N     . THR B 1 78  ? -11.156 17.961  -14.021 1.00 27.49 ? 61   THR B N     1 
ATOM   2229 C CA    . THR B 1 78  ? -12.006 16.879  -14.516 1.00 26.46 ? 61   THR B CA    1 
ATOM   2230 C C     . THR B 1 78  ? -11.114 15.695  -14.894 1.00 26.49 ? 61   THR B C     1 
ATOM   2231 O O     . THR B 1 78  ? -10.050 15.880  -15.486 1.00 26.40 ? 61   THR B O     1 
ATOM   2232 C CB    . THR B 1 78  ? -12.860 17.352  -15.723 1.00 26.71 ? 61   THR B CB    1 
ATOM   2233 O OG1   . THR B 1 78  ? -13.708 18.429  -15.305 1.00 23.58 ? 61   THR B OG1   1 
ATOM   2234 C CG2   . THR B 1 78  ? -13.723 16.211  -16.268 1.00 26.79 ? 61   THR B CG2   1 
ATOM   2235 N N     . GLY B 1 79  ? -11.550 14.494  -14.523 1.00 26.94 ? 62   GLY B N     1 
ATOM   2236 C CA    . GLY B 1 79  ? -10.814 13.258  -14.792 1.00 27.55 ? 62   GLY B CA    1 
ATOM   2237 C C     . GLY B 1 79  ? -10.781 12.854  -16.252 1.00 28.35 ? 62   GLY B C     1 
ATOM   2238 O O     . GLY B 1 79  ? -11.455 13.449  -17.088 1.00 28.23 ? 62   GLY B O     1 
ATOM   2239 N N     . THR B 1 80  ? -9.987  11.833  -16.552 1.00 28.27 ? 63   THR B N     1 
ATOM   2240 C CA    . THR B 1 80  ? -9.770  11.377  -17.923 1.00 28.51 ? 63   THR B CA    1 
ATOM   2241 C C     . THR B 1 80  ? -9.960  9.848   -18.047 1.00 28.03 ? 63   THR B C     1 
ATOM   2242 O O     . THR B 1 80  ? -9.525  9.240   -19.026 1.00 28.89 ? 63   THR B O     1 
ATOM   2243 C CB    . THR B 1 80  ? -8.391  11.840  -18.488 1.00 28.88 ? 63   THR B CB    1 
ATOM   2244 O OG1   . THR B 1 80  ? -7.328  11.413  -17.624 1.00 30.87 ? 63   THR B OG1   1 
ATOM   2245 C CG2   . THR B 1 80  ? -8.333  13.364  -18.638 1.00 28.92 ? 63   THR B CG2   1 
ATOM   2246 N N     . SER B 1 81  ? -10.641 9.254   -17.073 1.00 27.89 ? 64   SER B N     1 
ATOM   2247 C CA    . SER B 1 81  ? -10.934 7.813   -17.086 1.00 28.17 ? 64   SER B CA    1 
ATOM   2248 C C     . SER B 1 81  ? -11.981 7.382   -18.117 1.00 27.65 ? 64   SER B C     1 
ATOM   2249 O O     . SER B 1 81  ? -11.776 6.396   -18.832 1.00 27.19 ? 64   SER B O     1 
ATOM   2250 C CB    . SER B 1 81  ? -11.304 7.288   -15.689 1.00 28.73 ? 64   SER B CB    1 
ATOM   2251 O OG    . SER B 1 81  ? -12.546 7.781   -15.214 1.00 29.61 ? 64   SER B OG    1 
ATOM   2252 N N     . CYS B 1 82  ? -13.087 8.120   -18.213 1.00 26.63 ? 65   CYS B N     1 
ATOM   2253 C CA    . CYS B 1 82  ? -14.186 7.691   -19.074 1.00 24.96 ? 65   CYS B CA    1 
ATOM   2254 C C     . CYS B 1 82  ? -15.078 8.840   -19.535 1.00 23.28 ? 65   CYS B C     1 
ATOM   2255 O O     . CYS B 1 82  ? -15.434 9.737   -18.758 1.00 23.44 ? 65   CYS B O     1 
ATOM   2256 C CB    . CYS B 1 82  ? -15.045 6.649   -18.349 1.00 24.59 ? 65   CYS B CB    1 
ATOM   2257 S SG    . CYS B 1 82  ? -16.089 5.616   -19.411 1.00 28.84 ? 65   CYS B SG    1 
ATOM   2258 N N     . ALA B 1 83  ? -15.480 8.760   -20.792 1.00 21.29 ? 66   ALA B N     1 
ATOM   2259 C CA    . ALA B 1 83  ? -16.473 9.685   -21.353 1.00 19.07 ? 66   ALA B CA    1 
ATOM   2260 C C     . ALA B 1 83  ? -17.667 8.927   -21.946 1.00 18.31 ? 66   ALA B C     1 
ATOM   2261 O O     . ALA B 1 83  ? -17.576 7.718   -22.259 1.00 17.17 ? 66   ALA B O     1 
ATOM   2262 C CB    . ALA B 1 83  ? -15.823 10.537  -22.422 1.00 19.67 ? 66   ALA B CB    1 
ATOM   2263 N N     . LEU B 1 84  ? -18.768 9.655   -22.128 1.00 16.44 ? 67   LEU B N     1 
ATOM   2264 C CA    . LEU B 1 84  ? -19.996 9.150   -22.752 1.00 15.61 ? 67   LEU B CA    1 
ATOM   2265 C C     . LEU B 1 84  ? -20.322 10.091  -23.918 1.00 15.53 ? 67   LEU B C     1 
ATOM   2266 O O     . LEU B 1 84  ? -20.424 11.295  -23.712 1.00 14.85 ? 67   LEU B O     1 
ATOM   2267 C CB    . LEU B 1 84  ? -21.170 9.131   -21.766 1.00 15.90 ? 67   LEU B CB    1 
ATOM   2268 C CG    . LEU B 1 84  ? -22.548 8.733   -22.339 1.00 15.56 ? 67   LEU B CG    1 
ATOM   2269 C CD1   . LEU B 1 84  ? -22.530 7.305   -22.973 1.00 15.62 ? 67   LEU B CD1   1 
ATOM   2270 C CD2   . LEU B 1 84  ? -23.722 8.892   -21.312 1.00 15.83 ? 67   LEU B CD2   1 
ATOM   2271 N N     . ASP B 1 85  ? -20.387 9.525   -25.114 1.00 14.23 ? 68   ASP B N     1 
ATOM   2272 C CA    . ASP B 1 85  ? -20.689 10.258  -26.353 1.00 13.58 ? 68   ASP B CA    1 
ATOM   2273 C C     . ASP B 1 85  ? -22.165 10.002  -26.662 1.00 13.72 ? 68   ASP B C     1 
ATOM   2274 O O     . ASP B 1 85  ? -22.531 8.899   -27.059 1.00 13.06 ? 68   ASP B O     1 
ATOM   2275 C CB    . ASP B 1 85  ? -19.767 9.763   -27.489 1.00 13.61 ? 68   ASP B CB    1 
ATOM   2276 C CG    . ASP B 1 85  ? -19.821 10.658  -28.723 1.00 16.08 ? 68   ASP B CG    1 
ATOM   2277 O OD1   . ASP B 1 85  ? -20.677 11.581  -28.766 1.00 19.21 ? 68   ASP B OD1   1 
ATOM   2278 O OD2   . ASP B 1 85  ? -19.017 10.446  -29.654 1.00 16.35 ? 68   ASP B OD2   1 
ATOM   2279 N N     . CYS B 1 86  ? -23.008 11.012  -26.431 1.00 13.06 ? 69   CYS B N     1 
ATOM   2280 C CA    . CYS B 1 86  ? -24.471 10.917  -26.628 1.00 13.08 ? 69   CYS B CA    1 
ATOM   2281 C C     . CYS B 1 86  ? -24.924 11.346  -28.031 1.00 13.03 ? 69   CYS B C     1 
ATOM   2282 O O     . CYS B 1 86  ? -24.603 12.442  -28.483 1.00 13.05 ? 69   CYS B O     1 
ATOM   2283 C CB    . CYS B 1 86  ? -25.204 11.776  -25.614 1.00 14.50 ? 69   CYS B CB    1 
ATOM   2284 S SG    . CYS B 1 86  ? -24.803 11.358  -23.883 1.00 15.19 ? 69   CYS B SG    1 
ATOM   2285 N N     . GLY B 1 87  ? -25.724 10.499  -28.677 1.00 12.39 ? 70   GLY B N     1 
ATOM   2286 C CA    . GLY B 1 87  ? -26.068 10.700  -30.086 1.00 12.21 ? 70   GLY B CA    1 
ATOM   2287 C C     . GLY B 1 87  ? -24.781 10.653  -30.894 1.00 12.77 ? 70   GLY B C     1 
ATOM   2288 O O     . GLY B 1 87  ? -24.570 11.438  -31.810 1.00 13.63 ? 70   GLY B O     1 
ATOM   2289 N N     . ALA B 1 88  ? -23.955 9.668   -30.567 1.00 12.38 ? 71   ALA B N     1 
ATOM   2290 C CA    . ALA B 1 88  ? -22.595 9.560   -31.075 1.00 13.18 ? 71   ALA B CA    1 
ATOM   2291 C C     . ALA B 1 88  ? -22.518 9.304   -32.593 1.00 13.67 ? 71   ALA B C     1 
ATOM   2292 O O     . ALA B 1 88  ? -21.484 9.603   -33.215 1.00 14.25 ? 71   ALA B O     1 
ATOM   2293 C CB    . ALA B 1 88  ? -21.839 8.450   -30.281 1.00 13.26 ? 71   ALA B CB    1 
ATOM   2294 N N     . GLY B 1 89  ? -23.586 8.756   -33.181 1.00 14.15 ? 72   GLY B N     1 
ATOM   2295 C CA    . GLY B 1 89  ? -23.545 8.350   -34.603 1.00 14.78 ? 72   GLY B CA    1 
ATOM   2296 C C     . GLY B 1 89  ? -22.419 7.355   -34.866 1.00 15.63 ? 72   GLY B C     1 
ATOM   2297 O O     . GLY B 1 89  ? -22.230 6.424   -34.092 1.00 15.97 ? 72   GLY B O     1 
ATOM   2298 N N     . ILE B 1 90  ? -21.661 7.567   -35.946 1.00 15.91 ? 73   ILE B N     1 
ATOM   2299 C CA    . ILE B 1 90  ? -20.538 6.669   -36.280 1.00 17.00 ? 73   ILE B CA    1 
ATOM   2300 C C     . ILE B 1 90  ? -19.265 6.923   -35.468 1.00 17.74 ? 73   ILE B C     1 
ATOM   2301 O O     . ILE B 1 90  ? -18.278 6.200   -35.641 1.00 18.67 ? 73   ILE B O     1 
ATOM   2302 C CB    . ILE B 1 90  ? -20.207 6.695   -37.797 1.00 15.80 ? 73   ILE B CB    1 
ATOM   2303 C CG1   . ILE B 1 90  ? -19.651 8.080   -38.218 1.00 16.70 ? 73   ILE B CG1   1 
ATOM   2304 C CG2   . ILE B 1 90  ? -21.437 6.231   -38.610 1.00 17.54 ? 73   ILE B CG2   1 
ATOM   2305 C CD1   . ILE B 1 90  ? -18.993 8.086   -39.626 1.00 18.97 ? 73   ILE B CD1   1 
ATOM   2306 N N     . GLY B 1 91  ? -19.284 7.942   -34.605 1.00 17.30 ? 74   GLY B N     1 
ATOM   2307 C CA    . GLY B 1 91  ? -18.177 8.185   -33.689 1.00 17.67 ? 74   GLY B CA    1 
ATOM   2308 C C     . GLY B 1 91  ? -17.233 9.265   -34.170 1.00 18.31 ? 74   GLY B C     1 
ATOM   2309 O O     . GLY B 1 91  ? -16.041 9.234   -33.846 1.00 19.05 ? 74   GLY B O     1 
ATOM   2310 N N     . ARG B 1 92  ? -17.764 10.226  -34.931 1.00 17.79 ? 75   ARG B N     1 
ATOM   2311 C CA    . ARG B 1 92  ? -16.966 11.358  -35.407 1.00 17.45 ? 75   ARG B CA    1 
ATOM   2312 C C     . ARG B 1 92  ? -16.255 12.028  -34.243 1.00 16.85 ? 75   ARG B C     1 
ATOM   2313 O O     . ARG B 1 92  ? -15.052 12.301  -34.312 1.00 16.39 ? 75   ARG B O     1 
ATOM   2314 C CB    . ARG B 1 92  ? -17.844 12.370  -36.147 1.00 17.96 ? 75   ARG B CB    1 
ATOM   2315 C CG    . ARG B 1 92  ? -17.091 13.593  -36.689 1.00 16.30 ? 75   ARG B CG    1 
ATOM   2316 C CD    . ARG B 1 92  ? -18.052 14.637  -37.202 1.00 15.00 ? 75   ARG B CD    1 
ATOM   2317 N NE    . ARG B 1 92  ? -18.861 15.226  -36.140 1.00 16.79 ? 75   ARG B NE    1 
ATOM   2318 C CZ    . ARG B 1 92  ? -18.547 16.346  -35.492 1.00 17.14 ? 75   ARG B CZ    1 
ATOM   2319 N NH1   . ARG B 1 92  ? -17.443 16.988  -35.798 1.00 16.62 ? 75   ARG B NH1   1 
ATOM   2320 N NH2   . ARG B 1 92  ? -19.338 16.832  -34.541 1.00 18.25 ? 75   ARG B NH2   1 
ATOM   2321 N N     . ILE B 1 93  ? -16.999 12.255  -33.160 1.00 15.35 ? 76   ILE B N     1 
ATOM   2322 C CA    . ILE B 1 93  ? -16.473 12.948  -31.992 1.00 15.63 ? 76   ILE B CA    1 
ATOM   2323 C C     . ILE B 1 93  ? -15.646 11.981  -31.155 1.00 15.72 ? 76   ILE B C     1 
ATOM   2324 O O     . ILE B 1 93  ? -14.606 12.344  -30.612 1.00 16.42 ? 76   ILE B O     1 
ATOM   2325 C CB    . ILE B 1 93  ? -17.605 13.552  -31.120 1.00 15.05 ? 76   ILE B CB    1 
ATOM   2326 C CG1   . ILE B 1 93  ? -18.429 14.540  -31.971 1.00 14.96 ? 76   ILE B CG1   1 
ATOM   2327 C CG2   . ILE B 1 93  ? -17.011 14.268  -29.901 1.00 17.43 ? 76   ILE B CG2   1 
ATOM   2328 C CD1   . ILE B 1 93  ? -19.707 15.027  -31.259 1.00 15.97 ? 76   ILE B CD1   1 
ATOM   2329 N N     . THR B 1 94  ? -16.160 10.770  -30.992 1.00 16.34 ? 77   THR B N     1 
ATOM   2330 C CA    . THR B 1 94  ? -15.444 9.734   -30.252 1.00 17.12 ? 77   THR B CA    1 
ATOM   2331 C C     . THR B 1 94  ? -14.028 9.576   -30.841 1.00 17.83 ? 77   THR B C     1 
ATOM   2332 O O     . THR B 1 94  ? -13.069 9.472   -30.094 1.00 18.52 ? 77   THR B O     1 
ATOM   2333 C CB    . THR B 1 94  ? -16.250 8.406   -30.209 1.00 17.22 ? 77   THR B CB    1 
ATOM   2334 O OG1   . THR B 1 94  ? -17.274 8.514   -29.203 1.00 17.34 ? 77   THR B OG1   1 
ATOM   2335 C CG2   . THR B 1 94  ? -15.353 7.206   -29.817 1.00 17.86 ? 77   THR B CG2   1 
ATOM   2336 N N     . LYS B 1 95  ? -13.904 9.612   -32.162 1.00 18.89 ? 78   LYS B N     1 
ATOM   2337 C CA    . LYS B 1 95  ? -12.616 9.378   -32.825 1.00 20.99 ? 78   LYS B CA    1 
ATOM   2338 C C     . LYS B 1 95  ? -11.614 10.477  -32.549 1.00 21.12 ? 78   LYS B C     1 
ATOM   2339 O O     . LYS B 1 95  ? -10.446 10.217  -32.213 1.00 21.00 ? 78   LYS B O     1 
ATOM   2340 C CB    . LYS B 1 95  ? -12.775 9.236   -34.345 1.00 20.66 ? 78   LYS B CB    1 
ATOM   2341 C CG    . LYS B 1 95  ? -11.537 8.638   -35.036 1.00 23.84 ? 78   LYS B CG    1 
ATOM   2342 C CD    . LYS B 1 95  ? -11.721 8.541   -36.542 1.00 23.14 ? 78   LYS B CD    1 
ATOM   2343 C CE    . LYS B 1 95  ? -10.987 7.313   -37.095 1.00 27.95 ? 78   LYS B CE    1 
ATOM   2344 N NZ    . LYS B 1 95  ? -10.823 7.423   -38.572 1.00 28.85 ? 78   LYS B NZ    1 
ATOM   2345 N N     . ARG B 1 96  ? -12.051 11.717  -32.728 1.00 21.14 ? 79   ARG B N     1 
ATOM   2346 C CA    . ARG B 1 96  ? -11.097 12.815  -32.782 1.00 21.29 ? 79   ARG B CA    1 
ATOM   2347 C C     . ARG B 1 96  ? -10.974 13.555  -31.467 1.00 21.10 ? 79   ARG B C     1 
ATOM   2348 O O     . ARG B 1 96  ? -9.930  14.143  -31.191 1.00 20.29 ? 79   ARG B O     1 
ATOM   2349 C CB    . ARG B 1 96  ? -11.438 13.766  -33.927 1.00 21.41 ? 79   ARG B CB    1 
ATOM   2350 C CG    . ARG B 1 96  ? -11.153 13.154  -35.278 1.00 22.97 ? 79   ARG B CG    1 
ATOM   2351 C CD    . ARG B 1 96  ? -11.387 14.130  -36.404 1.00 24.58 ? 79   ARG B CD    1 
ATOM   2352 N NE    . ARG B 1 96  ? -10.447 15.250  -36.361 1.00 23.56 ? 79   ARG B NE    1 
ATOM   2353 C CZ    . ARG B 1 96  ? -10.471 16.288  -37.197 1.00 23.21 ? 79   ARG B CZ    1 
ATOM   2354 N NH1   . ARG B 1 96  ? -11.405 16.383  -38.138 1.00 22.46 ? 79   ARG B NH1   1 
ATOM   2355 N NH2   . ARG B 1 96  ? -9.568  17.245  -37.072 1.00 21.60 ? 79   ARG B NH2   1 
ATOM   2356 N N     . LEU B 1 97  ? -12.032 13.512  -30.651 1.00 19.96 ? 80   LEU B N     1 
ATOM   2357 C CA    . LEU B 1 97  ? -12.040 14.284  -29.440 1.00 19.45 ? 80   LEU B CA    1 
ATOM   2358 C C     . LEU B 1 97  ? -11.902 13.453  -28.183 1.00 19.86 ? 80   LEU B C     1 
ATOM   2359 O O     . LEU B 1 97  ? -11.077 13.761  -27.321 1.00 19.87 ? 80   LEU B O     1 
ATOM   2360 C CB    . LEU B 1 97  ? -13.303 15.169  -29.376 1.00 19.73 ? 80   LEU B CB    1 
ATOM   2361 C CG    . LEU B 1 97  ? -13.436 16.026  -28.114 1.00 21.17 ? 80   LEU B CG    1 
ATOM   2362 C CD1   . LEU B 1 97  ? -12.487 17.189  -28.256 1.00 19.33 ? 80   LEU B CD1   1 
ATOM   2363 C CD2   . LEU B 1 97  ? -14.899 16.501  -27.869 1.00 19.35 ? 80   LEU B CD2   1 
ATOM   2364 N N     . LEU B 1 98  ? -12.700 12.393  -28.067 1.00 19.21 ? 81   LEU B N     1 
ATOM   2365 C CA    . LEU B 1 98  ? -12.791 11.695  -26.810 1.00 19.34 ? 81   LEU B CA    1 
ATOM   2366 C C     . LEU B 1 98  ? -11.776 10.561  -26.659 1.00 19.98 ? 81   LEU B C     1 
ATOM   2367 O O     . LEU B 1 98  ? -11.130 10.469  -25.614 1.00 20.77 ? 81   LEU B O     1 
ATOM   2368 C CB    . LEU B 1 98  ? -14.228 11.215  -26.570 1.00 19.04 ? 81   LEU B CB    1 
ATOM   2369 C CG    . LEU B 1 98  ? -15.265 12.343  -26.750 1.00 16.79 ? 81   LEU B CG    1 
ATOM   2370 C CD1   . LEU B 1 98  ? -16.658 11.728  -26.572 1.00 19.11 ? 81   LEU B CD1   1 
ATOM   2371 C CD2   . LEU B 1 98  ? -15.033 13.450  -25.752 1.00 16.88 ? 81   LEU B CD2   1 
ATOM   2372 N N     . LEU B 1 99  ? -11.646 9.693   -27.663 1.00 21.21 ? 82   LEU B N     1 
ATOM   2373 C CA    . LEU B 1 99  ? -10.702 8.558   -27.518 1.00 22.37 ? 82   LEU B CA    1 
ATOM   2374 C C     . LEU B 1 99  ? -9.267  9.009   -27.219 1.00 23.53 ? 82   LEU B C     1 
ATOM   2375 O O     . LEU B 1 99  ? -8.618  8.410   -26.345 1.00 25.00 ? 82   LEU B O     1 
ATOM   2376 C CB    . LEU B 1 99  ? -10.741 7.605   -28.718 1.00 22.04 ? 82   LEU B CB    1 
ATOM   2377 C CG    . LEU B 1 99  ? -11.922 6.628   -28.785 1.00 22.26 ? 82   LEU B CG    1 
ATOM   2378 C CD1   . LEU B 1 99  ? -12.018 6.027   -30.201 1.00 22.15 ? 82   LEU B CD1   1 
ATOM   2379 C CD2   . LEU B 1 99  ? -11.828 5.539   -27.698 1.00 21.98 ? 82   LEU B CD2   1 
ATOM   2380 N N     . PRO B 1 100 ? -8.754  10.042  -27.931 1.00 24.61 ? 83   PRO B N     1 
ATOM   2381 C CA    . PRO B 1 100 ? -7.420  10.528  -27.550 1.00 25.36 ? 83   PRO B CA    1 
ATOM   2382 C C     . PRO B 1 100 ? -7.294  11.032  -26.091 1.00 26.07 ? 83   PRO B C     1 
ATOM   2383 O O     . PRO B 1 100 ? -6.237  10.878  -25.486 1.00 26.61 ? 83   PRO B O     1 
ATOM   2384 C CB    . PRO B 1 100 ? -7.161  11.658  -28.545 1.00 25.15 ? 83   PRO B CB    1 
ATOM   2385 C CG    . PRO B 1 100 ? -8.016  11.347  -29.709 1.00 25.52 ? 83   PRO B CG    1 
ATOM   2386 C CD    . PRO B 1 100 ? -9.259  10.763  -29.114 1.00 23.80 ? 83   PRO B CD    1 
ATOM   2387 N N     . LEU B 1 101 ? -8.355  11.597  -25.522 1.00 26.42 ? 84   LEU B N     1 
ATOM   2388 C CA    . LEU B 1 101 ? -8.260  12.211  -24.196 1.00 26.33 ? 84   LEU B CA    1 
ATOM   2389 C C     . LEU B 1 101 ? -8.695  11.329  -23.025 1.00 26.51 ? 84   LEU B C     1 
ATOM   2390 O O     . LEU B 1 101 ? -8.307  11.580  -21.878 1.00 27.31 ? 84   LEU B O     1 
ATOM   2391 C CB    . LEU B 1 101 ? -9.027  13.545  -24.154 1.00 26.66 ? 84   LEU B CB    1 
ATOM   2392 C CG    . LEU B 1 101 ? -8.595  14.685  -25.089 1.00 26.00 ? 84   LEU B CG    1 
ATOM   2393 C CD1   . LEU B 1 101 ? -9.535  15.885  -24.969 1.00 25.02 ? 84   LEU B CD1   1 
ATOM   2394 C CD2   . LEU B 1 101 ? -7.159  15.126  -24.846 1.00 28.40 ? 84   LEU B CD2   1 
ATOM   2395 N N     . PHE B 1 102 ? -9.519  10.320  -23.309 1.00 25.58 ? 85   PHE B N     1 
ATOM   2396 C CA    . PHE B 1 102 ? -10.135 9.497   -22.279 1.00 25.59 ? 85   PHE B CA    1 
ATOM   2397 C C     . PHE B 1 102 ? -9.726  8.031   -22.409 1.00 26.43 ? 85   PHE B C     1 
ATOM   2398 O O     . PHE B 1 102 ? -9.652  7.495   -23.517 1.00 26.88 ? 85   PHE B O     1 
ATOM   2399 C CB    . PHE B 1 102 ? -11.668 9.678   -22.274 1.00 24.40 ? 85   PHE B CB    1 
ATOM   2400 C CG    . PHE B 1 102 ? -12.078 11.071  -21.875 1.00 22.41 ? 85   PHE B CG    1 
ATOM   2401 C CD1   . PHE B 1 102 ? -12.326 11.381  -20.544 1.00 21.17 ? 85   PHE B CD1   1 
ATOM   2402 C CD2   . PHE B 1 102 ? -12.144 12.079  -22.824 1.00 20.29 ? 85   PHE B CD2   1 
ATOM   2403 C CE1   . PHE B 1 102 ? -12.634 12.686  -20.156 1.00 18.59 ? 85   PHE B CE1   1 
ATOM   2404 C CE2   . PHE B 1 102 ? -12.459 13.397  -22.450 1.00 19.85 ? 85   PHE B CE2   1 
ATOM   2405 C CZ    . PHE B 1 102 ? -12.713 13.687  -21.115 1.00 21.71 ? 85   PHE B CZ    1 
ATOM   2406 N N     . ARG B 1 103 ? -9.449  7.403   -21.270 1.00 27.38 ? 86   ARG B N     1 
ATOM   2407 C CA    . ARG B 1 103 ? -9.040  5.991   -21.257 1.00 28.60 ? 86   ARG B CA    1 
ATOM   2408 C C     . ARG B 1 103 ? -10.117 5.047   -21.813 1.00 27.69 ? 86   ARG B C     1 
ATOM   2409 O O     . ARG B 1 103 ? -9.810  4.125   -22.573 1.00 27.57 ? 86   ARG B O     1 
ATOM   2410 C CB    . ARG B 1 103 ? -8.576  5.553   -19.865 1.00 28.88 ? 86   ARG B CB    1 
ATOM   2411 C CG    . ARG B 1 103 ? -7.127  5.958   -19.573 1.00 30.33 ? 86   ARG B CG    1 
ATOM   2412 C CD    . ARG B 1 103 ? -6.592  5.300   -18.289 1.00 31.18 ? 86   ARG B CD    1 
ATOM   2413 N NE    . ARG B 1 103 ? -6.203  3.895   -18.476 1.00 36.85 ? 86   ARG B NE    1 
ATOM   2414 C CZ    . ARG B 1 103 ? -4.966  3.482   -18.772 1.00 38.30 ? 86   ARG B CZ    1 
ATOM   2415 N NH1   . ARG B 1 103 ? -3.981  4.364   -18.926 1.00 39.95 ? 86   ARG B NH1   1 
ATOM   2416 N NH2   . ARG B 1 103 ? -4.710  2.185   -18.917 1.00 37.86 ? 86   ARG B NH2   1 
ATOM   2417 N N     . GLU B 1 104 ? -11.373 5.275   -21.451 1.00 27.28 ? 87   GLU B N     1 
ATOM   2418 C CA    . GLU B 1 104 ? -12.454 4.538   -22.099 1.00 27.21 ? 87   GLU B CA    1 
ATOM   2419 C C     . GLU B 1 104 ? -13.549 5.493   -22.541 1.00 26.51 ? 87   GLU B C     1 
ATOM   2420 O O     . GLU B 1 104 ? -13.667 6.600   -22.003 1.00 26.64 ? 87   GLU B O     1 
ATOM   2421 C CB    . GLU B 1 104 ? -13.023 3.468   -21.176 1.00 27.72 ? 87   GLU B CB    1 
ATOM   2422 C CG    . GLU B 1 104 ? -11.999 2.446   -20.690 1.00 30.27 ? 87   GLU B CG    1 
ATOM   2423 C CD    . GLU B 1 104 ? -12.627 1.443   -19.769 1.00 33.45 ? 87   GLU B CD    1 
ATOM   2424 O OE1   . GLU B 1 104 ? -12.607 1.675   -18.539 1.00 35.65 ? 87   GLU B OE1   1 
ATOM   2425 O OE2   . GLU B 1 104 ? -13.176 0.445   -20.275 1.00 34.53 ? 87   GLU B OE2   1 
ATOM   2426 N N     . VAL B 1 105 ? -14.327 5.063   -23.533 1.00 25.86 ? 88   VAL B N     1 
ATOM   2427 C CA    . VAL B 1 105 ? -15.493 5.816   -23.999 1.00 24.35 ? 88   VAL B CA    1 
ATOM   2428 C C     . VAL B 1 105 ? -16.677 4.862   -24.186 1.00 23.57 ? 88   VAL B C     1 
ATOM   2429 O O     . VAL B 1 105 ? -16.509 3.725   -24.662 1.00 24.27 ? 88   VAL B O     1 
ATOM   2430 C CB    . VAL B 1 105 ? -15.205 6.594   -25.324 1.00 23.92 ? 88   VAL B CB    1 
ATOM   2431 C CG1   . VAL B 1 105 ? -16.471 7.359   -25.790 1.00 23.82 ? 88   VAL B CG1   1 
ATOM   2432 C CG2   . VAL B 1 105 ? -14.047 7.591   -25.167 1.00 23.46 ? 88   VAL B CG2   1 
ATOM   2433 N N     . ASP B 1 106 ? -17.856 5.304   -23.761 1.00 21.98 ? 89   ASP B N     1 
ATOM   2434 C CA    . ASP B 1 106 ? -19.121 4.640   -24.093 1.00 21.08 ? 89   ASP B CA    1 
ATOM   2435 C C     . ASP B 1 106 ? -19.802 5.477   -25.179 1.00 21.21 ? 89   ASP B C     1 
ATOM   2436 O O     . ASP B 1 106 ? -19.692 6.702   -25.157 1.00 21.09 ? 89   ASP B O     1 
ATOM   2437 C CB    . ASP B 1 106 ? -20.034 4.575   -22.874 1.00 21.31 ? 89   ASP B CB    1 
ATOM   2438 C CG    . ASP B 1 106 ? -19.652 3.465   -21.897 1.00 20.88 ? 89   ASP B CG    1 
ATOM   2439 O OD1   . ASP B 1 106 ? -18.739 2.693   -22.201 1.00 23.71 ? 89   ASP B OD1   1 
ATOM   2440 O OD2   . ASP B 1 106 ? -20.278 3.384   -20.833 1.00 21.88 ? 89   ASP B OD2   1 
ATOM   2441 N N     . MET B 1 107 ? -20.480 4.810   -26.118 1.00 20.18 ? 90   MET B N     1 
ATOM   2442 C CA    . MET B 1 107 ? -21.269 5.493   -27.149 1.00 19.62 ? 90   MET B CA    1 
ATOM   2443 C C     . MET B 1 107 ? -22.729 5.117   -27.025 1.00 18.59 ? 90   MET B C     1 
ATOM   2444 O O     . MET B 1 107 ? -23.055 3.944   -26.806 1.00 19.38 ? 90   MET B O     1 
ATOM   2445 C CB    . MET B 1 107 ? -20.758 5.118   -28.540 1.00 18.62 ? 90   MET B CB    1 
ATOM   2446 C CG    . MET B 1 107 ? -19.342 5.549   -28.793 1.00 19.63 ? 90   MET B CG    1 
ATOM   2447 S SD    . MET B 1 107 ? -18.707 4.966   -30.357 1.00 21.76 ? 90   MET B SD    1 
ATOM   2448 C CE    . MET B 1 107 ? -19.725 5.770   -31.602 1.00 18.63 ? 90   MET B CE    1 
ATOM   2449 N N     . VAL B 1 108 ? -23.626 6.098   -27.146 1.00 17.65 ? 91   VAL B N     1 
ATOM   2450 C CA    . VAL B 1 108 ? -25.057 5.794   -27.166 1.00 15.90 ? 91   VAL B CA    1 
ATOM   2451 C C     . VAL B 1 108 ? -25.705 6.504   -28.364 1.00 15.40 ? 91   VAL B C     1 
ATOM   2452 O O     . VAL B 1 108 ? -25.429 7.673   -28.603 1.00 14.84 ? 91   VAL B O     1 
ATOM   2453 C CB    . VAL B 1 108 ? -25.776 6.127   -25.823 1.00 15.74 ? 91   VAL B CB    1 
ATOM   2454 C CG1   . VAL B 1 108 ? -25.563 7.589   -25.373 1.00 16.59 ? 91   VAL B CG1   1 
ATOM   2455 C CG2   . VAL B 1 108 ? -27.285 5.814   -25.926 1.00 15.71 ? 91   VAL B CG2   1 
ATOM   2456 N N     . ASP B 1 109 ? -26.509 5.767   -29.127 1.00 14.99 ? 92   ASP B N     1 
ATOM   2457 C CA    . ASP B 1 109 ? -27.201 6.305   -30.322 1.00 15.31 ? 92   ASP B CA    1 
ATOM   2458 C C     . ASP B 1 109 ? -28.414 5.449   -30.658 1.00 15.14 ? 92   ASP B C     1 
ATOM   2459 O O     . ASP B 1 109 ? -28.393 4.242   -30.422 1.00 15.94 ? 92   ASP B O     1 
ATOM   2460 C CB    . ASP B 1 109 ? -26.256 6.323   -31.534 1.00 14.58 ? 92   ASP B CB    1 
ATOM   2461 C CG    . ASP B 1 109 ? -26.717 7.287   -32.616 1.00 14.84 ? 92   ASP B CG    1 
ATOM   2462 O OD1   . ASP B 1 109 ? -26.255 8.444   -32.603 1.00 13.02 ? 92   ASP B OD1   1 
ATOM   2463 O OD2   . ASP B 1 109 ? -27.559 6.905   -33.456 1.00 15.22 ? 92   ASP B OD2   1 
ATOM   2464 N N     . ILE B 1 110 ? -29.428 6.058   -31.256 1.00 15.32 ? 93   ILE B N     1 
ATOM   2465 C CA    . ILE B 1 110 ? -30.656 5.332   -31.620 1.00 15.99 ? 93   ILE B CA    1 
ATOM   2466 C C     . ILE B 1 110 ? -30.483 4.482   -32.854 1.00 15.90 ? 93   ILE B C     1 
ATOM   2467 O O     . ILE B 1 110 ? -31.265 3.564   -33.073 1.00 16.22 ? 93   ILE B O     1 
ATOM   2468 C CB    . ILE B 1 110 ? -31.882 6.259   -31.892 1.00 16.44 ? 93   ILE B CB    1 
ATOM   2469 C CG1   . ILE B 1 110 ? -31.599 7.274   -33.015 1.00 15.36 ? 93   ILE B CG1   1 
ATOM   2470 C CG2   . ILE B 1 110 ? -32.289 6.959   -30.656 1.00 20.26 ? 93   ILE B CG2   1 
ATOM   2471 C CD1   . ILE B 1 110 ? -32.874 8.012   -33.576 1.00 17.31 ? 93   ILE B CD1   1 
ATOM   2472 N N     . THR B 1 111 ? -29.473 4.790   -33.661 1.00 15.28 ? 94   THR B N     1 
ATOM   2473 C CA    . THR B 1 111 ? -29.354 4.200   -34.999 1.00 14.56 ? 94   THR B CA    1 
ATOM   2474 C C     . THR B 1 111 ? -28.332 3.068   -34.974 1.00 15.07 ? 94   THR B C     1 
ATOM   2475 O O     . THR B 1 111 ? -27.121 3.297   -34.970 1.00 16.27 ? 94   THR B O     1 
ATOM   2476 C CB    . THR B 1 111 ? -28.981 5.260   -36.048 1.00 14.92 ? 94   THR B CB    1 
ATOM   2477 O OG1   . THR B 1 111 ? -29.953 6.315   -36.024 1.00 14.57 ? 94   THR B OG1   1 
ATOM   2478 C CG2   . THR B 1 111 ? -28.932 4.641   -37.468 1.00 12.69 ? 94   THR B CG2   1 
ATOM   2479 N N     . GLU B 1 112 ? -28.833 1.837   -34.954 1.00 16.59 ? 95   GLU B N     1 
ATOM   2480 C CA    . GLU B 1 112 ? -27.965 0.668   -34.858 1.00 17.95 ? 95   GLU B CA    1 
ATOM   2481 C C     . GLU B 1 112 ? -26.870 0.639   -35.949 1.00 17.02 ? 95   GLU B C     1 
ATOM   2482 O O     . GLU B 1 112 ? -25.695 0.385   -35.650 1.00 16.98 ? 95   GLU B O     1 
ATOM   2483 C CB    . GLU B 1 112 ? -28.807 -0.607  -34.902 1.00 18.35 ? 95   GLU B CB    1 
ATOM   2484 C CG    . GLU B 1 112 ? -28.040 -1.855  -34.488 1.00 21.13 ? 95   GLU B CG    1 
ATOM   2485 C CD    . GLU B 1 112 ? -28.919 -3.100  -34.411 1.00 22.54 ? 95   GLU B CD    1 
ATOM   2486 O OE1   . GLU B 1 112 ? -30.147 -3.004  -34.650 1.00 28.19 ? 95   GLU B OE1   1 
ATOM   2487 O OE2   . GLU B 1 112 ? -28.370 -4.186  -34.109 1.00 28.08 ? 95   GLU B OE2   1 
ATOM   2488 N N     . ASP B 1 113 ? -27.232 0.956   -37.191 1.00 16.66 ? 96   ASP B N     1 
ATOM   2489 C CA    . ASP B 1 113 ? -26.261 0.933   -38.305 1.00 17.44 ? 96   ASP B CA    1 
ATOM   2490 C C     . ASP B 1 113 ? -25.056 1.853   -38.081 1.00 16.53 ? 96   ASP B C     1 
ATOM   2491 O O     . ASP B 1 113 ? -23.945 1.586   -38.580 1.00 16.02 ? 96   ASP B O     1 
ATOM   2492 C CB    . ASP B 1 113 ? -26.908 1.288   -39.645 1.00 17.32 ? 96   ASP B CB    1 
ATOM   2493 C CG    . ASP B 1 113 ? -27.834 0.202   -40.187 1.00 21.52 ? 96   ASP B CG    1 
ATOM   2494 O OD1   . ASP B 1 113 ? -27.865 -0.944  -39.683 1.00 24.71 ? 96   ASP B OD1   1 
ATOM   2495 O OD2   . ASP B 1 113 ? -28.534 0.512   -41.170 1.00 28.04 ? 96   ASP B OD2   1 
ATOM   2496 N N     . PHE B 1 114 ? -25.274 2.974   -37.393 1.00 16.56 ? 97   PHE B N     1 
ATOM   2497 C CA    . PHE B 1 114 ? -24.181 3.895   -37.119 1.00 15.76 ? 97   PHE B CA    1 
ATOM   2498 C C     . PHE B 1 114 ? -23.188 3.302   -36.144 1.00 16.21 ? 97   PHE B C     1 
ATOM   2499 O O     . PHE B 1 114 ? -21.980 3.465   -36.333 1.00 16.08 ? 97   PHE B O     1 
ATOM   2500 C CB    . PHE B 1 114 ? -24.673 5.269   -36.609 1.00 15.56 ? 97   PHE B CB    1 
ATOM   2501 C CG    . PHE B 1 114 ? -25.510 6.034   -37.602 1.00 14.04 ? 97   PHE B CG    1 
ATOM   2502 C CD1   . PHE B 1 114 ? -25.458 5.773   -38.976 1.00 14.84 ? 97   PHE B CD1   1 
ATOM   2503 C CD2   . PHE B 1 114 ? -26.318 7.090   -37.156 1.00 12.54 ? 97   PHE B CD2   1 
ATOM   2504 C CE1   . PHE B 1 114 ? -26.233 6.506   -39.874 1.00 16.13 ? 97   PHE B CE1   1 
ATOM   2505 C CE2   . PHE B 1 114 ? -27.086 7.820   -38.054 1.00 13.84 ? 97   PHE B CE2   1 
ATOM   2506 C CZ    . PHE B 1 114 ? -27.032 7.532   -39.414 1.00 14.74 ? 97   PHE B CZ    1 
ATOM   2507 N N     . LEU B 1 115 ? -23.694 2.638   -35.100 1.00 15.60 ? 98   LEU B N     1 
ATOM   2508 C CA    . LEU B 1 115 ? -22.846 2.024   -34.083 1.00 16.70 ? 98   LEU B CA    1 
ATOM   2509 C C     . LEU B 1 115 ? -22.084 0.820   -34.648 1.00 18.30 ? 98   LEU B C     1 
ATOM   2510 O O     . LEU B 1 115 ? -20.964 0.546   -34.217 1.00 17.96 ? 98   LEU B O     1 
ATOM   2511 C CB    . LEU B 1 115 ? -23.662 1.617   -32.859 1.00 17.13 ? 98   LEU B CB    1 
ATOM   2512 C CG    . LEU B 1 115 ? -24.360 2.745   -32.082 1.00 16.45 ? 98   LEU B CG    1 
ATOM   2513 C CD1   . LEU B 1 115 ? -25.269 2.163   -31.029 1.00 17.57 ? 98   LEU B CD1   1 
ATOM   2514 C CD2   . LEU B 1 115 ? -23.380 3.751   -31.439 1.00 18.96 ? 98   LEU B CD2   1 
ATOM   2515 N N     . VAL B 1 116 ? -22.714 0.100   -35.578 1.00 19.40 ? 99   VAL B N     1 
ATOM   2516 C CA    . VAL B 1 116 ? -22.017 -0.971  -36.325 1.00 19.67 ? 99   VAL B CA    1 
ATOM   2517 C C     . VAL B 1 116 ? -20.868 -0.379  -37.149 1.00 20.37 ? 99   VAL B C     1 
ATOM   2518 O O     . VAL B 1 116 ? -19.708 -0.819  -37.030 1.00 20.23 ? 99   VAL B O     1 
ATOM   2519 C CB    . VAL B 1 116 ? -22.998 -1.765  -37.220 1.00 20.30 ? 99   VAL B CB    1 
ATOM   2520 C CG1   . VAL B 1 116 ? -22.238 -2.734  -38.124 1.00 21.69 ? 99   VAL B CG1   1 
ATOM   2521 C CG2   . VAL B 1 116 ? -24.022 -2.513  -36.340 1.00 19.04 ? 99   VAL B CG2   1 
ATOM   2522 N N     . GLN B 1 117 ? -21.176 0.647   -37.942 1.00 20.09 ? 100  GLN B N     1 
ATOM   2523 C CA    . GLN B 1 117 ? -20.141 1.345   -38.698 1.00 21.38 ? 100  GLN B CA    1 
ATOM   2524 C C     . GLN B 1 117 ? -19.036 1.890   -37.802 1.00 21.04 ? 100  GLN B C     1 
ATOM   2525 O O     . GLN B 1 117 ? -17.867 1.878   -38.181 1.00 20.04 ? 100  GLN B O     1 
ATOM   2526 C CB    . GLN B 1 117 ? -20.720 2.474   -39.555 1.00 21.40 ? 100  GLN B CB    1 
ATOM   2527 C CG    . GLN B 1 117 ? -19.717 3.020   -40.591 1.00 24.22 ? 100  GLN B CG    1 
ATOM   2528 C CD    . GLN B 1 117 ? -19.242 1.940   -41.568 1.00 28.13 ? 100  GLN B CD    1 
