data_2EXG
# 
_entry.id   2EXG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EXG         
RCSB  RCSB035212   
WWPDB D_1000035212 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EXG 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Joshi, M.'      1 
'Vargas, C.'     2 
'Boisguerin, P.' 3 
'Krause, G.'     4 
'Schade, M.'     5 
'Oschkinat, H.'  6 
# 
_citation.id                        primary 
_citation.title                     'Discovery of low-molecular-weight ligands for the AF6 PDZ domain.' 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            45 
_citation.page_first                3790 
_citation.page_last                 3795 
_citation.year                      2006 
_citation.journal_id_ASTM           ACIEAY 
_citation.country                   GE 
_citation.journal_id_ISSN           0570-0833 
_citation.journal_id_CSD            0179 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16671149 
_citation.pdbx_database_id_DOI      10.1002/anie.200503965 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Joshi, M.'      1  
primary 'Vargas, C.'     2  
primary 'Boisguerin, P.' 3  
primary 'Diehl, A.'      4  
primary 'Krause, G.'     5  
primary 'Schmieder, P.'  6  
primary 'Moelling, K.'   7  
primary 'Hagen, V.'      8  
primary 'Schade, M.'     9  
primary 'Oschkinat, H.'  10 
# 
_cell.entry_id           2EXG 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2EXG 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Afadin                                                            10392.987 1 ? ? 
'PDZ domain (residues 985-1079)' ? 
2 non-polymer syn '(5R)-2-SULFANYL-5-[4-(TRIFLUOROMETHYL)BENZYL]-1,3-THIAZOL-4-ONE' 291.313   1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AF-6 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAA
ELMTRTSSVVTLEVAKQGAIY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAA
ELMTRTSSVVTLEVAKQGAIY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   LEU n 
1 7   ARG n 
1 8   LYS n 
1 9   GLU n 
1 10  PRO n 
1 11  GLU n 
1 12  ILE n 
1 13  ILE n 
1 14  THR n 
1 15  VAL n 
1 16  THR n 
1 17  LEU n 
1 18  LYS n 
1 19  LYS n 
1 20  GLN n 
1 21  ASN n 
1 22  GLY n 
1 23  MET n 
1 24  GLY n 
1 25  LEU n 
1 26  SER n 
1 27  ILE n 
1 28  VAL n 
1 29  ALA n 
1 30  ALA n 
1 31  LYS n 
1 32  GLY n 
1 33  ALA n 
1 34  GLY n 
1 35  GLN n 
1 36  ASP n 
1 37  LYS n 
1 38  LEU n 
1 39  GLY n 
1 40  ILE n 
1 41  TYR n 
1 42  VAL n 
1 43  LYS n 
1 44  SER n 
1 45  VAL n 
1 46  VAL n 
1 47  LYS n 
1 48  GLY n 
1 49  GLY n 
1 50  ALA n 
1 51  ALA n 
1 52  ASP n 
1 53  VAL n 
1 54  ASP n 
1 55  GLY n 
1 56  ARG n 
1 57  LEU n 
1 58  ALA n 
1 59  ALA n 
1 60  GLY n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  LEU n 
1 65  SER n 
1 66  VAL n 
1 67  ASP n 
1 68  GLY n 
1 69  ARG n 
1 70  SER n 
1 71  LEU n 
1 72  VAL n 
1 73  GLY n 
1 74  LEU n 
1 75  SER n 
1 76  GLN n 
1 77  GLU n 
1 78  ARG n 
1 79  ALA n 
1 80  ALA n 
1 81  GLU n 
1 82  LEU n 
1 83  MET n 
1 84  THR n 
1 85  ARG n 
1 86  THR n 
1 87  SER n 
1 88  SER n 
1 89  VAL n 
1 90  VAL n 
1 91  THR n 
1 92  LEU n 
1 93  GLU n 
1 94  VAL n 
1 95  ALA n 
1 96  LYS n 
1 97  GLN n 
1 98  GLY n 
1 99  ALA n 
1 100 ILE n 
1 101 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AFAD_HUMAN 
_struct_ref.pdbx_db_accession          P55196 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           985 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EXG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 101 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P55196 
_struct_ref_seq.db_align_beg                  985 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1079 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       101 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EXG GLY A 1  ? UNP P55196 ? ? 'CLONING ARTIFACT' 1  1 
1 2EXG PRO A 2  ? UNP P55196 ? ? 'CLONING ARTIFACT' 2  2 
1 2EXG LEU A 3  ? UNP P55196 ? ? 'CLONING ARTIFACT' 3  3 
1 2EXG GLY A 4  ? UNP P55196 ? ? 'CLONING ARTIFACT' 4  4 
1 2EXG SER A 5  ? UNP P55196 ? ? 'CLONING ARTIFACT' 5  5 
1 2EXG VAL A 53 ? UNP P55196 ? ? 'CLONING ARTIFACT' 53 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                           ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                          ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ? 'C4 H7 N O4'       133.103 
GLN 'L-peptide linking' y GLUTAMINE                                                         ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                           ? 'C2 H5 N O2'       75.067  
ILE 'L-peptide linking' y ISOLEUCINE                                                        ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                            ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                        ? 'C5 H11 N O2 S'    149.211 
PRO 'L-peptide linking' y PROLINE                                                           ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                            ? 'C3 H7 N O3'       105.093 
STF non-polymer         . '(5R)-2-SULFANYL-5-[4-(TRIFLUOROMETHYL)BENZYL]-1,3-THIAZOL-4-ONE' ? 'C11 H8 F3 N O S2' 291.313 
THR 'L-peptide linking' y THREONINE                                                         ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                                                          ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                            ? 'C5 H11 N O2'      117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 2 3D_13C-separated_NOESY 2 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 295 Ambient 6.5 '20 mM Phosphate, 50 mM NaCl' . K 
2 295 Ambient 6.5 '20 mM Phosphate, 50 mM NaCl' . K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.5 mM PDZ domain U-15N, 20mM phosphate buffer, 50mM Sodium chloride, 90%H2O, 10% D2O'          '90% H2O/10% D2O' 
2 '1.5 mM PDZ domain U-15N, 13C, 1.5 mM 5f, 20mM phosphate buffer, 50mM Sodium chloride, 100% D2O' '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 600 ? 
2 DMX Bruker 750 ? 
# 
_pdbx_nmr_refine.entry_id           2EXG 
_pdbx_nmr_refine.method             'Torsional angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2EXG 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2EXG 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' DIANA   1.0.6 'Guentert, P.'        1 
collection           XWINNMR 3.5   Bruker                2 
processing           XWINNMR 3.5   Bruker                3 
'data analysis'      Sparky  3.1   'Goddard and Kneller' 4 
refinement           DIANA   1.0.6 'Guentert, P.'        5 
# 
_exptl.entry_id          2EXG 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2EXG 
_struct.title                     
'Making Protein-Protein Interactions Drugable: Discovery of Low-Molecular-Weight Ligands for the AF6 PDZ Domain' 
_struct.pdbx_descriptor           Afadin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EXG 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;Inhibitors of protein-protein interactions, low-molecular-weight ligands, protein structure, NMR screening, PDZ domains, CELL ADHESION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 49 ? ARG A 56 ? GLY A 49 ARG A 56 1 ? 8 
HELX_P HELX_P2 2 SER A 75 ? ARG A 78 ? SER A 75 ARG A 78 5 ? 4 
HELX_P HELX_P3 3 ALA A 79 ? THR A 84 ? ALA A 79 THR A 84 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 11 ? THR A 16 ? GLU A 11 THR A 16 
A 2 VAL A 89 ? ALA A 95 ? VAL A 89 ALA A 95 
A 3 GLN A 62 ? VAL A 66 ? GLN A 62 VAL A 66 
B 1 LEU A 25 ? ALA A 30 ? LEU A 25 ALA A 30 
B 2 GLY A 39 ? VAL A 45 ? GLY A 39 VAL A 45 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 15 ? N VAL A 15 O VAL A 90 ? O VAL A 90 
A 2 3 O GLU A 93 ? O GLU A 93 N LEU A 64 ? N LEU A 64 
B 1 2 N ALA A 30 ? N ALA A 30 O GLY A 39 ? O GLY A 39 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE STF A 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 MET A 23 ? MET A 23 . ? 1_555 ? 
2 AC1 6 GLY A 24 ? GLY A 24 . ? 1_555 ? 
3 AC1 6 LEU A 25 ? LEU A 25 . ? 1_555 ? 
4 AC1 6 SER A 26 ? SER A 26 . ? 1_555 ? 
5 AC1 6 ILE A 27 ? ILE A 27 . ? 1_555 ? 
6 AC1 6 MET A 83 ? MET A 83 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EXG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EXG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . GLY A 1 1   ? 2.601   -0.427  -18.962 1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C CA   . GLY A 1 1   ? 1.465   -1.262  -18.547 1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C C    . GLY A 1 1   ? 0.189   -0.445  -18.466 1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O O    . GLY A 1 1   ? 0.275   0.777   -18.382 1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H H1   . GLY A 1 1   ? 2.718   0.366   -18.342 1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H H2   . GLY A 1 1   ? 2.473   -0.103  -19.912 1.00 0.00 ? 1   GLY A H2   1  
ATOM   7     H H3   . GLY A 1 1   ? 3.453   -0.974  -18.933 1.00 0.00 ? 1   GLY A H3   1  
ATOM   8     H HA2  . GLY A 1 1   ? 1.334   -2.069  -19.267 1.00 0.00 ? 1   GLY A HA2  1  
ATOM   9     H HA3  . GLY A 1 1   ? 1.669   -1.693  -17.566 1.00 0.00 ? 1   GLY A HA3  1  
ATOM   10    N N    . PRO A 1 2   ? -0.987  -1.094  -18.521 1.00 0.00 ? 2   PRO A N    1  
ATOM   11    C CA   . PRO A 1 2   ? -2.275  -0.432  -18.322 1.00 0.00 ? 2   PRO A CA   1  
ATOM   12    C C    . PRO A 1 2   ? -2.495  -0.084  -16.841 1.00 0.00 ? 2   PRO A C    1  
ATOM   13    O O    . PRO A 1 2   ? -1.785  -0.584  -15.967 1.00 0.00 ? 2   PRO A O    1  
ATOM   14    C CB   . PRO A 1 2   ? -3.311  -1.453  -18.814 1.00 0.00 ? 2   PRO A CB   1  
ATOM   15    C CG   . PRO A 1 2   ? -2.657  -2.795  -18.481 1.00 0.00 ? 2   PRO A CG   1  
ATOM   16    C CD   . PRO A 1 2   ? -1.169  -2.528  -18.707 1.00 0.00 ? 2   PRO A CD   1  
ATOM   17    H HA   . PRO A 1 2   ? -2.333  0.476   -18.921 1.00 0.00 ? 2   PRO A HA   1  
ATOM   18    H HB3  . PRO A 1 2   ? -3.430  -1.362  -19.894 1.00 0.00 ? 2   PRO A HB3  1  
ATOM   19    H HG3  . PRO A 1 2   ? -3.027  -3.597  -19.121 1.00 0.00 ? 2   PRO A HG3  1  
ATOM   20    H HD3  . PRO A 1 2   ? -0.900  -2.795  -19.730 1.00 0.00 ? 2   PRO A HD3  1  
ATOM   21    N N    . LEU A 1 3   ? -3.521  0.717   -16.558 1.00 0.00 ? 3   LEU A N    1  
ATOM   22    C CA   . LEU A 1 3   ? -4.035  0.952   -15.209 1.00 0.00 ? 3   LEU A CA   1  
ATOM   23    C C    . LEU A 1 3   ? -5.533  1.240   -15.300 1.00 0.00 ? 3   LEU A C    1  
ATOM   24    O O    . LEU A 1 3   ? -5.989  1.820   -16.289 1.00 0.00 ? 3   LEU A O    1  
ATOM   25    C CB   . LEU A 1 3   ? -3.219  2.048   -14.487 1.00 0.00 ? 3   LEU A CB   1  
ATOM   26    C CG   . LEU A 1 3   ? -3.213  3.453   -15.124 1.00 0.00 ? 3   LEU A CG   1  
ATOM   27    C CD1  . LEU A 1 3   ? -4.367  4.336   -14.642 1.00 0.00 ? 3   LEU A CD1  1  
ATOM   28    C CD2  . LEU A 1 3   ? -1.920  4.181   -14.745 1.00 0.00 ? 3   LEU A CD2  1  
ATOM   29    H H    . LEU A 1 3   ? -4.084  1.085   -17.311 1.00 0.00 ? 3   LEU A H    1  
ATOM   30    H HA   . LEU A 1 3   ? -3.916  0.030   -14.632 1.00 0.00 ? 3   LEU A HA   1  
ATOM   31    H HB3  . LEU A 1 3   ? -2.190  1.688   -14.433 1.00 0.00 ? 3   LEU A HB3  1  
ATOM   32    H HG   . LEU A 1 3   ? -3.248  3.375   -16.211 1.00 0.00 ? 3   LEU A HG   1  
ATOM   33    H HD11 . LEU A 1 3   ? -4.346  4.425   -13.556 1.00 0.00 ? 3   LEU A HD11 1  
ATOM   34    H HD12 . LEU A 1 3   ? -4.284  5.327   -15.087 1.00 0.00 ? 3   LEU A HD12 1  
ATOM   35    H HD13 . LEU A 1 3   ? -5.322  3.909   -14.940 1.00 0.00 ? 3   LEU A HD13 1  
ATOM   36    H HD21 . LEU A 1 3   ? -1.064  3.619   -15.117 1.00 0.00 ? 3   LEU A HD21 1  
ATOM   37    H HD22 . LEU A 1 3   ? -1.907  5.174   -15.193 1.00 0.00 ? 3   LEU A HD22 1  
ATOM   38    H HD23 . LEU A 1 3   ? -1.849  4.268   -13.659 1.00 0.00 ? 3   LEU A HD23 1  
ATOM   39    N N    . GLY A 1 4   ? -6.291  0.767   -14.311 1.00 0.00 ? 4   GLY A N    1  
ATOM   40    C CA   . GLY A 1 4   ? -7.736  0.920   -14.243 1.00 0.00 ? 4   GLY A CA   1  
ATOM   41    C C    . GLY A 1 4   ? -8.182  2.312   -13.802 1.00 0.00 ? 4   GLY A C    1  
ATOM   42    O O    . GLY A 1 4   ? -7.905  3.322   -14.452 1.00 0.00 ? 4   GLY A O    1  
ATOM   43    H H    . GLY A 1 4   ? -5.872  0.160   -13.606 1.00 0.00 ? 4   GLY A H    1  
ATOM   44    H HA2  . GLY A 1 4   ? -8.180  0.713   -15.216 1.00 0.00 ? 4   GLY A HA2  1  
ATOM   45    H HA3  . GLY A 1 4   ? -8.108  0.188   -13.527 1.00 0.00 ? 4   GLY A HA3  1  
ATOM   46    N N    . SER A 1 5   ? -8.961  2.359   -12.725 1.00 0.00 ? 5   SER A N    1  
ATOM   47    C CA   . SER A 1 5   ? -9.404  3.613   -12.107 1.00 0.00 ? 5   SER A CA   1  
ATOM   48    C C    . SER A 1 5   ? -9.726  3.377   -10.636 1.00 0.00 ? 5   SER A C    1  
ATOM   49    O O    . SER A 1 5   ? -9.041  3.888   -9.751  1.00 0.00 ? 5   SER A O    1  
ATOM   50    C CB   . SER A 1 5   ? -10.630 4.153   -12.859 1.00 0.00 ? 5   SER A CB   1  
ATOM   51    O OG   . SER A 1 5   ? -10.915 5.485   -12.481 1.00 0.00 ? 5   SER A OG   1  
ATOM   52    H H    . SER A 1 5   ? -9.126  1.493   -12.233 1.00 0.00 ? 5   SER A H    1  
ATOM   53    H HA   . SER A 1 5   ? -8.603  4.352   -12.167 1.00 0.00 ? 5   SER A HA   1  
ATOM   54    H HB3  . SER A 1 5   ? -11.504 3.527   -12.677 1.00 0.00 ? 5   SER A HB3  1  
ATOM   55    H HG   . SER A 1 5   ? -10.978 6.008   -13.301 1.00 0.00 ? 5   SER A HG   1  
ATOM   56    N N    . LEU A 1 6   ? -10.719 2.523   -10.385 1.00 0.00 ? 6   LEU A N    1  
ATOM   57    C CA   . LEU A 1 6   ? -11.140 2.062   -9.068  1.00 0.00 ? 6   LEU A CA   1  
ATOM   58    C C    . LEU A 1 6   ? -12.060 0.851   -9.242  1.00 0.00 ? 6   LEU A C    1  
ATOM   59    O O    . LEU A 1 6   ? -13.042 0.905   -9.983  1.00 0.00 ? 6   LEU A O    1  
ATOM   60    C CB   . LEU A 1 6   ? -11.826 3.209   -8.286  1.00 0.00 ? 6   LEU A CB   1  
ATOM   61    C CG   . LEU A 1 6   ? -13.084 3.840   -8.931  1.00 0.00 ? 6   LEU A CG   1  
ATOM   62    C CD1  . LEU A 1 6   ? -14.370 3.367   -8.248  1.00 0.00 ? 6   LEU A CD1  1  
ATOM   63    C CD2  . LEU A 1 6   ? -13.044 5.365   -8.818  1.00 0.00 ? 6   LEU A CD2  1  
ATOM   64    H H    . LEU A 1 6   ? -11.246 2.166   -11.171 1.00 0.00 ? 6   LEU A H    1  
ATOM   65    H HA   . LEU A 1 6   ? -10.254 1.750   -8.511  1.00 0.00 ? 6   LEU A HA   1  
ATOM   66    H HB3  . LEU A 1 6   ? -11.083 3.990   -8.135  1.00 0.00 ? 6   LEU A HB3  1  
ATOM   67    H HG   . LEU A 1 6   ? -13.136 3.593   -9.991  1.00 0.00 ? 6   LEU A HG   1  
ATOM   68    H HD11 . LEU A 1 6   ? -14.375 3.669   -7.200  1.00 0.00 ? 6   LEU A HD11 1  
ATOM   69    H HD12 . LEU A 1 6   ? -15.233 3.800   -8.753  1.00 0.00 ? 6   LEU A HD12 1  
ATOM   70    H HD13 . LEU A 1 6   ? -14.447 2.283   -8.308  1.00 0.00 ? 6   LEU A HD13 1  
ATOM   71    H HD21 . LEU A 1 6   ? -12.171 5.742   -9.352  1.00 0.00 ? 6   LEU A HD21 1  
ATOM   72    H HD22 . LEU A 1 6   ? -13.940 5.795   -9.263  1.00 0.00 ? 6   LEU A HD22 1  
ATOM   73    H HD23 . LEU A 1 6   ? -12.979 5.661   -7.769  1.00 0.00 ? 6   LEU A HD23 1  
ATOM   74    N N    . ARG A 1 7   ? -11.737 -0.250  -8.566  1.00 0.00 ? 7   ARG A N    1  
ATOM   75    C CA   . ARG A 1 7   ? -12.567 -1.456  -8.470  1.00 0.00 ? 7   ARG A CA   1  
ATOM   76    C C    . ARG A 1 7   ? -12.091 -2.264  -7.272  1.00 0.00 ? 7   ARG A C    1  
ATOM   77    O O    . ARG A 1 7   ? -10.967 -2.086  -6.810  1.00 0.00 ? 7   ARG A O    1  
ATOM   78    C CB   . ARG A 1 7   ? -12.496 -2.272  -9.782  1.00 0.00 ? 7   ARG A CB   1  
ATOM   79    C CG   . ARG A 1 7   ? -13.885 -2.379  -10.441 1.00 0.00 ? 7   ARG A CG   1  
ATOM   80    C CD   . ARG A 1 7   ? -13.838 -2.988  -11.847 1.00 0.00 ? 7   ARG A CD   1  
ATOM   81    N NE   . ARG A 1 7   ? -13.126 -2.116  -12.798 1.00 0.00 ? 7   ARG A NE   1  
ATOM   82    C CZ   . ARG A 1 7   ? -13.637 -1.132  -13.517 1.00 0.00 ? 7   ARG A CZ   1  
ATOM   83    N NH1  . ARG A 1 7   ? -14.920 -0.898  -13.549 1.00 0.00 ? 7   ARG A NH1  1  
ATOM   84    N NH2  . ARG A 1 7   ? -12.874 -0.356  -14.220 1.00 0.00 ? 7   ARG A NH2  1  
ATOM   85    H H    . ARG A 1 7   ? -10.867 -0.255  -8.044  1.00 0.00 ? 7   ARG A H    1  
ATOM   86    H HA   . ARG A 1 7   ? -13.597 -1.151  -8.282  1.00 0.00 ? 7   ARG A HA   1  
ATOM   87    H HB3  . ARG A 1 7   ? -12.119 -3.277  -9.588  1.00 0.00 ? 7   ARG A HB3  1  
ATOM   88    H HG3  . ARG A 1 7   ? -14.335 -1.388  -10.510 1.00 0.00 ? 7   ARG A HG3  1  
ATOM   89    H HD3  . ARG A 1 7   ? -14.859 -3.169  -12.191 1.00 0.00 ? 7   ARG A HD3  1  
ATOM   90    H HE   . ARG A 1 7   ? -12.117 -2.241  -12.836 1.00 0.00 ? 7   ARG A HE   1  
ATOM   91    H HH11 . ARG A 1 7   ? -15.533 -1.532  -13.078 1.00 0.00 ? 7   ARG A HH11 1  
ATOM   92    H HH12 . ARG A 1 7   ? -15.300 -0.176  -14.152 1.00 0.00 ? 7   ARG A HH12 1  
ATOM   93    H HH21 . ARG A 1 7   ? -11.880 -0.559  -14.300 1.00 0.00 ? 7   ARG A HH21 1  
ATOM   94    H HH22 . ARG A 1 7   ? -13.271 0.448   -14.693 1.00 0.00 ? 7   ARG A HH22 1  
ATOM   95    N N    . LYS A 1 8   ? -12.959 -3.105  -6.713  1.00 0.00 ? 8   LYS A N    1  
ATOM   96    C CA   . LYS A 1 8   ? -12.609 -3.939  -5.554  1.00 0.00 ? 8   LYS A CA   1  
ATOM   97    C C    . LYS A 1 8   ? -12.037 -5.281  -6.021  1.00 0.00 ? 8   LYS A C    1  
ATOM   98    O O    . LYS A 1 8   ? -12.648 -6.327  -5.843  1.00 0.00 ? 8   LYS A O    1  
ATOM   99    C CB   . LYS A 1 8   ? -13.768 -3.991  -4.525  1.00 0.00 ? 8   LYS A CB   1  
ATOM   100   C CG   . LYS A 1 8   ? -13.517 -3.090  -3.293  1.00 0.00 ? 8   LYS A CG   1  
ATOM   101   C CD   . LYS A 1 8   ? -13.483 -1.573  -3.558  1.00 0.00 ? 8   LYS A CD   1  
ATOM   102   C CE   . LYS A 1 8   ? -13.065 -0.823  -2.280  1.00 0.00 ? 8   LYS A CE   1  
ATOM   103   N NZ   . LYS A 1 8   ? -13.068 0.652   -2.452  1.00 0.00 ? 8   LYS A NZ   1  
ATOM   104   H H    . LYS A 1 8   ? -13.854 -3.237  -7.156  1.00 0.00 ? 8   LYS A H    1  
ATOM   105   H HA   . LYS A 1 8   ? -11.764 -3.479  -5.037  1.00 0.00 ? 8   LYS A HA   1  
ATOM   106   H HB3  . LYS A 1 8   ? -13.881 -5.009  -4.152  1.00 0.00 ? 8   LYS A HB3  1  
ATOM   107   H HG3  . LYS A 1 8   ? -12.569 -3.390  -2.842  1.00 0.00 ? 8   LYS A HG3  1  
ATOM   108   H HD3  . LYS A 1 8   ? -14.476 -1.243  -3.872  1.00 0.00 ? 8   LYS A HD3  1  
ATOM   109   H HE3  . LYS A 1 8   ? -12.058 -1.151  -2.005  1.00 0.00 ? 8   LYS A HE3  1  
ATOM   110   H HZ1  . LYS A 1 8   ? -14.016 1.032   -2.407  1.00 0.00 ? 8   LYS A HZ1  1  
ATOM   111   H HZ2  . LYS A 1 8   ? -12.547 1.117   -1.708  1.00 0.00 ? 8   LYS A HZ2  1  
ATOM   112   H HZ3  . LYS A 1 8   ? -12.640 0.939   -3.316  1.00 0.00 ? 8   LYS A HZ3  1  
ATOM   113   N N    . GLU A 1 9   ? -10.854 -5.228  -6.633  1.00 0.00 ? 9   GLU A N    1  
ATOM   114   C CA   . GLU A 1 9   ? -10.143 -6.405  -7.142  1.00 0.00 ? 9   GLU A CA   1  
ATOM   115   C C    . GLU A 1 9   ? -8.607  -6.233  -7.045  1.00 0.00 ? 9   GLU A C    1  
ATOM   116   O O    . GLU A 1 9   ? -8.149  -5.134  -6.731  1.00 0.00 ? 9   GLU A O    1  
ATOM   117   C CB   . GLU A 1 9   ? -10.711 -6.750  -8.537  1.00 0.00 ? 9   GLU A CB   1  
ATOM   118   C CG   . GLU A 1 9   ? -10.188 -5.914  -9.709  1.00 0.00 ? 9   GLU A CG   1  
ATOM   119   C CD   . GLU A 1 9   ? -11.038 -6.142  -10.971 1.00 0.00 ? 9   GLU A CD   1  
ATOM   120   O OE1  . GLU A 1 9   ? -11.575 -7.260  -11.176 1.00 0.00 ? 9   GLU A OE1  1  
ATOM   121   O OE2  . GLU A 1 9   ? -11.236 -5.180  -11.749 1.00 0.00 ? 9   GLU A OE2  1  
ATOM   122   H H    . GLU A 1 9   ? -10.377 -4.335  -6.720  1.00 0.00 ? 9   GLU A H    1  
ATOM   123   H HA   . GLU A 1 9   ? -10.392 -7.246  -6.495  1.00 0.00 ? 9   GLU A HA   1  
ATOM   124   H HB3  . GLU A 1 9   ? -11.797 -6.635  -8.498  1.00 0.00 ? 9   GLU A HB3  1  
ATOM   125   H HG3  . GLU A 1 9   ? -9.150  -6.182  -9.910  1.00 0.00 ? 9   GLU A HG3  1  
ATOM   126   N N    . PRO A 1 10  ? -7.805  -7.310  -7.191  1.00 0.00 ? 10  PRO A N    1  
ATOM   127   C CA   . PRO A 1 10  ? -6.356  -7.256  -7.016  1.00 0.00 ? 10  PRO A CA   1  
ATOM   128   C C    . PRO A 1 10  ? -5.693  -6.614  -8.236  1.00 0.00 ? 10  PRO A C    1  
ATOM   129   O O    . PRO A 1 10  ? -5.825  -7.102  -9.359  1.00 0.00 ? 10  PRO A O    1  
ATOM   130   C CB   . PRO A 1 10  ? -5.923  -8.710  -6.823  1.00 0.00 ? 10  PRO A CB   1  
ATOM   131   C CG   . PRO A 1 10  ? -6.930  -9.501  -7.651  1.00 0.00 ? 10  PRO A CG   1  
ATOM   132   C CD   . PRO A 1 10  ? -8.209  -8.670  -7.534  1.00 0.00 ? 10  PRO A CD   1  
ATOM   133   H HA   . PRO A 1 10  ? -6.117  -6.670  -6.133  1.00 0.00 ? 10  PRO A HA   1  
ATOM   134   H HB3  . PRO A 1 10  ? -6.048  -8.992  -5.781  1.00 0.00 ? 10  PRO A HB3  1  
ATOM   135   H HG3  . PRO A 1 10  ? -7.068  -10.507 -7.263  1.00 0.00 ? 10  PRO A HG3  1  
ATOM   136   H HD3  . PRO A 1 10  ? -8.850  -9.077  -6.751  1.00 0.00 ? 10  PRO A HD3  1  
ATOM   137   N N    . GLU A 1 11  ? -4.992  -5.507  -8.023  1.00 0.00 ? 11  GLU A N    1  
ATOM   138   C CA   . GLU A 1 11  ? -4.567  -4.608  -9.097  1.00 0.00 ? 11  GLU A CA   1  
ATOM   139   C C    . GLU A 1 11  ? -3.511  -3.610  -8.592  1.00 0.00 ? 11  GLU A C    1  
ATOM   140   O O    . GLU A 1 11  ? -3.214  -3.509  -7.395  1.00 0.00 ? 11  GLU A O    1  
ATOM   141   C CB   . GLU A 1 11  ? -5.785  -3.842  -9.717  1.00 0.00 ? 11  GLU A CB   1  
ATOM   142   C CG   . GLU A 1 11  ? -5.645  -3.623  -11.244 1.00 0.00 ? 11  GLU A CG   1  
ATOM   143   C CD   . GLU A 1 11  ? -6.637  -2.603  -11.857 1.00 0.00 ? 11  GLU A CD   1  
ATOM   144   O OE1  . GLU A 1 11  ? -7.869  -2.811  -11.748 1.00 0.00 ? 11  GLU A OE1  1  
ATOM   145   O OE2  . GLU A 1 11  ? -6.175  -1.650  -12.537 1.00 0.00 ? 11  GLU A OE2  1  
ATOM   146   H H    . GLU A 1 11  ? -4.823  -5.206  -7.068  1.00 0.00 ? 11  GLU A H    1  
ATOM   147   H HA   . GLU A 1 11  ? -4.107  -5.209  -9.875  1.00 0.00 ? 11  GLU A HA   1  
ATOM   148   H HB3  . GLU A 1 11  ? -5.898  -2.879  -9.216  1.00 0.00 ? 11  GLU A HB3  1  
ATOM   149   H HG3  . GLU A 1 11  ? -5.783  -4.585  -11.739 1.00 0.00 ? 11  GLU A HG3  1  
ATOM   150   N N    . ILE A 1 12  ? -2.969  -2.826  -9.523  1.00 0.00 ? 12  ILE A N    1  
ATOM   151   C CA   . ILE A 1 12  ? -2.341  -1.542  -9.219  1.00 0.00 ? 12  ILE A CA   1  
ATOM   152   C C    . ILE A 1 12  ? -3.369  -0.609  -8.552  1.00 0.00 ? 12  ILE A C    1  
ATOM   153   O O    . ILE A 1 12  ? -4.498  -0.476  -9.021  1.00 0.00 ? 12  ILE A O    1  
ATOM   154   C CB   . ILE A 1 12  ? -1.720  -0.928  -10.503 1.00 0.00 ? 12  ILE A CB   1  
ATOM   155   C CG1  . ILE A 1 12  ? -0.801  0.266   -10.154 1.00 0.00 ? 12  ILE A CG1  1  
ATOM   156   C CG2  . ILE A 1 12  ? -2.763  -0.536  -11.569 1.00 0.00 ? 12  ILE A CG2  1  
ATOM   157   C CD1  . ILE A 1 12  ? -0.093  0.903   -11.357 1.00 0.00 ? 12  ILE A CD1  1  
ATOM   158   H H    . ILE A 1 12  ? -3.289  -2.950  -10.471 1.00 0.00 ? 12  ILE A H    1  
ATOM   159   H HA   . ILE A 1 12  ? -1.534  -1.728  -8.516  1.00 0.00 ? 12  ILE A HA   1  
ATOM   160   H HB   . ILE A 1 12  ? -1.081  -1.696  -10.948 1.00 0.00 ? 12  ILE A HB   1  
ATOM   161   H HG13 . ILE A 1 12  ? -0.023  -0.091  -9.481  1.00 0.00 ? 12  ILE A HG13 1  
ATOM   162   H HG21 . ILE A 1 12  ? -3.311  0.352   -11.256 1.00 0.00 ? 12  ILE A HG21 1  
ATOM   163   H HG22 . ILE A 1 12  ? -2.277  -0.341  -12.525 1.00 0.00 ? 12  ILE A HG22 1  
ATOM   164   H HG23 . ILE A 1 12  ? -3.481  -1.339  -11.721 1.00 0.00 ? 12  ILE A HG23 1  
ATOM   165   H HD11 . ILE A 1 12  ? -0.813  1.408   -12.003 1.00 0.00 ? 12  ILE A HD11 1  
ATOM   166   H HD12 . ILE A 1 12  ? 0.629   1.639   -11.000 1.00 0.00 ? 12  ILE A HD12 1  
ATOM   167   H HD13 . ILE A 1 12  ? 0.434   0.135   -11.923 1.00 0.00 ? 12  ILE A HD13 1  
ATOM   168   N N    . ILE A 1 13  ? -2.970  0.087   -7.490  1.00 0.00 ? 13  ILE A N    1  
ATOM   169   C CA   . ILE A 1 13  ? -3.743  1.176   -6.875  1.00 0.00 ? 13  ILE A CA   1  
ATOM   170   C C    . ILE A 1 13  ? -2.788  2.352   -6.661  1.00 0.00 ? 13  ILE A C    1  
ATOM   171   O O    . ILE A 1 13  ? -1.599  2.168   -6.412  1.00 0.00 ? 13  ILE A O    1  
ATOM   172   C CB   . ILE A 1 13  ? -4.473  0.708   -5.586  1.00 0.00 ? 13  ILE A CB   1  
ATOM   173   C CG1  . ILE A 1 13  ? -5.525  -0.370  -5.957  1.00 0.00 ? 13  ILE A CG1  1  
ATOM   174   C CG2  . ILE A 1 13  ? -5.132  1.895   -4.848  1.00 0.00 ? 13  ILE A CG2  1  
ATOM   175   C CD1  . ILE A 1 13  ? -6.511  -0.760  -4.848  1.00 0.00 ? 13  ILE A CD1  1  
ATOM   176   H H    . ILE A 1 13  ? -2.010  -0.038  -7.180  1.00 0.00 ? 13  ILE A H    1  
ATOM   177   H HA   . ILE A 1 13  ? -4.505  1.509   -7.579  1.00 0.00 ? 13  ILE A HA   1  
ATOM   178   H HB   . ILE A 1 13  ? -3.743  0.258   -4.908  1.00 0.00 ? 13  ILE A HB   1  
ATOM   179   H HG13 . ILE A 1 13  ? -5.000  -1.273  -6.262  1.00 0.00 ? 13  ILE A HG13 1  
ATOM   180   H HG21 . ILE A 1 13  ? -5.874  2.372   -5.489  1.00 0.00 ? 13  ILE A HG21 1  
ATOM   181   H HG22 . ILE A 1 13  ? -5.620  1.553   -3.937  1.00 0.00 ? 13  ILE A HG22 1  
ATOM   182   H HG23 . ILE A 1 13  ? -4.383  2.624   -4.542  1.00 0.00 ? 13  ILE A HG23 1  
ATOM   183   H HD11 . ILE A 1 13  ? -7.246  0.032   -4.706  1.00 0.00 ? 13  ILE A HD11 1  
ATOM   184   H HD12 . ILE A 1 13  ? -7.034  -1.673  -5.134  1.00 0.00 ? 13  ILE A HD12 1  
ATOM   185   H HD13 . ILE A 1 13  ? -5.977  -0.927  -3.914  1.00 0.00 ? 13  ILE A HD13 1  
ATOM   186   N N    . THR A 1 14  ? -3.277  3.583   -6.777  1.00 0.00 ? 14  THR A N    1  
ATOM   187   C CA   . THR A 1 14  ? -2.448  4.782   -6.619  1.00 0.00 ? 14  THR A CA   1  
ATOM   188   C C    . THR A 1 14  ? -3.141  5.810   -5.741  1.00 0.00 ? 14  THR A C    1  
ATOM   189   O O    . THR A 1 14  ? -4.367  5.921   -5.741  1.00 0.00 ? 14  THR A O    1  
ATOM   190   C CB   . THR A 1 14  ? -2.012  5.337   -7.982  1.00 0.00 ? 14  THR A CB   1  
ATOM   191   O OG1  . THR A 1 14  ? -1.075  6.368   -7.800  1.00 0.00 ? 14  THR A OG1  1  
ATOM   192   C CG2  . THR A 1 14  ? -3.152  5.889   -8.836  1.00 0.00 ? 14  THR A CG2  1  
ATOM   193   H H    . THR A 1 14  ? -4.265  3.711   -6.932  1.00 0.00 ? 14  THR A H    1  
ATOM   194   H HA   . THR A 1 14  ? -1.540  4.496   -6.093  1.00 0.00 ? 14  THR A HA   1  
ATOM   195   H HB   . THR A 1 14  ? -1.528  4.531   -8.537  1.00 0.00 ? 14  THR A HB   1  
ATOM   196   H HG1  . THR A 1 14  ? -0.330  6.029   -7.291  1.00 0.00 ? 14  THR A HG1  1  
ATOM   197   H HG21 . THR A 1 14  ? -3.637  6.727   -8.335  1.00 0.00 ? 14  THR A HG21 1  
ATOM   198   H HG22 . THR A 1 14  ? -2.751  6.230   -9.792  1.00 0.00 ? 14  THR A HG22 1  
ATOM   199   H HG23 . THR A 1 14  ? -3.888  5.107   -9.026  1.00 0.00 ? 14  THR A HG23 1  
ATOM   200   N N    . VAL A 1 15  ? -2.351  6.509   -4.926  1.00 0.00 ? 15  VAL A N    1  
ATOM   201   C CA   . VAL A 1 15  ? -2.833  7.238   -3.753  1.00 0.00 ? 15  VAL A CA   1  
ATOM   202   C C    . VAL A 1 15  ? -2.115  8.586   -3.662  1.00 0.00 ? 15  VAL A C    1  
ATOM   203   O O    . VAL A 1 15  ? -0.970  8.689   -3.217  1.00 0.00 ? 15  VAL A O    1  
ATOM   204   C CB   . VAL A 1 15  ? -2.714  6.397   -2.455  1.00 0.00 ? 15  VAL A CB   1  
ATOM   205   C CG1  . VAL A 1 15  ? -4.046  6.473   -1.718  1.00 0.00 ? 15  VAL A CG1  1  
ATOM   206   C CG2  . VAL A 1 15  ? -2.415  4.896   -2.628  1.00 0.00 ? 15  VAL A CG2  1  
ATOM   207   H H    . VAL A 1 15  ? -1.353  6.338   -4.985  1.00 0.00 ? 15  VAL A H    1  
ATOM   208   H HA   . VAL A 1 15  ? -3.888  7.457   -3.911  1.00 0.00 ? 15  VAL A HA   1  
ATOM   209   H HB   . VAL A 1 15  ? -1.947  6.817   -1.806  1.00 0.00 ? 15  VAL A HB   1  
ATOM   210   H HG11 . VAL A 1 15  ? -4.830  6.026   -2.334  1.00 0.00 ? 15  VAL A HG11 1  
ATOM   211   H HG12 . VAL A 1 15  ? -3.989  5.933   -0.772  1.00 0.00 ? 15  VAL A HG12 1  
ATOM   212   H HG13 . VAL A 1 15  ? -4.296  7.514   -1.519  1.00 0.00 ? 15  VAL A HG13 1  
ATOM   213   H HG21 . VAL A 1 15  ? -1.472  4.747   -3.150  1.00 0.00 ? 15  VAL A HG21 1  
ATOM   214   H HG22 . VAL A 1 15  ? -2.332  4.426   -1.648  1.00 0.00 ? 15  VAL A HG22 1  
ATOM   215   H HG23 . VAL A 1 15  ? -3.213  4.407   -3.190  1.00 0.00 ? 15  VAL A HG23 1  
ATOM   216   N N    . THR A 1 16  ? -2.770  9.615   -4.203  1.00 0.00 ? 16  THR A N    1  
ATOM   217   C CA   . THR A 1 16  ? -2.251  10.984  -4.323  1.00 0.00 ? 16  THR A CA   1  
ATOM   218   C C    . THR A 1 16  ? -2.277  11.749  -2.996  1.00 0.00 ? 16  THR A C    1  
ATOM   219   O O    . THR A 1 16  ? -3.095  11.508  -2.107  1.00 0.00 ? 16  THR A O    1  
ATOM   220   C CB   . THR A 1 16  ? -3.051  11.781  -5.369  1.00 0.00 ? 16  THR A CB   1  
ATOM   221   O OG1  . THR A 1 16  ? -4.426  11.730  -5.077  1.00 0.00 ? 16  THR A OG1  1  
ATOM   222   C CG2  . THR A 1 16  ? -2.878  11.233  -6.785  1.00 0.00 ? 16  THR A CG2  1  
ATOM   223   H H    . THR A 1 16  ? -3.714  9.464   -4.539  1.00 0.00 ? 16  THR A H    1  
ATOM   224   H HA   . THR A 1 16  ? -1.216  10.938  -4.654  1.00 0.00 ? 16  THR A HA   1  
ATOM   225   H HB   . THR A 1 16  ? -2.720  12.820  -5.359  1.00 0.00 ? 16  THR A HB   1  
ATOM   226   H HG1  . THR A 1 16  ? -4.906  12.148  -5.799  1.00 0.00 ? 16  THR A HG1  1  
ATOM   227   H HG21 . THR A 1 16  ? -3.212  10.195  -6.840  1.00 0.00 ? 16  THR A HG21 1  
ATOM   228   H HG22 . THR A 1 16  ? -3.460  11.833  -7.486  1.00 0.00 ? 16  THR A HG22 1  
ATOM   229   H HG23 . THR A 1 16  ? -1.830  11.287  -7.074  1.00 0.00 ? 16  THR A HG23 1  
ATOM   230   N N    . LEU A 1 17  ? -1.388  12.734  -2.861  1.00 0.00 ? 17  LEU A N    1  
ATOM   231   C CA   . LEU A 1 17  ? -1.272  13.610  -1.686  1.00 0.00 ? 17  LEU A CA   1  
ATOM   232   C C    . LEU A 1 17  ? -2.329  14.744  -1.700  1.00 0.00 ? 17  LEU A C    1  
ATOM   233   O O    . LEU A 1 17  ? -2.003  15.908  -1.479  1.00 0.00 ? 17  LEU A O    1  
ATOM   234   C CB   . LEU A 1 17  ? 0.192   14.112  -1.577  1.00 0.00 ? 17  LEU A CB   1  
ATOM   235   C CG   . LEU A 1 17  ? 1.214   13.161  -0.913  1.00 0.00 ? 17  LEU A CG   1  
ATOM   236   C CD1  . LEU A 1 17  ? 1.198   13.309  0.608   1.00 0.00 ? 17  LEU A CD1  1  
ATOM   237   C CD2  . LEU A 1 17  ? 1.046   11.667  -1.214  1.00 0.00 ? 17  LEU A CD2  1  
ATOM   238   H H    . LEU A 1 17  ? -0.695  12.855  -3.596  1.00 0.00 ? 17  LEU A H    1  
ATOM   239   H HA   . LEU A 1 17  ? -1.484  13.016  -0.799  1.00 0.00 ? 17  LEU A HA   1  
ATOM   240   H HB3  . LEU A 1 17  ? 0.221   15.042  -1.010  1.00 0.00 ? 17  LEU A HB3  1  
ATOM   241   H HG   . LEU A 1 17  ? 2.205   13.456  -1.252  1.00 0.00 ? 17  LEU A HG   1  
ATOM   242   H HD11 . LEU A 1 17  ? 0.225   13.025  1.002   1.00 0.00 ? 17  LEU A HD11 1  
ATOM   243   H HD12 . LEU A 1 17  ? 1.965   12.673  1.043   1.00 0.00 ? 17  LEU A HD12 1  
ATOM   244   H HD13 . LEU A 1 17  ? 1.412   14.342  0.879   1.00 0.00 ? 17  LEU A HD13 1  