ATOM   2529 O OE1   . GLN B 1 117 ? -20.039 1.143   -42.069 1.00 31.61 ? 100  GLN B OE1   1 
ATOM   2530 N NE2   . GLN B 1 117 ? -17.943 1.929   -41.852 1.00 29.79 ? 100  GLN B NE2   1 
ATOM   2531 N N     . ALA B 1 118 ? -19.410 2.364   -36.616 1.00 20.71 ? 101  ALA B N     1 
ATOM   2532 C CA    . ALA B 1 118 ? -18.448 2.894   -35.657 1.00 21.69 ? 101  ALA B CA    1 
ATOM   2533 C C     . ALA B 1 118 ? -17.274 1.933   -35.398 1.00 22.11 ? 101  ALA B C     1 
ATOM   2534 O O     . ALA B 1 118 ? -16.117 2.355   -35.329 1.00 22.06 ? 101  ALA B O     1 
ATOM   2535 C CB    . ALA B 1 118 ? -19.150 3.252   -34.352 1.00 21.81 ? 101  ALA B CB    1 
ATOM   2536 N N     . LYS B 1 119 ? -17.574 0.644   -35.277 1.00 22.57 ? 102  LYS B N     1 
ATOM   2537 C CA    . LYS B 1 119 ? -16.527 -0.352  -34.997 1.00 24.24 ? 102  LYS B CA    1 
ATOM   2538 C C     . LYS B 1 119 ? -15.451 -0.387  -36.093 1.00 24.66 ? 102  LYS B C     1 
ATOM   2539 O O     . LYS B 1 119 ? -14.273 -0.645  -35.808 1.00 25.86 ? 102  LYS B O     1 
ATOM   2540 C CB    . LYS B 1 119 ? -17.152 -1.733  -34.846 1.00 24.39 ? 102  LYS B CB    1 
ATOM   2541 C CG    . LYS B 1 119 ? -17.980 -1.907  -33.613 1.00 25.81 ? 102  LYS B CG    1 
ATOM   2542 C CD    . LYS B 1 119 ? -18.632 -3.273  -33.649 1.00 28.62 ? 102  LYS B CD    1 
ATOM   2543 C CE    . LYS B 1 119 ? -19.607 -3.446  -32.511 1.00 31.13 ? 102  LYS B CE    1 
ATOM   2544 N NZ    . LYS B 1 119 ? -18.938 -3.529  -31.200 1.00 35.07 ? 102  LYS B NZ    1 
ATOM   2545 N N     . THR B 1 120 ? -15.861 -0.122  -37.330 1.00 24.62 ? 103  THR B N     1 
ATOM   2546 C CA    . THR B 1 120 ? -14.937 0.009   -38.471 1.00 25.15 ? 103  THR B CA    1 
ATOM   2547 C C     . THR B 1 120 ? -14.283 1.389   -38.504 1.00 24.61 ? 103  THR B C     1 
ATOM   2548 O O     . THR B 1 120 ? -13.059 1.518   -38.544 1.00 24.28 ? 103  THR B O     1 
ATOM   2549 C CB    . THR B 1 120 ? -15.659 -0.266  -39.818 1.00 25.52 ? 103  THR B CB    1 
ATOM   2550 O OG1   . THR B 1 120 ? -16.035 -1.645  -39.886 1.00 25.46 ? 103  THR B OG1   1 
ATOM   2551 C CG2   . THR B 1 120 ? -14.747 0.048   -41.004 1.00 25.61 ? 103  THR B CG2   1 
ATOM   2552 N N     . TYR B 1 121 ? -15.127 2.415   -38.477 1.00 23.80 ? 104  TYR B N     1 
ATOM   2553 C CA    . TYR B 1 121 ? -14.704 3.802   -38.489 1.00 23.58 ? 104  TYR B CA    1 
ATOM   2554 C C     . TYR B 1 121 ? -13.643 4.124   -37.439 1.00 23.94 ? 104  TYR B C     1 
ATOM   2555 O O     . TYR B 1 121 ? -12.654 4.790   -37.740 1.00 24.22 ? 104  TYR B O     1 
ATOM   2556 C CB    . TYR B 1 121 ? -15.926 4.699   -38.270 1.00 23.83 ? 104  TYR B CB    1 
ATOM   2557 C CG    . TYR B 1 121 ? -15.591 6.159   -38.381 1.00 23.11 ? 104  TYR B CG    1 
ATOM   2558 C CD1   . TYR B 1 121 ? -15.268 6.719   -39.616 1.00 23.29 ? 104  TYR B CD1   1 
ATOM   2559 C CD2   . TYR B 1 121 ? -15.605 6.979   -37.262 1.00 22.90 ? 104  TYR B CD2   1 
ATOM   2560 C CE1   . TYR B 1 121 ? -14.943 8.047   -39.727 1.00 25.34 ? 104  TYR B CE1   1 
ATOM   2561 C CE2   . TYR B 1 121 ? -15.291 8.330   -37.370 1.00 23.12 ? 104  TYR B CE2   1 
ATOM   2562 C CZ    . TYR B 1 121 ? -14.966 8.852   -38.601 1.00 21.48 ? 104  TYR B CZ    1 
ATOM   2563 O OH    . TYR B 1 121 ? -14.657 10.180  -38.742 1.00 25.52 ? 104  TYR B OH    1 
ATOM   2564 N N     . LEU B 1 122 ? -13.846 3.650   -36.218 1.00 24.15 ? 105  LEU B N     1 
ATOM   2565 C CA    . LEU B 1 122 ? -12.940 3.946   -35.113 1.00 24.58 ? 105  LEU B CA    1 
ATOM   2566 C C     . LEU B 1 122 ? -11.605 3.201   -35.201 1.00 26.04 ? 105  LEU B C     1 
ATOM   2567 O O     . LEU B 1 122 ? -10.613 3.639   -34.614 1.00 27.03 ? 105  LEU B O     1 
ATOM   2568 C CB    . LEU B 1 122 ? -13.630 3.692   -33.773 1.00 24.18 ? 105  LEU B CB    1 
ATOM   2569 C CG    . LEU B 1 122 ? -14.861 4.579   -33.491 1.00 22.97 ? 105  LEU B CG    1 
ATOM   2570 C CD1   . LEU B 1 122 ? -15.597 4.110   -32.252 1.00 20.91 ? 105  LEU B CD1   1 
ATOM   2571 C CD2   . LEU B 1 122 ? -14.430 6.020   -33.322 1.00 22.68 ? 105  LEU B CD2   1 
ATOM   2572 N N     . GLY B 1 123 ? -11.584 2.097   -35.946 1.00 27.12 ? 106  GLY B N     1 
ATOM   2573 C CA    . GLY B 1 123 ? -10.358 1.319   -36.159 1.00 27.92 ? 106  GLY B CA    1 
ATOM   2574 C C     . GLY B 1 123 ? -9.784  0.788   -34.863 1.00 28.17 ? 106  GLY B C     1 
ATOM   2575 O O     . GLY B 1 123 ? -10.520 0.449   -33.943 1.00 28.52 ? 106  GLY B O     1 
ATOM   2576 N N     . GLU B 1 124 ? -8.454  0.730   -34.797 1.00 29.52 ? 107  GLU B N     1 
ATOM   2577 C CA    . GLU B 1 124 ? -7.720  0.225   -33.638 1.00 29.81 ? 107  GLU B CA    1 
ATOM   2578 C C     . GLU B 1 124 ? -8.068  0.918   -32.326 1.00 29.56 ? 107  GLU B C     1 
ATOM   2579 O O     . GLU B 1 124 ? -8.318  0.258   -31.319 1.00 29.74 ? 107  GLU B O     1 
ATOM   2580 C CB    . GLU B 1 124 ? -6.206  0.345   -33.894 1.00 30.50 ? 107  GLU B CB    1 
ATOM   2581 C CG    . GLU B 1 124 ? -5.322  -0.031  -32.710 1.00 33.98 ? 107  GLU B CG    1 
ATOM   2582 C CD    . GLU B 1 124 ? -5.325  -1.511  -32.429 1.00 37.64 ? 107  GLU B CD    1 
ATOM   2583 O OE1   . GLU B 1 124 ? -5.627  -2.310  -33.353 1.00 40.40 ? 107  GLU B OE1   1 
ATOM   2584 O OE2   . GLU B 1 124 ? -5.027  -1.881  -31.272 1.00 40.70 ? 107  GLU B OE2   1 
ATOM   2585 N N     . GLU B 1 125 ? -8.066  2.251   -32.335 1.00 29.20 ? 108  GLU B N     1 
ATOM   2586 C CA    . GLU B 1 125 ? -8.371  3.023   -31.120 1.00 29.07 ? 108  GLU B CA    1 
ATOM   2587 C C     . GLU B 1 125 ? -9.774  2.734   -30.589 1.00 28.18 ? 108  GLU B C     1 
ATOM   2588 O O     . GLU B 1 125 ? -10.015 2.830   -29.388 1.00 27.65 ? 108  GLU B O     1 
ATOM   2589 C CB    . GLU B 1 125 ? -8.185  4.529   -31.365 1.00 29.00 ? 108  GLU B CB    1 
ATOM   2590 C CG    . GLU B 1 125 ? -6.728  4.953   -31.498 1.00 30.89 ? 108  GLU B CG    1 
ATOM   2591 C CD    . GLU B 1 125 ? -5.887  4.513   -30.313 1.00 32.45 ? 108  GLU B CD    1 
ATOM   2592 O OE1   . GLU B 1 125 ? -6.034  5.088   -29.211 1.00 34.06 ? 108  GLU B OE1   1 
ATOM   2593 O OE2   . GLU B 1 125 ? -5.078  3.582   -30.480 1.00 35.93 ? 108  GLU B OE2   1 
ATOM   2594 N N     . GLY B 1 126 ? -10.674 2.351   -31.496 1.00 28.22 ? 109  GLY B N     1 
ATOM   2595 C CA    . GLY B 1 126 ? -12.053 1.975   -31.164 1.00 27.81 ? 109  GLY B CA    1 
ATOM   2596 C C     . GLY B 1 126 ? -12.176 0.770   -30.247 1.00 27.97 ? 109  GLY B C     1 
ATOM   2597 O O     . GLY B 1 126 ? -13.202 0.575   -29.579 1.00 27.75 ? 109  GLY B O     1 
ATOM   2598 N N     . LYS B 1 127 ? -11.118 -0.035  -30.189 1.00 28.24 ? 110  LYS B N     1 
ATOM   2599 C CA    . LYS B 1 127 ? -11.075 -1.137  -29.243 1.00 28.59 ? 110  LYS B CA    1 
ATOM   2600 C C     . LYS B 1 127 ? -11.194 -0.660  -27.797 1.00 28.77 ? 110  LYS B C     1 
ATOM   2601 O O     . LYS B 1 127 ? -11.499 -1.449  -26.909 1.00 29.25 ? 110  LYS B O     1 
ATOM   2602 C CB    . LYS B 1 127 ? -9.821  -2.008  -29.465 1.00 28.48 ? 110  LYS B CB    1 
ATOM   2603 C CG    . LYS B 1 127 ? -9.925  -2.900  -30.696 1.00 29.82 ? 110  LYS B CG    1 
ATOM   2604 C CD    . LYS B 1 127 ? -8.920  -4.051  -30.638 1.00 32.86 ? 110  LYS B CD    1 
ATOM   2605 C CE    . LYS B 1 127 ? -7.508  -3.540  -30.850 1.00 33.01 ? 110  LYS B CE    1 
ATOM   2606 N NZ    . LYS B 1 127 ? -6.421  -4.539  -30.610 1.00 34.09 ? 110  LYS B NZ    1 
ATOM   2607 N N     . ARG B 1 128 ? -11.001 0.640   -27.564 1.00 28.93 ? 111  ARG B N     1 
ATOM   2608 C CA    . ARG B 1 128 ? -11.172 1.202   -26.215 1.00 29.40 ? 111  ARG B CA    1 
ATOM   2609 C C     . ARG B 1 128 ? -12.552 1.854   -25.980 1.00 29.00 ? 111  ARG B C     1 
ATOM   2610 O O     . ARG B 1 128 ? -12.759 2.569   -24.993 1.00 29.11 ? 111  ARG B O     1 
ATOM   2611 C CB    . ARG B 1 128 ? -10.039 2.174   -25.892 1.00 29.54 ? 111  ARG B CB    1 
ATOM   2612 C CG    . ARG B 1 128 ? -8.643  1.639   -26.223 1.00 31.21 ? 111  ARG B CG    1 
ATOM   2613 C CD    . ARG B 1 128 ? -7.734  2.781   -26.656 1.00 33.80 ? 111  ARG B CD    1 
ATOM   2614 N NE    . ARG B 1 128 ? -7.787  3.837   -25.664 1.00 34.86 ? 111  ARG B NE    1 
ATOM   2615 C CZ    . ARG B 1 128 ? -7.854  5.140   -25.928 1.00 35.17 ? 111  ARG B CZ    1 
ATOM   2616 N NH1   . ARG B 1 128 ? -7.833  5.590   -27.173 1.00 35.33 ? 111  ARG B NH1   1 
ATOM   2617 N NH2   . ARG B 1 128 ? -7.934  5.996   -24.921 1.00 36.04 ? 111  ARG B NH2   1 
ATOM   2618 N N     . VAL B 1 129 ? -13.490 1.603   -26.889 1.00 28.58 ? 112  VAL B N     1 
ATOM   2619 C CA    . VAL B 1 129 ? -14.899 1.874   -26.612 1.00 28.06 ? 112  VAL B CA    1 
ATOM   2620 C C     . VAL B 1 129 ? -15.424 0.693   -25.823 1.00 28.47 ? 112  VAL B C     1 
ATOM   2621 O O     . VAL B 1 129 ? -15.407 -0.450  -26.303 1.00 28.47 ? 112  VAL B O     1 
ATOM   2622 C CB    . VAL B 1 129 ? -15.724 2.096   -27.885 1.00 27.86 ? 112  VAL B CB    1 
ATOM   2623 C CG1   . VAL B 1 129 ? -17.226 2.088   -27.576 1.00 27.86 ? 112  VAL B CG1   1 
ATOM   2624 C CG2   . VAL B 1 129 ? -15.300 3.384   -28.561 1.00 28.70 ? 112  VAL B CG2   1 
ATOM   2625 N N     . ARG B 1 130 ? -15.860 0.984   -24.604 1.00 28.48 ? 113  ARG B N     1 
ATOM   2626 C CA    . ARG B 1 130 ? -16.276 -0.010  -23.632 1.00 29.31 ? 113  ARG B CA    1 
ATOM   2627 C C     . ARG B 1 130 ? -17.637 -0.585  -23.999 1.00 29.37 ? 113  ARG B C     1 
ATOM   2628 O O     . ARG B 1 130 ? -17.816 -1.799  -24.064 1.00 29.48 ? 113  ARG B O     1 
ATOM   2629 C CB    . ARG B 1 130 ? -16.317 0.637   -22.249 1.00 29.59 ? 113  ARG B CB    1 
ATOM   2630 C CG    . ARG B 1 130 ? -16.741 -0.277  -21.108 1.00 30.42 ? 113  ARG B CG    1 
ATOM   2631 C CD    . ARG B 1 130 ? -16.568 0.435   -19.777 1.00 34.51 ? 113  ARG B CD    1 
ATOM   2632 N NE    . ARG B 1 130 ? -17.543 1.514   -19.599 1.00 34.86 ? 113  ARG B NE    1 
ATOM   2633 C CZ    . ARG B 1 130 ? -17.585 2.318   -18.542 1.00 36.42 ? 113  ARG B CZ    1 
ATOM   2634 N NH1   . ARG B 1 130 ? -16.704 2.174   -17.558 1.00 36.85 ? 113  ARG B NH1   1 
ATOM   2635 N NH2   . ARG B 1 130 ? -18.507 3.270   -18.469 1.00 35.06 ? 113  ARG B NH2   1 
ATOM   2636 N N     . ASN B 1 131 ? -18.596 0.299   -24.244 1.00 28.81 ? 114  ASN B N     1 
ATOM   2637 C CA    . ASN B 1 131 ? -19.954 -0.100  -24.569 1.00 28.64 ? 114  ASN B CA    1 
ATOM   2638 C C     . ASN B 1 131 ? -20.463 0.639   -25.783 1.00 28.17 ? 114  ASN B C     1 
ATOM   2639 O O     . ASN B 1 131 ? -20.202 1.837   -25.940 1.00 28.04 ? 114  ASN B O     1 
ATOM   2640 C CB    . ASN B 1 131 ? -20.882 0.231   -23.413 1.00 28.76 ? 114  ASN B CB    1 
ATOM   2641 C CG    . ASN B 1 131 ? -20.513 -0.482  -22.136 1.00 30.13 ? 114  ASN B CG    1 
ATOM   2642 O OD1   . ASN B 1 131 ? -20.086 0.138   -21.160 1.00 33.91 ? 114  ASN B OD1   1 
ATOM   2643 N ND2   . ASN B 1 131 ? -20.688 -1.793  -22.131 1.00 31.45 ? 114  ASN B ND2   1 
ATOM   2644 N N     . TYR B 1 132 ? -21.202 -0.079  -26.621 1.00 27.17 ? 115  TYR B N     1 
ATOM   2645 C CA    . TYR B 1 132 ? -22.004 0.527   -27.674 1.00 26.67 ? 115  TYR B CA    1 
ATOM   2646 C C     . TYR B 1 132 ? -23.450 0.363   -27.235 1.00 26.26 ? 115  TYR B C     1 
ATOM   2647 O O     . TYR B 1 132 ? -23.985 -0.758  -27.189 1.00 27.04 ? 115  TYR B O     1 
ATOM   2648 C CB    . TYR B 1 132 ? -21.761 -0.158  -29.029 1.00 26.87 ? 115  TYR B CB    1 
ATOM   2649 C CG    . TYR B 1 132 ? -20.396 0.065   -29.628 1.00 26.82 ? 115  TYR B CG    1 
ATOM   2650 C CD1   . TYR B 1 132 ? -20.155 1.125   -30.511 1.00 28.05 ? 115  TYR B CD1   1 
ATOM   2651 C CD2   . TYR B 1 132 ? -19.331 -0.792  -29.320 1.00 28.54 ? 115  TYR B CD2   1 
ATOM   2652 C CE1   . TYR B 1 132 ? -18.892 1.330   -31.065 1.00 25.46 ? 115  TYR B CE1   1 
ATOM   2653 C CE2   . TYR B 1 132 ? -18.065 -0.597  -29.873 1.00 27.09 ? 115  TYR B CE2   1 
ATOM   2654 C CZ    . TYR B 1 132 ? -17.855 0.454   -30.739 1.00 27.35 ? 115  TYR B CZ    1 
ATOM   2655 O OH    . TYR B 1 132 ? -16.605 0.650   -31.273 1.00 28.89 ? 115  TYR B OH    1 
ATOM   2656 N N     . PHE B 1 133 ? -24.084 1.473   -26.879 1.00 24.11 ? 116  PHE B N     1 
ATOM   2657 C CA    . PHE B 1 133 ? -25.467 1.439   -26.443 1.00 23.25 ? 116  PHE B CA    1 
ATOM   2658 C C     . PHE B 1 133 ? -26.397 1.880   -27.577 1.00 22.70 ? 116  PHE B C     1 
ATOM   2659 O O     . PHE B 1 133 ? -26.380 3.044   -27.967 1.00 20.97 ? 116  PHE B O     1 
ATOM   2660 C CB    . PHE B 1 133 ? -25.685 2.377   -25.252 1.00 23.19 ? 116  PHE B CB    1 
ATOM   2661 C CG    . PHE B 1 133 ? -24.973 1.969   -23.983 1.00 25.37 ? 116  PHE B CG    1 
ATOM   2662 C CD1   . PHE B 1 133 ? -25.379 0.846   -23.255 1.00 26.01 ? 116  PHE B CD1   1 
ATOM   2663 C CD2   . PHE B 1 133 ? -23.918 2.740   -23.494 1.00 25.38 ? 116  PHE B CD2   1 
ATOM   2664 C CE1   . PHE B 1 133 ? -24.721 0.482   -22.066 1.00 25.16 ? 116  PHE B CE1   1 
ATOM   2665 C CE2   . PHE B 1 133 ? -23.273 2.400   -22.307 1.00 27.22 ? 116  PHE B CE2   1 
ATOM   2666 C CZ    . PHE B 1 133 ? -23.680 1.252   -21.591 1.00 24.49 ? 116  PHE B CZ    1 
ATOM   2667 N N     . CYS B 1 134 ? -27.221 0.963   -28.084 1.00 22.24 ? 117  CYS B N     1 
ATOM   2668 C CA    . CYS B 1 134 ? -28.228 1.345   -29.078 1.00 21.03 ? 117  CYS B CA    1 
ATOM   2669 C C     . CYS B 1 134 ? -29.528 1.639   -28.353 1.00 20.18 ? 117  CYS B C     1 
ATOM   2670 O O     . CYS B 1 134 ? -30.242 0.720   -27.931 1.00 20.37 ? 117  CYS B O     1 
ATOM   2671 C CB    . CYS B 1 134 ? -28.410 0.271   -30.152 1.00 21.47 ? 117  CYS B CB    1 
ATOM   2672 S SG    . CYS B 1 134 ? -29.531 0.797   -31.476 1.00 22.64 ? 117  CYS B SG    1 
ATOM   2673 N N     . CYS B 1 135 ? -29.813 2.929   -28.161 1.00 18.81 ? 118  CYS B N     1 
ATOM   2674 C CA    . CYS B 1 135 ? -30.912 3.350   -27.318 1.00 18.18 ? 118  CYS B CA    1 
ATOM   2675 C C     . CYS B 1 135 ? -31.206 4.820   -27.568 1.00 16.70 ? 118  CYS B C     1 
ATOM   2676 O O     . CYS B 1 135 ? -30.281 5.574   -27.867 1.00 15.58 ? 118  CYS B O     1 
ATOM   2677 C CB    . CYS B 1 135 ? -30.484 3.208   -25.849 1.00 18.45 ? 118  CYS B CB    1 
ATOM   2678 S SG    . CYS B 1 135 ? -31.800 3.448   -24.670 1.00 21.61 ? 118  CYS B SG    1 
ATOM   2679 N N     . GLY B 1 136 ? -32.467 5.221   -27.438 1.00 15.02 ? 119  GLY B N     1 
ATOM   2680 C CA    . GLY B 1 136 ? -32.814 6.670   -27.442 1.00 14.80 ? 119  GLY B CA    1 
ATOM   2681 C C     . GLY B 1 136 ? -32.382 7.297   -26.123 1.00 14.69 ? 119  GLY B C     1 
ATOM   2682 O O     . GLY B 1 136 ? -32.457 6.651   -25.085 1.00 14.37 ? 119  GLY B O     1 
ATOM   2683 N N     . LEU B 1 137 ? -31.908 8.541   -26.138 1.00 14.82 ? 120  LEU B N     1 
ATOM   2684 C CA    . LEU B 1 137 ? -31.475 9.184   -24.896 1.00 15.21 ? 120  LEU B CA    1 
ATOM   2685 C C     . LEU B 1 137 ? -32.663 9.258   -23.926 1.00 15.81 ? 120  LEU B C     1 
ATOM   2686 O O     . LEU B 1 137 ? -32.499 9.148   -22.702 1.00 17.11 ? 120  LEU B O     1 
ATOM   2687 C CB    . LEU B 1 137 ? -30.913 10.589  -25.174 1.00 13.95 ? 120  LEU B CB    1 
ATOM   2688 C CG    . LEU B 1 137 ? -29.720 10.727  -26.151 1.00 15.33 ? 120  LEU B CG    1 
ATOM   2689 C CD1   . LEU B 1 137 ? -29.186 12.153  -26.107 1.00 14.72 ? 120  LEU B CD1   1 
ATOM   2690 C CD2   . LEU B 1 137 ? -28.624 9.699   -25.850 1.00 15.23 ? 120  LEU B CD2   1 
ATOM   2691 N N     . GLN B 1 138 ? -33.862 9.386   -24.484 1.00 16.60 ? 121  GLN B N     1 
ATOM   2692 C CA    . GLN B 1 138 ? -35.077 9.475   -23.663 1.00 18.08 ? 121  GLN B CA    1 
ATOM   2693 C C     . GLN B 1 138 ? -35.350 8.175   -22.885 1.00 18.95 ? 121  GLN B C     1 
ATOM   2694 O O     . GLN B 1 138 ? -36.072 8.183   -21.896 1.00 20.56 ? 121  GLN B O     1 
ATOM   2695 C CB    . GLN B 1 138 ? -36.284 9.913   -24.514 1.00 17.13 ? 121  GLN B CB    1 
ATOM   2696 C CG    . GLN B 1 138 ? -36.835 8.862   -25.498 1.00 17.45 ? 121  GLN B CG    1 
ATOM   2697 C CD    . GLN B 1 138 ? -36.071 8.743   -26.800 1.00 17.24 ? 121  GLN B CD    1 
ATOM   2698 O OE1   . GLN B 1 138 ? -35.000 9.336   -26.985 1.00 16.19 ? 121  GLN B OE1   1 
ATOM   2699 N NE2   . GLN B 1 138 ? -36.647 7.985   -27.736 1.00 19.09 ? 121  GLN B NE2   1 
ATOM   2700 N N     . ASP B 1 139 ? -34.733 7.080   -23.317 1.00 19.17 ? 122  ASP B N     1 
ATOM   2701 C CA    . ASP B 1 139 ? -34.865 5.771   -22.677 1.00 21.02 ? 122  ASP B CA    1 
ATOM   2702 C C     . ASP B 1 139 ? -33.556 5.319   -22.006 1.00 20.80 ? 122  ASP B C     1 
ATOM   2703 O O     . ASP B 1 139 ? -33.432 4.178   -21.517 1.00 20.88 ? 122  ASP B O     1 
ATOM   2704 C CB    . ASP B 1 139 ? -35.289 4.757   -23.755 1.00 20.89 ? 122  ASP B CB    1 
ATOM   2705 C CG    . ASP B 1 139 ? -36.662 5.083   -24.354 1.00 22.87 ? 122  ASP B CG    1 
ATOM   2706 O OD1   . ASP B 1 139 ? -37.570 5.491   -23.595 1.00 22.78 ? 122  ASP B OD1   1 
ATOM   2707 O OD2   . ASP B 1 139 ? -36.837 4.960   -25.586 1.00 23.35 ? 122  ASP B OD2   1 
ATOM   2708 N N     . PHE B 1 140 ? -32.564 6.208   -21.994 1.00 20.50 ? 123  PHE B N     1 
ATOM   2709 C CA    . PHE B 1 140 ? -31.235 5.861   -21.517 1.00 20.05 ? 123  PHE B CA    1 
ATOM   2710 C C     . PHE B 1 140 ? -30.987 6.414   -20.136 1.00 21.65 ? 123  PHE B C     1 
ATOM   2711 O O     . PHE B 1 140 ? -31.233 7.592   -19.869 1.00 19.86 ? 123  PHE B O     1 
ATOM   2712 C CB    . PHE B 1 140 ? -30.157 6.377   -22.485 1.00 19.58 ? 123  PHE B CB    1 
ATOM   2713 C CG    . PHE B 1 140 ? -28.766 5.852   -22.210 1.00 18.83 ? 123  PHE B CG    1 
ATOM   2714 C CD1   . PHE B 1 140 ? -28.462 4.485   -22.345 1.00 20.12 ? 123  PHE B CD1   1 
ATOM   2715 C CD2   . PHE B 1 140 ? -27.749 6.731   -21.862 1.00 19.92 ? 123  PHE B CD2   1 
ATOM   2716 C CE1   . PHE B 1 140 ? -27.159 4.007   -22.112 1.00 21.15 ? 123  PHE B CE1   1 
ATOM   2717 C CE2   . PHE B 1 140 ? -26.450 6.291   -21.638 1.00 19.64 ? 123  PHE B CE2   1 
ATOM   2718 C CZ    . PHE B 1 140 ? -26.147 4.911   -21.745 1.00 19.64 ? 123  PHE B CZ    1 
ATOM   2719 N N     . THR B 1 141 ? -30.476 5.542   -19.268 1.00 24.09 ? 124  THR B N     1 
ATOM   2720 C CA    . THR B 1 141 ? -30.143 5.929   -17.910 1.00 26.24 ? 124  THR B CA    1 
ATOM   2721 C C     . THR B 1 141 ? -28.664 5.587   -17.692 1.00 27.03 ? 124  THR B C     1 
ATOM   2722 O O     . THR B 1 141 ? -28.301 4.409   -17.535 1.00 28.52 ? 124  THR B O     1 
ATOM   2723 C CB    . THR B 1 141 ? -31.065 5.240   -16.870 1.00 25.22 ? 124  THR B CB    1 
ATOM   2724 O OG1   . THR B 1 141 ? -32.424 5.634   -17.097 1.00 28.59 ? 124  THR B OG1   1 
ATOM   2725 C CG2   . THR B 1 141 ? -30.672 5.654   -15.462 1.00 27.25 ? 124  THR B CG2   1 
ATOM   2726 N N     . PRO B 1 142 ? -27.793 6.605   -17.737 1.00 28.05 ? 125  PRO B N     1 
ATOM   2727 C CA    . PRO B 1 142 ? -26.388 6.351   -17.450 1.00 28.79 ? 125  PRO B CA    1 
ATOM   2728 C C     . PRO B 1 142 ? -26.274 5.964   -15.964 1.00 29.44 ? 125  PRO B C     1 
ATOM   2729 O O     . PRO B 1 142 ? -26.953 6.560   -15.132 1.00 30.13 ? 125  PRO B O     1 
ATOM   2730 C CB    . PRO B 1 142 ? -25.717 7.689   -17.768 1.00 28.59 ? 125  PRO B CB    1 
ATOM   2731 C CG    . PRO B 1 142 ? -26.805 8.698   -17.636 1.00 29.35 ? 125  PRO B CG    1 
ATOM   2732 C CD    . PRO B 1 142 ? -28.045 8.014   -18.090 1.00 27.46 ? 125  PRO B CD    1 
ATOM   2733 N N     . GLU B 1 143 ? -25.502 4.927   -15.645 1.00 30.40 ? 126  GLU B N     1 
ATOM   2734 C CA    . GLU B 1 143 ? -25.462 4.441   -14.250 1.00 30.48 ? 126  GLU B CA    1 
ATOM   2735 C C     . GLU B 1 143 ? -24.599 5.352   -13.367 1.00 29.81 ? 126  GLU B C     1 
ATOM   2736 O O     . GLU B 1 143 ? -23.642 5.955   -13.857 1.00 30.60 ? 126  GLU B O     1 
ATOM   2737 C CB    . GLU B 1 143 ? -25.022 2.961   -14.160 1.00 30.96 ? 126  GLU B CB    1 
ATOM   2738 C CG    . GLU B 1 143 ? -26.043 1.942   -14.726 1.00 32.98 ? 126  GLU B CG    1 
ATOM   2739 C CD    . GLU B 1 143 ? -27.507 2.283   -14.386 1.00 36.04 ? 126  GLU B CD    1 
ATOM   2740 O OE1   . GLU B 1 143 ? -27.921 2.137   -13.212 1.00 35.18 ? 126  GLU B OE1   1 
ATOM   2741 O OE2   . GLU B 1 143 ? -28.252 2.698   -15.306 1.00 37.56 ? 126  GLU B OE2   1 
ATOM   2742 N N     . PRO B 1 144 ? -24.971 5.498   -12.080 1.00 29.65 ? 127  PRO B N     1 
ATOM   2743 C CA    . PRO B 1 144 ? -24.269 6.381   -11.143 1.00 28.64 ? 127  PRO B CA    1 
ATOM   2744 C C     . PRO B 1 144 ? -22.743 6.221   -11.202 1.00 28.34 ? 127  PRO B C     1 
ATOM   2745 O O     . PRO B 1 144 ? -22.267 5.139   -11.501 1.00 27.20 ? 127  PRO B O     1 
ATOM   2746 C CB    . PRO B 1 144 ? -24.804 5.921   -9.784  1.00 29.02 ? 127  PRO B CB    1 
ATOM   2747 C CG    . PRO B 1 144 ? -26.198 5.465   -10.069 1.00 28.96 ? 127  PRO B CG    1 
ATOM   2748 C CD    . PRO B 1 144 ? -26.124 4.821   -11.440 1.00 29.06 ? 127  PRO B CD    1 
ATOM   2749 N N     . ASP B 1 145 ? -22.008 7.311   -10.977 1.00 28.13 ? 128  ASP B N     1 
ATOM   2750 C CA    . ASP B 1 145 ? -20.537 7.291   -10.811 1.00 28.41 ? 128  ASP B CA    1 
ATOM   2751 C C     . ASP B 1 145 ? -19.748 6.713   -11.991 1.00 27.97 ? 128  ASP B C     1 
ATOM   2752 O O     . ASP B 1 145 ? -18.772 5.988   -11.787 1.00 28.17 ? 128  ASP B O     1 
ATOM   2753 C CB    . ASP B 1 145 ? -20.166 6.545   -9.510  1.00 29.39 ? 128  ASP B CB    1 
ATOM   2754 C CG    . ASP B 1 145 ? -18.941 7.137   -8.802  1.00 30.88 ? 128  ASP B CG    1 
ATOM   2755 O OD1   . ASP B 1 145 ? -18.450 8.227   -9.174  1.00 33.03 ? 128  ASP B OD1   1 
ATOM   2756 O OD2   . ASP B 1 145 ? -18.480 6.504   -7.828  1.00 35.58 ? 128  ASP B OD2   1 
ATOM   2757 N N     . SER B 1 146 ? -20.136 7.056   -13.221 1.00 27.17 ? 129  SER B N     1 
ATOM   2758 C CA    . SER B 1 146 ? -19.545 6.415   -14.409 1.00 26.31 ? 129  SER B CA    1 
ATOM   2759 C C     . SER B 1 146 ? -18.614 7.275   -15.282 1.00 25.56 ? 129  SER B C     1 
ATOM   2760 O O     . SER B 1 146 ? -17.615 6.779   -15.811 1.00 24.62 ? 129  SER B O     1 
ATOM   2761 C CB    . SER B 1 146 ? -20.633 5.806   -15.307 1.00 26.71 ? 129  SER B CB    1 
ATOM   2762 O OG    . SER B 1 146 ? -21.501 4.917   -14.621 1.00 27.38 ? 129  SER B OG    1 
ATOM   2763 N N     . TYR B 1 147 ? -18.947 8.559   -15.437 1.00 24.59 ? 130  TYR B N     1 
ATOM   2764 C CA    . TYR B 1 147 ? -18.328 9.379   -16.470 1.00 23.21 ? 130  TYR B CA    1 
ATOM   2765 C C     . TYR B 1 147 ? -17.719 10.690  -15.988 1.00 22.29 ? 130  TYR B C     1 
ATOM   2766 O O     . TYR B 1 147 ? -18.338 11.421  -15.210 1.00 22.36 ? 130  TYR B O     1 
ATOM   2767 C CB    . TYR B 1 147 ? -19.365 9.702   -17.550 1.00 23.57 ? 130  TYR B CB    1 
ATOM   2768 C CG    . TYR B 1 147 ? -19.990 8.469   -18.170 1.00 23.53 ? 130  TYR B CG    1 
ATOM   2769 C CD1   . TYR B 1 147 ? -19.215 7.605   -18.941 1.00 24.85 ? 130  TYR B CD1   1 
ATOM   2770 C CD2   . TYR B 1 147 ? -21.342 8.181   -18.007 1.00 24.60 ? 130  TYR B CD2   1 
ATOM   2771 C CE1   . TYR B 1 147 ? -19.755 6.474   -19.516 1.00 25.83 ? 130  TYR B CE1   1 
ATOM   2772 C CE2   . TYR B 1 147 ? -21.905 7.029   -18.588 1.00 25.20 ? 130  TYR B CE2   1 
ATOM   2773 C CZ    . TYR B 1 147 ? -21.086 6.188   -19.339 1.00 24.65 ? 130  TYR B CZ    1 
ATOM   2774 O OH    . TYR B 1 147 ? -21.584 5.051   -19.940 1.00 26.31 ? 130  TYR B OH    1 
ATOM   2775 N N     . ASP B 1 148 ? -16.533 10.991  -16.511 1.00 21.64 ? 131  ASP B N     1 
ATOM   2776 C CA    . ASP B 1 148 ? -15.857 12.264  -16.262 1.00 21.29 ? 131  ASP B CA    1 
ATOM   2777 C C     . ASP B 1 148 ? -16.393 13.333  -17.188 1.00 20.38 ? 131  ASP B C     1 
ATOM   2778 O O     . ASP B 1 148 ? -16.530 14.473  -16.795 1.00 21.00 ? 131  ASP B O     1 
ATOM   2779 C CB    . ASP B 1 148 ? -14.368 12.129  -16.492 1.00 21.30 ? 131  ASP B CB    1 
ATOM   2780 C CG    . ASP B 1 148 ? -13.731 11.156  -15.522 1.00 23.65 ? 131  ASP B CG    1 
ATOM   2781 O OD1   . ASP B 1 148 ? -13.825 11.402  -14.299 1.00 24.30 ? 131  ASP B OD1   1 
ATOM   2782 O OD2   . ASP B 1 148 ? -13.186 10.139  -16.002 1.00 23.64 ? 131  ASP B OD2   1 
ATOM   2783 N N     . VAL B 1 149 ? -16.699 12.950  -18.417 1.00 18.93 ? 132  VAL B N     1 
ATOM   2784 C CA    . VAL B 1 149 ? -17.331 13.887  -19.359 1.00 18.09 ? 132  VAL B CA    1 
ATOM   2785 C C     . VAL B 1 149 ? -18.468 13.171  -20.060 1.00 16.87 ? 132  VAL B C     1 
ATOM   2786 O O     . VAL B 1 149 ? -18.296 12.034  -20.502 1.00 17.14 ? 132  VAL B O     1 
ATOM   2787 C CB    . VAL B 1 149 ? -16.315 14.459  -20.377 1.00 17.65 ? 132  VAL B CB    1 
ATOM   2788 C CG1   . VAL B 1 149 ? -17.018 15.254  -21.477 1.00 18.54 ? 132  VAL B CG1   1 
ATOM   2789 C CG2   . VAL B 1 149 ? -15.280 15.359  -19.658 1.00 18.54 ? 132  VAL B CG2   1 
ATOM   2790 N N     . ILE B 1 150 ? -19.628 13.831  -20.133 1.00 14.96 ? 133  ILE B N     1 
ATOM   2791 C CA    . ILE B 1 150 ? -20.746 13.369  -20.960 1.00 14.38 ? 133  ILE B CA    1 
ATOM   2792 C C     . ILE B 1 150 ? -20.924 14.419  -22.048 1.00 13.31 ? 133  ILE B C     1 
ATOM   2793 O O     . ILE B 1 150 ? -21.240 15.579  -21.734 1.00 13.04 ? 133  ILE B O     1 
ATOM   2794 C CB    . ILE B 1 150 ? -22.040 13.243  -20.156 1.00 14.30 ? 133  ILE B CB    1 
ATOM   2795 C CG1   . ILE B 1 150 ? -21.892 12.150  -19.089 1.00 13.73 ? 133  ILE B CG1   1 
ATOM   2796 C CG2   . ILE B 1 150 ? -23.203 12.898  -21.075 1.00 14.79 ? 133  ILE B CG2   1 
ATOM   2797 C CD1   . ILE B 1 150 ? -22.950 12.177  -17.973 1.00 15.34 ? 133  ILE B CD1   1 
ATOM   2798 N N     . TRP B 1 151 ? -20.699 14.014  -23.294 1.00 12.85 ? 134  TRP B N     1 
ATOM   2799 C CA    . TRP B 1 151 ? -20.714 14.917  -24.463 1.00 12.80 ? 134  TRP B CA    1 
ATOM   2800 C C     . TRP B 1 151 ? -22.008 14.754  -25.268 1.00 12.59 ? 134  TRP B C     1 
ATOM   2801 O O     . TRP B 1 151 ? -22.321 13.656  -25.774 1.00 13.69 ? 134  TRP B O     1 
ATOM   2802 C CB    . TRP B 1 151 ? -19.480 14.668  -25.357 1.00 12.54 ? 134  TRP B CB    1 
ATOM   2803 C CG    . TRP B 1 151 ? -19.203 15.779  -26.290 1.00 12.21 ? 134  TRP B CG    1 
ATOM   2804 C CD1   . TRP B 1 151 ? -19.733 15.973  -27.537 1.00 13.85 ? 134  TRP B CD1   1 
ATOM   2805 C CD2   . TRP B 1 151 ? -18.349 16.893  -26.039 1.00 11.98 ? 134  TRP B CD2   1 
ATOM   2806 N NE1   . TRP B 1 151 ? -19.248 17.133  -28.084 1.00 12.85 ? 134  TRP B NE1   1 
ATOM   2807 C CE2   . TRP B 1 151 ? -18.406 17.729  -27.182 1.00 14.62 ? 134  TRP B CE2   1 
ATOM   2808 C CE3   . TRP B 1 151 ? -17.549 17.273  -24.959 1.00 14.35 ? 134  TRP B CE3   1 
ATOM   2809 C CZ2   . TRP B 1 151 ? -17.658 18.923  -27.284 1.00 15.19 ? 134  TRP B CZ2   1 
ATOM   2810 C CZ3   . TRP B 1 151 ? -16.808 18.481  -25.057 1.00 14.66 ? 134  TRP B CZ3   1 
ATOM   2811 C CH2   . TRP B 1 151 ? -16.875 19.272  -26.205 1.00 14.50 ? 134  TRP B CH2   1 
ATOM   2812 N N     . ILE B 1 152 ? -22.753 15.855  -25.424 1.00 11.96 ? 135  ILE B N     1 
ATOM   2813 C CA    . ILE B 1 152 ? -24.064 15.773  -26.062 1.00 11.73 ? 135  ILE B CA    1 
ATOM   2814 C C     . ILE B 1 152 ? -24.108 16.779  -27.196 1.00 12.83 ? 135  ILE B C     1 
ATOM   2815 O O     . ILE B 1 152 ? -24.322 17.976  -26.966 1.00 14.66 ? 135  ILE B O     1 
ATOM   2816 C CB    . ILE B 1 152 ? -25.195 16.096  -25.059 1.00 11.60 ? 135  ILE B CB    1 
ATOM   2817 C CG1   . ILE B 1 152 ? -25.018 15.290  -23.757 1.00 12.31 ? 135  ILE B CG1   1 
ATOM   2818 C CG2   . ILE B 1 152 ? -26.574 15.843  -25.715 1.00 13.00 ? 135  ILE B CG2   1 
ATOM   2819 C CD1   . ILE B 1 152 ? -26.033 15.695  -22.667 1.00 10.66 ? 135  ILE B CD1   1 
ATOM   2820 N N     . GLN B 1 153 ? -23.883 16.306  -28.401 1.00 12.63 ? 136  GLN B N     1 
ATOM   2821 C CA    . GLN B 1 153 ? -23.715 17.228  -29.557 1.00 12.72 ? 136  GLN B CA    1 
ATOM   2822 C C     . GLN B 1 153 ? -24.637 16.944  -30.731 1.00 11.93 ? 136  GLN B C     1 
ATOM   2823 O O     . GLN B 1 153 ? -24.763 15.797  -31.220 1.00 11.78 ? 136  GLN B O     1 
ATOM   2824 C CB    . GLN B 1 153 ? -22.255 17.294  -30.014 1.00 12.42 ? 136  GLN B CB    1 
ATOM   2825 C CG    . GLN B 1 153 ? -22.048 18.267  -31.202 1.00 13.33 ? 136  GLN B CG    1 
ATOM   2826 C CD    . GLN B 1 153 ? -20.618 18.799  -31.368 1.00 13.26 ? 136  GLN B CD    1 
ATOM   2827 O OE1   . GLN B 1 153 ? -19.743 18.587  -30.528 1.00 17.75 ? 136  GLN B OE1   1 
ATOM   2828 N NE2   . GLN B 1 153 ? -20.398 19.515  -32.453 1.00 12.89 ? 136  GLN B NE2   1 
ATOM   2829 N N     . TRP B 1 154 ? -25.289 18.008  -31.196 1.00 12.56 ? 137  TRP B N     1 
ATOM   2830 C CA    . TRP B 1 154 ? -26.225 17.922  -32.323 1.00 12.45 ? 137  TRP B CA    1 
ATOM   2831 C C     . TRP B 1 154 ? -27.301 16.823  -32.138 1.00 12.61 ? 137  TRP B C     1 
ATOM   2832 O O     . TRP B 1 154 ? -27.660 16.102  -33.054 1.00 12.36 ? 137  TRP B O     1 
ATOM   2833 C CB    . TRP B 1 154 ? -25.461 17.865  -33.666 1.00 13.72 ? 137  TRP B CB    1 
ATOM   2834 C CG    . TRP B 1 154 ? -24.861 19.245  -33.999 1.00 13.62 ? 137  TRP B CG    1 
ATOM   2835 C CD1   . TRP B 1 154 ? -25.476 20.465  -33.847 1.00 16.97 ? 137  TRP B CD1   1 
ATOM   2836 C CD2   . TRP B 1 154 ? -23.556 19.522  -34.532 1.00 15.62 ? 137  TRP B CD2   1 
ATOM   2837 N NE1   . TRP B 1 154 ? -24.638 21.476  -34.246 1.00 16.19 ? 137  TRP B NE1   1 
ATOM   2838 C CE2   . TRP B 1 154 ? -23.454 20.926  -34.672 1.00 18.00 ? 137  TRP B CE2   1 
ATOM   2839 C CE3   . TRP B 1 154 ? -22.466 18.716  -34.909 1.00 14.04 ? 137  TRP B CE3   1 
ATOM   2840 C CZ2   . TRP B 1 154 ? -22.306 21.554  -35.178 1.00 15.76 ? 137  TRP B CZ2   1 
ATOM   2841 C CZ3   . TRP B 1 154 ? -21.319 19.344  -35.405 1.00 16.01 ? 137  TRP B CZ3   1 
ATOM   2842 C CH2   . TRP B 1 154 ? -21.247 20.751  -35.523 1.00 15.36 ? 137  TRP B CH2   1 
ATOM   2843 N N     . VAL B 1 155 ? -27.854 16.764  -30.926 1.00 11.34 ? 138  VAL B N     1 
ATOM   2844 C CA    . VAL B 1 155 ? -28.898 15.784  -30.676 1.00 11.49 ? 138  VAL B CA    1 
ATOM   2845 C C     . VAL B 1 155 ? -29.960 16.299  -29.698 1.00 10.76 ? 138  VAL B C     1 
ATOM   2846 O O     . VAL B 1 155 ? -31.046 15.707  -29.629 1.00 11.02 ? 138  VAL B O     1 
ATOM   2847 C CB    . VAL B 1 155 ? -28.291 14.421  -30.229 1.00 10.38 ? 138  VAL B CB    1 
ATOM   2848 C CG1   . VAL B 1 155 ? -27.585 14.549  -28.861 1.00 11.17 ? 138  VAL B CG1   1 
ATOM   2849 C CG2   . VAL B 1 155 ? -29.316 13.265  -30.231 1.00 11.42 ? 138  VAL B CG2   1 
ATOM   2850 N N     . ILE B 1 156 ? -29.704 17.384  -28.957 1.00 11.59 ? 139  ILE B N     1 
ATOM   2851 C CA    . ILE B 1 156 ? -30.737 17.769  -27.945 1.00 11.43 ? 139  ILE B CA    1 
ATOM   2852 C C     . ILE B 1 156 ? -32.085 18.125  -28.576 1.00 11.11 ? 139  ILE B C     1 
ATOM   2853 O O     . ILE B 1 156 ? -33.140 18.037  -27.929 1.00 10.69 ? 139  ILE B O     1 
ATOM   2854 C CB    . ILE B 1 156 ? -30.327 18.939  -26.997 1.00 11.36 ? 139  ILE B CB    1 
ATOM   2855 C CG1   . ILE B 1 156 ? -30.205 20.250  -27.762 1.00 12.72 ? 139  ILE B CG1   1 
ATOM   2856 C CG2   . ILE B 1 156 ? -29.078 18.577  -26.196 1.00 12.08 ? 139  ILE B CG2   1 
ATOM   2857 C CD1   . ILE B 1 156 ? -30.050 21.483  -26.829 1.00 12.75 ? 139  ILE B CD1   1 
ATOM   2858 N N     . GLY B 1 157 ? -32.039 18.600  -29.811 1.00 11.92 ? 140  GLY B N     1 
ATOM   2859 C CA    . GLY B 1 157 ? -33.266 18.883  -30.557 1.00 12.18 ? 140  GLY B CA    1 
ATOM   2860 C C     . GLY B 1 157 ? -34.103 17.652  -30.886 1.00 11.98 ? 140  GLY B C     1 
ATOM   2861 O O     . GLY B 1 157 ? -35.230 17.793  -31.353 1.00 12.78 ? 140  GLY B O     1 
ATOM   2862 N N     . HIS B 1 158 ? -33.558 16.452  -30.696 1.00 11.10 ? 141  HIS B N     1 
ATOM   2863 C CA    . HIS B 1 158 ? -34.339 15.237  -30.857 1.00 11.72 ? 141  HIS B CA    1 
ATOM   2864 C C     . HIS B 1 158 ? -35.132 14.810  -29.628 1.00 12.43 ? 141  HIS B C     1 
ATOM   2865 O O     . HIS B 1 158 ? -35.860 13.785  -29.656 1.00 13.35 ? 141  HIS B O     1 
ATOM   2866 C CB    . HIS B 1 158 ? -33.458 14.096  -31.384 1.00 10.97 ? 141  HIS B CB    1 
ATOM   2867 C CG    . HIS B 1 158 ? -33.228 14.177  -32.854 1.00 11.74 ? 141  HIS B CG    1 
ATOM   2868 N ND1   . HIS B 1 158 ? -34.259 14.116  -33.777 1.00 13.61 ? 141  HIS B ND1   1 
ATOM   2869 C CD2   . HIS B 1 158 ? -32.089 14.348  -33.563 1.00 10.18 ? 141  HIS B CD2   1 
ATOM   2870 C CE1   . HIS B 1 158 ? -33.751 14.217  -34.995 1.00 14.17 ? 141  HIS B CE1   1 
ATOM   2871 N NE2   . HIS B 1 158 ? -32.439 14.356  -34.896 1.00 12.71 ? 141  HIS B NE2   1 
ATOM   2872 N N     . LEU B 1 159 ? -34.993 15.565  -28.542 1.00 12.64 ? 142  LEU B N     1 
ATOM   2873 C CA    . LEU B 1 159 ? -35.755 15.252  -27.310 1.00 13.72 ? 142  LEU B CA    1 
ATOM   2874 C C     . LEU B 1 159 ? -36.784 16.319  -27.008 1.00 13.94 ? 142  LEU B C     1 
ATOM   2875 O O     . LEU B 1 159 ? -36.551 17.485  -27.274 1.00 12.86 ? 142  LEU B O     1 
ATOM   2876 C CB    . LEU B 1 159 ? -34.817 15.138  -26.114 1.00 13.61 ? 142  LEU B CB    1 
ATOM   2877 C CG    . LEU B 1 159 ? -34.176 13.787  -25.765 1.00 16.64 ? 142  LEU B CG    1 
ATOM   2878 C CD1   . LEU B 1 159 ? -33.613 13.139  -26.979 1.00 17.77 ? 142  LEU B CD1   1 
ATOM   2879 C CD2   . LEU B 1 159 ? -33.112 13.953  -24.669 1.00 14.86 ? 142  LEU B CD2   1 
ATOM   2880 N N     . THR B 1 160 ? -37.909 15.923  -26.406 1.00 14.47 ? 143  THR B N     1 
ATOM   2881 C CA    . THR B 1 160 ? -38.867 16.927  -25.887 1.00 15.57 ? 143  THR B CA    1 
ATOM   2882 C C     . THR B 1 160 ? -38.218 17.685  -24.739 1.00 15.07 ? 143  THR B C     1 
ATOM   2883 O O     . THR B 1 160 ? -37.235 17.215  -24.165 1.00 15.26 ? 143  THR B O     1 
ATOM   2884 C CB    . THR B 1 160 ? -40.151 16.272  -25.333 1.00 15.35 ? 143  THR B CB    1 
ATOM   2885 O OG1   . THR B 1 160 ? -39.832 15.411  -24.226 1.00 16.52 ? 143  THR B OG1   1 
ATOM   2886 C CG2   . THR B 1 160 ? -40.872 15.494  -26.448 1.00 16.93 ? 143  THR B CG2   1 
ATOM   2887 N N     . ASP B 1 161 ? -38.766 18.841  -24.386 1.00 15.54 ? 144  ASP B N     1 
ATOM   2888 C CA    . ASP B 1 161 ? -38.259 19.572  -23.215 1.00 15.79 ? 144  ASP B CA    1 
ATOM   2889 C C     . ASP B 1 161 ? -38.191 18.685  -21.971 1.00 15.99 ? 144  ASP B C     1 
ATOM   2890 O O     . ASP B 1 161 ? -37.180 18.684  -21.275 1.00 16.17 ? 144  ASP B O     1 
ATOM   2891 C CB    . ASP B 1 161 ? -39.132 20.802  -22.921 1.00 16.20 ? 144  ASP B CB    1 
ATOM   2892 C CG    . ASP B 1 161 ? -39.044 21.847  -24.026 1.00 16.01 ? 144  ASP B CG    1 
ATOM   2893 O OD1   . ASP B 1 161 ? -38.069 21.810  -24.813 1.00 18.03 ? 144  ASP B OD1   1 
ATOM   2894 O OD2   . ASP B 1 161 ? -39.957 22.683  -24.129 1.00 15.37 ? 144  ASP B OD2   1 
ATOM   2895 N N     . GLN B 1 162 ? -39.263 17.942  -21.680 1.00 16.51 ? 145  GLN B N     1 
ATOM   2896 C CA    . GLN B 1 162 ? -39.288 17.153  -20.456 1.00 17.59 ? 145  GLN B CA    1 
ATOM   2897 C C     . GLN B 1 162 ? -38.279 16.035  -20.509 1.00 16.10 ? 145  GLN B C     1 
ATOM   2898 O O     . GLN B 1 162 ? -37.588 15.793  -19.528 1.00 15.18 ? 145  GLN B O     1 
ATOM   2899 C CB    . GLN B 1 162 ? -40.693 16.608  -20.101 1.00 17.11 ? 145  GLN B CB    1 
ATOM   2900 C CG    . GLN B 1 162 ? -40.747 16.046  -18.678 1.00 21.08 ? 145  GLN B CG    1 
ATOM   2901 C CD    . GLN B 1 162 ? -42.143 15.590  -18.247 1.00 22.02 ? 145  GLN B CD    1 
ATOM   2902 O OE1   . GLN B 1 162 ? -43.141 15.975  -18.849 1.00 27.50 ? 145  GLN B OE1   1 
ATOM   2903 N NE2   . GLN B 1 162 ? -42.207 14.769  -17.198 1.00 26.39 ? 145  GLN B NE2   1 
ATOM   2904 N N     . HIS B 1 163 ? -38.178 15.358  -21.649 1.00 15.42 ? 146  HIS B N     1 
ATOM   2905 C CA    . HIS B 1 163 ? -37.209 14.275  -21.748 1.00 15.14 ? 146  HIS B CA    1 
ATOM   2906 C C     . HIS B 1 163 ? -35.790 14.848  -21.660 1.00 14.68 ? 146  HIS B C     1 
ATOM   2907 O O     . HIS B 1 163 ? -34.899 14.204  -21.091 1.00 13.64 ? 146  HIS B O     1 
ATOM   2908 C CB    . HIS B 1 163 ? -37.390 13.428  -23.015 1.00 15.77 ? 146  HIS B CB    1 
ATOM   2909 C CG    . HIS B 1 163 ? -38.611 12.563  -23.001 1.00 18.95 ? 146  HIS B CG    1 
ATOM   2910 N ND1   . HIS B 1 163 ? -39.245 12.146  -24.154 1.00 19.52 ? 146  HIS B ND1   1 
ATOM   2911 C CD2   . HIS B 1 163 ? -39.323 12.043  -21.971 1.00 20.95 ? 146  HIS B CD2   1 
ATOM   2912 C CE1   . HIS B 1 163 ? -40.289 11.398  -23.835 1.00 22.21 ? 146  HIS B CE1   1 
ATOM   2913 N NE2   . HIS B 1 163 ? -40.357 11.316  -22.518 1.00 20.89 ? 146  HIS B NE2   1 
ATOM   2914 N N     . LEU B 1 164 ? -35.579 16.027  -22.237 1.00 13.45 ? 147  LEU B N     1 
ATOM   2915 C CA    . LEU B 1 164 ? -34.258 16.683  -22.127 1.00 14.07 ? 147  LEU B CA    1 
ATOM   2916 C C     . LEU B 1 164 ? -33.888 17.008  -20.667 1.00 14.53 ? 147  LEU B C     1 
ATOM   2917 O O     . LEU B 1 164 ? -32.812 16.643  -20.190 1.00 14.14 ? 147  LEU B O     1 
ATOM   2918 C CB    . LEU B 1 164 ? -34.180 17.938  -23.014 1.00 13.77 ? 147  LEU B CB    1 
ATOM   2919 C CG    . LEU B 1 164 ? -32.813 18.656  -23.019 1.00 13.07 ? 147  LEU B CG    1 
ATOM   2920 C CD1   . LEU B 1 164 ? -31.634 17.720  -23.355 1.00 14.49 ? 147  LEU B CD1   1 
ATOM   2921 C CD2   . LEU B 1 164 ? -32.861 19.830  -23.969 1.00 13.59 ? 147  LEU B CD2   1 
ATOM   2922 N N     . ALA B 1 165 ? -34.789 17.681  -19.957 1.00 15.84 ? 148  ALA B N     1 
ATOM   2923 C CA    . ALA B 1 165 ? -34.547 17.971  -18.540 1.00 16.90 ? 148  ALA B CA    1 
ATOM   2924 C C     . ALA B 1 165 ? -34.237 16.697  -17.737 1.00 17.30 ? 148  ALA B C     1 
ATOM   2925 O O     . ALA B 1 165 ? -33.305 16.670  -16.921 1.00 17.72 ? 148  ALA B O     1 
ATOM   2926 C CB    . ALA B 1 165 ? -35.757 18.717  -17.941 1.00 16.64 ? 148  ALA B CB    1 
ATOM   2927 N N     . GLU B 1 166 ? -35.005 15.633  -17.988 1.00 17.42 ? 149  GLU B N     1 
ATOM   2928 C CA    . GLU B 1 166 ? -34.912 14.402  -17.214 1.00 18.48 ? 149  GLU B CA    1 
ATOM   2929 C C     . GLU B 1 166 ? -33.638 13.665  -17.555 1.00 17.17 ? 149  GLU B C     1 
ATOM   2930 O O     . GLU B 1 166 ? -32.968 13.166  -16.668 1.00 16.97 ? 149  GLU B O     1 
ATOM   2931 C CB    . GLU B 1 166 ? -36.147 13.514  -17.433 1.00 19.21 ? 149  GLU B CB    1 
ATOM   2932 C CG    . GLU B 1 166 ? -37.387 14.169  -16.825 1.00 19.55 ? 149  GLU B CG    1 
ATOM   2933 C CD    . GLU B 1 166 ? -38.706 13.473  -17.167 1.00 22.30 ? 149  GLU B CD    1 
ATOM   2934 O OE1   . GLU B 1 166 ? -38.752 12.669  -18.125 1.00 27.10 ? 149  GLU B OE1   1 
ATOM   2935 O OE2   . GLU B 1 166 ? -39.717 13.756  -16.466 1.00 24.89 ? 149  GLU B OE2   1 
ATOM   2936 N N     . PHE B 1 167 ? -33.306 13.623  -18.844 1.00 16.49 ? 150  PHE B N     1 
ATOM   2937 C CA    . PHE B 1 167 ? -32.037 13.054  -19.280 1.00 15.36 ? 150  PHE B CA    1 
ATOM   2938 C C     . PHE B 1 167 ? -30.856 13.769  -18.592 1.00 14.60 ? 150  PHE B C     1 
ATOM   2939 O O     . PHE B 1 167 ? -29.943 13.119  -18.081 1.00 15.46 ? 150  PHE B O     1 
ATOM   2940 C CB    . PHE B 1 167 ? -31.874 13.117  -20.816 1.00 14.94 ? 150  PHE B CB    1 
ATOM   2941 C CG    . PHE B 1 167 ? -30.595 12.507  -21.292 1.00 13.10 ? 150  PHE B CG    1 
ATOM   2942 C CD1   . PHE B 1 167 ? -30.331 11.136  -21.089 1.00 13.36 ? 150  PHE B CD1   1 
ATOM   2943 C CD2   . PHE B 1 167 ? -29.624 13.284  -21.914 1.00 14.03 ? 150  PHE B CD2   1 
ATOM   2944 C CE1   . PHE B 1 167 ? -29.114 10.561  -21.507 1.00 14.06 ? 150  PHE B CE1   1 
ATOM   2945 C CE2   . PHE B 1 167 ? -28.408 12.707  -22.321 1.00 14.51 ? 150  PHE B CE2   1 
ATOM   2946 C CZ    . PHE B 1 167 ? -28.158 11.356  -22.140 1.00 14.85 ? 150  PHE B CZ    1 
ATOM   2947 N N     . LEU B 1 168 ? -30.880 15.096  -18.586 1.00 15.23 ? 151  LEU B N     1 
ATOM   2948 C CA    . LEU B 1 168 ? -29.793 15.868  -17.989 1.00 15.11 ? 151  LEU B CA    1 
ATOM   2949 C C     . LEU B 1 168 ? -29.699 15.604  -16.494 1.00 15.34 ? 151  LEU B C     1 
ATOM   2950 O O     . LEU B 1 168 ? -28.597 15.505  -15.955 1.00 15.69 ? 151  LEU B O     1 
ATOM   2951 C CB    . LEU B 1 168 ? -29.935 17.362  -18.269 1.00 14.96 ? 151  LEU B CB    1 
ATOM   2952 C CG    . LEU B 1 168 ? -29.741 17.838  -19.719 1.00 12.85 ? 151  LEU B CG    1 
ATOM   2953 C CD1   . LEU B 1 168 ? -30.100 19.341  -19.826 1.00 11.85 ? 151  LEU B CD1   1 
ATOM   2954 C CD2   . LEU B 1 168 ? -28.310 17.519  -20.209 1.00 13.74 ? 151  LEU B CD2   1 
ATOM   2955 N N     . ARG B 1 169 ? -30.842 15.418  -15.839 1.00 17.03 ? 152  ARG B N     1 
ATOM   2956 C CA    . ARG B 1 169 ? -30.830 15.005  -14.424 1.00 18.05 ? 152  ARG B CA    1 
ATOM   2957 C C     . ARG B 1 169 ? -30.215 13.625  -14.244 1.00 18.54 ? 152  ARG B C     1 
ATOM   2958 O O     . ARG B 1 169 ? -29.425 13.397  -13.315 1.00 17.98 ? 152  ARG B O     1 
ATOM   2959 C CB    . ARG B 1 169 ? -32.231 15.031  -13.817 1.00 18.38 ? 152  ARG B CB    1 
ATOM   2960 C CG    . ARG B 1 169 ? -32.830 16.434  -13.651 1.00 21.76 ? 152  ARG B CG    1 
ATOM   2961 C CD    . ARG B 1 169 ? -33.965 16.421  -12.607 1.00 28.15 ? 152  ARG B CD    1 
ATOM   2962 N NE    . ARG B 1 169 ? -34.339 17.759  -12.120 1.00 32.97 ? 152  ARG B NE    1 
ATOM   2963 C CZ    . ARG B 1 169 ? -33.772 18.407  -11.097 1.00 34.41 ? 152  ARG B CZ    1 
ATOM   2964 N NH1   . ARG B 1 169 ? -32.759 17.881  -10.419 1.00 36.64 ? 152  ARG B NH1   1 
ATOM   2965 N NH2   . ARG B 1 169 ? -34.219 19.606  -10.755 1.00 34.20 ? 152  ARG B NH2   1 
ATOM   2966 N N     . ARG B 1 170 ? -30.564 12.701  -15.136 1.00 18.71 ? 153  ARG B N     1 
ATOM   2967 C CA    . ARG B 1 170 ? -29.936 11.387  -15.128 1.00 18.91 ? 153  ARG B CA    1 
ATOM   2968 C C     . ARG B 1 170 ? -28.416 11.484  -15.343 1.00 18.74 ? 153  ARG B C     1 
ATOM   2969 O O     . ARG B 1 170 ? -27.636 10.896  -14.603 1.00 18.60 ? 153  ARG B O     1 
ATOM   2970 C CB    . ARG B 1 170 ? -30.617 10.440  -16.131 1.00 18.81 ? 153  ARG B CB    1 
ATOM   2971 C CG    . ARG B 1 170 ? -32.056 10.102  -15.766 1.00 17.94 ? 153  ARG B CG    1 
ATOM   2972 C CD    . ARG B 1 170 ? -32.553 8.780   -16.387 1.00 20.25 ? 153  ARG B CD    1 
ATOM   2973 N NE    . ARG B 1 170 ? -32.595 8.797   -17.848 1.00 20.73 ? 153  ARG B NE    1 
ATOM   2974 C CZ    . ARG B 1 170 ? -33.500 9.465   -18.563 1.00 20.13 ? 153  ARG B CZ    1 
ATOM   2975 N NH1   . ARG B 1 170 ? -34.449 10.179  -17.954 1.00 19.76 ? 153  ARG B NH1   1 
ATOM   2976 N NH2   . ARG B 1 170 ? -33.465 9.412   -19.890 1.00 19.59 ? 153  ARG B NH2   1 
ATOM   2977 N N     . CYS B 1 171 ? -27.991 12.240  -16.358 1.00 18.27 ? 154  CYS B N     1 
ATOM   2978 C CA    . CYS B 1 171 ? -26.581 12.496  -16.594 1.00 18.14 ? 154  CYS B CA    1 
ATOM   2979 C C     . CYS B 1 171 ? -25.861 13.027  -15.348 1.00 18.58 ? 154  CYS B C     1 
ATOM   2980 O O     . CYS B 1 171 ? -24.780 12.559  -15.024 1.00 18.56 ? 154  CYS B O     1 
ATOM   2981 C CB    . CYS B 1 171 ? -26.411 13.492  -17.742 1.00 17.53 ? 154  CYS B CB    1 
ATOM   2982 S SG    . CYS B 1 171 ? -26.773 12.764  -19.343 1.00 17.29 ? 154  CYS B SG    1 
ATOM   2983 N N     . LYS B 1 172 ? -26.457 14.016  -14.678 1.00 18.80 ? 155  LYS B N     1 
ATOM   2984 C CA    . LYS B 1 172 ? -25.857 14.613  -13.484 1.00 20.60 ? 155  LYS B CA    1 
ATOM   2985 C C     . LYS B 1 172 ? -25.599 13.502  -12.460 1.00 21.33 ? 155  LYS B C     1 
ATOM   2986 O O     . LYS B 1 172 ? -24.516 13.418  -11.889 1.00 20.76 ? 155  LYS B O     1 
ATOM   2987 C CB    . LYS B 1 172 ? -26.773 15.698  -12.911 1.00 20.18 ? 155  LYS B CB    1 
ATOM   2988 C CG    . LYS B 1 172 ? -26.212 16.398  -11.663 1.00 21.39 ? 155  LYS B CG    1 
ATOM   2989 C CD    . LYS B 1 172 ? -27.277 17.286  -11.017 1.00 21.54 ? 155  LYS B CD    1 
ATOM   2990 C CE    . LYS B 1 172 ? -26.790 17.897  -9.706  1.00 25.68 ? 155  LYS B CE    1 
ATOM   2991 N NZ    . LYS B 1 172 ? -25.891 19.079  -9.914  1.00 26.64 ? 155  LYS B NZ    1 
ATOM   2992 N N     . GLY B 1 173 ? -26.591 12.632  -12.276 1.00 22.31 ? 156  GLY B N     1 
ATOM   2993 C CA    . GLY B 1 173 ? -26.452 11.486  -11.377 1.00 24.97 ? 156  GLY B CA    1 
ATOM   2994 C C     . GLY B 1 173 ? -25.353 10.495  -11.726 1.00 25.28 ? 156  GLY B C     1 
ATOM   2995 O O     . GLY B 1 173 ? -24.939 9.711   -10.866 1.00 27.25 ? 156  GLY B O     1 
ATOM   2996 N N     . SER B 1 174 ? -24.865 10.518  -12.969 1.00 25.18 ? 157  SER B N     1 
ATOM   2997 C CA    . SER B 1 174 ? -23.814 9.584   -13.439 1.00 24.90 ? 157  SER B CA    1 
ATOM   2998 C C     . SER B 1 174 ? -22.384 10.141  -13.474 1.00 24.75 ? 157  SER B C     1 
ATOM   2999 O O     . SER B 1 174 ? -21.421 9.421   -13.788 1.00 24.44 ? 157  SER B O     1 
ATOM   3000 C CB    . SER B 1 174 ? -24.174 9.024   -14.819 1.00 25.41 ? 157  SER B CB    1 
ATOM   3001 O OG    . SER B 1 174 ? -24.057 10.023  -15.803 1.00 25.93 ? 157  SER B OG    1 
ATOM   3002 N N     . LEU B 1 175 ? -22.242 11.425  -13.154 1.00 24.17 ? 158  LEU B N     1 
ATOM   3003 C CA    . LEU B 1 175 ? -20.945 12.071  -13.206 1.00 23.81 ? 158  LEU B CA    1 
ATOM   3004 C C     . LEU B 1 175 ? -20.022 11.638  -12.075 1.00 25.00 ? 158  LEU B C     1 
ATOM   3005 O O     . LEU B 1 175 ? -20.447 11.509  -10.929 1.00 25.70 ? 158  LEU B O     1 
ATOM   3006 C CB    . LEU B 1 175 ? -21.114 13.585  -13.161 1.00 23.73 ? 158  LEU B CB    1 
ATOM   3007 C CG    . LEU B 1 175 ? -21.737 14.222  -14.406 1.00 21.51 ? 158  LEU B CG    1 
ATOM   3008 C CD1   . LEU B 1 175 ? -21.882 15.708  -14.146 1.00 20.92 ? 158  LEU B CD1   1 
ATOM   3009 C CD2   . LEU B 1 175 ? -20.853 13.988  -15.616 1.00 21.16 ? 158  LEU B CD2   1 
ATOM   3010 N N     . ARG B 1 176 ? -18.762 11.429  -12.420 1.00 25.13 ? 159  ARG B N     1 
ATOM   3011 C CA    . ARG B 1 176 ? -17.727 11.227  -11.420 1.00 26.43 ? 159  ARG B CA    1 
ATOM   3012 C C     . ARG B 1 176 ? -17.395 12.586  -10.758 1.00 26.03 ? 159  ARG B C     1 
ATOM   3013 O O     . ARG B 1 176 ? -17.740 13.645  -11.307 1.00 25.81 ? 159  ARG B O     1 
ATOM   3014 C CB    . ARG B 1 176 ? -16.506 10.596  -12.067 1.00 26.69 ? 159  ARG B CB    1 
ATOM   3015 C CG    . ARG B 1 176 ? -16.632 9.089   -12.325 1.00 29.68 ? 159  ARG B CG    1 
ATOM   3016 C CD    . ARG B 1 176 ? -15.257 8.456   -12.256 1.00 35.69 ? 159  ARG B CD    1 
ATOM   3017 N NE    . ARG B 1 176 ? -15.252 7.019   -12.508 1.00 39.62 ? 159  ARG B NE    1 
ATOM   3018 C CZ    . ARG B 1 176 ? -15.083 6.461   -13.709 1.00 41.24 ? 159  ARG B CZ    1 
ATOM   3019 N NH1   . ARG B 1 176 ? -14.927 7.216   -14.795 1.00 43.16 ? 159  ARG B NH1   1 
ATOM   3020 N NH2   . ARG B 1 176 ? -15.076 5.141   -13.830 1.00 42.07 ? 159  ARG B NH2   1 
ATOM   3021 N N     . PRO B 1 177 ? -16.758 12.568  -9.564  1.00 25.49 ? 160  PRO B N     1 
ATOM   3022 C CA    . PRO B 1 177 ? -16.366 13.845  -8.958  1.00 24.87 ? 160  PRO B CA    1 
ATOM   3023 C C     . PRO B 1 177 ? -15.605 14.744  -9.927  1.00 23.79 ? 160  PRO B C     1 
ATOM   3024 O O     . PRO B 1 177 ? -14.726 14.281  -10.652 1.00 22.73 ? 160  PRO B O     1 
ATOM   3025 C CB    . PRO B 1 177 ? -15.478 13.411  -7.769  1.00 25.19 ? 160  PRO B CB    1 
ATOM   3026 C CG    . PRO B 1 177 ? -16.077 12.092  -7.356  1.00 25.53 ? 160  PRO B CG    1 
ATOM   3027 C CD    . PRO B 1 177 ? -16.402 11.424  -8.691  1.00 26.29 ? 160  PRO B CD    1 
ATOM   3028 N N     . ASN B 1 178 ? -15.993 16.020  -9.947  1.00 23.00 ? 161  ASN B N     1 
ATOM   3029 C CA    . ASN B 1 178 ? -15.477 17.037  -10.872 1.00 22.82 ? 161  ASN B CA    1 
ATOM   3030 C C     . ASN B 1 178 ? -15.871 16.844  -12.338 1.00 22.22 ? 161  ASN B C     1 
ATOM   3031 O O     . ASN B 1 178 ? -15.434 17.597  -13.202 1.00 21.91 ? 161  ASN B O     1 
ATOM   3032 C CB    . ASN B 1 178 ? -13.968 17.200  -10.746 1.00 22.94 ? 161  ASN B CB    1 
ATOM   3033 C CG    . ASN B 1 178 ? -13.532 17.485  -9.315  1.00 23.92 ? 161  ASN B CG    1 
ATOM   3034 O OD1   . ASN B 1 178 ? -14.169 18.266  -8.602  1.00 26.78 ? 161  ASN B OD1   1 
ATOM   3035 N ND2   . ASN B 1 178 ? -12.440 16.856  -8.891  1.00 27.86 ? 161  ASN B ND2   1 
ATOM   3036 N N     . GLY B 1 179 ? -16.711 15.848  -12.597 1.00 21.47 ? 162  GLY B N     1 
ATOM   3037 C CA    . GLY B 1 179 ? -17.138 15.534  -13.964 1.00 20.05 ? 162  GLY B CA    1 
ATOM   3038 C C     . GLY B 1 179 ? -18.032 16.618  -14.540 1.00 18.73 ? 162  GLY B C     1 
ATOM   3039 O O     . GLY B 1 179 ? -18.661 17.389  -13.798 1.00 18.56 ? 162  GLY B O     1 
ATOM   3040 N N     . ILE B 1 180 ? -18.095 16.689  -15.866 1.00 17.76 ? 163  ILE B N     1 
ATOM   3041 C CA    . ILE B 1 180 ? -18.951 17.703  -16.521 1.00 16.19 ? 163  ILE B CA    1 
ATOM   3042 C C     . ILE B 1 180 ? -19.814 17.124  -17.646 1.00 16.12 ? 163  ILE B C     1 
ATOM   3043 O O     . ILE B 1 180 ? -19.476 16.103  -18.243 1.00 15.94 ? 163  ILE B O     1 
ATOM   3044 C CB    . ILE B 1 180 ? -18.126 18.882  -17.090 1.00 16.08 ? 163  ILE B CB    1 
ATOM   3045 C CG1   . ILE B 1 180 ? -17.199 18.405  -18.210 1.00 16.94 ? 163  ILE B CG1   1 
ATOM   3046 C CG2   . ILE B 1 180 ? -17.403 19.643  -15.948 1.00 15.97 ? 163  ILE B CG2   1 
ATOM   3047 C CD1   . ILE B 1 180 ? -16.449 19.514  -18.942 1.00 16.53 ? 163  ILE B CD1   1 
ATOM   3048 N N     . ILE B 1 181 ? -20.949 17.776  -17.890 1.00 15.75 ? 164  ILE B N     1 
ATOM   3049 C CA    . ILE B 1 181 ? -21.740 17.539  -19.091 1.00 15.00 ? 164  ILE B CA    1 
ATOM   3050 C C     . ILE B 1 181 ? -21.460 18.697  -20.054 1.00 15.36 ? 164  ILE B C     1 
ATOM   3051 O O     . ILE B 1 181 ? -21.425 19.864  -19.637 1.00 15.39 ? 164  ILE B O     1 
ATOM   3052 C CB    . ILE B 1 181 ? -23.256 17.544  -18.741 1.00 14.93 ? 164  ILE B CB    1 
ATOM   3053 C CG1   . ILE B 1 181 ? -23.593 16.392  -17.793 1.00 13.57 ? 164  ILE B CG1   1 
ATOM   3054 C CG2   . ILE B 1 181 ? -24.107 17.498  -20.006 1.00 15.66 ? 164  ILE B CG2   1 
ATOM   3055 C CD1   . ILE B 1 181 ? -24.736 16.694  -16.886 1.00 15.87 ? 164  ILE B CD1   1 
ATOM   3056 N N     . VAL B 1 182 ? -21.291 18.377  -21.330 1.00 14.54 ? 165  VAL B N     1 
ATOM   3057 C CA    . VAL B 1 182 ? -21.195 19.396  -22.359 1.00 14.14 ? 165  VAL B CA    1 
ATOM   3058 C C     . VAL B 1 182 ? -22.322 19.214  -23.356 1.00 13.75 ? 165  VAL B C     1 
ATOM   3059 O O     . VAL B 1 182 ? -22.490 18.125  -23.915 1.00 13.68 ? 165  VAL B O     1 
ATOM   3060 C CB    . VAL B 1 182 ? -19.847 19.333  -23.097 1.00 14.38 ? 165  VAL B CB    1 
ATOM   3061 C CG1   . VAL B 1 182 ? -19.841 20.350  -24.268 1.00 14.39 ? 165  VAL B CG1   1 
ATOM   3062 C CG2   . VAL B 1 182 ? -18.661 19.550  -22.084 1.00 14.46 ? 165  VAL B CG2   1 
ATOM   3063 N N     . ILE B 1 183 ? -23.111 20.266  -23.528 1.00 12.61 ? 166  ILE B N     1 
ATOM   3064 C CA    . ILE B 1 183 ? -24.050 20.402  -24.656 1.00 12.68 ? 166  ILE B CA    1 
ATOM   3065 C C     . ILE B 1 183 ? -23.432 21.309  -25.709 1.00 13.32 ? 166  ILE B C     1 
ATOM   3066 O O     . ILE B 1 183 ? -23.012 22.442  -25.410 1.00 13.68 ? 166  ILE B O     1 
ATOM   3067 C CB    . ILE B 1 183 ? -25.418 21.013  -24.215 1.00 13.09 ? 166  ILE B CB    1 
ATOM   3068 C CG1   . ILE B 1 183 ? -26.114 20.069  -23.246 1.00 12.32 ? 166  ILE B CG1   1 
ATOM   3069 C CG2   . ILE B 1 183 ? -26.319 21.314  -25.448 1.00 13.34 ? 166  ILE B CG2   1 
ATOM   3070 C CD1   . ILE B 1 183 ? -27.338 20.634  -22.546 1.00 12.75 ? 166  ILE B CD1   1 
ATOM   3071 N N     . LYS B 1 184 ? -23.370 20.804  -26.934 1.00 12.88 ? 167  LYS B N     1 
ATOM   3072 C CA    . LYS B 1 184 ? -22.947 21.619  -28.070 1.00 13.34 ? 167  LYS B CA    1 
ATOM   3073 C C     . LYS B 1 184 ? -23.979 21.471  -29.179 1.00 13.41 ? 167  LYS B C     1 
ATOM   3074 O O     . LYS B 1 184 ? -24.222 20.370  -29.667 1.00 12.84 ? 167  LYS B O     1 
ATOM   3075 C CB    . LYS B 1 184 ? -21.534 21.222  -28.513 1.00 13.00 ? 167  LYS B CB    1 
ATOM   3076 C CG    . LYS B 1 184 ? -21.020 22.058  -29.668 1.00 13.75 ? 167  LYS B CG    1 
ATOM   3077 C CD    . LYS B 1 184 ? -19.505 21.943  -29.915 1.00 13.93 ? 167  LYS B CD    1 
ATOM   3078 C CE    . LYS B 1 184 ? -19.105 23.024  -30.907 1.00 15.59 ? 167  LYS B CE    1 
ATOM   3079 N NZ    . LYS B 1 184 ? -17.626 23.085  -31.238 1.00 15.55 ? 167  LYS B NZ    1 
ATOM   3080 N N     . ASP B 1 185 ? -24.619 22.569  -29.568 1.00 14.25 ? 168  ASP B N     1 
ATOM   3081 C CA    . ASP B 1 185 ? -25.759 22.431  -30.463 1.00 14.82 ? 168  ASP B CA    1 
ATOM   3082 C C     . ASP B 1 185 ? -26.159 23.766  -31.109 1.00 16.55 ? 168  ASP B C     1 
ATOM   3083 O O     . ASP B 1 185 ? -25.672 24.837  -30.716 1.00 15.04 ? 168  ASP B O     1 
ATOM   3084 C CB    . ASP B 1 185 ? -26.951 21.815  -29.699 1.00 16.41 ? 168  ASP B CB    1 
ATOM   3085 C CG    . ASP B 1 185 ? -27.606 20.636  -30.448 1.00 15.48 ? 168  ASP B CG    1 
ATOM   3086 O OD1   . ASP B 1 185 ? -28.141 20.858  -31.534 1.00 20.79 ? 168  ASP B OD1   1 
ATOM   3087 O OD2   . ASP B 1 185 ? -27.645 19.508  -29.897 1.00 22.34 ? 168  ASP B OD2   1 
ATOM   3088 N N     . ASN B 1 186 ? -27.010 23.650  -32.127 1.00 17.42 ? 169  ASN B N     1 
ATOM   3089 C CA    . ASN B 1 186 ? -27.686 24.753  -32.776 1.00 18.74 ? 169  ASN B CA    1 
ATOM   3090 C C     . ASN B 1 186 ? -28.599 25.459  -31.798 1.00 19.23 ? 169  ASN B C     1 
ATOM   3091 O O     . ASN B 1 186 ? -29.295 24.797  -31.007 1.00 18.64 ? 169  ASN B O     1 
ATOM   3092 C CB    . ASN B 1 186 ? -28.533 24.205  -33.934 1.00 19.73 ? 169  ASN B CB    1 
ATOM   3093 C CG    . ASN B 1 186 ? -27.781 23.224  -34.768 1.00 20.82 ? 169  ASN B CG    1 
ATOM   3094 O OD1   . ASN B 1 186 ? -26.621 23.459  -35.103 1.00 23.07 ? 169  ASN B OD1   1 
ATOM   3095 N ND2   . ASN B 1 186 ? -28.413 22.094  -35.086 1.00 21.47 ? 169  ASN B ND2   1 
ATOM   3096 N N     . MET B 1 187 ? -28.550 26.787  -31.836 1.00 20.19 ? 170  MET B N     1 
ATOM   3097 C CA    . MET B 1 187 ? -29.472 27.633  -31.078 1.00 21.00 ? 170  MET B CA    1 
ATOM   3098 C C     . MET B 1 187 ? -30.272 28.460  -32.069 1.00 21.33 ? 170  MET B C     1 
ATOM   3099 O O     . MET B 1 187 ? -29.704 29.012  -33.012 1.00 22.43 ? 170  MET B O     1 
ATOM   3100 C CB    . MET B 1 187 ? -28.715 28.547  -30.112 1.00 21.55 ? 170  MET B CB    1 
ATOM   3101 C CG    . MET B 1 187 ? -27.838 27.792  -29.120 1.00 22.73 ? 170  MET B CG    1 
ATOM   3102 S SD    . MET B 1 187 ? -28.783 26.839  -27.907 1.00 23.50 ? 170  MET B SD    1 
ATOM   3103 C CE    . MET B 1 187 ? -27.870 25.294  -27.877 1.00 23.33 ? 170  MET B CE    1 
ATOM   3104 N N     . ALA B 1 188 ? -31.591 28.515  -31.875 1.00 21.42 ? 171  ALA B N     1 
ATOM   3105 C CA    . ALA B 1 188 ? -32.479 29.309  -32.753 1.00 21.88 ? 171  ALA B CA    1 
ATOM   3106 C C     . ALA B 1 188 ? -32.385 30.775  -32.354 1.00 23.01 ? 171  ALA B C     1 
ATOM   3107 O O     . ALA B 1 188 ? -32.066 31.085  -31.215 1.00 22.57 ? 171  ALA B O     1 
ATOM   3108 C CB    . ALA B 1 188 ? -33.929 28.827  -32.634 1.00 21.99 ? 171  ALA B CB    1 
ATOM   3109 N N     . GLN B 1 189 ? -32.688 31.673  -33.287 1.00 23.83 ? 172  GLN B N     1 
ATOM   3110 C CA    . GLN B 1 189 ? -32.713 33.104  -32.964 1.00 25.46 ? 172  GLN B CA    1 
ATOM   3111 C C     . GLN B 1 189 ? -33.802 33.367  -31.916 1.00 24.53 ? 172  GLN B C     1 
ATOM   3112 O O     . GLN B 1 189 ? -33.565 34.050  -30.933 1.00 25.32 ? 172  GLN B O     1 
ATOM   3113 C CB    . GLN B 1 189 ? -32.904 33.959  -34.226 1.00 25.71 ? 172  GLN B CB    1 
ATOM   3114 C CG    . GLN B 1 189 ? -31.829 33.749  -35.325 1.00 30.46 ? 172  GLN B CG    1 
ATOM   3115 C CD    . GLN B 1 189 ? -30.603 34.666  -35.201 1.00 34.46 ? 172  GLN B CD    1 
ATOM   3116 O OE1   . GLN B 1 189 ? -30.031 35.088  -36.215 1.00 36.91 ? 172  GLN B OE1   1 
ATOM   3117 N NE2   . GLN B 1 189 ? -30.178 34.952  -33.969 1.00 35.60 ? 172  GLN B NE2   1 
ATOM   3118 N N     . GLU B 1 190 ? -34.970 32.747  -32.089 1.00 24.71 ? 173  GLU B N     1 
ATOM   3119 C CA    . GLU B 1 190 ? -36.083 32.945  -31.176 1.00 24.41 ? 173  GLU B CA    1 
ATOM   3120 C C     . GLU B 1 190 ? -37.045 31.760  -31.156 1.00 23.55 ? 173  GLU B C     1 
ATOM   3121 O O     . GLU B 1 190 ? -37.357 31.183  -32.207 1.00 23.80 ? 173  GLU B O     1 
ATOM   3122 C CB    . GLU B 1 190 ? -36.811 34.218  -31.590 1.00 25.41 ? 173  GLU B CB    1 
ATOM   3123 C CG    . GLU B 1 190 ? -37.812 34.738  -30.635 1.00 27.62 ? 173  GLU B CG    1 
ATOM   3124 C CD    . GLU B 1 190 ? -38.432 35.986  -31.204 1.00 32.45 ? 173  GLU B CD    1 
ATOM   3125 O OE1   . GLU B 1 190 ? -39.571 35.893  -31.705 1.00 32.34 ? 173  GLU B OE1   1 
ATOM   3126 O OE2   . GLU B 1 190 ? -37.740 37.037  -31.203 1.00 35.29 ? 173  GLU B OE2   1 
ATOM   3127 N N     . GLY B 1 191 ? -37.474 31.383  -29.952 1.00 22.21 ? 174  GLY B N     1 
ATOM   3128 C CA    . GLY B 1 191 ? -38.535 30.395  -29.767 1.00 21.19 ? 174  GLY B CA    1 
ATOM   3129 C C     . GLY B 1 191 ? -38.076 28.963  -29.943 1.00 20.69 ? 174  GLY B C     1 
ATOM   3130 O O     . GLY B 1 191 ? -36.892 28.669  -29.816 1.00 19.66 ? 174  GLY B O     1 
ATOM   3131 N N     . VAL B 1 192 ? -39.032 28.080  -30.199 1.00 20.28 ? 175  VAL B N     1 