ATOM   245   H HD21 . LEU A 1 17  ? 1.001   11.502  -2.284  1.00 0.00 ? 17  LEU A HD21 1  
ATOM   246   H HD22 . LEU A 1 17  ? 1.905   11.119  -0.827  1.00 0.00 ? 17  LEU A HD22 1  
ATOM   247   H HD23 . LEU A 1 17  ? 0.132   11.282  -0.763  1.00 0.00 ? 17  LEU A HD23 1  
ATOM   248   N N    . LYS A 1 18  ? -3.608  14.395  -1.922  1.00 0.00 ? 18  LYS A N    1  
ATOM   249   C CA   . LYS A 1 18  ? -4.801  15.278  -2.023  1.00 0.00 ? 18  LYS A CA   1  
ATOM   250   C C    . LYS A 1 18  ? -4.835  16.503  -1.094  1.00 0.00 ? 18  LYS A C    1  
ATOM   251   O O    . LYS A 1 18  ? -5.349  17.546  -1.482  1.00 0.00 ? 18  LYS A O    1  
ATOM   252   C CB   . LYS A 1 18  ? -6.038  14.395  -1.763  1.00 0.00 ? 18  LYS A CB   1  
ATOM   253   C CG   . LYS A 1 18  ? -7.396  15.124  -1.779  1.00 0.00 ? 18  LYS A CG   1  
ATOM   254   C CD   . LYS A 1 18  ? -7.810  15.596  -3.182  1.00 0.00 ? 18  LYS A CD   1  
ATOM   255   C CE   . LYS A 1 18  ? -9.216  16.211  -3.214  1.00 0.00 ? 18  LYS A CE   1  
ATOM   256   N NZ   . LYS A 1 18  ? -10.245 15.289  -2.677  1.00 0.00 ? 18  LYS A NZ   1  
ATOM   257   H H    . LYS A 1 18  ? -3.769  13.398  -2.060  1.00 0.00 ? 18  LYS A H    1  
ATOM   258   H HA   . LYS A 1 18  ? -4.852  15.669  -3.038  1.00 0.00 ? 18  LYS A HA   1  
ATOM   259   H HB3  . LYS A 1 18  ? -5.932  13.930  -0.780  1.00 0.00 ? 18  LYS A HB3  1  
ATOM   260   H HG3  . LYS A 1 18  ? -7.392  15.968  -1.091  1.00 0.00 ? 18  LYS A HG3  1  
ATOM   261   H HD3  . LYS A 1 18  ? -7.782  14.744  -3.866  1.00 0.00 ? 18  LYS A HD3  1  
ATOM   262   H HE3  . LYS A 1 18  ? -9.451  16.462  -4.253  1.00 0.00 ? 18  LYS A HE3  1  
ATOM   263   H HZ1  . LYS A 1 18  ? -10.224 15.305  -1.659  1.00 0.00 ? 18  LYS A HZ1  1  
ATOM   264   H HZ2  . LYS A 1 18  ? -11.177 15.552  -2.946  1.00 0.00 ? 18  LYS A HZ2  1  
ATOM   265   H HZ3  . LYS A 1 18  ? -10.057 14.325  -2.970  1.00 0.00 ? 18  LYS A HZ3  1  
ATOM   266   N N    . LYS A 1 19  ? -4.333  16.349  0.135   1.00 0.00 ? 19  LYS A N    1  
ATOM   267   C CA   . LYS A 1 19  ? -4.345  17.351  1.214   1.00 0.00 ? 19  LYS A CA   1  
ATOM   268   C C    . LYS A 1 19  ? -2.974  17.498  1.899   1.00 0.00 ? 19  LYS A C    1  
ATOM   269   O O    . LYS A 1 19  ? -2.903  17.872  3.064   1.00 0.00 ? 19  LYS A O    1  
ATOM   270   C CB   . LYS A 1 19  ? -5.523  17.006  2.150   1.00 0.00 ? 19  LYS A CB   1  
ATOM   271   C CG   . LYS A 1 19  ? -5.902  18.136  3.127   1.00 0.00 ? 19  LYS A CG   1  
ATOM   272   C CD   . LYS A 1 19  ? -7.400  18.119  3.466   1.00 0.00 ? 19  LYS A CD   1  
ATOM   273   C CE   . LYS A 1 19  ? -8.213  18.731  2.317   1.00 0.00 ? 19  LYS A CE   1  
ATOM   274   N NZ   . LYS A 1 19  ? -9.665  18.512  2.499   1.00 0.00 ? 19  LYS A NZ   1  
ATOM   275   H H    . LYS A 1 19  ? -3.946  15.443  0.333   1.00 0.00 ? 19  LYS A H    1  
ATOM   276   H HA   . LYS A 1 19  ? -4.545  18.326  0.763   1.00 0.00 ? 19  LYS A HA   1  
ATOM   277   H HB3  . LYS A 1 19  ? -5.290  16.104  2.719   1.00 0.00 ? 19  LYS A HB3  1  
ATOM   278   H HG3  . LYS A 1 19  ? -5.648  19.109  2.700   1.00 0.00 ? 19  LYS A HG3  1  
ATOM   279   H HD3  . LYS A 1 19  ? -7.567  18.708  4.369   1.00 0.00 ? 19  LYS A HD3  1  
ATOM   280   H HE3  . LYS A 1 19  ? -7.900  18.284  1.370   1.00 0.00 ? 19  LYS A HE3  1  
ATOM   281   H HZ1  . LYS A 1 19  ? -9.971  18.733  3.446   1.00 0.00 ? 19  LYS A HZ1  1  
ATOM   282   H HZ2  . LYS A 1 19  ? -10.202 19.043  1.829   1.00 0.00 ? 19  LYS A HZ2  1  
ATOM   283   H HZ3  . LYS A 1 19  ? -9.905  17.545  2.283   1.00 0.00 ? 19  LYS A HZ3  1  
ATOM   284   N N    . GLN A 1 20  ? -1.900  17.133  1.183   1.00 0.00 ? 20  GLN A N    1  
ATOM   285   C CA   . GLN A 1 20  ? -0.461  17.293  1.482   1.00 0.00 ? 20  GLN A CA   1  
ATOM   286   C C    . GLN A 1 20  ? 0.105   16.798  2.839   1.00 0.00 ? 20  GLN A C    1  
ATOM   287   O O    . GLN A 1 20  ? 1.322   16.689  2.958   1.00 0.00 ? 20  GLN A O    1  
ATOM   288   C CB   . GLN A 1 20  ? -0.032  18.754  1.219   1.00 0.00 ? 20  GLN A CB   1  
ATOM   289   C CG   . GLN A 1 20  ? -0.241  19.246  -0.229  1.00 0.00 ? 20  GLN A CG   1  
ATOM   290   C CD   . GLN A 1 20  ? -1.536  20.032  -0.457  1.00 0.00 ? 20  GLN A CD   1  
ATOM   291   O OE1  . GLN A 1 20  ? -2.568  19.808  0.144   1.00 0.00 ? 20  GLN A OE1  1  
ATOM   292   N NE2  . GLN A 1 20  ? -1.533  21.007  -1.340  1.00 0.00 ? 20  GLN A NE2  1  
ATOM   293   H H    . GLN A 1 20  ? -2.105  16.875  0.225   1.00 0.00 ? 20  GLN A H    1  
ATOM   294   H HA   . GLN A 1 20  ? 0.063   16.689  0.741   1.00 0.00 ? 20  GLN A HA   1  
ATOM   295   H HB3  . GLN A 1 20  ? 1.037   18.826  1.427   1.00 0.00 ? 20  GLN A HB3  1  
ATOM   296   H HG3  . GLN A 1 20  ? -0.205  18.406  -0.924  1.00 0.00 ? 20  GLN A HG3  1  
ATOM   297   H HE21 . GLN A 1 20  ? -0.710  21.243  -1.858  1.00 0.00 ? 20  GLN A HE21 1  
ATOM   298   H HE22 . GLN A 1 20  ? -2.407  21.493  -1.448  1.00 0.00 ? 20  GLN A HE22 1  
ATOM   299   N N    . ASN A 1 21  ? -0.718  16.468  3.842   1.00 0.00 ? 21  ASN A N    1  
ATOM   300   C CA   . ASN A 1 21  ? -0.357  16.091  5.222   1.00 0.00 ? 21  ASN A CA   1  
ATOM   301   C C    . ASN A 1 21  ? 0.310   14.698  5.356   1.00 0.00 ? 21  ASN A C    1  
ATOM   302   O O    . ASN A 1 21  ? -0.110  13.867  6.160   1.00 0.00 ? 21  ASN A O    1  
ATOM   303   C CB   . ASN A 1 21  ? -1.633  16.213  6.087   1.00 0.00 ? 21  ASN A CB   1  
ATOM   304   C CG   . ASN A 1 21  ? -1.324  16.218  7.579   1.00 0.00 ? 21  ASN A CG   1  
ATOM   305   O OD1  . ASN A 1 21  ? -0.665  17.111  8.083   1.00 0.00 ? 21  ASN A OD1  1  
ATOM   306   N ND2  . ASN A 1 21  ? -1.792  15.263  8.349   1.00 0.00 ? 21  ASN A ND2  1  
ATOM   307   H H    . ASN A 1 21  ? -1.694  16.678  3.688   1.00 0.00 ? 21  ASN A H    1  
ATOM   308   H HA   . ASN A 1 21  ? 0.370   16.822  5.588   1.00 0.00 ? 21  ASN A HA   1  
ATOM   309   H HB3  . ASN A 1 21  ? -2.316  15.397  5.854   1.00 0.00 ? 21  ASN A HB3  1  
ATOM   310   H HD21 . ASN A 1 21  ? -2.253  14.446  7.974   1.00 0.00 ? 21  ASN A HD21 1  
ATOM   311   H HD22 . ASN A 1 21  ? -1.510  15.281  9.307   1.00 0.00 ? 21  ASN A HD22 1  
ATOM   312   N N    . GLY A 1 22  ? 1.288   14.388  4.502   1.00 0.00 ? 22  GLY A N    1  
ATOM   313   C CA   . GLY A 1 22  ? 1.785   13.028  4.285   1.00 0.00 ? 22  GLY A CA   1  
ATOM   314   C C    . GLY A 1 22  ? 0.697   12.076  3.766   1.00 0.00 ? 22  GLY A C    1  
ATOM   315   O O    . GLY A 1 22  ? -0.457  12.452  3.552   1.00 0.00 ? 22  GLY A O    1  
ATOM   316   H H    . GLY A 1 22  ? 1.592   15.119  3.867   1.00 0.00 ? 22  GLY A H    1  
ATOM   317   H HA2  . GLY A 1 22  ? 2.599   13.056  3.565   1.00 0.00 ? 22  GLY A HA2  1  
ATOM   318   H HA3  . GLY A 1 22  ? 2.170   12.636  5.228   1.00 0.00 ? 22  GLY A HA3  1  
ATOM   319   N N    . MET A 1 23  ? 1.054   10.809  3.535   1.00 0.00 ? 23  MET A N    1  
ATOM   320   C CA   . MET A 1 23  ? 0.069   9.790   3.154   1.00 0.00 ? 23  MET A CA   1  
ATOM   321   C C    . MET A 1 23  ? -0.840  9.414   4.328   1.00 0.00 ? 23  MET A C    1  
ATOM   322   O O    . MET A 1 23  ? -2.060  9.430   4.170   1.00 0.00 ? 23  MET A O    1  
ATOM   323   C CB   . MET A 1 23  ? 0.785   8.554   2.593   1.00 0.00 ? 23  MET A CB   1  
ATOM   324   C CG   . MET A 1 23  ? 1.332   8.820   1.184   1.00 0.00 ? 23  MET A CG   1  
ATOM   325   S SD   . MET A 1 23  ? 3.088   8.462   0.938   1.00 0.00 ? 23  MET A SD   1  
ATOM   326   C CE   . MET A 1 23  ? 3.122   6.703   1.358   1.00 0.00 ? 23  MET A CE   1  
ATOM   327   H H    . MET A 1 23  ? 2.011   10.530  3.693   1.00 0.00 ? 23  MET A H    1  
ATOM   328   H HA   . MET A 1 23  ? -0.576  10.192  2.370   1.00 0.00 ? 23  MET A HA   1  
ATOM   329   H HB3  . MET A 1 23  ? 0.092   7.714   2.540   1.00 0.00 ? 23  MET A HB3  1  
ATOM   330   H HG3  . MET A 1 23  ? 1.174   9.870   0.935   1.00 0.00 ? 23  MET A HG3  1  
ATOM   331   H HE1  . MET A 1 23  ? 2.377   6.172   0.766   1.00 0.00 ? 23  MET A HE1  1  
ATOM   332   H HE2  . MET A 1 23  ? 4.110   6.300   1.137   1.00 0.00 ? 23  MET A HE2  1  
ATOM   333   H HE3  . MET A 1 23  ? 2.904   6.564   2.418   1.00 0.00 ? 23  MET A HE3  1  
ATOM   334   N N    . GLY A 1 24  ? -0.261  9.113   5.496   1.00 0.00 ? 24  GLY A N    1  
ATOM   335   C CA   . GLY A 1 24  ? -1.003  8.643   6.668   1.00 0.00 ? 24  GLY A CA   1  
ATOM   336   C C    . GLY A 1 24  ? -1.594  7.249   6.459   1.00 0.00 ? 24  GLY A C    1  
ATOM   337   O O    . GLY A 1 24  ? -2.807  7.076   6.504   1.00 0.00 ? 24  GLY A O    1  
ATOM   338   H H    . GLY A 1 24  ? 0.749   9.117   5.551   1.00 0.00 ? 24  GLY A H    1  
ATOM   339   H HA2  . GLY A 1 24  ? -0.331  8.601   7.524   1.00 0.00 ? 24  GLY A HA2  1  
ATOM   340   H HA3  . GLY A 1 24  ? -1.814  9.329   6.899   1.00 0.00 ? 24  GLY A HA3  1  
ATOM   341   N N    . LEU A 1 25  ? -0.752  6.247   6.225   1.00 0.00 ? 25  LEU A N    1  
ATOM   342   C CA   . LEU A 1 25  ? -1.155  4.860   5.967   1.00 0.00 ? 25  LEU A CA   1  
ATOM   343   C C    . LEU A 1 25  ? -0.360  3.901   6.873   1.00 0.00 ? 25  LEU A C    1  
ATOM   344   O O    . LEU A 1 25  ? 0.560   4.303   7.574   1.00 0.00 ? 25  LEU A O    1  
ATOM   345   C CB   . LEU A 1 25  ? -0.975  4.558   4.465   1.00 0.00 ? 25  LEU A CB   1  
ATOM   346   C CG   . LEU A 1 25  ? -1.868  5.366   3.501   1.00 0.00 ? 25  LEU A CG   1  
ATOM   347   C CD1  . LEU A 1 25  ? -1.504  5.025   2.057   1.00 0.00 ? 25  LEU A CD1  1  
ATOM   348   C CD2  . LEU A 1 25  ? -3.354  5.072   3.690   1.00 0.00 ? 25  LEU A CD2  1  
ATOM   349   H H    . LEU A 1 25  ? 0.236   6.409   6.388   1.00 0.00 ? 25  LEU A H    1  
ATOM   350   H HA   . LEU A 1 25  ? -2.204  4.719   6.225   1.00 0.00 ? 25  LEU A HA   1  
ATOM   351   H HB3  . LEU A 1 25  ? -1.171  3.499   4.297   1.00 0.00 ? 25  LEU A HB3  1  
ATOM   352   H HG   . LEU A 1 25  ? -1.701  6.433   3.648   1.00 0.00 ? 25  LEU A HG   1  
ATOM   353   H HD11 . LEU A 1 25  ? -1.631  3.958   1.884   1.00 0.00 ? 25  LEU A HD11 1  
ATOM   354   H HD12 . LEU A 1 25  ? -2.155  5.560   1.369   1.00 0.00 ? 25  LEU A HD12 1  
ATOM   355   H HD13 . LEU A 1 25  ? -0.472  5.306   1.857   1.00 0.00 ? 25  LEU A HD13 1  
ATOM   356   H HD21 . LEU A 1 25  ? -3.686  5.480   4.643   1.00 0.00 ? 25  LEU A HD21 1  
ATOM   357   H HD22 . LEU A 1 25  ? -3.934  5.555   2.904   1.00 0.00 ? 25  LEU A HD22 1  
ATOM   358   H HD23 . LEU A 1 25  ? -3.533  3.997   3.663   1.00 0.00 ? 25  LEU A HD23 1  
ATOM   359   N N    . SER A 1 26  ? -0.699  2.617   6.894   1.00 0.00 ? 26  SER A N    1  
ATOM   360   C CA   . SER A 1 26  ? -0.073  1.627   7.774   1.00 0.00 ? 26  SER A CA   1  
ATOM   361   C C    . SER A 1 26  ? 0.105   0.318   7.014   1.00 0.00 ? 26  SER A C    1  
ATOM   362   O O    . SER A 1 26  ? -0.856  -0.223  6.466   1.00 0.00 ? 26  SER A O    1  
ATOM   363   C CB   . SER A 1 26  ? -0.947  1.435   9.015   1.00 0.00 ? 26  SER A CB   1  
ATOM   364   O OG   . SER A 1 26  ? -0.305  0.572   9.929   1.00 0.00 ? 26  SER A OG   1  
ATOM   365   H H    . SER A 1 26  ? -1.533  2.321   6.396   1.00 0.00 ? 26  SER A H    1  
ATOM   366   H HA   . SER A 1 26  ? 0.901   1.974   8.112   1.00 0.00 ? 26  SER A HA   1  
ATOM   367   H HB3  . SER A 1 26  ? -1.907  1.012   8.726   1.00 0.00 ? 26  SER A HB3  1  
ATOM   368   H HG   . SER A 1 26  ? -0.822  0.580   10.741  1.00 0.00 ? 26  SER A HG   1  
ATOM   369   N N    . ILE A 1 27  ? 1.340   -0.185  6.953   1.00 0.00 ? 27  ILE A N    1  
ATOM   370   C CA   . ILE A 1 27  ? 1.711   -1.426  6.259   1.00 0.00 ? 27  ILE A CA   1  
ATOM   371   C C    . ILE A 1 27  ? 2.619   -2.268  7.140   1.00 0.00 ? 27  ILE A C    1  
ATOM   372   O O    . ILE A 1 27  ? 3.371   -1.749  7.962   1.00 0.00 ? 27  ILE A O    1  
ATOM   373   C CB   . ILE A 1 27  ? 2.377   -1.208  4.876   1.00 0.00 ? 27  ILE A CB   1  
ATOM   374   C CG1  . ILE A 1 27  ? 3.556   -0.207  4.904   1.00 0.00 ? 27  ILE A CG1  1  
ATOM   375   C CG2  . ILE A 1 27  ? 1.319   -0.801  3.849   1.00 0.00 ? 27  ILE A CG2  1  
ATOM   376   C CD1  . ILE A 1 27  ? 4.915   -0.911  4.943   1.00 0.00 ? 27  ILE A CD1  1  
ATOM   377   H H    . ILE A 1 27  ? 2.055   0.235   7.532   1.00 0.00 ? 27  ILE A H    1  
ATOM   378   H HA   . ILE A 1 27  ? 0.806   -2.004  6.098   1.00 0.00 ? 27  ILE A HA   1  
ATOM   379   H HB   . ILE A 1 27  ? 2.762   -2.170  4.521   1.00 0.00 ? 27  ILE A HB   1  
ATOM   380   H HG13 . ILE A 1 27  ? 3.488   0.441   5.774   1.00 0.00 ? 27  ILE A HG13 1  
ATOM   381   H HG21 . ILE A 1 27  ? 0.742   0.043   4.214   1.00 0.00 ? 27  ILE A HG21 1  
ATOM   382   H HG22 . ILE A 1 27  ? 1.789   -0.545  2.903   1.00 0.00 ? 27  ILE A HG22 1  
ATOM   383   H HG23 . ILE A 1 27  ? 0.655   -1.641  3.665   1.00 0.00 ? 27  ILE A HG23 1  
ATOM   384   H HD11 . ILE A 1 27  ? 5.041   -1.542  4.060   1.00 0.00 ? 27  ILE A HD11 1  
ATOM   385   H HD12 . ILE A 1 27  ? 5.707   -0.162  4.966   1.00 0.00 ? 27  ILE A HD12 1  
ATOM   386   H HD13 . ILE A 1 27  ? 4.988   -1.528  5.837   1.00 0.00 ? 27  ILE A HD13 1  
ATOM   387   N N    . VAL A 1 28  ? 2.555   -3.576  6.909   1.00 0.00 ? 28  VAL A N    1  
ATOM   388   C CA   . VAL A 1 28  ? 3.413   -4.589  7.529   1.00 0.00 ? 28  VAL A CA   1  
ATOM   389   C C    . VAL A 1 28  ? 3.847   -5.564  6.443   1.00 0.00 ? 28  VAL A C    1  
ATOM   390   O O    . VAL A 1 28  ? 3.005   -6.103  5.722   1.00 0.00 ? 28  VAL A O    1  
ATOM   391   C CB   . VAL A 1 28  ? 2.684   -5.325  8.677   1.00 0.00 ? 28  VAL A CB   1  
ATOM   392   C CG1  . VAL A 1 28  ? 3.544   -6.432  9.307   1.00 0.00 ? 28  VAL A CG1  1  
ATOM   393   C CG2  . VAL A 1 28  ? 2.286   -4.362  9.807   1.00 0.00 ? 28  VAL A CG2  1  
ATOM   394   H H    . VAL A 1 28  ? 1.875   -3.891  6.222   1.00 0.00 ? 28  VAL A H    1  
ATOM   395   H HA   . VAL A 1 28  ? 4.302   -4.108  7.935   1.00 0.00 ? 28  VAL A HA   1  
ATOM   396   H HB   . VAL A 1 28  ? 1.773   -5.785  8.290   1.00 0.00 ? 28  VAL A HB   1  
ATOM   397   H HG11 . VAL A 1 28  ? 4.501   -6.031  9.646   1.00 0.00 ? 28  VAL A HG11 1  
ATOM   398   H HG12 . VAL A 1 28  ? 3.025   -6.872  10.157  1.00 0.00 ? 28  VAL A HG12 1  
ATOM   399   H HG13 . VAL A 1 28  ? 3.722   -7.226  8.583   1.00 0.00 ? 28  VAL A HG13 1  
ATOM   400   H HG21 . VAL A 1 28  ? 1.587   -3.617  9.432   1.00 0.00 ? 28  VAL A HG21 1  
ATOM   401   H HG22 . VAL A 1 28  ? 1.805   -4.912  10.614  1.00 0.00 ? 28  VAL A HG22 1  
ATOM   402   H HG23 . VAL A 1 28  ? 3.172   -3.854  10.195  1.00 0.00 ? 28  VAL A HG23 1  
ATOM   403   N N    . ALA A 1 29  ? 5.155   -5.791  6.329   1.00 0.00 ? 29  ALA A N    1  
ATOM   404   C CA   . ALA A 1 29  ? 5.694   -6.906  5.559   1.00 0.00 ? 29  ALA A CA   1  
ATOM   405   C C    . ALA A 1 29  ? 5.971   -8.115  6.460   1.00 0.00 ? 29  ALA A C    1  
ATOM   406   O O    . ALA A 1 29  ? 6.106   -8.007  7.679   1.00 0.00 ? 29  ALA A O    1  
ATOM   407   C CB   . ALA A 1 29  ? 6.972   -6.492  4.823   1.00 0.00 ? 29  ALA A CB   1  
ATOM   408   H H    . ALA A 1 29  ? 5.768   -5.360  7.014   1.00 0.00 ? 29  ALA A H    1  
ATOM   409   H HA   . ALA A 1 29  ? 4.978   -7.218  4.809   1.00 0.00 ? 29  ALA A HA   1  
ATOM   410   H HB1  . ALA A 1 29  ? 7.770   -6.319  5.542   1.00 0.00 ? 29  ALA A HB1  1  
ATOM   411   H HB2  . ALA A 1 29  ? 7.274   -7.299  4.157   1.00 0.00 ? 29  ALA A HB2  1  
ATOM   412   H HB3  . ALA A 1 29  ? 6.783   -5.602  4.228   1.00 0.00 ? 29  ALA A HB3  1  
ATOM   413   N N    . ALA A 1 30  ? 6.143   -9.265  5.824   1.00 0.00 ? 30  ALA A N    1  
ATOM   414   C CA   . ALA A 1 30  ? 6.726   -10.453 6.418   1.00 0.00 ? 30  ALA A CA   1  
ATOM   415   C C    . ALA A 1 30  ? 7.968   -10.870 5.617   1.00 0.00 ? 30  ALA A C    1  
ATOM   416   O O    . ALA A 1 30  ? 8.232   -10.365 4.520   1.00 0.00 ? 30  ALA A O    1  
ATOM   417   C CB   . ALA A 1 30  ? 5.649   -11.543 6.496   1.00 0.00 ? 30  ALA A CB   1  
ATOM   418   H H    . ALA A 1 30  ? 5.984   -9.282  4.821   1.00 0.00 ? 30  ALA A H    1  
ATOM   419   H HA   . ALA A 1 30  ? 7.056   -10.237 7.431   1.00 0.00 ? 30  ALA A HA   1  
ATOM   420   H HB1  . ALA A 1 30  ? 5.253   -11.754 5.504   1.00 0.00 ? 30  ALA A HB1  1  
ATOM   421   H HB2  . ALA A 1 30  ? 6.061   -12.457 6.926   1.00 0.00 ? 30  ALA A HB2  1  
ATOM   422   H HB3  . ALA A 1 30  ? 4.833   -11.195 7.132   1.00 0.00 ? 30  ALA A HB3  1  
ATOM   423   N N    . LYS A 1 31  ? 8.719   -11.826 6.154   1.00 0.00 ? 31  LYS A N    1  
ATOM   424   C CA   . LYS A 1 31  ? 9.890   -12.437 5.522   1.00 0.00 ? 31  LYS A CA   1  
ATOM   425   C C    . LYS A 1 31  ? 9.769   -13.959 5.547   1.00 0.00 ? 31  LYS A C    1  
ATOM   426   O O    . LYS A 1 31  ? 8.892   -14.517 6.206   1.00 0.00 ? 31  LYS A O    1  
ATOM   427   C CB   . LYS A 1 31  ? 11.165  -11.921 6.224   1.00 0.00 ? 31  LYS A CB   1  
ATOM   428   C CG   . LYS A 1 31  ? 11.513  -10.512 5.709   1.00 0.00 ? 31  LYS A CG   1  
ATOM   429   C CD   . LYS A 1 31  ? 12.760  -9.886  6.333   1.00 0.00 ? 31  LYS A CD   1  
ATOM   430   C CE   . LYS A 1 31  ? 12.533  -9.516  7.800   1.00 0.00 ? 31  LYS A CE   1  
ATOM   431   N NZ   . LYS A 1 31  ? 13.599  -8.610  8.271   1.00 0.00 ? 31  LYS A NZ   1  
ATOM   432   H H    . LYS A 1 31  ? 8.487   -12.131 7.094   1.00 0.00 ? 31  LYS A H    1  
ATOM   433   H HA   . LYS A 1 31  ? 9.937   -12.162 4.467   1.00 0.00 ? 31  LYS A HA   1  
ATOM   434   H HB3  . LYS A 1 31  ? 12.007  -12.582 6.012   1.00 0.00 ? 31  LYS A HB3  1  
ATOM   435   H HG3  . LYS A 1 31  ? 10.671  -9.839  5.874   1.00 0.00 ? 31  LYS A HG3  1  
ATOM   436   H HD3  . LYS A 1 31  ? 12.991  -8.979  5.772   1.00 0.00 ? 31  LYS A HD3  1  
ATOM   437   H HE3  . LYS A 1 31  ? 12.512  -10.425 8.406   1.00 0.00 ? 31  LYS A HE3  1  
ATOM   438   H HZ1  . LYS A 1 31  ? 13.513  -7.705  7.806   1.00 0.00 ? 31  LYS A HZ1  1  
ATOM   439   H HZ2  . LYS A 1 31  ? 13.540  -8.488  9.281   1.00 0.00 ? 31  LYS A HZ2  1  
ATOM   440   H HZ3  . LYS A 1 31  ? 14.520  -8.983  8.052   1.00 0.00 ? 31  LYS A HZ3  1  
ATOM   441   N N    . GLY A 1 32  ? 10.657  -14.635 4.826   1.00 0.00 ? 32  GLY A N    1  
ATOM   442   C CA   . GLY A 1 32  ? 10.804  -16.092 4.855   1.00 0.00 ? 32  GLY A CA   1  
ATOM   443   C C    . GLY A 1 32  ? 11.684  -16.560 6.019   1.00 0.00 ? 32  GLY A C    1  
ATOM   444   O O    . GLY A 1 32  ? 12.652  -17.283 5.798   1.00 0.00 ? 32  GLY A O    1  
ATOM   445   H H    . GLY A 1 32  ? 11.318  -14.096 4.272   1.00 0.00 ? 32  GLY A H    1  
ATOM   446   H HA2  . GLY A 1 32  ? 9.822   -16.558 4.959   1.00 0.00 ? 32  GLY A HA2  1  
ATOM   447   H HA3  . GLY A 1 32  ? 11.253  -16.425 3.921   1.00 0.00 ? 32  GLY A HA3  1  
ATOM   448   N N    . ALA A 1 33  ? 11.411  -16.091 7.240   1.00 0.00 ? 33  ALA A N    1  
ATOM   449   C CA   . ALA A 1 33  ? 12.266  -16.299 8.408   1.00 0.00 ? 33  ALA A CA   1  
ATOM   450   C C    . ALA A 1 33  ? 11.440  -16.363 9.702   1.00 0.00 ? 33  ALA A C    1  
ATOM   451   O O    . ALA A 1 33  ? 10.590  -15.509 9.947   1.00 0.00 ? 33  ALA A O    1  
ATOM   452   C CB   . ALA A 1 33  ? 13.289  -15.155 8.467   1.00 0.00 ? 33  ALA A CB   1  
ATOM   453   H H    . ALA A 1 33  ? 10.543  -15.585 7.378   1.00 0.00 ? 33  ALA A H    1  
ATOM   454   H HA   . ALA A 1 33  ? 12.805  -17.242 8.297   1.00 0.00 ? 33  ALA A HA   1  
ATOM   455   H HB1  . ALA A 1 33  ? 12.769  -14.202 8.567   1.00 0.00 ? 33  ALA A HB1  1  
ATOM   456   H HB2  . ALA A 1 33  ? 13.950  -15.292 9.322   1.00 0.00 ? 33  ALA A HB2  1  
ATOM   457   H HB3  . ALA A 1 33  ? 13.885  -15.146 7.553   1.00 0.00 ? 33  ALA A HB3  1  
ATOM   458   N N    . GLY A 1 34  ? 11.691  -17.380 10.535  1.00 0.00 ? 34  GLY A N    1  
ATOM   459   C CA   . GLY A 1 34  ? 10.983  -17.625 11.807  1.00 0.00 ? 34  GLY A CA   1  
ATOM   460   C C    . GLY A 1 34  ? 9.549   -18.150 11.647  1.00 0.00 ? 34  GLY A C    1  
ATOM   461   O O    . GLY A 1 34  ? 9.125   -19.018 12.405  1.00 0.00 ? 34  GLY A O    1  
ATOM   462   H H    . GLY A 1 34  ? 12.393  -18.049 10.261  1.00 0.00 ? 34  GLY A H    1  
ATOM   463   H HA2  . GLY A 1 34  ? 11.548  -18.343 12.400  1.00 0.00 ? 34  GLY A HA2  1  
ATOM   464   H HA3  . GLY A 1 34  ? 10.932  -16.686 12.363  1.00 0.00 ? 34  GLY A HA3  1  
ATOM   465   N N    . GLN A 1 35  ? 8.835   -17.683 10.624  1.00 0.00 ? 35  GLN A N    1  
ATOM   466   C CA   . GLN A 1 35  ? 7.698   -18.354 9.998   1.00 0.00 ? 35  GLN A CA   1  
ATOM   467   C C    . GLN A 1 35  ? 7.888   -18.354 8.469   1.00 0.00 ? 35  GLN A C    1  
ATOM   468   O O    . GLN A 1 35  ? 8.614   -17.545 7.897   1.00 0.00 ? 35  GLN A O    1  
ATOM   469   C CB   . GLN A 1 35  ? 6.358   -17.715 10.403  1.00 0.00 ? 35  GLN A CB   1  
ATOM   470   C CG   . GLN A 1 35  ? 5.935   -18.016 11.850  1.00 0.00 ? 35  GLN A CG   1  
ATOM   471   C CD   . GLN A 1 35  ? 6.317   -16.915 12.836  1.00 0.00 ? 35  GLN A CD   1  
ATOM   472   O OE1  . GLN A 1 35  ? 5.709   -15.856 12.878  1.00 0.00 ? 35  GLN A OE1  1  
ATOM   473   N NE2  . GLN A 1 35  ? 7.309   -17.131 13.670  1.00 0.00 ? 35  GLN A NE2  1  
ATOM   474   H H    . GLN A 1 35  ? 9.233   -16.907 10.103  1.00 0.00 ? 35  GLN A H    1  
ATOM   475   H HA   . GLN A 1 35  ? 7.684   -19.400 10.311  1.00 0.00 ? 35  GLN A HA   1  
ATOM   476   H HB3  . GLN A 1 35  ? 5.591   -18.138 9.757   1.00 0.00 ? 35  GLN A HB3  1  
ATOM   477   H HG3  . GLN A 1 35  ? 6.348   -18.972 12.172  1.00 0.00 ? 35  GLN A HG3  1  
ATOM   478   H HE21 . GLN A 1 35  ? 7.840   -17.992 13.603  1.00 0.00 ? 35  GLN A HE21 1  
ATOM   479   H HE22 . GLN A 1 35  ? 7.509   -16.421 14.349  1.00 0.00 ? 35  GLN A HE22 1  
ATOM   480   N N    . ASP A 1 36  ? 7.242   -19.306 7.806   1.00 0.00 ? 36  ASP A N    1  
ATOM   481   C CA   . ASP A 1 36  ? 7.403   -19.728 6.405   1.00 0.00 ? 36  ASP A CA   1  
ATOM   482   C C    . ASP A 1 36  ? 6.787   -18.798 5.331   1.00 0.00 ? 36  ASP A C    1  
ATOM   483   O O    . ASP A 1 36  ? 6.629   -19.192 4.171   1.00 0.00 ? 36  ASP A O    1  
ATOM   484   C CB   . ASP A 1 36  ? 6.751   -21.124 6.307   1.00 0.00 ? 36  ASP A CB   1  
ATOM   485   C CG   . ASP A 1 36  ? 5.247   -21.114 6.633   1.00 0.00 ? 36  ASP A CG   1  
ATOM   486   O OD1  . ASP A 1 36  ? 4.875   -20.764 7.771   1.00 0.00 ? 36  ASP A OD1  1  
ATOM   487   O OD2  . ASP A 1 36  ? 4.430   -21.520 5.767   1.00 0.00 ? 36  ASP A OD2  1  
ATOM   488   H H    . ASP A 1 36  ? 6.554   -19.854 8.322   1.00 0.00 ? 36  ASP A H    1  
ATOM   489   H HA   . ASP A 1 36  ? 8.469   -19.821 6.183   1.00 0.00 ? 36  ASP A HA   1  
ATOM   490   H HB3  . ASP A 1 36  ? 7.251   -21.796 7.008   1.00 0.00 ? 36  ASP A HB3  1  
ATOM   491   N N    . LYS A 1 37  ? 6.359   -17.585 5.705   1.00 0.00 ? 37  LYS A N    1  
ATOM   492   C CA   . LYS A 1 37  ? 5.149   -16.996 5.100   1.00 0.00 ? 37  LYS A CA   1  
ATOM   493   C C    . LYS A 1 37  ? 5.394   -15.958 4.001   1.00 0.00 ? 37  LYS A C    1  
ATOM   494   O O    . LYS A 1 37  ? 4.756   -16.071 2.956   1.00 0.00 ? 37  LYS A O    1  
ATOM   495   C CB   . LYS A 1 37  ? 4.241   -16.442 6.211   1.00 0.00 ? 37  LYS A CB   1  
ATOM   496   C CG   . LYS A 1 37  ? 3.803   -17.562 7.170   1.00 0.00 ? 37  LYS A CG   1  
ATOM   497   C CD   . LYS A 1 37  ? 2.901   -17.044 8.292   1.00 0.00 ? 37  LYS A CD   1  
ATOM   498   C CE   . LYS A 1 37  ? 2.600   -18.188 9.265   1.00 0.00 ? 37  LYS A CE   1  
ATOM   499   N NZ   . LYS A 1 37  ? 1.683   -17.741 10.333  1.00 0.00 ? 37  LYS A NZ   1  
ATOM   500   H H    . LYS A 1 37  ? 6.639   -17.275 6.625   1.00 0.00 ? 37  LYS A H    1  
ATOM   501   H HA   . LYS A 1 37  ? 4.592   -17.794 4.605   1.00 0.00 ? 37  LYS A HA   1  
ATOM   502   H HB3  . LYS A 1 37  ? 3.354   -15.999 5.755   1.00 0.00 ? 37  LYS A HB3  1  
ATOM   503   H HG3  . LYS A 1 37  ? 4.682   -18.010 7.629   1.00 0.00 ? 37  LYS A HG3  1  
ATOM   504   H HD3  . LYS A 1 37  ? 1.971   -16.670 7.860   1.00 0.00 ? 37  LYS A HD3  1  
ATOM   505   H HE3  . LYS A 1 37  ? 3.538   -18.542 9.701   1.00 0.00 ? 37  LYS A HE3  1  
ATOM   506   H HZ1  . LYS A 1 37  ? 0.772   -17.513 9.963   1.00 0.00 ? 37  LYS A HZ1  1  
ATOM   507   H HZ2  . LYS A 1 37  ? 1.573   -18.450 11.059  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM   508   H HZ3  . LYS A 1 37  ? 2.074   -16.941 10.832  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM   509   N N    . LEU A 1 38  ? 6.321   -15.007 4.195   1.00 0.00 ? 38  LEU A N    1  
ATOM   510   C CA   . LEU A 1 38  ? 6.546   -13.842 3.305   1.00 0.00 ? 38  LEU A CA   1  
ATOM   511   C C    . LEU A 1 38  ? 5.261   -12.999 3.043   1.00 0.00 ? 38  LEU A C    1  
ATOM   512   O O    . LEU A 1 38  ? 4.178   -13.328 3.524   1.00 0.00 ? 38  LEU A O    1  
ATOM   513   C CB   . LEU A 1 38  ? 7.268   -14.363 2.032   1.00 0.00 ? 38  LEU A CB   1  
ATOM   514   C CG   . LEU A 1 38  ? 7.834   -13.341 1.023   1.00 0.00 ? 38  LEU A CG   1  
ATOM   515   C CD1  . LEU A 1 38  ? 8.831   -12.375 1.662   1.00 0.00 ? 38  LEU A CD1  1  
ATOM   516   C CD2  . LEU A 1 38  ? 8.556   -14.079 -0.105  1.00 0.00 ? 38  LEU A CD2  1  
ATOM   517   H H    . LEU A 1 38  ? 6.847   -15.048 5.057   1.00 0.00 ? 38  LEU A H    1  
ATOM   518   H HA   . LEU A 1 38  ? 7.237   -13.178 3.824   1.00 0.00 ? 38  LEU A HA   1  
ATOM   519   H HB3  . LEU A 1 38  ? 6.576   -15.005 1.485   1.00 0.00 ? 38  LEU A HB3  1  
ATOM   520   H HG   . LEU A 1 38  ? 7.022   -12.774 0.578   1.00 0.00 ? 38  LEU A HG   1  
ATOM   521   H HD11 . LEU A 1 38  ? 9.646   -12.929 2.123   1.00 0.00 ? 38  LEU A HD11 1  
ATOM   522   H HD12 . LEU A 1 38  ? 9.234   -11.713 0.897   1.00 0.00 ? 38  LEU A HD12 1  
ATOM   523   H HD13 . LEU A 1 38  ? 8.334   -11.763 2.409   1.00 0.00 ? 38  LEU A HD13 1  
ATOM   524   H HD21 . LEU A 1 38  ? 7.869   -14.771 -0.591  1.00 0.00 ? 38  LEU A HD21 1  
ATOM   525   H HD22 . LEU A 1 38  ? 8.896   -13.359 -0.851  1.00 0.00 ? 38  LEU A HD22 1  
ATOM   526   H HD23 . LEU A 1 38  ? 9.412   -14.632 0.285   1.00 0.00 ? 38  LEU A HD23 1  
ATOM   527   N N    . GLY A 1 39  ? 5.375   -11.871 2.337   1.00 0.00 ? 39  GLY A N    1  
ATOM   528   C CA   . GLY A 1 39  ? 4.240   -11.040 1.894   1.00 0.00 ? 39  GLY A CA   1  
ATOM   529   C C    . GLY A 1 39  ? 4.264   -9.604  2.425   1.00 0.00 ? 39  GLY A C    1  
ATOM   530   O O    . GLY A 1 39  ? 5.186   -9.209  3.142   1.00 0.00 ? 39  GLY A O    1  
ATOM   531   H H    . GLY A 1 39  ? 6.294   -11.588 2.032   1.00 0.00 ? 39  GLY A H    1  
ATOM   532   H HA2  . GLY A 1 39  ? 4.247   -10.995 0.805   1.00 0.00 ? 39  GLY A HA2  1  
ATOM   533   H HA3  . GLY A 1 39  ? 3.296   -11.494 2.197   1.00 0.00 ? 39  GLY A HA3  1  
ATOM   534   N N    . ILE A 1 40  ? 3.238   -8.818  2.085   1.00 0.00 ? 40  ILE A N    1  
ATOM   535   C CA   . ILE A 1 40  ? 3.027   -7.445  2.568   1.00 0.00 ? 40  ILE A CA   1  
ATOM   536   C C    . ILE A 1 40  ? 1.517   -7.180  2.671   1.00 0.00 ? 40  ILE A C    1  
ATOM   537   O O    . ILE A 1 40  ? 0.739   -7.735  1.899   1.00 0.00 ? 40  ILE A O    1  
ATOM   538   C CB   . ILE A 1 40  ? 3.699   -6.381  1.652   1.00 0.00 ? 40  ILE A CB   1  
ATOM   539   C CG1  . ILE A 1 40  ? 4.960   -6.834  0.873   1.00 0.00 ? 40  ILE A CG1  1  
ATOM   540   C CG2  . ILE A 1 40  ? 3.988   -5.107  2.467   1.00 0.00 ? 40  ILE A CG2  1  
ATOM   541   C CD1  . ILE A 1 40  ? 5.345   -5.873  -0.258  1.00 0.00 ? 40  ILE A CD1  1  
ATOM   542   H H    . ILE A 1 40  ? 2.510   -9.185  1.485   1.00 0.00 ? 40  ILE A H    1  
ATOM   543   H HA   . ILE A 1 40  ? 3.439   -7.373  3.567   1.00 0.00 ? 40  ILE A HA   1  
ATOM   544   H HB   . ILE A 1 40  ? 2.969   -6.115  0.900   1.00 0.00 ? 40  ILE A HB   1  
ATOM   545   H HG13 . ILE A 1 40  ? 4.767   -7.788  0.384   1.00 0.00 ? 40  ILE A HG13 1  
ATOM   546   H HG21 . ILE A 1 40  ? 4.698   -5.324  3.261   1.00 0.00 ? 40  ILE A HG21 1  
ATOM   547   H HG22 . ILE A 1 40  ? 4.399   -4.327  1.826   1.00 0.00 ? 40  ILE A HG22 1  
ATOM   548   H HG23 . ILE A 1 40  ? 3.072   -4.715  2.907   1.00 0.00 ? 40  ILE A HG23 1  
ATOM   549   H HD11 . ILE A 1 40  ? 5.788   -4.960  0.140   1.00 0.00 ? 40  ILE A HD11 1  
ATOM   550   H HD12 . ILE A 1 40  ? 6.064   -6.360  -0.914  1.00 0.00 ? 40  ILE A HD12 1  
ATOM   551   H HD13 . ILE A 1 40  ? 4.469   -5.633  -0.859  1.00 0.00 ? 40  ILE A HD13 1  
ATOM   552   N N    . TYR A 1 41  ? 1.087   -6.335  3.609   1.00 0.00 ? 41  TYR A N    1  
ATOM   553   C CA   . TYR A 1 41  ? -0.324  -6.030  3.871   1.00 0.00 ? 41  TYR A CA   1  
ATOM   554   C C    . TYR A 1 41  ? -0.506  -4.572  4.307   1.00 0.00 ? 41  TYR A C    1  
ATOM   555   O O    . TYR A 1 41  ? 0.243   -4.083  5.153   1.00 0.00 ? 41  TYR A O    1  
ATOM   556   C CB   . TYR A 1 41  ? -0.857  -6.961  4.979   1.00 0.00 ? 41  TYR A CB   1  
ATOM   557   C CG   . TYR A 1 41  ? -0.752  -8.439  4.649   1.00 0.00 ? 41  TYR A CG   1  
ATOM   558   C CD1  . TYR A 1 41  ? -1.787  -9.072  3.934   1.00 0.00 ? 41  TYR A CD1  1  
ATOM   559   C CD2  . TYR A 1 41  ? 0.409   -9.157  4.996   1.00 0.00 ? 41  TYR A CD2  1  
ATOM   560   C CE1  . TYR A 1 41  ? -1.634  -10.407 3.514   1.00 0.00 ? 41  TYR A CE1  1  
ATOM   561   C CE2  . TYR A 1 41  ? 0.570   -10.489 4.567   1.00 0.00 ? 41  TYR A CE2  1  
ATOM   562   C CZ   . TYR A 1 41  ? -0.437  -11.102 3.794   1.00 0.00 ? 41  TYR A CZ   1  
ATOM   563   O OH   . TYR A 1 41  ? -0.235  -12.345 3.286   1.00 0.00 ? 41  TYR A OH   1  
ATOM   564   H H    . TYR A 1 41  ? 1.768   -5.978  4.272   1.00 0.00 ? 41  TYR A H    1  
ATOM   565   H HA   . TYR A 1 41  ? -0.910  -6.198  2.970   1.00 0.00 ? 41  TYR A HA   1  
ATOM   566   H HB3  . TYR A 1 41  ? -1.905  -6.720  5.164   1.00 0.00 ? 41  TYR A HB3  1  
ATOM   567   H HD1  . TYR A 1 41  ? -2.686  -8.524  3.679   1.00 0.00 ? 41  TYR A HD1  1  
ATOM   568   H HD2  . TYR A 1 41  ? 1.202   -8.668  5.547   1.00 0.00 ? 41  TYR A HD2  1  
ATOM   569   H HE1  . TYR A 1 41  ? -2.417  -10.894 2.956   1.00 0.00 ? 41  TYR A HE1  1  
ATOM   570   H HE2  . TYR A 1 41  ? 1.476   -11.036 4.783   1.00 0.00 ? 41  TYR A HE2  1  
ATOM   571   H HH   . TYR A 1 41  ? -0.865  -12.537 2.575   1.00 0.00 ? 41  TYR A HH   1  
ATOM   572   N N    . VAL A 1 42  ? -1.531  -3.894  3.782   1.00 0.00 ? 42  VAL A N    1  
ATOM   573   C CA   . VAL A 1 42  ? -2.074  -2.644  4.340   1.00 0.00 ? 42  VAL A CA   1  
ATOM   574   C C    . VAL A 1 42  ? -2.784  -2.971  5.650   1.00 0.00 ? 42  VAL A C    1  
ATOM   575   O O    . VAL A 1 42  ? -3.910  -3.466  5.653   1.00 0.00 ? 42  VAL A O    1  
ATOM   576   C CB   . VAL A 1 42  ? -3.027  -1.934  3.356   1.00 0.00 ? 42  VAL A CB   1  
ATOM   577   C CG1  . VAL A 1 42  ? -3.561  -0.615  3.935   1.00 0.00 ? 42  VAL A CG1  1  
ATOM   578   C CG2  . VAL A 1 42  ? -2.321  -1.603  2.034   1.00 0.00 ? 42  VAL A CG2  1  
ATOM   579   H H    . VAL A 1 42  ? -2.069  -4.344  3.046   1.00 0.00 ? 42  VAL A H    1  