ATOM   3132 C CA    . VAL B 1 192 ? -38.763 26.652  -30.483 1.00 19.87 ? 175  VAL B CA    1 
ATOM   3133 C C     . VAL B 1 192 ? -39.281 26.385  -31.905 1.00 20.37 ? 175  VAL B C     1 
ATOM   3134 O O     . VAL B 1 192 ? -40.454 26.640  -32.194 1.00 19.35 ? 175  VAL B O     1 
ATOM   3135 C CB    . VAL B 1 192 ? -39.461 25.751  -29.449 1.00 20.96 ? 175  VAL B CB    1 
ATOM   3136 C CG1   . VAL B 1 192 ? -39.287 24.266  -29.776 1.00 21.15 ? 175  VAL B CG1   1 
ATOM   3137 C CG2   . VAL B 1 192 ? -38.932 26.049  -28.051 1.00 19.02 ? 175  VAL B CG2   1 
ATOM   3138 N N     . ILE B 1 193 ? -38.390 25.904  -32.776 1.00 20.28 ? 176  ILE B N     1 
ATOM   3139 C CA    . ILE B 1 193 ? -38.650 25.743  -34.207 1.00 21.88 ? 176  ILE B CA    1 
ATOM   3140 C C     . ILE B 1 193 ? -38.584 24.262  -34.600 1.00 22.32 ? 176  ILE B C     1 
ATOM   3141 O O     . ILE B 1 193 ? -37.597 23.596  -34.312 1.00 22.16 ? 176  ILE B O     1 
ATOM   3142 C CB    . ILE B 1 193 ? -37.605 26.537  -35.024 1.00 21.90 ? 176  ILE B CB    1 
ATOM   3143 C CG1   . ILE B 1 193 ? -37.745 28.051  -34.728 1.00 23.85 ? 176  ILE B CG1   1 
ATOM   3144 C CG2   . ILE B 1 193 ? -37.726 26.261  -36.522 1.00 22.05 ? 176  ILE B CG2   1 
ATOM   3145 C CD1   . ILE B 1 193 ? -36.645 28.898  -35.305 1.00 26.42 ? 176  ILE B CD1   1 
ATOM   3146 N N     . LEU B 1 194 ? -39.608 23.775  -35.299 1.00 23.43 ? 177  LEU B N     1 
ATOM   3147 C CA    . LEU B 1 194 ? -39.626 22.385  -35.766 1.00 23.41 ? 177  LEU B CA    1 
ATOM   3148 C C     . LEU B 1 194 ? -38.964 22.251  -37.137 1.00 23.86 ? 177  LEU B C     1 
ATOM   3149 O O     . LEU B 1 194 ? -39.244 23.021  -38.074 1.00 23.56 ? 177  LEU B O     1 
ATOM   3150 C CB    . LEU B 1 194 ? -41.063 21.841  -35.811 1.00 23.17 ? 177  LEU B CB    1 
ATOM   3151 C CG    . LEU B 1 194 ? -41.227 20.358  -36.200 1.00 24.04 ? 177  LEU B CG    1 
ATOM   3152 C CD1   . LEU B 1 194 ? -40.825 19.429  -35.069 1.00 23.52 ? 177  LEU B CD1   1 
ATOM   3153 C CD2   . LEU B 1 194 ? -42.652 20.055  -36.619 1.00 25.08 ? 177  LEU B CD2   1 
ATOM   3154 N N     . ASP B 1 195 ? -38.063 21.279  -37.241 1.00 22.97 ? 178  ASP B N     1 
ATOM   3155 C CA    . ASP B 1 195 ? -37.512 20.864  -38.516 1.00 23.63 ? 178  ASP B CA    1 
ATOM   3156 C C     . ASP B 1 195 ? -38.282 19.616  -38.897 1.00 23.45 ? 178  ASP B C     1 
ATOM   3157 O O     . ASP B 1 195 ? -38.113 18.568  -38.283 1.00 22.87 ? 178  ASP B O     1 
ATOM   3158 C CB    . ASP B 1 195 ? -36.004 20.565  -38.371 1.00 23.70 ? 178  ASP B CB    1 
ATOM   3159 C CG    . ASP B 1 195 ? -35.296 20.338  -39.719 1.00 26.32 ? 178  ASP B CG    1 
ATOM   3160 O OD1   . ASP B 1 195 ? -35.890 19.763  -40.651 1.00 26.62 ? 178  ASP B OD1   1 
ATOM   3161 O OD2   . ASP B 1 195 ? -34.119 20.733  -39.848 1.00 29.38 ? 178  ASP B OD2   1 
ATOM   3162 N N     . ASP B 1 196 ? -39.183 19.715  -39.875 1.00 23.72 ? 179  ASP B N     1 
ATOM   3163 C CA    . ASP B 1 196 ? -39.913 18.513  -40.254 1.00 23.82 ? 179  ASP B CA    1 
ATOM   3164 C C     . ASP B 1 196 ? -39.145 17.631  -41.276 1.00 22.71 ? 179  ASP B C     1 
ATOM   3165 O O     . ASP B 1 196 ? -39.642 16.597  -41.720 1.00 24.25 ? 179  ASP B O     1 
ATOM   3166 C CB    . ASP B 1 196 ? -41.375 18.819  -40.640 1.00 24.16 ? 179  ASP B CB    1 
ATOM   3167 C CG    . ASP B 1 196 ? -41.493 19.656  -41.892 1.00 24.42 ? 179  ASP B CG    1 
ATOM   3168 O OD1   . ASP B 1 196 ? -40.448 19.988  -42.494 1.00 25.90 ? 179  ASP B OD1   1 
ATOM   3169 O OD2   . ASP B 1 196 ? -42.649 19.991  -42.258 1.00 25.44 ? 179  ASP B OD2   1 
ATOM   3170 N N     . VAL B 1 197 ? -37.908 18.008  -41.603 1.00 22.60 ? 180  VAL B N     1 
ATOM   3171 C CA    . VAL B 1 197 ? -37.048 17.124  -42.404 1.00 22.01 ? 180  VAL B CA    1 
ATOM   3172 C C     . VAL B 1 197 ? -36.535 15.983  -41.508 1.00 21.40 ? 180  VAL B C     1 
ATOM   3173 O O     . VAL B 1 197 ? -36.792 14.794  -41.777 1.00 21.89 ? 180  VAL B O     1 
ATOM   3174 C CB    . VAL B 1 197 ? -35.865 17.887  -43.095 1.00 22.04 ? 180  VAL B CB    1 
ATOM   3175 C CG1   . VAL B 1 197 ? -34.835 16.935  -43.694 1.00 22.88 ? 180  VAL B CG1   1 
ATOM   3176 C CG2   . VAL B 1 197 ? -36.394 18.844  -44.163 1.00 23.46 ? 180  VAL B CG2   1 
ATOM   3177 N N     . ASP B 1 198 ? -35.821 16.347  -40.449 1.00 20.21 ? 181  ASP B N     1 
ATOM   3178 C CA    . ASP B 1 198 ? -35.229 15.338  -39.580 1.00 18.37 ? 181  ASP B CA    1 
ATOM   3179 C C     . ASP B 1 198 ? -36.069 15.077  -38.316 1.00 17.25 ? 181  ASP B C     1 
ATOM   3180 O O     . ASP B 1 198 ? -35.690 14.245  -37.489 1.00 17.06 ? 181  ASP B O     1 
ATOM   3181 C CB    . ASP B 1 198 ? -33.759 15.682  -39.249 1.00 17.76 ? 181  ASP B CB    1 
ATOM   3182 C CG    . ASP B 1 198 ? -33.615 16.962  -38.462 1.00 18.12 ? 181  ASP B CG    1 
ATOM   3183 O OD1   . ASP B 1 198 ? -34.656 17.503  -38.046 1.00 19.52 ? 181  ASP B OD1   1 
ATOM   3184 O OD2   . ASP B 1 198 ? -32.466 17.417  -38.232 1.00 20.02 ? 181  ASP B OD2   1 
ATOM   3185 N N     . SER B 1 199 ? -37.200 15.777  -38.162 1.00 16.31 ? 182  SER B N     1 
ATOM   3186 C CA    . SER B 1 199 ? -38.060 15.615  -36.977 1.00 16.03 ? 182  SER B CA    1 
ATOM   3187 C C     . SER B 1 199 ? -37.297 15.932  -35.679 1.00 16.57 ? 182  SER B C     1 
ATOM   3188 O O     . SER B 1 199 ? -37.135 15.076  -34.785 1.00 15.42 ? 182  SER B O     1 
ATOM   3189 C CB    . SER B 1 199 ? -38.679 14.216  -36.917 1.00 15.74 ? 182  SER B CB    1 
ATOM   3190 O OG    . SER B 1 199 ? -39.686 14.130  -35.942 1.00 15.76 ? 182  SER B OG    1 
ATOM   3191 N N     . SER B 1 200 ? -36.833 17.177  -35.612 1.00 17.04 ? 183  SER B N     1 
ATOM   3192 C CA    . SER B 1 200 ? -36.129 17.713  -34.455 1.00 17.66 ? 183  SER B CA    1 
ATOM   3193 C C     . SER B 1 200 ? -36.627 19.143  -34.232 1.00 17.69 ? 183  SER B C     1 
ATOM   3194 O O     . SER B 1 200 ? -37.306 19.718  -35.092 1.00 17.77 ? 183  SER B O     1 
ATOM   3195 C CB    . SER B 1 200 ? -34.620 17.708  -34.672 1.00 17.58 ? 183  SER B CB    1 
ATOM   3196 O OG    . SER B 1 200 ? -34.221 18.561  -35.758 1.00 18.87 ? 183  SER B OG    1 
ATOM   3197 N N     . VAL B 1 201 ? -36.320 19.689  -33.070 1.00 16.85 ? 184  VAL B N     1 
ATOM   3198 C CA    . VAL B 1 201 ? -36.499 21.121  -32.853 1.00 16.91 ? 184  VAL B CA    1 
ATOM   3199 C C     . VAL B 1 201 ? -35.179 21.854  -32.675 1.00 17.20 ? 184  VAL B C     1 
ATOM   3200 O O     . VAL B 1 201 ? -34.145 21.254  -32.375 1.00 15.96 ? 184  VAL B O     1 
ATOM   3201 C CB    . VAL B 1 201 ? -37.423 21.414  -31.662 1.00 16.60 ? 184  VAL B CB    1 
ATOM   3202 C CG1   . VAL B 1 201 ? -38.809 20.814  -31.936 1.00 17.00 ? 184  VAL B CG1   1 
ATOM   3203 C CG2   . VAL B 1 201 ? -36.817 20.878  -30.320 1.00 18.31 ? 184  VAL B CG2   1 
ATOM   3204 N N     . CYS B 1 202 ? -35.234 23.169  -32.826 1.00 17.86 ? 185  CYS B N     1 
ATOM   3205 C CA    . CYS B 1 202 ? -34.145 24.024  -32.431 1.00 18.29 ? 185  CYS B CA    1 
ATOM   3206 C C     . CYS B 1 202 ? -34.741 25.023  -31.465 1.00 17.80 ? 185  CYS B C     1 
ATOM   3207 O O     . CYS B 1 202 ? -35.834 25.542  -31.708 1.00 18.60 ? 185  CYS B O     1 
ATOM   3208 C CB    . CYS B 1 202 ? -33.557 24.774  -33.624 1.00 17.94 ? 185  CYS B CB    1 
ATOM   3209 S SG    . CYS B 1 202 ? -31.977 25.506  -33.226 1.00 22.58 ? 185  CYS B SG    1 
ATOM   3210 N N     . ARG B 1 203 ? -34.021 25.304  -30.401 1.00 17.18 ? 186  ARG B N     1 
ATOM   3211 C CA    . ARG B 1 203 ? -34.524 26.140  -29.318 1.00 17.22 ? 186  ARG B CA    1 
ATOM   3212 C C     . ARG B 1 203 ? -33.626 27.345  -29.164 1.00 17.67 ? 186  ARG B C     1 
ATOM   3213 O O     . ARG B 1 203 ? -32.430 27.236  -29.392 1.00 18.49 ? 186  ARG B O     1 
ATOM   3214 C CB    . ARG B 1 203 ? -34.490 25.383  -28.004 1.00 17.24 ? 186  ARG B CB    1 
ATOM   3215 C CG    . ARG B 1 203 ? -35.358 24.144  -27.934 1.00 14.86 ? 186  ARG B CG    1 
ATOM   3216 C CD    . ARG B 1 203 ? -34.791 23.282  -26.810 1.00 15.76 ? 186  ARG B CD    1 
ATOM   3217 N NE    . ARG B 1 203 ? -35.626 22.145  -26.391 1.00 15.58 ? 186  ARG B NE    1 
ATOM   3218 C CZ    . ARG B 1 203 ? -35.402 20.869  -26.701 1.00 14.55 ? 186  ARG B CZ    1 
ATOM   3219 N NH1   . ARG B 1 203 ? -34.382 20.540  -27.504 1.00 14.45 ? 186  ARG B NH1   1 
ATOM   3220 N NH2   . ARG B 1 203 ? -36.210 19.925  -26.199 1.00 16.06 ? 186  ARG B NH2   1 
ATOM   3221 N N     . ASP B 1 204 ? -34.196 28.485  -28.756 1.00 17.72 ? 187  ASP B N     1 
ATOM   3222 C CA    . ASP B 1 204 ? -33.367 29.673  -28.497 1.00 18.48 ? 187  ASP B CA    1 
ATOM   3223 C C     . ASP B 1 204 ? -32.556 29.535  -27.186 1.00 18.09 ? 187  ASP B C     1 
ATOM   3224 O O     . ASP B 1 204 ? -32.852 28.663  -26.368 1.00 18.52 ? 187  ASP B O     1 
ATOM   3225 C CB    . ASP B 1 204 ? -34.190 30.990  -28.622 1.00 18.40 ? 187  ASP B CB    1 
ATOM   3226 C CG    . ASP B 1 204 ? -35.077 31.281  -27.420 1.00 21.21 ? 187  ASP B CG    1 
ATOM   3227 O OD1   . ASP B 1 204 ? -34.766 30.830  -26.303 1.00 21.68 ? 187  ASP B OD1   1 
ATOM   3228 O OD2   . ASP B 1 204 ? -36.078 32.030  -27.595 1.00 22.48 ? 187  ASP B OD2   1 
ATOM   3229 N N     . LEU B 1 205 ? -31.522 30.364  -27.011 1.00 18.23 ? 188  LEU B N     1 
ATOM   3230 C CA    . LEU B 1 205 ? -30.688 30.315  -25.802 1.00 18.59 ? 188  LEU B CA    1 
ATOM   3231 C C     . LEU B 1 205 ? -31.450 30.358  -24.482 1.00 18.65 ? 188  LEU B C     1 
ATOM   3232 O O     . LEU B 1 205 ? -31.094 29.673  -23.535 1.00 17.86 ? 188  LEU B O     1 
ATOM   3233 C CB    . LEU B 1 205 ? -29.645 31.437  -25.823 1.00 18.22 ? 188  LEU B CB    1 
ATOM   3234 C CG    . LEU B 1 205 ? -28.521 31.293  -26.844 1.00 20.51 ? 188  LEU B CG    1 
ATOM   3235 C CD1   . LEU B 1 205 ? -27.777 32.601  -26.999 1.00 21.06 ? 188  LEU B CD1   1 
ATOM   3236 C CD2   . LEU B 1 205 ? -27.567 30.179  -26.433 1.00 20.15 ? 188  LEU B CD2   1 
ATOM   3237 N N     . ASP B 1 206 ? -32.491 31.183  -24.408 1.00 19.12 ? 189  ASP B N     1 
ATOM   3238 C CA    . ASP B 1 206 ? -33.284 31.282  -23.192 1.00 19.77 ? 189  ASP B CA    1 
ATOM   3239 C C     . ASP B 1 206 ? -33.995 29.986  -22.841 1.00 19.16 ? 189  ASP B C     1 
ATOM   3240 O O     . ASP B 1 206 ? -33.991 29.562  -21.678 1.00 19.58 ? 189  ASP B O     1 
ATOM   3241 C CB    . ASP B 1 206 ? -34.254 32.468  -23.287 1.00 20.11 ? 189  ASP B CB    1 
ATOM   3242 C CG    . ASP B 1 206 ? -33.528 33.815  -23.259 1.00 24.07 ? 189  ASP B CG    1 
ATOM   3243 O OD1   . ASP B 1 206 ? -32.407 33.914  -22.708 1.00 25.24 ? 189  ASP B OD1   1 
ATOM   3244 O OD2   . ASP B 1 206 ? -34.088 34.788  -23.793 1.00 28.26 ? 189  ASP B OD2   1 
ATOM   3245 N N     . VAL B 1 207 ? -34.589 29.345  -23.843 1.00 17.74 ? 190  VAL B N     1 
ATOM   3246 C CA    . VAL B 1 207 ? -35.244 28.060  -23.640 1.00 17.12 ? 190  VAL B CA    1 
ATOM   3247 C C     . VAL B 1 207 ? -34.237 27.020  -23.118 1.00 16.19 ? 190  VAL B C     1 
ATOM   3248 O O     . VAL B 1 207 ? -34.508 26.316  -22.140 1.00 16.11 ? 190  VAL B O     1 
ATOM   3249 C CB    . VAL B 1 207 ? -35.949 27.575  -24.935 1.00 17.15 ? 190  VAL B CB    1 
ATOM   3250 C CG1   . VAL B 1 207 ? -36.543 26.184  -24.753 1.00 15.97 ? 190  VAL B CG1   1 
ATOM   3251 C CG2   . VAL B 1 207 ? -37.058 28.580  -25.367 1.00 17.20 ? 190  VAL B CG2   1 
ATOM   3252 N N     . VAL B 1 208 ? -33.071 26.947  -23.752 1.00 15.48 ? 191  VAL B N     1 
ATOM   3253 C CA    . VAL B 1 208 ? -32.051 25.971  -23.359 1.00 15.45 ? 191  VAL B CA    1 
ATOM   3254 C C     . VAL B 1 208 ? -31.551 26.240  -21.939 1.00 15.44 ? 191  VAL B C     1 
ATOM   3255 O O     . VAL B 1 208 ? -31.441 25.318  -21.128 1.00 14.86 ? 191  VAL B O     1 
ATOM   3256 C CB    . VAL B 1 208 ? -30.899 25.913  -24.372 1.00 15.36 ? 191  VAL B CB    1 
ATOM   3257 C CG1   . VAL B 1 208 ? -29.784 24.989  -23.864 1.00 15.75 ? 191  VAL B CG1   1 
ATOM   3258 C CG2   . VAL B 1 208 ? -31.416 25.391  -25.722 1.00 15.09 ? 191  VAL B CG2   1 
ATOM   3259 N N     . ARG B 1 209 ? -31.271 27.504  -21.632 1.00 16.08 ? 192  ARG B N     1 
ATOM   3260 C CA    . ARG B 1 209 ? -30.899 27.851  -20.259 1.00 17.12 ? 192  ARG B CA    1 
ATOM   3261 C C     . ARG B 1 209 ? -31.952 27.482  -19.216 1.00 16.88 ? 192  ARG B C     1 
ATOM   3262 O O     . ARG B 1 209 ? -31.608 27.047  -18.134 1.00 16.42 ? 192  ARG B O     1 
ATOM   3263 C CB    . ARG B 1 209 ? -30.592 29.320  -20.146 1.00 17.03 ? 192  ARG B CB    1 
ATOM   3264 C CG    . ARG B 1 209 ? -29.401 29.758  -20.928 1.00 21.36 ? 192  ARG B CG    1 
ATOM   3265 C CD    . ARG B 1 209 ? -29.395 31.270  -20.837 1.00 25.69 ? 192  ARG B CD    1 
ATOM   3266 N NE    . ARG B 1 209 ? -28.699 31.903  -21.945 1.00 27.07 ? 192  ARG B NE    1 
ATOM   3267 C CZ    . ARG B 1 209 ? -27.384 31.970  -22.003 1.00 26.55 ? 192  ARG B CZ    1 
ATOM   3268 N NH1   . ARG B 1 209 ? -26.674 31.426  -21.021 1.00 27.55 ? 192  ARG B NH1   1 
ATOM   3269 N NH2   . ARG B 1 209 ? -26.785 32.571  -23.023 1.00 28.61 ? 192  ARG B NH2   1 
ATOM   3270 N N     . ARG B 1 210 ? -33.230 27.728  -19.512 1.00 17.66 ? 193  ARG B N     1 
ATOM   3271 C CA    . ARG B 1 210 ? -34.320 27.362  -18.616 1.00 18.68 ? 193  ARG B CA    1 
ATOM   3272 C C     . ARG B 1 210 ? -34.283 25.877  -18.316 1.00 17.77 ? 193  ARG B C     1 
ATOM   3273 O O     . ARG B 1 210 ? -34.396 25.469  -17.170 1.00 17.36 ? 193  ARG B O     1 
ATOM   3274 C CB    . ARG B 1 210 ? -35.672 27.730  -19.251 1.00 19.13 ? 193  ARG B CB    1 
ATOM   3275 C CG    . ARG B 1 210 ? -36.825 27.883  -18.298 1.00 21.89 ? 193  ARG B CG    1 
ATOM   3276 C CD    . ARG B 1 210 ? -38.008 28.649  -18.946 1.00 22.09 ? 193  ARG B CD    1 
ATOM   3277 N NE    . ARG B 1 210 ? -37.564 29.763  -19.782 1.00 30.45 ? 193  ARG B NE    1 
ATOM   3278 C CZ    . ARG B 1 210 ? -37.992 30.030  -21.021 1.00 30.18 ? 193  ARG B CZ    1 
ATOM   3279 N NH1   . ARG B 1 210 ? -38.928 29.291  -21.611 1.00 30.59 ? 193  ARG B NH1   1 
ATOM   3280 N NH2   . ARG B 1 210 ? -37.487 31.068  -21.669 1.00 32.00 ? 193  ARG B NH2   1 
ATOM   3281 N N     . ILE B 1 211 ? -34.124 25.065  -19.365 1.00 16.90 ? 194  ILE B N     1 
ATOM   3282 C CA    . ILE B 1 211 ? -34.103 23.620  -19.203 1.00 16.20 ? 194  ILE B CA    1 
ATOM   3283 C C     . ILE B 1 211 ? -32.898 23.182  -18.341 1.00 16.75 ? 194  ILE B C     1 
ATOM   3284 O O     . ILE B 1 211 ? -33.022 22.326  -17.453 1.00 16.95 ? 194  ILE B O     1 
ATOM   3285 C CB    . ILE B 1 211 ? -34.117 22.910  -20.584 1.00 15.87 ? 194  ILE B CB    1 
ATOM   3286 C CG1   . ILE B 1 211 ? -35.456 23.161  -21.284 1.00 15.08 ? 194  ILE B CG1   1 
ATOM   3287 C CG2   . ILE B 1 211 ? -33.825 21.396  -20.407 1.00 17.14 ? 194  ILE B CG2   1 
ATOM   3288 C CD1   . ILE B 1 211 ? -35.466 22.882  -22.818 1.00 15.54 ? 194  ILE B CD1   1 
ATOM   3289 N N     . ILE B 1 212 ? -31.727 23.760  -18.613 1.00 16.87 ? 195  ILE B N     1 
ATOM   3290 C CA    . ILE B 1 212 ? -30.531 23.501  -17.787 1.00 17.66 ? 195  ILE B CA    1 
ATOM   3291 C C     . ILE B 1 212 ? -30.761 23.783  -16.300 1.00 17.64 ? 195  ILE B C     1 
ATOM   3292 O O     . ILE B 1 212 ? -30.514 22.929  -15.450 1.00 17.52 ? 195  ILE B O     1 
ATOM   3293 C CB    . ILE B 1 212 ? -29.291 24.259  -18.350 1.00 17.04 ? 195  ILE B CB    1 
ATOM   3294 C CG1   . ILE B 1 212 ? -28.930 23.648  -19.720 1.00 17.76 ? 195  ILE B CG1   1 
ATOM   3295 C CG2   . ILE B 1 212 ? -28.099 24.244  -17.329 1.00 17.60 ? 195  ILE B CG2   1 
ATOM   3296 C CD1   . ILE B 1 212 ? -27.936 24.451  -20.563 1.00 17.83 ? 195  ILE B CD1   1 
ATOM   3297 N N     . CYS B 1 213 ? -31.257 24.973  -15.984 1.00 18.64 ? 196  CYS B N     1 
ATOM   3298 C CA    . CYS B 1 213 ? -31.421 25.364  -14.579 1.00 20.45 ? 196  CYS B CA    1 
ATOM   3299 C C     . CYS B 1 213 ? -32.422 24.443  -13.880 1.00 20.63 ? 196  CYS B C     1 
ATOM   3300 O O     . CYS B 1 213 ? -32.192 23.997  -12.741 1.00 20.50 ? 196  CYS B O     1 
ATOM   3301 C CB    . CYS B 1 213 ? -31.817 26.838  -14.480 1.00 20.89 ? 196  CYS B CB    1 
ATOM   3302 S SG    . CYS B 1 213 ? -30.537 27.914  -15.175 1.00 24.56 ? 196  CYS B SG    1 
ATOM   3303 N N     . SER B 1 214 ? -33.481 24.088  -14.609 1.00 20.68 ? 197  SER B N     1 
ATOM   3304 C CA    . SER B 1 214 ? -34.515 23.170  -14.107 1.00 21.40 ? 197  SER B CA    1 
ATOM   3305 C C     . SER B 1 214 ? -33.993 21.744  -13.818 1.00 21.31 ? 197  SER B C     1 
ATOM   3306 O O     . SER B 1 214 ? -34.565 21.017  -13.009 1.00 21.03 ? 197  SER B O     1 
ATOM   3307 C CB    . SER B 1 214 ? -35.703 23.123  -15.078 1.00 21.32 ? 197  SER B CB    1 
ATOM   3308 O OG    . SER B 1 214 ? -35.486 22.182  -16.130 1.00 21.35 ? 197  SER B OG    1 
ATOM   3309 N N     . ALA B 1 215 ? -32.899 21.346  -14.466 1.00 21.03 ? 198  ALA B N     1 
ATOM   3310 C CA    . ALA B 1 215 ? -32.323 20.023  -14.213 1.00 21.08 ? 198  ALA B CA    1 
ATOM   3311 C C     . ALA B 1 215 ? -31.376 20.004  -12.999 1.00 21.13 ? 198  ALA B C     1 
ATOM   3312 O O     . ALA B 1 215 ? -30.744 18.988  -12.716 1.00 21.83 ? 198  ALA B O     1 
ATOM   3313 C CB    . ALA B 1 215 ? -31.608 19.488  -15.476 1.00 20.70 ? 198  ALA B CB    1 
ATOM   3314 N N     . GLY B 1 216 ? -31.252 21.136  -12.306 1.00 20.74 ? 199  GLY B N     1 
ATOM   3315 C CA    . GLY B 1 216 ? -30.453 21.194  -11.092 1.00 20.48 ? 199  GLY B CA    1 
ATOM   3316 C C     . GLY B 1 216 ? -28.972 21.266  -11.407 1.00 20.28 ? 199  GLY B C     1 
ATOM   3317 O O     . GLY B 1 216 ? -28.122 20.904  -10.589 1.00 21.53 ? 199  GLY B O     1 
ATOM   3318 N N     . LEU B 1 217 ? -28.669 21.735  -12.607 1.00 19.56 ? 200  LEU B N     1 
ATOM   3319 C CA    . LEU B 1 217 ? -27.295 21.902  -13.038 1.00 19.14 ? 200  LEU B CA    1 
ATOM   3320 C C     . LEU B 1 217 ? -26.860 23.354  -12.908 1.00 19.32 ? 200  LEU B C     1 
ATOM   3321 O O     . LEU B 1 217 ? -27.679 24.265  -12.931 1.00 18.98 ? 200  LEU B O     1 
ATOM   3322 C CB    . LEU B 1 217 ? -27.160 21.473  -14.501 1.00 19.48 ? 200  LEU B CB    1 
ATOM   3323 C CG    . LEU B 1 217 ? -27.370 19.979  -14.759 1.00 17.93 ? 200  LEU B CG    1 
ATOM   3324 C CD1   . LEU B 1 217 ? -27.619 19.787  -16.222 1.00 18.99 ? 200  LEU B CD1   1 
ATOM   3325 C CD2   . LEU B 1 217 ? -26.171 19.145  -14.258 1.00 20.72 ? 200  LEU B CD2   1 
ATOM   3326 N N     . SER B 1 218 ? -25.552 23.546  -12.790 1.00 19.90 ? 201  SER B N     1 
ATOM   3327 C CA    . SER B 1 218 ? -24.936 24.858  -12.872 1.00 19.61 ? 201  SER B CA    1 
ATOM   3328 C C     . SER B 1 218 ? -24.258 25.004  -14.210 1.00 20.14 ? 201  SER B C     1 
ATOM   3329 O O     . SER B 1 218 ? -23.666 24.047  -14.727 1.00 18.95 ? 201  SER B O     1 
ATOM   3330 C CB    . SER B 1 218 ? -23.864 25.021  -11.792 1.00 20.14 ? 201  SER B CB    1 
ATOM   3331 O OG    . SER B 1 218 ? -24.402 25.082  -10.493 1.00 20.45 ? 201  SER B OG    1 
ATOM   3332 N N     . LEU B 1 219 ? -24.327 26.210  -14.762 1.00 19.96 ? 202  LEU B N     1 
ATOM   3333 C CA    . LEU B 1 219 ? -23.570 26.547  -15.955 1.00 20.56 ? 202  LEU B CA    1 
ATOM   3334 C C     . LEU B 1 219 ? -22.131 26.791  -15.517 1.00 20.56 ? 202  LEU B C     1 
ATOM   3335 O O     . LEU B 1 219 ? -21.892 27.555  -14.595 1.00 20.50 ? 202  LEU B O     1 
ATOM   3336 C CB    . LEU B 1 219 ? -24.156 27.799  -16.660 1.00 21.23 ? 202  LEU B CB    1 
ATOM   3337 C CG    . LEU B 1 219 ? -23.432 28.264  -17.941 1.00 22.02 ? 202  LEU B CG    1 
ATOM   3338 C CD1   . LEU B 1 219 ? -23.514 27.229  -19.080 1.00 24.28 ? 202  LEU B CD1   1 
ATOM   3339 C CD2   . LEU B 1 219 ? -23.936 29.639  -18.435 1.00 21.88 ? 202  LEU B CD2   1 
ATOM   3340 N N     . LEU B 1 220 ? -21.187 26.135  -16.184 1.00 19.95 ? 203  LEU B N     1 
ATOM   3341 C CA    . LEU B 1 220 ? -19.766 26.319  -15.879 1.00 20.24 ? 203  LEU B CA    1 
ATOM   3342 C C     . LEU B 1 220 ? -19.056 27.219  -16.881 1.00 21.03 ? 203  LEU B C     1 
ATOM   3343 O O     . LEU B 1 220 ? -18.157 27.985  -16.513 1.00 21.55 ? 203  LEU B O     1 
ATOM   3344 C CB    . LEU B 1 220 ? -19.053 24.962  -15.810 1.00 19.61 ? 203  LEU B CB    1 
ATOM   3345 C CG    . LEU B 1 220 ? -19.684 23.935  -14.843 1.00 18.97 ? 203  LEU B CG    1 
ATOM   3346 C CD1   . LEU B 1 220 ? -18.994 22.605  -14.959 1.00 18.10 ? 203  LEU B CD1   1 
ATOM   3347 C CD2   . LEU B 1 220 ? -19.769 24.381  -13.358 1.00 20.22 ? 203  LEU B CD2   1 
ATOM   3348 N N     . ALA B 1 221 ? -19.448 27.099  -18.145 1.00 20.66 ? 204  ALA B N     1 
ATOM   3349 C CA    . ALA B 1 221 ? -18.872 27.873  -19.230 1.00 21.30 ? 204  ALA B CA    1 
ATOM   3350 C C     . ALA B 1 221 ? -19.833 27.855  -20.406 1.00 22.11 ? 204  ALA B C     1 
ATOM   3351 O O     . ALA B 1 221 ? -20.530 26.863  -20.640 1.00 21.63 ? 204  ALA B O     1 
ATOM   3352 C CB    . ALA B 1 221 ? -17.491 27.293  -19.640 1.00 20.54 ? 204  ALA B CB    1 
ATOM   3353 N N     . GLU B 1 222 ? -19.886 28.971  -21.120 1.00 22.70 ? 205  GLU B N     1 
ATOM   3354 C CA    . GLU B 1 222 ? -20.661 29.072  -22.357 1.00 24.88 ? 205  GLU B CA    1 
ATOM   3355 C C     . GLU B 1 222 ? -19.766 29.702  -23.432 1.00 24.31 ? 205  GLU B C     1 
ATOM   3356 O O     . GLU B 1 222 ? -18.997 30.628  -23.147 1.00 24.83 ? 205  GLU B O     1 
ATOM   3357 C CB    . GLU B 1 222 ? -21.923 29.898  -22.077 1.00 24.58 ? 205  GLU B CB    1 
ATOM   3358 C CG    . GLU B 1 222 ? -22.760 30.306  -23.260 1.00 28.84 ? 205  GLU B CG    1 
ATOM   3359 C CD    . GLU B 1 222 ? -23.964 31.131  -22.826 1.00 29.05 ? 205  GLU B CD    1 
ATOM   3360 O OE1   . GLU B 1 222 ? -24.661 30.702  -21.878 1.00 33.82 ? 205  GLU B OE1   1 
ATOM   3361 O OE2   . GLU B 1 222 ? -24.209 32.205  -23.415 1.00 35.69 ? 205  GLU B OE2   1 
ATOM   3362 N N     . GLU B 1 223 ? -19.855 29.193  -24.656 1.00 23.21 ? 206  GLU B N     1 
ATOM   3363 C CA    . GLU B 1 223 ? -19.036 29.695  -25.749 1.00 23.41 ? 206  GLU B CA    1 
ATOM   3364 C C     . GLU B 1 223 ? -19.724 29.536  -27.099 1.00 23.69 ? 206  GLU B C     1 
ATOM   3365 O O     . GLU B 1 223 ? -20.100 28.427  -27.479 1.00 22.74 ? 206  GLU B O     1 
ATOM   3366 C CB    . GLU B 1 223 ? -17.704 28.930  -25.759 1.00 23.18 ? 206  GLU B CB    1 
ATOM   3367 C CG    . GLU B 1 223 ? -16.680 29.475  -26.719 1.00 25.33 ? 206  GLU B CG    1 
ATOM   3368 C CD    . GLU B 1 223 ? -15.371 28.740  -26.590 1.00 26.96 ? 206  GLU B CD    1 
ATOM   3369 O OE1   . GLU B 1 223 ? -14.702 28.908  -25.552 1.00 27.87 ? 206  GLU B OE1   1 
ATOM   3370 O OE2   . GLU B 1 223 ? -15.031 27.974  -27.512 1.00 28.09 ? 206  GLU B OE2   1 
ATOM   3371 N N     . ARG B 1 224 ? -19.890 30.650  -27.812 1.00 23.67 ? 207  ARG B N     1 
ATOM   3372 C CA    . ARG B 1 224 ? -20.357 30.621  -29.189 1.00 25.70 ? 207  ARG B CA    1 
ATOM   3373 C C     . ARG B 1 224 ? -19.238 30.131  -30.106 1.00 26.13 ? 207  ARG B C     1 
ATOM   3374 O O     . ARG B 1 224 ? -18.095 30.583  -29.993 1.00 26.57 ? 207  ARG B O     1 
ATOM   3375 C CB    . ARG B 1 224 ? -20.829 32.016  -29.634 1.00 25.39 ? 207  ARG B CB    1 
ATOM   3376 C CG    . ARG B 1 224 ? -21.493 32.004  -31.008 1.00 26.97 ? 207  ARG B CG    1 
ATOM   3377 C CD    . ARG B 1 224 ? -21.875 33.401  -31.516 1.00 27.13 ? 207  ARG B CD    1 
ATOM   3378 N NE    . ARG B 1 224 ? -22.259 33.308  -32.921 1.00 29.75 ? 207  ARG B NE    1 
ATOM   3379 C CZ    . ARG B 1 224 ? -22.463 34.341  -33.730 1.00 30.36 ? 207  ARG B CZ    1 
ATOM   3380 N NH2   . ARG B 1 224 ? -22.795 34.099  -34.994 1.00 32.23 ? 207  ARG B NH2   1 
ATOM   3381 N N     . GLN B 1 225 ? -19.591 29.207  -30.994 1.00 27.66 ? 208  GLN B N     1 
ATOM   3382 C CA    . GLN B 1 225 ? -18.701 28.641  -32.000 1.00 29.52 ? 208  GLN B CA    1 
ATOM   3383 C C     . GLN B 1 225 ? -18.456 29.625  -33.141 1.00 30.78 ? 208  GLN B C     1 
ATOM   3384 O O     . GLN B 1 225 ? -19.398 30.180  -33.712 1.00 30.34 ? 208  GLN B O     1 
ATOM   3385 C CB    . GLN B 1 225 ? -19.327 27.370  -32.574 1.00 29.67 ? 208  GLN B CB    1 
ATOM   3386 C CG    . GLN B 1 225 ? -18.613 26.797  -33.806 1.00 29.73 ? 208  GLN B CG    1 
ATOM   3387 C CD    . GLN B 1 225 ? -17.285 26.137  -33.472 1.00 30.53 ? 208  GLN B CD    1 
ATOM   3388 O OE1   . GLN B 1 225 ? -17.227 25.254  -32.642 1.00 27.24 ? 208  GLN B OE1   1 
ATOM   3389 N NE2   . GLN B 1 225 ? -16.216 26.558  -34.145 1.00 30.55 ? 208  GLN B NE2   1 
ATOM   3390 N N     . GLU B 1 226 ? -17.190 29.812  -33.496 1.00 32.73 ? 209  GLU B N     1 
ATOM   3391 C CA    . GLU B 1 226 ? -16.832 30.729  -34.582 1.00 34.64 ? 209  GLU B CA    1 
ATOM   3392 C C     . GLU B 1 226 ? -16.445 29.995  -35.864 1.00 35.10 ? 209  GLU B C     1 
ATOM   3393 O O     . GLU B 1 226 ? -16.118 28.800  -35.837 1.00 35.62 ? 209  GLU B O     1 
ATOM   3394 C CB    . GLU B 1 226 ? -15.690 31.641  -34.141 1.00 35.25 ? 209  GLU B CB    1 
ATOM   3395 C CG    . GLU B 1 226 ? -15.886 32.239  -32.755 1.00 37.51 ? 209  GLU B CG    1 
ATOM   3396 C CD    . GLU B 1 226 ? -14.633 32.906  -32.220 1.00 41.13 ? 209  GLU B CD    1 
ATOM   3397 O OE1   . GLU B 1 226 ? -14.486 32.983  -30.982 1.00 42.29 ? 209  GLU B OE1   1 
ATOM   3398 O OE2   . GLU B 1 226 ? -13.795 33.356  -33.033 1.00 43.72 ? 209  GLU B OE2   1 
ATOM   3399 N N     . ASN B 1 227 ? -16.487 30.718  -36.982 1.00 35.99 ? 210  ASN B N     1 
ATOM   3400 C CA    . ASN B 1 227 ? -15.980 30.231  -38.274 1.00 37.02 ? 210  ASN B CA    1 
ATOM   3401 C C     . ASN B 1 227 ? -16.886 29.213  -38.961 1.00 37.09 ? 210  ASN B C     1 
ATOM   3402 O O     . ASN B 1 227 ? -16.410 28.321  -39.663 1.00 37.09 ? 210  ASN B O     1 
ATOM   3403 C CB    . ASN B 1 227 ? -14.562 29.667  -38.120 1.00 37.24 ? 210  ASN B CB    1 
ATOM   3404 C CG    . ASN B 1 227 ? -13.586 30.687  -37.571 1.00 38.87 ? 210  ASN B CG    1 
ATOM   3405 O OD1   . ASN B 1 227 ? -13.319 31.714  -38.200 1.00 40.49 ? 210  ASN B OD1   1 
ATOM   3406 N ND2   . ASN B 1 227 ? -13.043 30.407  -36.390 1.00 40.78 ? 210  ASN B ND2   1 
ATOM   3407 N N     . LEU B 1 228 ? -18.187 29.353  -38.735 1.00 37.36 ? 211  LEU B N     1 
ATOM   3408 C CA    . LEU B 1 228 ? -19.199 28.495  -39.347 1.00 37.80 ? 211  LEU B CA    1 
ATOM   3409 C C     . LEU B 1 228 ? -19.821 29.155  -40.572 1.00 37.90 ? 211  LEU B C     1 
ATOM   3410 O O     . LEU B 1 228 ? -19.788 30.377  -40.682 1.00 38.12 ? 211  LEU B O     1 
ATOM   3411 C CB    . LEU B 1 228 ? -20.296 28.188  -38.327 1.00 37.34 ? 211  LEU B CB    1 
ATOM   3412 C CG    . LEU B 1 228 ? -20.361 26.811  -37.658 1.00 38.01 ? 211  LEU B CG    1 
ATOM   3413 C CD1   . LEU B 1 228 ? -19.005 26.140  -37.448 1.00 37.37 ? 211  LEU B CD1   1 
ATOM   3414 C CD2   . LEU B 1 228 ? -21.127 26.922  -36.350 1.00 35.76 ? 211  LEU B CD2   1 
ATOM   3415 N N     . PRO B 1 229 ? -20.400 28.350  -41.491 1.00 38.38 ? 212  PRO B N     1 
ATOM   3416 C CA    . PRO B 1 229 ? -21.171 28.935  -42.596 1.00 38.70 ? 212  PRO B CA    1 
ATOM   3417 C C     . PRO B 1 229 ? -22.290 29.822  -42.051 1.00 39.07 ? 212  PRO B C     1 
ATOM   3418 O O     . PRO B 1 229 ? -22.908 29.477  -41.040 1.00 39.59 ? 212  PRO B O     1 
ATOM   3419 C CB    . PRO B 1 229 ? -21.759 27.711  -43.304 1.00 38.68 ? 212  PRO B CB    1 
ATOM   3420 C CG    . PRO B 1 229 ? -20.842 26.577  -42.952 1.00 38.47 ? 212  PRO B CG    1 
ATOM   3421 C CD    . PRO B 1 229 ? -20.357 26.873  -41.564 1.00 38.59 ? 212  PRO B CD    1 
ATOM   3422 N N     . ASP B 1 230 ? -22.536 30.963  -42.695 1.00 39.39 ? 213  ASP B N     1 
ATOM   3423 C CA    . ASP B 1 230 ? -23.529 31.926  -42.196 1.00 39.41 ? 213  ASP B CA    1 
ATOM   3424 C C     . ASP B 1 230 ? -24.969 31.415  -42.261 1.00 38.85 ? 213  ASP B C     1 
ATOM   3425 O O     . ASP B 1 230 ? -25.817 31.862  -41.480 1.00 39.29 ? 213  ASP B O     1 
ATOM   3426 C CB    . ASP B 1 230 ? -23.449 33.262  -42.950 1.00 40.04 ? 213  ASP B CB    1 
ATOM   3427 C CG    . ASP B 1 230 ? -22.143 34.010  -42.714 1.00 41.68 ? 213  ASP B CG    1 
ATOM   3428 O OD1   . ASP B 1 230 ? -21.614 33.998  -41.576 1.00 44.14 ? 213  ASP B OD1   1 
ATOM   3429 O OD2   . ASP B 1 230 ? -21.659 34.643  -43.677 1.00 44.38 ? 213  ASP B OD2   1 
ATOM   3430 N N     . GLU B 1 231 ? -25.243 30.487  -43.181 1.00 38.09 ? 214  GLU B N     1 
ATOM   3431 C CA    . GLU B 1 231 ? -26.617 30.015  -43.431 1.00 37.00 ? 214  GLU B CA    1 
ATOM   3432 C C     . GLU B 1 231 ? -27.144 28.979  -42.434 1.00 35.92 ? 214  GLU B C     1 