ATOM   580   H HA   . VAL A 1 42  ? -1.258  -1.963  4.562   1.00 0.00 ? 42  VAL A HA   1  
ATOM   581   H HB   . VAL A 1 42  ? -3.872  -2.587  3.146   1.00 0.00 ? 42  VAL A HB   1  
ATOM   582   H HG11 . VAL A 1 42  ? -2.736  0.046   4.207   1.00 0.00 ? 42  VAL A HG11 1  
ATOM   583   H HG12 . VAL A 1 42  ? -4.194  -0.124  3.199   1.00 0.00 ? 42  VAL A HG12 1  
ATOM   584   H HG13 . VAL A 1 42  ? -4.172  -0.813  4.816   1.00 0.00 ? 42  VAL A HG13 1  
ATOM   585   H HG21 . VAL A 1 42  ? -1.988  -2.518  1.546   1.00 0.00 ? 42  VAL A HG21 1  
ATOM   586   H HG22 . VAL A 1 42  ? -3.020  -1.103  1.362   1.00 0.00 ? 42  VAL A HG22 1  
ATOM   587   H HG23 . VAL A 1 42  ? -1.465  -0.950  2.214   1.00 0.00 ? 42  VAL A HG23 1  
ATOM   588   N N    . LYS A 1 43  ? -2.118  -2.736  6.782   1.00 0.00 ? 43  LYS A N    1  
ATOM   589   C CA   . LYS A 1 43  ? -2.711  -2.924  8.112   1.00 0.00 ? 43  LYS A CA   1  
ATOM   590   C C    . LYS A 1 43  ? -3.879  -1.958  8.345   1.00 0.00 ? 43  LYS A C    1  
ATOM   591   O O    . LYS A 1 43  ? -4.899  -2.378  8.880   1.00 0.00 ? 43  LYS A O    1  
ATOM   592   C CB   . LYS A 1 43  ? -1.609  -2.858  9.184   1.00 0.00 ? 43  LYS A CB   1  
ATOM   593   C CG   . LYS A 1 43  ? -2.151  -3.052  10.613  1.00 0.00 ? 43  LYS A CG   1  
ATOM   594   C CD   . LYS A 1 43  ? -1.058  -3.518  11.587  1.00 0.00 ? 43  LYS A CD   1  
ATOM   595   C CE   . LYS A 1 43  ? -1.589  -3.509  13.027  1.00 0.00 ? 43  LYS A CE   1  
ATOM   596   N NZ   . LYS A 1 43  ? -0.738  -4.307  13.942  1.00 0.00 ? 43  LYS A NZ   1  
ATOM   597   H H    . LYS A 1 43  ? -1.217  -2.280  6.703   1.00 0.00 ? 43  LYS A H    1  
ATOM   598   H HA   . LYS A 1 43  ? -3.154  -3.922  8.148   1.00 0.00 ? 43  LYS A HA   1  
ATOM   599   H HB3  . LYS A 1 43  ? -1.091  -1.900  9.126   1.00 0.00 ? 43  LYS A HB3  1  
ATOM   600   H HG3  . LYS A 1 43  ? -2.942  -3.806  10.602  1.00 0.00 ? 43  LYS A HG3  1  
ATOM   601   H HD3  . LYS A 1 43  ? -0.195  -2.853  11.520  1.00 0.00 ? 43  LYS A HD3  1  
ATOM   602   H HE3  . LYS A 1 43  ? -2.606  -3.911  13.040  1.00 0.00 ? 43  LYS A HE3  1  
ATOM   603   H HZ1  . LYS A 1 43  ? 0.260   -4.166  13.791  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM   604   H HZ2  . LYS A 1 43  ? -0.932  -4.084  14.915  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM   605   H HZ3  . LYS A 1 43  ? -0.902  -5.308  13.833  1.00 0.00 ? 43  LYS A HZ3  1  
ATOM   606   N N    . SER A 1 44  ? -3.768  -0.707  7.882   1.00 0.00 ? 44  SER A N    1  
ATOM   607   C CA   . SER A 1 44  ? -4.846  0.293   7.940   1.00 0.00 ? 44  SER A CA   1  
ATOM   608   C C    . SER A 1 44  ? -4.507  1.579   7.168   1.00 0.00 ? 44  SER A C    1  
ATOM   609   O O    . SER A 1 44  ? -3.375  1.800   6.741   1.00 0.00 ? 44  SER A O    1  
ATOM   610   C CB   . SER A 1 44  ? -5.160  0.648   9.410   1.00 0.00 ? 44  SER A CB   1  
ATOM   611   O OG   . SER A 1 44  ? -4.094  1.351   10.018  1.00 0.00 ? 44  SER A OG   1  
ATOM   612   H H    . SER A 1 44  ? -2.901  -0.433  7.436   1.00 0.00 ? 44  SER A H    1  
ATOM   613   H HA   . SER A 1 44  ? -5.743  -0.141  7.497   1.00 0.00 ? 44  SER A HA   1  
ATOM   614   H HB3  . SER A 1 44  ? -5.358  -0.256  9.983   1.00 0.00 ? 44  SER A HB3  1  
ATOM   615   H HG   . SER A 1 44  ? -4.335  2.296   9.995   1.00 0.00 ? 44  SER A HG   1  
ATOM   616   N N    . VAL A 1 45  ? -5.482  2.482   7.058   1.00 0.00 ? 45  VAL A N    1  
ATOM   617   C CA   . VAL A 1 45  ? -5.231  3.935   6.993   1.00 0.00 ? 45  VAL A CA   1  
ATOM   618   C C    . VAL A 1 45  ? -4.850  4.478   8.388   1.00 0.00 ? 45  VAL A C    1  
ATOM   619   O O    . VAL A 1 45  ? -5.075  3.786   9.382   1.00 0.00 ? 45  VAL A O    1  
ATOM   620   C CB   . VAL A 1 45  ? -6.483  4.661   6.463   1.00 0.00 ? 45  VAL A CB   1  
ATOM   621   C CG1  . VAL A 1 45  ? -6.805  4.264   5.018   1.00 0.00 ? 45  VAL A CG1  1  
ATOM   622   C CG2  . VAL A 1 45  ? -7.741  4.444   7.317   1.00 0.00 ? 45  VAL A CG2  1  
ATOM   623   H H    . VAL A 1 45  ? -6.403  2.211   7.363   1.00 0.00 ? 45  VAL A H    1  
ATOM   624   H HA   . VAL A 1 45  ? -4.405  4.128   6.310   1.00 0.00 ? 45  VAL A HA   1  
ATOM   625   H HB   . VAL A 1 45  ? -6.255  5.717   6.465   1.00 0.00 ? 45  VAL A HB   1  
ATOM   626   H HG11 . VAL A 1 45  ? -7.091  3.214   4.965   1.00 0.00 ? 45  VAL A HG11 1  
ATOM   627   H HG12 . VAL A 1 45  ? -7.629  4.879   4.651   1.00 0.00 ? 45  VAL A HG12 1  
ATOM   628   H HG13 . VAL A 1 45  ? -5.939  4.430   4.383   1.00 0.00 ? 45  VAL A HG13 1  
ATOM   629   H HG21 . VAL A 1 45  ? -7.565  4.759   8.344   1.00 0.00 ? 45  VAL A HG21 1  
ATOM   630   H HG22 . VAL A 1 45  ? -8.550  5.053   6.909   1.00 0.00 ? 45  VAL A HG22 1  
ATOM   631   H HG23 . VAL A 1 45  ? -8.049  3.400   7.300   1.00 0.00 ? 45  VAL A HG23 1  
ATOM   632   N N    . VAL A 1 46  ? -4.329  5.705   8.513   1.00 0.00 ? 46  VAL A N    1  
ATOM   633   C CA   . VAL A 1 46  ? -3.944  6.296   9.825   1.00 0.00 ? 46  VAL A CA   1  
ATOM   634   C C    . VAL A 1 46  ? -4.928  7.382   10.300  1.00 0.00 ? 46  VAL A C    1  
ATOM   635   O O    . VAL A 1 46  ? -4.652  8.083   11.267  1.00 0.00 ? 46  VAL A O    1  
ATOM   636   C CB   . VAL A 1 46  ? -2.448  6.709   9.837   1.00 0.00 ? 46  VAL A CB   1  
ATOM   637   C CG1  . VAL A 1 46  ? -1.894  7.366   11.115  1.00 0.00 ? 46  VAL A CG1  1  
ATOM   638   C CG2  . VAL A 1 46  ? -1.587  5.453   9.649   1.00 0.00 ? 46  VAL A CG2  1  
ATOM   639   H H    . VAL A 1 46  ? -4.095  6.229   7.674   1.00 0.00 ? 46  VAL A H    1  
ATOM   640   H HA   . VAL A 1 46  ? -4.033  5.524   10.591  1.00 0.00 ? 46  VAL A HA   1  
ATOM   641   H HB   . VAL A 1 46  ? -2.266  7.398   9.019   1.00 0.00 ? 46  VAL A HB   1  
ATOM   642   H HG11 . VAL A 1 46  ? -2.213  6.801   11.992  1.00 0.00 ? 46  VAL A HG11 1  
ATOM   643   H HG12 . VAL A 1 46  ? -0.806  7.402   11.081  1.00 0.00 ? 46  VAL A HG12 1  
ATOM   644   H HG13 . VAL A 1 46  ? -2.249  8.393   11.179  1.00 0.00 ? 46  VAL A HG13 1  
ATOM   645   H HG21 . VAL A 1 46  ? -1.904  4.904   8.769   1.00 0.00 ? 46  VAL A HG21 1  
ATOM   646   H HG22 . VAL A 1 46  ? -0.541  5.735   9.520   1.00 0.00 ? 46  VAL A HG22 1  
ATOM   647   H HG23 . VAL A 1 46  ? -1.678  4.799   10.518  1.00 0.00 ? 46  VAL A HG23 1  
ATOM   648   N N    . LYS A 1 47  ? -6.118  7.496   9.676   1.00 0.00 ? 47  LYS A N    1  
ATOM   649   C CA   . LYS A 1 47  ? -7.240  8.321   10.184  1.00 0.00 ? 47  LYS A CA   1  
ATOM   650   C C    . LYS A 1 47  ? -6.832  9.805   10.347  1.00 0.00 ? 47  LYS A C    1  
ATOM   651   O O    . LYS A 1 47  ? -7.195  10.463  11.324  1.00 0.00 ? 47  LYS A O    1  
ATOM   652   C CB   . LYS A 1 47  ? -7.745  7.609   11.467  1.00 0.00 ? 47  LYS A CB   1  
ATOM   653   C CG   . LYS A 1 47  ? -9.028  8.087   12.167  1.00 0.00 ? 47  LYS A CG   1  
ATOM   654   C CD   . LYS A 1 47  ? -9.267  7.149   13.366  1.00 0.00 ? 47  LYS A CD   1  
ATOM   655   C CE   . LYS A 1 47  ? -10.305 7.665   14.365  1.00 0.00 ? 47  LYS A CE   1  
ATOM   656   N NZ   . LYS A 1 47  ? -10.400 6.734   15.513  1.00 0.00 ? 47  LYS A NZ   1  
ATOM   657   H H    . LYS A 1 47  ? -6.279  6.957   8.837   1.00 0.00 ? 47  LYS A H    1  
ATOM   658   H HA   . LYS A 1 47  ? -8.035  8.307   9.438   1.00 0.00 ? 47  LYS A HA   1  
ATOM   659   H HB3  . LYS A 1 47  ? -6.947  7.645   12.209  1.00 0.00 ? 47  LYS A HB3  1  
ATOM   660   H HG3  . LYS A 1 47  ? -9.876  8.040   11.480  1.00 0.00 ? 47  LYS A HG3  1  
ATOM   661   H HD3  . LYS A 1 47  ? -8.324  7.028   13.909  1.00 0.00 ? 47  LYS A HD3  1  
ATOM   662   H HE3  . LYS A 1 47  ? -11.277 7.752   13.870  1.00 0.00 ? 47  LYS A HE3  1  
ATOM   663   H HZ1  . LYS A 1 47  ? -9.483  6.558   15.929  1.00 0.00 ? 47  LYS A HZ1  1  
ATOM   664   H HZ2  . LYS A 1 47  ? -11.023 7.046   16.248  1.00 0.00 ? 47  LYS A HZ2  1  
ATOM   665   H HZ3  . LYS A 1 47  ? -10.776 5.836   15.218  1.00 0.00 ? 47  LYS A HZ3  1  
ATOM   666   N N    . GLY A 1 48  ? -5.983  10.313  9.451   1.00 0.00 ? 48  GLY A N    1  
ATOM   667   C CA   . GLY A 1 48  ? -5.376  11.645  9.541   1.00 0.00 ? 48  GLY A CA   1  
ATOM   668   C C    . GLY A 1 48  ? -4.324  11.999  8.473   1.00 0.00 ? 48  GLY A C    1  
ATOM   669   O O    . GLY A 1 48  ? -3.364  12.698  8.793   1.00 0.00 ? 48  GLY A O    1  
ATOM   670   H H    . GLY A 1 48  ? -5.903  9.809   8.575   1.00 0.00 ? 48  GLY A H    1  
ATOM   671   H HA2  . GLY A 1 48  ? -6.171  12.386  9.470   1.00 0.00 ? 48  GLY A HA2  1  
ATOM   672   H HA3  . GLY A 1 48  ? -4.902  11.749  10.517  1.00 0.00 ? 48  GLY A HA3  1  
ATOM   673   N N    . GLY A 1 49  ? -4.472  11.559  7.218   1.00 0.00 ? 49  GLY A N    1  
ATOM   674   C CA   . GLY A 1 49  ? -3.500  11.851  6.146   1.00 0.00 ? 49  GLY A CA   1  
ATOM   675   C C    . GLY A 1 49  ? -4.125  11.976  4.759   1.00 0.00 ? 49  GLY A C    1  
ATOM   676   O O    . GLY A 1 49  ? -5.291  11.647  4.559   1.00 0.00 ? 49  GLY A O    1  
ATOM   677   H H    . GLY A 1 49  ? -5.323  11.049  6.973   1.00 0.00 ? 49  GLY A H    1  
ATOM   678   H HA2  . GLY A 1 49  ? -2.978  12.783  6.360   1.00 0.00 ? 49  GLY A HA2  1  
ATOM   679   H HA3  . GLY A 1 49  ? -2.757  11.060  6.110   1.00 0.00 ? 49  GLY A HA3  1  
ATOM   680   N N    . ALA A 1 50  ? -3.370  12.479  3.779   1.00 0.00 ? 50  ALA A N    1  
ATOM   681   C CA   . ALA A 1 50  ? -3.912  12.775  2.450   1.00 0.00 ? 50  ALA A CA   1  
ATOM   682   C C    . ALA A 1 50  ? -4.317  11.516  1.656   1.00 0.00 ? 50  ALA A C    1  
ATOM   683   O O    . ALA A 1 50  ? -5.346  11.513  0.984   1.00 0.00 ? 50  ALA A O    1  
ATOM   684   C CB   . ALA A 1 50  ? -2.875  13.592  1.681   1.00 0.00 ? 50  ALA A CB   1  
ATOM   685   H H    . ALA A 1 50  ? -2.389  12.666  3.954   1.00 0.00 ? 50  ALA A H    1  
ATOM   686   H HA   . ALA A 1 50  ? -4.808  13.386  2.569   1.00 0.00 ? 50  ALA A HA   1  
ATOM   687   H HB1  . ALA A 1 50  ? -1.981  12.993  1.526   1.00 0.00 ? 50  ALA A HB1  1  
ATOM   688   H HB2  . ALA A 1 50  ? -3.294  13.853  0.715   1.00 0.00 ? 50  ALA A HB2  1  
ATOM   689   H HB3  . ALA A 1 50  ? -2.621  14.495  2.235   1.00 0.00 ? 50  ALA A HB3  1  
ATOM   690   N N    . ALA A 1 51  ? -3.527  10.444  1.765   1.00 0.00 ? 51  ALA A N    1  
ATOM   691   C CA   . ALA A 1 51  ? -3.813  9.159   1.127   1.00 0.00 ? 51  ALA A CA   1  
ATOM   692   C C    . ALA A 1 51  ? -4.811  8.315   1.949   1.00 0.00 ? 51  ALA A C    1  
ATOM   693   O O    . ALA A 1 51  ? -5.563  7.523   1.386   1.00 0.00 ? 51  ALA A O    1  
ATOM   694   C CB   . ALA A 1 51  ? -2.484  8.429   0.914   1.00 0.00 ? 51  ALA A CB   1  
ATOM   695   H H    . ALA A 1 51  ? -2.754  10.487  2.413   1.00 0.00 ? 51  ALA A H    1  
ATOM   696   H HA   . ALA A 1 51  ? -4.261  9.344   0.148   1.00 0.00 ? 51  ALA A HA   1  
ATOM   697   H HB1  . ALA A 1 51  ? -2.051  8.163   1.875   1.00 0.00 ? 51  ALA A HB1  1  
ATOM   698   H HB2  . ALA A 1 51  ? -2.660  7.517   0.356   1.00 0.00 ? 51  ALA A HB2  1  
ATOM   699   H HB3  . ALA A 1 51  ? -1.797  9.057   0.347   1.00 0.00 ? 51  ALA A HB3  1  
ATOM   700   N N    . ASP A 1 52  ? -4.872  8.518   3.265   1.00 0.00 ? 52  ASP A N    1  
ATOM   701   C CA   . ASP A 1 52  ? -5.970  8.058   4.121   1.00 0.00 ? 52  ASP A CA   1  
ATOM   702   C C    . ASP A 1 52  ? -7.321  8.661   3.689   1.00 0.00 ? 52  ASP A C    1  
ATOM   703   O O    . ASP A 1 52  ? -8.217  7.917   3.285   1.00 0.00 ? 52  ASP A O    1  
ATOM   704   C CB   . ASP A 1 52  ? -5.593  8.354   5.583   1.00 0.00 ? 52  ASP A CB   1  
ATOM   705   C CG   . ASP A 1 52  ? -6.755  8.711   6.504   1.00 0.00 ? 52  ASP A CG   1  
ATOM   706   O OD1  . ASP A 1 52  ? -7.508  7.805   6.924   1.00 0.00 ? 52  ASP A OD1  1  
ATOM   707   O OD2  . ASP A 1 52  ? -6.828  9.897   6.881   1.00 0.00 ? 52  ASP A OD2  1  
ATOM   708   H H    . ASP A 1 52  ? -4.177  9.124   3.683   1.00 0.00 ? 52  ASP A H    1  
ATOM   709   H HA   . ASP A 1 52  ? -6.073  6.977   4.024   1.00 0.00 ? 52  ASP A HA   1  
ATOM   710   H HB3  . ASP A 1 52  ? -4.863  9.165   5.618   1.00 0.00 ? 52  ASP A HB3  1  
ATOM   711   N N    . VAL A 1 53  ? -7.457  9.993   3.711   1.00 0.00 ? 53  VAL A N    1  
ATOM   712   C CA   . VAL A 1 53  ? -8.753  10.673  3.544   1.00 0.00 ? 53  VAL A CA   1  
ATOM   713   C C    . VAL A 1 53  ? -9.345  10.550  2.136   1.00 0.00 ? 53  VAL A C    1  
ATOM   714   O O    . VAL A 1 53  ? -10.571 10.503  2.007   1.00 0.00 ? 53  VAL A O    1  
ATOM   715   C CB   . VAL A 1 53  ? -8.660  12.144  4.010   1.00 0.00 ? 53  VAL A CB   1  
ATOM   716   C CG1  . VAL A 1 53  ? -7.938  13.069  3.019   1.00 0.00 ? 53  VAL A CG1  1  
ATOM   717   C CG2  . VAL A 1 53  ? -10.042 12.738  4.306   1.00 0.00 ? 53  VAL A CG2  1  
ATOM   718   H H    . VAL A 1 53  ? -6.682  10.542  4.071   1.00 0.00 ? 53  VAL A H    1  
ATOM   719   H HA   . VAL A 1 53  ? -9.451  10.172  4.213   1.00 0.00 ? 53  VAL A HA   1  
ATOM   720   H HB   . VAL A 1 53  ? -8.102  12.161  4.947   1.00 0.00 ? 53  VAL A HB   1  
ATOM   721   H HG11 . VAL A 1 53  ? -8.538  13.209  2.119   1.00 0.00 ? 53  VAL A HG11 1  
ATOM   722   H HG12 . VAL A 1 53  ? -7.764  14.036  3.487   1.00 0.00 ? 53  VAL A HG12 1  
ATOM   723   H HG13 . VAL A 1 53  ? -6.980  12.631  2.746   1.00 0.00 ? 53  VAL A HG13 1  
ATOM   724   H HG21 . VAL A 1 53  ? -10.559 12.113  5.033   1.00 0.00 ? 53  VAL A HG21 1  
ATOM   725   H HG22 . VAL A 1 53  ? -9.928  13.737  4.725   1.00 0.00 ? 53  VAL A HG22 1  
ATOM   726   H HG23 . VAL A 1 53  ? -10.636 12.799  3.393   1.00 0.00 ? 53  VAL A HG23 1  
ATOM   727   N N    . ASP A 1 54  ? -8.507  10.447  1.094   1.00 0.00 ? 54  ASP A N    1  
ATOM   728   C CA   . ASP A 1 54  ? -8.968  10.390  -0.303  1.00 0.00 ? 54  ASP A CA   1  
ATOM   729   C C    . ASP A 1 54  ? -8.564  9.128   -1.080  1.00 0.00 ? 54  ASP A C    1  
ATOM   730   O O    . ASP A 1 54  ? -9.195  8.806   -2.086  1.00 0.00 ? 54  ASP A O    1  
ATOM   731   C CB   . ASP A 1 54  ? -8.645  11.699  -1.038  1.00 0.00 ? 54  ASP A CB   1  
ATOM   732   C CG   . ASP A 1 54  ? -9.718  12.109  -2.060  1.00 0.00 ? 54  ASP A CG   1  
ATOM   733   O OD1  . ASP A 1 54  ? -10.932 11.927  -1.797  1.00 0.00 ? 54  ASP A OD1  1  
ATOM   734   O OD2  . ASP A 1 54  ? -9.363  12.748  -3.071  1.00 0.00 ? 54  ASP A OD2  1  
ATOM   735   H H    . ASP A 1 54  ? -7.516  10.560  1.271   1.00 0.00 ? 54  ASP A H    1  
ATOM   736   H HA   . ASP A 1 54  ? -10.040 10.332  -0.264  1.00 0.00 ? 54  ASP A HA   1  
ATOM   737   H HB3  . ASP A 1 54  ? -7.671  11.611  -1.526  1.00 0.00 ? 54  ASP A HB3  1  
ATOM   738   N N    . GLY A 1 55  ? -7.640  8.322   -0.547  1.00 0.00 ? 55  GLY A N    1  
ATOM   739   C CA   . GLY A 1 55  ? -7.382  6.963   -1.033  1.00 0.00 ? 55  GLY A CA   1  
ATOM   740   C C    . GLY A 1 55  ? -8.239  5.896   -0.352  1.00 0.00 ? 55  GLY A C    1  
ATOM   741   O O    . GLY A 1 55  ? -8.671  4.949   -1.008  1.00 0.00 ? 55  GLY A O    1  
ATOM   742   H H    . GLY A 1 55  ? -7.163  8.616   0.295   1.00 0.00 ? 55  GLY A H    1  
ATOM   743   H HA2  . GLY A 1 55  ? -7.533  6.906   -2.113  1.00 0.00 ? 55  GLY A HA2  1  
ATOM   744   H HA3  . GLY A 1 55  ? -6.354  6.714   -0.812  1.00 0.00 ? 55  GLY A HA3  1  
ATOM   745   N N    . ARG A 1 56  ? -8.552  6.076   0.944   1.00 0.00 ? 56  ARG A N    1  
ATOM   746   C CA   . ARG A 1 56  ? -9.510  5.256   1.718   1.00 0.00 ? 56  ARG A CA   1  
ATOM   747   C C    . ARG A 1 56  ? -9.294  3.739   1.545   1.00 0.00 ? 56  ARG A C    1  
ATOM   748   O O    . ARG A 1 56  ? -10.244 2.990   1.308   1.00 0.00 ? 56  ARG A O    1  
ATOM   749   C CB   . ARG A 1 56  ? -10.944 5.725   1.385   1.00 0.00 ? 56  ARG A CB   1  
ATOM   750   C CG   . ARG A 1 56  ? -11.205 7.185   1.810   1.00 0.00 ? 56  ARG A CG   1  
ATOM   751   C CD   . ARG A 1 56  ? -12.505 7.743   1.216   1.00 0.00 ? 56  ARG A CD   1  
ATOM   752   N NE   . ARG A 1 56  ? -12.349 8.056   -0.221  1.00 0.00 ? 56  ARG A NE   1  
ATOM   753   C CZ   . ARG A 1 56  ? -12.306 9.257   -0.775  1.00 0.00 ? 56  ARG A CZ   1  
ATOM   754   N NH1  . ARG A 1 56  ? -12.464 10.364  -0.115  1.00 0.00 ? 56  ARG A NH1  1  
ATOM   755   N NH2  . ARG A 1 56  ? -12.004 9.401   -2.028  1.00 0.00 ? 56  ARG A NH2  1  
ATOM   756   H H    . ARG A 1 56  ? -8.144  6.878   1.417   1.00 0.00 ? 56  ARG A H    1  
ATOM   757   H HA   . ARG A 1 56  ? -9.338  5.455   2.776   1.00 0.00 ? 56  ARG A HA   1  
ATOM   758   H HB3  . ARG A 1 56  ? -11.663 5.089   1.903   1.00 0.00 ? 56  ARG A HB3  1  
ATOM   759   H HG3  . ARG A 1 56  ? -10.384 7.828   1.494   1.00 0.00 ? 56  ARG A HG3  1  
ATOM   760   H HD3  . ARG A 1 56  ? -12.779 8.637   1.775   1.00 0.00 ? 56  ARG A HD3  1  
ATOM   761   H HE   . ARG A 1 56  ? -12.206 7.280   -0.844  1.00 0.00 ? 56  ARG A HE   1  
ATOM   762   H HH11 . ARG A 1 56  ? -12.290 10.330  0.879   1.00 0.00 ? 56  ARG A HH11 1  
ATOM   763   H HH12 . ARG A 1 56  ? -12.162 11.204  -0.607  1.00 0.00 ? 56  ARG A HH12 1  
ATOM   764   H HH21 . ARG A 1 56  ? -11.481 8.669   -2.479  1.00 0.00 ? 56  ARG A HH21 1  
ATOM   765   H HH22 . ARG A 1 56  ? -11.762 10.352  -2.303  1.00 0.00 ? 56  ARG A HH22 1  
ATOM   766   N N    . LEU A 1 57  ? -8.029  3.305   1.583   1.00 0.00 ? 57  LEU A N    1  
ATOM   767   C CA   . LEU A 1 57  ? -7.620  1.896   1.440   1.00 0.00 ? 57  LEU A CA   1  
ATOM   768   C C    . LEU A 1 57  ? -8.250  1.006   2.523   1.00 0.00 ? 57  LEU A C    1  
ATOM   769   O O    . LEU A 1 57  ? -8.549  1.485   3.621   1.00 0.00 ? 57  LEU A O    1  
ATOM   770   C CB   . LEU A 1 57  ? -6.084  1.775   1.493   1.00 0.00 ? 57  LEU A CB   1  
ATOM   771   C CG   . LEU A 1 57  ? -5.291  2.631   0.487   1.00 0.00 ? 57  LEU A CG   1  
ATOM   772   C CD1  . LEU A 1 57  ? -3.806  2.295   0.613   1.00 0.00 ? 57  LEU A CD1  1  
ATOM   773   C CD2  . LEU A 1 57  ? -5.713  2.401   -0.964  1.00 0.00 ? 57  LEU A CD2  1  
ATOM   774   H H    . LEU A 1 57  ? -7.315  3.993   1.754   1.00 0.00 ? 57  LEU A H    1  
ATOM   775   H HA   . LEU A 1 57  ? -7.966  1.529   0.473   1.00 0.00 ? 57  LEU A HA   1  
ATOM   776   H HB3  . LEU A 1 57  ? -5.827  0.726   1.327   1.00 0.00 ? 57  LEU A HB3  1  
ATOM   777   H HG   . LEU A 1 57  ? -5.428  3.686   0.729   1.00 0.00 ? 57  LEU A HG   1  
ATOM   778   H HD11 . LEU A 1 57  ? -3.629  1.260   0.317   1.00 0.00 ? 57  LEU A HD11 1  
ATOM   779   H HD12 . LEU A 1 57  ? -3.222  2.953   -0.027  1.00 0.00 ? 57  LEU A HD12 1  
ATOM   780   H HD13 . LEU A 1 57  ? -3.484  2.427   1.647   1.00 0.00 ? 57  LEU A HD13 1  
ATOM   781   H HD21 . LEU A 1 57  ? -6.739  2.739   -1.113  1.00 0.00 ? 57  LEU A HD21 1  
ATOM   782   H HD22 . LEU A 1 57  ? -5.069  2.972   -1.631  1.00 0.00 ? 57  LEU A HD22 1  
ATOM   783   H HD23 . LEU A 1 57  ? -5.640  1.341   -1.212  1.00 0.00 ? 57  LEU A HD23 1  
ATOM   784   N N    . ALA A 1 58  ? -8.428  -0.291  2.255   1.00 0.00 ? 58  ALA A N    1  
ATOM   785   C CA   . ALA A 1 58  ? -9.054  -1.189  3.217   1.00 0.00 ? 58  ALA A CA   1  
ATOM   786   C C    . ALA A 1 58  ? -8.011  -1.903  4.092   1.00 0.00 ? 58  ALA A C    1  
ATOM   787   O O    . ALA A 1 58  ? -6.941  -2.315  3.646   1.00 0.00 ? 58  ALA A O    1  
ATOM   788   C CB   . ALA A 1 58  ? -9.973  -2.165  2.471   1.00 0.00 ? 58  ALA A CB   1  
ATOM   789   H H    . ALA A 1 58  ? -8.031  -0.710  1.414   1.00 0.00 ? 58  ALA A H    1  
ATOM   790   H HA   . ALA A 1 58  ? -9.694  -0.605  3.879   1.00 0.00 ? 58  ALA A HA   1  
ATOM   791   H HB1  . ALA A 1 58  ? -9.394  -2.757  1.766   1.00 0.00 ? 58  ALA A HB1  1  
ATOM   792   H HB2  . ALA A 1 58  ? -10.466 -2.824  3.184   1.00 0.00 ? 58  ALA A HB2  1  
ATOM   793   H HB3  . ALA A 1 58  ? -10.730 -1.603  1.921   1.00 0.00 ? 58  ALA A HB3  1  
ATOM   794   N N    . ALA A 1 59  ? -8.360  -2.108  5.366   1.00 0.00 ? 59  ALA A N    1  
ATOM   795   C CA   . ALA A 1 59  ? -7.604  -2.987  6.251   1.00 0.00 ? 59  ALA A CA   1  
ATOM   796   C C    . ALA A 1 59  ? -7.529  -4.401  5.637   1.00 0.00 ? 59  ALA A C    1  
ATOM   797   O O    . ALA A 1 59  ? -8.555  -4.970  5.238   1.00 0.00 ? 59  ALA A O    1  
ATOM   798   C CB   . ALA A 1 59  ? -8.265  -2.992  7.634   1.00 0.00 ? 59  ALA A CB   1  
ATOM   799   H H    . ALA A 1 59  ? -9.240  -1.747  5.694   1.00 0.00 ? 59  ALA A H    1  
ATOM   800   H HA   . ALA A 1 59  ? -6.588  -2.599  6.352   1.00 0.00 ? 59  ALA A HA   1  
ATOM   801   H HB1  . ALA A 1 59  ? -9.282  -3.379  7.565   1.00 0.00 ? 59  ALA A HB1  1  
ATOM   802   H HB2  . ALA A 1 59  ? -7.692  -3.629  8.310   1.00 0.00 ? 59  ALA A HB2  1  
ATOM   803   H HB3  . ALA A 1 59  ? -8.283  -1.979  8.042   1.00 0.00 ? 59  ALA A HB3  1  
ATOM   804   N N    . GLY A 1 60  ? -6.313  -4.921  5.485   1.00 0.00 ? 60  GLY A N    1  
ATOM   805   C CA   . GLY A 1 60  ? -6.019  -6.281  5.017   1.00 0.00 ? 60  GLY A CA   1  
ATOM   806   C C    . GLY A 1 60  ? -5.544  -6.406  3.563   1.00 0.00 ? 60  GLY A C    1  
ATOM   807   O O    . GLY A 1 60  ? -5.227  -7.514  3.131   1.00 0.00 ? 60  GLY A O    1  
ATOM   808   H H    . GLY A 1 60  ? -5.516  -4.340  5.731   1.00 0.00 ? 60  GLY A H    1  
ATOM   809   H HA2  . GLY A 1 60  ? -5.237  -6.700  5.647   1.00 0.00 ? 60  GLY A HA2  1  
ATOM   810   H HA3  . GLY A 1 60  ? -6.907  -6.901  5.129   1.00 0.00 ? 60  GLY A HA3  1  
ATOM   811   N N    . ASP A 1 61  ? -5.503  -5.320  2.785   1.00 0.00 ? 61  ASP A N    1  
ATOM   812   C CA   . ASP A 1 61  ? -5.126  -5.366  1.363   1.00 0.00 ? 61  ASP A CA   1  
ATOM   813   C C    . ASP A 1 61  ? -3.674  -5.862  1.172   1.00 0.00 ? 61  ASP A C    1  
ATOM   814   O O    . ASP A 1 61  ? -2.722  -5.196  1.579   1.00 0.00 ? 61  ASP A O    1  
ATOM   815   C CB   . ASP A 1 61  ? -5.370  -3.991  0.704   1.00 0.00 ? 61  ASP A CB   1  
ATOM   816   C CG   . ASP A 1 61  ? -6.844  -3.569  0.697   1.00 0.00 ? 61  ASP A CG   1  
ATOM   817   O OD1  . ASP A 1 61  ? -7.695  -4.471  0.889   1.00 0.00 ? 61  ASP A OD1  1  
ATOM   818   O OD2  . ASP A 1 61  ? -7.138  -2.371  0.480   1.00 0.00 ? 61  ASP A OD2  1  
ATOM   819   H H    . ASP A 1 61  ? -5.787  -4.427  3.172   1.00 0.00 ? 61  ASP A H    1  
ATOM   820   H HA   . ASP A 1 61  ? -5.775  -6.088  0.870   1.00 0.00 ? 61  ASP A HA   1  
ATOM   821   H HB3  . ASP A 1 61  ? -5.039  -4.044  -0.330  1.00 0.00 ? 61  ASP A HB3  1  
ATOM   822   N N    . GLN A 1 62  ? -3.497  -7.055  0.590   1.00 0.00 ? 62  GLN A N    1  
ATOM   823   C CA   . GLN A 1 62  ? -2.204  -7.739  0.451   1.00 0.00 ? 62  GLN A CA   1  
ATOM   824   C C    . GLN A 1 62  ? -1.342  -7.073  -0.625  1.00 0.00 ? 62  GLN A C    1  
ATOM   825   O O    . GLN A 1 62  ? -1.504  -7.345  -1.812  1.00 0.00 ? 62  GLN A O    1  
ATOM   826   C CB   . GLN A 1 62  ? -2.412  -9.237  0.192   1.00 0.00 ? 62  GLN A CB   1  
ATOM   827   C CG   . GLN A 1 62  ? -1.082  -10.006 0.121   1.00 0.00 ? 62  GLN A CG   1  
ATOM   828   C CD   . GLN A 1 62  ? -1.303  -11.495 -0.111  1.00 0.00 ? 62  GLN A CD   1  
ATOM   829   O OE1  . GLN A 1 62  ? -1.533  -12.277 0.804   1.00 0.00 ? 62  GLN A OE1  1  
ATOM   830   N NE2  . GLN A 1 62  ? -1.285  -11.943 -1.347  1.00 0.00 ? 62  GLN A NE2  1  
ATOM   831   H H    . GLN A 1 62  ? -4.316  -7.548  0.255   1.00 0.00 ? 62  GLN A H    1  
ATOM   832   H HA   . GLN A 1 62  ? -1.673  -7.657  1.399   1.00 0.00 ? 62  GLN A HA   1  
ATOM   833   H HB3  . GLN A 1 62  ? -2.963  -9.381  -0.737  1.00 0.00 ? 62  GLN A HB3  1  
ATOM   834   H HG3  . GLN A 1 62  ? -0.536  -9.877  1.055   1.00 0.00 ? 62  GLN A HG3  1  
ATOM   835   H HE21 . GLN A 1 62  ? -1.105  -11.311 -2.108  1.00 0.00 ? 62  GLN A HE21 1  
ATOM   836   H HE22 . GLN A 1 62  ? -1.445  -12.926 -1.479  1.00 0.00 ? 62  GLN A HE22 1  
ATOM   837   N N    . LEU A 1 63  ? -0.481  -6.161  -0.190  1.00 0.00 ? 63  LEU A N    1  
ATOM   838   C CA   . LEU A 1 63  ? 0.438   -5.381  -1.010  1.00 0.00 ? 63  LEU A CA   1  
ATOM   839   C C    . LEU A 1 63  ? 1.543   -6.275  -1.621  1.00 0.00 ? 63  LEU A C    1  
ATOM   840   O O    . LEU A 1 63  ? 2.004   -7.234  -1.002  1.00 0.00 ? 63  LEU A O    1  
ATOM   841   C CB   . LEU A 1 63  ? 0.894   -4.206  -0.114  1.00 0.00 ? 63  LEU A CB   1  
ATOM   842   C CG   . LEU A 1 63  ? 1.543   -2.976  -0.781  1.00 0.00 ? 63  LEU A CG   1  
ATOM   843   C CD1  . LEU A 1 63  ? 1.486   -1.826  0.227   1.00 0.00 ? 63  LEU A CD1  1  
ATOM   844   C CD2  . LEU A 1 63  ? 3.016   -3.158  -1.139  1.00 0.00 ? 63  LEU A CD2  1  
ATOM   845   H H    . LEU A 1 63  ? -0.404  -6.065  0.809   1.00 0.00 ? 63  LEU A H    1  
ATOM   846   H HA   . LEU A 1 63  ? -0.137  -4.972  -1.829  1.00 0.00 ? 63  LEU A HA   1  
ATOM   847   H HB3  . LEU A 1 63  ? 1.545   -4.568  0.676   1.00 0.00 ? 63  LEU A HB3  1  
ATOM   848   H HG   . LEU A 1 63  ? 0.985   -2.692  -1.674  1.00 0.00 ? 63  LEU A HG   1  
ATOM   849   H HD11 . LEU A 1 63  ? 1.986   -2.122  1.149   1.00 0.00 ? 63  LEU A HD11 1  
ATOM   850   H HD12 . LEU A 1 63  ? 1.984   -0.947  -0.176  1.00 0.00 ? 63  LEU A HD12 1  
ATOM   851   H HD13 . LEU A 1 63  ? 0.449   -1.568  0.436   1.00 0.00 ? 63  LEU A HD13 1  
ATOM   852   H HD21 . LEU A 1 63  ? 3.133   -3.907  -1.913  1.00 0.00 ? 63  LEU A HD21 1  
ATOM   853   H HD22 . LEU A 1 63  ? 3.396   -2.219  -1.537  1.00 0.00 ? 63  LEU A HD22 1  
ATOM   854   H HD23 . LEU A 1 63  ? 3.589   -3.437  -0.260  1.00 0.00 ? 63  LEU A HD23 1  
ATOM   855   N N    . LEU A 1 64  ? 1.953   -5.973  -2.855  1.00 0.00 ? 64  LEU A N    1  
ATOM   856   C CA   . LEU A 1 64  ? 2.884   -6.764  -3.674  1.00 0.00 ? 64  LEU A CA   1  
ATOM   857   C C    . LEU A 1 64  ? 3.979   -5.910  -4.332  1.00 0.00 ? 64  LEU A C    1  
ATOM   858   O O    . LEU A 1 64  ? 5.128   -6.344  -4.361  1.00 0.00 ? 64  LEU A O    1  
ATOM   859   C CB   . LEU A 1 64  ? 2.093   -7.510  -4.769  1.00 0.00 ? 64  LEU A CB   1  
ATOM   860   C CG   . LEU A 1 64  ? 1.080   -8.553  -4.264  1.00 0.00 ? 64  LEU A CG   1  
ATOM   861   C CD1  . LEU A 1 64  ? 0.306   -9.127  -5.453  1.00 0.00 ? 64  LEU A CD1  1  
ATOM   862   C CD2  . LEU A 1 64  ? 1.751   -9.720  -3.529  1.00 0.00 ? 64  LEU A CD2  1  
ATOM   863   H H    . LEU A 1 64  ? 1.472   -5.205  -3.308  1.00 0.00 ? 64  LEU A H    1  
ATOM   864   H HA   . LEU A 1 64  ? 3.396   -7.497  -3.049  1.00 0.00 ? 64  LEU A HA   1  
ATOM   865   H HB3  . LEU A 1 64  ? 2.800   -8.014  -5.427  1.00 0.00 ? 64  LEU A HB3  1  
ATOM   866   H HG   . LEU A 1 64  ? 0.365   -8.080  -3.596  1.00 0.00 ? 64  LEU A HG   1  
ATOM   867   H HD11 . LEU A 1 64  ? 0.997   -9.620  -6.139  1.00 0.00 ? 64  LEU A HD11 1  
ATOM   868   H HD12 . LEU A 1 64  ? -0.438  -9.840  -5.105  1.00 0.00 ? 64  LEU A HD12 1  
ATOM   869   H HD13 . LEU A 1 64  ? -0.200  -8.319  -5.980  1.00 0.00 ? 64  LEU A HD13 1  
ATOM   870   H HD21 . LEU A 1 64  ? 2.221   -9.357  -2.615  1.00 0.00 ? 64  LEU A HD21 1  
ATOM   871   H HD22 . LEU A 1 64  ? 1.004   -10.464 -3.260  1.00 0.00 ? 64  LEU A HD22 1  
ATOM   872   H HD23 . LEU A 1 64  ? 2.505   -10.176 -4.171  1.00 0.00 ? 64  LEU A HD23 1  
ATOM   873   N N    . SER A 1 65  ? 3.666   -4.690  -4.778  1.00 0.00 ? 65  SER A N    1  
ATOM   874   C CA   . SER A 1 65  ? 4.619   -3.750  -5.401  1.00 0.00 ? 65  SER A CA   1  
ATOM   875   C C    . SER A 1 65  ? 4.434   -2.320  -4.889  1.00 0.00 ? 65  SER A C    1  
ATOM   876   O O    . SER A 1 65  ? 3.435   -1.998  -4.242  1.00 0.00 ? 65  SER A O    1  
ATOM   877   C CB   . SER A 1 65  ? 4.535   -3.742  -6.933  1.00 0.00 ? 65  SER A CB   1  
ATOM   878   O OG   . SER A 1 65  ? 4.854   -5.000  -7.484  1.00 0.00 ? 65  SER A OG   1  
ATOM   879   H H    . SER A 1 65  ? 2.704   -4.391  -4.704  1.00 0.00 ? 65  SER A H    1  
ATOM   880   H HA   . SER A 1 65  ? 5.626   -4.059  -5.138  1.00 0.00 ? 65  SER A HA   1  
ATOM   881   H HB3  . SER A 1 65  ? 5.248   -3.012  -7.311  1.00 0.00 ? 65  SER A HB3  1  
ATOM   882   H HG   . SER A 1 65  ? 3.988   -5.455  -7.683  1.00 0.00 ? 65  SER A HG   1  
ATOM   883   N N    . VAL A 1 66  ? 5.416   -1.460  -5.168  1.00 0.00 ? 66  VAL A N    1  
ATOM   884   C CA   . VAL A 1 66  ? 5.619   -0.159  -4.516  1.00 0.00 ? 66  VAL A CA   1  
ATOM   885   C C    . VAL A 1 66  ? 6.073   0.896   -5.522  1.00 0.00 ? 66  VAL A C    1  
ATOM   886   O O    . VAL A 1 66  ? 6.602   0.561   -6.583  1.00 0.00 ? 66  VAL A O    1  
ATOM   887   C CB   . VAL A 1 66  ? 6.655   -0.363  -3.386  1.00 0.00 ? 66  VAL A CB   1  
ATOM   888   C CG1  . VAL A 1 66  ? 7.559   0.831   -3.062  1.00 0.00 ? 66  VAL A CG1  1  
ATOM   889   C CG2  . VAL A 1 66  ? 5.903   -0.804  -2.123  1.00 0.00 ? 66  VAL A CG2  1  
ATOM   890   H H    . VAL A 1 66  ? 6.170   -1.758  -5.779  1.00 0.00 ? 66  VAL A H    1  
ATOM   891   H HA   . VAL A 1 66  ? 4.678   0.199   -4.099  1.00 0.00 ? 66  VAL A HA   1  
ATOM   892   H HB   . VAL A 1 66  ? 7.335   -1.165  -3.671  1.00 0.00 ? 66  VAL A HB   1  
ATOM   893   H HG11 . VAL A 1 66  ? 6.963   1.718   -2.871  1.00 0.00 ? 66  VAL A HG11 1  
ATOM   894   H HG12 . VAL A 1 66  ? 8.170   0.609   -2.197  1.00 0.00 ? 66  VAL A HG12 1  
ATOM   895   H HG13 . VAL A 1 66  ? 8.224   1.026   -3.903  1.00 0.00 ? 66  VAL A HG13 1  
ATOM   896   H HG21 . VAL A 1 66  ? 5.540   -1.820  -2.262  1.00 0.00 ? 66  VAL A HG21 1  
ATOM   897   H HG22 . VAL A 1 66  ? 6.545   -0.779  -1.247  1.00 0.00 ? 66  VAL A HG22 1  
ATOM   898   H HG23 . VAL A 1 66  ? 5.049   -0.152  -1.949  1.00 0.00 ? 66  VAL A HG23 1  
ATOM   899   N N    . ASP A 1 67  ? 5.875   2.175   -5.196  1.00 0.00 ? 67  ASP A N    1  
ATOM   900   C CA   . ASP A 1 67  ? 6.258   3.284   -6.069  1.00 0.00 ? 67  ASP A CA   1  
ATOM   901   C C    . ASP A 1 67  ? 7.719   3.191   -6.528  1.00 0.00 ? 67  ASP A C    1  
ATOM   902   O O    . ASP A 1 67  ? 8.627   2.866   -5.756  1.00 0.00 ? 67  ASP A O    1  
ATOM   903   C CB   . ASP A 1 67  ? 5.940   4.647   -5.449  1.00 0.00 ? 67  ASP A CB   1  
ATOM   904   C CG   . ASP A 1 67  ? 5.872   5.668   -6.581  1.00 0.00 ? 67  ASP A CG   1  
ATOM   905   O OD1  . ASP A 1 67  ? 4.760   5.780   -7.149  1.00 0.00 ? 67  ASP A OD1  1  
ATOM   906   O OD2  . ASP A 1 67  ? 6.936   6.194   -6.971  1.00 0.00 ? 67  ASP A OD2  1  
ATOM   907   H H    . ASP A 1 67  ? 5.272   2.389   -4.416  1.00 0.00 ? 67  ASP A H    1  
ATOM   908   H HA   . ASP A 1 67  ? 5.642   3.187   -6.963  1.00 0.00 ? 67  ASP A HA   1  
ATOM   909   H HB3  . ASP A 1 67  ? 6.698   4.926   -4.715  1.00 0.00 ? 67  ASP A HB3  1  
ATOM   910   N N    . GLY A 1 68  ? 7.923   3.370   -7.833  1.00 0.00 ? 68  GLY A N    1  
ATOM   911   C CA   . GLY A 1 68  ? 9.206   3.188   -8.512  1.00 0.00 ? 68  GLY A CA   1  
ATOM   912   C C    . GLY A 1 68  ? 9.815   1.774   -8.462  1.00 0.00 ? 68  GLY A C    1  
ATOM   913   O O    . GLY A 1 68  ? 10.870  1.564   -9.063  1.00 0.00 ? 68  GLY A O    1  
ATOM   914   H H    . GLY A 1 68  ? 7.138   3.710   -8.370  1.00 0.00 ? 68  GLY A H    1  
ATOM   915   H HA2  . GLY A 1 68  ? 9.085   3.462   -9.561  1.00 0.00 ? 68  GLY A HA2  1  
ATOM   916   H HA3  . GLY A 1 68  ? 9.927   3.870   -8.058  1.00 0.00 ? 68  GLY A HA3  1  
ATOM   917   N N    . ARG A 1 69  ? 9.204   0.798   -7.772  1.00 0.00 ? 69  ARG A N    1  
ATOM   918   C CA   . ARG A 1 69  ? 9.760   -0.543  -7.522  1.00 0.00 ? 69  ARG A CA   1  
ATOM   919   C C    . ARG A 1 69  ? 8.684   -1.639  -7.596  1.00 0.00 ? 69  ARG A C    1  
ATOM   920   O O    . ARG A 1 69  ? 8.028   -1.978  -6.613  1.00 0.00 ? 69  ARG A O    1  
ATOM   921   C CB   . ARG A 1 69  ? 10.488  -0.572  -6.164  1.00 0.00 ? 69  ARG A CB   1  
ATOM   922   C CG   . ARG A 1 69  ? 11.678  0.399   -6.043  1.00 0.00 ? 69  ARG A CG   1  
ATOM   923   C CD   . ARG A 1 69  ? 12.433  0.161   -4.727  1.00 0.00 ? 69  ARG A CD   1  
ATOM   924   N NE   . ARG A 1 69  ? 13.540  1.118   -4.542  1.00 0.00 ? 69  ARG A NE   1  
ATOM   925   C CZ   . ARG A 1 69  ? 14.037  1.510   -3.384  1.00 0.00 ? 69  ARG A CZ   1  
ATOM   926   N NH1  . ARG A 1 69  ? 13.608  0.943   -2.111  1.00 0.00 ? 69  ARG A NH1  1  
ATOM   927   N NH2  . ARG A 1 69  ? 14.882  2.484   -3.325  1.00 0.00 ? 69  ARG A NH2  1  
ATOM   928   H H    . ARG A 1 69  ? 8.335   1.033   -7.292  1.00 0.00 ? 69  ARG A H    1  
ATOM   929   H HA   . ARG A 1 69  ? 10.494  -0.765  -8.297  1.00 0.00 ? 69  ARG A HA   1  
ATOM   930   H HB3  . ARG A 1 69  ? 10.869  -1.580  -6.018  1.00 0.00 ? 69  ARG A HB3  1  
ATOM   931   H HG3  . ARG A 1 69  ? 11.311  1.424   -6.056  1.00 0.00 ? 69  ARG A HG3  1  
ATOM   932   H HD3  . ARG A 1 69  ? 12.843  -0.849  -4.731  1.00 0.00 ? 69  ARG A HD3  1  
ATOM   933   H HE   . ARG A 1 69  ? 13.933  1.570   -5.359  1.00 0.00 ? 69  ARG A HE   1  
ATOM   934   H HH11 . ARG A 1 69  ? 13.254  0.061   -2.278  1.00 0.00 ? 69  ARG A HH11 1  
ATOM   935   H HH12 . ARG A 1 69  ? 14.127  1.370   -1.417  1.00 0.00 ? 69  ARG A HH12 1  
ATOM   936   H HH21 . ARG A 1 69  ? 15.227  2.872   -4.193  1.00 0.00 ? 69  ARG A HH21 1  
ATOM   937   H HH22 . ARG A 1 69  ? 15.186  2.797   -2.400  1.00 0.00 ? 69  ARG A HH22 1  
ATOM   938   N N    . SER A 1 70  ? 8.549   -2.248  -8.773  1.00 0.00 ? 70  SER A N    1  
ATOM   939   C CA   . SER A 1 70  ? 7.763   -3.458  -9.075  1.00 0.00 ? 70  SER A CA   1  
ATOM   940   C C    . SER A 1 70  ? 8.240   -4.730  -8.335  1.00 0.00 ? 70  SER A C    1  
ATOM   941   O O    . SER A 1 70  ? 8.750   -5.665  -8.946  1.00 0.00 ? 70  SER A O    1  
ATOM   942   C CB   . SER A 1 70  ? 7.736   -3.657  -10.605 1.00 0.00 ? 70  SER A CB   1  
ATOM   943   O OG   . SER A 1 70  ? 8.992   -3.347  -11.205 1.00 0.00 ? 70  SER A OG   1  
ATOM   944   H H    . SER A 1 70  ? 9.113   -1.915  -9.542  1.00 0.00 ? 70  SER A H    1  
ATOM   945   H HA   . SER A 1 70  ? 6.737   -3.289  -8.762  1.00 0.00 ? 70  SER A HA   1  
ATOM   946   H HB3  . SER A 1 70  ? 6.985   -2.986  -11.022 1.00 0.00 ? 70  SER A HB3  1  
ATOM   947   H HG   . SER A 1 70  ? 9.019   -3.767  -12.087 1.00 0.00 ? 70  SER A HG   1  
ATOM   948   N N    . LEU A 1 71  ? 8.128   -4.763  -6.999  1.00 0.00 ? 71  LEU A N    1  
ATOM   949   C CA   . LEU A 1 71  ? 8.624   -5.869  -6.153  1.00 0.00 ? 71  LEU A CA   1  
ATOM   950   C C    . LEU A 1 71  ? 7.962   -7.231  -6.431  1.00 0.00 ? 71  LEU A C    1  
ATOM   951   O O    . LEU A 1 71  ? 8.562   -8.255  -6.111  1.00 0.00 ? 71  LEU A O    1  
ATOM   952   C CB   . LEU A 1 71  ? 8.433   -5.597  -4.644  1.00 0.00 ? 71  LEU A CB   1  
ATOM   953   C CG   . LEU A 1 71  ? 8.378   -4.154  -4.127  1.00 0.00 ? 71  LEU A CG   1  
ATOM   954   C CD1  . LEU A 1 71  ? 7.808   -4.150  -2.712  1.00 0.00 ? 71  LEU A CD1  1  
ATOM   955   C CD2  . LEU A 1 71  ? 9.761   -3.512  -4.133  1.00 0.00 ? 71  LEU A CD2  1  
ATOM   956   H H    . LEU A 1 71  ? 7.753   -3.939  -6.547  1.00 0.00 ? 71  LEU A H    1  
ATOM   957   H HA   . LEU A 1 71  ? 9.692   -5.980  -6.351  1.00 0.00 ? 71  LEU A HA   1  
ATOM   958   H HB3  . LEU A 1 71  ? 9.218   -6.124  -4.110  1.00 0.00 ? 71  LEU A HB3  1  
ATOM   959   H HG   . LEU A 1 71  ? 7.702   -3.569  -4.738  1.00 0.00 ? 71  LEU A HG   1  
ATOM   960   H HD11 . LEU A 1 71  ? 8.502   -4.626  -2.022  1.00 0.00 ? 71  LEU A HD11 1  
ATOM   961   H HD12 . LEU A 1 71  ? 7.616   -3.132  -2.402  1.00 0.00 ? 71  LEU A HD12 1  
ATOM   962   H HD13 . LEU A 1 71  ? 6.859   -4.686  -2.689  1.00 0.00 ? 71  LEU A HD13 1  
ATOM   963   H HD21 . LEU A 1 71  ? 10.176  -3.569  -5.138  1.00 0.00 ? 71  LEU A HD21 1  
ATOM   964   H HD22 . LEU A 1 71  ? 9.674   -2.466  -3.840  1.00 0.00 ? 71  LEU A HD22 1  
ATOM   965   H HD23 . LEU A 1 71  ? 10.424  -4.034  -3.442  1.00 0.00 ? 71  LEU A HD23 1  
ATOM   966   N N    . VAL A 1 72  ? 6.711   -7.226  -6.912  1.00 0.00 ? 72  VAL A N    1  
ATOM   967   C CA   . VAL A 1 72  ? 5.735   -8.336  -7.047  1.00 0.00 ? 72  VAL A CA   1  
ATOM   968   C C    . VAL A 1 72  ? 5.541   -9.294  -5.850  1.00 0.00 ? 72  VAL A C    1  
ATOM   969   O O    . VAL A 1 72  ? 4.681   -10.172 -5.916  1.00 0.00 ? 72  VAL A O    1  
ATOM   970   C CB   . VAL A 1 72  ? 5.883   -9.091  -8.385  1.00 0.00 ? 72  VAL A CB   1  
ATOM   971   C CG1  . VAL A 1 72  ? 5.741   -8.139  -9.581  1.00 0.00 ? 72  VAL A CG1  1  
ATOM   972   C CG2  . VAL A 1 72  ? 7.202   -9.860  -8.524  1.00 0.00 ? 72  VAL A CG2  1  
ATOM   973   H H    . VAL A 1 72  ? 6.323   -6.310  -7.105  1.00 0.00 ? 72  VAL A H    1  
ATOM   974   H HA   . VAL A 1 72  ? 4.767   -7.838  -7.114  1.00 0.00 ? 72  VAL A HA   1  
ATOM   975   H HB   . VAL A 1 72  ? 5.071   -9.815  -8.461  1.00 0.00 ? 72  VAL A HB   1  
ATOM   976   H HG11 . VAL A 1 72  ? 6.568   -7.430  -9.602  1.00 0.00 ? 72  VAL A HG11 1  
ATOM   977   H HG12 . VAL A 1 72  ? 5.733   -8.711  -10.507 1.00 0.00 ? 72  VAL A HG12 1  
ATOM   978   H HG13 . VAL A 1 72  ? 4.801   -7.589  -9.499  1.00 0.00 ? 72  VAL A HG13 1  
ATOM   979   H HG21 . VAL A 1 72  ? 7.335   -10.521 -7.666  1.00 0.00 ? 72  VAL A HG21 1  
ATOM   980   H HG22 . VAL A 1 72  ? 7.182   -10.461 -9.433  1.00 0.00 ? 72  VAL A HG22 1  
ATOM   981   H HG23 . VAL A 1 72  ? 8.040   -9.166  -8.575  1.00 0.00 ? 72  VAL A HG23 1  
ATOM   982   N N    . GLY A 1 73  ? 6.272   -9.137  -4.740  1.00 0.00 ? 73  GLY A N    1  
ATOM   983   C CA   . GLY A 1 73  ? 6.062   -9.901  -3.503  1.00 0.00 ? 73  GLY A CA   1  
ATOM   984   C C    . GLY A 1 73  ? 7.235   -9.909  -2.507  1.00 0.00 ? 73  GLY A C    1  
ATOM   985   O O    . GLY A 1 73  ? 7.483   -10.952 -1.901  1.00 0.00 ? 73  GLY A O    1  
ATOM   986   H H    . GLY A 1 73  ? 7.014   -8.455  -4.782  1.00 0.00 ? 73  GLY A H    1  
ATOM   987   H HA2  . GLY A 1 73  ? 5.189   -9.486  -2.994  1.00 0.00 ? 73  GLY A HA2  1  
ATOM   988   H HA3  . GLY A 1 73  ? 5.837   -10.938 -3.760  1.00 0.00 ? 73  GLY A HA3  1  
ATOM   989   N N    . LEU A 1 74  ? 7.962   -8.796  -2.319  1.00 0.00 ? 74  LEU A N    1  
ATOM   990   C CA   . LEU A 1 74  ? 9.197   -8.754  -1.506  1.00 0.00 ? 74  LEU A CA   1  
ATOM   991   C C    . LEU A 1 74  ? 9.161   -7.681  -0.397  1.00 0.00 ? 74  LEU A C    1  
ATOM   992   O O    . LEU A 1 74  ? 8.500   -6.659  -0.523  1.00 0.00 ? 74  LEU A O    1  
ATOM   993   C CB   . LEU A 1 74  ? 10.422  -8.567  -2.420  1.00 0.00 ? 74  LEU A CB   1  
ATOM   994   C CG   . LEU A 1 74  ? 10.635  -9.676  -3.471  1.00 0.00 ? 74  LEU A CG   1  
ATOM   995   C CD1  . LEU A 1 74  ? 11.785  -9.280  -4.401  1.00 0.00 ? 74  LEU A CD1  1  
ATOM   996   C CD2  . LEU A 1 74  ? 10.989  -11.019 -2.829  1.00 0.00 ? 74  LEU A CD2  1  
ATOM   997   H H    . LEU A 1 74  ? 7.658   -7.943  -2.765  1.00 0.00 ? 74  LEU A H    1  
ATOM   998   H HA   . LEU A 1 74  ? 9.310   -9.710  -0.992  1.00 0.00 ? 74  LEU A HA   1  
ATOM   999   H HB3  . LEU A 1 74  ? 11.315  -8.508  -1.799  1.00 0.00 ? 74  LEU A HB3  1  
ATOM   1000  H HG   . LEU A 1 74  ? 9.737   -9.797  -4.076  1.00 0.00 ? 74  LEU A HG   1  
ATOM   1001  H HD11 . LEU A 1 74  ? 12.705  -9.151  -3.834  1.00 0.00 ? 74  LEU A HD11 1  
ATOM   1002  H HD12 . LEU A 1 74  ? 11.924  -10.052 -5.157  1.00 0.00 ? 74  LEU A HD12 1  
ATOM   1003  H HD13 . LEU A 1 74  ? 11.529  -8.348  -4.908  1.00 0.00 ? 74  LEU A HD13 1  
ATOM   1004  H HD21 . LEU A 1 74  ? 10.152  -11.377 -2.229  1.00 0.00 ? 74  LEU A HD21 1  
ATOM   1005  H HD22 . LEU A 1 74  ? 11.181  -11.757 -3.610  1.00 0.00 ? 74  LEU A HD22 1  
ATOM   1006  H HD23 . LEU A 1 74  ? 11.873  -10.918 -2.199  1.00 0.00 ? 74  LEU A HD23 1  
ATOM   1007  N N    . SER A 1 75  ? 9.859   -7.939  0.710   1.00 0.00 ? 75  SER A N    1  
ATOM   1008  C CA   . SER A 1 75  ? 9.657   -7.276  2.008   1.00 0.00 ? 75  SER A CA   1  
ATOM   1009  C C    . SER A 1 75  ? 10.012  -5.778  2.073   1.00 0.00 ? 75  SER A C    1  
ATOM   1010  O O    . SER A 1 75  ? 10.846  -5.263  1.323   1.00 0.00 ? 75  SER A O    1  
ATOM   1011  C CB   . SER A 1 75  ? 10.427  -8.052  3.081   1.00 0.00 ? 75  SER A CB   1  
ATOM   1012  O OG   . SER A 1 75  ? 10.204  -9.445  2.917   1.00 0.00 ? 75  SER A OG   1  
ATOM   1013  H H    . SER A 1 75  ? 10.373  -8.806  0.745   1.00 0.00 ? 75  SER A H    1  
ATOM   1014  H HA   . SER A 1 75  ? 8.597   -7.362  2.245   1.00 0.00 ? 75  SER A HA   1  
ATOM   1015  H HB3  . SER A 1 75  ? 10.104  -7.744  4.075   1.00 0.00 ? 75  SER A HB3  1  
ATOM   1016  H HG   . SER A 1 75  ? 9.436   -9.709  3.460   1.00 0.00 ? 75  SER A HG   1  
ATOM   1017  N N    . GLN A 1 76  ? 9.389   -5.072  3.027   1.00 0.00 ? 76  GLN A N    1  
ATOM   1018  C CA   . GLN A 1 76  ? 9.391   -3.604  3.131   1.00 0.00 ? 76  GLN A CA   1  
ATOM   1019  C C    . GLN A 1 76  ? 10.772  -2.941  3.229   1.00 0.00 ? 76  GLN A C    1  
ATOM   1020  O O    . GLN A 1 76  ? 10.927  -1.801  2.793   1.00 0.00 ? 76  GLN A O    1  
ATOM   1021  C CB   . GLN A 1 76  ? 8.457   -3.130  4.263   1.00 0.00 ? 76  GLN A CB   1  
ATOM   1022  C CG   . GLN A 1 76  ? 8.835   -3.561  5.692   1.00 0.00 ? 76  GLN A CG   1  
ATOM   1023  C CD   . GLN A 1 76  ? 10.002  -2.792  6.298   1.00 0.00 ? 76  GLN A CD   1  
ATOM   1024  O OE1  . GLN A 1 76  ? 10.039  -1.573  6.322   1.00 0.00 ? 76  GLN A OE1  1  
ATOM   1025  N NE2  . GLN A 1 76  ? 11.017  -3.472  6.775   1.00 0.00 ? 76  GLN A NE2  1  
ATOM   1026  H H    . GLN A 1 76  ? 8.799   -5.577  3.669   1.00 0.00 ? 76  GLN A H    1  
ATOM   1027  H HA   . GLN A 1 76  ? 8.957   -3.232  2.205   1.00 0.00 ? 76  GLN A HA   1  
ATOM   1028  H HB3  . GLN A 1 76  ? 7.454   -3.493  4.048   1.00 0.00 ? 76  GLN A HB3  1  
ATOM   1029  H HG3  . GLN A 1 76  ? 9.075   -4.622  5.707   1.00 0.00 ? 76  GLN A HG3  1  
ATOM   1030  H HE21 . GLN A 1 76  ? 11.061  -4.478  6.614   1.00 0.00 ? 76  GLN A HE21 1  
ATOM   1031  H HE22 . GLN A 1 76  ? 11.776  -2.944  7.164   1.00 0.00 ? 76  GLN A HE22 1  
ATOM   1032  N N    . GLU A 1 77  ? 11.787  -3.629  3.746   1.00 0.00 ? 77  GLU A N    1  
ATOM   1033  C CA   . GLU A 1 77  ? 13.150  -3.108  3.920   1.00 0.00 ? 77  GLU A CA   1  
ATOM   1034  C C    . GLU A 1 77  ? 13.835  -2.656  2.619   1.00 0.00 ? 77  GLU A C    1  
ATOM   1035  O O    . GLU A 1 77  ? 14.824  -1.932  2.679   1.00 0.00 ? 77  GLU A O    1  
ATOM   1036  C CB   . GLU A 1 77  ? 14.041  -4.088  4.721   1.00 0.00 ? 77  GLU A CB   1  
ATOM   1037  C CG   . GLU A 1 77  ? 13.739  -5.592  4.610   1.00 0.00 ? 77  GLU A CG   1  
ATOM   1038  C CD   . GLU A 1 77  ? 12.667  -6.019  5.625   1.00 0.00 ? 77  GLU A CD   1  
ATOM   1039  O OE1  . GLU A 1 77  ? 13.011  -6.365  6.780   1.00 0.00 ? 77  GLU A OE1  1  
ATOM   1040  O OE2  . GLU A 1 77  ? 11.461  -5.913  5.315   1.00 0.00 ? 77  GLU A OE2  1  
ATOM   1041  H H    . GLU A 1 77  ? 11.573  -4.547  4.133   1.00 0.00 ? 77  GLU A H    1  
ATOM   1042  H HA   . GLU A 1 77  ? 13.072  -2.203  4.520   1.00 0.00 ? 77  GLU A HA   1  
ATOM   1043  H HB3  . GLU A 1 77  ? 13.983  -3.811  5.777   1.00 0.00 ? 77  GLU A HB3  1  
ATOM   1044  H HG3  . GLU A 1 77  ? 14.656  -6.146  4.825   1.00 0.00 ? 77  GLU A HG3  1  
ATOM   1045  N N    . ARG A 1 78  ? 13.295  -3.019  1.448   1.00 0.00 ? 78  ARG A N    1  
ATOM   1046  C CA   . ARG A 1 78  ? 13.784  -2.546  0.137   1.00 0.00 ? 78  ARG A CA   1  
ATOM   1047  C C    . ARG A 1 78  ? 12.686  -1.835  -0.662  1.00 0.00 ? 78  ARG A C    1  
ATOM   1048  O O    . ARG A 1 78  ? 12.795  -1.682  -1.876  1.00 0.00 ? 78  ARG A O    1  
ATOM   1049  C CB   . ARG A 1 78  ? 14.531  -3.688  -0.582  1.00 0.00 ? 78  ARG A CB   1  
ATOM   1050  C CG   . ARG A 1 78  ? 15.694  -4.166  0.312   1.00 0.00 ? 78  ARG A CG   1  
ATOM   1051  C CD   . ARG A 1 78  ? 16.632  -5.194  -0.322  1.00 0.00 ? 78  ARG A CD   1  
ATOM   1052  N NE   . ARG A 1 78  ? 17.589  -5.685  0.695   1.00 0.00 ? 78  ARG A NE   1  
ATOM   1053  C CZ   . ARG A 1 78  ? 17.379  -6.628  1.597   1.00 0.00 ? 78  ARG A CZ   1  
ATOM   1054  N NH1  . ARG A 1 78  ? 16.301  -7.359  1.625   1.00 0.00 ? 78  ARG A NH1  1  
ATOM   1055  N NH2  . ARG A 1 78  ? 18.260  -6.843  2.522   1.00 0.00 ? 78  ARG A NH2  1  
ATOM   1056  H H    . ARG A 1 78  ? 12.498  -3.651  1.481   1.00 0.00 ? 78  ARG A H    1  
ATOM   1057  H HA   . ARG A 1 78  ? 14.524  -1.763  0.311   1.00 0.00 ? 78  ARG A HA   1  
ATOM   1058  H HB3  . ARG A 1 78  ? 14.938  -3.324  -1.526  1.00 0.00 ? 78  ARG A HB3  1  
ATOM   1059  H HG3  . ARG A 1 78  ? 15.282  -4.620  1.214   1.00 0.00 ? 78  ARG A HG3  1  
ATOM   1060  H HD3  . ARG A 1 78  ? 17.180  -4.726  -1.141  1.00 0.00 ? 78  ARG A HD3  1  
ATOM   1061  H HE   . ARG A 1 78  ? 18.457  -5.178  0.821   1.00 0.00 ? 78  ARG A HE   1  
ATOM   1062  H HH11 . ARG A 1 78  ? 15.574  -7.223  0.956   1.00 0.00 ? 78  ARG A HH11 1  
ATOM   1063  H HH12 . ARG A 1 78  ? 16.220  -8.044  2.377   1.00 0.00 ? 78  ARG A HH12 1  
ATOM   1064  H HH21 . ARG A 1 78  ? 19.065  -6.222  2.581   1.00 0.00 ? 78  ARG A HH21 1  
ATOM   1065  H HH22 . ARG A 1 78  ? 18.063  -7.555  3.223   1.00 0.00 ? 78  ARG A HH22 1  
ATOM   1066  N N    . ALA A 1 79  ? 11.657  -1.338  0.031   1.00 0.00 ? 79  ALA A N    1  
ATOM   1067  C CA   . ALA A 1 79  ? 10.464  -0.741  -0.571  1.00 0.00 ? 79  ALA A CA   1  
ATOM   1068  C C    . ALA A 1 79  ? 9.840   0.422   0.231   1.00 0.00 ? 79  ALA A C    1  
ATOM   1069  O O    . ALA A 1 79  ? 9.625   1.497   -0.327  1.00 0.00 ? 79  ALA A O    1  
ATOM   1070  C CB   . ALA A 1 79  ? 9.453   -1.875  -0.744  1.00 0.00 ? 79  ALA A CB   1  
ATOM   1071  H H    . ALA A 1 79  ? 11.648  -1.505  1.028   1.00 0.00 ? 79  ALA A H    1  
ATOM   1072  H HA   . ALA A 1 79  ? 10.709  -0.348  -1.560  1.00 0.00 ? 79  ALA A HA   1  
ATOM   1073  H HB1  . ALA A 1 79  ? 9.110   -2.238  0.222   1.00 0.00 ? 79  ALA A HB1  1  
ATOM   1074  H HB2  . ALA A 1 79  ? 8.495   -1.515  -1.161  1.00 0.00 ? 79  ALA A HB2  1  
ATOM   1075  H HB3  . ALA A 1 79  ? 9.911   -2.700  -1.294  1.00 0.00 ? 79  ALA A HB3  1  
ATOM   1076  N N    . ALA A 1 80  ? 9.573   0.270   1.530   1.00 0.00 ? 80  ALA A N    1  
ATOM   1077  C CA   . ALA A 1 80  ? 9.096   1.372   2.376   1.00 0.00 ? 80  ALA A CA   1  
ATOM   1078  C C    . ALA A 1 80  ? 10.101  2.538   2.473   1.00 0.00 ? 80  ALA A C    1  
ATOM   1079  O O    . ALA A 1 80  ? 9.708   3.699   2.600   1.00 0.00 ? 80  ALA A O    1  
ATOM   1080  C CB   . ALA A 1 80  ? 8.745   0.825   3.759   1.00 0.00 ? 80  ALA A CB   1  
ATOM   1081  H H    . ALA A 1 80  ? 9.782   -0.620  1.970   1.00 0.00 ? 80  ALA A H    1  
ATOM   1082  H HA   . ALA A 1 80  ? 8.194   1.778   1.925   1.00 0.00 ? 80  ALA A HA   1  
ATOM   1083  H HB1  . ALA A 1 80  ? 9.612   0.348   4.221   1.00 0.00 ? 80  ALA A HB1  1  
ATOM   1084  H HB2  . ALA A 1 80  ? 8.409   1.642   4.397   1.00 0.00 ? 80  ALA A HB2  1  
ATOM   1085  H HB3  . ALA A 1 80  ? 7.933   0.104   3.669   1.00 0.00 ? 80  ALA A HB3  1  
ATOM   1086  N N    . GLU A 1 81  ? 11.391  2.236   2.329   1.00 0.00 ? 81  GLU A N    1  
ATOM   1087  C CA   . GLU A 1 81  ? 12.484  3.185   2.120   1.00 0.00 ? 81  GLU A CA   1  
ATOM   1088  C C    . GLU A 1 81  ? 12.268  4.129   0.915   1.00 0.00 ? 81  GLU A C    1  
ATOM   1089  O O    . GLU A 1 81  ? 12.618  5.308   0.994   1.00 0.00 ? 81  GLU A O    1  
ATOM   1090  C CB   . GLU A 1 81  ? 13.753  2.320   2.021   1.00 0.00 ? 81  GLU A CB   1  
ATOM   1091  C CG   . GLU A 1 81  ? 15.069  3.089   1.801   1.00 0.00 ? 81  GLU A CG   1  
ATOM   1092  C CD   . GLU A 1 81  ? 15.427  3.418   0.350   1.00 0.00 ? 81  GLU A CD   1  
ATOM   1093  O OE1  . GLU A 1 81  ? 14.957  2.750   -0.582  1.00 0.00 ? 81  GLU A OE1  1  
ATOM   1094  O OE2  . GLU A 1 81  ? 16.188  4.399   0.161   1.00 0.00 ? 81  GLU A OE2  1  
ATOM   1095  H H    . GLU A 1 81  ? 11.642  1.258   2.313   1.00 0.00 ? 81  GLU A H    1  
ATOM   1096  H HA   . GLU A 1 81  ? 12.578  3.812   3.005   1.00 0.00 ? 81  GLU A HA   1  
ATOM   1097  H HB3  . GLU A 1 81  ? 13.631  1.545   1.279   1.00 0.00 ? 81  GLU A HB3  1  
ATOM   1098  H HG3  . GLU A 1 81  ? 15.873  2.470   2.213   1.00 0.00 ? 81  GLU A HG3  1  
ATOM   1099  N N    . LEU A 1 82  ? 11.629  3.649   -0.162  1.00 0.00 ? 82  LEU A N    1  
ATOM   1100  C CA   . LEU A 1 82  ? 11.179  4.480   -1.293  1.00 0.00 ? 82  LEU A CA   1  
ATOM   1101  C C    . LEU A 1 82  ? 9.849   5.162   -0.939  1.00 0.00 ? 82  LEU A C    1  
ATOM   1102  O O    . LEU A 1 82  ? 9.794   6.393   -0.921  1.00 0.00 ? 82  LEU A O    1  
ATOM   1103  C CB   . LEU A 1 82  ? 11.058  3.632   -2.582  1.00 0.00 ? 82  LEU A CB   1  
ATOM   1104  C CG   . LEU A 1 82  ? 11.010  4.389   -3.930  1.00 0.00 ? 82  LEU A CG   1  
ATOM   1105  C CD1  . LEU A 1 82  ? 9.789   5.299   -4.077  1.00 0.00 ? 82  LEU A CD1  1  
ATOM   1106  C CD2  . LEU A 1 82  ? 12.267  5.232   -4.164  1.00 0.00 ? 82  LEU A CD2  1  
ATOM   1107  H H    . LEU A 1 82  ? 11.347  2.680   -0.131  1.00 0.00 ? 82  LEU A H    1  
ATOM   1108  H HA   . LEU A 1 82  ? 11.922  5.264   -1.466  1.00 0.00 ? 82  LEU A HA   1  
ATOM   1109  H HB3  . LEU A 1 82  ? 10.186  2.981   -2.525  1.00 0.00 ? 82  LEU A HB3  1  
ATOM   1110  H HG   . LEU A 1 82  ? 10.972  3.642   -4.720  1.00 0.00 ? 82  LEU A HG   1  
ATOM   1111  H HD11 . LEU A 1 82  ? 9.884   6.203   -3.478  1.00 0.00 ? 82  LEU A HD11 1  
ATOM   1112  H HD12 . LEU A 1 82  ? 9.678   5.589   -5.123  1.00 0.00 ? 82  LEU A HD12 1  
ATOM   1113  H HD13 . LEU A 1 82  ? 8.760   4.853   -3.880  1.00 0.00 ? 82  LEU A HD13 1  
ATOM   1114  H HD21 . LEU A 1 82  ? 13.154  4.614   -4.044  1.00 0.00 ? 82  LEU A HD21 1  
ATOM   1115  H HD22 . LEU A 1 82  ? 12.247  5.621   -5.182  1.00 0.00 ? 82  LEU A HD22 1  
ATOM   1116  H HD23 . LEU A 1 82  ? 12.304  6.072   -3.472  1.00 0.00 ? 82  LEU A HD23 1  
ATOM   1117  N N    . MET A 1 83  ? 8.814   4.393   -0.551  1.00 0.00 ? 83  MET A N    1  
ATOM   1118  C CA   . MET A 1 83  ? 7.467   4.926   -0.252  1.00 0.00 ? 83  MET A CA   1  
ATOM   1119  C C    . MET A 1 83  ? 7.448   6.094   0.735   1.00 0.00 ? 83  MET A C    1  
ATOM   1120  O O    . MET A 1 83  ? 6.601   6.982   0.640   1.00 0.00 ? 83  MET A O    1  
ATOM   1121  C CB   . MET A 1 83  ? 6.547   3.880   0.381   1.00 0.00 ? 83  MET A CB   1  
ATOM   1122  C CG   . MET A 1 83  ? 6.229   2.683   -0.496  1.00 0.00 ? 83  MET A CG   1  
ATOM   1123  S SD   . MET A 1 83  ? 4.837   1.713   0.116   1.00 0.00 ? 83  MET A SD   1  
ATOM   1124  C CE   . MET A 1 83  ? 5.427   1.148   1.727   1.00 0.00 ? 83  MET A CE   1  
ATOM   1125  H H    . MET A 1 83  ? 8.942   3.386   -0.558  1.00 0.00 ? 83  MET A H    1  
ATOM   1126  H HA   . MET A 1 83  ? 7.016   5.273   -1.181  1.00 0.00 ? 83  MET A HA   1  
ATOM   1127  H HB3  . MET A 1 83  ? 5.599   4.366   0.625   1.00 0.00 ? 83  MET A HB3  1  
ATOM   1128  H HG3  . MET A 1 83  ? 7.107   2.041   -0.569  1.00 0.00 ? 83  MET A HG3  1  
ATOM   1129  H HE1  . MET A 1 83  ? 5.592   1.995   2.392   1.00 0.00 ? 83  MET A HE1  1  
ATOM   1130  H HE2  . MET A 1 83  ? 4.683   0.485   2.167   1.00 0.00 ? 83  MET A HE2  1  
ATOM   1131  H HE3  . MET A 1 83  ? 6.355   0.586   1.600   1.00 0.00 ? 83  MET A HE3  1  
ATOM   1132  N N    . THR A 1 84  ? 8.343   6.096   1.718   1.00 0.00 ? 84  THR A N    1  
ATOM   1133  C CA   . THR A 1 84  ? 8.412   7.165   2.725   1.00 0.00 ? 84  THR A CA   1  
ATOM   1134  C C    . THR A 1 84  ? 8.781   8.516   2.101   1.00 0.00 ? 84  THR A C    1  
ATOM   1135  O O    . THR A 1 84  ? 8.313   9.548   2.577   1.00 0.00 ? 84  THR A O    1  
ATOM   1136  C CB   . THR A 1 84  ? 9.403   6.787   3.840   1.00 0.00 ? 84  THR A CB   1  
ATOM   1137  O OG1  . THR A 1 84  ? 9.007   5.561   4.412   1.00 0.00 ? 84  THR A OG1  1  
ATOM   1138  C CG2  . THR A 1 84  ? 9.446   7.794   4.988   1.00 0.00 ? 84  THR A CG2  1  
ATOM   1139  H H    . THR A 1 84  ? 8.982   5.314   1.786   1.00 0.00 ? 84  THR A H    1  
ATOM   1140  H HA   . THR A 1 84  ? 7.431   7.282   3.185   1.00 0.00 ? 84  THR A HA   1  
ATOM   1141  H HB   . THR A 1 84  ? 10.410  6.679   3.418   1.00 0.00 ? 84  THR A HB   1  
ATOM   1142  H HG1  . THR A 1 84  ? 9.276   4.851   3.805   1.00 0.00 ? 84  THR A HG1  1  
ATOM   1143  H HG21 . THR A 1 84  ? 8.438   7.962   5.376   1.00 0.00 ? 84  THR A HG21 1  
ATOM   1144  H HG22 . THR A 1 84  ? 10.076  7.407   5.789   1.00 0.00 ? 84  THR A HG22 1  
ATOM   1145  H HG23 . THR A 1 84  ? 9.864   8.740   4.648   1.00 0.00 ? 84  THR A HG23 1  
ATOM   1146  N N    . ARG A 1 85  ? 9.589   8.542   1.029   1.00 0.00 ? 85  ARG A N    1  
ATOM   1147  C CA   . ARG A 1 85  ? 10.032  9.795   0.375   1.00 0.00 ? 85  ARG A CA   1  
ATOM   1148  C C    . ARG A 1 85  ? 9.034   10.373  -0.636  1.00 0.00 ? 85  ARG A C    1  
ATOM   1149  O O    . ARG A 1 85  ? 9.213   11.513  -1.063  1.00 0.00 ? 85  ARG A O    1  
ATOM   1150  C CB   . ARG A 1 85  ? 11.397  9.601   -0.304  1.00 0.00 ? 85  ARG A CB   1  
ATOM   1151  C CG   . ARG A 1 85  ? 12.503  9.157   0.664   1.00 0.00 ? 85  ARG A CG   1  
ATOM   1152  C CD   . ARG A 1 85  ? 13.880  9.392   0.022   1.00 0.00 ? 85  ARG A CD   1  
ATOM   1153  N NE   . ARG A 1 85  ? 14.964  8.685   0.730   1.00 0.00 ? 85  ARG A NE   1  
ATOM   1154  C CZ   . ARG A 1 85  ? 15.389  7.471   0.443   1.00 0.00 ? 85  ARG A CZ   1  
ATOM   1155  N NH1  . ARG A 1 85  ? 14.775  6.677   -0.379  1.00 0.00 ? 85  ARG A NH1  1  
ATOM   1156  N NH2  . ARG A 1 85  ? 16.457  6.998   1.003   1.00 0.00 ? 85  ARG A NH2  1  
ATOM   1157  H H    . ARG A 1 85  ? 9.861   7.655   0.610   1.00 0.00 ? 85  ARG A H    1  
ATOM   1158  H HA   . ARG A 1 85  ? 10.147  10.567  1.141   1.00 0.00 ? 85  ARG A HA   1  
ATOM   1159  H HB3  . ARG A 1 85  ? 11.693  10.549  -0.751  1.00 0.00 ? 85  ARG A HB3  1  
ATOM   1160  H HG3  . ARG A 1 85  ? 12.378  8.095   0.883   1.00 0.00 ? 85  ARG A HG3  1  
ATOM   1161  H HD3  . ARG A 1 85  ? 14.096  10.461  0.014   1.00 0.00 ? 85  ARG A HD3  1  
ATOM   1162  H HE   . ARG A 1 85  ? 15.530  9.192   1.402   1.00 0.00 ? 85  ARG A HE   1  
ATOM   1163  H HH11 . ARG A 1 85  ? 13.798  6.824   -0.560  1.00 0.00 ? 85  ARG A HH11 1  
ATOM   1164  H HH12 . ARG A 1 85  ? 15.162  5.735   -0.448  1.00 0.00 ? 85  ARG A HH12 1  
ATOM   1165  H HH21 . ARG A 1 85  ? 16.977  7.558   1.664   1.00 0.00 ? 85  ARG A HH21 1  
ATOM   1166  H HH22 . ARG A 1 85  ? 16.685  6.023   0.790   1.00 0.00 ? 85  ARG A HH22 1  
ATOM   1167  N N    . THR A 1 86  ? 7.987   9.616   -0.980  1.00 0.00 ? 86  THR A N    1  
ATOM   1168  C CA   . THR A 1 86  ? 6.980   9.874   -2.033  1.00 0.00 ? 86  THR A CA   1  
ATOM   1169  C C    . THR A 1 86  ? 6.660   11.339  -2.336  1.00 0.00 ? 86  THR A C    1  
ATOM   1170  O O    . THR A 1 86  ? 6.698   11.740  -3.492  1.00 0.00 ? 86  THR A O    1  
ATOM   1171  C CB   . THR A 1 86  ? 5.693   9.149   -1.636  1.00 0.00 ? 86  THR A CB   1  
ATOM   1172  O OG1  . THR A 1 86  ? 5.926   7.775   -1.766  1.00 0.00 ? 86  THR A OG1  1  
ATOM   1173  C CG2  . THR A 1 86  ? 4.473   9.495   -2.474  1.00 0.00 ? 86  THR A CG2  1  
ATOM   1174  H H    . THR A 1 86  ? 7.978   8.688   -0.585  1.00 0.00 ? 86  THR A H    1  
ATOM   1175  H HA   . THR A 1 86  ? 7.338   9.434   -2.965  1.00 0.00 ? 86  THR A HA   1  
ATOM   1176  H HB   . THR A 1 86  ? 5.457   9.364   -0.594  1.00 0.00 ? 86  THR A HB   1  
ATOM   1177  H HG1  . THR A 1 86  ? 6.070   7.429   -0.868  1.00 0.00 ? 86  THR A HG1  1  
ATOM   1178  H HG21 . THR A 1 86  ? 4.749   9.449   -3.523  1.00 0.00 ? 86  THR A HG21 1  
ATOM   1179  H HG22 . THR A 1 86  ? 3.676   8.788   -2.262  1.00 0.00 ? 86  THR A HG22 1  
ATOM   1180  H HG23 . THR A 1 86  ? 4.110   10.490  -2.228  1.00 0.00 ? 86  THR A HG23 1  
ATOM   1181  N N    . SER A 1 87  ? 6.342   12.141  -1.316  1.00 0.00 ? 87  SER A N    1  
ATOM   1182  C CA   . SER A 1 87  ? 6.001   13.578  -1.399  1.00 0.00 ? 87  SER A CA   1  
ATOM   1183  C C    . SER A 1 87  ? 4.800   13.992  -2.278  1.00 0.00 ? 87  SER A C    1  
ATOM   1184  O O    . SER A 1 87  ? 4.277   15.082  -2.057  1.00 0.00 ? 87  SER A O    1  
ATOM   1185  C CB   . SER A 1 87  ? 7.249   14.395  -1.761  1.00 0.00 ? 87  SER A CB   1  
ATOM   1186  O OG   . SER A 1 87  ? 8.302   14.109  -0.854  1.00 0.00 ? 87  SER A OG   1  
ATOM   1187  H H    . SER A 1 87  ? 6.402   11.746  -0.391  1.00 0.00 ? 87  SER A H    1  
ATOM   1188  H HA   . SER A 1 87  ? 5.725   13.887  -0.393  1.00 0.00 ? 87  SER A HA   1  
ATOM   1189  H HB3  . SER A 1 87  ? 7.011   15.458  -1.710  1.00 0.00 ? 87  SER A HB3  1  
ATOM   1190  H HG   . SER A 1 87  ? 8.640   13.216  -1.054  1.00 0.00 ? 87  SER A HG   1  
ATOM   1191  N N    . SER A 1 88  ? 4.302   13.162  -3.212  1.00 0.00 ? 88  SER A N    1  
ATOM   1192  C CA   . SER A 1 88  ? 3.238   13.557  -4.158  1.00 0.00 ? 88  SER A CA   1  
ATOM   1193  C C    . SER A 1 88  ? 2.205   12.473  -4.512  1.00 0.00 ? 88  SER A C    1  
ATOM   1194  O O    . SER A 1 88  ? 1.010   12.779  -4.534  1.00 0.00 ? 88  SER A O    1  
ATOM   1195  C CB   . SER A 1 88  ? 3.869   14.115  -5.436  1.00 0.00 ? 88  SER A CB   1  
ATOM   1196  O OG   . SER A 1 88  ? 4.684   13.144  -6.056  1.00 0.00 ? 88  SER A OG   1  
ATOM   1197  H H    . SER A 1 88  ? 4.874   12.366  -3.467  1.00 0.00 ? 88  SER A H    1  
ATOM   1198  H HA   . SER A 1 88  ? 2.672   14.371  -3.714  1.00 0.00 ? 88  SER A HA   1  
ATOM   1199  H HB3  . SER A 1 88  ? 4.478   14.984  -5.183  1.00 0.00 ? 88  SER A HB3  1  
ATOM   1200  H HG   . SER A 1 88  ? 5.373   13.616  -6.570  1.00 0.00 ? 88  SER A HG   1  
ATOM   1201  N N    . VAL A 1 89  ? 2.603   11.214  -4.719  1.00 0.00 ? 89  VAL A N    1  
ATOM   1202  C CA   . VAL A 1 89  ? 1.690   10.080  -4.988  1.00 0.00 ? 89  VAL A CA   1  
ATOM   1203  C C    . VAL A 1 89  ? 2.417   8.746   -4.820  1.00 0.00 ? 89  VAL A C    1  
ATOM   1204  O O    . VAL A 1 89  ? 3.465   8.555   -5.422  1.00 0.00 ? 89  VAL A O    1  
ATOM   1205  C CB   . VAL A 1 89  ? 1.076   10.204  -6.409  1.00 0.00 ? 89  VAL A CB   1  
ATOM   1206  C CG1  . VAL A 1 89  ? 2.079   10.415  -7.553  1.00 0.00 ? 89  VAL A CG1  1  
ATOM   1207  C CG2  . VAL A 1 89  ? 0.197   9.002   -6.760  1.00 0.00 ? 89  VAL A CG2  1  
ATOM   1208  H H    . VAL A 1 89  ? 3.596   11.039  -4.810  1.00 0.00 ? 89  VAL A H    1  
ATOM   1209  H HA   . VAL A 1 89  ? 0.876   10.110  -4.267  1.00 0.00 ? 89  VAL A HA   1  
ATOM   1210  H HB   . VAL A 1 89  ? 0.423   11.076  -6.406  1.00 0.00 ? 89  VAL A HB   1  
ATOM   1211  H HG11 . VAL A 1 89  ? 2.733   9.547   -7.651  1.00 0.00 ? 89  VAL A HG11 1  
ATOM   1212  H HG12 . VAL A 1 89  ? 1.543   10.557  -8.492  1.00 0.00 ? 89  VAL A HG12 1  
ATOM   1213  H HG13 . VAL A 1 89  ? 2.689   11.297  -7.366  1.00 0.00 ? 89  VAL A HG13 1  
ATOM   1214  H HG21 . VAL A 1 89  ? -0.521  8.813   -5.966  1.00 0.00 ? 89  VAL A HG21 1  
ATOM   1215  H HG22 . VAL A 1 89  ? -0.349  9.195   -7.683  1.00 0.00 ? 89  VAL A HG22 1  
ATOM   1216  H HG23 . VAL A 1 89  ? 0.816   8.116   -6.905  1.00 0.00 ? 89  VAL A HG23 1  
ATOM   1217  N N    . VAL A 1 90  ? 1.880   7.816   -4.022  1.00 0.00 ? 90  VAL A N    1  
ATOM   1218  C CA   . VAL A 1 90  ? 2.338   6.411   -4.059  1.00 0.00 ? 90  VAL A CA   1  
ATOM   1219  C C    . VAL A 1 90  ? 1.546   5.673   -5.132  1.00 0.00 ? 90  VAL A C    1  
ATOM   1220  O O    . VAL A 1 90  ? 0.325   5.554   -5.033  1.00 0.00 ? 90  VAL A O    1  
ATOM   1221  C CB   . VAL A 1 90  ? 2.191   5.643   -2.722  1.00 0.00 ? 90  VAL A CB   1  
ATOM   1222  C CG1  . VAL A 1 90  ? 3.481   5.631   -1.903  1.00 0.00 ? 90  VAL A CG1  1  
ATOM   1223  C CG2  . VAL A 1 90  ? 1.054   6.150   -1.828  1.00 0.00 ? 90  VAL A CG2  1  
ATOM   1224  H H    . VAL A 1 90  ? 1.004   8.026   -3.556  1.00 0.00 ? 90  VAL A H    1  
ATOM   1225  H HA   . VAL A 1 90  ? 3.390   6.372   -4.354  1.00 0.00 ? 90  VAL A HA   1  
ATOM   1226  H HB   . VAL A 1 90  ? 1.984   4.601   -2.955  1.00 0.00 ? 90  VAL A HB   1  
ATOM   1227  H HG11 . VAL A 1 90  ? 3.676   6.624   -1.506  1.00 0.00 ? 90  VAL A HG11 1  
ATOM   1228  H HG12 . VAL A 1 90  ? 3.388   4.923   -1.081  1.00 0.00 ? 90  VAL A HG12 1  
ATOM   1229  H HG13 . VAL A 1 90  ? 4.318   5.323   -2.532  1.00 0.00 ? 90  VAL A HG13 1  
ATOM   1230  H HG21 . VAL A 1 90  ? 0.144   6.203   -2.418  1.00 0.00 ? 90  VAL A HG21 1  
ATOM   1231  H HG22 . VAL A 1 90  ? 0.895   5.463   -0.999  1.00 0.00 ? 90  VAL A HG22 1  
ATOM   1232  H HG23 . VAL A 1 90  ? 1.285   7.145   -1.447  1.00 0.00 ? 90  VAL A HG23 1  
ATOM   1233  N N    . THR A 1 91  ? 2.205   5.159   -6.163  1.00 0.00 ? 91  THR A N    1  
ATOM   1234  C CA   . THR A 1 91  ? 1.729   3.935   -6.823  1.00 0.00 ? 91  THR A CA   1  
ATOM   1235  C C    . THR A 1 91  ? 2.045   2.734   -5.930  1.00 0.00 ? 91  THR A C    1  
ATOM   1236  O O    . THR A 1 91  ? 3.041   2.708   -5.205  1.00 0.00 ? 91  THR A O    1  
ATOM   1237  C CB   . THR A 1 91  ? 2.284   3.745   -8.248  1.00 0.00 ? 91  THR A CB   1  
ATOM   1238  O OG1  . THR A 1 91  ? 3.685   3.707   -8.296  1.00 0.00 ? 91  THR A OG1  1  
ATOM   1239  C CG2  . THR A 1 91  ? 1.850   4.872   -9.187  1.00 0.00 ? 91  THR A CG2  1  
ATOM   1240  H H    . THR A 1 91  ? 3.186   5.412   -6.290  1.00 0.00 ? 91  THR A H    1  
ATOM   1241  H HA   . THR A 1 91  ? 0.647   3.975   -6.912  1.00 0.00 ? 91  THR A HA   1  
ATOM   1242  H HB   . THR A 1 91  ? 1.895   2.804   -8.649  1.00 0.00 ? 91  THR A HB   1  
ATOM   1243  H HG1  . THR A 1 91  ? 4.030   4.555   -7.927  1.00 0.00 ? 91  THR A HG1  1  
ATOM   1244  H HG21 . THR A 1 91  ? 2.208   5.834   -8.818  1.00 0.00 ? 91  THR A HG21 1  
ATOM   1245  H HG22 . THR A 1 91  ? 2.268   4.697   -10.180 1.00 0.00 ? 91  THR A HG22 1  
ATOM   1246  H HG23 . THR A 1 91  ? 0.766   4.893   -9.271  1.00 0.00 ? 91  THR A HG23 1  
ATOM   1247  N N    . LEU A 1 92  ? 1.141   1.762   -5.932  1.00 0.00 ? 92  LEU A N    1  
ATOM   1248  C CA   . LEU A 1 92  ? 1.160   0.526   -5.153  1.00 0.00 ? 92  LEU A CA   1  
ATOM   1249  C C    . LEU A 1 92  ? 0.538   -0.595  -5.999  1.00 0.00 ? 92  LEU A C    1  
ATOM   1250  O O    . LEU A 1 92  ? -0.129  -0.347  -7.001  1.00 0.00 ? 92  LEU A O    1  