ATOM   3433 O O     . GLU B 1 231 ? -28.333 28.664  -42.446 1.00 36.39 ? 214  GLU B O     1 
ATOM   3434 C CB    . GLU B 1 231 ? -26.781 29.505  -44.877 1.00 37.24 ? 214  GLU B CB    1 
ATOM   3435 C CG    . GLU B 1 231 ? -26.184 28.119  -45.167 1.00 37.93 ? 214  GLU B CG    1 
ATOM   3436 C CD    . GLU B 1 231 ? -24.683 28.129  -45.434 1.00 39.56 ? 214  GLU B CD    1 
ATOM   3437 O OE1   . GLU B 1 231 ? -24.024 29.189  -45.287 1.00 41.38 ? 214  GLU B OE1   1 
ATOM   3438 O OE2   . GLU B 1 231 ? -24.156 27.055  -45.790 1.00 39.39 ? 214  GLU B OE2   1 
ATOM   3439 N N     . ILE B 1 232 ? -26.276 28.455  -41.574 1.00 34.40 ? 215  ILE B N     1 
ATOM   3440 C CA    . ILE B 1 232 ? -26.716 27.467  -40.572 1.00 32.50 ? 215  ILE B CA    1 
ATOM   3441 C C     . ILE B 1 232 ? -26.929 28.077  -39.182 1.00 31.68 ? 215  ILE B C     1 
ATOM   3442 O O     . ILE B 1 232 ? -26.415 29.162  -38.887 1.00 30.98 ? 215  ILE B O     1 
ATOM   3443 C CB    . ILE B 1 232 ? -25.774 26.220  -40.517 1.00 32.89 ? 215  ILE B CB    1 
ATOM   3444 C CG1   . ILE B 1 232 ? -24.373 26.584  -39.993 1.00 32.49 ? 215  ILE B CG1   1 
ATOM   3445 C CG2   . ILE B 1 232 ? -25.689 25.559  -41.903 1.00 32.30 ? 215  ILE B CG2   1 
ATOM   3446 C CD1   . ILE B 1 232 ? -23.427 25.387  -39.896 1.00 32.10 ? 215  ILE B CD1   1 
ATOM   3447 N N     . TYR B 1 233 ? -27.695 27.386  -38.335 1.00 29.91 ? 216  TYR B N     1 
ATOM   3448 C CA    . TYR B 1 233 ? -27.933 27.859  -36.964 1.00 28.73 ? 216  TYR B CA    1 
ATOM   3449 C C     . TYR B 1 233 ? -26.629 28.189  -36.232 1.00 27.24 ? 216  TYR B C     1 
ATOM   3450 O O     . TYR B 1 233 ? -25.634 27.461  -36.360 1.00 26.71 ? 216  TYR B O     1 
ATOM   3451 C CB    . TYR B 1 233 ? -28.650 26.792  -36.136 1.00 29.33 ? 216  TYR B CB    1 
ATOM   3452 C CG    . TYR B 1 233 ? -30.135 26.591  -36.369 1.00 30.27 ? 216  TYR B CG    1 
ATOM   3453 C CD1   . TYR B 1 233 ? -30.627 25.330  -36.700 1.00 30.81 ? 216  TYR B CD1   1 
ATOM   3454 C CD2   . TYR B 1 233 ? -31.055 27.636  -36.203 1.00 30.64 ? 216  TYR B CD2   1 
ATOM   3455 C CE1   . TYR B 1 233 ? -31.982 25.108  -36.898 1.00 32.10 ? 216  TYR B CE1   1 
ATOM   3456 C CE2   . TYR B 1 233 ? -32.436 27.422  -36.401 1.00 30.26 ? 216  TYR B CE2   1 
ATOM   3457 C CZ    . TYR B 1 233 ? -32.882 26.148  -36.741 1.00 30.79 ? 216  TYR B CZ    1 
ATOM   3458 O OH    . TYR B 1 233 ? -34.224 25.887  -36.940 1.00 32.69 ? 216  TYR B OH    1 
ATOM   3459 N N     . HIS B 1 234 ? -26.650 29.252  -35.427 1.00 25.89 ? 217  HIS B N     1 
ATOM   3460 C CA    . HIS B 1 234 ? -25.555 29.524  -34.477 1.00 24.54 ? 217  HIS B CA    1 
ATOM   3461 C C     . HIS B 1 234 ? -25.315 28.282  -33.615 1.00 22.96 ? 217  HIS B C     1 
ATOM   3462 O O     . HIS B 1 234 ? -26.247 27.516  -33.349 1.00 22.29 ? 217  HIS B O     1 
ATOM   3463 C CB    . HIS B 1 234 ? -25.906 30.696  -33.578 1.00 25.20 ? 217  HIS B CB    1 
ATOM   3464 C CG    . HIS B 1 234 ? -25.860 32.027  -34.264 1.00 27.97 ? 217  HIS B CG    1 
ATOM   3465 N ND1   . HIS B 1 234 ? -25.995 32.171  -35.630 1.00 31.48 ? 217  HIS B ND1   1 
ATOM   3466 C CD2   . HIS B 1 234 ? -25.717 33.277  -33.766 1.00 29.33 ? 217  HIS B CD2   1 
ATOM   3467 C CE1   . HIS B 1 234 ? -25.922 33.452  -35.945 1.00 31.62 ? 217  HIS B CE1   1 
ATOM   3468 N NE2   . HIS B 1 234 ? -25.762 34.146  -34.831 1.00 31.92 ? 217  HIS B NE2   1 
ATOM   3469 N N     . VAL B 1 235 ? -24.067 28.072  -33.210 1.00 21.33 ? 218  VAL B N     1 
ATOM   3470 C CA    . VAL B 1 235 ? -23.729 26.933  -32.356 1.00 19.96 ? 218  VAL B CA    1 
ATOM   3471 C C     . VAL B 1 235 ? -23.105 27.457  -31.069 1.00 19.93 ? 218  VAL B C     1 
ATOM   3472 O O     . VAL B 1 235 ? -22.255 28.370  -31.090 1.00 19.69 ? 218  VAL B O     1 
ATOM   3473 C CB    . VAL B 1 235 ? -22.800 25.895  -33.081 1.00 20.37 ? 218  VAL B CB    1 
ATOM   3474 C CG1   . VAL B 1 235 ? -22.240 24.868  -32.110 1.00 19.09 ? 218  VAL B CG1   1 
ATOM   3475 C CG2   . VAL B 1 235 ? -23.537 25.194  -34.223 1.00 21.46 ? 218  VAL B CG2   1 
ATOM   3476 N N     . TYR B 1 236 ? -23.549 26.886  -29.949 1.00 18.21 ? 219  TYR B N     1 
ATOM   3477 C CA    . TYR B 1 236 ? -23.035 27.209  -28.633 1.00 17.50 ? 219  TYR B CA    1 
ATOM   3478 C C     . TYR B 1 236 ? -22.635 25.948  -27.896 1.00 16.04 ? 219  TYR B C     1 
ATOM   3479 O O     . TYR B 1 236 ? -23.276 24.915  -28.059 1.00 15.76 ? 219  TYR B O     1 
ATOM   3480 C CB    . TYR B 1 236 ? -24.102 27.906  -27.807 1.00 18.34 ? 219  TYR B CB    1 
ATOM   3481 C CG    . TYR B 1 236 ? -24.230 29.385  -28.115 1.00 19.13 ? 219  TYR B CG    1 
ATOM   3482 C CD1   . TYR B 1 236 ? -24.789 29.813  -29.312 1.00 22.38 ? 219  TYR B CD1   1 
ATOM   3483 C CD2   . TYR B 1 236 ? -23.792 30.343  -27.205 1.00 20.61 ? 219  TYR B CD2   1 
ATOM   3484 C CE1   . TYR B 1 236 ? -24.905 31.177  -29.604 1.00 24.16 ? 219  TYR B CE1   1 
ATOM   3485 C CE2   . TYR B 1 236 ? -23.911 31.695  -27.481 1.00 23.80 ? 219  TYR B CE2   1 
ATOM   3486 C CZ    . TYR B 1 236 ? -24.454 32.105  -28.681 1.00 22.49 ? 219  TYR B CZ    1 
ATOM   3487 O OH    . TYR B 1 236 ? -24.575 33.457  -28.952 1.00 25.61 ? 219  TYR B OH    1 
ATOM   3488 N N     . SER B 1 237 ? -21.597 26.063  -27.075 1.00 15.16 ? 220  SER B N     1 
ATOM   3489 C CA    . SER B 1 237 ? -21.195 24.988  -26.172 1.00 15.12 ? 220  SER B CA    1 
ATOM   3490 C C     . SER B 1 237 ? -21.494 25.459  -24.767 1.00 15.73 ? 220  SER B C     1 
ATOM   3491 O O     . SER B 1 237 ? -21.204 26.617  -24.428 1.00 14.15 ? 220  SER B O     1 
ATOM   3492 C CB    . SER B 1 237 ? -19.698 24.697  -26.334 1.00 15.82 ? 220  SER B CB    1 
ATOM   3493 O OG    . SER B 1 237 ? -19.431 24.261  -27.666 1.00 13.76 ? 220  SER B OG    1 
ATOM   3494 N N     . PHE B 1 238 ? -22.062 24.563  -23.959 1.00 15.67 ? 221  PHE B N     1 
ATOM   3495 C CA    . PHE B 1 238 ? -22.325 24.779  -22.558 1.00 16.64 ? 221  PHE B CA    1 
ATOM   3496 C C     . PHE B 1 238 ? -21.650 23.657  -21.747 1.00 16.67 ? 221  PHE B C     1 
ATOM   3497 O O     . PHE B 1 238 ? -21.910 22.490  -21.980 1.00 18.42 ? 221  PHE B O     1 
ATOM   3498 C CB    . PHE B 1 238 ? -23.838 24.699  -22.252 1.00 16.97 ? 221  PHE B CB    1 
ATOM   3499 C CG    . PHE B 1 238 ? -24.678 25.681  -23.016 1.00 19.53 ? 221  PHE B CG    1 
ATOM   3500 C CD1   . PHE B 1 238 ? -25.298 25.300  -24.189 1.00 20.37 ? 221  PHE B CD1   1 
ATOM   3501 C CD2   . PHE B 1 238 ? -24.852 26.982  -22.547 1.00 23.33 ? 221  PHE B CD2   1 
ATOM   3502 C CE1   . PHE B 1 238 ? -26.096 26.196  -24.914 1.00 21.52 ? 221  PHE B CE1   1 
ATOM   3503 C CE2   . PHE B 1 238 ? -25.638 27.901  -23.266 1.00 24.36 ? 221  PHE B CE2   1 
ATOM   3504 C CZ    . PHE B 1 238 ? -26.249 27.499  -24.454 1.00 23.44 ? 221  PHE B CZ    1 
ATOM   3505 N N     . ALA B 1 239 ? -20.796 24.014  -20.799 1.00 16.52 ? 222  ALA B N     1 
ATOM   3506 C CA    . ALA B 1 239 ? -20.281 23.028  -19.839 1.00 16.19 ? 222  ALA B CA    1 
ATOM   3507 C C     . ALA B 1 239 ? -21.074 23.136  -18.540 1.00 16.33 ? 222  ALA B C     1 
ATOM   3508 O O     . ALA B 1 239 ? -21.291 24.246  -18.043 1.00 15.85 ? 222  ALA B O     1 
ATOM   3509 C CB    . ALA B 1 239 ? -18.791 23.252  -19.598 1.00 16.30 ? 222  ALA B CB    1 
ATOM   3510 N N     . LEU B 1 240 ? -21.518 21.996  -18.009 1.00 16.03 ? 223  LEU B N     1 
ATOM   3511 C CA    . LEU B 1 240 ? -22.480 21.940  -16.882 1.00 16.66 ? 223  LEU B CA    1 
ATOM   3512 C C     . LEU B 1 240 ? -22.062 20.926  -15.830 1.00 17.52 ? 223  LEU B C     1 
ATOM   3513 O O     . LEU B 1 240 ? -21.441 19.908  -16.154 1.00 17.94 ? 223  LEU B O     1 
ATOM   3514 C CB    . LEU B 1 240 ? -23.868 21.503  -17.380 1.00 16.26 ? 223  LEU B CB    1 
ATOM   3515 C CG    . LEU B 1 240 ? -24.399 22.149  -18.666 1.00 17.37 ? 223  LEU B CG    1 
ATOM   3516 C CD1   . LEU B 1 240 ? -25.673 21.444  -19.214 1.00 18.95 ? 223  LEU B CD1   1 
ATOM   3517 C CD2   . LEU B 1 240 ? -24.653 23.626  -18.388 1.00 15.07 ? 223  LEU B CD2   1 
ATOM   3518 N N     . ARG B 1 241 ? -22.457 21.160  -14.576 1.00 18.25 ? 224  ARG B N     1 
ATOM   3519 C CA    . ARG B 1 241 ? -22.439 20.077  -13.575 1.00 19.79 ? 224  ARG B CA    1 
ATOM   3520 C C     . ARG B 1 241 ? -23.417 20.277  -12.417 1.00 20.39 ? 224  ARG B C     1 
ATOM   3521 O O     . ARG B 1 241 ? -23.957 21.381  -12.266 1.00 22.20 ? 224  ARG B O     1 
ATOM   3522 C CB    . ARG B 1 241 ? -21.026 19.796  -13.063 1.00 19.34 ? 224  ARG B CB    1 
ATOM   3523 C CG    . ARG B 1 241 ? -20.502 20.745  -12.011 1.00 20.46 ? 224  ARG B CG    1 
ATOM   3524 C CD    . ARG B 1 241 ? -19.373 20.033  -11.246 1.00 20.19 ? 224  ARG B CD    1 
ATOM   3525 N NE    . ARG B 1 241 ? -18.156 19.825  -12.037 1.00 19.10 ? 224  ARG B NE    1 
ATOM   3526 C CZ    . ARG B 1 241 ? -17.192 20.734  -12.205 1.00 19.59 ? 224  ARG B CZ    1 
ATOM   3527 N NH1   . ARG B 1 241 ? -17.316 21.956  -11.691 1.00 19.75 ? 224  ARG B NH1   1 
ATOM   3528 N NH2   . ARG B 1 241 ? -16.110 20.437  -12.915 1.00 20.98 ? 224  ARG B NH2   1 
HETATM 3529 N N     . SAH C 2 .   ? 0.728   -1.212  4.793   1.00 14.73 ? 1401 SAH A N     1 
HETATM 3530 C CA    . SAH C 2 .   ? 1.233   -0.681  6.099   1.00 15.65 ? 1401 SAH A CA    1 
HETATM 3531 C CB    . SAH C 2 .   ? 0.110   -0.354  7.076   1.00 15.13 ? 1401 SAH A CB    1 
HETATM 3532 C CG    . SAH C 2 .   ? -0.844  -1.515  7.347   1.00 16.39 ? 1401 SAH A CG    1 
HETATM 3533 S SD    . SAH C 2 .   ? -2.173  -1.091  8.484   0.85 13.81 ? 1401 SAH A SD    1 
HETATM 3534 C C     . SAH C 2 .   ? 2.207   -1.654  6.737   1.00 15.40 ? 1401 SAH A C     1 
HETATM 3535 O O     . SAH C 2 .   ? 2.226   -2.834  6.384   1.00 14.55 ? 1401 SAH A O     1 
HETATM 3536 O OXT   . SAH C 2 .   ? 2.966   -1.240  7.610   1.00 16.12 ? 1401 SAH A OXT   1 
HETATM 3537 C "C5'" . SAH C 2 .   ? -3.386  -0.766  7.143   1.00 14.19 ? 1401 SAH A "C5'" 1 
HETATM 3538 C "C4'" . SAH C 2 .   ? -3.390  0.681   6.605   1.00 15.11 ? 1401 SAH A "C4'" 1 
HETATM 3539 O "O4'" . SAH C 2 .   ? -4.444  0.820   5.640   1.00 13.04 ? 1401 SAH A "O4'" 1 
HETATM 3540 C "C3'" . SAH C 2 .   ? -3.629  1.806   7.626   1.00 14.39 ? 1401 SAH A "C3'" 1 
HETATM 3541 O "O3'" . SAH C 2 .   ? -2.601  2.769   7.546   1.00 17.44 ? 1401 SAH A "O3'" 1 
HETATM 3542 C "C2'" . SAH C 2 .   ? -4.978  2.409   7.241   1.00 14.67 ? 1401 SAH A "C2'" 1 
HETATM 3543 O "O2'" . SAH C 2 .   ? -5.077  3.807   7.478   1.00 12.61 ? 1401 SAH A "O2'" 1 
HETATM 3544 C "C1'" . SAH C 2 .   ? -4.980  2.130   5.748   1.00 13.76 ? 1401 SAH A "C1'" 1 
HETATM 3545 N N9    . SAH C 2 .   ? -6.288  2.033   5.110   1.00 13.79 ? 1401 SAH A N9    1 
HETATM 3546 C C8    . SAH C 2 .   ? -7.403  1.366   5.580   1.00 13.40 ? 1401 SAH A C8    1 
HETATM 3547 N N7    . SAH C 2 .   ? -8.364  1.449   4.616   1.00 13.88 ? 1401 SAH A N7    1 
HETATM 3548 C C5    . SAH C 2 .   ? -7.862  2.139   3.557   1.00 13.75 ? 1401 SAH A C5    1 
HETATM 3549 C C6    . SAH C 2 .   ? -8.402  2.515   2.330   1.00 14.42 ? 1401 SAH A C6    1 
HETATM 3550 N N6    . SAH C 2 .   ? -9.648  2.217   1.998   1.00 12.92 ? 1401 SAH A N6    1 
HETATM 3551 N N1    . SAH C 2 .   ? -7.618  3.204   1.430   1.00 12.10 ? 1401 SAH A N1    1 
HETATM 3552 C C2    . SAH C 2 .   ? -6.320  3.547   1.754   1.00 13.62 ? 1401 SAH A C2    1 
HETATM 3553 N N3    . SAH C 2 .   ? -5.783  3.192   2.978   1.00 14.60 ? 1401 SAH A N3    1 
HETATM 3554 C C4    . SAH C 2 .   ? -6.561  2.504   3.859   1.00 14.91 ? 1401 SAH A C4    1 
HETATM 3555 N N     . SAH D 2 .   ? -23.193 13.808  -32.351 1.00 12.95 ? 1402 SAH B N     1 
HETATM 3556 C CA    . SAH D 2 .   ? -22.642 13.168  -33.591 1.00 13.42 ? 1402 SAH B CA    1 
HETATM 3557 C CB    . SAH D 2 .   ? -23.755 12.764  -34.585 1.00 12.97 ? 1402 SAH B CB    1 
HETATM 3558 C CG    . SAH D 2 .   ? -24.649 13.920  -35.026 1.00 12.85 ? 1402 SAH B CG    1 
HETATM 3559 S SD    . SAH D 2 .   ? -26.066 13.486  -36.033 0.85 11.86 ? 1402 SAH B SD    1 
HETATM 3560 C C     . SAH D 2 .   ? -21.666 14.114  -34.261 1.00 14.53 ? 1402 SAH B C     1 
HETATM 3561 O O     . SAH D 2 .   ? -21.652 15.311  -33.922 1.00 15.23 ? 1402 SAH B O     1 
HETATM 3562 O OXT   . SAH D 2 .   ? -20.938 13.693  -35.178 1.00 15.46 ? 1402 SAH B OXT   1 
HETATM 3563 C "C5'" . SAH D 2 .   ? -27.314 13.168  -34.746 1.00 12.67 ? 1402 SAH B "C5'" 1 
HETATM 3564 C "C4'" . SAH D 2 .   ? -27.265 11.776  -34.133 1.00 12.69 ? 1402 SAH B "C4'" 1 
HETATM 3565 O "O4'" . SAH D 2 .   ? -28.340 11.662  -33.203 1.00 11.79 ? 1402 SAH B "O4'" 1 
HETATM 3566 C "C3'" . SAH D 2 .   ? -27.476 10.638  -35.125 1.00 12.60 ? 1402 SAH B "C3'" 1 
HETATM 3567 O "O3'" . SAH D 2 .   ? -26.435 9.696   -34.986 1.00 13.61 ? 1402 SAH B "O3'" 1 
HETATM 3568 C "C2'" . SAH D 2 .   ? -28.829 10.033  -34.758 1.00 13.83 ? 1402 SAH B "C2'" 1 
HETATM 3569 O "O2'" . SAH D 2 .   ? -28.927 8.631   -34.932 1.00 13.04 ? 1402 SAH B "O2'" 1 
HETATM 3570 C "C1'" . SAH D 2 .   ? -28.859 10.356  -33.283 1.00 12.58 ? 1402 SAH B "C1'" 1 
HETATM 3571 N N9    . SAH D 2 .   ? -30.184 10.460  -32.657 1.00 11.82 ? 1402 SAH B N9    1 
HETATM 3572 C C8    . SAH D 2 .   ? -31.324 11.051  -33.148 1.00 12.65 ? 1402 SAH B C8    1 
HETATM 3573 N N7    . SAH D 2 .   ? -32.288 10.976  -32.171 1.00 12.01 ? 1402 SAH B N7    1 
HETATM 3574 C C5    . SAH D 2 .   ? -31.770 10.334  -31.099 1.00 11.06 ? 1402 SAH B C5    1 
HETATM 3575 C C6    . SAH D 2 .   ? -32.276 10.005  -29.843 1.00 13.79 ? 1402 SAH B C6    1 
HETATM 3576 N N6    . SAH D 2 .   ? -33.521 10.262  -29.495 1.00 12.20 ? 1402 SAH B N6    1 
HETATM 3577 N N1    . SAH D 2 .   ? -31.438 9.377   -28.926 1.00 12.34 ? 1402 SAH B N1    1 
HETATM 3578 C C2    . SAH D 2 .   ? -30.130 9.093   -29.251 1.00 12.93 ? 1402 SAH B C2    1 
HETATM 3579 N N3    . SAH D 2 .   ? -29.619 9.417   -30.489 1.00 12.78 ? 1402 SAH B N3    1 
HETATM 3580 C C4    . SAH D 2 .   ? -30.427 10.050  -31.381 1.00 11.88 ? 1402 SAH B C4    1 
HETATM 3581 O O     . HOH E 3 .   ? 4.619   1.568   4.666   1.00 13.78 ? 1402 HOH A O     1 
HETATM 3582 O O     . HOH E 3 .   ? -12.901 -0.646  4.526   1.00 15.22 ? 1403 HOH A O     1 
HETATM 3583 O O     . HOH E 3 .   ? 1.565   -0.891  2.128   1.00 14.51 ? 1404 HOH A O     1 
HETATM 3584 O O     . HOH E 3 .   ? 6.794   -5.945  3.759   1.00 21.39 ? 1405 HOH A O     1 
HETATM 3585 O O     . HOH E 3 .   ? 9.986   -0.853  -14.063 1.00 18.58 ? 1406 HOH A O     1 
HETATM 3586 O O     . HOH E 3 .   ? -6.561  10.303  -7.363  1.00 28.15 ? 1407 HOH A O     1 
HETATM 3587 O O     . HOH E 3 .   ? -11.200 1.670   4.341   1.00 14.19 ? 1408 HOH A O     1 
HETATM 3588 O O     . HOH E 3 .   ? 9.940   0.246   9.637   1.00 17.48 ? 1409 HOH A O     1 
HETATM 3589 O O     . HOH E 3 .   ? 3.237   1.503   8.061   1.00 13.72 ? 1410 HOH A O     1 
HETATM 3590 O O     . HOH E 3 .   ? -2.573  -4.286  10.122  1.00 17.77 ? 1411 HOH A O     1 
HETATM 3591 O O     . HOH E 3 .   ? -8.710  7.121   9.388   1.00 20.84 ? 1412 HOH A O     1 
HETATM 3592 O O     . HOH E 3 .   ? -15.398 7.928   9.176   1.00 23.36 ? 1413 HOH A O     1 
HETATM 3593 O O     . HOH E 3 .   ? -7.077  -4.083  8.590   1.00 18.45 ? 1414 HOH A O     1 
HETATM 3594 O O     . HOH E 3 .   ? -18.470 -8.679  -4.303  1.00 22.29 ? 1415 HOH A O     1 
HETATM 3595 O O     . HOH E 3 .   ? 15.106  -2.489  0.969   1.00 18.78 ? 1416 HOH A O     1 
HETATM 3596 O O     . HOH E 3 .   ? -11.275 1.154   -6.545  1.00 16.40 ? 1417 HOH A O     1 
HETATM 3597 O O     . HOH E 3 .   ? -18.266 5.888   3.542   1.00 21.49 ? 1418 HOH A O     1 
HETATM 3598 O O     . HOH E 3 .   ? 10.615  -6.715  14.109  1.00 21.74 ? 1419 HOH A O     1 
HETATM 3599 O O     . HOH E 3 .   ? 10.008  -2.007  11.285  1.00 18.94 ? 1420 HOH A O     1 
HETATM 3600 O O     . HOH E 3 .   ? -4.096  -13.921 -13.064 1.00 20.20 ? 1421 HOH A O     1 
HETATM 3601 O O     . HOH E 3 .   ? -21.477 -6.213  6.963   1.00 24.44 ? 1422 HOH A O     1 
HETATM 3602 O O     . HOH E 3 .   ? 11.085  12.916  -3.794  1.00 27.51 ? 1423 HOH A O     1 
HETATM 3603 O O     . HOH E 3 .   ? 14.864  4.788   4.683   1.00 19.37 ? 1424 HOH A O     1 
HETATM 3604 O O     . HOH E 3 .   ? 4.913   -13.811 1.286   1.00 19.30 ? 1425 HOH A O     1 
HETATM 3605 O O     . HOH E 3 .   ? -6.262  11.242  10.690  1.00 21.55 ? 1426 HOH A O     1 
HETATM 3606 O O     . HOH E 3 .   ? -4.437  -4.302  8.171   1.00 18.27 ? 1427 HOH A O     1 
HETATM 3607 O O     . HOH E 3 .   ? -11.189 8.584   -0.204  1.00 21.59 ? 1428 HOH A O     1 
HETATM 3608 O O     . HOH E 3 .   ? -19.512 -4.304  6.681   1.00 19.16 ? 1429 HOH A O     1 
HETATM 3609 O O     . HOH E 3 .   ? -7.779  11.179  7.436   1.00 20.25 ? 1430 HOH A O     1 
HETATM 3610 O O     . HOH E 3 .   ? -6.203  -6.601  4.305   1.00 19.29 ? 1431 HOH A O     1 
HETATM 3611 O O     . HOH E 3 .   ? -8.542  9.893   9.691   1.00 22.31 ? 1432 HOH A O     1 
HETATM 3612 O O     . HOH E 3 .   ? -13.386 -12.835 -15.252 1.00 26.44 ? 1433 HOH A O     1 
HETATM 3613 O O     . HOH E 3 .   ? -18.528 -0.757  -6.870  1.00 32.63 ? 1434 HOH A O     1 
HETATM 3614 O O     . HOH E 3 .   ? -8.982  -18.858 -8.520  1.00 24.01 ? 1435 HOH A O     1 
HETATM 3615 O O     . HOH E 3 .   ? 7.028   2.399   15.670  1.00 27.60 ? 1436 HOH A O     1 
HETATM 3616 O O     . HOH E 3 .   ? 12.517  -13.127 6.863   1.00 26.15 ? 1437 HOH A O     1 
HETATM 3617 O O     . HOH E 3 .   ? -11.925 -5.852  -13.586 1.00 31.98 ? 1438 HOH A O     1 
HETATM 3618 O O     . HOH E 3 .   ? -8.684  -9.780  1.582   1.00 19.72 ? 1439 HOH A O     1 
HETATM 3619 O O     . HOH E 3 .   ? -17.986 -5.779  -4.875  1.00 23.93 ? 1440 HOH A O     1 
HETATM 3620 O O     . HOH E 3 .   ? 18.086  0.241   -6.110  1.00 21.45 ? 1441 HOH A O     1 
HETATM 3621 O O     . HOH E 3 .   ? -7.206  -12.247 1.601   1.00 24.70 ? 1442 HOH A O     1 
HETATM 3622 O O     . HOH E 3 .   ? -16.092 8.698   6.438   1.00 29.04 ? 1443 HOH A O     1 
HETATM 3623 O O     . HOH E 3 .   ? -3.785  -1.650  15.346  1.00 22.57 ? 1444 HOH A O     1 
HETATM 3624 O O     . HOH E 3 .   ? -12.350 4.060   4.617   1.00 25.34 ? 1445 HOH A O     1 
HETATM 3625 O O     . HOH E 3 .   ? 7.311   -11.329 0.857   1.00 19.32 ? 1446 HOH A O     1 
HETATM 3626 O O     . HOH E 3 .   ? 10.464  15.269  -2.064  1.00 27.38 ? 1447 HOH A O     1 
HETATM 3627 O O     . HOH E 3 .   ? 10.559  -10.016 12.964  1.00 21.83 ? 1448 HOH A O     1 
HETATM 3628 O O     . HOH E 3 .   ? -25.030 3.516   2.295   1.00 36.77 ? 1449 HOH A O     1 
HETATM 3629 O O     . HOH E 3 .   ? -13.135 2.013   -8.483  1.00 25.87 ? 1450 HOH A O     1 
HETATM 3630 O O     . HOH E 3 .   ? -12.041 6.933   15.872  1.00 25.85 ? 1451 HOH A O     1 
HETATM 3631 O O     . HOH E 3 .   ? 17.220  12.718  1.973   1.00 35.24 ? 1452 HOH A O     1 
HETATM 3632 O O     . HOH E 3 .   ? -6.844  -19.819 1.395   1.00 23.35 ? 1453 HOH A O     1 
HETATM 3633 O O     . HOH E 3 .   ? -18.186 -1.887  -4.367  1.00 21.33 ? 1454 HOH A O     1 
HETATM 3634 O O     . HOH E 3 .   ? -9.231  -8.759  -18.417 1.00 27.48 ? 1455 HOH A O     1 
HETATM 3635 O O     . HOH E 3 .   ? -26.206 -2.735  0.713   1.00 23.11 ? 1456 HOH A O     1 
HETATM 3636 O O     . HOH E 3 .   ? -21.851 -2.498  6.173   1.00 26.34 ? 1457 HOH A O     1 
HETATM 3637 O O     . HOH E 3 .   ? 16.528  4.911   2.471   1.00 23.98 ? 1458 HOH A O     1 
HETATM 3638 O O     . HOH E 3 .   ? 5.927   0.084   17.147  1.00 29.27 ? 1459 HOH A O     1 
HETATM 3639 O O     . HOH E 3 .   ? -19.122 -5.837  -2.082  1.00 28.75 ? 1460 HOH A O     1 
HETATM 3640 O O     . HOH E 3 .   ? 15.062  11.430  -5.083  1.00 28.98 ? 1461 HOH A O     1 
HETATM 3641 O O     . HOH E 3 .   ? -18.268 -3.020  8.804   1.00 25.25 ? 1462 HOH A O     1 
HETATM 3642 O O     . HOH E 3 .   ? 11.198  -14.138 0.270   1.00 26.24 ? 1463 HOH A O     1 
HETATM 3643 O O     . HOH E 3 .   ? -2.320  10.257  -8.225  1.00 30.71 ? 1464 HOH A O     1 
HETATM 3644 O O     . HOH E 3 .   ? 18.201  10.629  0.960   1.00 27.27 ? 1465 HOH A O     1 
HETATM 3645 O O     . HOH E 3 .   ? 2.177   -17.861 6.011   1.00 24.67 ? 1466 HOH A O     1 
HETATM 3646 O O     . HOH E 3 .   ? 3.465   -17.135 -10.647 1.00 27.78 ? 1467 HOH A O     1 
HETATM 3647 O O     . HOH E 3 .   ? 10.857  -7.426  -13.870 1.00 25.08 ? 1468 HOH A O     1 
HETATM 3648 O O     . HOH E 3 .   ? -11.517 -19.967 -8.123  1.00 25.87 ? 1469 HOH A O     1 
HETATM 3649 O O     . HOH E 3 .   ? 10.728  13.097  6.414   1.00 27.97 ? 1470 HOH A O     1 
HETATM 3650 O O     . HOH E 3 .   ? -27.532 -6.853  10.366  1.00 30.72 ? 1471 HOH A O     1 
HETATM 3651 O O     . HOH E 3 .   ? -3.923  -5.191  12.095  1.00 27.34 ? 1472 HOH A O     1 
HETATM 3652 O O     . HOH E 3 .   ? 15.293  -4.977  6.879   1.00 36.40 ? 1473 HOH A O     1 
HETATM 3653 O O     . HOH E 3 .   ? 14.878  -1.604  -15.104 1.00 36.23 ? 1474 HOH A O     1 
HETATM 3654 O O     . HOH E 3 .   ? -0.026  9.158   -8.816  1.00 31.57 ? 1475 HOH A O     1 
HETATM 3655 O O     . HOH E 3 .   ? -9.579  -8.841  7.771   1.00 29.37 ? 1476 HOH A O     1 
HETATM 3656 O O     . HOH E 3 .   ? 13.806  13.447  -4.030  1.00 28.52 ? 1477 HOH A O     1 
HETATM 3657 O O     . HOH E 3 .   ? 16.371  8.712   7.478   1.00 26.82 ? 1478 HOH A O     1 
HETATM 3658 O O     . HOH E 3 .   ? 18.539  -2.449  -6.671  1.00 30.06 ? 1479 HOH A O     1 
HETATM 3659 O O     . HOH E 3 .   ? 7.682   8.201   14.346  1.00 31.65 ? 1480 HOH A O     1 
HETATM 3660 O O     . HOH E 3 .   ? -1.477  -6.908  10.603  1.00 32.27 ? 1481 HOH A O     1 
HETATM 3661 O O     . HOH E 3 .   ? -6.801  -20.688 -7.693  1.00 35.18 ? 1482 HOH A O     1 
HETATM 3662 O O     . HOH E 3 .   ? -18.174 -12.889 7.790   1.00 27.47 ? 1483 HOH A O     1 
HETATM 3663 O O     . HOH E 3 .   ? -2.775  -5.812  0.735   1.00 23.88 ? 1484 HOH A O     1 
HETATM 3664 O O     . HOH E 3 .   ? -5.171  -1.063  -16.865 1.00 31.03 ? 1485 HOH A O     1 
HETATM 3665 O O     . HOH E 3 .   ? -16.802 -2.949  12.669  1.00 31.40 ? 1486 HOH A O     1 
HETATM 3666 O O     . HOH E 3 .   ? 6.807   9.005   -11.398 1.00 26.15 ? 1487 HOH A O     1 
HETATM 3667 O O     . HOH E 3 .   ? -11.469 2.527   -12.235 1.00 25.95 ? 1488 HOH A O     1 
HETATM 3668 O O     . HOH E 3 .   ? -24.123 -1.126  -0.070  1.00 27.73 ? 1489 HOH A O     1 
HETATM 3669 O O     . HOH E 3 .   ? 18.642  -3.052  -9.357  1.00 34.25 ? 1490 HOH A O     1 
HETATM 3670 O O     . HOH E 3 .   ? 1.289   10.642  -16.398 1.00 32.63 ? 1491 HOH A O     1 
HETATM 3671 O O     . HOH E 3 .   ? 11.107  1.571   -17.495 1.00 27.27 ? 1492 HOH A O     1 
HETATM 3672 O O     . HOH E 3 .   ? -14.639 11.371  6.946   1.00 34.74 ? 1493 HOH A O     1 
HETATM 3673 O O     . HOH E 3 .   ? -7.454  -8.796  6.551   1.00 35.08 ? 1494 HOH A O     1 
HETATM 3674 O O     . HOH E 3 .   ? -14.901 -10.067 15.512  1.00 34.33 ? 1495 HOH A O     1 
HETATM 3675 O O     . HOH E 3 .   ? -7.449  -9.280  3.894   1.00 27.47 ? 1496 HOH A O     1 
HETATM 3676 O O     . HOH E 3 .   ? -1.791  -12.328 9.450   1.00 33.00 ? 1497 HOH A O     1 
HETATM 3677 O O     . HOH E 3 .   ? -5.427  -13.126 11.935  1.00 42.65 ? 1498 HOH A O     1 
HETATM 3678 O O     . HOH E 3 .   ? -1.658  -10.123 -18.035 1.00 41.30 ? 1499 HOH A O     1 
HETATM 3679 O O     . HOH E 3 .   ? 2.749   15.715  -0.473  1.00 25.44 ? 1500 HOH A O     1 
HETATM 3680 O O     . HOH E 3 .   ? 4.805   -9.939  -17.749 1.00 31.06 ? 1501 HOH A O     1 
HETATM 3681 O O     . HOH E 3 .   ? 9.858   -1.518  14.055  1.00 25.85 ? 1502 HOH A O     1 
HETATM 3682 O O     . HOH E 3 .   ? 14.261  -7.811  -18.700 1.00 35.27 ? 1503 HOH A O     1 
HETATM 3683 O O     . HOH E 3 .   ? 13.501  6.405   6.425   1.00 30.72 ? 1504 HOH A O     1 
HETATM 3684 O O     . HOH E 3 .   ? -19.382 2.303   -5.100  1.00 37.00 ? 1505 HOH A O     1 
HETATM 3685 O O     . HOH E 3 .   ? 10.740  15.193  -7.075  1.00 31.12 ? 1506 HOH A O     1 
HETATM 3686 O O     . HOH E 3 .   ? 11.936  2.690   -14.734 1.00 31.85 ? 1507 HOH A O     1 
HETATM 3687 O O     . HOH E 3 .   ? -1.100  -2.859  21.170  1.00 31.82 ? 1508 HOH A O     1 
HETATM 3688 O O     . HOH E 3 .   ? -2.214  -21.147 3.022   1.00 46.48 ? 1509 HOH A O     1 
HETATM 3689 O O     . HOH E 3 .   ? 5.900   6.574   15.471  1.00 33.14 ? 1510 HOH A O     1 
HETATM 3690 O O     . HOH E 3 .   ? 1.500   -18.683 8.511   1.00 32.25 ? 1511 HOH A O     1 
HETATM 3691 O O     . HOH E 3 .   ? 8.655   0.910   -23.528 1.00 35.02 ? 1512 HOH A O     1 
HETATM 3692 O O     . HOH E 3 .   ? 10.487  12.935  -10.024 1.00 32.08 ? 1513 HOH A O     1 
HETATM 3693 O O     . HOH E 3 .   ? 6.177   -11.253 9.595   1.00 56.43 ? 1514 HOH A O     1 
HETATM 3694 O O     . HOH E 3 .   ? -10.658 11.388  -1.105  1.00 37.57 ? 1515 HOH A O     1 
HETATM 3695 O O     . HOH E 3 .   ? 4.998   -20.347 -1.268  1.00 42.11 ? 1516 HOH A O     1 
HETATM 3696 O O     . HOH E 3 .   ? -9.038  13.344  6.407   1.00 50.01 ? 1517 HOH A O     1 
HETATM 3697 O O     . HOH E 3 .   ? 14.584  -12.216 8.674   1.00 32.20 ? 1518 HOH A O     1 
HETATM 3698 O O     . HOH E 3 .   ? -10.366 0.489   -13.035 1.00 29.21 ? 1519 HOH A O     1 
HETATM 3699 O O     . HOH E 3 .   ? 14.297  -6.457  14.451  1.00 29.85 ? 1520 HOH A O     1 
HETATM 3700 O O     . HOH E 3 .   ? -9.770  9.511   -8.597  1.00 29.95 ? 1521 HOH A O     1 
HETATM 3701 O O     . HOH E 3 .   ? -12.926 5.978   2.763   1.00 27.66 ? 1522 HOH A O     1 
HETATM 3702 O O     . HOH E 3 .   ? 5.913   9.585   -15.961 1.00 38.87 ? 1523 HOH A O     1 
HETATM 3703 O O     . HOH E 3 .   ? 20.025  2.203   0.187   1.00 29.40 ? 1524 HOH A O     1 
HETATM 3704 O O     . HOH E 3 .   ? -9.181  -11.205 -17.192 1.00 27.83 ? 1525 HOH A O     1 
HETATM 3705 O O     . HOH E 3 .   ? 12.541  -9.872  -13.543 1.00 36.76 ? 1526 HOH A O     1 
HETATM 3706 O O     . HOH E 3 .   ? 5.698   -4.981  19.001  1.00 38.53 ? 1527 HOH A O     1 
HETATM 3707 O O     . HOH E 3 .   ? 5.911   -3.942  -18.785 1.00 31.46 ? 1528 HOH A O     1 
HETATM 3708 O O     . HOH E 3 .   ? -8.424  -21.342 -0.828  1.00 32.31 ? 1529 HOH A O     1 
HETATM 3709 O O     . HOH E 3 .   ? -15.735 6.736   4.653   1.00 30.30 ? 1530 HOH A O     1 
HETATM 3710 O O     . HOH E 3 .   ? -27.680 0.696   6.279   1.00 35.71 ? 1531 HOH A O     1 
HETATM 3711 O O     . HOH E 3 .   ? 6.759   -2.258  16.925  1.00 28.77 ? 1532 HOH A O     1 
HETATM 3712 O O     . HOH E 3 .   ? -17.160 0.868   -8.389  1.00 33.53 ? 1533 HOH A O     1 
HETATM 3713 O O     . HOH E 3 .   ? 1.862   -4.043  -16.930 1.00 26.68 ? 1534 HOH A O     1 
HETATM 3714 O O     . HOH E 3 .   ? 8.677   -1.999  -23.125 1.00 35.28 ? 1535 HOH A O     1 
HETATM 3715 O O     . HOH E 3 .   ? -8.737  1.183   -15.312 1.00 36.28 ? 1536 HOH A O     1 
HETATM 3716 O O     . HOH E 3 .   ? -12.006 5.712   -8.157  1.00 36.86 ? 1537 HOH A O     1 
HETATM 3717 O O     . HOH E 3 .   ? 15.845  -2.187  7.494   1.00 31.56 ? 1538 HOH A O     1 
HETATM 3718 O O     . HOH E 3 .   ? 9.635   1.182   14.293  1.00 25.14 ? 1539 HOH A O     1 
HETATM 3719 O O     . HOH E 3 .   ? -12.354 -1.043  -14.250 1.00 33.61 ? 1540 HOH A O     1 
HETATM 3720 O O     . HOH E 3 .   ? 4.507   -3.494  -16.334 1.00 30.56 ? 1541 HOH A O     1 
HETATM 3721 O O     . HOH E 3 .   ? 0.885   -0.222  20.506  1.00 28.96 ? 1542 HOH A O     1 
HETATM 3722 O O     . HOH E 3 .   ? 10.673  -6.826  17.061  1.00 50.87 ? 1543 HOH A O     1 
HETATM 3723 O O     . HOH E 3 .   ? -15.514 5.746   -0.162  1.00 34.02 ? 1544 HOH A O     1 
HETATM 3724 O O     . HOH E 3 .   ? -22.102 3.212   -1.800  1.00 33.26 ? 1545 HOH A O     1 
HETATM 3725 O O     . HOH E 3 .   ? -3.949  14.295  -0.489  1.00 30.13 ? 1546 HOH A O     1 
HETATM 3726 O O     . HOH E 3 .   ? -7.184  -6.160  6.534   1.00 33.39 ? 1547 HOH A O     1 
HETATM 3727 O O     . HOH E 3 .   ? -12.747 -9.393  -16.158 1.00 33.51 ? 1548 HOH A O     1 
HETATM 3728 O O     . HOH E 3 .   ? 8.924   14.249  4.264   1.00 30.74 ? 1549 HOH A O     1 
HETATM 3729 O O     . HOH E 3 .   ? -2.616  -8.386  13.107  1.00 34.57 ? 1550 HOH A O     1 
HETATM 3730 O O     . HOH E 3 .   ? -4.537  -9.132  -19.759 1.00 34.73 ? 1551 HOH A O     1 
HETATM 3731 O O     . HOH E 3 .   ? -10.942 8.906   17.027  1.00 35.44 ? 1552 HOH A O     1 
HETATM 3732 O O     . HOH E 3 .   ? -19.552 3.450   -1.022  1.00 37.64 ? 1553 HOH A O     1 
HETATM 3733 O O     . HOH E 3 .   ? 9.017   9.969   -8.187  1.00 52.92 ? 1554 HOH A O     1 