ATOM   1251  C CB   . LEU A 1 92  ? 0.326   0.684   -3.858  1.00 0.00 ? 92  LEU A CB   1  
ATOM   1252  C CG   . LEU A 1 92  ? 0.741   1.804   -2.890  1.00 0.00 ? 92  LEU A CG   1  
ATOM   1253  C CD1  . LEU A 1 92  ? -0.274  1.890   -1.750  1.00 0.00 ? 92  LEU A CD1  1  
ATOM   1254  C CD2  . LEU A 1 92  ? 2.118   1.569   -2.263  1.00 0.00 ? 92  LEU A CD2  1  
ATOM   1255  H H    . LEU A 1 92  ? 0.317   1.889   -6.512  1.00 0.00 ? 92  LEU A H    1  
ATOM   1256  H HA   . LEU A 1 92  ? 2.183   0.252   -4.900  1.00 0.00 ? 92  LEU A HA   1  
ATOM   1257  H HB3  . LEU A 1 92  ? 0.359   -0.259  -3.313  1.00 0.00 ? 92  LEU A HB3  1  
ATOM   1258  H HG   . LEU A 1 92  ? 0.738   2.759   -3.415  1.00 0.00 ? 92  LEU A HG   1  
ATOM   1259  H HD11 . LEU A 1 92  ? -0.278  0.966   -1.175  1.00 0.00 ? 92  LEU A HD11 1  
ATOM   1260  H HD12 . LEU A 1 92  ? -0.023  2.725   -1.098  1.00 0.00 ? 92  LEU A HD12 1  
ATOM   1261  H HD13 . LEU A 1 92  ? -1.269  2.059   -2.162  1.00 0.00 ? 92  LEU A HD13 1  
ATOM   1262  H HD21 . LEU A 1 92  ? 2.885   1.545   -3.032  1.00 0.00 ? 92  LEU A HD21 1  
ATOM   1263  H HD22 . LEU A 1 92  ? 2.348   2.377   -1.572  1.00 0.00 ? 92  LEU A HD22 1  
ATOM   1264  H HD23 . LEU A 1 92  ? 2.135   0.622   -1.731  1.00 0.00 ? 92  LEU A HD23 1  
ATOM   1265  N N    . GLU A 1 93  ? 0.668   -1.835  -5.546  1.00 0.00 ? 93  GLU A N    1  
ATOM   1266  C CA   . GLU A 1 93  ? -0.057  -2.997  -6.081  1.00 0.00 ? 93  GLU A CA   1  
ATOM   1267  C C    . GLU A 1 93  ? -0.545  -3.836  -4.904  1.00 0.00 ? 93  GLU A C    1  
ATOM   1268  O O    . GLU A 1 93  ? 0.245   -4.114  -4.001  1.00 0.00 ? 93  GLU A O    1  
ATOM   1269  C CB   . GLU A 1 93  ? 0.896   -3.785  -6.996  1.00 0.00 ? 93  GLU A CB   1  
ATOM   1270  C CG   . GLU A 1 93  ? 0.332   -5.020  -7.718  1.00 0.00 ? 93  GLU A CG   1  
ATOM   1271  C CD   . GLU A 1 93  ? 1.421   -5.732  -8.547  1.00 0.00 ? 93  GLU A CD   1  
ATOM   1272  O OE1  . GLU A 1 93  ? 2.522   -5.987  -7.996  1.00 0.00 ? 93  GLU A OE1  1  
ATOM   1273  O OE2  . GLU A 1 93  ? 1.170   -6.019  -9.741  1.00 0.00 ? 93  GLU A OE2  1  
ATOM   1274  H H    . GLU A 1 93  ? 1.288   -1.985  -4.759  1.00 0.00 ? 93  GLU A H    1  
ATOM   1275  H HA   . GLU A 1 93  ? -0.927  -2.678  -6.652  1.00 0.00 ? 93  GLU A HA   1  
ATOM   1276  H HB3  . GLU A 1 93  ? 1.726   -4.107  -6.380  1.00 0.00 ? 93  GLU A HB3  1  
ATOM   1277  H HG3  . GLU A 1 93  ? -0.481  -4.698  -8.373  1.00 0.00 ? 93  GLU A HG3  1  
ATOM   1278  N N    . VAL A 1 94  ? -1.831  -4.195  -4.874  1.00 0.00 ? 94  VAL A N    1  
ATOM   1279  C CA   . VAL A 1 94  ? -2.471  -4.859  -3.726  1.00 0.00 ? 94  VAL A CA   1  
ATOM   1280  C C    . VAL A 1 94  ? -3.503  -5.915  -4.145  1.00 0.00 ? 94  VAL A C    1  
ATOM   1281  O O    . VAL A 1 94  ? -3.984  -5.929  -5.274  1.00 0.00 ? 94  VAL A O    1  
ATOM   1282  C CB   . VAL A 1 94  ? -3.135  -3.844  -2.760  1.00 0.00 ? 94  VAL A CB   1  
ATOM   1283  C CG1  . VAL A 1 94  ? -2.204  -2.742  -2.239  1.00 0.00 ? 94  VAL A CG1  1  
ATOM   1284  C CG2  . VAL A 1 94  ? -4.358  -3.154  -3.374  1.00 0.00 ? 94  VAL A CG2  1  
ATOM   1285  H H    . VAL A 1 94  ? -2.419  -3.993  -5.683  1.00 0.00 ? 94  VAL A H    1  
ATOM   1286  H HA   . VAL A 1 94  ? -1.705  -5.392  -3.175  1.00 0.00 ? 94  VAL A HA   1  
ATOM   1287  H HB   . VAL A 1 94  ? -3.471  -4.405  -1.889  1.00 0.00 ? 94  VAL A HB   1  
ATOM   1288  H HG11 . VAL A 1 94  ? -1.877  -2.099  -3.058  1.00 0.00 ? 94  VAL A HG11 1  
ATOM   1289  H HG12 . VAL A 1 94  ? -2.726  -2.136  -1.501  1.00 0.00 ? 94  VAL A HG12 1  
ATOM   1290  H HG13 . VAL A 1 94  ? -1.336  -3.183  -1.764  1.00 0.00 ? 94  VAL A HG13 1  
ATOM   1291  H HG21 . VAL A 1 94  ? -5.111  -3.885  -3.667  1.00 0.00 ? 94  VAL A HG21 1  
ATOM   1292  H HG22 . VAL A 1 94  ? -4.804  -2.482  -2.641  1.00 0.00 ? 94  VAL A HG22 1  
ATOM   1293  H HG23 . VAL A 1 94  ? -4.059  -2.585  -4.254  1.00 0.00 ? 94  VAL A HG23 1  
ATOM   1294  N N    . ALA A 1 95  ? -3.903  -6.771  -3.200  1.00 0.00 ? 95  ALA A N    1  
ATOM   1295  C CA   . ALA A 1 95  ? -4.953  -7.773  -3.364  1.00 0.00 ? 95  ALA A CA   1  
ATOM   1296  C C    . ALA A 1 95  ? -5.878  -7.847  -2.136  1.00 0.00 ? 95  ALA A C    1  
ATOM   1297  O O    . ALA A 1 95  ? -5.458  -8.255  -1.050  1.00 0.00 ? 95  ALA A O    1  
ATOM   1298  C CB   . ALA A 1 95  ? -4.290  -9.118  -3.674  1.00 0.00 ? 95  ALA A CB   1  
ATOM   1299  H H    . ALA A 1 95  ? -3.342  -6.810  -2.356  1.00 0.00 ? 95  ALA A H    1  
ATOM   1300  H HA   . ALA A 1 95  ? -5.574  -7.495  -4.213  1.00 0.00 ? 95  ALA A HA   1  
ATOM   1301  H HB1  . ALA A 1 95  ? -3.605  -9.397  -2.876  1.00 0.00 ? 95  ALA A HB1  1  
ATOM   1302  H HB2  . ALA A 1 95  ? -5.050  -9.893  -3.779  1.00 0.00 ? 95  ALA A HB2  1  
ATOM   1303  H HB3  . ALA A 1 95  ? -3.727  -9.038  -4.606  1.00 0.00 ? 95  ALA A HB3  1  
ATOM   1304  N N    . LYS A 1 96  ? -7.144  -7.429  -2.298  1.00 0.00 ? 96  LYS A N    1  
ATOM   1305  C CA   . LYS A 1 96  ? -8.136  -7.359  -1.205  1.00 0.00 ? 96  LYS A CA   1  
ATOM   1306  C C    . LYS A 1 96  ? -8.333  -8.711  -0.502  1.00 0.00 ? 96  LYS A C    1  
ATOM   1307  O O    . LYS A 1 96  ? -8.967  -9.626  -1.034  1.00 0.00 ? 96  LYS A O    1  
ATOM   1308  C CB   . LYS A 1 96  ? -9.474  -6.754  -1.700  1.00 0.00 ? 96  LYS A CB   1  
ATOM   1309  C CG   . LYS A 1 96  ? -10.243 -5.906  -0.660  1.00 0.00 ? 96  LYS A CG   1  
ATOM   1310  C CD   . LYS A 1 96  ? -10.757 -6.625  0.607   1.00 0.00 ? 96  LYS A CD   1  
ATOM   1311  C CE   . LYS A 1 96  ? -10.801 -5.721  1.854   1.00 0.00 ? 96  LYS A CE   1  
ATOM   1312  N NZ   . LYS A 1 96  ? -9.481  -5.630  2.530   1.00 0.00 ? 96  LYS A NZ   1  
ATOM   1313  H H    . LYS A 1 96  ? -7.398  -7.054  -3.204  1.00 0.00 ? 96  LYS A H    1  
ATOM   1314  H HA   . LYS A 1 96  ? -7.719  -6.667  -0.473  1.00 0.00 ? 96  LYS A HA   1  
ATOM   1315  H HB3  . LYS A 1 96  ? -10.133 -7.542  -2.068  1.00 0.00 ? 96  LYS A HB3  1  
ATOM   1316  H HG3  . LYS A 1 96  ? -11.113 -5.485  -1.162  1.00 0.00 ? 96  LYS A HG3  1  
ATOM   1317  H HD3  . LYS A 1 96  ? -10.169 -7.503  0.841   1.00 0.00 ? 96  LYS A HD3  1  
ATOM   1318  H HE3  . LYS A 1 96  ? -11.527 -6.145  2.554   1.00 0.00 ? 96  LYS A HE3  1  
ATOM   1319  H HZ1  . LYS A 1 96  ? -8.794  -5.184  1.919   1.00 0.00 ? 96  LYS A HZ1  1  
ATOM   1320  H HZ2  . LYS A 1 96  ? -9.499  -5.109  3.398   1.00 0.00 ? 96  LYS A HZ2  1  
ATOM   1321  H HZ3  . LYS A 1 96  ? -9.123  -6.549  2.777   1.00 0.00 ? 96  LYS A HZ3  1  
ATOM   1322  N N    . GLN A 1 97  ? -7.857  -8.794  0.736   1.00 0.00 ? 97  GLN A N    1  
ATOM   1323  C CA   . GLN A 1 97  ? -8.178  -9.857  1.703   1.00 0.00 ? 97  GLN A CA   1  
ATOM   1324  C C    . GLN A 1 97  ? -8.567  -9.233  3.049   1.00 0.00 ? 97  GLN A C    1  
ATOM   1325  O O    . GLN A 1 97  ? -8.284  -8.059  3.277   1.00 0.00 ? 97  GLN A O    1  
ATOM   1326  C CB   . GLN A 1 97  ? -6.998  -10.831 1.843   1.00 0.00 ? 97  GLN A CB   1  
ATOM   1327  C CG   . GLN A 1 97  ? -6.746  -11.670 0.586   1.00 0.00 ? 97  GLN A CG   1  
ATOM   1328  C CD   . GLN A 1 97  ? -5.544  -12.588 0.745   1.00 0.00 ? 97  GLN A CD   1  
ATOM   1329  O OE1  . GLN A 1 97  ? -5.638  -13.807 0.774   1.00 0.00 ? 97  GLN A OE1  1  
ATOM   1330  N NE2  . GLN A 1 97  ? -4.369  -12.014 0.855   1.00 0.00 ? 97  GLN A NE2  1  
ATOM   1331  H H    . GLN A 1 97  ? -7.304  -8.023  1.075   1.00 0.00 ? 97  GLN A H    1  
ATOM   1332  H HA   . GLN A 1 97  ? -9.044  -10.420 1.350   1.00 0.00 ? 97  GLN A HA   1  
ATOM   1333  H HB3  . GLN A 1 97  ? -7.208  -11.519 2.663   1.00 0.00 ? 97  GLN A HB3  1  
ATOM   1334  H HG3  . GLN A 1 97  ? -6.571  -11.026 -0.275  1.00 0.00 ? 97  GLN A HG3  1  
ATOM   1335  H HE21 . GLN A 1 97  ? -4.304  -11.010 0.842   1.00 0.00 ? 97  GLN A HE21 1  
ATOM   1336  H HE22 . GLN A 1 97  ? -3.546  -12.599 0.936   1.00 0.00 ? 97  GLN A HE22 1  
ATOM   1337  N N    . GLY A 1 98  ? -9.224  -9.996  3.924   1.00 0.00 ? 98  GLY A N    1  
ATOM   1338  C CA   . GLY A 1 98  ? -9.737  -9.479  5.200   1.00 0.00 ? 98  GLY A CA   1  
ATOM   1339  C C    . GLY A 1 98  ? -10.697 -8.285  5.081   1.00 0.00 ? 98  GLY A C    1  
ATOM   1340  O O    . GLY A 1 98  ? -11.145 -7.913  3.994   1.00 0.00 ? 98  GLY A O    1  
ATOM   1341  H H    . GLY A 1 98  ? -9.428  -10.953 3.683   1.00 0.00 ? 98  GLY A H    1  
ATOM   1342  H HA2  . GLY A 1 98  ? -10.248 -10.275 5.742   1.00 0.00 ? 98  GLY A HA2  1  
ATOM   1343  H HA3  . GLY A 1 98  ? -8.885  -9.163  5.804   1.00 0.00 ? 98  GLY A HA3  1  
ATOM   1344  N N    . ALA A 1 99  ? -11.008 -7.678  6.220   1.00 0.00 ? 99  ALA A N    1  
ATOM   1345  C CA   . ALA A 1 99  ? -11.860 -6.497  6.346   1.00 0.00 ? 99  ALA A CA   1  
ATOM   1346  C C    . ALA A 1 99  ? -11.448 -5.676  7.584   1.00 0.00 ? 99  ALA A C    1  
ATOM   1347  O O    . ALA A 1 99  ? -10.505 -6.046  8.286   1.00 0.00 ? 99  ALA A O    1  
ATOM   1348  C CB   . ALA A 1 99  ? -13.327 -6.965  6.434   1.00 0.00 ? 99  ALA A CB   1  
ATOM   1349  H H    . ALA A 1 99  ? -10.575 -8.005  7.072   1.00 0.00 ? 99  ALA A H    1  
ATOM   1350  H HA   . ALA A 1 99  ? -11.741 -5.862  5.469   1.00 0.00 ? 99  ALA A HA   1  
ATOM   1351  H HB1  . ALA A 1 99  ? -13.473 -7.578  7.324   1.00 0.00 ? 99  ALA A HB1  1  
ATOM   1352  H HB2  . ALA A 1 99  ? -14.002 -6.108  6.476   1.00 0.00 ? 99  ALA A HB2  1  
ATOM   1353  H HB3  . ALA A 1 99  ? -13.574 -7.556  5.553   1.00 0.00 ? 99  ALA A HB3  1  
ATOM   1354  N N    . ILE A 1 100 ? -12.171 -4.585  7.873   1.00 0.00 ? 100 ILE A N    1  
ATOM   1355  C CA   . ILE A 1 100 ? -12.101 -3.909  9.182   1.00 0.00 ? 100 ILE A CA   1  
ATOM   1356  C C    . ILE A 1 100 ? -12.554 -4.900  10.273  1.00 0.00 ? 100 ILE A C    1  
ATOM   1357  O O    . ILE A 1 100 ? -11.783 -5.210  11.177  1.00 0.00 ? 100 ILE A O    1  
ATOM   1358  C CB   . ILE A 1 100 ? -12.956 -2.613  9.185   1.00 0.00 ? 100 ILE A CB   1  
ATOM   1359  C CG1  . ILE A 1 100 ? -12.506 -1.645  8.063   1.00 0.00 ? 100 ILE A CG1  1  
ATOM   1360  C CG2  . ILE A 1 100 ? -12.880 -1.922  10.562  1.00 0.00 ? 100 ILE A CG2  1  
ATOM   1361  C CD1  . ILE A 1 100 ? -13.380 -0.391  7.916   1.00 0.00 ? 100 ILE A CD1  1  
ATOM   1362  H H    . ILE A 1 100 ? -12.930 -4.347  7.256   1.00 0.00 ? 100 ILE A H    1  
ATOM   1363  H HA   . ILE A 1 100 ? -11.064 -3.641  9.397   1.00 0.00 ? 100 ILE A HA   1  
ATOM   1364  H HB   . ILE A 1 100 ? -13.996 -2.882  9.002   1.00 0.00 ? 100 ILE A HB   1  
ATOM   1365  H HG13 . ILE A 1 100 ? -12.534 -2.162  7.103   1.00 0.00 ? 100 ILE A HG13 1  
ATOM   1366  H HG21 . ILE A 1 100 ? -11.857 -1.600  10.763  1.00 0.00 ? 100 ILE A HG21 1  
ATOM   1367  H HG22 . ILE A 1 100 ? -13.540 -1.057  10.593  1.00 0.00 ? 100 ILE A HG22 1  
ATOM   1368  H HG23 . ILE A 1 100 ? -13.195 -2.601  11.354  1.00 0.00 ? 100 ILE A HG23 1  
ATOM   1369  H HD11 . ILE A 1 100 ? -13.268 0.267   8.778   1.00 0.00 ? 100 ILE A HD11 1  
ATOM   1370  H HD12 . ILE A 1 100 ? -13.079 0.155   7.022   1.00 0.00 ? 100 ILE A HD12 1  
ATOM   1371  H HD13 . ILE A 1 100 ? -14.426 -0.679  7.809   1.00 0.00 ? 100 ILE A HD13 1  
ATOM   1372  N N    . TYR A 1 101 ? -13.754 -5.464  10.085  1.00 0.00 ? 101 TYR A N    1  
ATOM   1373  C CA   . TYR A 1 101 ? -14.334 -6.635  10.754  1.00 0.00 ? 101 TYR A CA   1  
ATOM   1374  C C    . TYR A 1 101 ? -15.308 -7.312  9.775   1.00 0.00 ? 101 TYR A C    1  
ATOM   1375  O O    . TYR A 1 101 ? -15.883 -6.604  8.914   1.00 0.00 ? 101 TYR A O    1  
ATOM   1376  C CB   . TYR A 1 101 ? -15.053 -6.218  12.052  1.00 0.00 ? 101 TYR A CB   1  
ATOM   1377  C CG   . TYR A 1 101 ? -14.162 -5.726  13.185  1.00 0.00 ? 101 TYR A CG   1  
ATOM   1378  C CD1  . TYR A 1 101 ? -13.223 -6.611  13.763  1.00 0.00 ? 101 TYR A CD1  1  
ATOM   1379  C CD2  . TYR A 1 101 ? -14.283 -4.402  13.668  1.00 0.00 ? 101 TYR A CD2  1  
ATOM   1380  C CE1  . TYR A 1 101 ? -12.391 -6.168  14.812  1.00 0.00 ? 101 TYR A CE1  1  
ATOM   1381  C CE2  . TYR A 1 101 ? -13.453 -3.953  14.720  1.00 0.00 ? 101 TYR A CE2  1  
ATOM   1382  C CZ   . TYR A 1 101 ? -12.502 -4.838  15.284  1.00 0.00 ? 101 TYR A CZ   1  
ATOM   1383  O OH   . TYR A 1 101 ? -11.691 -4.427  16.298  1.00 0.00 ? 101 TYR A OH   1  
ATOM   1384  O OXT  . TYR A 1 101 ? -15.466 -8.549  9.826   1.00 0.00 ? 101 TYR A OXT  1  
ATOM   1385  H H    . TYR A 1 101 ? -14.308 -5.147  9.302   1.00 0.00 ? 101 TYR A H    1  
ATOM   1386  H HA   . TYR A 1 101 ? -13.556 -7.356  10.994  1.00 0.00 ? 101 TYR A HA   1  
ATOM   1387  H HB3  . TYR A 1 101 ? -15.609 -7.078  12.422  1.00 0.00 ? 101 TYR A HB3  1  
ATOM   1388  H HD1  . TYR A 1 101 ? -13.133 -7.622  13.380  1.00 0.00 ? 101 TYR A HD1  1  
ATOM   1389  H HD2  . TYR A 1 101 ? -15.013 -3.729  13.225  1.00 0.00 ? 101 TYR A HD2  1  
ATOM   1390  H HE1  . TYR A 1 101 ? -11.655 -6.834  15.255  1.00 0.00 ? 101 TYR A HE1  1  
ATOM   1391  H HE2  . TYR A 1 101 ? -13.544 -2.941  15.097  1.00 0.00 ? 101 TYR A HE2  1  
ATOM   1392  H HH   . TYR A 1 101 ? -11.800 -3.503  16.549  1.00 0.00 ? 101 TYR A HH   1  
HETATM 1393  C C8   . STF B 2 .   ? 4.467   6.819   6.841   1.00 0.00 ? 102 STF A C8   1  
HETATM 1394  S S12  . STF B 2 .   ? 5.501   7.717   5.591   1.00 0.00 ? 102 STF A S12  1  
HETATM 1395  C C11  . STF B 2 .   ? 3.997   8.495   4.876   1.00 0.00 ? 102 STF A C11  1  
HETATM 1396  N N10  . STF B 2 .   ? 2.834   8.163   5.475   1.00 0.00 ? 102 STF A N10  1  
HETATM 1397  C C9   . STF B 2 .   ? 3.012   7.167   6.570   1.00 0.00 ? 102 STF A C9   1  
HETATM 1398  O O17  . STF B 2 .   ? 2.087   6.903   7.304   1.00 0.00 ? 102 STF A O17  1  
HETATM 1399  S S18  . STF B 2 .   ? 4.206   9.691   3.631   1.00 0.00 ? 102 STF A S18  1  
HETATM 1400  C C7   . STF B 2 .   ? 4.684   5.346   6.722   1.00 0.00 ? 102 STF A C7   1  
HETATM 1401  C C1   . STF B 2 .   ? 3.996   4.702   5.568   1.00 0.00 ? 102 STF A C1   1  
HETATM 1402  C C6   . STF B 2 .   ? 4.436   4.807   4.255   1.00 0.00 ? 102 STF A C6   1  
HETATM 1403  C C5   . STF B 2 .   ? 3.738   4.226   3.181   1.00 0.00 ? 102 STF A C5   1  
HETATM 1404  C C4   . STF B 2 .   ? 2.600   3.429   3.428   1.00 0.00 ? 102 STF A C4   1  
HETATM 1405  C C3   . STF B 2 .   ? 2.249   3.183   4.772   1.00 0.00 ? 102 STF A C3   1  
HETATM 1406  C C2   . STF B 2 .   ? 2.946   3.759   5.822   1.00 0.00 ? 102 STF A C2   1  
HETATM 1407  C C13  . STF B 2 .   ? 1.814   2.825   2.267   1.00 0.00 ? 102 STF A C13  1  
HETATM 1408  F F16  . STF B 2 .   ? 1.722   3.736   1.232   1.00 0.00 ? 102 STF A F16  1  
HETATM 1409  F F15  . STF B 2 .   ? 0.555   2.458   2.632   1.00 0.00 ? 102 STF A F15  1  
HETATM 1410  F F14  . STF B 2 .   ? 2.463   1.705   1.809   1.00 0.00 ? 102 STF A F14  1  
HETATM 1411  H H7   . STF B 2 .   ? 4.757   7.186   7.829   1.00 0.00 ? 102 STF A H7   1  
HETATM 1412  H H19  . STF B 2 .   ? 5.233   9.594   3.547   1.00 0.00 ? 102 STF A H19  1  
HETATM 1413  H H6   . STF B 2 .   ? 5.783   5.126   6.672   1.00 0.00 ? 102 STF A H6   1  
HETATM 1414  H H5   . STF B 2 .   ? 4.361   4.828   7.675   1.00 0.00 ? 102 STF A H5   1  
HETATM 1415  H H4   . STF B 2 .   ? 5.319   5.423   4.034   1.00 0.00 ? 102 STF A H4   1  
HETATM 1416  H H3   . STF B 2 .   ? 4.058   4.390   2.166   1.00 0.00 ? 102 STF A H3   1  
HETATM 1417  H H2   . STF B 2 .   ? 1.401   2.521   4.985   1.00 0.00 ? 102 STF A H2   1  
HETATM 1418  H H1   . STF B 2 .   ? 2.665   3.547   6.843   1.00 0.00 ? 102 STF A H1   1  
ATOM   1419  N N    . GLY A 1 1   ? 2.508   -0.362  -18.868 1.00 0.00 ? 1   GLY A N    2  
ATOM   1420  C CA   . GLY A 1 1   ? 1.373   -1.188  -18.491 1.00 0.00 ? 1   GLY A CA   2  
ATOM   1421  C C    . GLY A 1 1   ? 0.110   -0.342  -18.325 1.00 0.00 ? 1   GLY A C    2  
ATOM   1422  O O    . GLY A 1 1   ? 0.188   0.880   -18.212 1.00 0.00 ? 1   GLY A O    2  
ATOM   1423  H H1   . GLY A 1 1   ? 2.270   0.525   -19.265 1.00 0.00 ? 1   GLY A H1   2  
ATOM   1424  H HA2  . GLY A 1 1   ? 1.207   -1.953  -19.250 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   1425  H HA3  . GLY A 1 1   ? 1.593   -1.708  -17.558 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   1426  N N    . PRO A 1 2   ? -1.054  -1.044  -18.315 1.00 0.00 ? 2   PRO A N    2  
ATOM   1427  C CA   . PRO A 1 2   ? -2.333  -0.370  -18.165 1.00 0.00 ? 2   PRO A CA   2  
ATOM   1428  C C    . PRO A 1 2   ? -2.550  0.076   -16.719 1.00 0.00 ? 2   PRO A C    2  
ATOM   1429  O O    . PRO A 1 2   ? -1.686  -0.121  -15.866 1.00 0.00 ? 2   PRO A O    2  
ATOM   1430  C CB   . PRO A 1 2   ? -3.367  -1.381  -18.637 1.00 0.00 ? 2   PRO A CB   2  
ATOM   1431  C CG   . PRO A 1 2   ? -2.679  -2.735  -18.592 1.00 0.00 ? 2   PRO A CG   2  
ATOM   1432  C CD   . PRO A 1 2   ? -1.184  -2.493  -18.445 1.00 0.00 ? 2   PRO A CD   2  
ATOM   1433  H HA   . PRO A 1 2   ? -2.353  0.464   -18.714 1.00 0.00 ? 2   PRO A HA   2  
ATOM   1434  H HB2  . PRO A 1 2   ? -4.247  -1.368  -17.992 1.00 0.00 ? 2   PRO A HB2  2  
ATOM   1435  H HB3  . PRO A 1 2   ? -3.709  -1.148  -19.645 1.00 0.00 ? 2   PRO A HB3  2  
ATOM   1436  H HG2  . PRO A 1 2   ? -3.053  -3.327  -17.758 1.00 0.00 ? 2   PRO A HG2  2  
ATOM   1437  H HG3  . PRO A 1 2   ? -2.887  -3.297  -19.502 1.00 0.00 ? 2   PRO A HG3  2  
ATOM   1438  H HD2  . PRO A 1 2   ? -0.784  -3.007  -17.572 1.00 0.00 ? 2   PRO A HD2  2  
ATOM   1439  H HD3  . PRO A 1 2   ? -0.637  -2.862  -19.313 1.00 0.00 ? 2   PRO A HD3  2  
ATOM   1440  N N    . LEU A 1 3   ? -3.712  0.671   -16.485 1.00 0.00 ? 3   LEU A N    2  
ATOM   1441  C CA   . LEU A 1 3   ? -4.053  1.149   -15.156 1.00 0.00 ? 3   LEU A CA   2  
ATOM   1442  C C    . LEU A 1 3   ? -5.540  1.509   -15.114 1.00 0.00 ? 3   LEU A C    2  
ATOM   1443  O O    . LEU A 1 3   ? -5.987  2.402   -15.832 1.00 0.00 ? 3   LEU A O    2  
ATOM   1444  C CB   . LEU A 1 3   ? -3.132  2.298   -14.745 1.00 0.00 ? 3   LEU A CB   2  
ATOM   1445  C CG   . LEU A 1 3   ? -3.092  3.498   -15.693 1.00 0.00 ? 3   LEU A CG   2  
ATOM   1446  C CD1  . LEU A 1 3   ? -3.820  4.701   -15.087 1.00 0.00 ? 3   LEU A CD1  2  
ATOM   1447  C CD2  . LEU A 1 3   ? -1.653  3.838   -16.088 1.00 0.00 ? 3   LEU A CD2  2  
ATOM   1448  H H    . LEU A 1 3   ? -4.411  0.829   -17.183 1.00 0.00 ? 3   LEU A H    2  
ATOM   1449  H HA   . LEU A 1 3   ? -3.877  0.329   -14.459 1.00 0.00 ? 3   LEU A HA   2  
ATOM   1450  H HB2  . LEU A 1 3   ? -3.438  2.650   -13.760 1.00 0.00 ? 3   LEU A HB2  2  
ATOM   1451  H HB3  . LEU A 1 3   ? -2.118  1.907   -14.645 1.00 0.00 ? 3   LEU A HB3  2  
ATOM   1452  H HG   . LEU A 1 3   ? -3.621  3.230   -16.607 1.00 0.00 ? 3   LEU A HG   2  
ATOM   1453  H HD11 . LEU A 1 3   ? -3.581  4.773   -14.027 1.00 0.00 ? 3   LEU A HD11 2  
ATOM   1454  H HD12 . LEU A 1 3   ? -3.501  5.611   -15.595 1.00 0.00 ? 3   LEU A HD12 2  
ATOM   1455  H HD13 . LEU A 1 3   ? -4.896  4.574   -15.210 1.00 0.00 ? 3   LEU A HD13 2  
ATOM   1456  H HD21 . LEU A 1 3   ? -1.661  4.570   -16.896 1.00 0.00 ? 3   LEU A HD21 2  
ATOM   1457  H HD22 . LEU A 1 3   ? -1.129  4.251   -15.229 1.00 0.00 ? 3   LEU A HD22 2  
ATOM   1458  H HD23 . LEU A 1 3   ? -1.146  2.934   -16.425 1.00 0.00 ? 3   LEU A HD23 2  
ATOM   1459  N N    . GLY A 1 4   ? -6.266  0.795   -14.266 1.00 0.00 ? 4   GLY A N    2  
ATOM   1460  C CA   . GLY A 1 4   ? -7.693  1.027   -14.122 1.00 0.00 ? 4   GLY A CA   2  
ATOM   1461  C C    . GLY A 1 4   ? -7.965  2.392   -13.485 1.00 0.00 ? 4   GLY A C    2  
ATOM   1462  O O    . GLY A 1 4   ? -7.273  3.365   -13.775 1.00 0.00 ? 4   GLY A O    2  
ATOM   1463  H H    . GLY A 1 4   ? -5.895  0.069   -13.686 1.00 0.00 ? 4   GLY A H    2  
ATOM   1464  H HA2  . GLY A 1 4   ? -8.173  0.976   -15.099 1.00 0.00 ? 4   GLY A HA2  2  
ATOM   1465  H HA3  . GLY A 1 4   ? -8.133  0.242   -13.508 1.00 0.00 ? 4   GLY A HA3  2  
ATOM   1466  N N    . SER A 1 5   ? -8.973  2.417   -12.626 1.00 0.00 ? 5   SER A N    2  
ATOM   1467  C CA   . SER A 1 5   ? -9.345  3.647   -11.946 1.00 0.00 ? 5   SER A CA   2  
ATOM   1468  C C    . SER A 1 5   ? -9.664  3.355   -10.479 1.00 0.00 ? 5   SER A C    2  
ATOM   1469  O O    . SER A 1 5   ? -9.055  3.935   -9.580  1.00 0.00 ? 5   SER A O    2  
ATOM   1470  C CB   . SER A 1 5   ? -10.542 4.313   -12.627 1.00 0.00 ? 5   SER A CB   2  
ATOM   1471  O OG   . SER A 1 5   ? -10.253 5.648   -13.027 1.00 0.00 ? 5   SER A OG   2  
ATOM   1472  H H    . SER A 1 5   ? -9.533  1.620   -12.395 1.00 0.00 ? 5   SER A H    2  
ATOM   1473  H HA   . SER A 1 5   ? -8.473  4.296   -12.028 1.00 0.00 ? 5   SER A HA   2  
ATOM   1474  H HB2  . SER A 1 5   ? -10.834 3.729   -13.499 1.00 0.00 ? 5   SER A HB2  2  
ATOM   1475  H HB3  . SER A 1 5   ? -11.393 4.315   -11.944 1.00 0.00 ? 5   SER A HB3  2  
ATOM   1476  H HG   . SER A 1 5   ? -9.295  5.723   -13.305 1.00 0.00 ? 5   SER A HG   2  
ATOM   1477  N N    . LEU A 1 6   ? -10.618 2.457   -10.280 1.00 0.00 ? 6   LEU A N    2  
ATOM   1478  C CA   . LEU A 1 6   ? -11.024 2.082   -8.936  1.00 0.00 ? 6   LEU A CA   2  
ATOM   1479  C C    . LEU A 1 6   ? -12.012 0.916   -9.014  1.00 0.00 ? 6   LEU A C    2  
ATOM   1480  O O    . LEU A 1 6   ? -13.044 1.016   -9.677  1.00 0.00 ? 6   LEU A O    2  
ATOM   1481  C CB   . LEU A 1 6   ? -11.565 3.297   -8.181  1.00 0.00 ? 6   LEU A CB   2  
ATOM   1482  C CG   . LEU A 1 6   ? -12.794 3.975   -8.792  1.00 0.00 ? 6   LEU A CG   2  
ATOM   1483  C CD1  . LEU A 1 6   ? -13.975 3.947   -7.819  1.00 0.00 ? 6   LEU A CD1  2  
ATOM   1484  C CD2  . LEU A 1 6   ? -12.464 5.396   -9.253  1.00 0.00 ? 6   LEU A CD2  2  
ATOM   1485  H H    . LEU A 1 6   ? -11.108 1.990   -11.014 1.00 0.00 ? 6   LEU A H    2  
ATOM   1486  H HA   . LEU A 1 6   ? -10.133 1.743   -8.408  1.00 0.00 ? 6   LEU A HA   2  
ATOM   1487  H HB2  . LEU A 1 6   ? -11.811 2.991   -7.165  1.00 0.00 ? 6   LEU A HB2  2  
ATOM   1488  H HB3  . LEU A 1 6   ? -10.768 4.037   -8.104  1.00 0.00 ? 6   LEU A HB3  2  
ATOM   1489  H HG   . LEU A 1 6   ? -13.091 3.409   -9.675  1.00 0.00 ? 6   LEU A HG   2  
ATOM   1490  H HD11 . LEU A 1 6   ? -14.192 2.916   -7.540  1.00 0.00 ? 6   LEU A HD11 2  
ATOM   1491  H HD12 . LEU A 1 6   ? -13.725 4.519   -6.927  1.00 0.00 ? 6   LEU A HD12 2  
ATOM   1492  H HD13 . LEU A 1 6   ? -14.850 4.385   -8.299  1.00 0.00 ? 6   LEU A HD13 2  
ATOM   1493  H HD21 . LEU A 1 6   ? -12.341 6.041   -8.384  1.00 0.00 ? 6   LEU A HD21 2  
ATOM   1494  H HD22 . LEU A 1 6   ? -11.541 5.384   -9.832  1.00 0.00 ? 6   LEU A HD22 2  
ATOM   1495  H HD23 . LEU A 1 6   ? -13.276 5.773   -9.873  1.00 0.00 ? 6   LEU A HD23 2  
ATOM   1496  N N    . ARG A 1 7   ? -11.663 -0.162  -8.326  1.00 0.00 ? 7   ARG A N    2  
ATOM   1497  C CA   . ARG A 1 7   ? -12.507 -1.343  -8.309  1.00 0.00 ? 7   ARG A CA   2  
ATOM   1498  C C    . ARG A 1 7   ? -12.020 -2.329  -7.245  1.00 0.00 ? 7   ARG A C    2  
ATOM   1499  O O    . ARG A 1 7   ? -10.816 -2.475  -7.033  1.00 0.00 ? 7   ARG A O    2  
ATOM   1500  C CB   . ARG A 1 7   ? -12.510 -2.039  -9.672  1.00 0.00 ? 7   ARG A CB   2  
ATOM   1501  C CG   . ARG A 1 7   ? -13.835 -1.808  -10.402 1.00 0.00 ? 7   ARG A CG   2  
ATOM   1502  C CD   . ARG A 1 7   ? -13.617 -1.699  -11.913 1.00 0.00 ? 7   ARG A CD   2  
ATOM   1503  N NE   . ARG A 1 7   ? -13.447 -0.281  -12.299 1.00 0.00 ? 7   ARG A NE   2  
ATOM   1504  C CZ   . ARG A 1 7   ? -14.390 0.658   -12.148 1.00 0.00 ? 7   ARG A CZ   2  
ATOM   1505  N NH1  . ARG A 1 7   ? -15.576 0.334   -11.615 1.00 0.00 ? 7   ARG A NH1  2  
ATOM   1506  N NH2  . ARG A 1 7   ? -14.146 1.919   -12.527 1.00 0.00 ? 7   ARG A NH2  2  
ATOM   1507  H H    . ARG A 1 7   ? -10.823 -0.234  -7.790  1.00 0.00 ? 7   ARG A H    2  
ATOM   1508  H HA   . ARG A 1 7   ? -13.503 -0.971  -8.072  1.00 0.00 ? 7   ARG A HA   2  
ATOM   1509  H HB2  . ARG A 1 7   ? -11.686 -1.660  -10.279 1.00 0.00 ? 7   ARG A HB2  2  
ATOM   1510  H HB3  . ARG A 1 7   ? -12.345 -3.108  -9.541  1.00 0.00 ? 7   ARG A HB3  2  
ATOM   1511  H HG2  . ARG A 1 7   ? -14.520 -2.627  -10.188 1.00 0.00 ? 7   ARG A HG2  2  
ATOM   1512  H HG3  . ARG A 1 7   ? -14.303 -0.896  -10.033 1.00 0.00 ? 7   ARG A HG3  2  
ATOM   1513  H HD2  . ARG A 1 7   ? -12.737 -2.273  -12.204 1.00 0.00 ? 7   ARG A HD2  2  
ATOM   1514  H HD3  . ARG A 1 7   ? -14.466 -2.130  -12.443 1.00 0.00 ? 7   ARG A HD3  2  
ATOM   1515  H HE   . ARG A 1 7   ? -12.573 -0.007  -12.701 1.00 0.00 ? 7   ARG A HE   2  
ATOM   1516  H HH11 . ARG A 1 7   ? -15.759 -0.608  -11.332 1.00 0.00 ? 7   ARG A HH11 2  
ATOM   1517  H HH12 . ARG A 1 7   ? -16.280 1.036   -11.501 1.00 0.00 ? 7   ARG A HH12 2  
ATOM   1518  H HH21 . ARG A 1 7   ? -13.262 2.159   -12.924 1.00 0.00 ? 7   ARG A HH21 2  
ATOM   1519  H HH22 . ARG A 1 7   ? -14.852 2.620   -12.413 1.00 0.00 ? 7   ARG A HH22 2  
ATOM   1520  N N    . LYS A 1 8   ? -12.978 -2.979  -6.602  1.00 0.00 ? 8   LYS A N    2  
ATOM   1521  C CA   . LYS A 1 8   ? -12.660 -3.945  -5.565  1.00 0.00 ? 8   LYS A CA   2  
ATOM   1522  C C    . LYS A 1 8   ? -12.024 -5.182  -6.202  1.00 0.00 ? 8   LYS A C    2  
ATOM   1523  O O    . LYS A 1 8   ? -12.703 -6.176  -6.453  1.00 0.00 ? 8   LYS A O    2  
ATOM   1524  C CB   . LYS A 1 8   ? -13.902 -4.256  -4.725  1.00 0.00 ? 8   LYS A CB   2  
ATOM   1525  C CG   . LYS A 1 8   ? -14.071 -3.236  -3.599  1.00 0.00 ? 8   LYS A CG   2  
ATOM   1526  C CD   . LYS A 1 8   ? -14.583 -1.900  -4.140  1.00 0.00 ? 8   LYS A CD   2  
ATOM   1527  C CE   . LYS A 1 8   ? -13.627 -0.761  -3.779  1.00 0.00 ? 8   LYS A CE   2  
ATOM   1528  N NZ   . LYS A 1 8   ? -13.726 0.332   -4.772  1.00 0.00 ? 8   LYS A NZ   2  
ATOM   1529  H H    . LYS A 1 8   ? -13.954 -2.854  -6.780  1.00 0.00 ? 8   LYS A H    2  
ATOM   1530  H HA   . LYS A 1 8   ? -11.931 -3.484  -4.901  1.00 0.00 ? 8   LYS A HA   2  
ATOM   1531  H HB2  . LYS A 1 8   ? -14.787 -4.251  -5.362  1.00 0.00 ? 8   LYS A HB2  2  
ATOM   1532  H HB3  . LYS A 1 8   ? -13.820 -5.259  -4.304  1.00 0.00 ? 8   LYS A HB3  2  
ATOM   1533  H HG2  . LYS A 1 8   ? -14.772 -3.623  -2.856  1.00 0.00 ? 8   LYS A HG2  2  
ATOM   1534  H HG3  . LYS A 1 8   ? -13.118 -3.086  -3.092  1.00 0.00 ? 8   LYS A HG3  2  
ATOM   1535  H HD2  . LYS A 1 8   ? -14.690 -1.959  -5.223  1.00 0.00 ? 8   LYS A HD2  2  
ATOM   1536  H HD3  . LYS A 1 8   ? -15.571 -1.692  -3.732  1.00 0.00 ? 8   LYS A HD3  2  
ATOM   1537  H HE2  . LYS A 1 8   ? -13.864 -0.380  -2.786  1.00 0.00 ? 8   LYS A HE2  2  
ATOM   1538  H HE3  . LYS A 1 8   ? -12.604 -1.135  -3.743  1.00 0.00 ? 8   LYS A HE3  2  
ATOM   1539  H HZ1  . LYS A 1 8   ? -14.480 0.143   -5.402  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM   1540  H HZ2  . LYS A 1 8   ? -13.896 1.198   -4.300  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM   1541  H HZ3  . LYS A 1 8   ? -12.871 0.396   -5.285  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM   1542  N N    . GLU A 1 9   ? -10.726 -5.079  -6.445  1.00 0.00 ? 9   GLU A N    2  
ATOM   1543  C CA   . GLU A 1 9   ? -9.990  -6.176  -7.049  1.00 0.00 ? 9   GLU A CA   2  
ATOM   1544  C C    . GLU A 1 9   ? -8.484  -5.974  -6.861  1.00 0.00 ? 9   GLU A C    2  
ATOM   1545  O O    . GLU A 1 9   ? -8.029  -4.853  -6.634  1.00 0.00 ? 9   GLU A O    2  
ATOM   1546  C CB   . GLU A 1 9   ? -10.341 -6.324  -8.531  1.00 0.00 ? 9   GLU A CB   2  
ATOM   1547  C CG   . GLU A 1 9   ? -9.539  -5.342  -9.385  1.00 0.00 ? 9   GLU A CG   2  
ATOM   1548  C CD   . GLU A 1 9   ? -10.215 -5.111  -10.739 1.00 0.00 ? 9   GLU A CD   2  
ATOM   1549  O OE1  . GLU A 1 9   ? -10.555 -6.127  -11.382 1.00 0.00 ? 9   GLU A OE1  2  
ATOM   1550  O OE2  . GLU A 1 9   ? -10.379 -3.925  -11.097 1.00 0.00 ? 9   GLU A OE2  2  
ATOM   1551  H H    . GLU A 1 9   ? -10.180 -4.268  -6.238  1.00 0.00 ? 9   GLU A H    2  
ATOM   1552  H HA   . GLU A 1 9   ? -10.311 -7.071  -6.515  1.00 0.00 ? 9   GLU A HA   2  
ATOM   1553  H HB2  . GLU A 1 9   ? -10.138 -7.345  -8.857  1.00 0.00 ? 9   GLU A HB2  2  
ATOM   1554  H HB3  . GLU A 1 9   ? -11.407 -6.150  -8.674  1.00 0.00 ? 9   GLU A HB3  2  
ATOM   1555  H HG2  . GLU A 1 9   ? -9.439  -4.392  -8.858  1.00 0.00 ? 9   GLU A HG2  2  
ATOM   1556  H HG3  . GLU A 1 9   ? -8.531  -5.727  -9.540  1.00 0.00 ? 9   GLU A HG3  2  
ATOM   1557  N N    . PRO A 1 10  ? -7.734  -7.103  -6.963  1.00 0.00 ? 10  PRO A N    2  
ATOM   1558  C CA   . PRO A 1 10  ? -6.290  -7.060  -6.807  1.00 0.00 ? 10  PRO A CA   2  
ATOM   1559  C C    . PRO A 1 10  ? -5.622  -6.462  -8.046  1.00 0.00 ? 10  PRO A C    2  
ATOM   1560  O O    . PRO A 1 10  ? -5.882  -6.899  -9.167  1.00 0.00 ? 10  PRO A O    2  
ATOM   1561  C CB   . PRO A 1 10  ? -5.879  -8.500  -6.546  1.00 0.00 ? 10  PRO A CB   2  
ATOM   1562  C CG   . PRO A 1 10  ? -7.039  -9.357  -7.025  1.00 0.00 ? 10  PRO A CG   2  
ATOM   1563  C CD   . PRO A 1 10  ? -8.239  -8.446  -7.229  1.00 0.00 ? 10  PRO A CD   2  
ATOM   1564  H HA   . PRO A 1 10  ? -6.041  -6.460  -6.046  1.00 0.00 ? 10  PRO A HA   2  
ATOM   1565  H HB2  . PRO A 1 10  ? -4.963  -8.747  -7.080  1.00 0.00 ? 10  PRO A HB2  2  
ATOM   1566  H HB3  . PRO A 1 10  ? -5.683  -8.664  -5.487  1.00 0.00 ? 10  PRO A HB3  2  
ATOM   1567  H HG2  . PRO A 1 10  ? -6.782  -9.864  -7.956  1.00 0.00 ? 10  PRO A HG2  2  
ATOM   1568  H HG3  . PRO A 1 10  ? -7.269  -10.134 -6.293  1.00 0.00 ? 10  PRO A HG3  2  
ATOM   1569  H HD2  . PRO A 1 10  ? -8.631  -8.530  -8.243  1.00 0.00 ? 10  PRO A HD2  2  
ATOM   1570  H HD3  . PRO A 1 10  ? -9.053  -8.706  -6.553  1.00 0.00 ? 10  PRO A HD3  2  
ATOM   1571  N N    . GLU A 1 11  ? -4.774  -5.473  -7.803  1.00 0.00 ? 11  GLU A N    2  
ATOM   1572  C CA   . GLU A 1 11  ? -4.068  -4.811  -8.886  1.00 0.00 ? 11  GLU A CA   2  
ATOM   1573  C C    . GLU A 1 11  ? -3.231  -3.651  -8.343  1.00 0.00 ? 11  GLU A C    2  
ATOM   1574  O O    . GLU A 1 11  ? -3.143  -3.458  -7.132  1.00 0.00 ? 11  GLU A O    2  
ATOM   1575  C CB   . GLU A 1 11  ? -5.041  -4.328  -9.963  1.00 0.00 ? 11  GLU A CB   2  
ATOM   1576  C CG   . GLU A 1 11  ? -6.174  -3.506  -9.348  1.00 0.00 ? 11  GLU A CG   2  
ATOM   1577  C CD   . GLU A 1 11  ? -6.712  -2.479  -10.346 1.00 0.00 ? 11  GLU A CD   2  
ATOM   1578  O OE1  . GLU A 1 11  ? -5.890  -1.669  -10.827 1.00 0.00 ? 11  GLU A OE1  2  
ATOM   1579  O OE2  . GLU A 1 11  ? -7.934  -2.527  -10.610 1.00 0.00 ? 11  GLU A OE2  2  
ATOM   1580  H H    . GLU A 1 11  ? -4.570  -5.124  -6.889  1.00 0.00 ? 11  GLU A H    2  
ATOM   1581  H HA   . GLU A 1 11  ? -3.414  -5.572  -9.313  1.00 0.00 ? 11  GLU A HA   2  
ATOM   1582  H HB2  . GLU A 1 11  ? -4.507  -3.726  -10.698 1.00 0.00 ? 11  GLU A HB2  2  
ATOM   1583  H HB3  . GLU A 1 11  ? -5.455  -5.185  -10.495 1.00 0.00 ? 11  GLU A HB3  2  
ATOM   1584  H HG2  . GLU A 1 11  ? -6.981  -4.169  -9.034  1.00 0.00 ? 11  GLU A HG2  2  
ATOM   1585  H HG3  . GLU A 1 11  ? -5.816  -2.995  -8.455  1.00 0.00 ? 11  GLU A HG3  2  
ATOM   1586  N N    . ILE A 1 12  ? -2.637  -2.909  -9.266  1.00 0.00 ? 12  ILE A N    2  
ATOM   1587  C CA   . ILE A 1 12  ? -1.811  -1.772  -8.895  1.00 0.00 ? 12  ILE A CA   2  
ATOM   1588  C C    . ILE A 1 12  ? -2.709  -0.583  -8.555  1.00 0.00 ? 12  ILE A C    2  
ATOM   1589  O O    . ILE A 1 12  ? -3.559  -0.192  -9.356  1.00 0.00 ? 12  ILE A O    2  
ATOM   1590  C CB   . ILE A 1 12  ? -0.785  -1.476  -9.992  1.00 0.00 ? 12  ILE A CB   2  
ATOM   1591  C CG1  . ILE A 1 12  ? 0.246   -0.451  -9.514  1.00 0.00 ? 12  ILE A CG1  2  
ATOM   1592  C CG2  . ILE A 1 12  ? -1.476  -1.033  -11.283 1.00 0.00 ? 12  ILE A CG2  2  
ATOM   1593  C CD1  . ILE A 1 12  ? 1.480   -0.454  -10.419 1.00 0.00 ? 12  ILE A CD1  2  
ATOM   1594  H H    . ILE A 1 12  ? -2.713  -3.073  -10.250 1.00 0.00 ? 12  ILE A H    2  
ATOM   1595  H HA   . ILE A 1 12  ? -1.255  -2.052  -8.000  1.00 0.00 ? 12  ILE A HA   2  
ATOM   1596  H HB   . ILE A 1 12  ? -0.246  -2.396  -10.214 1.00 0.00 ? 12  ILE A HB   2  
ATOM   1597  H HG12 . ILE A 1 12  ? -0.201  0.542   -9.504  1.00 0.00 ? 12  ILE A HG12 2  
ATOM   1598  H HG13 . ILE A 1 12  ? 0.542   -0.679  -8.490  1.00 0.00 ? 12  ILE A HG13 2  
ATOM   1599  H HG21 . ILE A 1 12  ? -0.934  -1.432  -12.141 1.00 0.00 ? 12  ILE A HG21 2  
ATOM   1600  H HG22 . ILE A 1 12  ? -2.499  -1.409  -11.296 1.00 0.00 ? 12  ILE A HG22 2  
ATOM   1601  H HG23 . ILE A 1 12  ? -1.488  0.056   -11.334 1.00 0.00 ? 12  ILE A HG23 2  
ATOM   1602  H HD11 . ILE A 1 12  ? 1.452   -1.326  -11.070 1.00 0.00 ? 12  ILE A HD11 2  
ATOM   1603  H HD12 . ILE A 1 12  ? 1.486   0.452   -11.025 1.00 0.00 ? 12  ILE A HD12 2  
ATOM   1604  H HD13 . ILE A 1 12  ? 2.380   -0.486  -9.806  1.00 0.00 ? 12  ILE A HD13 2  
ATOM   1605  N N    . ILE A 1 13  ? -2.494  -0.039  -7.366  1.00 0.00 ? 13  ILE A N    2  
ATOM   1606  C CA   . ILE A 1 13  ? -3.273  1.100   -6.910  1.00 0.00 ? 13  ILE A CA   2  
ATOM   1607  C C    . ILE A 1 13  ? -2.359  2.318   -6.778  1.00 0.00 ? 13  ILE A C    2  
ATOM   1608  O O    . ILE A 1 13  ? -1.173  2.181   -6.484  1.00 0.00 ? 13  ILE A O    2  
ATOM   1609  C CB   . ILE A 1 13  ? -4.026  0.751   -5.625  1.00 0.00 ? 13  ILE A CB   2  
ATOM   1610  C CG1  . ILE A 1 13  ? -4.386  -0.736  -5.584  1.00 0.00 ? 13  ILE A CG1  2  
ATOM   1611  C CG2  . ILE A 1 13  ? -5.257  1.644   -5.452  1.00 0.00 ? 13  ILE A CG2  2  
ATOM   1612  C CD1  . ILE A 1 13  ? -5.407  -1.081  -6.671  1.00 0.00 ? 13  ILE A CD1  2  
ATOM   1613  H H    . ILE A 1 13  ? -1.801  -0.362  -6.722  1.00 0.00 ? 13  ILE A H    2  
ATOM   1614  H HA   . ILE A 1 13  ? -4.020  1.310   -7.675  1.00 0.00 ? 13  ILE A HA   2  
ATOM   1615  H HB   . ILE A 1 13  ? -3.367  0.946   -4.779  1.00 0.00 ? 13  ILE A HB   2  
ATOM   1616  H HG12 . ILE A 1 13  ? -3.485  -1.334  -5.723  1.00 0.00 ? 13  ILE A HG12 2  
ATOM   1617  H HG13 . ILE A 1 13  ? -4.792  -0.988  -4.606  1.00 0.00 ? 13  ILE A HG13 2  
ATOM   1618  H HG21 . ILE A 1 13  ? -4.942  2.637   -5.131  1.00 0.00 ? 13  ILE A HG21 2  
ATOM   1619  H HG22 . ILE A 1 13  ? -5.788  1.720   -6.401  1.00 0.00 ? 13  ILE A HG22 2  
ATOM   1620  H HG23 . ILE A 1 13  ? -5.917  1.210   -4.700  1.00 0.00 ? 13  ILE A HG23 2  
ATOM   1621  H HD11 . ILE A 1 13  ? -6.228  -0.366  -6.640  1.00 0.00 ? 13  ILE A HD11 2  
ATOM   1622  H HD12 . ILE A 1 13  ? -4.926  -1.042  -7.648  1.00 0.00 ? 13  ILE A HD12 2  
ATOM   1623  H HD13 . ILE A 1 13  ? -5.794  -2.086  -6.497  1.00 0.00 ? 13  ILE A HD13 2  
ATOM   1624  N N    . THR A 1 14  ? -2.947  3.486   -7.000  1.00 0.00 ? 14  THR A N    2  
ATOM   1625  C CA   . THR A 1 14  ? -2.199  4.728   -6.909  1.00 0.00 ? 14  THR A CA   2  
ATOM   1626  C C    . THR A 1 14  ? -2.926  5.722   -6.001  1.00 0.00 ? 14  THR A C    2  
ATOM   1627  O O    . THR A 1 14  ? -4.101  6.018   -6.213  1.00 0.00 ? 14  THR A O    2  
ATOM   1628  C CB   . THR A 1 14  ? -1.979  5.252   -8.330  1.00 0.00 ? 14  THR A CB   2  
ATOM   1629  O OG1  . THR A 1 14  ? -1.315  6.499   -8.141  1.00 0.00 ? 14  THR A OG1  2  
ATOM   1630  C CG2  . THR A 1 14  ? -3.289  5.631   -9.025  1.00 0.00 ? 14  THR A CG2  2  
ATOM   1631  H H    . THR A 1 14  ? -3.912  3.589   -7.238  1.00 0.00 ? 14  THR A H    2  
ATOM   1632  H HA   . THR A 1 14  ? -1.236  4.517   -6.445  1.00 0.00 ? 14  THR A HA   2  
ATOM   1633  H HB   . THR A 1 14  ? -1.415  4.535   -8.926  1.00 0.00 ? 14  THR A HB   2  
ATOM   1634  H HG1  . THR A 1 14  ? -1.137  6.930   -9.025  1.00 0.00 ? 14  THR A HG1  2  
ATOM   1635  H HG21 . THR A 1 14  ? -3.135  5.653   -10.103 1.00 0.00 ? 14  THR A HG21 2  
ATOM   1636  H HG22 . THR A 1 14  ? -4.055  4.893   -8.781  1.00 0.00 ? 14  THR A HG22 2  
ATOM   1637  H HG23 . THR A 1 14  ? -3.610  6.614   -8.683  1.00 0.00 ? 14  THR A HG23 2  
ATOM   1638  N N    . VAL A 1 15  ? -2.198  6.209   -5.007  1.00 0.00 ? 15  VAL A N    2  
ATOM   1639  C CA   . VAL A 1 15  ? -2.758  7.163   -4.066  1.00 0.00 ? 15  VAL A CA   2  
ATOM   1640  C C    . VAL A 1 15  ? -2.092  8.526   -4.270  1.00 0.00 ? 15  VAL A C    2  
ATOM   1641  O O    . VAL A 1 15  ? -0.872  8.611   -4.400  1.00 0.00 ? 15  VAL A O    2  
ATOM   1642  C CB   . VAL A 1 15  ? -2.613  6.636   -2.638  1.00 0.00 ? 15  VAL A CB   2  
ATOM   1643  C CG1  . VAL A 1 15  ? -3.705  7.204   -1.729  1.00 0.00 ? 15  VAL A CG1  2  
ATOM   1644  C CG2  . VAL A 1 15  ? -2.623  5.105   -2.615  1.00 0.00 ? 15  VAL A CG2  2  
ATOM   1645  H H    . VAL A 1 15  ? -1.242  5.963   -4.842  1.00 0.00 ? 15  VAL A H    2  
ATOM   1646  H HA   . VAL A 1 15  ? -3.821  7.256   -4.285  1.00 0.00 ? 15  VAL A HA   2  
ATOM   1647  H HB   . VAL A 1 15  ? -1.649  6.969   -2.252  1.00 0.00 ? 15  VAL A HB   2  
ATOM   1648  H HG11 . VAL A 1 15  ? -3.693  8.294   -1.784  1.00 0.00 ? 15  VAL A HG11 2  
ATOM   1649  H HG12 . VAL A 1 15  ? -4.678  6.835   -2.053  1.00 0.00 ? 15  VAL A HG12 2  
ATOM   1650  H HG13 . VAL A 1 15  ? -3.521  6.892   -0.701  1.00 0.00 ? 15  VAL A HG13 2  
ATOM   1651  H HG21 . VAL A 1 15  ? -2.660  4.757   -1.583  1.00 0.00 ? 15  VAL A HG21 2  
ATOM   1652  H HG22 . VAL A 1 15  ? -3.499  4.740   -3.151  1.00 0.00 ? 15  VAL A HG22 2  
ATOM   1653  H HG23 . VAL A 1 15  ? -1.720  4.729   -3.094  1.00 0.00 ? 15  VAL A HG23 2  
ATOM   1654  N N    . THR A 1 16  ? -2.923  9.558   -4.291  1.00 0.00 ? 16  THR A N    2  
ATOM   1655  C CA   . THR A 1 16  ? -2.432  10.912  -4.477  1.00 0.00 ? 16  THR A CA   2  
ATOM   1656  C C    . THR A 1 16  ? -2.540  11.703  -3.173  1.00 0.00 ? 16  THR A C    2  
ATOM   1657  O O    . THR A 1 16  ? -3.374  11.393  -2.323  1.00 0.00 ? 16  THR A O    2  
ATOM   1658  C CB   . THR A 1 16  ? -3.207  11.542  -5.636  1.00 0.00 ? 16  THR A CB   2  
ATOM   1659  O OG1  . THR A 1 16  ? -3.064  10.603  -6.700  1.00 0.00 ? 16  THR A OG1  2  
ATOM   1660  C CG2  . THR A 1 16  ? -2.536  12.811  -6.166  1.00 0.00 ? 16  THR A CG2  2  
ATOM   1661  H H    . THR A 1 16  ? -3.915  9.479   -4.185  1.00 0.00 ? 16  THR A H    2  
ATOM   1662  H HA   . THR A 1 16  ? -1.372  10.861  -4.733  1.00 0.00 ? 16  THR A HA   2  
ATOM   1663  H HB   . THR A 1 16  ? -4.241  11.736  -5.352  1.00 0.00 ? 16  THR A HB   2  
ATOM   1664  H HG1  . THR A 1 16  ? -3.678  10.844  -7.451  1.00 0.00 ? 16  THR A HG1  2  
ATOM   1665  H HG21 . THR A 1 16  ? -3.222  13.330  -6.838  1.00 0.00 ? 16  THR A HG21 2  
ATOM   1666  H HG22 . THR A 1 16  ? -2.282  13.464  -5.331  1.00 0.00 ? 16  THR A HG22 2  
ATOM   1667  H HG23 . THR A 1 16  ? -1.630  12.544  -6.709  1.00 0.00 ? 16  THR A HG23 2  
ATOM   1668  N N    . LEU A 1 17  ? -1.685  12.709  -3.053  1.00 0.00 ? 17  LEU A N    2  
ATOM   1669  C CA   . LEU A 1 17  ? -1.675  13.546  -1.866  1.00 0.00 ? 17  LEU A CA   2  
ATOM   1670  C C    . LEU A 1 17  ? -2.544  14.781  -2.111  1.00 0.00 ? 17  LEU A C    2  
ATOM   1671  O O    . LEU A 1 17  ? -2.157  15.677  -2.860  1.00 0.00 ? 17  LEU A O    2  
ATOM   1672  C CB   . LEU A 1 17  ? -0.238  13.875  -1.456  1.00 0.00 ? 17  LEU A CB   2  
ATOM   1673  C CG   . LEU A 1 17  ? 0.468   12.829  -0.591  1.00 0.00 ? 17  LEU A CG   2  
ATOM   1674  C CD1  . LEU A 1 17  ? 1.222   13.490  0.565   1.00 0.00 ? 17  LEU A CD1  2  
ATOM   1675  C CD2  . LEU A 1 17  ? -0.517  11.767  -0.100  1.00 0.00 ? 17  LEU A CD2  2  
ATOM   1676  H H    . LEU A 1 17  ? -1.011  12.953  -3.749  1.00 0.00 ? 17  LEU A H    2  
ATOM   1677  H HA   . LEU A 1 17  ? -2.118  12.967  -1.055  1.00 0.00 ? 17  LEU A HA   2  
ATOM   1678  H HB2  . LEU A 1 17  ? 0.350   14.029  -2.358  1.00 0.00 ? 17  LEU A HB2  2  
ATOM   1679  H HB3  . LEU A 1 17  ? -0.245  14.821  -0.914  1.00 0.00 ? 17  LEU A HB3  2  
ATOM   1680  H HG   . LEU A 1 17  ? 1.209   12.321  -1.208  1.00 0.00 ? 17  LEU A HG   2  
ATOM   1681  H HD11 . LEU A 1 17  ? 2.069   14.052  0.172   1.00 0.00 ? 17  LEU A HD11 2  
ATOM   1682  H HD12 . LEU A 1 17  ? 0.551   14.167  1.095   1.00 0.00 ? 17  LEU A HD12 2  
ATOM   1683  H HD13 . LEU A 1 17  ? 1.581   12.724  1.249   1.00 0.00 ? 17  LEU A HD13 2  
ATOM   1684  H HD21 . LEU A 1 17  ? -1.253  12.230  0.557   1.00 0.00 ? 17  LEU A HD21 2  
ATOM   1685  H HD22 . LEU A 1 17  ? -1.024  11.319  -0.953  1.00 0.00 ? 17  LEU A HD22 2  
ATOM   1686  H HD23 . LEU A 1 17  ? 0.024   10.995  0.447   1.00 0.00 ? 17  LEU A HD23 2  
ATOM   1687  N N    . LYS A 1 18  ? -3.702  14.789  -1.468  1.00 0.00 ? 18  LYS A N    2  
ATOM   1688  C CA   . LYS A 1 18  ? -4.628  15.900  -1.607  1.00 0.00 ? 18  LYS A CA   2  
ATOM   1689  C C    . LYS A 1 18  ? -4.321  16.951  -0.539  1.00 0.00 ? 18  LYS A C    2  
ATOM   1690  O O    . LYS A 1 18  ? -4.050  18.107  -0.861  1.00 0.00 ? 18  LYS A O    2  
ATOM   1691  C CB   . LYS A 1 18  ? -6.073  15.398  -1.579  1.00 0.00 ? 18  LYS A CB   2  
ATOM   1692  C CG   . LYS A 1 18  ? -7.052  16.530  -1.897  1.00 0.00 ? 18  LYS A CG   2  
ATOM   1693  C CD   . LYS A 1 18  ? -8.430  16.252  -1.290  1.00 0.00 ? 18  LYS A CD   2  
ATOM   1694  C CE   . LYS A 1 18  ? -9.440  17.319  -1.712  1.00 0.00 ? 18  LYS A CE   2  
ATOM   1695  N NZ   . LYS A 1 18  ? -10.158 16.896  -2.936  1.00 0.00 ? 18  LYS A NZ   2  
ATOM   1696  H H    . LYS A 1 18  ? -4.009  14.055  -0.861  1.00 0.00 ? 18  LYS A H    2  
ATOM   1697  H HA   . LYS A 1 18  ? -4.460  16.343  -2.588  1.00 0.00 ? 18  LYS A HA   2  
ATOM   1698  H HB2  . LYS A 1 18  ? -6.198  14.592  -2.301  1.00 0.00 ? 18  LYS A HB2  2  
ATOM   1699  H HB3  . LYS A 1 18  ? -6.300  14.983  -0.597  1.00 0.00 ? 18  LYS A HB3  2  
ATOM   1700  H HG2  . LYS A 1 18  ? -6.664  17.473  -1.508  1.00 0.00 ? 18  LYS A HG2  2  
ATOM   1701  H HG3  . LYS A 1 18  ? -7.144  16.644  -2.977  1.00 0.00 ? 18  LYS A HG3  2  
ATOM   1702  H HD2  . LYS A 1 18  ? -8.778  15.269  -1.607  1.00 0.00 ? 18  LYS A HD2  2  
ATOM   1703  H HD3  . LYS A 1 18  ? -8.352  16.228  -0.203  1.00 0.00 ? 18  LYS A HD3  2  
ATOM   1704  H HE2  . LYS A 1 18  ? -10.153 17.492  -0.906  1.00 0.00 ? 18  LYS A HE2  2  
ATOM   1705  H HE3  . LYS A 1 18  ? -8.928  18.263  -1.893  1.00 0.00 ? 18  LYS A HE3  2  
ATOM   1706  H HZ1  . LYS A 1 18  ? -10.121 15.900  -3.018  1.00 0.00 ? 18  LYS A HZ1  2  
ATOM   1707  H HZ2  . LYS A 1 18  ? -11.113 17.190  -2.881  1.00 0.00 ? 18  LYS A HZ2  2  
ATOM   1708  H HZ3  . LYS A 1 18  ? -9.728  17.312  -3.736  1.00 0.00 ? 18  LYS A HZ3  2  
ATOM   1709  N N    . LYS A 1 19  ? -4.373  16.512  0.711   1.00 0.00 ? 19  LYS A N    2  
ATOM   1710  C CA   . LYS A 1 19  ? -4.103  17.401  1.828   1.00 0.00 ? 19  LYS A CA   2  
ATOM   1711  C C    . LYS A 1 19  ? -2.596  17.654  1.921   1.00 0.00 ? 19  LYS A C    2  
ATOM   1712  O O    . LYS A 1 19  ? -2.142  18.402  2.785   1.00 0.00 ? 19  LYS A O    2  
ATOM   1713  C CB   . LYS A 1 19  ? -4.714  16.844  3.115   1.00 0.00 ? 19  LYS A CB   2  
ATOM   1714  C CG   . LYS A 1 19  ? -4.777  17.920  4.202   1.00 0.00 ? 19  LYS A CG   2  
ATOM   1715  C CD   . LYS A 1 19  ? -6.013  17.737  5.084   1.00 0.00 ? 19  LYS A CD   2  
ATOM   1716  C CE   . LYS A 1 19  ? -5.632  17.182  6.456   1.00 0.00 ? 19  LYS A CE   2  
ATOM   1717  N NZ   . LYS A 1 19  ? -6.167  18.047  7.532   1.00 0.00 ? 19  LYS A NZ   2  
ATOM   1718  H H    . LYS A 1 19  ? -4.594  15.570  0.962   1.00 0.00 ? 19  LYS A H    2  
ATOM   1719  H HA   . LYS A 1 19  ? -4.600  18.349  1.619   1.00 0.00 ? 19  LYS A HA   2  
ATOM   1720  H HB2  . LYS A 1 19  ? -5.717  16.467  2.913   1.00 0.00 ? 19  LYS A HB2  2  
ATOM   1721  H HB3  . LYS A 1 19  ? -4.122  16.000  3.468   1.00 0.00 ? 19  LYS A HB3  2  
ATOM   1722  H HG2  . LYS A 1 19  ? -3.878  17.871  4.816   1.00 0.00 ? 19  LYS A HG2  2  
ATOM   1723  H HG3  . LYS A 1 19  ? -4.796  18.907  3.742   1.00 0.00 ? 19  LYS A HG3  2  
ATOM   1724  H HD2  . LYS A 1 19  ? -6.524  18.692  5.202   1.00 0.00 ? 19  LYS A HD2  2  
ATOM   1725  H HD3  . LYS A 1 19  ? -6.715  17.059  4.596   1.00 0.00 ? 19  LYS A HD3  2  
ATOM   1726  H HE2  . LYS A 1 19  ? -6.021  16.169  6.569   1.00 0.00 ? 19  LYS A HE2  2  
ATOM   1727  H HE3  . LYS A 1 19  ? -4.548  17.118  6.540   1.00 0.00 ? 19  LYS A HE3  2  
ATOM   1728  H HZ1  . LYS A 1 19  ? -7.067  17.710  7.812   1.00 0.00 ? 19  LYS A HZ1  2  
ATOM   1729  H HZ2  . LYS A 1 19  ? -5.546  18.030  8.315   1.00 0.00 ? 19  LYS A HZ2  2  
ATOM   1730  H HZ3  . LYS A 1 19  ? -6.253  18.984  7.194   1.00 0.00 ? 19  LYS A HZ3  2  
ATOM   1731  N N    . GLN A 1 20  ? -1.865  17.016  1.019   1.00 0.00 ? 20  GLN A N    2  
ATOM   1732  C CA   . GLN A 1 20  ? -0.420  17.162  0.988   1.00 0.00 ? 20  GLN A CA   2  
ATOM   1733  C C    . GLN A 1 20  ? 0.178   16.807  2.353   1.00 0.00 ? 20  GLN A C    2  
ATOM   1734  O O    . GLN A 1 20  ? 1.174   17.397  2.770   1.00 0.00 ? 20  GLN A O    2  
ATOM   1735  C CB   . GLN A 1 20  ? -0.021  18.577  0.567   1.00 0.00 ? 20  GLN A CB   2  
ATOM   1736  C CG   . GLN A 1 20  ? 0.647   18.570  -0.809  1.00 0.00 ? 20  GLN A CG   2  
ATOM   1737  C CD   . GLN A 1 20  ? 2.166   18.714  -0.684  1.00 0.00 ? 20  GLN A CD   2  
ATOM   1738  O OE1  . GLN A 1 20  ? 2.892   17.752  -0.492  1.00 0.00 ? 20  GLN A OE1  2  
ATOM   1739  N NE2  . GLN A 1 20  ? 2.602   19.964  -0.802  1.00 0.00 ? 20  GLN A NE2  2  
ATOM   1740  H H    . GLN A 1 20  ? -2.243  16.409  0.320   1.00 0.00 ? 20  GLN A H    2  
ATOM   1741  H HA   . GLN A 1 20  ? -0.074  16.453  0.237   1.00 0.00 ? 20  GLN A HA   2  
ATOM   1742  H HB2  . GLN A 1 20  ? -0.904  19.215  0.544   1.00 0.00 ? 20  GLN A HB2  2  
ATOM   1743  H HB3  . GLN A 1 20  ? 0.661   19.001  1.304   1.00 0.00 ? 20  GLN A HB3  2  
ATOM   1744  H HG2  . GLN A 1 20  ? 0.408   17.642  -1.329  1.00 0.00 ? 20  GLN A HG2  2  
ATOM   1745  H HG3  . GLN A 1 20  ? 0.250   19.384  -1.416  1.00 0.00 ? 20  GLN A HG3  2  
ATOM   1746  H HE21 . GLN A 1 20  ? 1.952   20.708  -0.958  1.00 0.00 ? 20  GLN A HE21 2  
ATOM   1747  H HE22 . GLN A 1 20  ? 3.581   20.161  -0.733  1.00 0.00 ? 20  GLN A HE22 2  
ATOM   1748  N N    . ASN A 1 21  ? -0.456  15.848  3.009   1.00 0.00 ? 21  ASN A N    2  
ATOM   1749  C CA   . ASN A 1 21  ? 0.001   15.408  4.317   1.00 0.00 ? 21  ASN A CA   2  
ATOM   1750  C C    . ASN A 1 21  ? 0.899   14.180  4.153   1.00 0.00 ? 21  ASN A C    2  
ATOM   1751  O O    . ASN A 1 21  ? 0.825   13.483  3.143   1.00 0.00 ? 21  ASN A O    2  
ATOM   1752  C CB   . ASN A 1 21  ? -1.178  15.015  5.208   1.00 0.00 ? 21  ASN A CB   2  
ATOM   1753  C CG   . ASN A 1 21  ? -1.339  15.995  6.371   1.00 0.00 ? 21  ASN A CG   2  
ATOM   1754  O OD1  . ASN A 1 21  ? -2.029  16.999  6.281   1.00 0.00 ? 21  ASN A OD1  2  
ATOM   1755  N ND2  . ASN A 1 21  ? -0.667  15.653  7.466   1.00 0.00 ? 21  ASN A ND2  2  
ATOM   1756  H H    . ASN A 1 21  ? -1.265  15.373  2.663   1.00 0.00 ? 21  ASN A H    2  
ATOM   1757  H HA   . ASN A 1 21  ? 0.533   16.261  4.736   1.00 0.00 ? 21  ASN A HA   2  
ATOM   1758  H HB2  . ASN A 1 21  ? -2.095  14.991  4.618   1.00 0.00 ? 21  ASN A HB2  2  
ATOM   1759  H HB3  . ASN A 1 21  ? -1.025  14.008  5.598   1.00 0.00 ? 21  ASN A HB3  2  
ATOM   1760  H HD21 . ASN A 1 21  ? -0.118  14.816  7.474   1.00 0.00 ? 21  ASN A HD21 2  
ATOM   1761  H HD22 . ASN A 1 21  ? -0.707  16.231  8.280   1.00 0.00 ? 21  ASN A HD22 2  
ATOM   1762  N N    . GLY A 1 22  ? 1.729   13.954  5.162   1.00 0.00 ? 22  GLY A N    2  
ATOM   1763  C CA   . GLY A 1 22  ? 2.640   12.823  5.141   1.00 0.00 ? 22  GLY A CA   2  
ATOM   1764  C C    . GLY A 1 22  ? 2.060   11.665  4.326   1.00 0.00 ? 22  GLY A C    2  
ATOM   1765  O O    . GLY A 1 22  ? 2.636   11.264  3.316   1.00 0.00 ? 22  GLY A O    2  
ATOM   1766  H H    . GLY A 1 22  ? 1.782   14.526  5.980   1.00 0.00 ? 22  GLY A H    2  
ATOM   1767  H HA2  . GLY A 1 22  ? 3.595   13.130  4.717   1.00 0.00 ? 22  GLY A HA2  2  
ATOM   1768  H HA3  . GLY A 1 22  ? 2.836   12.491  6.161   1.00 0.00 ? 22  GLY A HA3  2  
ATOM   1769  N N    . MET A 1 23  ? 0.928   11.163  4.793   1.00 0.00 ? 23  MET A N    2  
ATOM   1770  C CA   . MET A 1 23  ? 0.264   10.060  4.119   1.00 0.00 ? 23  MET A CA   2  
ATOM   1771  C C    . MET A 1 23  ? -0.757  9.389   5.040   1.00 0.00 ? 23  MET A C    2  
ATOM   1772  O O    . MET A 1 23  ? -1.929  9.266   4.688   1.00 0.00 ? 23  MET A O    2  
ATOM   1773  C CB   . MET A 1 23  ? 1.306   9.030   3.676   1.00 0.00 ? 23  MET A CB   2  
ATOM   1774  C CG   . MET A 1 23  ? 1.316   8.880   2.153   1.00 0.00 ? 23  MET A CG   2  
ATOM   1775  S SD   . MET A 1 23  ? 2.952   9.207   1.520   1.00 0.00 ? 23  MET A SD   2  
ATOM   1776  C CE   . MET A 1 23  ? 3.640   7.560   1.575   1.00 0.00 ? 23  MET A CE   2  
ATOM   1777  H H    . MET A 1 23  ? 0.465   11.496  5.615   1.00 0.00 ? 23  MET A H    2  
ATOM   1778  H HA   . MET A 1 23  ? -0.244  10.503  3.263   1.00 0.00 ? 23  MET A HA   2  
ATOM   1779  H HB2  . MET A 1 23  ? 2.294   9.335   4.023   1.00 0.00 ? 23  MET A HB2  2  
ATOM   1780  H HB3  . MET A 1 23  ? 1.090   8.067   4.139   1.00 0.00 ? 23  MET A HB3  2  
ATOM   1781  H HG2  . MET A 1 23  ? 1.004   7.873   1.877   1.00 0.00 ? 23  MET A HG2  2  
ATOM   1782  H HG3  . MET A 1 23  ? 0.599   9.570   1.708   1.00 0.00 ? 23  MET A HG3  2  
ATOM   1783  H HE1  . MET A 1 23  ? 4.642   7.570   1.143   1.00 0.00 ? 23  MET A HE1  2  
ATOM   1784  H HE2  . MET A 1 23  ? 3.694   7.223   2.611   1.00 0.00 ? 23  MET A HE2  2  
ATOM   1785  H HE3  . MET A 1 23  ? 3.006   6.881   1.005   1.00 0.00 ? 23  MET A HE3  2  
ATOM   1786  N N    . GLY A 1 24  ? -0.276  8.973   6.202   1.00 0.00 ? 24  GLY A N    2  
ATOM   1787  C CA   . GLY A 1 24  ? -1.132  8.320   7.177   1.00 0.00 ? 24  GLY A CA   2  
ATOM   1788  C C    . GLY A 1 24  ? -1.505  6.908   6.718   1.00 0.00 ? 24  GLY A C    2  
ATOM   1789  O O    . GLY A 1 24  ? -2.677  6.535   6.736   1.00 0.00 ? 24  GLY A O    2  
ATOM   1790  H H    . GLY A 1 24  ? 0.679   9.078   6.482   1.00 0.00 ? 24  GLY A H    2  
ATOM   1791  H HA2  . GLY A 1 24  ? -0.623  8.271   8.139   1.00 0.00 ? 24  GLY A HA2  2  
ATOM   1792  H HA3  . GLY A 1 24  ? -2.037  8.909   7.325   1.00 0.00 ? 24  GLY A HA3  2  
ATOM   1793  N N    . LEU A 1 25  ? -0.485  6.161   6.320   1.00 0.00 ? 25  LEU A N    2  
ATOM   1794  C CA   . LEU A 1 25  ? -0.690  4.799   5.859   1.00 0.00 ? 25  LEU A CA   2  
ATOM   1795  C C    . LEU A 1 25  ? -0.044  3.827   6.848   1.00 0.00 ? 25  LEU A C    2  
ATOM   1796  O O    . LEU A 1 25  ? 0.838   4.210   7.614   1.00 0.00 ? 25  LEU A O    2  
ATOM   1797  C CB   . LEU A 1 25  ? -0.190  4.639   4.423   1.00 0.00 ? 25  LEU A CB   2  
ATOM   1798  C CG   . LEU A 1 25  ? -1.216  4.903   3.320   1.00 0.00 ? 25  LEU A CG   2  
ATOM   1799  C CD1  . LEU A 1 25  ? -1.195  3.790   2.271   1.00 0.00 ? 25  LEU A CD1  2  
ATOM   1800  C CD2  . LEU A 1 25  ? -2.614  5.108   3.910   1.00 0.00 ? 25  LEU A CD2  2  
ATOM   1801  H H    . LEU A 1 25  ? 0.466   6.472   6.310   1.00 0.00 ? 25  LEU A H    2  
ATOM   1802  H HA   . LEU A 1 25  ? -1.764  4.616   5.847   1.00 0.00 ? 25  LEU A HA   2  
ATOM   1803  H HB2  . LEU A 1 25  ? 0.654   5.313   4.274   1.00 0.00 ? 25  LEU A HB2  2  
ATOM   1804  H HB3  . LEU A 1 25  ? 0.191   3.623   4.302   1.00 0.00 ? 25  LEU A HB3  2  
ATOM   1805  H HG   . LEU A 1 25  ? -0.941  5.829   2.813   1.00 0.00 ? 25  LEU A HG   2  
ATOM   1806  H HD11 . LEU A 1 25  ? -1.781  4.095   1.404   1.00 0.00 ? 25  LEU A HD11 2  
ATOM   1807  H HD12 . LEU A 1 25  ? -0.166  3.599   1.965   1.00 0.00 ? 25  LEU A HD12 2  
ATOM   1808  H HD13 . LEU A 1 25  ? -1.621  2.881   2.697   1.00 0.00 ? 25  LEU A HD13 2  
ATOM   1809  H HD21 . LEU A 1 25  ? -2.581  5.906   4.651   1.00 0.00 ? 25  LEU A HD21 2  
ATOM   1810  H HD22 . LEU A 1 25  ? -3.308  5.380   3.113   1.00 0.00 ? 25  LEU A HD22 2  
ATOM   1811  H HD23 . LEU A 1 25  ? -2.946  4.185   4.384   1.00 0.00 ? 25  LEU A HD23 2  
ATOM   1812  N N    . SER A 1 26  ? -0.509  2.586   6.798   1.00 0.00 ? 26  SER A N    2  
ATOM   1813  C CA   . SER A 1 26  ? 0.014   1.557   7.680   1.00 0.00 ? 26  SER A CA   2  
ATOM   1814  C C    . SER A 1 26  ? 0.030   0.208   6.957   1.00 0.00 ? 26  SER A C    2  
ATOM   1815  O O    . SER A 1 26  ? -1.020  -0.383  6.712   1.00 0.00 ? 26  SER A O    2  
ATOM   1816  C CB   . SER A 1 26  ? -0.815  1.459   8.964   1.00 0.00 ? 26  SER A CB   2  
ATOM   1817  O OG   . SER A 1 26  ? -1.262  2.737   9.409   1.00 0.00 ? 26  SER A OG   2  
ATOM   1818  H H    . SER A 1 26  ? -1.227  2.282   6.172   1.00 0.00 ? 26  SER A H    2  
ATOM   1819  H HA   . SER A 1 26  ? 1.027   1.872   7.925   1.00 0.00 ? 26  SER A HA   2  
ATOM   1820  H HB2  . SER A 1 26  ? -1.675  0.814   8.792   1.00 0.00 ? 26  SER A HB2  2  
ATOM   1821  H HB3  . SER A 1 26  ? -0.217  0.991   9.747   1.00 0.00 ? 26  SER A HB3  2  
ATOM   1822  H HG   . SER A 1 26  ? -0.822  2.971   10.275  1.00 0.00 ? 26  SER A HG   2  
ATOM   1823  N N    . ILE A 1 27  ? 1.235   -0.239  6.636   1.00 0.00 ? 27  ILE A N    2  
ATOM   1824  C CA   . ILE A 1 27  ? 1.404   -1.507  5.946   1.00 0.00 ? 27  ILE A CA   2  
ATOM   1825  C C    . ILE A 1 27  ? 2.478   -2.332  6.659   1.00 0.00 ? 27  ILE A C    2  
ATOM   1826  O O    . ILE A 1 27  ? 3.105   -1.857  7.603   1.00 0.00 ? 27  ILE A O    2  
ATOM   1827  C CB   . ILE A 1 27  ? 1.693   -1.274  4.461   1.00 0.00 ? 27  ILE A CB   2  
ATOM   1828  C CG1  . ILE A 1 27  ? 3.198   -1.168  4.205   1.00 0.00 ? 27  ILE A CG1  2  
ATOM   1829  C CG2  . ILE A 1 27  ? 0.934   -0.051  3.941   1.00 0.00 ? 27  ILE A CG2  2  
ATOM   1830  C CD1  . ILE A 1 27  ? 3.479   -0.702  2.775   1.00 0.00 ? 27  ILE A CD1  2  
ATOM   1831  H H    . ILE A 1 27  ? 2.085   0.248   6.839   1.00 0.00 ? 27  ILE A H    2  
ATOM   1832  H HA   . ILE A 1 27  ? 0.456   -2.043  6.010   1.00 0.00 ? 27  ILE A HA   2  
ATOM   1833  H HB   . ILE A 1 27  ? 1.331   -2.138  3.905   1.00 0.00 ? 27  ILE A HB   2  
ATOM   1834  H HG12 . ILE A 1 27  ? 3.641   -0.470  4.914   1.00 0.00 ? 27  ILE A HG12 2  
ATOM   1835  H HG13 . ILE A 1 27  ? 3.668   -2.136  4.375   1.00 0.00 ? 27  ILE A HG13 2  
ATOM   1836  H HG21 . ILE A 1 27  ? 0.038   0.103   4.539   1.00 0.00 ? 27  ILE A HG21 2  
ATOM   1837  H HG22 . ILE A 1 27  ? 1.575   0.829   4.011   1.00 0.00 ? 27  ILE A HG22 2  
ATOM   1838  H HG23 . ILE A 1 27  ? 0.654   -0.215  2.899   1.00 0.00 ? 27  ILE A HG23 2  
ATOM   1839  H HD11 . ILE A 1 27  ? 4.224   0.093   2.793   1.00 0.00 ? 27  ILE A HD11 2  
ATOM   1840  H HD12 . ILE A 1 27  ? 3.855   -1.539  2.188   1.00 0.00 ? 27  ILE A HD12 2  
ATOM   1841  H HD13 . ILE A 1 27  ? 2.559   -0.329  2.328   1.00 0.00 ? 27  ILE A HD13 2  
ATOM   1842  N N    . VAL A 1 28  ? 2.653   -3.556  6.180   1.00 0.00 ? 28  VAL A N    2  
ATOM   1843  C CA   . VAL A 1 28  ? 3.639   -4.452  6.760   1.00 0.00 ? 28  VAL A CA   2  
ATOM   1844  C C    . VAL A 1 28  ? 4.165   -5.394  5.675   1.00 0.00 ? 28  VAL A C    2  
ATOM   1845  O O    . VAL A 1 28  ? 3.599   -5.471  4.587   1.00 0.00 ? 28  VAL A O    2  
ATOM   1846  C CB   . VAL A 1 28  ? 3.034   -5.193  7.954   1.00 0.00 ? 28  VAL A CB   2  
ATOM   1847  C CG1  . VAL A 1 28  ? 3.990   -6.267  8.474   1.00 0.00 ? 28  VAL A CG1  2  
ATOM   1848  C CG2  . VAL A 1 28  ? 2.648   -4.217  9.068   1.00 0.00 ? 28  VAL A CG2  2  
ATOM   1849  H H    . VAL A 1 28  ? 2.137   -3.934  5.411   1.00 0.00 ? 28  VAL A H    2  
ATOM   1850  H HA   . VAL A 1 28  ? 4.464   -3.841  7.125   1.00 0.00 ? 28  VAL A HA   2  
ATOM   1851  H HB   . VAL A 1 28  ? 2.125   -5.689  7.615   1.00 0.00 ? 28  VAL A HB   2  
ATOM   1852  H HG11 . VAL A 1 28  ? 3.587   -6.699  9.389   1.00 0.00 ? 28  VAL A HG11 2  
ATOM   1853  H HG12 . VAL A 1 28  ? 4.102   -7.049  7.722   1.00 0.00 ? 28  VAL A HG12 2  
ATOM   1854  H HG13 . VAL A 1 28  ? 4.962   -5.819  8.679   1.00 0.00 ? 28  VAL A HG13 2  
ATOM   1855  H HG21 . VAL A 1 28  ? 2.571   -4.756  10.012  1.00 0.00 ? 28  VAL A HG21 2  
ATOM   1856  H HG22 . VAL A 1 28  ? 3.409   -3.442  9.152   1.00 0.00 ? 28  VAL A HG22 2  
ATOM   1857  H HG23 . VAL A 1 28  ? 1.688   -3.757  8.830   1.00 0.00 ? 28  VAL A HG23 2  
ATOM   1858  N N    . ALA A 1 29  ? 5.244   -6.085  6.011   1.00 0.00 ? 29  ALA A N    2  
ATOM   1859  C CA   . ALA A 1 29  ? 5.853   -7.019  5.079   1.00 0.00 ? 29  ALA A CA   2  
ATOM   1860  C C    . ALA A 1 29  ? 6.536   -8.142  5.863   1.00 0.00 ? 29  ALA A C    2  
ATOM   1861  O O    . ALA A 1 29  ? 7.479   -7.897  6.613   1.00 0.00 ? 29  ALA A O    2  
ATOM   1862  C CB   . ALA A 1 29  ? 6.828   -6.269  4.169   1.00 0.00 ? 29  ALA A CB   2  
ATOM   1863  H H    . ALA A 1 29  ? 5.699   -6.016  6.899   1.00 0.00 ? 29  ALA A H    2  
ATOM   1864  H HA   . ALA A 1 29  ? 5.059   -7.445  4.468   1.00 0.00 ? 29  ALA A HA   2  
ATOM   1865  H HB1  . ALA A 1 29  ? 6.339   -5.382  3.767   1.00 0.00 ? 29  ALA A HB1  2  
ATOM   1866  H HB2  . ALA A 1 29  ? 7.706   -5.972  4.743   1.00 0.00 ? 29  ALA A HB2  2  
ATOM   1867  H HB3  . ALA A 1 29  ? 7.132   -6.920  3.349   1.00 0.00 ? 29  ALA A HB3  2  
ATOM   1868  N N    . ALA A 1 30  ? 6.033   -9.351  5.662   1.00 0.00 ? 30  ALA A N    2  
ATOM   1869  C CA   . ALA A 1 30  ? 6.581   -10.513 6.341   1.00 0.00 ? 30  ALA A CA   2  
ATOM   1870  C C    . ALA A 1 30  ? 6.099   -11.784 5.637   1.00 0.00 ? 30  ALA A C    2  
ATOM   1871  O O    . ALA A 1 30  ? 5.090   -11.764 4.934   1.00 0.00 ? 30  ALA A O    2  
ATOM   1872  C CB   . ALA A 1 30  ? 6.183   -10.478 7.817   1.00 0.00 ? 30  ALA A CB   2  
ATOM   1873  H H    . ALA A 1 30  ? 5.265   -9.543  5.051   1.00 0.00 ? 30  ALA A H    2  
ATOM   1874  H HA   . ALA A 1 30  ? 7.668   -10.458 6.267   1.00 0.00 ? 30  ALA A HA   2  
ATOM   1875  H HB1  . ALA A 1 30  ? 6.233   -9.452  8.182   1.00 0.00 ? 30  ALA A HB1  2  
ATOM   1876  H HB2  . ALA A 1 30  ? 5.166   -10.854 7.929   1.00 0.00 ? 30  ALA A HB2  2  
ATOM   1877  H HB3  . ALA A 1 30  ? 6.866   -11.102 8.393   1.00 0.00 ? 30  ALA A HB3  2  
ATOM   1878  N N    . LYS A 1 31  ? 6.844   -12.859 5.851   1.00 0.00 ? 31  LYS A N    2  
ATOM   1879  C CA   . LYS A 1 31  ? 6.505   -14.136 5.248   1.00 0.00 ? 31  LYS A CA   2  
ATOM   1880  C C    . LYS A 1 31  ? 5.418   -14.818 6.080   1.00 0.00 ? 31  LYS A C    2  
ATOM   1881  O O    . LYS A 1 31  ? 5.494   -14.840 7.307   1.00 0.00 ? 31  LYS A O    2  
ATOM   1882  C CB   . LYS A 1 31  ? 7.761   -14.990 5.059   1.00 0.00 ? 31  LYS A CB   2  
ATOM   1883  C CG   . LYS A 1 31  ? 8.472   -15.219 6.392   1.00 0.00 ? 31  LYS A CG   2  
ATOM   1884  C CD   . LYS A 1 31  ? 9.905   -14.681 6.351   1.00 0.00 ? 31  LYS A CD   2  
ATOM   1885  C CE   . LYS A 1 31  ? 10.850  -15.576 7.153   1.00 0.00 ? 31  LYS A CE   2  
ATOM   1886  N NZ   . LYS A 1 31  ? 10.536  -15.496 8.598   1.00 0.00 ? 31  LYS A NZ   2  
ATOM   1887  H H    . LYS A 1 31  ? 7.663   -12.867 6.424   1.00 0.00 ? 31  LYS A H    2  
ATOM   1888  H HA   . LYS A 1 31  ? 6.103   -13.932 4.254   1.00 0.00 ? 31  LYS A HA   2  
ATOM   1889  H HB2  . LYS A 1 31  ? 7.491   -15.948 4.615   1.00 0.00 ? 31  LYS A HB2  2  
ATOM   1890  H HB3  . LYS A 1 31  ? 8.438   -14.497 4.361   1.00 0.00 ? 31  LYS A HB3  2  
ATOM   1891  H HG2  . LYS A 1 31  ? 7.919   -14.728 7.193   1.00 0.00 ? 31  LYS A HG2  2  
ATOM   1892  H HG3  . LYS A 1 31  ? 8.486   -16.285 6.622   1.00 0.00 ? 31  LYS A HG3  2  
ATOM   1893  H HD2  . LYS A 1 31  ? 10.244  -14.622 5.317   1.00 0.00 ? 31  LYS A HD2  2  
ATOM   1894  H HD3  . LYS A 1 31  ? 9.927   -13.669 6.753   1.00 0.00 ? 31  LYS A HD3  2  
ATOM   1895  H HE2  . LYS A 1 31  ? 10.762  -16.608 6.812   1.00 0.00 ? 31  LYS A HE2  2  
ATOM   1896  H HE3  . LYS A 1 31  ? 11.883  -15.271 6.983   1.00 0.00 ? 31  LYS A HE3  2  
ATOM   1897  H HZ1  . LYS A 1 31  ? 11.366  -15.668 9.129   1.00 0.00 ? 31  LYS A HZ1  2  
ATOM   1898  H HZ2  . LYS A 1 31  ? 10.185  -14.587 8.813   1.00 0.00 ? 31  LYS A HZ2  2  
ATOM   1899  H HZ3  . LYS A 1 31  ? 9.846   -16.184 8.827   1.00 0.00 ? 31  LYS A HZ3  2  
ATOM   1900  N N    . GLY A 1 32  ? 4.431   -15.356 5.381   1.00 0.00 ? 32  GLY A N    2  
ATOM   1901  C CA   . GLY A 1 32  ? 3.329   -16.037 6.040   1.00 0.00 ? 32  GLY A CA   2  
ATOM   1902  C C    . GLY A 1 32  ? 1.988   -15.410 5.653   1.00 0.00 ? 32  GLY A C    2  
ATOM   1903  O O    . GLY A 1 32  ? 1.028   -16.121 5.360   1.00 0.00 ? 32  GLY A O    2  
ATOM   1904  H H    . GLY A 1 32  ? 4.376   -15.333 4.382   1.00 0.00 ? 32  GLY A H    2  
ATOM   1905  H HA2  . GLY A 1 32  ? 3.333   -17.092 5.768   1.00 0.00 ? 32  GLY A HA2  2  
ATOM   1906  H HA3  . GLY A 1 32  ? 3.460   -15.985 7.120   1.00 0.00 ? 32  GLY A HA3  2  
ATOM   1907  N N    . ALA A 1 33  ? 1.964   -14.085 5.665   1.00 0.00 ? 33  ALA A N    2  
ATOM   1908  C CA   . ALA A 1 33  ? 0.756   -13.355 5.320   1.00 0.00 ? 33  ALA A CA   2  
ATOM   1909  C C    . ALA A 1 33  ? 0.625   -13.284 3.797   1.00 0.00 ? 33  ALA A C    2  
ATOM   1910  O O    . ALA A 1 33  ? 1.397   -12.590 3.137   1.00 0.00 ? 33  ALA A O    2  
ATOM   1911  C CB   . ALA A 1 33  ? 0.794   -11.970 5.967   1.00 0.00 ? 33  ALA A CB   2  
ATOM   1912  H H    . ALA A 1 33  ? 2.748   -13.514 5.905   1.00 0.00 ? 33  ALA A H    2  
ATOM   1913  H HA   . ALA A 1 33  ? -0.093  -13.908 5.723   1.00 0.00 ? 33  ALA A HA   2  
ATOM   1914  H HB1  . ALA A 1 33  ? -0.030  -11.367 5.584   1.00 0.00 ? 33  ALA A HB1  2  
ATOM   1915  H HB2  . ALA A 1 33  ? 0.697   -12.071 7.048   1.00 0.00 ? 33  ALA A HB2  2  
ATOM   1916  H HB3  . ALA A 1 33  ? 1.740   -11.484 5.730   1.00 0.00 ? 33  ALA A HB3  2  
ATOM   1917  N N    . GLY A 1 34  ? -0.356  -14.011 3.284   1.00 0.00 ? 34  GLY A N    2  
ATOM   1918  C CA   . GLY A 1 34  ? -0.597  -14.040 1.851   1.00 0.00 ? 34  GLY A CA   2  
ATOM   1919  C C    . GLY A 1 34  ? 0.523   -14.785 1.121   1.00 0.00 ? 34  GLY A C    2  
ATOM   1920  O O    . GLY A 1 34  ? 0.361   -15.944 0.746   1.00 0.00 ? 34  GLY A O    2  