HETATM 3734 O O     . HOH E 3 .   ? -11.061 10.926  10.661  1.00 33.65 ? 1555 HOH A O     1 
HETATM 3735 O O     . HOH E 3 .   ? 15.682  -9.077  -14.263 1.00 30.40 ? 1556 HOH A O     1 
HETATM 3736 O O     . HOH E 3 .   ? -21.350 5.857   6.423   1.00 39.36 ? 1557 HOH A O     1 
HETATM 3737 O O     . HOH E 3 .   ? -4.566  -7.558  15.652  1.00 31.25 ? 1558 HOH A O     1 
HETATM 3738 O O     . HOH E 3 .   ? 8.738   -3.648  15.133  1.00 36.31 ? 1559 HOH A O     1 
HETATM 3739 O O     . HOH E 3 .   ? 9.788   9.141   -11.609 1.00 36.69 ? 1560 HOH A O     1 
HETATM 3740 O O     . HOH E 3 .   ? -3.614  -1.630  18.012  1.00 32.95 ? 1561 HOH A O     1 
HETATM 3741 O O     . HOH E 3 .   ? 16.011  -12.436 -3.953  1.00 34.61 ? 1562 HOH A O     1 
HETATM 3742 O O     . HOH E 3 .   ? -12.543 -10.406 14.238  1.00 37.55 ? 1563 HOH A O     1 
HETATM 3743 O O     . HOH E 3 .   ? 12.661  12.865  11.898  1.00 35.18 ? 1564 HOH A O     1 
HETATM 3744 O O     . HOH E 3 .   ? 17.592  4.953   -2.427  1.00 38.80 ? 1565 HOH A O     1 
HETATM 3745 O O     . HOH E 3 .   ? -4.879  0.509   19.774  1.00 35.51 ? 1566 HOH A O     1 
HETATM 3746 O O     . HOH E 3 .   ? 0.064   12.070  13.468  1.00 40.19 ? 1567 HOH A O     1 
HETATM 3747 O O     . HOH E 3 .   ? -17.878 5.206   12.166  1.00 36.46 ? 1568 HOH A O     1 
HETATM 3748 O O     . HOH E 3 .   ? -4.412  -19.546 4.984   1.00 42.35 ? 1569 HOH A O     1 
HETATM 3749 O O     . HOH E 3 .   ? 9.129   14.699  1.441   1.00 33.27 ? 1570 HOH A O     1 
HETATM 3750 O O     . HOH E 3 .   ? -13.222 9.296   14.775  1.00 38.26 ? 1571 HOH A O     1 
HETATM 3751 O O     . HOH E 3 .   ? -12.444 -19.651 6.728   1.00 41.76 ? 1572 HOH A O     1 
HETATM 3752 O O     . HOH E 3 .   ? -13.927 9.589   10.030  1.00 28.86 ? 1573 HOH A O     1 
HETATM 3753 O O     . HOH E 3 .   ? 14.337  10.546  -9.915  1.00 44.50 ? 1574 HOH A O     1 
HETATM 3754 O O     . HOH E 3 .   ? 2.571   11.224  17.571  1.00 44.95 ? 1575 HOH A O     1 
HETATM 3755 O O     . HOH E 3 .   ? -7.916  -7.750  10.313  1.00 34.25 ? 1576 HOH A O     1 
HETATM 3756 O O     . HOH E 3 .   ? -9.700  7.145   -12.505 1.00 33.61 ? 1577 HOH A O     1 
HETATM 3757 O O     . HOH E 3 .   ? 11.899  -8.104  -19.982 1.00 53.36 ? 1578 HOH A O     1 
HETATM 3758 O O     . HOH E 3 .   ? -13.497 -19.845 -2.215  1.00 43.13 ? 1579 HOH A O     1 
HETATM 3759 O O     . HOH E 3 .   ? 20.245  9.488   5.436   1.00 38.66 ? 1580 HOH A O     1 
HETATM 3760 O O     . HOH E 3 .   ? 6.054   4.051   -21.154 1.00 41.49 ? 1581 HOH A O     1 
HETATM 3761 O O     . HOH E 3 .   ? -4.722  7.418   14.320  1.00 43.45 ? 1582 HOH A O     1 
HETATM 3762 O O     . HOH E 3 .   ? 14.784  14.643  -1.936  1.00 37.57 ? 1583 HOH A O     1 
HETATM 3763 O O     . HOH E 3 .   ? -4.699  -6.985  8.880   1.00 27.23 ? 1584 HOH A O     1 
HETATM 3764 O O     . HOH E 3 .   ? 1.648   -7.965  -18.358 1.00 47.31 ? 1585 HOH A O     1 
HETATM 3765 O O     . HOH E 3 .   ? -4.416  -7.802  11.433  1.00 39.34 ? 1586 HOH A O     1 
HETATM 3766 O O     . HOH E 3 .   ? 16.134  14.074  -8.744  1.00 32.12 ? 1587 HOH A O     1 
HETATM 3767 O O     . HOH E 3 .   ? -25.834 -12.068 1.544   1.00 37.16 ? 1588 HOH A O     1 
HETATM 3768 O O     . HOH E 3 .   ? -6.262  -5.323  -17.169 1.00 42.83 ? 1589 HOH A O     1 
HETATM 3769 O O     . HOH E 3 .   ? 16.674  11.124  10.152  1.00 32.61 ? 1590 HOH A O     1 
HETATM 3770 O O     . HOH E 3 .   ? -6.669  -7.720  -19.559 1.00 34.89 ? 1591 HOH A O     1 
HETATM 3771 O O     . HOH E 3 .   ? 16.929  14.480  0.050   1.00 40.51 ? 1592 HOH A O     1 
HETATM 3772 O O     . HOH E 3 .   ? 8.549   6.268   -18.088 1.00 44.32 ? 1593 HOH A O     1 
HETATM 3773 O O     . HOH E 3 .   ? 4.895   -11.071 6.920   1.00 35.84 ? 1594 HOH A O     1 
HETATM 3774 O O     . HOH E 3 .   ? -2.007  12.726  -9.269  1.00 39.12 ? 1595 HOH A O     1 
HETATM 3775 O O     . HOH E 3 .   ? -19.514 4.716   10.189  1.00 34.67 ? 1596 HOH A O     1 
HETATM 3776 O O     . HOH E 3 .   ? -18.648 -14.982 5.910   1.00 46.85 ? 1597 HOH A O     1 
HETATM 3777 O O     . HOH E 3 .   ? -7.489  9.756   17.605  1.00 35.12 ? 1598 HOH A O     1 
HETATM 3778 O O     . HOH E 3 .   ? -9.075  11.244  -5.560  1.00 30.41 ? 1599 HOH A O     1 
HETATM 3779 O O     . HOH E 3 .   ? -11.733 -14.682 11.312  1.00 42.46 ? 1600 HOH A O     1 
HETATM 3780 O O     . HOH E 3 .   ? 7.486   16.622  -4.599  1.00 44.66 ? 1601 HOH A O     1 
HETATM 3781 O O     . HOH E 3 .   ? -7.039  -3.429  17.095  1.00 27.38 ? 1602 HOH A O     1 
HETATM 3782 O O     . HOH E 3 .   ? -3.753  -18.699 21.177  1.00 37.18 ? 1603 HOH A O     1 
HETATM 3783 O O     . HOH E 3 .   ? -13.148 -20.261 -4.680  1.00 37.10 ? 1604 HOH A O     1 
HETATM 3784 O O     . HOH E 3 .   ? -15.941 -16.866 -4.109  1.00 46.17 ? 1605 HOH A O     1 
HETATM 3785 O O     . HOH E 3 .   ? -5.490  -18.337 6.966   1.00 39.79 ? 1606 HOH A O     1 
HETATM 3786 O O     . HOH E 3 .   ? 19.299  -6.508  -14.978 1.00 49.88 ? 1607 HOH A O     1 
HETATM 3787 O O     . HOH E 3 .   ? 5.380   14.806  11.645  1.00 35.16 ? 1608 HOH A O     1 
HETATM 3788 O O     . HOH E 3 .   ? -9.606  -18.047 8.109   1.00 36.49 ? 1609 HOH A O     1 
HETATM 3789 O O     . HOH E 3 .   ? 19.309  0.496   -3.810  1.00 40.98 ? 1610 HOH A O     1 
HETATM 3790 O O     . HOH E 3 .   ? 1.424   11.679  -9.438  1.00 45.34 ? 1611 HOH A O     1 
HETATM 3791 O O     . HOH E 3 .   ? -22.157 -3.955  -0.266  1.00 40.01 ? 1612 HOH A O     1 
HETATM 3792 O O     . HOH E 3 .   ? -13.104 -19.008 -10.484 1.00 49.57 ? 1613 HOH A O     1 
HETATM 3793 O O     . HOH E 3 .   ? 0.003   -18.143 10.722  1.00 45.32 ? 1614 HOH A O     1 
HETATM 3794 O O     . HOH E 3 .   ? -0.207  -20.373 -8.395  1.00 43.67 ? 1615 HOH A O     1 
HETATM 3795 O O     . HOH E 3 .   ? -9.004  8.057   19.829  1.00 55.17 ? 1616 HOH A O     1 
HETATM 3796 O O     . HOH E 3 .   ? -14.271 -8.426  -8.130  1.00 40.85 ? 1617 HOH A O     1 
HETATM 3797 O O     . HOH E 3 .   ? -14.921 -1.142  13.327  1.00 31.70 ? 1618 HOH A O     1 
HETATM 3798 O O     . HOH E 3 .   ? -4.325  11.472  -6.456  1.00 37.31 ? 1619 HOH A O     1 
HETATM 3799 O O     . HOH E 3 .   ? -20.880 -5.316  11.387  1.00 40.18 ? 1620 HOH A O     1 
HETATM 3800 O O     . HOH E 3 .   ? 12.107  9.077   -9.305  1.00 26.62 ? 1621 HOH A O     1 
HETATM 3801 O O     . HOH E 3 .   ? -11.387 8.477   2.458   1.00 42.80 ? 1622 HOH A O     1 
HETATM 3802 O O     . HOH E 3 .   ? -14.733 9.008   12.788  1.00 37.88 ? 1623 HOH A O     1 
HETATM 3803 O O     . HOH E 3 .   ? -3.482  15.259  10.906  1.00 39.68 ? 1624 HOH A O     1 
HETATM 3804 O O     . HOH E 3 .   ? -8.782  -8.018  14.088  1.00 40.56 ? 1625 HOH A O     1 
HETATM 3805 O O     . HOH E 3 .   ? 18.382  -4.886  -5.304  1.00 37.95 ? 1626 HOH A O     1 
HETATM 3806 O O     . HOH E 3 .   ? 18.419  -8.526  -16.591 1.00 37.52 ? 1627 HOH A O     1 
HETATM 3807 O O     . HOH E 3 .   ? -13.653 -12.500 -9.051  1.00 43.19 ? 1628 HOH A O     1 
HETATM 3808 O O     . HOH E 3 .   ? -15.404 -12.650 -4.436  1.00 36.99 ? 1629 HOH A O     1 
HETATM 3809 O O     . HOH E 3 .   ? 11.965  -15.298 -2.171  1.00 40.36 ? 1630 HOH A O     1 
HETATM 3810 O O     . HOH E 3 .   ? 1.307   0.826   -17.885 1.00 36.46 ? 1631 HOH A O     1 
HETATM 3811 O O     . HOH E 3 .   ? -1.489  -7.697  -17.656 1.00 48.23 ? 1632 HOH A O     1 
HETATM 3812 O O     . HOH E 3 .   ? -16.918 -10.070 12.383  1.00 37.26 ? 1633 HOH A O     1 
HETATM 3813 O O     . HOH E 3 .   ? -14.722 5.448   -5.746  1.00 44.68 ? 1634 HOH A O     1 
HETATM 3814 O O     . HOH E 3 .   ? -4.853  -19.742 8.959   1.00 45.11 ? 1635 HOH A O     1 
HETATM 3815 O O     . HOH E 3 .   ? 6.064   -18.200 -7.851  1.00 35.74 ? 1636 HOH A O     1 
HETATM 3816 O O     . HOH E 3 .   ? -14.875 1.600   13.395  1.00 34.94 ? 1637 HOH A O     1 
HETATM 3817 O O     . HOH E 3 .   ? -18.278 5.304   0.525   1.00 37.91 ? 1638 HOH A O     1 
HETATM 3818 O O     . HOH E 3 .   ? 16.737  -5.020  -18.402 1.00 41.80 ? 1639 HOH A O     1 
HETATM 3819 O O     . HOH E 3 .   ? -18.914 -3.609  11.335  1.00 31.54 ? 1640 HOH A O     1 
HETATM 3820 O O     . HOH E 3 .   ? 9.016   -18.697 -3.510  1.00 39.39 ? 1641 HOH A O     1 
HETATM 3821 O O     . HOH E 3 .   ? -6.915  -6.332  14.895  1.00 43.73 ? 1642 HOH A O     1 
HETATM 3822 O O     . HOH E 3 .   ? -4.673  10.390  -11.616 1.00 33.22 ? 1643 HOH A O     1 
HETATM 3823 O O     . HOH E 3 .   ? -4.124  -12.969 16.453  1.00 55.31 ? 1644 HOH A O     1 
HETATM 3824 O O     . HOH E 3 .   ? 14.596  7.910   -13.325 1.00 44.74 ? 1645 HOH A O     1 
HETATM 3825 O O     . HOH E 3 .   ? 5.954   -6.161  -19.637 1.00 43.70 ? 1646 HOH A O     1 
HETATM 3826 O O     . HOH E 3 .   ? 16.962  -9.814  -19.457 1.00 45.28 ? 1647 HOH A O     1 
HETATM 3827 O O     . HOH E 3 .   ? 2.808   -20.496 -3.750  1.00 55.16 ? 1648 HOH A O     1 
HETATM 3828 O O     . HOH E 3 .   ? -21.732 -1.690  -8.074  1.00 49.55 ? 1649 HOH A O     1 
HETATM 3829 O O     . HOH E 3 .   ? 13.118  9.819   12.467  1.00 37.78 ? 1650 HOH A O     1 
HETATM 3830 O O     . HOH E 3 .   ? -1.183  1.543   -19.595 1.00 42.01 ? 1651 HOH A O     1 
HETATM 3831 O O     . HOH E 3 .   ? -5.040  10.157  -14.327 1.00 36.08 ? 1652 HOH A O     1 
HETATM 3832 O O     . HOH E 3 .   ? -12.140 -22.757 7.602   1.00 40.84 ? 1653 HOH A O     1 
HETATM 3833 O O     . HOH E 3 .   ? 3.422   -1.042  -18.225 1.00 30.79 ? 1654 HOH A O     1 
HETATM 3834 O O     . HOH E 3 .   ? 10.071  -22.641 7.402   1.00 39.81 ? 1655 HOH A O     1 
HETATM 3835 O O     . HOH E 3 .   ? -11.438 -11.112 8.615   1.00 37.08 ? 1656 HOH A O     1 
HETATM 3836 O O     . HOH E 3 .   ? 11.262  -12.010 -12.278 1.00 48.04 ? 1657 HOH A O     1 
HETATM 3837 O O     . HOH E 3 .   ? -24.058 -11.042 -3.925  1.00 38.45 ? 1658 HOH A O     1 
HETATM 3838 O O     . HOH E 3 .   ? -10.976 -22.316 -0.626  1.00 42.46 ? 1659 HOH A O     1 
HETATM 3839 O O     . HOH E 3 .   ? -9.116  3.985   -16.083 1.00 42.72 ? 1660 HOH A O     1 
HETATM 3840 O O     . HOH E 3 .   ? 18.733  -7.456  -6.748  1.00 49.20 ? 1661 HOH A O     1 
HETATM 3841 O O     . HOH E 3 .   ? 18.404  -12.361 -1.908  1.00 50.43 ? 1662 HOH A O     1 
HETATM 3842 O O     . HOH E 3 .   ? -15.346 12.039  9.655   1.00 38.73 ? 1663 HOH A O     1 
HETATM 3843 O O     . HOH E 3 .   ? 8.377   13.575  -10.411 1.00 37.08 ? 1664 HOH A O     1 
HETATM 3844 O O     . HOH E 3 .   ? 4.737   -22.715 0.189   1.00 41.05 ? 1665 HOH A O     1 
HETATM 3845 O O     . HOH E 3 .   ? 19.979  0.349   -12.025 1.00 41.81 ? 1666 HOH A O     1 
HETATM 3846 O O     . HOH E 3 .   ? -4.725  5.031   -12.797 1.00 46.58 ? 1667 HOH A O     1 
HETATM 3847 O O     . HOH E 3 .   ? 4.118   -18.829 8.265   1.00 54.07 ? 1668 HOH A O     1 
HETATM 3848 O O     . HOH E 3 .   ? 4.545   13.730  -8.684  1.00 56.11 ? 1669 HOH A O     1 
HETATM 3849 O O     . HOH E 3 .   ? 20.516  -1.594  -10.292 1.00 46.34 ? 1670 HOH A O     1 
HETATM 3850 O O     . HOH E 3 .   ? 10.292  7.954   14.864  1.00 37.53 ? 1671 HOH A O     1 
HETATM 3851 O O     . HOH E 3 .   ? 8.078   15.990  -8.245  1.00 53.76 ? 1672 HOH A O     1 
HETATM 3852 O O     . HOH E 3 .   ? -11.512 -11.951 11.125  1.00 46.23 ? 1673 HOH A O     1 
HETATM 3853 O O     . HOH E 3 .   ? -5.235  14.936  -12.501 1.00 43.00 ? 1674 HOH A O     1 
HETATM 3854 O O     . HOH E 3 .   ? -3.360  -8.307  18.709  1.00 38.09 ? 1675 HOH A O     1 
HETATM 3855 O O     . HOH E 3 .   ? -11.798 12.722  8.317   1.00 42.85 ? 1676 HOH A O     1 
HETATM 3856 O O     . HOH E 3 .   ? -21.799 -10.276 7.619   1.00 47.49 ? 1677 HOH A O     1 
HETATM 3857 O O     . HOH E 3 .   ? -4.410  6.268   19.680  1.00 35.77 ? 1678 HOH A O     1 
HETATM 3858 O O     . HOH E 3 .   ? 10.966  -15.555 6.823   1.00 41.46 ? 1679 HOH A O     1 
HETATM 3859 O O     . HOH E 3 .   ? -19.501 -5.802  -7.543  1.00 49.22 ? 1680 HOH A O     1 
HETATM 3860 O O     . HOH E 3 .   ? -13.100 -7.036  -18.246 1.00 41.75 ? 1681 HOH A O     1 
HETATM 3861 O O     . HOH E 3 .   ? -13.073 12.197  14.634  1.00 44.67 ? 1682 HOH A O     1 
HETATM 3862 O O     . HOH E 3 .   ? 10.484  -15.417 -6.376  1.00 44.23 ? 1683 HOH A O     1 
HETATM 3863 O O     . HOH E 3 .   ? -23.639 -6.032  -0.097  1.00 41.11 ? 1684 HOH A O     1 
HETATM 3864 O O     . HOH E 3 .   ? -19.921 8.249   4.046   1.00 39.88 ? 1685 HOH A O     1 
HETATM 3865 O O     . HOH E 3 .   ? 2.591   -10.521 20.780  1.00 39.37 ? 1686 HOH A O     1 
HETATM 3866 O O     . HOH E 3 .   ? -4.979  14.970  14.281  1.00 38.46 ? 1687 HOH A O     1 
HETATM 3867 O O     . HOH E 3 .   ? -2.368  7.856   19.781  1.00 43.91 ? 1688 HOH A O     1 
HETATM 3868 O O     . HOH E 3 .   ? -7.679  13.564  10.984  1.00 37.14 ? 1689 HOH A O     1 
HETATM 3869 O O     . HOH E 3 .   ? -4.607  13.769  -9.971  1.00 42.67 ? 1690 HOH A O     1 
HETATM 3870 O O     . HOH E 3 .   ? 17.433  0.765   -11.911 1.00 29.01 ? 1691 HOH A O     1 
HETATM 3871 O O     . HOH E 3 .   ? -6.124  -4.333  12.523  1.00 38.52 ? 1692 HOH A O     1 
HETATM 3872 O O     . HOH E 3 .   ? -26.004 -8.700  3.387   1.00 34.72 ? 1693 HOH A O     1 
HETATM 3873 O O     . HOH E 3 .   ? 16.097  -1.737  5.118   1.00 47.26 ? 1694 HOH A O     1 
HETATM 3874 O O     . HOH F 3 .   ? -17.136 18.459  -31.453 1.00 16.68 ? 1403 HOH B O     1 
HETATM 3875 O O     . HOH F 3 .   ? -22.308 13.421  -29.776 1.00 12.95 ? 1404 HOH B O     1 
HETATM 3876 O O     . HOH F 3 .   ? -19.151 26.476  -29.198 1.00 14.81 ? 1405 HOH B O     1 
HETATM 3877 O O     . HOH F 3 .   ? -36.690 13.072  -32.283 1.00 11.55 ? 1406 HOH B O     1 
HETATM 3878 O O     . HOH F 3 .   ? -30.057 1.277   -38.203 1.00 19.60 ? 1407 HOH B O     1 
HETATM 3879 O O     . HOH F 3 .   ? -32.772 22.180  -29.350 1.00 15.59 ? 1408 HOH B O     1 
HETATM 3880 O O     . HOH F 3 .   ? -20.693 10.933  -35.488 1.00 14.85 ? 1409 HOH B O     1 
HETATM 3881 O O     . HOH F 3 .   ? -34.882 3.756   -27.199 1.00 20.70 ? 1410 HOH B O     1 
HETATM 3882 O O     . HOH F 3 .   ? -35.094 10.933  -31.922 1.00 13.74 ? 1411 HOH B O     1 
HETATM 3883 O O     . HOH F 3 .   ? -13.938 14.657  -38.890 1.00 18.51 ? 1412 HOH B O     1 
HETATM 3884 O O     . HOH F 3 .   ? -13.329 19.017  -41.596 1.00 22.57 ? 1413 HOH B O     1 
HETATM 3885 O O     . HOH F 3 .   ? -31.002 16.315  -36.282 1.00 16.15 ? 1414 HOH B O     1 
HETATM 3886 O O     . HOH F 3 .   ? -29.933 24.870  -11.224 1.00 19.68 ? 1415 HOH B O     1 
HETATM 3887 O O     . HOH F 3 .   ? -19.441 11.059  -32.216 1.00 19.49 ? 1416 HOH B O     1 
HETATM 3888 O O     . HOH F 3 .   ? -30.094 19.122  -31.839 1.00 20.62 ? 1417 HOH B O     1 
HETATM 3889 O O     . HOH F 3 .   ? -32.490 5.291   -36.796 1.00 22.13 ? 1418 HOH B O     1 
HETATM 3890 O O     . HOH F 3 .   ? -26.318 16.791  -37.645 1.00 17.28 ? 1419 HOH B O     1 
HETATM 3891 O O     . HOH F 3 .   ? -14.078 13.948  -13.630 1.00 22.83 ? 1420 HOH B O     1 
HETATM 3892 O O     . HOH F 3 .   ? -31.297 24.617  -29.268 1.00 21.16 ? 1421 HOH B O     1 
HETATM 3893 O O     . HOH F 3 .   ? -35.475 26.981  -15.239 1.00 22.95 ? 1422 HOH B O     1 
HETATM 3894 O O     . HOH F 3 .   ? -33.438 21.261  -35.648 1.00 23.76 ? 1423 HOH B O     1 
HETATM 3895 O O     . HOH F 3 .   ? -39.369 4.600   -36.629 1.00 22.80 ? 1424 HOH B O     1 
HETATM 3896 O O     . HOH F 3 .   ? -42.584 21.347  -23.473 1.00 24.46 ? 1425 HOH B O     1 
HETATM 3897 O O     . HOH F 3 .   ? -28.223 16.762  -35.788 1.00 15.84 ? 1426 HOH B O     1 
HETATM 3898 O O     . HOH F 3 .   ? -30.848 32.254  -29.300 1.00 27.91 ? 1427 HOH B O     1 
HETATM 3899 O O     . HOH F 3 .   ? -31.645 1.422   -34.664 1.00 20.21 ? 1428 HOH B O     1 
HETATM 3900 O O     . HOH F 3 .   ? -36.267 8.482   -32.080 1.00 20.95 ? 1429 HOH B O     1 
HETATM 3901 O O     . HOH F 3 .   ? -35.277 11.564  -21.001 1.00 20.14 ? 1430 HOH B O     1 
HETATM 3902 O O     . HOH F 3 .   ? -45.591 18.586  -34.765 1.00 21.55 ? 1431 HOH B O     1 
HETATM 3903 O O     . HOH F 3 .   ? -12.861 26.719  -28.147 1.00 21.76 ? 1432 HOH B O     1 
HETATM 3904 O O     . HOH F 3 .   ? -32.454 2.621   -37.089 1.00 21.02 ? 1433 HOH B O     1 
HETATM 3905 O O     . HOH F 3 .   ? -43.115 18.503  -25.698 1.00 22.52 ? 1434 HOH B O     1 
HETATM 3906 O O     . HOH F 3 .   ? -45.562 15.039  -33.836 1.00 22.12 ? 1435 HOH B O     1 
HETATM 3907 O O     . HOH F 3 .   ? -22.099 29.931  -34.106 1.00 26.36 ? 1436 HOH B O     1 
HETATM 3908 O O     . HOH F 3 .   ? -7.433  7.740   -29.589 1.00 26.84 ? 1437 HOH B O     1 
HETATM 3909 O O     . HOH F 3 .   ? -19.711 16.499  -11.138 1.00 23.36 ? 1438 HOH B O     1 
HETATM 3910 O O     . HOH F 3 .   ? -42.055 6.641   -31.058 1.00 23.10 ? 1439 HOH B O     1 
HETATM 3911 O O     . HOH F 3 .   ? -16.490 9.979   -43.174 1.00 23.72 ? 1440 HOH B O     1 
HETATM 3912 O O     . HOH F 3 .   ? -13.973 12.199  -36.976 1.00 23.33 ? 1441 HOH B O     1 
HETATM 3913 O O     . HOH F 3 .   ? -35.380 23.489  -36.307 1.00 27.74 ? 1442 HOH B O     1 
HETATM 3914 O O     . HOH F 3 .   ? -25.169 27.756  -10.415 1.00 19.62 ? 1443 HOH B O     1 
HETATM 3915 O O     . HOH F 3 .   ? -17.803 11.949  -44.718 1.00 24.71 ? 1444 HOH B O     1 
HETATM 3916 O O     . HOH F 3 .   ? -27.622 14.007  -42.977 1.00 19.41 ? 1445 HOH B O     1 
HETATM 3917 O O     . HOH F 3 .   ? -42.032 15.527  -36.271 1.00 30.14 ? 1446 HOH B O     1 
HETATM 3918 O O     . HOH F 3 .   ? -18.681 23.283  -9.672  1.00 24.58 ? 1447 HOH B O     1 
HETATM 3919 O O     . HOH F 3 .   ? -33.675 31.478  -19.776 1.00 23.11 ? 1448 HOH B O     1 
HETATM 3920 O O     . HOH F 3 .   ? -31.438 33.113  -20.505 1.00 26.44 ? 1449 HOH B O     1 
HETATM 3921 O O     . HOH F 3 .   ? -39.975 3.931   -34.017 1.00 31.58 ? 1450 HOH B O     1 
HETATM 3922 O O     . HOH F 3 .   ? -16.491 26.822  -14.825 1.00 22.68 ? 1451 HOH B O     1 
HETATM 3923 O O     . HOH F 3 .   ? -28.079 17.271  -39.899 1.00 25.52 ? 1452 HOH B O     1 
HETATM 3924 O O     . HOH F 3 .   ? -12.098 20.048  -11.155 1.00 31.09 ? 1453 HOH B O     1 
HETATM 3925 O O     . HOH F 3 .   ? -43.444 16.873  -34.478 1.00 24.87 ? 1454 HOH B O     1 
HETATM 3926 O O     . HOH F 3 .   ? -37.222 10.615  -19.314 1.00 31.36 ? 1455 HOH B O     1 
HETATM 3927 O O     . HOH F 3 .   ? -13.209 20.638  -13.805 1.00 24.51 ? 1456 HOH B O     1 
HETATM 3928 O O     . HOH F 3 .   ? -16.827 24.033  -28.489 1.00 20.19 ? 1457 HOH B O     1 
HETATM 3929 O O     . HOH F 3 .   ? -39.656 5.833   -31.912 1.00 28.65 ? 1458 HOH B O     1 
HETATM 3930 O O     . HOH F 3 .   ? -41.791 7.210   -28.378 1.00 25.98 ? 1459 HOH B O     1 
HETATM 3931 O O     . HOH F 3 .   ? -22.301 17.330  -10.722 1.00 26.98 ? 1460 HOH B O     1 
HETATM 3932 O O     . HOH F 3 .   ? -34.876 -0.951  -34.345 1.00 36.32 ? 1461 HOH B O     1 
HETATM 3933 O O     . HOH F 3 .   ? -32.728 30.590  -17.176 1.00 26.14 ? 1462 HOH B O     1 
HETATM 3934 O O     . HOH F 3 .   ? -33.793 4.136   -18.702 1.00 28.33 ? 1463 HOH B O     1 
HETATM 3935 O O     . HOH F 3 .   ? -38.586 10.713  -41.075 1.00 28.70 ? 1464 HOH B O     1 
HETATM 3936 O O     . HOH F 3 .   ? -48.043 13.657  -27.754 1.00 24.25 ? 1465 HOH B O     1 
HETATM 3937 O O     . HOH F 3 .   ? -42.049 14.212  -23.176 1.00 22.06 ? 1466 HOH B O     1 
HETATM 3938 O O     . HOH F 3 .   ? -41.970 18.586  -22.719 1.00 23.60 ? 1467 HOH B O     1 
HETATM 3939 O O     . HOH F 3 .   ? -9.042  7.909   -32.110 1.00 26.87 ? 1468 HOH B O     1 
HETATM 3940 O O     . HOH F 3 .   ? -8.734  15.414  -28.620 1.00 27.40 ? 1469 HOH B O     1 
HETATM 3941 O O     . HOH F 3 .   ? -17.981 5.634   -42.863 1.00 24.98 ? 1470 HOH B O     1 
HETATM 3942 O O     . HOH F 3 .   ? -39.279 6.859   -27.439 1.00 28.54 ? 1471 HOH B O     1 
HETATM 3943 O O     . HOH F 3 .   ? -31.197 18.786  -34.054 1.00 31.12 ? 1472 HOH B O     1 
HETATM 3944 O O     . HOH F 3 .   ? -14.164 11.131  -41.957 1.00 28.96 ? 1473 HOH B O     1 
HETATM 3945 O O     . HOH F 3 .   ? -16.690 7.575   -43.957 1.00 27.53 ? 1474 HOH B O     1 
HETATM 3946 O O     . HOH F 3 .   ? -8.438  17.612  -34.666 1.00 38.56 ? 1475 HOH B O     1 
HETATM 3947 O O     . HOH F 3 .   ? -25.474 19.290  -38.377 1.00 27.56 ? 1476 HOH B O     1 
HETATM 3948 O O     . HOH F 3 .   ? -37.151 6.442   -30.170 1.00 25.44 ? 1477 HOH B O     1 
HETATM 3949 O O     . HOH F 3 .   ? -31.205 21.817  -31.371 1.00 27.55 ? 1478 HOH B O     1 
HETATM 3950 O O     . HOH F 3 .   ? -42.010 25.298  -35.892 1.00 31.10 ? 1479 HOH B O     1 
HETATM 3951 O O     . HOH F 3 .   ? -11.562 25.697  -34.679 1.00 32.94 ? 1480 HOH B O     1 
HETATM 3952 O O     . HOH F 3 .   ? -49.983 21.461  -31.266 1.00 36.92 ? 1481 HOH B O     1 
HETATM 3953 O O     . HOH F 3 .   ? -34.467 12.277  -14.454 1.00 26.18 ? 1482 HOH B O     1 
HETATM 3954 O O     . HOH F 3 .   ? -40.926 11.403  -18.909 1.00 31.62 ? 1483 HOH B O     1 
HETATM 3955 O O     . HOH F 3 .   ? -23.974 4.034   -17.819 1.00 23.67 ? 1484 HOH B O     1 
HETATM 3956 O O     . HOH F 3 .   ? -27.117 -1.915  -27.426 1.00 33.34 ? 1485 HOH B O     1 
HETATM 3957 O O     . HOH F 3 .   ? -27.223 13.759  -45.596 1.00 30.16 ? 1486 HOH B O     1 
HETATM 3958 O O     . HOH F 3 .   ? -24.104 30.443  -38.680 1.00 31.13 ? 1487 HOH B O     1 
HETATM 3959 O O     . HOH F 3 .   ? -30.101 2.677   -19.839 1.00 27.04 ? 1488 HOH B O     1 
HETATM 3960 O O     . HOH F 3 .   ? -33.052 1.382   -22.004 1.00 36.59 ? 1489 HOH B O     1 
HETATM 3961 O O     . HOH F 3 .   ? -12.478 10.185  -12.416 1.00 38.79 ? 1490 HOH B O     1 
HETATM 3962 O O     . HOH F 3 .   ? -29.245 30.552  -35.109 1.00 33.40 ? 1491 HOH B O     1 
HETATM 3963 O O     . HOH F 3 .   ? -6.084  12.577  -21.001 1.00 29.61 ? 1492 HOH B O     1 
HETATM 3964 O O     . HOH F 3 .   ? -35.730 4.230   -29.866 1.00 30.40 ? 1493 HOH B O     1 
HETATM 3965 O O     . HOH F 3 .   ? -12.362 27.900  -25.427 1.00 30.41 ? 1494 HOH B O     1 
HETATM 3966 O O     . HOH F 3 .   ? -25.960 2.752   -19.050 1.00 36.65 ? 1495 HOH B O     1 
HETATM 3967 O O     . HOH F 3 .   ? -13.477 22.326  -40.864 1.00 22.14 ? 1496 HOH B O     1 
HETATM 3968 O O     . HOH F 3 .   ? -32.452 -1.134  -33.931 1.00 31.27 ? 1497 HOH B O     1 
HETATM 3969 O O     . HOH F 3 .   ? -18.309 17.600  -46.739 1.00 29.88 ? 1498 HOH B O     1 
HETATM 3970 O O     . HOH F 3 .   ? -22.936 12.260  -47.884 1.00 40.26 ? 1499 HOH B O     1 
HETATM 3971 O O     . HOH F 3 .   ? -20.129 14.431  -9.587  1.00 32.43 ? 1500 HOH B O     1 
HETATM 3972 O O     . HOH F 3 .   ? -6.719  1.639   -36.886 1.00 38.72 ? 1501 HOH B O     1 
HETATM 3973 O O     . HOH F 3 .   ? -3.530  -0.926  -18.600 1.00 36.73 ? 1502 HOH B O     1 
HETATM 3974 O O     . HOH F 3 .   ? -15.490 24.582  -44.047 1.00 29.95 ? 1503 HOH B O     1 
HETATM 3975 O O     . HOH F 3 .   ? -13.569 -2.513  -24.911 1.00 35.40 ? 1504 HOH B O     1 
HETATM 3976 O O     . HOH F 3 .   ? -18.315 17.091  -8.827  1.00 30.41 ? 1505 HOH B O     1 
HETATM 3977 O O     . HOH F 3 .   ? -35.407 9.944   -15.260 1.00 36.18 ? 1506 HOH B O     1 
HETATM 3978 O O     . HOH F 3 .   ? -5.657  15.562  -20.798 1.00 37.71 ? 1507 HOH B O     1 
HETATM 3979 O O     . HOH F 3 .   ? -31.025 -1.266  -38.297 1.00 34.60 ? 1508 HOH B O     1 
HETATM 3980 O O     . HOH F 3 .   ? -50.103 15.345  -28.260 1.00 27.46 ? 1509 HOH B O     1 
HETATM 3981 O O     . HOH F 3 .   ? -13.205 12.265  -10.333 1.00 30.45 ? 1510 HOH B O     1 
HETATM 3982 O O     . HOH F 3 .   ? -9.561  24.791  -36.773 1.00 40.54 ? 1511 HOH B O     1 
HETATM 3983 O O     . HOH F 3 .   ? -9.824  19.299  -41.971 1.00 28.93 ? 1512 HOH B O     1 
HETATM 3984 O O     . HOH F 3 .   ? -28.297 19.430  -36.630 1.00 24.01 ? 1513 HOH B O     1 
HETATM 3985 O O     . HOH F 3 .   ? -31.710 19.711  -38.214 1.00 34.07 ? 1514 HOH B O     1 
HETATM 3986 O O     . HOH F 3 .   ? -43.406 16.695  -23.508 1.00 39.46 ? 1515 HOH B O     1 
HETATM 3987 O O     . HOH F 3 .   ? -20.726 -2.992  -26.308 1.00 33.17 ? 1516 HOH B O     1 
HETATM 3988 O O     . HOH F 3 .   ? -42.597 13.456  -20.761 1.00 33.70 ? 1517 HOH B O     1 
HETATM 3989 O O     . HOH F 3 .   ? -36.033 32.597  -19.335 1.00 35.46 ? 1518 HOH B O     1 
HETATM 3990 O O     . HOH F 3 .   ? -6.763  0.096   -28.989 1.00 40.39 ? 1519 HOH B O     1 
HETATM 3991 O O     . HOH F 3 .   ? -27.837 5.931   -47.349 1.00 40.56 ? 1520 HOH B O     1 
HETATM 3992 O O     . HOH F 3 .   ? -12.029 3.859   -17.116 1.00 43.76 ? 1521 HOH B O     1 
HETATM 3993 O O     . HOH F 3 .   ? -18.836 19.491  -7.639  1.00 39.96 ? 1522 HOH B O     1 
HETATM 3994 O O     . HOH F 3 .   ? -34.531 1.061   -26.333 1.00 37.35 ? 1523 HOH B O     1 
HETATM 3995 O O     . HOH F 3 .   ? -12.916 28.273  -34.759 1.00 37.91 ? 1524 HOH B O     1 
HETATM 3996 O O     . HOH F 3 .   ? -28.557 19.639  -43.700 1.00 33.34 ? 1525 HOH B O     1 
HETATM 3997 O O     . HOH F 3 .   ? -24.136 22.487  -9.868  1.00 27.36 ? 1526 HOH B O     1 
HETATM 3998 O O     . HOH F 3 .   ? -17.311 14.622  -44.716 1.00 31.35 ? 1527 HOH B O     1 
HETATM 3999 O O     . HOH F 3 .   ? -25.943 0.127   -18.496 1.00 36.88 ? 1528 HOH B O     1 
HETATM 4000 O O     . HOH F 3 .   ? -9.955  21.176  -9.232  1.00 41.18 ? 1529 HOH B O     1 
HETATM 4001 O O     . HOH F 3 .   ? -7.506  3.474   -34.565 1.00 41.99 ? 1530 HOH B O     1 
HETATM 4002 O O     . HOH F 3 .   ? -25.941 21.676  -38.076 1.00 38.44 ? 1531 HOH B O     1 
HETATM 4003 O O     . HOH F 3 .   ? -41.845 6.701   -39.415 1.00 36.24 ? 1532 HOH B O     1 
HETATM 4004 O O     . HOH F 3 .   ? -22.888 32.242  -45.552 1.00 44.22 ? 1533 HOH B O     1 
HETATM 4005 O O     . HOH F 3 .   ? -40.889 14.932  -40.261 1.00 41.23 ? 1534 HOH B O     1 
HETATM 4006 O O     . HOH F 3 .   ? -9.677  14.590  -11.693 1.00 37.98 ? 1535 HOH B O     1 
HETATM 4007 O O     . HOH F 3 .   ? -22.266 30.974  -36.545 1.00 36.43 ? 1536 HOH B O     1 
HETATM 4008 O O     . HOH F 3 .   ? -33.176 11.568  -12.258 1.00 27.37 ? 1537 HOH B O     1 
HETATM 4009 O O     . HOH F 3 .   ? -32.803 7.848   -48.652 1.00 28.72 ? 1538 HOH B O     1 
HETATM 4010 O O     . HOH F 3 .   ? -36.887 14.605  -44.352 1.00 39.24 ? 1539 HOH B O     1 
HETATM 4011 O O     . HOH F 3 .   ? -32.984 2.529   -31.125 1.00 31.26 ? 1540 HOH B O     1 
HETATM 4012 O O     . HOH F 3 .   ? -28.510 32.914  -30.509 1.00 40.69 ? 1541 HOH B O     1 
HETATM 4013 O O     . HOH F 3 .   ? -47.641 10.623  -28.303 1.00 35.16 ? 1542 HOH B O     1 
HETATM 4014 O O     . HOH F 3 .   ? -17.375 -0.113  -43.832 1.00 36.48 ? 1543 HOH B O     1 
HETATM 4015 O O     . HOH F 3 .   ? -25.639 24.641  -37.136 1.00 32.98 ? 1544 HOH B O     1 
HETATM 4016 O O     . HOH F 3 .   ? -24.694 -4.837  -33.599 1.00 45.45 ? 1545 HOH B O     1 
HETATM 4017 O O     . HOH F 3 .   ? -43.576 7.412   -37.706 1.00 28.26 ? 1546 HOH B O     1 
HETATM 4018 O O     . HOH F 3 .   ? -18.929 31.314  -19.488 1.00 32.67 ? 1547 HOH B O     1 
HETATM 4019 O O     . HOH F 3 .   ? -40.347 22.540  -40.207 1.00 32.56 ? 1548 HOH B O     1 
HETATM 4020 O O     . HOH F 3 .   ? -36.313 18.371  -13.856 1.00 43.08 ? 1549 HOH B O     1 
HETATM 4021 O O     . HOH F 3 .   ? -48.017 23.758  -23.593 1.00 37.86 ? 1550 HOH B O     1 
HETATM 4022 O O     . HOH F 3 .   ? -8.018  25.472  -24.042 1.00 38.73 ? 1551 HOH B O     1 
HETATM 4023 O O     . HOH F 3 .   ? -8.853  10.325  -14.455 1.00 39.03 ? 1552 HOH B O     1 
HETATM 4024 O O     . HOH F 3 .   ? -17.112 4.231   -15.337 1.00 35.16 ? 1553 HOH B O     1 
HETATM 4025 O O     . HOH F 3 .   ? -11.133 -0.152  -39.126 1.00 44.67 ? 1554 HOH B O     1 
HETATM 4026 O O     . HOH F 3 .   ? -15.168 28.811  -22.562 1.00 40.44 ? 1555 HOH B O     1 
HETATM 4027 O O     . HOH F 3 .   ? -37.867 35.685  -34.363 1.00 39.56 ? 1556 HOH B O     1 
HETATM 4028 O O     . HOH F 3 .   ? -31.187 0.039   -23.531 1.00 44.89 ? 1557 HOH B O     1 
HETATM 4029 O O     . HOH F 3 .   ? -44.245 31.365  -25.875 1.00 44.89 ? 1558 HOH B O     1 
HETATM 4030 O O     . HOH F 3 .   ? -32.578 4.901   -48.075 1.00 33.33 ? 1559 HOH B O     1 
HETATM 4031 O O     . HOH F 3 .   ? -7.724  13.734  -32.961 1.00 36.50 ? 1560 HOH B O     1 
HETATM 4032 O O     . HOH F 3 .   ? -29.632 -1.488  -43.473 1.00 39.90 ? 1561 HOH B O     1 
HETATM 4033 O O     . HOH F 3 .   ? -42.971 3.929   -34.197 1.00 53.48 ? 1562 HOH B O     1 
HETATM 4034 O O     . HOH F 3 .   ? -13.996 26.053  -21.533 1.00 43.86 ? 1563 HOH B O     1 
HETATM 4035 O O     . HOH F 3 .   ? -12.908 0.305   -22.994 1.00 35.01 ? 1564 HOH B O     1 