ATOM   1921  H H    . GLY A 1 34  ? -0.979  -14.574 3.829   1.00 0.00 ? 34  GLY A H    2  
ATOM   1922  H HA2  . GLY A 1 34  ? -1.551  -14.524 1.649   1.00 0.00 ? 34  GLY A HA2  2  
ATOM   1923  H HA3  . GLY A 1 34  ? -0.668  -13.021 1.471   1.00 0.00 ? 34  GLY A HA3  2  
ATOM   1924  N N    . GLN A 1 35  ? 1.636   -14.087 0.943   1.00 0.00 ? 35  GLN A N    2  
ATOM   1925  C CA   . GLN A 1 35  ? 2.783   -14.667 0.265   1.00 0.00 ? 35  GLN A CA   2  
ATOM   1926  C C    . GLN A 1 35  ? 3.676   -15.402 1.267   1.00 0.00 ? 35  GLN A C    2  
ATOM   1927  O O    . GLN A 1 35  ? 4.579   -14.804 1.853   1.00 0.00 ? 35  GLN A O    2  
ATOM   1928  C CB   . GLN A 1 35  ? 3.571   -13.598 -0.492  1.00 0.00 ? 35  GLN A CB   2  
ATOM   1929  C CG   . GLN A 1 35  ? 4.232   -14.185 -1.741  1.00 0.00 ? 35  GLN A CG   2  
ATOM   1930  C CD   . GLN A 1 35  ? 3.191   -14.483 -2.821  1.00 0.00 ? 35  GLN A CD   2  
ATOM   1931  O OE1  . GLN A 1 35  ? 2.011   -14.645 -2.557  1.00 0.00 ? 35  GLN A OE1  2  
ATOM   1932  N NE2  . GLN A 1 35  ? 3.693   -14.547 -4.052  1.00 0.00 ? 35  GLN A NE2  2  
ATOM   1933  H H    . GLN A 1 35  ? 1.761   -13.145 1.253   1.00 0.00 ? 35  GLN A H    2  
ATOM   1934  H HA   . GLN A 1 35  ? 2.367   -15.378 -0.449  1.00 0.00 ? 35  GLN A HA   2  
ATOM   1935  H HB2  . GLN A 1 35  ? 2.905   -12.783 -0.777  1.00 0.00 ? 35  GLN A HB2  2  
ATOM   1936  H HB3  . GLN A 1 35  ? 4.334   -13.171 0.162   1.00 0.00 ? 35  GLN A HB3  2  
ATOM   1937  H HG2  . GLN A 1 35  ? 4.972   -13.484 -2.127  1.00 0.00 ? 35  GLN A HG2  2  
ATOM   1938  H HG3  . GLN A 1 35  ? 4.764   -15.100 -1.480  1.00 0.00 ? 35  GLN A HG3  2  
ATOM   1939  H HE21 . GLN A 1 35  ? 4.672   -14.405 -4.202  1.00 0.00 ? 35  GLN A HE21 2  
ATOM   1940  H HE22 . GLN A 1 35  ? 3.092   -14.737 -4.828  1.00 0.00 ? 35  GLN A HE22 2  
ATOM   1941  N N    . ASP A 1 36  ? 3.394   -16.685 1.436   1.00 0.00 ? 36  ASP A N    2  
ATOM   1942  C CA   . ASP A 1 36  ? 4.161   -17.506 2.357   1.00 0.00 ? 36  ASP A CA   2  
ATOM   1943  C C    . ASP A 1 36  ? 5.644   -17.148 2.239   1.00 0.00 ? 36  ASP A C    2  
ATOM   1944  O O    . ASP A 1 36  ? 6.390   -17.255 3.209   1.00 0.00 ? 36  ASP A O    2  
ATOM   1945  C CB   . ASP A 1 36  ? 4.007   -18.993 2.029   1.00 0.00 ? 36  ASP A CB   2  
ATOM   1946  C CG   . ASP A 1 36  ? 2.567   -19.512 2.048   1.00 0.00 ? 36  ASP A CG   2  
ATOM   1947  O OD1  . ASP A 1 36  ? 1.734   -18.906 1.344   1.00 0.00 ? 36  ASP A OD1  2  
ATOM   1948  O OD2  . ASP A 1 36  ? 2.334   -20.507 2.772   1.00 0.00 ? 36  ASP A OD2  2  
ATOM   1949  H H    . ASP A 1 36  ? 2.658   -17.163 0.955   1.00 0.00 ? 36  ASP A H    2  
ATOM   1950  H HA   . ASP A 1 36  ? 3.755   -17.285 3.344   1.00 0.00 ? 36  ASP A HA   2  
ATOM   1951  H HB2  . ASP A 1 36  ? 4.430   -19.178 1.041   1.00 0.00 ? 36  ASP A HB2  2  
ATOM   1952  H HB3  . ASP A 1 36  ? 4.596   -19.570 2.742   1.00 0.00 ? 36  ASP A HB3  2  
ATOM   1953  N N    . LYS A 1 37  ? 6.025   -16.729 1.040   1.00 0.00 ? 37  LYS A N    2  
ATOM   1954  C CA   . LYS A 1 37  ? 7.405   -16.354 0.784   1.00 0.00 ? 37  LYS A CA   2  
ATOM   1955  C C    . LYS A 1 37  ? 7.532   -14.830 0.828   1.00 0.00 ? 37  LYS A C    2  
ATOM   1956  O O    . LYS A 1 37  ? 7.825   -14.199 -0.186  1.00 0.00 ? 37  LYS A O    2  
ATOM   1957  C CB   . LYS A 1 37  ? 7.894   -16.974 -0.527  1.00 0.00 ? 37  LYS A CB   2  
ATOM   1958  C CG   . LYS A 1 37  ? 8.241   -18.452 -0.338  1.00 0.00 ? 37  LYS A CG   2  
ATOM   1959  C CD   . LYS A 1 37  ? 7.801   -19.278 -1.547  1.00 0.00 ? 37  LYS A CD   2  
ATOM   1960  C CE   . LYS A 1 37  ? 7.183   -20.607 -1.108  1.00 0.00 ? 37  LYS A CE   2  
ATOM   1961  N NZ   . LYS A 1 37  ? 8.049   -21.739 -1.509  1.00 0.00 ? 37  LYS A NZ   2  
ATOM   1962  H H    . LYS A 1 37  ? 5.411   -16.644 0.256   1.00 0.00 ? 37  LYS A H    2  
ATOM   1963  H HA   . LYS A 1 37  ? 8.013   -16.775 1.584   1.00 0.00 ? 37  LYS A HA   2  
ATOM   1964  H HB2  . LYS A 1 37  ? 7.122   -16.873 -1.291  1.00 0.00 ? 37  LYS A HB2  2  
ATOM   1965  H HB3  . LYS A 1 37  ? 8.770   -16.434 -0.885  1.00 0.00 ? 37  LYS A HB3  2  
ATOM   1966  H HG2  . LYS A 1 37  ? 9.317   -18.561 -0.192  1.00 0.00 ? 37  LYS A HG2  2  
ATOM   1967  H HG3  . LYS A 1 37  ? 7.758   -18.831 0.562   1.00 0.00 ? 37  LYS A HG3  2  
ATOM   1968  H HD2  . LYS A 1 37  ? 7.075   -18.713 -2.133  1.00 0.00 ? 37  LYS A HD2  2  
ATOM   1969  H HD3  . LYS A 1 37  ? 8.657   -19.467 -2.196  1.00 0.00 ? 37  LYS A HD3  2  
ATOM   1970  H HE2  . LYS A 1 37  ? 7.047   -20.612 -0.027  1.00 0.00 ? 37  LYS A HE2  2  
ATOM   1971  H HE3  . LYS A 1 37  ? 6.196   -20.723 -1.555  1.00 0.00 ? 37  LYS A HE3  2  
ATOM   1972  H HZ1  . LYS A 1 37  ? 8.257   -22.301 -0.708  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM   1973  H HZ2  . LYS A 1 37  ? 7.575   -22.295 -2.192  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM   1974  H HZ3  . LYS A 1 37  ? 8.899   -21.385 -1.898  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM   1975  N N    . LEU A 1 38  ? 7.306   -14.284 2.013   1.00 0.00 ? 38  LEU A N    2  
ATOM   1976  C CA   . LEU A 1 38  ? 7.390   -12.846 2.203   1.00 0.00 ? 38  LEU A CA   2  
ATOM   1977  C C    . LEU A 1 38  ? 6.238   -12.169 1.459   1.00 0.00 ? 38  LEU A C    2  
ATOM   1978  O O    . LEU A 1 38  ? 6.261   -12.068 0.233   1.00 0.00 ? 38  LEU A O    2  
ATOM   1979  C CB   . LEU A 1 38  ? 8.773   -12.332 1.794   1.00 0.00 ? 38  LEU A CB   2  
ATOM   1980  C CG   . LEU A 1 38  ? 8.800   -10.986 1.066   1.00 0.00 ? 38  LEU A CG   2  
ATOM   1981  C CD1  . LEU A 1 38  ? 8.160   -9.888  1.917   1.00 0.00 ? 38  LEU A CD1  2  
ATOM   1982  C CD2  . LEU A 1 38  ? 10.224  -10.624 0.637   1.00 0.00 ? 38  LEU A CD2  2  
ATOM   1983  H H    . LEU A 1 38  ? 7.067   -14.805 2.834   1.00 0.00 ? 38  LEU A H    2  
ATOM   1984  H HA   . LEU A 1 38  ? 7.277   -12.648 3.269   1.00 0.00 ? 38  LEU A HA   2  
ATOM   1985  H HB2  . LEU A 1 38  ? 9.388   -12.250 2.691   1.00 0.00 ? 38  LEU A HB2  2  
ATOM   1986  H HB3  . LEU A 1 38  ? 9.242   -13.080 1.153   1.00 0.00 ? 38  LEU A HB3  2  
ATOM   1987  H HG   . LEU A 1 38  ? 8.204   -11.078 0.158   1.00 0.00 ? 38  LEU A HG   2  
ATOM   1988  H HD11 . LEU A 1 38  ? 7.854   -9.063  1.276   1.00 0.00 ? 38  LEU A HD11 2  
ATOM   1989  H HD12 . LEU A 1 38  ? 7.287   -10.291 2.433   1.00 0.00 ? 38  LEU A HD12 2  
ATOM   1990  H HD13 . LEU A 1 38  ? 8.883   -9.532  2.651   1.00 0.00 ? 38  LEU A HD13 2  
ATOM   1991  H HD21 . LEU A 1 38  ? 10.734  -11.519 0.278   1.00 0.00 ? 38  LEU A HD21 2  
ATOM   1992  H HD22 . LEU A 1 38  ? 10.183  -9.883  -0.161  1.00 0.00 ? 38  LEU A HD22 2  
ATOM   1993  H HD23 . LEU A 1 38  ? 10.765  -10.213 1.488   1.00 0.00 ? 38  LEU A HD23 2  
ATOM   1994  N N    . GLY A 1 39  ? 5.259   -11.721 2.231   1.00 0.00 ? 39  GLY A N    2  
ATOM   1995  C CA   . GLY A 1 39  ? 4.099   -11.057 1.661   1.00 0.00 ? 39  GLY A CA   2  
ATOM   1996  C C    . GLY A 1 39  ? 3.832   -9.723  2.361   1.00 0.00 ? 39  GLY A C    2  
ATOM   1997  O O    . GLY A 1 39  ? 3.975   -9.618  3.578   1.00 0.00 ? 39  GLY A O    2  
ATOM   1998  H H    . GLY A 1 39  ? 5.249   -11.808 3.227   1.00 0.00 ? 39  GLY A H    2  
ATOM   1999  H HA2  . GLY A 1 39  ? 4.261   -10.887 0.596   1.00 0.00 ? 39  GLY A HA2  2  
ATOM   2000  H HA3  . GLY A 1 39  ? 3.224   -11.701 1.752   1.00 0.00 ? 39  GLY A HA3  2  
ATOM   2001  N N    . ILE A 1 40  ? 3.450   -8.738  1.562   1.00 0.00 ? 40  ILE A N    2  
ATOM   2002  C CA   . ILE A 1 40  ? 3.161   -7.416  2.090   1.00 0.00 ? 40  ILE A CA   2  
ATOM   2003  C C    . ILE A 1 40  ? 1.660   -7.292  2.354   1.00 0.00 ? 40  ILE A C    2  
ATOM   2004  O O    . ILE A 1 40  ? 0.853   -7.928  1.678   1.00 0.00 ? 40  ILE A O    2  
ATOM   2005  C CB   . ILE A 1 40  ? 3.713   -6.335  1.158   1.00 0.00 ? 40  ILE A CB   2  
ATOM   2006  C CG1  . ILE A 1 40  ? 4.946   -6.836  0.405   1.00 0.00 ? 40  ILE A CG1  2  
ATOM   2007  C CG2  . ILE A 1 40  ? 3.996   -5.042  1.924   1.00 0.00 ? 40  ILE A CG2  2  
ATOM   2008  C CD1  . ILE A 1 40  ? 5.413   -5.812  -0.630  1.00 0.00 ? 40  ILE A CD1  2  
ATOM   2009  H H    . ILE A 1 40  ? 3.337   -8.832  0.573   1.00 0.00 ? 40  ILE A H    2  
ATOM   2010  H HA   . ILE A 1 40  ? 3.688   -7.320  3.040   1.00 0.00 ? 40  ILE A HA   2  
ATOM   2011  H HB   . ILE A 1 40  ? 2.953   -6.107  0.412   1.00 0.00 ? 40  ILE A HB   2  
ATOM   2012  H HG12 . ILE A 1 40  ? 5.752   -7.035  1.112   1.00 0.00 ? 40  ILE A HG12 2  
ATOM   2013  H HG13 . ILE A 1 40  ? 4.715   -7.780  -0.090  1.00 0.00 ? 40  ILE A HG13 2  
ATOM   2014  H HG21 . ILE A 1 40  ? 4.432   -4.306  1.248   1.00 0.00 ? 40  ILE A HG21 2  
ATOM   2015  H HG22 . ILE A 1 40  ? 3.064   -4.650  2.334   1.00 0.00 ? 40  ILE A HG22 2  
ATOM   2016  H HG23 . ILE A 1 40  ? 4.693   -5.245  2.738   1.00 0.00 ? 40  ILE A HG23 2  
ATOM   2017  H HD11 . ILE A 1 40  ? 4.546   -5.300  -1.050  1.00 0.00 ? 40  ILE A HD11 2  
ATOM   2018  H HD12 . ILE A 1 40  ? 6.067   -5.083  -0.152  1.00 0.00 ? 40  ILE A HD12 2  
ATOM   2019  H HD13 . ILE A 1 40  ? 5.955   -6.320  -1.427  1.00 0.00 ? 40  ILE A HD13 2  
ATOM   2020  N N    . TYR A 1 41  ? 1.330   -6.469  3.340   1.00 0.00 ? 41  TYR A N    2  
ATOM   2021  C CA   . TYR A 1 41  ? -0.062  -6.255  3.700   1.00 0.00 ? 41  TYR A CA   2  
ATOM   2022  C C    . TYR A 1 41  ? -0.294  -4.812  4.151   1.00 0.00 ? 41  TYR A C    2  
ATOM   2023  O O    . TYR A 1 41  ? 0.657   -4.086  4.441   1.00 0.00 ? 41  TYR A O    2  
ATOM   2024  C CB   . TYR A 1 41  ? -0.342  -7.195  4.873   1.00 0.00 ? 41  TYR A CB   2  
ATOM   2025  C CG   . TYR A 1 41  ? -1.683  -7.925  4.778   1.00 0.00 ? 41  TYR A CG   2  
ATOM   2026  C CD1  . TYR A 1 41  ? -1.965  -8.711  3.679   1.00 0.00 ? 41  TYR A CD1  2  
ATOM   2027  C CD2  . TYR A 1 41  ? -2.610  -7.801  5.792   1.00 0.00 ? 41  TYR A CD2  2  
ATOM   2028  C CE1  . TYR A 1 41  ? -3.226  -9.399  3.590   1.00 0.00 ? 41  TYR A CE1  2  
ATOM   2029  C CE2  . TYR A 1 41  ? -3.873  -8.487  5.703   1.00 0.00 ? 41  TYR A CE2  2  
ATOM   2030  C CZ   . TYR A 1 41  ? -4.118  -9.254  4.606   1.00 0.00 ? 41  TYR A CZ   2  
ATOM   2031  O OH   . TYR A 1 41  ? -5.310  -9.903  4.522   1.00 0.00 ? 41  TYR A OH   2  
ATOM   2032  H H    . TYR A 1 41  ? 1.992   -5.955  3.883   1.00 0.00 ? 41  TYR A H    2  
ATOM   2033  H HA   . TYR A 1 41  ? -0.672  -6.456  2.819   1.00 0.00 ? 41  TYR A HA   2  
ATOM   2034  H HB2  . TYR A 1 41  ? 0.459   -7.932  4.934   1.00 0.00 ? 41  TYR A HB2  2  
ATOM   2035  H HB3  . TYR A 1 41  ? -0.317  -6.621  5.799   1.00 0.00 ? 41  TYR A HB3  2  
ATOM   2036  H HD1  . TYR A 1 41  ? -1.231  -8.811  2.879   1.00 0.00 ? 41  TYR A HD1  2  
ATOM   2037  H HD2  . TYR A 1 41  ? -2.389  -7.179  6.659   1.00 0.00 ? 41  TYR A HD2  2  
ATOM   2038  H HE1  . TYR A 1 41  ? -3.460  -10.023 2.727   1.00 0.00 ? 41  TYR A HE1  2  
ATOM   2039  H HE2  . TYR A 1 41  ? -4.615  -8.397  6.496   1.00 0.00 ? 41  TYR A HE2  2  
ATOM   2040  H HH   . TYR A 1 41  ? -5.224  -10.695 3.917   1.00 0.00 ? 41  TYR A HH   2  
ATOM   2041  N N    . VAL A 1 42  ? -1.565  -4.436  4.196   1.00 0.00 ? 42  VAL A N    2  
ATOM   2042  C CA   . VAL A 1 42  ? -1.934  -3.093  4.608   1.00 0.00 ? 42  VAL A CA   2  
ATOM   2043  C C    . VAL A 1 42  ? -2.704  -3.163  5.929   1.00 0.00 ? 42  VAL A C    2  
ATOM   2044  O O    . VAL A 1 42  ? -3.769  -3.775  5.998   1.00 0.00 ? 42  VAL A O    2  
ATOM   2045  C CB   . VAL A 1 42  ? -2.720  -2.402  3.492   1.00 0.00 ? 42  VAL A CB   2  
ATOM   2046  C CG1  . VAL A 1 42  ? -3.405  -1.135  4.007   1.00 0.00 ? 42  VAL A CG1  2  
ATOM   2047  C CG2  . VAL A 1 42  ? -1.819  -2.091  2.297   1.00 0.00 ? 42  VAL A CG2  2  
ATOM   2048  H H    . VAL A 1 42  ? -2.332  -5.033  3.959   1.00 0.00 ? 42  VAL A H    2  
ATOM   2049  H HA   . VAL A 1 42  ? -1.013  -2.533  4.768   1.00 0.00 ? 42  VAL A HA   2  
ATOM   2050  H HB   . VAL A 1 42  ? -3.498  -3.089  3.157   1.00 0.00 ? 42  VAL A HB   2  
ATOM   2051  H HG11 . VAL A 1 42  ? -2.649  -0.407  4.301   1.00 0.00 ? 42  VAL A HG11 2  
ATOM   2052  H HG12 . VAL A 1 42  ? -4.029  -0.713  3.221   1.00 0.00 ? 42  VAL A HG12 2  
ATOM   2053  H HG13 . VAL A 1 42  ? -4.025  -1.382  4.871   1.00 0.00 ? 42  VAL A HG13 2  
ATOM   2054  H HG21 . VAL A 1 42  ? -1.094  -2.895  2.170   1.00 0.00 ? 42  VAL A HG21 2  
ATOM   2055  H HG22 . VAL A 1 42  ? -2.426  -2.003  1.396   1.00 0.00 ? 42  VAL A HG22 2  
ATOM   2056  H HG23 . VAL A 1 42  ? -1.294  -1.151  2.473   1.00 0.00 ? 42  VAL A HG23 2  
ATOM   2057  N N    . LYS A 1 43  ? -2.135  -2.527  6.943   1.00 0.00 ? 43  LYS A N    2  
ATOM   2058  C CA   . LYS A 1 43  ? -2.754  -2.508  8.257   1.00 0.00 ? 43  LYS A CA   2  
ATOM   2059  C C    . LYS A 1 43  ? -3.957  -1.562  8.236   1.00 0.00 ? 43  LYS A C    2  
ATOM   2060  O O    . LYS A 1 43  ? -5.042  -1.923  8.689   1.00 0.00 ? 43  LYS A O    2  
ATOM   2061  C CB   . LYS A 1 43  ? -1.721  -2.164  9.331   1.00 0.00 ? 43  LYS A CB   2  
ATOM   2062  C CG   . LYS A 1 43  ? -2.378  -2.060  10.709  1.00 0.00 ? 43  LYS A CG   2  
ATOM   2063  C CD   . LYS A 1 43  ? -1.714  -0.970  11.553  1.00 0.00 ? 43  LYS A CD   2  
ATOM   2064  C CE   . LYS A 1 43  ? -1.076  -1.562  12.811  1.00 0.00 ? 43  LYS A CE   2  
ATOM   2065  N NZ   . LYS A 1 43  ? -0.691  -0.486  13.752  1.00 0.00 ? 43  LYS A NZ   2  
ATOM   2066  H H    . LYS A 1 43  ? -1.269  -2.031  6.876   1.00 0.00 ? 43  LYS A H    2  
ATOM   2067  H HA   . LYS A 1 43  ? -3.112  -3.517  8.463   1.00 0.00 ? 43  LYS A HA   2  
ATOM   2068  H HB2  . LYS A 1 43  ? -0.944  -2.929  9.352   1.00 0.00 ? 43  LYS A HB2  2  
ATOM   2069  H HB3  . LYS A 1 43  ? -1.235  -1.221  9.084   1.00 0.00 ? 43  LYS A HB3  2  
ATOM   2070  H HG2  . LYS A 1 43  ? -3.439  -1.841  10.595  1.00 0.00 ? 43  LYS A HG2  2  
ATOM   2071  H HG3  . LYS A 1 43  ? -2.304  -3.018  11.224  1.00 0.00 ? 43  LYS A HG3  2  
ATOM   2072  H HD2  . LYS A 1 43  ? -0.954  -0.462  10.960  1.00 0.00 ? 43  LYS A HD2  2  
ATOM   2073  H HD3  . LYS A 1 43  ? -2.454  -0.221  11.832  1.00 0.00 ? 43  LYS A HD3  2  
ATOM   2074  H HE2  . LYS A 1 43  ? -1.777  -2.243  13.295  1.00 0.00 ? 43  LYS A HE2  2  
ATOM   2075  H HE3  . LYS A 1 43  ? -0.198  -2.148  12.540  1.00 0.00 ? 43  LYS A HE3  2  
ATOM   2076  H HZ1  . LYS A 1 43  ? -0.907  0.404   13.348  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM   2077  H HZ2  . LYS A 1 43  ? -1.198  -0.594  14.607  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM   2078  H HZ3  . LYS A 1 43  ? 0.289   -0.540  13.937  1.00 0.00 ? 43  LYS A HZ3  2  
ATOM   2079  N N    . SER A 1 44  ? -3.725  -0.373  7.703   1.00 0.00 ? 44  SER A N    2  
ATOM   2080  C CA   . SER A 1 44  ? -4.776  0.627   7.617   1.00 0.00 ? 44  SER A CA   2  
ATOM   2081  C C    . SER A 1 44  ? -4.161  2.025   7.524   1.00 0.00 ? 44  SER A C    2  
ATOM   2082  O O    . SER A 1 44  ? -2.949  2.185   7.652   1.00 0.00 ? 44  SER A O    2  
ATOM   2083  C CB   . SER A 1 44  ? -5.718  0.541   8.819   1.00 0.00 ? 44  SER A CB   2  
ATOM   2084  O OG   . SER A 1 44  ? -5.015  0.286   10.033  1.00 0.00 ? 44  SER A OG   2  
ATOM   2085  H H    . SER A 1 44  ? -2.839  -0.086  7.337   1.00 0.00 ? 44  SER A H    2  
ATOM   2086  H HA   . SER A 1 44  ? -5.327  0.390   6.707   1.00 0.00 ? 44  SER A HA   2  
ATOM   2087  H HB2  . SER A 1 44  ? -6.275  1.473   8.911   1.00 0.00 ? 44  SER A HB2  2  
ATOM   2088  H HB3  . SER A 1 44  ? -6.450  -0.251  8.651   1.00 0.00 ? 44  SER A HB3  2  
ATOM   2089  H HG   . SER A 1 44  ? -4.500  1.099   10.306  1.00 0.00 ? 44  SER A HG   2  
ATOM   2090  N N    . VAL A 1 45  ? -5.028  3.004   7.302   1.00 0.00 ? 45  VAL A N    2  
ATOM   2091  C CA   . VAL A 1 45  ? -4.586  4.384   7.190   1.00 0.00 ? 45  VAL A CA   2  
ATOM   2092  C C    . VAL A 1 45  ? -4.594  5.031   8.577   1.00 0.00 ? 45  VAL A C    2  
ATOM   2093  O O    . VAL A 1 45  ? -5.596  4.970   9.288   1.00 0.00 ? 45  VAL A O    2  
ATOM   2094  C CB   . VAL A 1 45  ? -5.453  5.131   6.176   1.00 0.00 ? 45  VAL A CB   2  
ATOM   2095  C CG1  . VAL A 1 45  ? -5.441  4.425   4.820   1.00 0.00 ? 45  VAL A CG1  2  
ATOM   2096  C CG2  . VAL A 1 45  ? -6.884  5.296   6.695   1.00 0.00 ? 45  VAL A CG2  2  
ATOM   2097  H H    . VAL A 1 45  ? -6.012  2.866   7.200   1.00 0.00 ? 45  VAL A H    2  
ATOM   2098  H HA   . VAL A 1 45  ? -3.561  4.371   6.815   1.00 0.00 ? 45  VAL A HA   2  
ATOM   2099  H HB   . VAL A 1 45  ? -5.030  6.125   6.041   1.00 0.00 ? 45  VAL A HB   2  
ATOM   2100  H HG11 . VAL A 1 45  ? -6.450  4.096   4.571   1.00 0.00 ? 45  VAL A HG11 2  
ATOM   2101  H HG12 . VAL A 1 45  ? -5.085  5.114   4.054   1.00 0.00 ? 45  VAL A HG12 2  
ATOM   2102  H HG13 . VAL A 1 45  ? -4.778  3.560   4.865   1.00 0.00 ? 45  VAL A HG13 2  
ATOM   2103  H HG21 . VAL A 1 45  ? -7.533  5.607   5.876   1.00 0.00 ? 45  VAL A HG21 2  
ATOM   2104  H HG22 . VAL A 1 45  ? -7.237  4.347   7.098   1.00 0.00 ? 45  VAL A HG22 2  
ATOM   2105  H HG23 . VAL A 1 45  ? -6.900  6.053   7.479   1.00 0.00 ? 45  VAL A HG23 2  
ATOM   2106  N N    . VAL A 1 46  ? -3.466  5.637   8.919   1.00 0.00 ? 46  VAL A N    2  
ATOM   2107  C CA   . VAL A 1 46  ? -3.332  6.295   10.208  1.00 0.00 ? 46  VAL A CA   2  
ATOM   2108  C C    . VAL A 1 46  ? -4.638  7.015   10.547  1.00 0.00 ? 46  VAL A C    2  
ATOM   2109  O O    . VAL A 1 46  ? -4.998  7.141   11.716  1.00 0.00 ? 46  VAL A O    2  
ATOM   2110  C CB   . VAL A 1 46  ? -2.121  7.229   10.194  1.00 0.00 ? 46  VAL A CB   2  
ATOM   2111  C CG1  . VAL A 1 46  ? -2.169  8.208   11.369  1.00 0.00 ? 46  VAL A CG1  2  
ATOM   2112  C CG2  . VAL A 1 46  ? -0.814  6.434   10.194  1.00 0.00 ? 46  VAL A CG2  2  
ATOM   2113  H H    . VAL A 1 46  ? -2.656  5.681   8.334   1.00 0.00 ? 46  VAL A H    2  
ATOM   2114  H HA   . VAL A 1 46  ? -3.153  5.522   10.954  1.00 0.00 ? 46  VAL A HA   2  
ATOM   2115  H HB   . VAL A 1 46  ? -2.158  7.812   9.273   1.00 0.00 ? 46  VAL A HB   2  
ATOM   2116  H HG11 . VAL A 1 46  ? -1.983  7.668   12.298  1.00 0.00 ? 46  VAL A HG11 2  
ATOM   2117  H HG12 . VAL A 1 46  ? -1.406  8.974   11.236  1.00 0.00 ? 46  VAL A HG12 2  
ATOM   2118  H HG13 . VAL A 1 46  ? -3.153  8.676   11.413  1.00 0.00 ? 46  VAL A HG13 2  
ATOM   2119  H HG21 . VAL A 1 46  ? -0.709  5.910   9.245   1.00 0.00 ? 46  VAL A HG21 2  
ATOM   2120  H HG22 . VAL A 1 46  ? 0.026   7.115   10.328  1.00 0.00 ? 46  VAL A HG22 2  
ATOM   2121  H HG23 . VAL A 1 46  ? -0.830  5.711   11.010  1.00 0.00 ? 46  VAL A HG23 2  
ATOM   2122  N N    . LYS A 1 47  ? -5.317  7.467   9.502   1.00 0.00 ? 47  LYS A N    2  
ATOM   2123  C CA   . LYS A 1 47  ? -6.576  8.172   9.674   1.00 0.00 ? 47  LYS A CA   2  
ATOM   2124  C C    . LYS A 1 47  ? -6.296  9.660   9.900   1.00 0.00 ? 47  LYS A C    2  
ATOM   2125  O O    . LYS A 1 47  ? -7.081  10.349  10.550  1.00 0.00 ? 47  LYS A O    2  
ATOM   2126  C CB   . LYS A 1 47  ? -7.402  7.524   10.787  1.00 0.00 ? 47  LYS A CB   2  
ATOM   2127  C CG   . LYS A 1 47  ? -8.873  7.940   10.690  1.00 0.00 ? 47  LYS A CG   2  
ATOM   2128  C CD   . LYS A 1 47  ? -9.721  6.812   10.100  1.00 0.00 ? 47  LYS A CD   2  
ATOM   2129  C CE   . LYS A 1 47  ? -11.213 7.142   10.191  1.00 0.00 ? 47  LYS A CE   2  
ATOM   2130  N NZ   . LYS A 1 47  ? -11.972 6.403   9.160   1.00 0.00 ? 47  LYS A NZ   2  
ATOM   2131  H H    . LYS A 1 47  ? -5.018  7.361   8.554   1.00 0.00 ? 47  LYS A H    2  
ATOM   2132  H HA   . LYS A 1 47  ? -7.141  8.063   8.749   1.00 0.00 ? 47  LYS A HA   2  
ATOM   2133  H HB2  . LYS A 1 47  ? -7.322  6.440   10.722  1.00 0.00 ? 47  LYS A HB2  2  
ATOM   2134  H HB3  . LYS A 1 47  ? -7.003  7.817   11.759  1.00 0.00 ? 47  LYS A HB3  2  
ATOM   2135  H HG2  . LYS A 1 47  ? -9.247  8.201   11.679  1.00 0.00 ? 47  LYS A HG2  2  
ATOM   2136  H HG3  . LYS A 1 47  ? -8.962  8.831   10.069  1.00 0.00 ? 47  LYS A HG3  2  
ATOM   2137  H HD2  . LYS A 1 47  ? -9.444  6.650   9.057   1.00 0.00 ? 47  LYS A HD2  2  
ATOM   2138  H HD3  . LYS A 1 47  ? -9.517  5.883   10.630  1.00 0.00 ? 47  LYS A HD3  2  
ATOM   2139  H HE2  . LYS A 1 47  ? -11.587 6.885   11.182  1.00 0.00 ? 47  LYS A HE2  2  
ATOM   2140  H HE3  . LYS A 1 47  ? -11.362 8.215   10.062  1.00 0.00 ? 47  LYS A HE3  2  
ATOM   2141  H HZ1  . LYS A 1 47  ? -12.551 5.716   9.600   1.00 0.00 ? 47  LYS A HZ1  2  
ATOM   2142  H HZ2  . LYS A 1 47  ? -12.544 7.040   8.645   1.00 0.00 ? 47  LYS A HZ2  2  
ATOM   2143  H HZ3  . LYS A 1 47  ? -11.334 5.949   8.537   1.00 0.00 ? 47  LYS A HZ3  2  
ATOM   2144  N N    . GLY A 1 48  ? -5.177  10.109  9.354   1.00 0.00 ? 48  GLY A N    2  
ATOM   2145  C CA   . GLY A 1 48  ? -4.785  11.501  9.487   1.00 0.00 ? 48  GLY A CA   2  
ATOM   2146  C C    . GLY A 1 48  ? -3.730  11.876  8.446   1.00 0.00 ? 48  GLY A C    2  
ATOM   2147  O O    . GLY A 1 48  ? -2.732  12.520  8.769   1.00 0.00 ? 48  GLY A O    2  
ATOM   2148  H H    . GLY A 1 48  ? -4.544  9.540   8.827   1.00 0.00 ? 48  GLY A H    2  
ATOM   2149  H HA2  . GLY A 1 48  ? -5.659  12.142  9.370   1.00 0.00 ? 48  GLY A HA2  2  
ATOM   2150  H HA3  . GLY A 1 48  ? -4.392  11.678  10.488  1.00 0.00 ? 48  GLY A HA3  2  
ATOM   2151  N N    . GLY A 1 49  ? -3.984  11.457  7.215   1.00 0.00 ? 49  GLY A N    2  
ATOM   2152  C CA   . GLY A 1 49  ? -3.068  11.742  6.123   1.00 0.00 ? 49  GLY A CA   2  
ATOM   2153  C C    . GLY A 1 49  ? -3.831  12.034  4.829   1.00 0.00 ? 49  GLY A C    2  
ATOM   2154  O O    . GLY A 1 49  ? -5.017  11.731  4.722   1.00 0.00 ? 49  GLY A O    2  
ATOM   2155  H H    . GLY A 1 49  ? -4.798  10.935  6.959   1.00 0.00 ? 49  GLY A H    2  
ATOM   2156  H HA2  . GLY A 1 49  ? -2.443  12.596  6.382   1.00 0.00 ? 49  GLY A HA2  2  
ATOM   2157  H HA3  . GLY A 1 49  ? -2.401  10.892  5.973   1.00 0.00 ? 49  GLY A HA3  2  
ATOM   2158  N N    . ALA A 1 50  ? -3.117  12.619  3.878   1.00 0.00 ? 50  ALA A N    2  
ATOM   2159  C CA   . ALA A 1 50  ? -3.711  12.955  2.595   1.00 0.00 ? 50  ALA A CA   2  
ATOM   2160  C C    . ALA A 1 50  ? -4.152  11.670  1.890   1.00 0.00 ? 50  ALA A C    2  
ATOM   2161  O O    . ALA A 1 50  ? -5.328  11.506  1.570   1.00 0.00 ? 50  ALA A O    2  
ATOM   2162  C CB   . ALA A 1 50  ? -2.711  13.763  1.765   1.00 0.00 ? 50  ALA A CB   2  
ATOM   2163  H H    . ALA A 1 50  ? -2.151  12.863  3.973   1.00 0.00 ? 50  ALA A H    2  
ATOM   2164  H HA   . ALA A 1 50  ? -4.588  13.574  2.788   1.00 0.00 ? 50  ALA A HA   2  
ATOM   2165  H HB1  . ALA A 1 50  ? -2.916  14.827  1.885   1.00 0.00 ? 50  ALA A HB1  2  
ATOM   2166  H HB2  . ALA A 1 50  ? -1.698  13.547  2.107   1.00 0.00 ? 50  ALA A HB2  2  
ATOM   2167  H HB3  . ALA A 1 50  ? -2.807  13.489  0.716   1.00 0.00 ? 50  ALA A HB3  2  
ATOM   2168  N N    . ALA A 1 51  ? -3.185  10.794  1.670   1.00 0.00 ? 51  ALA A N    2  
ATOM   2169  C CA   . ALA A 1 51  ? -3.459  9.528   1.008   1.00 0.00 ? 51  ALA A CA   2  
ATOM   2170  C C    . ALA A 1 51  ? -4.301  8.647   1.931   1.00 0.00 ? 51  ALA A C    2  
ATOM   2171  O O    . ALA A 1 51  ? -4.885  7.659   1.488   1.00 0.00 ? 51  ALA A O    2  
ATOM   2172  C CB   . ALA A 1 51  ? -2.137  8.864   0.612   1.00 0.00 ? 51  ALA A CB   2  
ATOM   2173  H H    . ALA A 1 51  ? -2.230  10.934  1.934   1.00 0.00 ? 51  ALA A H    2  
ATOM   2174  H HA   . ALA A 1 51  ? -4.027  9.744   0.104   1.00 0.00 ? 51  ALA A HA   2  
ATOM   2175  H HB1  . ALA A 1 51  ? -1.958  8.001   1.254   1.00 0.00 ? 51  ALA A HB1  2  
ATOM   2176  H HB2  . ALA A 1 51  ? -2.193  8.538   -0.427  1.00 0.00 ? 51  ALA A HB2  2  
ATOM   2177  H HB3  . ALA A 1 51  ? -1.322  9.578   0.725   1.00 0.00 ? 51  ALA A HB3  2  
ATOM   2178  N N    . ASP A 1 52  ? -4.337  9.036   3.197   1.00 0.00 ? 52  ASP A N    2  
ATOM   2179  C CA   . ASP A 1 52  ? -5.100  8.293   4.187   1.00 0.00 ? 52  ASP A CA   2  
ATOM   2180  C C    . ASP A 1 52  ? -6.596  8.507   3.938   1.00 0.00 ? 52  ASP A C    2  
ATOM   2181  O O    . ASP A 1 52  ? -7.356  7.544   3.842   1.00 0.00 ? 52  ASP A O    2  
ATOM   2182  C CB   . ASP A 1 52  ? -4.783  8.777   5.603   1.00 0.00 ? 52  ASP A CB   2  
ATOM   2183  C CG   . ASP A 1 52  ? -6.002  8.998   6.500   1.00 0.00 ? 52  ASP A CG   2  
ATOM   2184  O OD1  . ASP A 1 52  ? -6.813  8.051   6.598   1.00 0.00 ? 52  ASP A OD1  2  
ATOM   2185  O OD2  . ASP A 1 52  ? -6.097  10.108  7.067   1.00 0.00 ? 52  ASP A OD2  2  
ATOM   2186  H H    . ASP A 1 52  ? -3.860  9.841   3.549   1.00 0.00 ? 52  ASP A H    2  
ATOM   2187  H HA   . ASP A 1 52  ? -4.800  7.254   4.058   1.00 0.00 ? 52  ASP A HA   2  
ATOM   2188  H HB2  . ASP A 1 52  ? -4.126  8.049   6.080   1.00 0.00 ? 52  ASP A HB2  2  
ATOM   2189  H HB3  . ASP A 1 52  ? -4.226  9.711   5.536   1.00 0.00 ? 52  ASP A HB3  2  
ATOM   2190  N N    . VAL A 1 53  ? -6.971  9.773   3.841   1.00 0.00 ? 53  VAL A N    2  
ATOM   2191  C CA   . VAL A 1 53  ? -8.361  10.125  3.605   1.00 0.00 ? 53  VAL A CA   2  
ATOM   2192  C C    . VAL A 1 53  ? -8.677  9.970   2.118   1.00 0.00 ? 53  VAL A C    2  
ATOM   2193  O O    . VAL A 1 53  ? -9.669  9.340   1.753   1.00 0.00 ? 53  VAL A O    2  
ATOM   2194  C CB   . VAL A 1 53  ? -8.640  11.534  4.132   1.00 0.00 ? 53  VAL A CB   2  
ATOM   2195  C CG1  . VAL A 1 53  ? -8.719  12.543  2.984   1.00 0.00 ? 53  VAL A CG1  2  
ATOM   2196  C CG2  . VAL A 1 53  ? -9.918  11.563  4.973   1.00 0.00 ? 53  VAL A CG2  2  
ATOM   2197  H H    . VAL A 1 53  ? -6.346  10.551  3.921   1.00 0.00 ? 53  VAL A H    2  
ATOM   2198  H HA   . VAL A 1 53  ? -8.977  9.425   4.171   1.00 0.00 ? 53  VAL A HA   2  
ATOM   2199  H HB   . VAL A 1 53  ? -7.809  11.823  4.776   1.00 0.00 ? 53  VAL A HB   2  
ATOM   2200  H HG11 . VAL A 1 53  ? -9.476  12.223  2.270   1.00 0.00 ? 53  VAL A HG11 2  
ATOM   2201  H HG12 . VAL A 1 53  ? -8.983  13.524  3.380   1.00 0.00 ? 53  VAL A HG12 2  
ATOM   2202  H HG13 . VAL A 1 53  ? -7.750  12.601  2.486   1.00 0.00 ? 53  VAL A HG13 2  
ATOM   2203  H HG21 . VAL A 1 53  ? -10.244 12.594  5.106   1.00 0.00 ? 53  VAL A HG21 2  
ATOM   2204  H HG22 . VAL A 1 53  ? -10.701 10.997  4.466   1.00 0.00 ? 53  VAL A HG22 2  
ATOM   2205  H HG23 . VAL A 1 53  ? -9.722  11.116  5.949   1.00 0.00 ? 53  VAL A HG23 2  
ATOM   2206  N N    . ASP A 1 54  ? -7.814  10.554  1.298   1.00 0.00 ? 54  ASP A N    2  
ATOM   2207  C CA   . ASP A 1 54  ? -7.989  10.487  -0.143  1.00 0.00 ? 54  ASP A CA   2  
ATOM   2208  C C    . ASP A 1 54  ? -7.947  9.025   -0.590  1.00 0.00 ? 54  ASP A C    2  
ATOM   2209  O O    . ASP A 1 54  ? -8.832  8.567   -1.312  1.00 0.00 ? 54  ASP A O    2  
ATOM   2210  C CB   . ASP A 1 54  ? -6.871  11.237  -0.869  1.00 0.00 ? 54  ASP A CB   2  
ATOM   2211  C CG   . ASP A 1 54  ? -7.104  11.459  -2.364  1.00 0.00 ? 54  ASP A CG   2  
ATOM   2212  O OD1  . ASP A 1 54  ? -8.085  12.164  -2.687  1.00 0.00 ? 54  ASP A OD1  2  
ATOM   2213  O OD2  . ASP A 1 54  ? -6.298  10.920  -3.151  1.00 0.00 ? 54  ASP A OD2  2  
ATOM   2214  H H    . ASP A 1 54  ? -7.011  11.063  1.604   1.00 0.00 ? 54  ASP A H    2  
ATOM   2215  H HA   . ASP A 1 54  ? -8.956  10.954  -0.336  1.00 0.00 ? 54  ASP A HA   2  
ATOM   2216  H HB2  . ASP A 1 54  ? -6.733  12.207  -0.389  1.00 0.00 ? 54  ASP A HB2  2  
ATOM   2217  H HB3  . ASP A 1 54  ? -5.940  10.684  -0.739  1.00 0.00 ? 54  ASP A HB3  2  
ATOM   2218  N N    . GLY A 1 55  ? -6.909  8.333   -0.145  1.00 0.00 ? 55  GLY A N    2  
ATOM   2219  C CA   . GLY A 1 55  ? -6.739  6.932   -0.491  1.00 0.00 ? 55  GLY A CA   2  
ATOM   2220  C C    . GLY A 1 55  ? -7.883  6.086   0.071   1.00 0.00 ? 55  GLY A C    2  
ATOM   2221  O O    . GLY A 1 55  ? -8.549  5.364   -0.671  1.00 0.00 ? 55  GLY A O    2  
ATOM   2222  H H    . GLY A 1 55  ? -6.193  8.713   0.440   1.00 0.00 ? 55  GLY A H    2  
ATOM   2223  H HA2  . GLY A 1 55  ? -6.701  6.823   -1.576  1.00 0.00 ? 55  GLY A HA2  2  
ATOM   2224  H HA3  . GLY A 1 55  ? -5.789  6.569   -0.102  1.00 0.00 ? 55  GLY A HA3  2  
ATOM   2225  N N    . ARG A 1 56  ? -8.077  6.203   1.376   1.00 0.00 ? 56  ARG A N    2  
ATOM   2226  C CA   . ARG A 1 56  ? -9.129  5.459   2.047   1.00 0.00 ? 56  ARG A CA   2  
ATOM   2227  C C    . ARG A 1 56  ? -8.969  3.960   1.783   1.00 0.00 ? 56  ARG A C    2  
ATOM   2228  O O    . ARG A 1 56  ? -9.943  3.271   1.481   1.00 0.00 ? 56  ARG A O    2  
ATOM   2229  C CB   . ARG A 1 56  ? -10.511 5.909   1.572   1.00 0.00 ? 56  ARG A CB   2  
ATOM   2230  C CG   . ARG A 1 56  ? -11.618 5.249   2.399   1.00 0.00 ? 56  ARG A CG   2  
ATOM   2231  C CD   . ARG A 1 56  ? -12.811 6.191   2.566   1.00 0.00 ? 56  ARG A CD   2  
ATOM   2232  N NE   . ARG A 1 56  ? -14.043 5.408   2.816   1.00 0.00 ? 56  ARG A NE   2  
ATOM   2233  C CZ   . ARG A 1 56  ? -14.409 4.947   4.019   1.00 0.00 ? 56  ARG A CZ   2  
ATOM   2234  N NH1  . ARG A 1 56  ? -13.640 5.188   5.090   1.00 0.00 ? 56  ARG A NH1  2  
ATOM   2235  N NH2  . ARG A 1 56  ? -15.542 4.245   4.152   1.00 0.00 ? 56  ARG A NH2  2  
ATOM   2236  H H    . ARG A 1 56  ? -7.532  6.793   1.971   1.00 0.00 ? 56  ARG A H    2  
ATOM   2237  H HA   . ARG A 1 56  ? -9.000  5.685   3.105   1.00 0.00 ? 56  ARG A HA   2  
ATOM   2238  H HB2  . ARG A 1 56  ? -10.591 6.993   1.650   1.00 0.00 ? 56  ARG A HB2  2  
ATOM   2239  H HB3  . ARG A 1 56  ? -10.639 5.654   0.519   1.00 0.00 ? 56  ARG A HB3  2  
ATOM   2240  H HG2  . ARG A 1 56  ? -11.940 4.329   1.913   1.00 0.00 ? 56  ARG A HG2  2  
ATOM   2241  H HG3  . ARG A 1 56  ? -11.228 4.973   3.379   1.00 0.00 ? 56  ARG A HG3  2  
ATOM   2242  H HD2  . ARG A 1 56  ? -12.633 6.875   3.394   1.00 0.00 ? 56  ARG A HD2  2  
ATOM   2243  H HD3  . ARG A 1 56  ? -12.934 6.800   1.670   1.00 0.00 ? 56  ARG A HD3  2  
ATOM   2244  H HE   . ARG A 1 56  ? -14.638 5.210   2.037   1.00 0.00 ? 56  ARG A HE   2  
ATOM   2245  H HH11 . ARG A 1 56  ? -12.795 5.712   4.991   1.00 0.00 ? 56  ARG A HH11 2  
ATOM   2246  H HH12 . ARG A 1 56  ? -13.913 4.844   5.989   1.00 0.00 ? 56  ARG A HH12 2  
ATOM   2247  H HH21 . ARG A 1 56  ? -16.115 4.065   3.352   1.00 0.00 ? 56  ARG A HH21 2  
ATOM   2248  H HH22 . ARG A 1 56  ? -15.814 3.900   5.050   1.00 0.00 ? 56  ARG A HH22 2  
ATOM   2249  N N    . LEU A 1 57  ? -7.733  3.498   1.905   1.00 0.00 ? 57  LEU A N    2  
ATOM   2250  C CA   . LEU A 1 57  ? -7.434  2.093   1.683   1.00 0.00 ? 57  LEU A CA   2  
ATOM   2251  C C    . LEU A 1 57  ? -8.044  1.261   2.813   1.00 0.00 ? 57  LEU A C    2  
ATOM   2252  O O    . LEU A 1 57  ? -8.147  1.727   3.946   1.00 0.00 ? 57  LEU A O    2  
ATOM   2253  C CB   . LEU A 1 57  ? -5.928  1.887   1.512   1.00 0.00 ? 57  LEU A CB   2  
ATOM   2254  C CG   . LEU A 1 57  ? -5.287  2.592   0.313   1.00 0.00 ? 57  LEU A CG   2  
ATOM   2255  C CD1  . LEU A 1 57  ? -3.761  2.577   0.422   1.00 0.00 ? 57  LEU A CD1  2  