HETATM 4036 O O     . HOH F 3 .   ? -28.741 0.876   -23.519 1.00 30.88 ? 1565 HOH B O     1 
HETATM 4037 O O     . HOH F 3 .   ? -24.209 -6.017  -31.501 1.00 32.72 ? 1566 HOH B O     1 
HETATM 4038 O O     . HOH F 3 .   ? -23.053 14.937  -9.879  1.00 30.27 ? 1567 HOH B O     1 
HETATM 4039 O O     . HOH F 3 .   ? -13.251 -2.760  -39.334 1.00 37.60 ? 1568 HOH B O     1 
HETATM 4040 O O     . HOH F 3 .   ? -33.325 16.760  -47.395 1.00 31.86 ? 1569 HOH B O     1 
HETATM 4041 O O     . HOH F 3 .   ? -31.885 2.609   -45.254 1.00 53.88 ? 1570 HOH B O     1 
HETATM 4042 O O     . HOH F 3 .   ? -6.979  24.954  -34.386 1.00 42.81 ? 1571 HOH B O     1 
HETATM 4043 O O     . HOH F 3 .   ? -13.831 14.084  -41.641 1.00 32.81 ? 1572 HOH B O     1 
HETATM 4044 O O     . HOH F 3 .   ? -42.537 26.955  -33.818 1.00 38.75 ? 1573 HOH B O     1 
HETATM 4045 O O     . HOH F 3 .   ? -28.727 15.712  -46.194 1.00 35.38 ? 1574 HOH B O     1 
HETATM 4046 O O     . HOH F 3 .   ? -45.029 6.423   -33.826 1.00 40.56 ? 1575 HOH B O     1 
HETATM 4047 O O     . HOH F 3 .   ? -10.490 5.991   -33.698 1.00 31.80 ? 1576 HOH B O     1 
HETATM 4048 O O     . HOH F 3 .   ? -49.874 15.656  -36.956 1.00 57.19 ? 1577 HOH B O     1 
HETATM 4049 O O     . HOH F 3 .   ? -16.425 -0.023  -46.333 1.00 40.62 ? 1578 HOH B O     1 
HETATM 4050 O O     . HOH F 3 .   ? -7.834  7.872   -15.464 1.00 44.07 ? 1579 HOH B O     1 
HETATM 4051 O O     . HOH F 3 .   ? -11.850 22.973  -13.937 1.00 40.55 ? 1580 HOH B O     1 
HETATM 4052 O O     . HOH F 3 .   ? -31.844 19.271  -8.106  1.00 37.65 ? 1581 HOH B O     1 
HETATM 4053 O O     . HOH F 3 .   ? -16.393 32.394  -28.835 1.00 37.77 ? 1582 HOH B O     1 
HETATM 4054 O O     . HOH F 3 .   ? -46.104 18.821  -37.570 1.00 42.73 ? 1583 HOH B O     1 
HETATM 4055 O O     . HOH F 3 .   ? -9.119  8.275   -40.358 1.00 44.15 ? 1584 HOH B O     1 
HETATM 4056 O O     . HOH F 3 .   ? -27.368 31.832  -39.327 1.00 40.49 ? 1585 HOH B O     1 
HETATM 4057 O O     . HOH F 3 .   ? -51.571 19.665  -37.879 1.00 37.67 ? 1586 HOH B O     1 
HETATM 4058 O O     . HOH F 3 .   ? -23.828 35.269  -21.286 1.00 44.44 ? 1587 HOH B O     1 
HETATM 4059 O O     . HOH F 3 .   ? -43.804 4.336   -31.790 1.00 34.71 ? 1588 HOH B O     1 
HETATM 4060 O O     . HOH F 3 .   ? -48.992 27.771  -28.764 1.00 39.64 ? 1589 HOH B O     1 
HETATM 4061 O O     . HOH F 3 .   ? -15.166 28.937  -31.428 1.00 35.79 ? 1590 HOH B O     1 
HETATM 4062 O O     . HOH F 3 .   ? -45.394 33.552  -31.197 1.00 29.62 ? 1591 HOH B O     1 
HETATM 4063 O O     . HOH F 3 .   ? -8.724  22.495  -13.825 1.00 35.32 ? 1592 HOH B O     1 
HETATM 4064 O O     . HOH F 3 .   ? -34.497 19.482  -6.120  1.00 43.18 ? 1593 HOH B O     1 
HETATM 4065 O O     . HOH F 3 .   ? -16.264 3.837   -41.596 1.00 43.16 ? 1594 HOH B O     1 
HETATM 4066 O O     . HOH F 3 .   ? -46.712 13.006  -40.405 1.00 41.20 ? 1595 HOH B O     1 
HETATM 4067 O O     . HOH F 3 .   ? -38.844 13.323  -40.984 1.00 34.11 ? 1596 HOH B O     1 
HETATM 4068 O O     . HOH F 3 .   ? -38.042 32.022  -25.603 1.00 33.82 ? 1597 HOH B O     1 
HETATM 4069 O O     . HOH F 3 .   ? -7.277  -1.709  -26.415 1.00 35.65 ? 1598 HOH B O     1 
HETATM 4070 O O     . HOH F 3 .   ? -36.516 13.951  -13.135 1.00 29.90 ? 1599 HOH B O     1 
HETATM 4071 O O     . HOH F 3 .   ? -48.428 20.492  -29.533 1.00 34.70 ? 1600 HOH B O     1 
HETATM 4072 O O     . HOH F 3 .   ? -42.989 16.166  -38.653 1.00 32.16 ? 1601 HOH B O     1 
HETATM 4073 O O     . HOH F 3 .   ? -21.745 -5.577  -33.390 1.00 52.50 ? 1602 HOH B O     1 
HETATM 4074 O O     . HOH F 3 .   ? -33.423 30.748  -35.912 1.00 47.90 ? 1603 HOH B O     1 
HETATM 4075 O O     . HOH F 3 .   ? -26.090 -6.120  -35.722 1.00 39.26 ? 1604 HOH B O     1 
HETATM 4076 O O     . HOH F 3 .   ? -32.682 14.478  -46.220 1.00 36.90 ? 1605 HOH B O     1 
HETATM 4077 O O     . HOH F 3 .   ? -11.218 17.443  -6.529  1.00 32.87 ? 1606 HOH B O     1 
HETATM 4078 O O     . HOH F 3 .   ? -38.297 26.828  -21.637 1.00 55.24 ? 1607 HOH B O     1 
HETATM 4079 O O     . HOH F 3 .   ? -7.659  21.536  -7.908  1.00 39.98 ? 1608 HOH B O     1 
HETATM 4080 O O     . HOH F 3 .   ? -37.644 24.400  -39.851 1.00 49.04 ? 1609 HOH B O     1 
HETATM 4081 O O     . HOH F 3 .   ? -39.593 24.829  -22.427 1.00 36.61 ? 1610 HOH B O     1 
HETATM 4082 O O     . HOH F 3 .   ? -4.246  12.507  -23.956 1.00 38.03 ? 1611 HOH B O     1 
HETATM 4083 O O     . HOH F 3 .   ? -28.233 11.577  -47.654 1.00 46.15 ? 1612 HOH B O     1 
HETATM 4084 O O     . HOH F 3 .   ? -37.885 7.978   -20.127 1.00 40.15 ? 1613 HOH B O     1 
HETATM 4085 O O     . HOH F 3 .   ? -13.055 -0.416  -33.382 1.00 36.36 ? 1614 HOH B O     1 
HETATM 4086 O O     . HOH F 3 .   ? -13.427 16.712  -42.915 1.00 43.56 ? 1615 HOH B O     1 
HETATM 4087 O O     . HOH F 3 .   ? -30.283 17.648  -10.623 1.00 57.50 ? 1616 HOH B O     1 
HETATM 4088 O O     . HOH F 3 .   ? -28.468 24.834  -44.083 1.00 51.98 ? 1617 HOH B O     1 
HETATM 4089 O O     . HOH F 3 .   ? -14.773 -1.242  -31.482 1.00 44.15 ? 1618 HOH B O     1 
HETATM 4090 O O     . HOH F 3 .   ? -39.049 22.089  -43.230 1.00 42.80 ? 1619 HOH B O     1 
HETATM 4091 O O     . HOH F 3 .   ? -28.209 4.224   -43.125 1.00 40.12 ? 1620 HOH B O     1 
HETATM 4092 O O     . HOH F 3 .   ? -27.294 19.844  -40.893 1.00 49.24 ? 1621 HOH B O     1 
HETATM 4093 O O     . HOH F 3 .   ? -21.069 -4.303  -29.562 1.00 38.56 ? 1622 HOH B O     1 
HETATM 4094 O O     . HOH F 3 .   ? -10.152 26.116  -32.369 1.00 40.78 ? 1623 HOH B O     1 
HETATM 4095 O O     . HOH F 3 .   ? -14.743 24.697  -41.820 1.00 34.27 ? 1624 HOH B O     1 
HETATM 4096 O O     . HOH F 3 .   ? -6.215  9.485   -22.316 1.00 39.65 ? 1625 HOH B O     1 
HETATM 4097 O O     . HOH F 3 .   ? -6.609  22.218  -10.329 1.00 48.64 ? 1626 HOH B O     1 
HETATM 4098 O O     . HOH F 3 .   ? -32.213 -0.221  -26.019 1.00 37.32 ? 1627 HOH B O     1 
HETATM 4099 O O     . HOH F 3 .   ? -5.721  -1.277  -37.075 1.00 44.76 ? 1628 HOH B O     1 
HETATM 4100 O O     . HOH F 3 .   ? -21.054 34.125  -38.979 1.00 44.20 ? 1629 HOH B O     1 
HETATM 4101 O O     . HOH F 3 .   ? -29.515 34.495  -23.582 1.00 43.42 ? 1630 HOH B O     1 
HETATM 4102 O O     . HOH F 3 .   ? -26.441 22.500  -40.542 1.00 51.55 ? 1631 HOH B O     1 
HETATM 4103 O O     . HOH F 3 .   ? -34.818 26.820  -12.605 1.00 36.50 ? 1632 HOH B O     1 
HETATM 4104 O O     . HOH F 3 .   ? -8.912  -2.171  -35.986 1.00 46.24 ? 1633 HOH B O     1 
HETATM 4105 O O     . HOH F 3 .   ? -16.244 29.987  -17.806 1.00 36.69 ? 1634 HOH B O     1 
HETATM 4106 O O     . HOH F 3 .   ? -35.967 38.122  -29.458 1.00 48.63 ? 1635 HOH B O     1 
HETATM 4107 O O     . HOH F 3 .   ? -46.007 30.304  -19.919 1.00 42.20 ? 1636 HOH B O     1 
HETATM 4108 O O     . HOH F 3 .   ? -38.626 3.343   -40.290 1.00 34.63 ? 1637 HOH B O     1 
HETATM 4109 O O     . HOH F 3 .   ? -47.982 17.972  -27.043 1.00 48.98 ? 1638 HOH B O     1 
HETATM 4110 O O     . HOH F 3 .   ? -34.401 3.665   -46.027 1.00 50.43 ? 1639 HOH B O     1 
HETATM 4111 O O     . HOH F 3 .   ? -21.966 1.729   -17.833 1.00 33.36 ? 1640 HOH B O     1 
HETATM 4112 O O     . HOH F 3 .   ? -38.653 25.088  -19.843 1.00 44.74 ? 1641 HOH B O     1 
HETATM 4113 O O     . HOH F 3 .   ? -26.643 20.182  -46.922 1.00 38.63 ? 1642 HOH B O     1 
HETATM 4114 O O     . HOH F 3 .   ? -20.024 2.618   -15.561 1.00 46.31 ? 1643 HOH B O     1 
HETATM 4115 O O     . HOH F 3 .   ? -6.285  17.297  -39.551 1.00 43.37 ? 1644 HOH B O     1 
HETATM 4116 O O     . HOH F 3 .   ? -28.769 20.243  -38.875 1.00 31.69 ? 1645 HOH B O     1 
HETATM 4117 O O     . HOH F 3 .   ? -36.223 26.693  -39.979 1.00 38.50 ? 1646 HOH B O     1 
HETATM 4118 O O     . HOH F 3 .   ? -12.315 32.552  -28.486 1.00 44.37 ? 1647 HOH B O     1 
HETATM 4119 O O     . HOH F 3 .   ? -31.962 34.482  -27.805 1.00 49.00 ? 1648 HOH B O     1 
HETATM 4120 O O     . HOH F 3 .   ? -13.652 27.530  -18.901 1.00 48.73 ? 1649 HOH B O     1 
HETATM 4121 O O     . HOH F 3 .   ? -13.844 3.811   -42.569 1.00 35.11 ? 1650 HOH B O     1 
HETATM 4122 O O     . HOH F 3 .   ? -32.235 18.144  -42.183 1.00 48.61 ? 1651 HOH B O     1 
HETATM 4123 O O     . HOH F 3 .   ? -44.161 16.295  -26.570 1.00 34.79 ? 1652 HOH B O     1 
HETATM 4124 O O     . HOH F 3 .   ? -44.118 29.247  -23.687 1.00 43.72 ? 1653 HOH B O     1 
HETATM 4125 O O     . HOH F 3 .   ? -48.798 30.168  -32.627 1.00 45.03 ? 1654 HOH B O     1 
HETATM 4126 O O     . HOH F 3 .   ? -16.479 19.540  -8.768  1.00 42.26 ? 1655 HOH B O     1 
HETATM 4127 O O     . HOH F 3 .   ? -10.106 28.827  -24.200 1.00 51.22 ? 1656 HOH B O     1 
HETATM 4128 O O     . HOH F 3 .   ? -35.999 5.195   -43.350 1.00 27.89 ? 1657 HOH B O     1 
HETATM 4129 O O     . HOH F 3 .   ? -43.262 33.874  -30.173 1.00 46.20 ? 1658 HOH B O     1 
HETATM 4130 O O     . HOH F 3 .   ? -7.821  14.644  -35.306 1.00 38.52 ? 1659 HOH B O     1 
HETATM 4131 O O     . HOH F 3 .   ? -41.035 32.880  -30.174 1.00 43.67 ? 1660 HOH B O     1 
HETATM 4132 O O     . HOH F 3 .   ? -31.617 -3.104  -26.366 1.00 40.28 ? 1661 HOH B O     1 
HETATM 4133 O O     . HOH F 3 .   ? -17.488 -4.569  -37.004 1.00 42.05 ? 1662 HOH B O     1 
HETATM 4134 O O     . HOH F 3 .   ? -35.002 6.466   -31.205 1.00 58.65 ? 1663 HOH B O     1 
HETATM 4135 O O     . HOH F 3 .   ? -4.449  22.345  -13.275 1.00 38.28 ? 1664 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -17 ?   ?   ?   A . n 
A 1 2   GLY 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   SER 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  HIS 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  SER 12  -6  ?   ?   ?   A . n 
A 1 13  GLY 13  -5  ?   ?   ?   A . n 
A 1 14  LEU 14  -4  ?   ?   ?   A . n 
A 1 15  VAL 15  -3  ?   ?   ?   A . n 
A 1 16  PRO 16  -2  ?   ?   ?   A . n 
A 1 17  ARG 17  -1  -1  ARG ARG A . n 
A 1 18  GLY 18  0   0   GLY GLY A . n 
A 1 19  SER 19  1   1   SER SER A . n 
A 1 20  THR 20  2   2   THR THR A . n 
A 1 21  SER 21  3   3   SER SER A . n 
A 1 22  GLU 22  4   4   GLU GLU A . n 
A 1 23  VAL 23  5   5   VAL VAL A . n 
A 1 24  ILE 24  6   6   ILE ILE A . n 
A 1 25  GLU 25  7   7   GLU GLU A . n 
A 1 26  ASP 26  8   8   ASP ASP A . n 
A 1 27  GLU 27  9   9   GLU GLU A . n 
A 1 28  LYS 28  10  10  LYS LYS A . n 
A 1 29  GLN 29  11  11  GLN GLN A . n 
A 1 30  PHE 30  12  12  PHE PHE A . n 
A 1 31  TYR 31  13  13  TYR TYR A . n 
A 1 32  SER 32  14  14  SER SER A . n 
A 1 33  LYS 33  15  15  LYS LYS A . n 
A 1 34  ALA 34  16  16  ALA ALA A . n 
A 1 35  LYS 35  17  17  LYS LYS A . n 
A 1 36  THR 36  18  18  THR THR A . n 
A 1 37  TYR 37  19  19  TYR TYR A . n 
A 1 38  TRP 38  20  20  TRP TRP A . n 
A 1 39  LYS 39  21  21  LYS LYS A . n 
A 1 40  GLN 40  22  22  GLN GLN A . n 
A 1 41  ILE 41  23  23  ILE ILE A . n 
A 1 42  PRO 42  24  24  PRO PRO A . n 
A 1 43  PRO 43  25  25  PRO PRO A . n 
A 1 44  THR 44  26  26  THR THR A . n 
A 1 45  VAL 45  27  27  VAL VAL A . n 
A 1 46  ASP 46  28  28  ASP ASP A . n 
A 1 47  GLY 47  29  29  GLY GLY A . n 
A 1 48  MET 48  30  30  MET MET A . n 
A 1 49  LEU 49  31  31  LEU LEU A . n 
A 1 50  GLY 50  32  32  GLY GLY A . n 
A 1 51  GLY 51  33  33  GLY GLY A . n 
A 1 52  TYR 52  34  34  TYR TYR A . n 
A 1 53  GLY 53  35  35  GLY GLY A . n 
A 1 54  HIS 54  36  36  HIS HIS A . n 
A 1 55  ILE 55  37  37  ILE ILE A . n 
A 1 56  SER 56  38  38  SER SER A . n 
A 1 57  SER 57  39  39  SER SER A . n 
A 1 58  ILE 58  40  40  ILE ILE A . n 
A 1 59  ASP 59  41  41  ASP ASP A . n 
A 1 60  ILE 60  42  42  ILE ILE A . n 
A 1 61  ASN 61  43  43  ASN ASN A . n 
A 1 62  SER 62  44  44  SER SER A . n 
A 1 63  SER 63  45  45  SER SER A . n 
A 1 64  ARG 64  46  46  ARG ARG A . n 
A 1 65  LYS 65  47  47  LYS LYS A . n 
A 1 66  PHE 66  48  48  PHE PHE A . n 
A 1 67  LEU 67  49  49  LEU LEU A . n 
A 1 68  GLN 68  50  50  GLN GLN A . n 
A 1 69  ARG 69  51  51  ARG ARG A . n 
A 1 70  PHE 70  52  52  PHE PHE A . n 
A 1 71  LEU 71  53  53  LEU LEU A . n 
A 1 72  ARG 72  54  54  ARG ARG A . n 
A 1 73  GLU 73  56  ?   ?   ?   A . n 
A 1 74  GLY 74  57  ?   ?   ?   A . n 
A 1 75  PRO 75  58  ?   ?   ?   A . n 
A 1 76  ASN 76  59  ?   ?   ?   A . n 
A 1 77  LYS 77  60  60  LYS LYS A . n 
A 1 78  THR 78  61  61  THR THR A . n 
A 1 79  GLY 79  62  62  GLY GLY A . n 
A 1 80  THR 80  63  63  THR THR A . n 
A 1 81  SER 81  64  64  SER SER A . n 
A 1 82  CYS 82  65  65  CYS CYS A . n 
A 1 83  ALA 83  66  66  ALA ALA A . n 
A 1 84  LEU 84  67  67  LEU LEU A . n 
A 1 85  ASP 85  68  68  ASP ASP A . n 
A 1 86  CYS 86  69  69  CYS CYS A . n 
A 1 87  GLY 87  70  70  GLY GLY A . n 
A 1 88  ALA 88  71  71  ALA ALA A . n 
A 1 89  GLY 89  72  72  GLY GLY A . n 
A 1 90  ILE 90  73  73  ILE ILE A . n 
A 1 91  GLY 91  74  74  GLY GLY A . n 
A 1 92  ARG 92  75  75  ARG ARG A . n 
A 1 93  ILE 93  76  76  ILE ILE A . n 
A 1 94  THR 94  77  77  THR THR A . n 
A 1 95  LYS 95  78  78  LYS LYS A . n 
A 1 96  ARG 96  79  79  ARG ARG A . n 
A 1 97  LEU 97  80  80  LEU LEU A . n 
A 1 98  LEU 98  81  81  LEU LEU A . n 
A 1 99  LEU 99  82  82  LEU LEU A . n 
A 1 100 PRO 100 83  83  PRO PRO A . n 
A 1 101 LEU 101 84  84  LEU LEU A . n 
A 1 102 PHE 102 85  85  PHE PHE A . n 
A 1 103 ARG 103 86  86  ARG ARG A . n 
A 1 104 GLU 104 87  87  GLU GLU A . n 
A 1 105 VAL 105 88  88  VAL VAL A . n 
A 1 106 ASP 106 89  89  ASP ASP A . n 
A 1 107 MET 107 90  90  MET MET A . n 
A 1 108 VAL 108 91  91  VAL VAL A . n 
A 1 109 ASP 109 92  92  ASP ASP A . n 
A 1 110 ILE 110 93  93  ILE ILE A . n 
A 1 111 THR 111 94  94  THR THR A . n 
A 1 112 GLU 112 95  95  GLU GLU A . n 
A 1 113 ASP 113 96  96  ASP ASP A . n 
A 1 114 PHE 114 97  97  PHE PHE A . n 
A 1 115 LEU 115 98  98  LEU LEU A . n 
A 1 116 VAL 116 99  99  VAL VAL A . n 
A 1 117 GLN 117 100 100 GLN GLN A . n 
A 1 118 ALA 118 101 101 ALA ALA A . n 
A 1 119 LYS 119 102 102 LYS LYS A . n 
A 1 120 THR 120 103 103 THR THR A . n 
A 1 121 TYR 121 104 104 TYR TYR A . n 
A 1 122 LEU 122 105 105 LEU LEU A . n 
A 1 123 GLY 123 106 106 GLY GLY A . n 
A 1 124 GLU 124 107 107 GLU GLU A . n 
A 1 125 GLU 125 108 108 GLU GLU A . n 
A 1 126 GLY 126 109 109 GLY GLY A . n 
A 1 127 LYS 127 110 110 LYS LYS A . n 
A 1 128 ARG 128 111 111 ARG ARG A . n 
A 1 129 VAL 129 112 112 VAL VAL A . n 
A 1 130 ARG 130 113 113 ARG ARG A . n 
A 1 131 ASN 131 114 114 ASN ASN A . n 
A 1 132 TYR 132 115 115 TYR TYR A . n 
A 1 133 PHE 133 116 116 PHE PHE A . n 
A 1 134 CYS 134 117 117 CYS CYS A . n 
A 1 135 CYS 135 118 118 CYS CYS A . n 
A 1 136 GLY 136 119 119 GLY GLY A . n 
A 1 137 LEU 137 120 120 LEU LEU A . n 
A 1 138 GLN 138 121 121 GLN GLN A . n 
A 1 139 ASP 139 122 122 ASP ASP A . n 
A 1 140 PHE 140 123 123 PHE PHE A . n 
A 1 141 THR 141 124 124 THR THR A . n 
A 1 142 PRO 142 125 125 PRO PRO A . n 
A 1 143 GLU 143 126 126 GLU GLU A . n 
A 1 144 PRO 144 127 127 PRO PRO A . n 
A 1 145 ASP 145 128 128 ASP ASP A . n 
A 1 146 SER 146 129 129 SER SER A . n 
A 1 147 TYR 147 130 130 TYR TYR A . n 
A 1 148 ASP 148 131 131 ASP ASP A . n 
A 1 149 VAL 149 132 132 VAL VAL A . n 
A 1 150 ILE 150 133 133 ILE ILE A . n 
A 1 151 TRP 151 134 134 TRP TRP A . n 
A 1 152 ILE 152 135 135 ILE ILE A . n 
A 1 153 GLN 153 136 136 GLN GLN A . n 
A 1 154 TRP 154 137 137 TRP TRP A . n 
A 1 155 VAL 155 138 138 VAL VAL A . n 
A 1 156 ILE 156 139 139 ILE ILE A . n 
A 1 157 GLY 157 140 140 GLY GLY A . n 
A 1 158 HIS 158 141 141 HIS HIS A . n 
A 1 159 LEU 159 142 142 LEU LEU A . n 
A 1 160 THR 160 143 143 THR THR A . n 
A 1 161 ASP 161 144 144 ASP ASP A . n 
A 1 162 GLN 162 145 145 GLN GLN A . n 
A 1 163 HIS 163 146 146 HIS HIS A . n 
A 1 164 LEU 164 147 147 LEU LEU A . n 
A 1 165 ALA 165 148 148 ALA ALA A . n 
A 1 166 GLU 166 149 149 GLU GLU A . n 
A 1 167 PHE 167 150 150 PHE PHE A . n 
A 1 168 LEU 168 151 151 LEU LEU A . n 
A 1 169 ARG 169 152 152 ARG ARG A . n 
A 1 170 ARG 170 153 153 ARG ARG A . n 
A 1 171 CYS 171 154 154 CYS CYS A . n 
A 1 172 LYS 172 155 155 LYS LYS A . n 
A 1 173 GLY 173 156 156 GLY GLY A . n 
A 1 174 SER 174 157 157 SER SER A . n 
A 1 175 LEU 175 158 158 LEU LEU A . n 
A 1 176 ARG 176 159 159 ARG ARG A . n 
A 1 177 PRO 177 160 160 PRO PRO A . n 
A 1 178 ASN 178 161 161 ASN ASN A . n 
A 1 179 GLY 179 162 162 GLY GLY A . n 
A 1 180 ILE 180 163 163 ILE ILE A . n 
A 1 181 ILE 181 164 164 ILE ILE A . n 
A 1 182 VAL 182 165 165 VAL VAL A . n 
A 1 183 ILE 183 166 166 ILE ILE A . n 
A 1 184 LYS 184 167 167 LYS LYS A . n 
A 1 185 ASP 185 168 168 ASP ASP A . n 
A 1 186 ASN 186 169 169 ASN ASN A . n 
A 1 187 MET 187 170 170 MET MET A . n 
A 1 188 ALA 188 171 171 ALA ALA A . n 
A 1 189 GLN 189 172 172 GLN GLN A . n 
A 1 190 GLU 190 173 173 GLU GLU A . n 
A 1 191 GLY 191 174 174 GLY GLY A . n 
A 1 192 VAL 192 175 175 VAL VAL A . n 
A 1 193 ILE 193 176 176 ILE ILE A . n 
A 1 194 LEU 194 177 177 LEU LEU A . n 
A 1 195 ASP 195 178 178 ASP ASP A . n 
A 1 196 ASP 196 179 179 ASP ASP A . n 
A 1 197 VAL 197 180 180 VAL VAL A . n 
A 1 198 ASP 198 181 181 ASP ASP A . n 
A 1 199 SER 199 182 182 SER SER A . n 
A 1 200 SER 200 183 183 SER SER A . n 
A 1 201 VAL 201 184 184 VAL VAL A . n 
A 1 202 CYS 202 185 185 CYS CYS A . n 
A 1 203 ARG 203 186 186 ARG ARG A . n 
A 1 204 ASP 204 187 187 ASP ASP A . n 
A 1 205 LEU 205 188 188 LEU LEU A . n 
A 1 206 ASP 206 189 189 ASP ASP A . n 
A 1 207 VAL 207 190 190 VAL VAL A . n 
A 1 208 VAL 208 191 191 VAL VAL A . n 
A 1 209 ARG 209 192 192 ARG ARG A . n 
A 1 210 ARG 210 193 193 ARG ARG A . n 
A 1 211 ILE 211 194 194 ILE ILE A . n 
A 1 212 ILE 212 195 195 ILE ILE A . n 
A 1 213 CYS 213 196 196 CYS CYS A . n 
A 1 214 SER 214 197 197 SER SER A . n 
A 1 215 ALA 215 198 198 ALA ALA A . n 
A 1 216 GLY 216 199 199 GLY GLY A . n 
A 1 217 LEU 217 200 200 LEU LEU A . n 
A 1 218 SER 218 201 201 SER SER A . n 
A 1 219 LEU 219 202 202 LEU LEU A . n 
A 1 220 LEU 220 203 203 LEU LEU A . n 
A 1 221 ALA 221 204 204 ALA ALA A . n 
A 1 222 GLU 222 205 205 GLU GLU A . n 
A 1 223 GLU 223 206 206 GLU GLU A . n 
A 1 224 ARG 224 207 207 ARG ARG A . n 
A 1 225 GLN 225 208 208 GLN GLN A . n 
A 1 226 GLU 226 209 209 GLU GLU A . n 
A 1 227 ASN 227 210 210 ASN ASN A . n 
A 1 228 LEU 228 211 211 LEU LEU A . n 
A 1 229 PRO 229 212 212 PRO PRO A . n 
A 1 230 ASP 230 213 213 ASP ASP A . n 
A 1 231 GLU 231 214 214 GLU GLU A . n 
A 1 232 ILE 232 215 215 ILE ILE A . n 
A 1 233 TYR 233 216 216 TYR TYR A . n 
A 1 234 HIS 234 217 217 HIS HIS A . n 
A 1 235 VAL 235 218 218 VAL VAL A . n 
A 1 236 TYR 236 219 219 TYR TYR A . n 
A 1 237 SER 237 220 220 SER SER A . n 
A 1 238 PHE 238 221 221 PHE PHE A . n 
A 1 239 ALA 239 222 222 ALA ALA A . n 
A 1 240 LEU 240 223 223 LEU LEU A . n 
A 1 241 ARG 241 224 224 ARG ARG A . n 
B 1 1   MET 1   -17 ?   ?   ?   B . n 
B 1 2   GLY 2   -16 ?   ?   ?   B . n 
B 1 3   SER 3   -15 ?   ?   ?   B . n 
B 1 4   SER 4   -14 ?   ?   ?   B . n 
B 1 5   HIS 5   -13 ?   ?   ?   B . n 
B 1 6   HIS 6   -12 ?   ?   ?   B . n 
B 1 7   HIS 7   -11 ?   ?   ?   B . n 
B 1 8   HIS 8   -10 ?   ?   ?   B . n 
B 1 9   HIS 9   -9  ?   ?   ?   B . n 
B 1 10  HIS 10  -8  ?   ?   ?   B . n 
B 1 11  SER 11  -7  ?   ?   ?   B . n 
B 1 12  SER 12  -6  ?   ?   ?   B . n 
B 1 13  GLY 13  -5  ?   ?   ?   B . n 
B 1 14  LEU 14  -4  ?   ?   ?   B . n 
B 1 15  VAL 15  -3  ?   ?   ?   B . n 
B 1 16  PRO 16  -2  ?   ?   ?   B . n 
B 1 17  ARG 17  -1  -1  ARG ARG B . n 
B 1 18  GLY 18  0   0   GLY GLY B . n 
B 1 19  SER 19  1   1   SER SER B . n 
B 1 20  THR 20  2   2   THR THR B . n 
B 1 21  SER 21  3   3   SER SER B . n 
B 1 22  GLU 22  4   4   GLU GLU B . n 
B 1 23  VAL 23  5   5   VAL VAL B . n 
B 1 24  ILE 24  6   6   ILE ILE B . n 
B 1 25  GLU 25  7   7   GLU GLU B . n 
B 1 26  ASP 26  8   8   ASP ASP B . n 
B 1 27  GLU 27  9   9   GLU GLU B . n 
B 1 28  LYS 28  10  10  LYS LYS B . n 
B 1 29  GLN 29  11  11  GLN GLN B . n 
B 1 30  PHE 30  12  12  PHE PHE B . n 
B 1 31  TYR 31  13  13  TYR TYR B . n 
B 1 32  SER 32  14  14  SER SER B . n 
B 1 33  LYS 33  15  15  LYS LYS B . n 
B 1 34  ALA 34  16  16  ALA ALA B . n 
B 1 35  LYS 35  17  17  LYS LYS B . n 
B 1 36  THR 36  18  18  THR THR B . n 
B 1 37  TYR 37  19  19  TYR TYR B . n 
B 1 38  TRP 38  20  20  TRP TRP B . n 
B 1 39  LYS 39  21  21  LYS LYS B . n 
B 1 40  GLN 40  22  22  GLN GLN B . n 
B 1 41  ILE 41  23  23  ILE ILE B . n 
B 1 42  PRO 42  24  24  PRO PRO B . n 
B 1 43  PRO 43  25  25  PRO PRO B . n 
B 1 44  THR 44  26  26  THR THR B . n 
B 1 45  VAL 45  27  27  VAL VAL B . n 
B 1 46  ASP 46  28  28  ASP ASP B . n 
B 1 47  GLY 47  29  29  GLY GLY B . n 
B 1 48  MET 48  30  30  MET MET B . n 
B 1 49  LEU 49  31  31  LEU LEU B . n 
B 1 50  GLY 50  32  32  GLY GLY B . n 
B 1 51  GLY 51  33  33  GLY GLY B . n 
B 1 52  TYR 52  34  34  TYR TYR B . n 
B 1 53  GLY 53  35  35  GLY GLY B . n 
B 1 54  HIS 54  36  36  HIS HIS B . n 
B 1 55  ILE 55  37  37  ILE ILE B . n 
B 1 56  SER 56  38  38  SER SER B . n 
B 1 57  SER 57  39  39  SER SER B . n 
B 1 58  ILE 58  40  40  ILE ILE B . n 
B 1 59  ASP 59  41  41  ASP ASP B . n 
B 1 60  ILE 60  42  42  ILE ILE B . n 
B 1 61  ASN 61  43  43  ASN ASN B . n 
B 1 62  SER 62  44  44  SER SER B . n 
B 1 63  SER 63  45  45  SER SER B . n 
B 1 64  ARG 64  46  46  ARG ARG B . n 
B 1 65  LYS 65  47  47  LYS LYS B . n 
B 1 66  PHE 66  48  48  PHE PHE B . n 
B 1 67  LEU 67  49  49  LEU LEU B . n 
B 1 68  GLN 68  50  50  GLN GLN B . n 
B 1 69  ARG 69  51  51  ARG ARG B . n 
B 1 70  PHE 70  52  52  PHE PHE B . n 
B 1 71  LEU 71  53  53  LEU LEU B . n 
B 1 72  ARG 72  54  54  ARG ARG B . n 
B 1 73  GLU 73  56  ?   ?   ?   B . n 
B 1 74  GLY 74  57  ?   ?   ?   B . n 
B 1 75  PRO 75  58  ?   ?   ?   B . n 
B 1 76  ASN 76  59  ?   ?   ?   B . n 
B 1 77  LYS 77  60  60  LYS LYS B . n 
B 1 78  THR 78  61  61  THR THR B . n 
B 1 79  GLY 79  62  62  GLY GLY B . n 
B 1 80  THR 80  63  63  THR THR B . n 
B 1 81  SER 81  64  64  SER SER B . n 
B 1 82  CYS 82  65  65  CYS CYS B . n 
B 1 83  ALA 83  66  66  ALA ALA B . n 
B 1 84  LEU 84  67  67  LEU LEU B . n 
B 1 85  ASP 85  68  68  ASP ASP B . n 
B 1 86  CYS 86  69  69  CYS CYS B . n 
B 1 87  GLY 87  70  70  GLY GLY B . n 
B 1 88  ALA 88  71  71  ALA ALA B . n 
B 1 89  GLY 89  72  72  GLY GLY B . n 
B 1 90  ILE 90  73  73  ILE ILE B . n 
B 1 91  GLY 91  74  74  GLY GLY B . n 
B 1 92  ARG 92  75  75  ARG ARG B . n 
B 1 93  ILE 93  76  76  ILE ILE B . n 
B 1 94  THR 94  77  77  THR THR B . n 
B 1 95  LYS 95  78  78  LYS LYS B . n 
B 1 96  ARG 96  79  79  ARG ARG B . n 
B 1 97  LEU 97  80  80  LEU LEU B . n 
B 1 98  LEU 98  81  81  LEU LEU B . n 
B 1 99  LEU 99  82  82  LEU LEU B . n 
B 1 100 PRO 100 83  83  PRO PRO B . n 
B 1 101 LEU 101 84  84  LEU LEU B . n 
B 1 102 PHE 102 85  85  PHE PHE B . n 
B 1 103 ARG 103 86  86  ARG ARG B . n 
B 1 104 GLU 104 87  87  GLU GLU B . n 
B 1 105 VAL 105 88  88  VAL VAL B . n 
B 1 106 ASP 106 89  89  ASP ASP B . n 
B 1 107 MET 107 90  90  MET MET B . n 
B 1 108 VAL 108 91  91  VAL VAL B . n 
B 1 109 ASP 109 92  92  ASP ASP B . n 
B 1 110 ILE 110 93  93  ILE ILE B . n 
B 1 111 THR 111 94  94  THR THR B . n 
B 1 112 GLU 112 95  95  GLU GLU B . n 
B 1 113 ASP 113 96  96  ASP ASP B . n 
B 1 114 PHE 114 97  97  PHE PHE B . n 
B 1 115 LEU 115 98  98  LEU LEU B . n 
B 1 116 VAL 116 99  99  VAL VAL B . n 
B 1 117 GLN 117 100 100 GLN GLN B . n 
B 1 118 ALA 118 101 101 ALA ALA B . n 
B 1 119 LYS 119 102 102 LYS LYS B . n 
B 1 120 THR 120 103 103 THR THR B . n 
B 1 121 TYR 121 104 104 TYR TYR B . n 
B 1 122 LEU 122 105 105 LEU LEU B . n 
B 1 123 GLY 123 106 106 GLY GLY B . n 
B 1 124 GLU 124 107 107 GLU GLU B . n 
B 1 125 GLU 125 108 108 GLU GLU B . n 
B 1 126 GLY 126 109 109 GLY GLY B . n 
B 1 127 LYS 127 110 110 LYS LYS B . n 
B 1 128 ARG 128 111 111 ARG ARG B . n 
B 1 129 VAL 129 112 112 VAL VAL B . n 
B 1 130 ARG 130 113 113 ARG ARG B . n 
B 1 131 ASN 131 114 114 ASN ASN B . n 
B 1 132 TYR 132 115 115 TYR TYR B . n 
B 1 133 PHE 133 116 116 PHE PHE B . n 
B 1 134 CYS 134 117 117 CYS CYS B . n 
B 1 135 CYS 135 118 118 CYS CYS B . n 
B 1 136 GLY 136 119 119 GLY GLY B . n 
B 1 137 LEU 137 120 120 LEU LEU B . n 
B 1 138 GLN 138 121 121 GLN GLN B . n 
B 1 139 ASP 139 122 122 ASP ASP B . n 
B 1 140 PHE 140 123 123 PHE PHE B . n 
B 1 141 THR 141 124 124 THR THR B . n 
B 1 142 PRO 142 125 125 PRO PRO B . n 
B 1 143 GLU 143 126 126 GLU GLU B . n 
B 1 144 PRO 144 127 127 PRO PRO B . n 
B 1 145 ASP 145 128 128 ASP ASP B . n 
B 1 146 SER 146 129 129 SER SER B . n 
B 1 147 TYR 147 130 130 TYR TYR B . n 
B 1 148 ASP 148 131 131 ASP ASP B . n 
B 1 149 VAL 149 132 132 VAL VAL B . n 
B 1 150 ILE 150 133 133 ILE ILE B . n 
B 1 151 TRP 151 134 134 TRP TRP B . n 
B 1 152 ILE 152 135 135 ILE ILE B . n 
B 1 153 GLN 153 136 136 GLN GLN B . n 
B 1 154 TRP 154 137 137 TRP TRP B . n 
B 1 155 VAL 155 138 138 VAL VAL B . n 
B 1 156 ILE 156 139 139 ILE ILE B . n 
B 1 157 GLY 157 140 140 GLY GLY B . n 
B 1 158 HIS 158 141 141 HIS HIS B . n 
B 1 159 LEU 159 142 142 LEU LEU B . n 
B 1 160 THR 160 143 143 THR THR B . n 
B 1 161 ASP 161 144 144 ASP ASP B . n 
B 1 162 GLN 162 145 145 GLN GLN B . n 
B 1 163 HIS 163 146 146 HIS HIS B . n 
B 1 164 LEU 164 147 147 LEU LEU B . n 
B 1 165 ALA 165 148 148 ALA ALA B . n 
B 1 166 GLU 166 149 149 GLU GLU B . n 
B 1 167 PHE 167 150 150 PHE PHE B . n 
B 1 168 LEU 168 151 151 LEU LEU B . n 
B 1 169 ARG 169 152 152 ARG ARG B . n 
B 1 170 ARG 170 153 153 ARG ARG B . n 
B 1 171 CYS 171 154 154 CYS CYS B . n 
B 1 172 LYS 172 155 155 LYS LYS B . n 
B 1 173 GLY 173 156 156 GLY GLY B . n 
B 1 174 SER 174 157 157 SER SER B . n 
B 1 175 LEU 175 158 158 LEU LEU B . n 
B 1 176 ARG 176 159 159 ARG ARG B . n 
B 1 177 PRO 177 160 160 PRO PRO B . n 
B 1 178 ASN 178 161 161 ASN ASN B . n 
B 1 179 GLY 179 162 162 GLY GLY B . n 
B 1 180 ILE 180 163 163 ILE ILE B . n 
B 1 181 ILE 181 164 164 ILE ILE B . n 
B 1 182 VAL 182 165 165 VAL VAL B . n 
B 1 183 ILE 183 166 166 ILE ILE B . n 
B 1 184 LYS 184 167 167 LYS LYS B . n 
B 1 185 ASP 185 168 168 ASP ASP B . n 
B 1 186 ASN 186 169 169 ASN ASN B . n 
B 1 187 MET 187 170 170 MET MET B . n 
B 1 188 ALA 188 171 171 ALA ALA B . n 
B 1 189 GLN 189 172 172 GLN GLN B . n 
B 1 190 GLU 190 173 173 GLU GLU B . n 
B 1 191 GLY 191 174 174 GLY GLY B . n 
B 1 192 VAL 192 175 175 VAL VAL B . n 
B 1 193 ILE 193 176 176 ILE ILE B . n 
B 1 194 LEU 194 177 177 LEU LEU B . n 
B 1 195 ASP 195 178 178 ASP ASP B . n 
B 1 196 ASP 196 179 179 ASP ASP B . n 
B 1 197 VAL 197 180 180 VAL VAL B . n 
B 1 198 ASP 198 181 181 ASP ASP B . n 
B 1 199 SER 199 182 182 SER SER B . n 
B 1 200 SER 200 183 183 SER SER B . n 
B 1 201 VAL 201 184 184 VAL VAL B . n 
B 1 202 CYS 202 185 185 CYS CYS B . n 
B 1 203 ARG 203 186 186 ARG ARG B . n 
B 1 204 ASP 204 187 187 ASP ASP B . n 
B 1 205 LEU 205 188 188 LEU LEU B . n 
B 1 206 ASP 206 189 189 ASP ASP B . n 
B 1 207 VAL 207 190 190 VAL VAL B . n 
B 1 208 VAL 208 191 191 VAL VAL B . n 
B 1 209 ARG 209 192 192 ARG ARG B . n 
B 1 210 ARG 210 193 193 ARG ARG B . n 
B 1 211 ILE 211 194 194 ILE ILE B . n 
B 1 212 ILE 212 195 195 ILE ILE B . n 
B 1 213 CYS 213 196 196 CYS CYS B . n 
B 1 214 SER 214 197 197 SER SER B . n 
B 1 215 ALA 215 198 198 ALA ALA B . n 
B 1 216 GLY 216 199 199 GLY GLY B . n 
B 1 217 LEU 217 200 200 LEU LEU B . n 
B 1 218 SER 218 201 201 SER SER B . n 
B 1 219 LEU 219 202 202 LEU LEU B . n 
B 1 220 LEU 220 203 203 LEU LEU B . n 
B 1 221 ALA 221 204 204 ALA ALA B . n 
B 1 222 GLU 222 205 205 GLU GLU B . n 
B 1 223 GLU 223 206 206 GLU GLU B . n 
B 1 224 ARG 224 207 207 ARG ARG B . n 
B 1 225 GLN 225 208 208 GLN GLN B . n 
B 1 226 GLU 226 209 209 GLU GLU B . n 
B 1 227 ASN 227 210 210 ASN ASN B . n 
B 1 228 LEU 228 211 211 LEU LEU B . n 
B 1 229 PRO 229 212 212 PRO PRO B . n 
B 1 230 ASP 230 213 213 ASP ASP B . n 
B 1 231 GLU 231 214 214 GLU GLU B . n 
B 1 232 ILE 232 215 215 ILE ILE B . n 
B 1 233 TYR 233 216 216 TYR TYR B . n 
B 1 234 HIS 234 217 217 HIS HIS B . n 
B 1 235 VAL 235 218 218 VAL VAL B . n 
B 1 236 TYR 236 219 219 TYR TYR B . n 
B 1 237 SER 237 220 220 SER SER B . n 
B 1 238 PHE 238 221 221 PHE PHE B . n 
B 1 239 ALA 239 222 222 ALA ALA B . n 
B 1 240 LEU 240 223 223 LEU LEU B . n 
B 1 241 ARG 241 224 224 ARG ARG B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SAH 1   1401 401 SAH SAH A . 
D 2 SAH 1   1402 402 SAH SAH B . 
E 3 HOH 1   1402 1   HOH HOH A . 
E 3 HOH 2   1403 2   HOH HOH A . 
E 3 HOH 3   1404 7   HOH HOH A . 
E 3 HOH 4   1405 9   HOH HOH A . 
E 3 HOH 5   1406 10  HOH HOH A . 
E 3 HOH 6   1407 12  HOH HOH A . 
E 3 HOH 7   1408 13  HOH HOH A . 
E 3 HOH 8   1409 16  HOH HOH A . 
E 3 HOH 9   1410 18  HOH HOH A . 
E 3 HOH 10  1411 19  HOH HOH A . 
E 3 HOH 11  1412 20  HOH HOH A . 
E 3 HOH 12  1413 24  HOH HOH A . 
E 3 HOH 13  1414 26  HOH HOH A . 
E 3 HOH 14  1415 28  HOH HOH A . 
E 3 HOH 15  1416 29  HOH HOH A . 
E 3 HOH 16  1417 31  HOH HOH A . 
E 3 HOH 17  1418 34  HOH HOH A . 
E 3 HOH 18  1419 35  HOH HOH A . 
E 3 HOH 19  1420 36  HOH HOH A . 
E 3 HOH 20  1421 37  HOH HOH A . 
E 3 HOH 21  1422 38  HOH HOH A . 
E 3 HOH 22  1423 44  HOH HOH A . 
E 3 HOH 23  1424 45  HOH HOH A . 
E 3 HOH 24  1425 48  HOH HOH A . 
E 3 HOH 25  1426 50  HOH HOH A . 
E 3 HOH 26  1427 51  HOH HOH A . 
E 3 HOH 27  1428 52  HOH HOH A . 
E 3 HOH 28  1429 56  HOH HOH A . 
E 3 HOH 29  1430 58  HOH HOH A . 
E 3 HOH 30  1431 61  HOH HOH A . 
E 3 HOH 31  1432 63  HOH HOH A . 
E 3 HOH 32  1433 66  HOH HOH A . 
E 3 HOH 33  1434 68  HOH HOH A . 
E 3 HOH 34  1435 70  HOH HOH A . 
E 3 HOH 35  1436 71  HOH HOH A . 
E 3 HOH 36  1437 74  HOH HOH A . 
E 3 HOH 37  1438 75  HOH HOH A . 
E 3 HOH 38  1439 78  HOH HOH A . 
E 3 HOH 39  1440 81  HOH HOH A . 
E 3 HOH 40  1441 83  HOH HOH A . 
E 3 HOH 41  1442 87  HOH HOH A . 
E 3 HOH 42  1443 89  HOH HOH A . 
E 3 HOH 43  1444 90  HOH HOH A . 
E 3 HOH 44  1445 92  HOH HOH A . 
E 3 HOH 45  1446 94  HOH HOH A . 
E 3 HOH 46  1447 95  HOH HOH A . 
E 3 HOH 47  1448 96  HOH HOH A . 
E 3 HOH 48  1449 97  HOH HOH A . 
E 3 HOH 49  1450 98  HOH HOH A . 
E 3 HOH 50  1451 102 HOH HOH A . 
E 3 HOH 51  1452 103 HOH HOH A . 
E 3 HOH 52  1453 104 HOH HOH A . 
E 3 HOH 53  1454 107 HOH HOH A . 
E 3 HOH 54  1455 109 HOH HOH A . 
E 3 HOH 55  1456 111 HOH HOH A . 
E 3 HOH 56  1457 112 HOH HOH A . 
E 3 HOH 57  1458 113 HOH HOH A . 
E 3 HOH 58  1459 116 HOH HOH A . 
E 3 HOH 59  1460 117 HOH HOH A . 
E 3 HOH 60  1461 118 HOH HOH A . 
E 3 HOH 61  1462 119 HOH HOH A . 
E 3 HOH 62  1463 120 HOH HOH A . 
E 3 HOH 63  1464 127 HOH HOH A . 
E 3 HOH 64  1465 129 HOH HOH A . 
E 3 HOH 65  1466 131 HOH HOH A . 
E 3 HOH 66  1467 134 HOH HOH A . 
E 3 HOH 67  1468 135 HOH HOH A . 
E 3 HOH 68  1469 138 HOH HOH A . 
E 3 HOH 69  1470 140 HOH HOH A . 
E 3 HOH 70  1471 141 HOH HOH A . 
E 3 HOH 71  1472 143 HOH HOH A . 
E 3 HOH 72  1473 144 HOH HOH A . 
E 3 HOH 73  1474 145 HOH HOH A . 
E 3 HOH 74  1475 146 HOH HOH A . 
E 3 HOH 75  1476 147 HOH HOH A . 
E 3 HOH 76  1477 149 HOH HOH A . 
E 3 HOH 77  1478 150 HOH HOH A . 
E 3 HOH 78  1479 152 HOH HOH A . 
E 3 HOH 79  1480 156 HOH HOH A . 
E 3 HOH 80  1481 157 HOH HOH A . 
E 3 HOH 81  1482 158 HOH HOH A . 
E 3 HOH 82  1483 161 HOH HOH A . 
E 3 HOH 83  1484 163 HOH HOH A . 
E 3 HOH 84  1485 164 HOH HOH A . 
E 3 HOH 85  1486 167 HOH HOH A . 
E 3 HOH 86  1487 169 HOH HOH A . 
E 3 HOH 87  1488 170 HOH HOH A . 
E 3 HOH 88  1489 171 HOH HOH A . 
E 3 HOH 89  1490 173 HOH HOH A . 
E 3 HOH 90  1491 175 HOH HOH A . 
E 3 HOH 91  1492 183 HOH HOH A . 
E 3 HOH 92  1493 187 HOH HOH A . 
E 3 HOH 93  1494 191 HOH HOH A . 
E 3 HOH 94  1495 193 HOH HOH A . 
E 3 HOH 95  1496 194 HOH HOH A . 
E 3 HOH 96  1497 196 HOH HOH A . 
E 3 HOH 97  1498 199 HOH HOH A . 
E 3 HOH 98  1499 200 HOH HOH A . 
E 3 HOH 99  1500 201 HOH HOH A . 
E 3 HOH 100 1501 202 HOH HOH A . 
E 3 HOH 101 1502 203 HOH HOH A . 
E 3 HOH 102 1503 205 HOH HOH A . 
E 3 HOH 103 1504 206 HOH HOH A . 
E 3 HOH 104 1505 207 HOH HOH A . 
E 3 HOH 105 1506 209 HOH HOH A . 
E 3 HOH 106 1507 213 HOH HOH A . 
E 3 HOH 107 1508 217 HOH HOH A . 
E 3 HOH 108 1509 221 HOH HOH A . 
E 3 HOH 109 1510 222 HOH HOH A . 
E 3 HOH 110 1511 223 HOH HOH A . 
E 3 HOH 111 1512 224 HOH HOH A . 
E 3 HOH 112 1513 226 HOH HOH A . 
E 3 HOH 113 1514 227 HOH HOH A . 
E 3 HOH 114 1515 228 HOH HOH A . 
E 3 HOH 115 1516 230 HOH HOH A . 
E 3 HOH 116 1517 231 HOH HOH A . 
E 3 HOH 117 1518 232 HOH HOH A . 
E 3 HOH 118 1519 233 HOH HOH A . 
E 3 HOH 119 1520 235 HOH HOH A . 
E 3 HOH 120 1521 236 HOH HOH A . 
E 3 HOH 121 1522 239 HOH HOH A . 
E 3 HOH 122 1523 241 HOH HOH A . 
E 3 HOH 123 1524 242 HOH HOH A . 
E 3 HOH 124 1525 243 HOH HOH A . 
E 3 HOH 125 1526 246 HOH HOH A . 
E 3 HOH 126 1527 249 HOH HOH A . 
E 3 HOH 127 1528 251 HOH HOH A . 
E 3 HOH 128 1529 253 HOH HOH A . 
E 3 HOH 129 1530 254 HOH HOH A . 
E 3 HOH 130 1531 256 HOH HOH A . 
E 3 HOH 131 1532 257 HOH HOH A . 
E 3 HOH 132 1533 258 HOH HOH A . 
E 3 HOH 133 1534 259 HOH HOH A . 
E 3 HOH 134 1535 260 HOH HOH A . 
E 3 HOH 135 1536 261 HOH HOH A . 
E 3 HOH 136 1537 262 HOH HOH A . 
E 3 HOH 137 1538 263 HOH HOH A . 
E 3 HOH 138 1539 267 HOH HOH A . 
E 3 HOH 139 1540 270 HOH HOH A . 
E 3 HOH 140 1541 271 HOH HOH A . 
E 3 HOH 141 1542 274 HOH HOH A . 
E 3 HOH 142 1543 277 HOH HOH A . 
E 3 HOH 143 1544 279 HOH HOH A . 
E 3 HOH 144 1545 280 HOH HOH A . 
E 3 HOH 145 1546 286 HOH HOH A . 
E 3 HOH 146 1547 287 HOH HOH A . 
E 3 HOH 147 1548 288 HOH HOH A . 
E 3 HOH 148 1549 289 HOH HOH A . 
E 3 HOH 149 1550 290 HOH HOH A . 
E 3 HOH 150 1551 291 HOH HOH A . 
E 3 HOH 151 1552 293 HOH HOH A . 
E 3 HOH 152 1553 296 HOH HOH A . 
E 3 HOH 153 1554 297 HOH HOH A . 
E 3 HOH 154 1555 299 HOH HOH A . 
E 3 HOH 155 1556 301 HOH HOH A . 
E 3 HOH 156 1557 306 HOH HOH A . 
E 3 HOH 157 1558 308 HOH HOH A . 
E 3 HOH 158 1559 309 HOH HOH A . 
E 3 HOH 159 1560 311 HOH HOH A . 
E 3 HOH 160 1561 314 HOH HOH A . 
E 3 HOH 161 1562 317 HOH HOH A . 
E 3 HOH 162 1563 318 HOH HOH A . 
E 3 HOH 163 1564 319 HOH HOH A . 
E 3 HOH 164 1565 321 HOH HOH A . 
E 3 HOH 165 1566 328 HOH HOH A . 
E 3 HOH 166 1567 329 HOH HOH A . 
E 3 HOH 167 1568 332 HOH HOH A . 
E 3 HOH 168 1569 333 HOH HOH A . 
E 3 HOH 169 1570 335 HOH HOH A . 
E 3 HOH 170 1571 336 HOH HOH A . 
E 3 HOH 171 1572 337 HOH HOH A . 
E 3 HOH 172 1573 339 HOH HOH A . 
E 3 HOH 173 1574 342 HOH HOH A . 
E 3 HOH 174 1575 343 HOH HOH A . 
E 3 HOH 175 1576 346 HOH HOH A . 
E 3 HOH 176 1577 347 HOH HOH A . 
E 3 HOH 177 1578 348 HOH HOH A . 
E 3 HOH 178 1579 350 HOH HOH A . 
E 3 HOH 179 1580 351 HOH HOH A . 
E 3 HOH 180 1581 354 HOH HOH A . 
E 3 HOH 181 1582 355 HOH HOH A . 
E 3 HOH 182 1583 357 HOH HOH A . 
E 3 HOH 183 1584 358 HOH HOH A . 
E 3 HOH 184 1585 363 HOH HOH A . 
E 3 HOH 185 1586 364 HOH HOH A . 
E 3 HOH 186 1587 365 HOH HOH A . 
E 3 HOH 187 1588 367 HOH HOH A . 
E 3 HOH 188 1589 371 HOH HOH A . 
E 3 HOH 189 1590 375 HOH HOH A . 
E 3 HOH 190 1591 378 HOH HOH A . 
E 3 HOH 191 1592 379 HOH HOH A . 
E 3 HOH 192 1593 380 HOH HOH A . 
E 3 HOH 193 1594 382 HOH HOH A . 
E 3 HOH 194 1595 384 HOH HOH A . 
E 3 HOH 195 1596 391 HOH HOH A . 
E 3 HOH 196 1597 392 HOH HOH A . 
E 3 HOH 197 1598 393 HOH HOH A . 
E 3 HOH 198 1599 397 HOH HOH A . 
E 3 HOH 199 1600 398 HOH HOH A . 
E 3 HOH 200 1601 400 HOH HOH A . 
E 3 HOH 201 1602 403 HOH HOH A . 
E 3 HOH 202 1603 404 HOH HOH A . 
E 3 HOH 203 1604 405 HOH HOH A . 
E 3 HOH 204 1605 410 HOH HOH A . 
E 3 HOH 205 1606 411 HOH HOH A . 
E 3 HOH 206 1607 412 HOH HOH A . 
E 3 HOH 207 1608 414 HOH HOH A . 
E 3 HOH 208 1609 417 HOH HOH A . 
E 3 HOH 209 1610 418 HOH HOH A . 
E 3 HOH 210 1611 419 HOH HOH A . 
E 3 HOH 211 1612 420 HOH HOH A . 
E 3 HOH 212 1613 421 HOH HOH A . 
E 3 HOH 213 1614 425 HOH HOH A . 
E 3 HOH 214 1615 428 HOH HOH A . 
E 3 HOH 215 1616 431 HOH HOH A . 
E 3 HOH 216 1617 433 HOH HOH A . 
E 3 HOH 217 1618 435 HOH HOH A . 
E 3 HOH 218 1619 436 HOH HOH A . 
E 3 HOH 219 1620 440 HOH HOH A . 
E 3 HOH 220 1621 442 HOH HOH A . 
E 3 HOH 221 1622 443 HOH HOH A . 
E 3 HOH 222 1623 444 HOH HOH A . 
E 3 HOH 223 1624 447 HOH HOH A . 
E 3 HOH 224 1625 450 HOH HOH A . 
E 3 HOH 225 1626 451 HOH HOH A . 
E 3 HOH 226 1627 452 HOH HOH A . 
E 3 HOH 227 1628 453 HOH HOH A . 
E 3 HOH 228 1629 454 HOH HOH A . 
E 3 HOH 229 1630 455 HOH HOH A . 
E 3 HOH 230 1631 456 HOH HOH A . 
E 3 HOH 231 1632 457 HOH HOH A . 
E 3 HOH 232 1633 459 HOH HOH A . 
E 3 HOH 233 1634 462 HOH HOH A . 
E 3 HOH 234 1635 465 HOH HOH A . 
E 3 HOH 235 1636 466 HOH HOH A . 
E 3 HOH 236 1637 467 HOH HOH A . 
E 3 HOH 237 1638 468 HOH HOH A . 
E 3 HOH 238 1639 471 HOH HOH A . 
E 3 HOH 239 1640 473 HOH HOH A . 
E 3 HOH 240 1641 474 HOH HOH A . 
E 3 HOH 241 1642 475 HOH HOH A . 
E 3 HOH 242 1643 478 HOH HOH A . 
E 3 HOH 243 1644 480 HOH HOH A . 
E 3 HOH 244 1645 481 HOH HOH A . 
E 3 HOH 245 1646 484 HOH HOH A . 
E 3 HOH 246 1647 489 HOH HOH A . 
E 3 HOH 247 1648 491 HOH HOH A . 
E 3 HOH 248 1649 493 HOH HOH A . 
E 3 HOH 249 1650 496 HOH HOH A . 
E 3 HOH 250 1651 497 HOH HOH A . 
E 3 HOH 251 1652 498 HOH HOH A . 
E 3 HOH 252 1653 502 HOH HOH A . 
E 3 HOH 253 1654 504 HOH HOH A . 
E 3 HOH 254 1655 506 HOH HOH A . 
E 3 HOH 255 1656 507 HOH HOH A . 
E 3 HOH 256 1657 509 HOH HOH A . 
E 3 HOH 257 1658 510 HOH HOH A . 
E 3 HOH 258 1659 511 HOH HOH A . 
E 3 HOH 259 1660 515 HOH HOH A . 
E 3 HOH 260 1661 516 HOH HOH A . 
E 3 HOH 261 1662 518 HOH HOH A . 
E 3 HOH 262 1663 519 HOH HOH A . 
E 3 HOH 263 1664 520 HOH HOH A . 
E 3 HOH 264 1665 521 HOH HOH A . 
E 3 HOH 265 1666 522 HOH HOH A . 
E 3 HOH 266 1667 523 HOH HOH A . 
E 3 HOH 267 1668 525 HOH HOH A . 
E 3 HOH 268 1669 527 HOH HOH A . 
E 3 HOH 269 1670 529 HOH HOH A . 
E 3 HOH 270 1671 531 HOH HOH A . 
E 3 HOH 271 1672 532 HOH HOH A . 
E 3 HOH 272 1673 534 HOH HOH A . 
E 3 HOH 273 1674 535 HOH HOH A . 
E 3 HOH 274 1675 537 HOH HOH A . 
E 3 HOH 275 1676 538 HOH HOH A . 
E 3 HOH 276 1677 540 HOH HOH A . 
E 3 HOH 277 1678 541 HOH HOH A . 
E 3 HOH 278 1679 546 HOH HOH A . 
E 3 HOH 279 1680 547 HOH HOH A . 
E 3 HOH 280 1681 551 HOH HOH A . 
E 3 HOH 281 1682 555 HOH HOH A . 
E 3 HOH 282 1683 559 HOH HOH A . 
E 3 HOH 283 1684 560 HOH HOH A . 
E 3 HOH 284 1685 563 HOH HOH A . 
E 3 HOH 285 1686 564 HOH HOH A . 
E 3 HOH 286 1687 566 HOH HOH A . 
E 3 HOH 287 1688 567 HOH HOH A . 
E 3 HOH 288 1689 568 HOH HOH A . 
E 3 HOH 289 1690 569 HOH HOH A . 
E 3 HOH 290 1691 571 HOH HOH A . 
E 3 HOH 291 1692 573 HOH HOH A . 
E 3 HOH 292 1693 575 HOH HOH A . 
E 3 HOH 293 1694 577 HOH HOH A . 
F 3 HOH 1   1403 3   HOH HOH B . 
F 3 HOH 2   1404 4   HOH HOH B . 
F 3 HOH 3   1405 5   HOH HOH B . 
F 3 HOH 4   1406 6   HOH HOH B . 
F 3 HOH 5   1407 8   HOH HOH B . 
F 3 HOH 6   1408 11  HOH HOH B . 
F 3 HOH 7   1409 14  HOH HOH B . 
F 3 HOH 8   1410 15  HOH HOH B . 
F 3 HOH 9   1411 17  HOH HOH B . 
F 3 HOH 10  1412 21  HOH HOH B . 
F 3 HOH 11  1413 22  HOH HOH B . 
F 3 HOH 12  1414 23  HOH HOH B . 
F 3 HOH 13  1415 25  HOH HOH B . 
F 3 HOH 14  1416 27  HOH HOH B . 
F 3 HOH 15  1417 30  HOH HOH B . 
F 3 HOH 16  1418 32  HOH HOH B . 
F 3 HOH 17  1419 33  HOH HOH B . 
F 3 HOH 18  1420 39  HOH HOH B . 
F 3 HOH 19  1421 40  HOH HOH B . 
F 3 HOH 20  1422 41  HOH HOH B . 
F 3 HOH 21  1423 42  HOH HOH B . 
F 3 HOH 22  1424 43  HOH HOH B . 
F 3 HOH 23  1425 46  HOH HOH B . 
F 3 HOH 24  1426 47  HOH HOH B . 
F 3 HOH 25  1427 49  HOH HOH B . 
F 3 HOH 26  1428 53  HOH HOH B . 
F 3 HOH 27  1429 54  HOH HOH B . 
F 3 HOH 28  1430 55  HOH HOH B . 
F 3 HOH 29  1431 57  HOH HOH B . 
F 3 HOH 30  1432 59  HOH HOH B . 
F 3 HOH 31  1433 60  HOH HOH B . 
F 3 HOH 32  1434 62  HOH HOH B . 
F 3 HOH 33  1435 64  HOH HOH B . 
F 3 HOH 34  1436 65  HOH HOH B . 
F 3 HOH 35  1437 67  HOH HOH B . 
F 3 HOH 36  1438 69  HOH HOH B . 
F 3 HOH 37  1439 72  HOH HOH B . 
F 3 HOH 38  1440 73  HOH HOH B . 
F 3 HOH 39  1441 76  HOH HOH B . 
F 3 HOH 40  1442 77  HOH HOH B . 
F 3 HOH 41  1443 79  HOH HOH B . 
F 3 HOH 42  1444 80  HOH HOH B . 
F 3 HOH 43  1445 82  HOH HOH B . 
F 3 HOH 44  1446 84  HOH HOH B . 
F 3 HOH 45  1447 85  HOH HOH B . 
F 3 HOH 46  1448 86  HOH HOH B . 
F 3 HOH 47  1449 88  HOH HOH B . 
F 3 HOH 48  1450 91  HOH HOH B . 
F 3 HOH 49  1451 93  HOH HOH B . 
F 3 HOH 50  1452 99  HOH HOH B . 
F 3 HOH 51  1453 101 HOH HOH B . 
F 3 HOH 52  1454 105 HOH HOH B . 
F 3 HOH 53  1455 106 HOH HOH B . 
F 3 HOH 54  1456 108 HOH HOH B . 
F 3 HOH 55  1457 110 HOH HOH B . 
F 3 HOH 56  1458 114 HOH HOH B . 
F 3 HOH 57  1459 115 HOH HOH B . 
F 3 HOH 58  1460 121 HOH HOH B . 
F 3 HOH 59  1461 122 HOH HOH B . 
F 3 HOH 60  1462 123 HOH HOH B . 
F 3 HOH 61  1463 124 HOH HOH B . 
F 3 HOH 62  1464 125 HOH HOH B . 
F 3 HOH 63  1465 128 HOH HOH B . 
F 3 HOH 64  1466 130 HOH HOH B . 
F 3 HOH 65  1467 132 HOH HOH B . 
F 3 HOH 66  1468 133 HOH HOH B . 
F 3 HOH 67  1469 136 HOH HOH B . 
F 3 HOH 68  1470 137 HOH HOH B . 
F 3 HOH 69  1471 142 HOH HOH B . 
F 3 HOH 70  1472 148 HOH HOH B . 
F 3 HOH 71  1473 151 HOH HOH B . 
F 3 HOH 72  1474 154 HOH HOH B . 
F 3 HOH 73  1475 155 HOH HOH B . 
F 3 HOH 74  1476 159 HOH HOH B . 
F 3 HOH 75  1477 160 HOH HOH B . 
F 3 HOH 76  1478 162 HOH HOH B . 
F 3 HOH 77  1479 165 HOH HOH B . 
F 3 HOH 78  1480 166 HOH HOH B . 
F 3 HOH 79  1481 168 HOH HOH B . 
F 3 HOH 80  1482 172 HOH HOH B . 
F 3 HOH 81  1483 174 HOH HOH B . 
F 3 HOH 82  1484 176 HOH HOH B . 
F 3 HOH 83  1485 177 HOH HOH B . 
F 3 HOH 84  1486 178 HOH HOH B . 
F 3 HOH 85  1487 179 HOH HOH B . 
F 3 HOH 86  1488 180 HOH HOH B . 
F 3 HOH 87  1489 181 HOH HOH B . 
F 3 HOH 88  1490 182 HOH HOH B . 
F 3 HOH 89  1491 184 HOH HOH B . 
F 3 HOH 90  1492 185 HOH HOH B . 
F 3 HOH 91  1493 188 HOH HOH B . 
F 3 HOH 92  1494 189 HOH HOH B . 
F 3 HOH 93  1495 190 HOH HOH B . 
F 3 HOH 94  1496 192 HOH HOH B . 
F 3 HOH 95  1497 195 HOH HOH B . 
F 3 HOH 96  1498 197 HOH HOH B . 
F 3 HOH 97  1499 198 HOH HOH B . 
F 3 HOH 98  1500 204 HOH HOH B . 
F 3 HOH 99  1501 208 HOH HOH B . 
F 3 HOH 100 1502 210 HOH HOH B . 
F 3 HOH 101 1503 211 HOH HOH B . 
F 3 HOH 102 1504 212 HOH HOH B . 
F 3 HOH 103 1505 214 HOH HOH B . 
F 3 HOH 104 1506 215 HOH HOH B . 
F 3 HOH 105 1507 218 HOH HOH B . 
F 3 HOH 106 1508 219 HOH HOH B . 
F 3 HOH 107 1509 220 HOH HOH B . 
F 3 HOH 108 1510 225 HOH HOH B . 
F 3 HOH 109 1511 229 HOH HOH B . 
F 3 HOH 110 1512 234 HOH HOH B . 
F 3 HOH 111 1513 238 HOH HOH B . 
F 3 HOH 112 1514 240 HOH HOH B . 
F 3 HOH 113 1515 244 HOH HOH B . 
F 3 HOH 114 1516 245 HOH HOH B . 
F 3 HOH 115 1517 247 HOH HOH B . 
F 3 HOH 116 1518 248 HOH HOH B . 
F 3 HOH 117 1519 250 HOH HOH B . 
F 3 HOH 118 1520 252 HOH HOH B . 
F 3 HOH 119 1521 255 HOH HOH B . 
F 3 HOH 120 1522 264 HOH HOH B . 
F 3 HOH 121 1523 265 HOH HOH B . 
F 3 HOH 122 1524 266 HOH HOH B . 
F 3 HOH 123 1525 268 HOH HOH B . 
F 3 HOH 124 1526 269 HOH HOH B . 
F 3 HOH 125 1527 272 HOH HOH B . 
F 3 HOH 126 1528 273 HOH HOH B . 
F 3 HOH 127 1529 275 HOH HOH B . 
F 3 HOH 128 1530 276 HOH HOH B . 
F 3 HOH 129 1531 278 HOH HOH B . 
F 3 HOH 130 1532 281 HOH HOH B . 
F 3 HOH 131 1533 283 HOH HOH B . 
F 3 HOH 132 1534 284 HOH HOH B . 
F 3 HOH 133 1535 285 HOH HOH B . 
F 3 HOH 134 1536 292 HOH HOH B . 
F 3 HOH 135 1537 294 HOH HOH B . 
F 3 HOH 136 1538 298 HOH HOH B . 
F 3 HOH 137 1539 300 HOH HOH B . 
F 3 HOH 138 1540 302 HOH HOH B . 
F 3 HOH 139 1541 303 HOH HOH B . 
F 3 HOH 140 1542 304 HOH HOH B . 
F 3 HOH 141 1543 307 HOH HOH B . 
F 3 HOH 142 1544 312 HOH HOH B . 
F 3 HOH 143 1545 313 HOH HOH B . 
F 3 HOH 144 1546 315 HOH HOH B . 
F 3 HOH 145 1547 316 HOH HOH B . 
F 3 HOH 146 1548 320 HOH HOH B . 
F 3 HOH 147 1549 323 HOH HOH B . 
F 3 HOH 148 1550 324 HOH HOH B . 
F 3 HOH 149 1551 325 HOH HOH B . 
F 3 HOH 150 1552 326 HOH HOH B . 
F 3 HOH 151 1553 327 HOH HOH B . 
F 3 HOH 152 1554 330 HOH HOH B . 
F 3 HOH 153 1555 334 HOH HOH B . 
F 3 HOH 154 1556 338 HOH HOH B . 
F 3 HOH 155 1557 340 HOH HOH B . 
F 3 HOH 156 1558 341 HOH HOH B . 
F 3 HOH 157 1559 344 HOH HOH B . 
F 3 HOH 158 1560 345 HOH HOH B . 
F 3 HOH 159 1561 349 HOH HOH B . 
F 3 HOH 160 1562 352 HOH HOH B . 
F 3 HOH 161 1563 353 HOH HOH B . 
F 3 HOH 162 1564 359 HOH HOH B . 
F 3 HOH 163 1565 360 HOH HOH B . 
F 3 HOH 164 1566 362 HOH HOH B . 
F 3 HOH 165 1567 366 HOH HOH B . 
F 3 HOH 166 1568 368 HOH HOH B . 
F 3 HOH 167 1569 369 HOH HOH B . 
F 3 HOH 168 1570 370 HOH HOH B . 
F 3 HOH 169 1571 372 HOH HOH B . 
F 3 HOH 170 1572 373 HOH HOH B . 
F 3 HOH 171 1573 374 HOH HOH B . 
F 3 HOH 172 1574 376 HOH HOH B . 
F 3 HOH 173 1575 377 HOH HOH B . 
F 3 HOH 174 1576 381 HOH HOH B . 
F 3 HOH 175 1577 383 HOH HOH B . 
F 3 HOH 176 1578 385 HOH HOH B . 
F 3 HOH 177 1579 386 HOH HOH B . 
F 3 HOH 178 1580 387 HOH HOH B . 
F 3 HOH 179 1581 388 HOH HOH B . 
F 3 HOH 180 1582 389 HOH HOH B . 
F 3 HOH 181 1583 390 HOH HOH B . 
F 3 HOH 182 1584 395 HOH HOH B . 
F 3 HOH 183 1585 396 HOH HOH B . 
F 3 HOH 184 1586 399 HOH HOH B . 
F 3 HOH 185 1587 401 HOH HOH B . 
F 3 HOH 186 1588 402 HOH HOH B . 
F 3 HOH 187 1589 406 HOH HOH B . 
F 3 HOH 188 1590 407 HOH HOH B . 
F 3 HOH 189 1591 408 HOH HOH B . 
F 3 HOH 190 1592 409 HOH HOH B . 
F 3 HOH 191 1593 413 HOH HOH B . 
F 3 HOH 192 1594 415 HOH HOH B . 
F 3 HOH 193 1595 416 HOH HOH B . 
F 3 HOH 194 1596 422 HOH HOH B . 
F 3 HOH 195 1597 423 HOH HOH B . 
F 3 HOH 196 1598 424 HOH HOH B . 
F 3 HOH 197 1599 426 HOH HOH B . 
F 3 HOH 198 1600 427 HOH HOH B . 
F 3 HOH 199 1601 429 HOH HOH B . 
F 3 HOH 200 1602 430 HOH HOH B . 
F 3 HOH 201 1603 432 HOH HOH B . 
F 3 HOH 202 1604 434 HOH HOH B . 
F 3 HOH 203 1605 437 HOH HOH B . 
F 3 HOH 204 1606 438 HOH HOH B . 
F 3 HOH 205 1607 439 HOH HOH B . 
F 3 HOH 206 1608 441 HOH HOH B . 
F 3 HOH 207 1609 445 HOH HOH B . 
F 3 HOH 208 1610 446 HOH HOH B . 
F 3 HOH 209 1611 448 HOH HOH B . 
F 3 HOH 210 1612 449 HOH HOH B . 
F 3 HOH 211 1613 458 HOH HOH B . 
F 3 HOH 212 1614 460 HOH HOH B . 
F 3 HOH 213 1615 461 HOH HOH B . 
F 3 HOH 214 1616 463 HOH HOH B . 
F 3 HOH 215 1617 464 HOH HOH B . 
F 3 HOH 216 1618 469 HOH HOH B . 
F 3 HOH 217 1619 470 HOH HOH B . 
F 3 HOH 218 1620 472 HOH HOH B . 
F 3 HOH 219 1621 477 HOH HOH B . 
F 3 HOH 220 1622 479 HOH HOH B . 
F 3 HOH 221 1623 482 HOH HOH B . 
F 3 HOH 222 1624 483 HOH HOH B . 
F 3 HOH 223 1625 485 HOH HOH B . 
F 3 HOH 224 1626 486 HOH HOH B . 
F 3 HOH 225 1627 487 HOH HOH B . 
F 3 HOH 226 1628 488 HOH HOH B . 
F 3 HOH 227 1629 490 HOH HOH B . 
F 3 HOH 228 1630 492 HOH HOH B . 
F 3 HOH 229 1631 494 HOH HOH B . 
F 3 HOH 230 1632 495 HOH HOH B . 
F 3 HOH 231 1633 499 HOH HOH B . 
F 3 HOH 232 1634 500 HOH HOH B . 
F 3 HOH 233 1635 501 HOH HOH B . 
F 3 HOH 234 1636 503 HOH HOH B . 
F 3 HOH 235 1637 505 HOH HOH B . 
F 3 HOH 236 1638 508 HOH HOH B . 
F 3 HOH 237 1639 512 HOH HOH B . 
F 3 HOH 238 1640 513 HOH HOH B . 
F 3 HOH 239 1641 514 HOH HOH B . 
F 3 HOH 240 1642 517 HOH HOH B . 
F 3 HOH 241 1643 524 HOH HOH B . 
F 3 HOH 242 1644 526 HOH HOH B . 
F 3 HOH 243 1645 528 HOH HOH B . 
F 3 HOH 244 1646 530 HOH HOH B . 
F 3 HOH 245 1647 536 HOH HOH B . 
F 3 HOH 246 1648 539 HOH HOH B . 
F 3 HOH 247 1649 542 HOH HOH B . 
F 3 HOH 248 1650 543 HOH HOH B . 
F 3 HOH 249 1651 544 HOH HOH B . 
F 3 HOH 250 1652 545 HOH HOH B . 
F 3 HOH 251 1653 548 HOH HOH B . 
F 3 HOH 252 1654 549 HOH HOH B . 
F 3 HOH 253 1655 550 HOH HOH B . 
F 3 HOH 254 1656 552 HOH HOH B . 
F 3 HOH 255 1657 553 HOH HOH B . 
F 3 HOH 256 1658 554 HOH HOH B . 
F 3 HOH 257 1659 556 HOH HOH B . 
F 3 HOH 258 1660 561 HOH HOH B . 
F 3 HOH 259 1661 562 HOH HOH B . 
F 3 HOH 260 1662 565 HOH HOH B . 
F 3 HOH 261 1663 576 HOH HOH B . 
F 3 HOH 262 1664 578 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-11-15 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    SG 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    CYS 
_pdbx_validate_symm_contact.auth_seq_id_1     196 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    SG 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    CYS 
_pdbx_validate_symm_contact.auth_seq_id_2     196 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_545 
_pdbx_validate_symm_contact.dist              2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 138 ? ? -140.46 -16.81 
2 1 VAL B 138 ? ? -145.65 -15.18 
3 1 ASN B 210 ? ? 75.54   31.33  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 51  ? CD  ? A ARG 69  CD  
2 1 Y 1 A ARG 54  ? CD  ? A ARG 72  CD  
3 1 Y 1 A ARG 207 ? NH1 ? A ARG 224 NH1 
4 1 Y 1 B ARG 51  ? CD  ? B ARG 69  CD  
5 1 Y 1 B ARG 54  ? CD  ? B ARG 72  CD  
6 1 Y 1 B ARG 207 ? NH1 ? B ARG 224 NH1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -17 ? A MET 1  
2  1 Y 1 A GLY -16 ? A GLY 2  
3  1 Y 1 A SER -15 ? A SER 3  
4  1 Y 1 A SER -14 ? A SER 4  
5  1 Y 1 A HIS -13 ? A HIS 5  
6  1 Y 1 A HIS -12 ? A HIS 6  
7  1 Y 1 A HIS -11 ? A HIS 7  
8  1 Y 1 A HIS -10 ? A HIS 8  
9  1 Y 1 A HIS -9  ? A HIS 9  
10 1 Y 1 A HIS -8  ? A HIS 10 
11 1 Y 1 A SER -7  ? A SER 11 
12 1 Y 1 A SER -6  ? A SER 12 
13 1 Y 1 A GLY -5  ? A GLY 13 
14 1 Y 1 A LEU -4  ? A LEU 14 
15 1 Y 1 A VAL -3  ? A VAL 15 
16 1 Y 1 A PRO -2  ? A PRO 16 
17 1 Y 1 A GLU 56  ? A GLU 73 
18 1 Y 1 A GLY 57  ? A GLY 74 
19 1 Y 1 A PRO 58  ? A PRO 75 
20 1 Y 1 A ASN 59  ? A ASN 76 
21 1 Y 1 B MET -17 ? B MET 1  
22 1 Y 1 B GLY -16 ? B GLY 2  
23 1 Y 1 B SER -15 ? B SER 3  
24 1 Y 1 B SER -14 ? B SER 4  
25 1 Y 1 B HIS -13 ? B HIS 5  
26 1 Y 1 B HIS -12 ? B HIS 6  
27 1 Y 1 B HIS -11 ? B HIS 7  
28 1 Y 1 B HIS -10 ? B HIS 8  
29 1 Y 1 B HIS -9  ? B HIS 9  
30 1 Y 1 B HIS -8  ? B HIS 10 
31 1 Y 1 B SER -7  ? B SER 11 
32 1 Y 1 B SER -6  ? B SER 12 
33 1 Y 1 B GLY -5  ? B GLY 13 
34 1 Y 1 B LEU -4  ? B LEU 14 
35 1 Y 1 B VAL -3  ? B VAL 15 
36 1 Y 1 B PRO -2  ? B PRO 16 
37 1 Y 1 B GLU 56  ? B GLU 73 
38 1 Y 1 B GLY 57  ? B GLY 74 
39 1 Y 1 B PRO 58  ? B PRO 75 
40 1 Y 1 B ASN 59  ? B ASN 76 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 S-ADENOSYL-L-HOMOCYSTEINE SAH 
3 water                     HOH 
#