ATOM   2256  C CD2  . LEU A 1 57  ? -5.773  1.983   -1.003  1.00 0.00 ? 57  LEU A CD2  2  
ATOM   2257  H H    . LEU A 1 57  ? -6.946  4.064   2.152   1.00 0.00 ? 57  LEU A H    2  
ATOM   2258  H HA   . LEU A 1 57  ? -7.908  1.803   0.744   1.00 0.00 ? 57  LEU A HA   2  
ATOM   2259  H HB2  . LEU A 1 57  ? -5.429  2.230   2.418   1.00 0.00 ? 57  LEU A HB2  2  
ATOM   2260  H HB3  . LEU A 1 57  ? -5.736  0.817   1.426   1.00 0.00 ? 57  LEU A HB3  2  
ATOM   2261  H HG   . LEU A 1 57  ? -5.601  3.635   0.321   1.00 0.00 ? 57  LEU A HG   2  
ATOM   2262  H HD11 . LEU A 1 57  ? -3.469  2.736   1.461   1.00 0.00 ? 57  LEU A HD11 2  
ATOM   2263  H HD12 . LEU A 1 57  ? -3.381  1.614   0.080   1.00 0.00 ? 57  LEU A HD12 2  
ATOM   2264  H HD13 . LEU A 1 57  ? -3.346  3.374   -0.198  1.00 0.00 ? 57  LEU A HD13 2  
ATOM   2265  H HD21 . LEU A 1 57  ? -6.862  1.916   -0.994  1.00 0.00 ? 57  LEU A HD21 2  
ATOM   2266  H HD22 . LEU A 1 57  ? -5.457  2.616   -1.833  1.00 0.00 ? 57  LEU A HD22 2  
ATOM   2267  H HD23 . LEU A 1 57  ? -5.348  0.986   -1.122  1.00 0.00 ? 57  LEU A HD23 2  
ATOM   2268  N N    . ALA A 1 58  ? -8.433  0.043   2.465   1.00 0.00 ? 58  ALA A N    2  
ATOM   2269  C CA   . ALA A 1 58  ? -9.030  -0.858  3.435   1.00 0.00 ? 58  ALA A CA   2  
ATOM   2270  C C    . ALA A 1 58  ? -7.921  -1.545  4.235   1.00 0.00 ? 58  ALA A C    2  
ATOM   2271  O O    . ALA A 1 58  ? -6.769  -1.579  3.805   1.00 0.00 ? 58  ALA A O    2  
ATOM   2272  C CB   . ALA A 1 58  ? -9.935  -1.859  2.712   1.00 0.00 ? 58  ALA A CB   2  
ATOM   2273  H H    . ALA A 1 58  ? -8.346  -0.329  1.539   1.00 0.00 ? 58  ALA A H    2  
ATOM   2274  H HA   . ALA A 1 58  ? -9.638  -0.260  4.112   1.00 0.00 ? 58  ALA A HA   2  
ATOM   2275  H HB1  . ALA A 1 58  ? -10.660 -1.319  2.105   1.00 0.00 ? 58  ALA A HB1  2  
ATOM   2276  H HB2  . ALA A 1 58  ? -9.328  -2.500  2.073   1.00 0.00 ? 58  ALA A HB2  2  
ATOM   2277  H HB3  . ALA A 1 58  ? -10.459 -2.470  3.447   1.00 0.00 ? 58  ALA A HB3  2  
ATOM   2278  N N    . ALA A 1 59  ? -8.308  -2.078  5.385   1.00 0.00 ? 59  ALA A N    2  
ATOM   2279  C CA   . ALA A 1 59  ? -7.362  -2.763  6.248   1.00 0.00 ? 59  ALA A CA   2  
ATOM   2280  C C    . ALA A 1 59  ? -7.340  -4.251  5.895   1.00 0.00 ? 59  ALA A C    2  
ATOM   2281  O O    . ALA A 1 59  ? -8.359  -4.932  5.996   1.00 0.00 ? 59  ALA A O    2  
ATOM   2282  C CB   . ALA A 1 59  ? -7.735  -2.516  7.711   1.00 0.00 ? 59  ALA A CB   2  
ATOM   2283  H H    . ALA A 1 59  ? -9.247  -2.046  5.727   1.00 0.00 ? 59  ALA A H    2  
ATOM   2284  H HA   . ALA A 1 59  ? -6.376  -2.338  6.062   1.00 0.00 ? 59  ALA A HA   2  
ATOM   2285  H HB1  . ALA A 1 59  ? -8.682  -3.009  7.933   1.00 0.00 ? 59  ALA A HB1  2  
ATOM   2286  H HB2  . ALA A 1 59  ? -6.956  -2.920  8.358   1.00 0.00 ? 59  ALA A HB2  2  
ATOM   2287  H HB3  . ALA A 1 59  ? -7.833  -1.445  7.887   1.00 0.00 ? 59  ALA A HB3  2  
ATOM   2288  N N    . GLY A 1 60  ? -6.168  -4.713  5.487   1.00 0.00 ? 60  GLY A N    2  
ATOM   2289  C CA   . GLY A 1 60  ? -5.999  -6.109  5.118   1.00 0.00 ? 60  GLY A CA   2  
ATOM   2290  C C    . GLY A 1 60  ? -5.813  -6.257  3.607   1.00 0.00 ? 60  GLY A C    2  
ATOM   2291  O O    . GLY A 1 60  ? -6.400  -7.143  2.989   1.00 0.00 ? 60  GLY A O    2  
ATOM   2292  H H    . GLY A 1 60  ? -5.342  -4.153  5.407   1.00 0.00 ? 60  GLY A H    2  
ATOM   2293  H HA2  . GLY A 1 60  ? -5.136  -6.524  5.637   1.00 0.00 ? 60  GLY A HA2  2  
ATOM   2294  H HA3  . GLY A 1 60  ? -6.870  -6.681  5.439   1.00 0.00 ? 60  GLY A HA3  2  
ATOM   2295  N N    . ASP A 1 61  ? -4.992  -5.375  3.055   1.00 0.00 ? 61  ASP A N    2  
ATOM   2296  C CA   . ASP A 1 61  ? -4.721  -5.397  1.628   1.00 0.00 ? 61  ASP A CA   2  
ATOM   2297  C C    . ASP A 1 61  ? -3.337  -6.002  1.385   1.00 0.00 ? 61  ASP A C    2  
ATOM   2298  O O    . ASP A 1 61  ? -2.335  -5.486  1.879   1.00 0.00 ? 61  ASP A O    2  
ATOM   2299  C CB   . ASP A 1 61  ? -4.728  -3.983  1.044   1.00 0.00 ? 61  ASP A CB   2  
ATOM   2300  C CG   . ASP A 1 61  ? -5.824  -3.065  1.587   1.00 0.00 ? 61  ASP A CG   2  
ATOM   2301  O OD1  . ASP A 1 61  ? -6.766  -3.608  2.202   1.00 0.00 ? 61  ASP A OD1  2  
ATOM   2302  O OD2  . ASP A 1 61  ? -5.693  -1.839  1.377   1.00 0.00 ? 61  ASP A OD2  2  
ATOM   2303  H H    . ASP A 1 61  ? -4.518  -4.657  3.564   1.00 0.00 ? 61  ASP A H    2  
ATOM   2304  H HA   . ASP A 1 61  ? -5.521  -5.998  1.193   1.00 0.00 ? 61  ASP A HA   2  
ATOM   2305  H HB2  . ASP A 1 61  ? -3.759  -3.522  1.235   1.00 0.00 ? 61  ASP A HB2  2  
ATOM   2306  H HB3  . ASP A 1 61  ? -4.838  -4.054  -0.038  1.00 0.00 ? 61  ASP A HB3  2  
ATOM   2307  N N    . GLN A 1 62  ? -3.324  -7.088  0.625   1.00 0.00 ? 62  GLN A N    2  
ATOM   2308  C CA   . GLN A 1 62  ? -2.079  -7.768  0.311   1.00 0.00 ? 62  GLN A CA   2  
ATOM   2309  C C    . GLN A 1 62  ? -1.279  -6.963  -0.712  1.00 0.00 ? 62  GLN A C    2  
ATOM   2310  O O    . GLN A 1 62  ? -1.663  -6.876  -1.878  1.00 0.00 ? 62  GLN A O    2  
ATOM   2311  C CB   . GLN A 1 62  ? -2.343  -9.187  -0.193  1.00 0.00 ? 62  GLN A CB   2  
ATOM   2312  C CG   . GLN A 1 62  ? -1.034  -9.961  -0.362  1.00 0.00 ? 62  GLN A CG   2  
ATOM   2313  C CD   . GLN A 1 62  ? -1.058  -10.808 -1.636  1.00 0.00 ? 62  GLN A CD   2  
ATOM   2314  O OE1  . GLN A 1 62  ? -1.832  -10.579 -2.552  1.00 0.00 ? 62  GLN A OE1  2  
ATOM   2315  N NE2  . GLN A 1 62  ? -0.174  -11.801 -1.643  1.00 0.00 ? 62  GLN A NE2  2  
ATOM   2316  H H    . GLN A 1 62  ? -4.145  -7.502  0.227   1.00 0.00 ? 62  GLN A H    2  
ATOM   2317  H HA   . GLN A 1 62  ? -1.532  -7.819  1.252   1.00 0.00 ? 62  GLN A HA   2  
ATOM   2318  H HB2  . GLN A 1 62  ? -2.992  -9.713  0.508   1.00 0.00 ? 62  GLN A HB2  2  
ATOM   2319  H HB3  . GLN A 1 62  ? -2.871  -9.147  -1.146  1.00 0.00 ? 62  GLN A HB3  2  
ATOM   2320  H HG2  . GLN A 1 62  ? -0.197  -9.263  -0.403  1.00 0.00 ? 62  GLN A HG2  2  
ATOM   2321  H HG3  . GLN A 1 62  ? -0.872  -10.603 0.504   1.00 0.00 ? 62  GLN A HG3  2  
ATOM   2322  H HE21 . GLN A 1 62  ? 0.432   -11.937 -0.858  1.00 0.00 ? 62  GLN A HE21 2  
ATOM   2323  H HE22 . GLN A 1 62  ? -0.112  -12.413 -2.434  1.00 0.00 ? 62  GLN A HE22 2  
ATOM   2324  N N    . LEU A 1 63  ? -0.179  -6.393  -0.240  1.00 0.00 ? 63  LEU A N    2  
ATOM   2325  C CA   . LEU A 1 63  ? 0.681   -5.598  -1.100  1.00 0.00 ? 63  LEU A CA   2  
ATOM   2326  C C    . LEU A 1 63  ? 1.808   -6.478  -1.642  1.00 0.00 ? 63  LEU A C    2  
ATOM   2327  O O    . LEU A 1 63  ? 2.156   -7.490  -1.037  1.00 0.00 ? 63  LEU A O    2  
ATOM   2328  C CB   . LEU A 1 63  ? 1.174   -4.353  -0.360  1.00 0.00 ? 63  LEU A CB   2  
ATOM   2329  C CG   . LEU A 1 63  ? 2.099   -3.425  -1.151  1.00 0.00 ? 63  LEU A CG   2  
ATOM   2330  C CD1  . LEU A 1 63  ? 1.308   -2.292  -1.808  1.00 0.00 ? 63  LEU A CD1  2  
ATOM   2331  C CD2  . LEU A 1 63  ? 3.231   -2.896  -0.268  1.00 0.00 ? 63  LEU A CD2  2  
ATOM   2332  H H    . LEU A 1 63  ? 0.127   -6.468  0.709   1.00 0.00 ? 63  LEU A H    2  
ATOM   2333  H HA   . LEU A 1 63  ? 0.076   -5.255  -1.940  1.00 0.00 ? 63  LEU A HA   2  
ATOM   2334  H HB2  . LEU A 1 63  ? 0.305   -3.778  -0.038  1.00 0.00 ? 63  LEU A HB2  2  
ATOM   2335  H HB3  . LEU A 1 63  ? 1.698   -4.672  0.541   1.00 0.00 ? 63  LEU A HB3  2  
ATOM   2336  H HG   . LEU A 1 63  ? 2.559   -4.003  -1.952  1.00 0.00 ? 63  LEU A HG   2  
ATOM   2337  H HD11 . LEU A 1 63  ? 1.714   -2.092  -2.800  1.00 0.00 ? 63  LEU A HD11 2  
ATOM   2338  H HD12 . LEU A 1 63  ? 0.262   -2.583  -1.896  1.00 0.00 ? 63  LEU A HD12 2  
ATOM   2339  H HD13 . LEU A 1 63  ? 1.384   -1.392  -1.196  1.00 0.00 ? 63  LEU A HD13 2  
ATOM   2340  H HD21 . LEU A 1 63  ? 4.152   -3.430  -0.501  1.00 0.00 ? 63  LEU A HD21 2  
ATOM   2341  H HD22 . LEU A 1 63  ? 3.371   -1.831  -0.455  1.00 0.00 ? 63  LEU A HD22 2  
ATOM   2342  H HD23 . LEU A 1 63  ? 2.976   -3.052  0.780   1.00 0.00 ? 63  LEU A HD23 2  
ATOM   2343  N N    . LEU A 1 64  ? 2.348   -6.061  -2.779  1.00 0.00 ? 64  LEU A N    2  
ATOM   2344  C CA   . LEU A 1 64  ? 3.429   -6.798  -3.409  1.00 0.00 ? 64  LEU A CA   2  
ATOM   2345  C C    . LEU A 1 64  ? 4.354   -5.820  -4.135  1.00 0.00 ? 64  LEU A C    2  
ATOM   2346  O O    . LEU A 1 64  ? 5.569   -6.003  -4.150  1.00 0.00 ? 64  LEU A O    2  
ATOM   2347  C CB   . LEU A 1 64  ? 2.870   -7.902  -4.311  1.00 0.00 ? 64  LEU A CB   2  
ATOM   2348  C CG   . LEU A 1 64  ? 1.515   -8.481  -3.901  1.00 0.00 ? 64  LEU A CG   2  
ATOM   2349  C CD1  . LEU A 1 64  ? 0.381   -7.509  -4.233  1.00 0.00 ? 64  LEU A CD1  2  
ATOM   2350  C CD2  . LEU A 1 64  ? 1.293   -9.857  -4.532  1.00 0.00 ? 64  LEU A CD2  2  
ATOM   2351  H H    . LEU A 1 64  ? 2.059   -5.238  -3.266  1.00 0.00 ? 64  LEU A H    2  
ATOM   2352  H HA   . LEU A 1 64  ? 3.997   -7.287  -2.617  1.00 0.00 ? 64  LEU A HA   2  
ATOM   2353  H HB2  . LEU A 1 64  ? 2.784   -7.507  -5.323  1.00 0.00 ? 64  LEU A HB2  2  
ATOM   2354  H HB3  . LEU A 1 64  ? 3.595   -8.716  -4.348  1.00 0.00 ? 64  LEU A HB3  2  
ATOM   2355  H HG   . LEU A 1 64  ? 1.515   -8.618  -2.820  1.00 0.00 ? 64  LEU A HG   2  
ATOM   2356  H HD11 . LEU A 1 64  ? 0.750   -6.734  -4.904  1.00 0.00 ? 64  LEU A HD11 2  
ATOM   2357  H HD12 . LEU A 1 64  ? -0.434  -8.050  -4.714  1.00 0.00 ? 64  LEU A HD12 2  
ATOM   2358  H HD13 . LEU A 1 64  ? 0.017   -7.049  -3.313  1.00 0.00 ? 64  LEU A HD13 2  
ATOM   2359  H HD21 . LEU A 1 64  ? 0.581   -10.422 -3.931  1.00 0.00 ? 64  LEU A HD21 2  
ATOM   2360  H HD22 . LEU A 1 64  ? 0.899   -9.735  -5.541  1.00 0.00 ? 64  LEU A HD22 2  
ATOM   2361  H HD23 . LEU A 1 64  ? 2.240   -10.394 -4.574  1.00 0.00 ? 64  LEU A HD23 2  
ATOM   2362  N N    . SER A 1 65  ? 3.741   -4.800  -4.720  1.00 0.00 ? 65  SER A N    2  
ATOM   2363  C CA   . SER A 1 65  ? 4.494   -3.792  -5.447  1.00 0.00 ? 65  SER A CA   2  
ATOM   2364  C C    . SER A 1 65  ? 4.558   -2.499  -4.631  1.00 0.00 ? 65  SER A C    2  
ATOM   2365  O O    . SER A 1 65  ? 3.641   -2.194  -3.872  1.00 0.00 ? 65  SER A O    2  
ATOM   2366  C CB   . SER A 1 65  ? 3.874   -3.524  -6.820  1.00 0.00 ? 65  SER A CB   2  
ATOM   2367  O OG   . SER A 1 65  ? 2.975   -2.418  -6.792  1.00 0.00 ? 65  SER A OG   2  
ATOM   2368  H H    . SER A 1 65  ? 2.751   -4.658  -4.705  1.00 0.00 ? 65  SER A H    2  
ATOM   2369  H HA   . SER A 1 65  ? 5.493   -4.214  -5.575  1.00 0.00 ? 65  SER A HA   2  
ATOM   2370  H HB2  . SER A 1 65  ? 4.665   -3.330  -7.544  1.00 0.00 ? 65  SER A HB2  2  
ATOM   2371  H HB3  . SER A 1 65  ? 3.343   -4.415  -7.157  1.00 0.00 ? 65  SER A HB3  2  
ATOM   2372  H HG   . SER A 1 65  ? 3.428   -1.601  -7.148  1.00 0.00 ? 65  SER A HG   2  
ATOM   2373  N N    . VAL A 1 66  ? 5.651   -1.774  -4.818  1.00 0.00 ? 66  VAL A N    2  
ATOM   2374  C CA   . VAL A 1 66  ? 5.848   -0.520  -4.109  1.00 0.00 ? 66  VAL A CA   2  
ATOM   2375  C C    . VAL A 1 66  ? 6.052   0.607   -5.123  1.00 0.00 ? 66  VAL A C    2  
ATOM   2376  O O    . VAL A 1 66  ? 6.488   0.365   -6.246  1.00 0.00 ? 66  VAL A O    2  
ATOM   2377  C CB   . VAL A 1 66  ? 7.009   -0.655  -3.122  1.00 0.00 ? 66  VAL A CB   2  
ATOM   2378  C CG1  . VAL A 1 66  ? 8.099   0.379   -3.416  1.00 0.00 ? 66  VAL A CG1  2  
ATOM   2379  C CG2  . VAL A 1 66  ? 6.517   -0.535  -1.678  1.00 0.00 ? 66  VAL A CG2  2  
ATOM   2380  H H    . VAL A 1 66  ? 6.393   -2.029  -5.437  1.00 0.00 ? 66  VAL A H    2  
ATOM   2381  H HA   . VAL A 1 66  ? 4.941   -0.320  -3.538  1.00 0.00 ? 66  VAL A HA   2  
ATOM   2382  H HB   . VAL A 1 66  ? 7.443   -1.646  -3.247  1.00 0.00 ? 66  VAL A HB   2  
ATOM   2383  H HG11 . VAL A 1 66  ? 7.656   1.373   -3.457  1.00 0.00 ? 66  VAL A HG11 2  
ATOM   2384  H HG12 . VAL A 1 66  ? 8.851   0.348   -2.628  1.00 0.00 ? 66  VAL A HG12 2  
ATOM   2385  H HG13 . VAL A 1 66  ? 8.567   0.148   -4.374  1.00 0.00 ? 66  VAL A HG13 2  
ATOM   2386  H HG21 . VAL A 1 66  ? 7.162   0.152   -1.130  1.00 0.00 ? 66  VAL A HG21 2  
ATOM   2387  H HG22 . VAL A 1 66  ? 5.495   -0.157  -1.672  1.00 0.00 ? 66  VAL A HG22 2  
ATOM   2388  H HG23 . VAL A 1 66  ? 6.545   -1.517  -1.204  1.00 0.00 ? 66  VAL A HG23 2  
ATOM   2389  N N    . ASP A 1 67  ? 5.723   1.816   -4.690  1.00 0.00 ? 67  ASP A N    2  
ATOM   2390  C CA   . ASP A 1 67  ? 5.864   2.982   -5.546  1.00 0.00 ? 67  ASP A CA   2  
ATOM   2391  C C    . ASP A 1 67  ? 7.350   3.280   -5.751  1.00 0.00 ? 67  ASP A C    2  
ATOM   2392  O O    . ASP A 1 67  ? 8.033   3.717   -4.826  1.00 0.00 ? 67  ASP A O    2  
ATOM   2393  C CB   . ASP A 1 67  ? 5.217   4.214   -4.908  1.00 0.00 ? 67  ASP A CB   2  
ATOM   2394  C CG   . ASP A 1 67  ? 5.373   5.510   -5.705  1.00 0.00 ? 67  ASP A CG   2  
ATOM   2395  O OD1  . ASP A 1 67  ? 6.368   5.598   -6.456  1.00 0.00 ? 67  ASP A OD1  2  
ATOM   2396  O OD2  . ASP A 1 67  ? 4.495   6.385   -5.543  1.00 0.00 ? 67  ASP A OD2  2  
ATOM   2397  H H    . ASP A 1 67  ? 5.368   2.003   -3.774  1.00 0.00 ? 67  ASP A H    2  
ATOM   2398  H HA   . ASP A 1 67  ? 5.359   2.718   -6.474  1.00 0.00 ? 67  ASP A HA   2  
ATOM   2399  H HB2  . ASP A 1 67  ? 4.155   4.016   -4.768  1.00 0.00 ? 67  ASP A HB2  2  
ATOM   2400  H HB3  . ASP A 1 67  ? 5.648   4.359   -3.917  1.00 0.00 ? 67  ASP A HB3  2  
ATOM   2401  N N    . GLY A 1 68  ? 7.808   3.033   -6.970  1.00 0.00 ? 68  GLY A N    2  
ATOM   2402  C CA   . GLY A 1 68  ? 9.200   3.270   -7.310  1.00 0.00 ? 68  GLY A CA   2  
ATOM   2403  C C    . GLY A 1 68  ? 9.878   1.978   -7.775  1.00 0.00 ? 68  GLY A C    2  
ATOM   2404  O O    . GLY A 1 68  ? 10.874  2.022   -8.495  1.00 0.00 ? 68  GLY A O    2  
ATOM   2405  H H    . GLY A 1 68  ? 7.245   2.677   -7.717  1.00 0.00 ? 68  GLY A H    2  
ATOM   2406  H HA2  . GLY A 1 68  ? 9.262   4.023   -8.096  1.00 0.00 ? 68  GLY A HA2  2  
ATOM   2407  H HA3  . GLY A 1 68  ? 9.725   3.670   -6.443  1.00 0.00 ? 68  GLY A HA3  2  
ATOM   2408  N N    . ARG A 1 69  ? 9.310   0.863   -7.345  1.00 0.00 ? 69  ARG A N    2  
ATOM   2409  C CA   . ARG A 1 69  ? 9.847   -0.439  -7.709  1.00 0.00 ? 69  ARG A CA   2  
ATOM   2410  C C    . ARG A 1 69  ? 8.731   -1.483  -7.739  1.00 0.00 ? 69  ARG A C    2  
ATOM   2411  O O    . ARG A 1 69  ? 8.012   -1.657  -6.758  1.00 0.00 ? 69  ARG A O    2  
ATOM   2412  C CB   . ARG A 1 69  ? 10.929  -0.883  -6.723  1.00 0.00 ? 69  ARG A CB   2  
ATOM   2413  C CG   . ARG A 1 69  ? 12.081  0.123   -6.680  1.00 0.00 ? 69  ARG A CG   2  
ATOM   2414  C CD   . ARG A 1 69  ? 13.110  -0.266  -5.616  1.00 0.00 ? 69  ARG A CD   2  
ATOM   2415  N NE   . ARG A 1 69  ? 14.359  -0.726  -6.265  1.00 0.00 ? 69  ARG A NE   2  
ATOM   2416  C CZ   . ARG A 1 69  ? 15.175  0.069   -6.971  1.00 0.00 ? 69  ARG A CZ   2  
ATOM   2417  N NH1  . ARG A 1 69  ? 14.879  1.367   -7.125  1.00 0.00 ? 69  ARG A NH1  2  
ATOM   2418  N NH2  . ARG A 1 69  ? 16.286  -0.435  -7.524  1.00 0.00 ? 69  ARG A NH2  2  
ATOM   2419  H H    . ARG A 1 69  ? 8.500   0.836   -6.761  1.00 0.00 ? 69  ARG A H    2  
ATOM   2420  H HA   . ARG A 1 69  ? 10.277  -0.295  -8.701  1.00 0.00 ? 69  ARG A HA   2  
ATOM   2421  H HB2  . ARG A 1 69  ? 10.495  -0.987  -5.727  1.00 0.00 ? 69  ARG A HB2  2  
ATOM   2422  H HB3  . ARG A 1 69  ? 11.308  -1.864  -7.010  1.00 0.00 ? 69  ARG A HB3  2  
ATOM   2423  H HG2  . ARG A 1 69  ? 12.562  0.170   -7.657  1.00 0.00 ? 69  ARG A HG2  2  
ATOM   2424  H HG3  . ARG A 1 69  ? 11.691  1.119   -6.468  1.00 0.00 ? 69  ARG A HG3  2  
ATOM   2425  H HD2  . ARG A 1 69  ? 13.318  0.588   -4.971  1.00 0.00 ? 69  ARG A HD2  2  
ATOM   2426  H HD3  . ARG A 1 69  ? 12.708  -1.056  -4.982  1.00 0.00 ? 69  ARG A HD3  2  
ATOM   2427  H HE   . ARG A 1 69  ? 14.609  -1.689  -6.171  1.00 0.00 ? 69  ARG A HE   2  
ATOM   2428  H HH11 . ARG A 1 69  ? 14.049  1.743   -6.711  1.00 0.00 ? 69  ARG A HH11 2  
ATOM   2429  H HH12 . ARG A 1 69  ? 15.489  1.959   -7.650  1.00 0.00 ? 69  ARG A HH12 2  
ATOM   2430  H HH21 . ARG A 1 69  ? 16.507  -1.404  -7.410  1.00 0.00 ? 69  ARG A HH21 2  
ATOM   2431  H HH22 . ARG A 1 69  ? 16.895  0.157   -8.051  1.00 0.00 ? 69  ARG A HH22 2  
ATOM   2432  N N    . SER A 1 70  ? 8.623   -2.154  -8.876  1.00 0.00 ? 70  SER A N    2  
ATOM   2433  C CA   . SER A 1 70  ? 7.608   -3.178  -9.047  1.00 0.00 ? 70  SER A CA   2  
ATOM   2434  C C    . SER A 1 70  ? 8.010   -4.447  -8.292  1.00 0.00 ? 70  SER A C    2  
ATOM   2435  O O    . SER A 1 70  ? 8.451   -5.422  -8.899  1.00 0.00 ? 70  SER A O    2  
ATOM   2436  C CB   . SER A 1 70  ? 7.384   -3.492  -10.527 1.00 0.00 ? 70  SER A CB   2  
ATOM   2437  O OG   . SER A 1 70  ? 7.099   -2.318  -11.284 1.00 0.00 ? 70  SER A OG   2  
ATOM   2438  H H    . SER A 1 70  ? 9.213   -2.007  -9.672  1.00 0.00 ? 70  SER A H    2  
ATOM   2439  H HA   . SER A 1 70  ? 6.697   -2.755  -8.625  1.00 0.00 ? 70  SER A HA   2  
ATOM   2440  H HB2  . SER A 1 70  ? 8.270   -3.979  -10.933 1.00 0.00 ? 70  SER A HB2  2  
ATOM   2441  H HB3  . SER A 1 70  ? 6.558   -4.197  -10.629 1.00 0.00 ? 70  SER A HB3  2  
ATOM   2442  H HG   . SER A 1 70  ? 7.939   -1.969  -11.700 1.00 0.00 ? 70  SER A HG   2  
ATOM   2443  N N    . LEU A 1 71  ? 7.845   -4.393  -6.978  1.00 0.00 ? 71  LEU A N    2  
ATOM   2444  C CA   . LEU A 1 71  ? 8.187   -5.525  -6.134  1.00 0.00 ? 71  LEU A CA   2  
ATOM   2445  C C    . LEU A 1 71  ? 7.450   -6.769  -6.635  1.00 0.00 ? 71  LEU A C    2  
ATOM   2446  O O    . LEU A 1 71  ? 8.074   -7.786  -6.934  1.00 0.00 ? 71  LEU A O    2  
ATOM   2447  C CB   . LEU A 1 71  ? 7.915   -5.199  -4.664  1.00 0.00 ? 71  LEU A CB   2  
ATOM   2448  C CG   . LEU A 1 71  ? 9.021   -4.439  -3.930  1.00 0.00 ? 71  LEU A CG   2  
ATOM   2449  C CD1  . LEU A 1 71  ? 9.067   -2.974  -4.369  1.00 0.00 ? 71  LEU A CD1  2  
ATOM   2450  C CD2  . LEU A 1 71  ? 8.868   -4.577  -2.413  1.00 0.00 ? 71  LEU A CD2  2  
ATOM   2451  H H    . LEU A 1 71  ? 7.486   -3.596  -6.493  1.00 0.00 ? 71  LEU A H    2  
ATOM   2452  H HA   . LEU A 1 71  ? 9.258   -5.694  -6.233  1.00 0.00 ? 71  LEU A HA   2  
ATOM   2453  H HB2  . LEU A 1 71  ? 6.998   -4.611  -4.607  1.00 0.00 ? 71  LEU A HB2  2  
ATOM   2454  H HB3  . LEU A 1 71  ? 7.728   -6.132  -4.133  1.00 0.00 ? 71  LEU A HB3  2  
ATOM   2455  H HG   . LEU A 1 71  ? 9.978   -4.886  -4.199  1.00 0.00 ? 71  LEU A HG   2  
ATOM   2456  H HD11 . LEU A 1 71  ? 9.832   -2.850  -5.137  1.00 0.00 ? 71  LEU A HD11 2  
ATOM   2457  H HD12 . LEU A 1 71  ? 8.096   -2.687  -4.774  1.00 0.00 ? 71  LEU A HD12 2  
ATOM   2458  H HD13 . LEU A 1 71  ? 9.304   -2.346  -3.513  1.00 0.00 ? 71  LEU A HD13 2  
ATOM   2459  H HD21 . LEU A 1 71  ? 8.388   -3.684  -2.014  1.00 0.00 ? 71  LEU A HD21 2  
ATOM   2460  H HD22 . LEU A 1 71  ? 8.257   -5.451  -2.189  1.00 0.00 ? 71  LEU A HD22 2  
ATOM   2461  H HD23 . LEU A 1 71  ? 9.851   -4.696  -1.958  1.00 0.00 ? 71  LEU A HD23 2  
ATOM   2462  N N    . VAL A 1 72  ? 6.133   -6.648  -6.710  1.00 0.00 ? 72  VAL A N    2  
ATOM   2463  C CA   . VAL A 1 72  ? 5.305   -7.750  -7.168  1.00 0.00 ? 72  VAL A CA   2  
ATOM   2464  C C    . VAL A 1 72  ? 5.164   -8.779  -6.043  1.00 0.00 ? 72  VAL A C    2  
ATOM   2465  O O    . VAL A 1 72  ? 4.407   -9.741  -6.169  1.00 0.00 ? 72  VAL A O    2  
ATOM   2466  C CB   . VAL A 1 72  ? 5.889   -8.344  -8.451  1.00 0.00 ? 72  VAL A CB   2  
ATOM   2467  C CG1  . VAL A 1 72  ? 6.698   -7.298  -9.221  1.00 0.00 ? 72  VAL A CG1  2  
ATOM   2468  C CG2  . VAL A 1 72  ? 6.739   -9.580  -8.147  1.00 0.00 ? 72  VAL A CG2  2  
ATOM   2469  H H    . VAL A 1 72  ? 5.633   -5.817  -6.464  1.00 0.00 ? 72  VAL A H    2  
ATOM   2470  H HA   . VAL A 1 72  ? 4.319   -7.347  -7.401  1.00 0.00 ? 72  VAL A HA   2  
ATOM   2471  H HB   . VAL A 1 72  ? 5.058   -8.658  -9.083  1.00 0.00 ? 72  VAL A HB   2  
ATOM   2472  H HG11 . VAL A 1 72  ? 6.413   -6.302  -8.887  1.00 0.00 ? 72  VAL A HG11 2  
ATOM   2473  H HG12 . VAL A 1 72  ? 7.761   -7.454  -9.039  1.00 0.00 ? 72  VAL A HG12 2  
ATOM   2474  H HG13 . VAL A 1 72  ? 6.494   -7.396  -10.289 1.00 0.00 ? 72  VAL A HG13 2  
ATOM   2475  H HG21 . VAL A 1 72  ? 7.012   -9.581  -7.092  1.00 0.00 ? 72  VAL A HG21 2  
ATOM   2476  H HG22 . VAL A 1 72  ? 6.169   -10.480 -8.375  1.00 0.00 ? 72  VAL A HG22 2  
ATOM   2477  H HG23 . VAL A 1 72  ? 7.643   -9.557  -8.755  1.00 0.00 ? 72  VAL A HG23 2  
ATOM   2478  N N    . GLY A 1 73  ? 5.903   -8.540  -4.970  1.00 0.00 ? 73  GLY A N    2  
ATOM   2479  C CA   . GLY A 1 73  ? 5.871   -9.434  -3.825  1.00 0.00 ? 73  GLY A CA   2  
ATOM   2480  C C    . GLY A 1 73  ? 7.225   -9.471  -3.119  1.00 0.00 ? 73  GLY A C    2  
ATOM   2481  O O    . GLY A 1 73  ? 7.813   -10.538 -2.948  1.00 0.00 ? 73  GLY A O    2  
ATOM   2482  H H    . GLY A 1 73  ? 6.515   -7.756  -4.876  1.00 0.00 ? 73  GLY A H    2  
ATOM   2483  H HA2  . GLY A 1 73  ? 5.100   -9.106  -3.125  1.00 0.00 ? 73  GLY A HA2  2  
ATOM   2484  H HA3  . GLY A 1 73  ? 5.597   -10.438 -4.151  1.00 0.00 ? 73  GLY A HA3  2  
ATOM   2485  N N    . LEU A 1 74  ? 7.686   -8.290  -2.726  1.00 0.00 ? 74  LEU A N    2  
ATOM   2486  C CA   . LEU A 1 74  ? 8.962   -8.176  -2.043  1.00 0.00 ? 74  LEU A CA   2  
ATOM   2487  C C    . LEU A 1 74  ? 8.735   -7.590  -0.646  1.00 0.00 ? 74  LEU A C    2  
ATOM   2488  O O    . LEU A 1 74  ? 7.619   -7.203  -0.304  1.00 0.00 ? 74  LEU A O    2  
ATOM   2489  C CB   . LEU A 1 74  ? 9.953   -7.379  -2.891  1.00 0.00 ? 74  LEU A CB   2  
ATOM   2490  C CG   . LEU A 1 74  ? 10.778  -8.185  -3.895  1.00 0.00 ? 74  LEU A CG   2  
ATOM   2491  C CD1  . LEU A 1 74  ? 11.758  -7.286  -4.650  1.00 0.00 ? 74  LEU A CD1  2  
ATOM   2492  C CD2  . LEU A 1 74  ? 11.485  -9.355  -3.209  1.00 0.00 ? 74  LEU A CD2  2  
ATOM   2493  H H    . LEU A 1 74  ? 7.202   -7.428  -2.868  1.00 0.00 ? 74  LEU A H    2  
ATOM   2494  H HA   . LEU A 1 74  ? 9.366   -9.181  -1.933  1.00 0.00 ? 74  LEU A HA   2  
ATOM   2495  H HB2  . LEU A 1 74  ? 9.403   -6.612  -3.434  1.00 0.00 ? 74  LEU A HB2  2  
ATOM   2496  H HB3  . LEU A 1 74  ? 10.640  -6.859  -2.220  1.00 0.00 ? 74  LEU A HB3  2  
ATOM   2497  H HG   . LEU A 1 74  ? 10.097  -8.608  -4.634  1.00 0.00 ? 74  LEU A HG   2  
ATOM   2498  H HD11 . LEU A 1 74  ? 12.748  -7.740  -4.641  1.00 0.00 ? 74  LEU A HD11 2  
ATOM   2499  H HD12 . LEU A 1 74  ? 11.422  -7.165  -5.680  1.00 0.00 ? 74  LEU A HD12 2  
ATOM   2500  H HD13 . LEU A 1 74  ? 11.802  -6.310  -4.166  1.00 0.00 ? 74  LEU A HD13 2  
ATOM   2501  H HD21 . LEU A 1 74  ? 10.829  -10.227 -3.211  1.00 0.00 ? 74  LEU A HD21 2  
ATOM   2502  H HD22 . LEU A 1 74  ? 12.402  -9.593  -3.749  1.00 0.00 ? 74  LEU A HD22 2  
ATOM   2503  H HD23 . LEU A 1 74  ? 11.727  -9.083  -2.184  1.00 0.00 ? 74  LEU A HD23 2  
ATOM   2504  N N    . SER A 1 75  ? 9.814   -7.542  0.122   1.00 0.00 ? 75  SER A N    2  
ATOM   2505  C CA   . SER A 1 75  ? 9.747   -7.010  1.472   1.00 0.00 ? 75  SER A CA   2  
ATOM   2506  C C    . SER A 1 75  ? 9.585   -5.490  1.428   1.00 0.00 ? 75  SER A C    2  
ATOM   2507  O O    . SER A 1 75  ? 9.884   -4.858  0.416   1.00 0.00 ? 75  SER A O    2  
ATOM   2508  C CB   . SER A 1 75  ? 10.995  -7.387  2.275   1.00 0.00 ? 75  SER A CB   2  
ATOM   2509  O OG   . SER A 1 75  ? 10.818  -8.602  2.999   1.00 0.00 ? 75  SER A OG   2  
ATOM   2510  H H    . SER A 1 75  ? 10.720  -7.858  -0.164  1.00 0.00 ? 75  SER A H    2  
ATOM   2511  H HA   . SER A 1 75  ? 8.872   -7.476  1.923   1.00 0.00 ? 75  SER A HA   2  
ATOM   2512  H HB2  . SER A 1 75  ? 11.844  -7.488  1.599   1.00 0.00 ? 75  SER A HB2  2  
ATOM   2513  H HB3  . SER A 1 75  ? 11.235  -6.583  2.970   1.00 0.00 ? 75  SER A HB3  2  
ATOM   2514  H HG   . SER A 1 75  ? 10.809  -8.416  3.981   1.00 0.00 ? 75  SER A HG   2  
ATOM   2515  N N    . GLN A 1 76  ? 9.110   -4.945  2.539   1.00 0.00 ? 76  GLN A N    2  
ATOM   2516  C CA   . GLN A 1 76  ? 8.903   -3.510  2.639   1.00 0.00 ? 76  GLN A CA   2  
ATOM   2517  C C    . GLN A 1 76  ? 10.204  -2.813  3.044   1.00 0.00 ? 76  GLN A C    2  
ATOM   2518  O O    . GLN A 1 76  ? 10.335  -1.599  2.895   1.00 0.00 ? 76  GLN A O    2  
ATOM   2519  C CB   . GLN A 1 76  ? 7.779   -3.186  3.626   1.00 0.00 ? 76  GLN A CB   2  
ATOM   2520  C CG   . GLN A 1 76  ? 6.422   -3.151  2.918   1.00 0.00 ? 76  GLN A CG   2  
ATOM   2521  C CD   . GLN A 1 76  ? 6.203   -1.807  2.220   1.00 0.00 ? 76  GLN A CD   2  
ATOM   2522  O OE1  . GLN A 1 76  ? 5.933   -1.733  1.032   1.00 0.00 ? 76  GLN A OE1  2  
ATOM   2523  N NE2  . GLN A 1 76  ? 6.333   -0.754  3.020   1.00 0.00 ? 76  GLN A NE2  2  
ATOM   2524  H H    . GLN A 1 76  ? 8.868   -5.465  3.358   1.00 0.00 ? 76  GLN A H    2  
ATOM   2525  H HA   . GLN A 1 76  ? 8.607   -3.189  1.641   1.00 0.00 ? 76  GLN A HA   2  
ATOM   2526  H HB2  . GLN A 1 76  ? 7.760   -3.932  4.419   1.00 0.00 ? 76  GLN A HB2  2  
ATOM   2527  H HB3  . GLN A 1 76  ? 7.971   -2.222  4.098   1.00 0.00 ? 76  GLN A HB3  2  
ATOM   2528  H HG2  . GLN A 1 76  ? 6.369   -3.958  2.188   1.00 0.00 ? 76  GLN A HG2  2  
ATOM   2529  H HG3  . GLN A 1 76  ? 5.626   -3.323  3.643   1.00 0.00 ? 76  GLN A HG3  2  
ATOM   2530  H HE21 . GLN A 1 76  ? 6.554   -0.884  3.987   1.00 0.00 ? 76  GLN A HE21 2  
ATOM   2531  H HE22 . GLN A 1 76  ? 6.206   0.170   2.656   1.00 0.00 ? 76  GLN A HE22 2  
ATOM   2532  N N    . GLU A 1 77  ? 11.134  -3.612  3.547   1.00 0.00 ? 77  GLU A N    2  
ATOM   2533  C CA   . GLU A 1 77  ? 12.422  -3.087  3.974   1.00 0.00 ? 77  GLU A CA   2  
ATOM   2534  C C    . GLU A 1 77  ? 12.902  -2.007  3.002   1.00 0.00 ? 77  GLU A C    2  
ATOM   2535  O O    . GLU A 1 77  ? 13.044  -0.846  3.380   1.00 0.00 ? 77  GLU A O    2  
ATOM   2536  C CB   . GLU A 1 77  ? 13.453  -4.208  4.104   1.00 0.00 ? 77  GLU A CB   2  
ATOM   2537  C CG   . GLU A 1 77  ? 12.901  -5.371  4.931   1.00 0.00 ? 77  GLU A CG   2  
ATOM   2538  C CD   . GLU A 1 77  ? 13.876  -5.769  6.039   1.00 0.00 ? 77  GLU A CD   2  
ATOM   2539  O OE1  . GLU A 1 77  ? 15.017  -6.142  5.684   1.00 0.00 ? 77  GLU A OE1  2  
ATOM   2540  O OE2  . GLU A 1 77  ? 13.461  -5.695  7.215   1.00 0.00 ? 77  GLU A OE2  2  
ATOM   2541  H H    . GLU A 1 77  ? 11.020  -4.599  3.665   1.00 0.00 ? 77  GLU A H    2  
ATOM   2542  H HA   . GLU A 1 77  ? 12.244  -2.649  4.955   1.00 0.00 ? 77  GLU A HA   2  
ATOM   2543  H HB2  . GLU A 1 77  ? 13.737  -4.564  3.113   1.00 0.00 ? 77  GLU A HB2  2  
ATOM   2544  H HB3  . GLU A 1 77  ? 14.357  -3.821  4.574   1.00 0.00 ? 77  GLU A HB3  2  
ATOM   2545  H HG2  . GLU A 1 77  ? 11.943  -5.087  5.369   1.00 0.00 ? 77  GLU A HG2  2  
ATOM   2546  H HG3  . GLU A 1 77  ? 12.713  -6.226  4.281   1.00 0.00 ? 77  GLU A HG3  2  
ATOM   2547  N N    . ARG A 1 78  ? 13.141  -2.430  1.769   1.00 0.00 ? 78  ARG A N    2  
ATOM   2548  C CA   . ARG A 1 78  ? 13.603  -1.514  0.740   1.00 0.00 ? 78  ARG A CA   2  
ATOM   2549  C C    . ARG A 1 78  ? 12.435  -0.686  0.204   1.00 0.00 ? 78  ARG A C    2  
ATOM   2550  O O    . ARG A 1 78  ? 12.524  0.539   0.122   1.00 0.00 ? 78  ARG A O    2  
ATOM   2551  C CB   . ARG A 1 78  ? 14.257  -2.271  -0.418  1.00 0.00 ? 78  ARG A CB   2  
ATOM   2552  C CG   . ARG A 1 78  ? 14.852  -3.597  0.060   1.00 0.00 ? 78  ARG A CG   2  
ATOM   2553  C CD   . ARG A 1 78  ? 13.948  -4.772  -0.320  1.00 0.00 ? 78  ARG A CD   2  
ATOM   2554  N NE   . ARG A 1 78  ? 14.748  -5.844  -0.953  1.00 0.00 ? 78  ARG A NE   2  
ATOM   2555  C CZ   . ARG A 1 78  ? 15.131  -5.836  -2.237  1.00 0.00 ? 78  ARG A CZ   2  
ATOM   2556  N NH1  . ARG A 1 78  ? 14.786  -4.815  -3.034  1.00 0.00 ? 78  ARG A NH1  2  
ATOM   2557  N NH2  . ARG A 1 78  ? 15.856  -6.850  -2.726  1.00 0.00 ? 78  ARG A NH2  2  
ATOM   2558  H H    . ARG A 1 78  ? 13.023  -3.378  1.470   1.00 0.00 ? 78  ARG A H    2  
ATOM   2559  H HA   . ARG A 1 78  ? 14.337  -0.882  1.240   1.00 0.00 ? 78  ARG A HA   2  
ATOM   2560  H HB2  . ARG A 1 78  ? 13.517  -2.460  -1.197  1.00 0.00 ? 78  ARG A HB2  2  
ATOM   2561  H HB3  . ARG A 1 78  ? 15.040  -1.657  -0.862  1.00 0.00 ? 78  ARG A HB3  2  
ATOM   2562  H HG2  . ARG A 1 78  ? 15.838  -3.737  -0.379  1.00 0.00 ? 78  ARG A HG2  2  
ATOM   2563  H HG3  . ARG A 1 78  ? 14.984  -3.572  1.141   1.00 0.00 ? 78  ARG A HG3  2  
ATOM   2564  H HD2  . ARG A 1 78  ? 13.446  -5.159  0.569   1.00 0.00 ? 78  ARG A HD2  2  
ATOM   2565  H HD3  . ARG A 1 78  ? 13.169  -4.435  -1.004  1.00 0.00 ? 78  ARG A HD3  2  
ATOM   2566  H HE   . ARG A 1 78  ? 15.023  -6.622  -0.387  1.00 0.00 ? 78  ARG A HE   2  
ATOM   2567  H HH11 . ARG A 1 78  ? 14.244  -4.058  -2.668  1.00 0.00 ? 78  ARG A HH11 2  
ATOM   2568  H HH12 . ARG A 1 78  ? 15.071  -4.810  -3.992  1.00 0.00 ? 78  ARG A HH12 2  
ATOM   2569  H HH21 . ARG A 1 78  ? 16.113  -7.614  -2.133  1.00 0.00 ? 78  ARG A HH21 2  
ATOM   2570  H HH22 . ARG A 1 78  ? 16.140  -6.845  -3.685  1.00 0.00 ? 78  ARG A HH22 2  
ATOM   2571  N N    . ALA A 1 79  ? 11.366  -1.385  -0.149  1.00 0.00 ? 79  ALA A N    2  
ATOM   2572  C CA   . ALA A 1 79  ? 10.182  -0.729  -0.676  1.00 0.00 ? 79  ALA A CA   2  
ATOM   2573  C C    . ALA A 1 79  ? 9.805   0.441   0.237   1.00 0.00 ? 79  ALA A C    2  
ATOM   2574  O O    . ALA A 1 79  ? 10.020  1.600   -0.113  1.00 0.00 ? 79  ALA A O    2  
ATOM   2575  C CB   . ALA A 1 79  ? 9.051   -1.750  -0.814  1.00 0.00 ? 79  ALA A CB   2  
ATOM   2576  H H    . ALA A 1 79  ? 11.303  -2.380  -0.079  1.00 0.00 ? 79  ALA A H    2  
ATOM   2577  H HA   . ALA A 1 79  ? 10.428  -0.342  -1.665  1.00 0.00 ? 79  ALA A HA   2  
ATOM   2578  H HB1  . ALA A 1 79  ? 8.666   -1.729  -1.833  1.00 0.00 ? 79  ALA A HB1  2  
ATOM   2579  H HB2  . ALA A 1 79  ? 9.432   -2.746  -0.589  1.00 0.00 ? 79  ALA A HB2  2  
ATOM   2580  H HB3  . ALA A 1 79  ? 8.250   -1.500  -0.117  1.00 0.00 ? 79  ALA A HB3  2  
ATOM   2581  N N    . ALA A 1 80  ? 9.248   0.096   1.388   1.00 0.00 ? 80  ALA A N    2  
ATOM   2582  C CA   . ALA A 1 80  ? 8.837   1.103   2.352   1.00 0.00 ? 80  ALA A CA   2  
ATOM   2583  C C    . ALA A 1 80  ? 9.621   2.392   2.101   1.00 0.00 ? 80  ALA A C    2  
ATOM   2584  O O    . ALA A 1 80  ? 9.049   3.398   1.685   1.00 0.00 ? 80  ALA A O    2  
ATOM   2585  C CB   . ALA A 1 80  ? 9.041   0.563   3.770   1.00 0.00 ? 80  ALA A CB   2  
ATOM   2586  H H    . ALA A 1 80  ? 9.075   -0.849  1.665   1.00 0.00 ? 80  ALA A H    2  
ATOM   2587  H HA   . ALA A 1 80  ? 7.776   1.296   2.200   1.00 0.00 ? 80  ALA A HA   2  
ATOM   2588  H HB1  . ALA A 1 80  ? 8.480   -0.362  3.892   1.00 0.00 ? 80  ALA A HB1  2  
ATOM   2589  H HB2  . ALA A 1 80  ? 10.102  0.371   3.937   1.00 0.00 ? 80  ALA A HB2  2  
ATOM   2590  H HB3  . ALA A 1 80  ? 8.688   1.300   4.492   1.00 0.00 ? 80  ALA A HB3  2  
ATOM   2591  N N    . GLU A 1 81  ? 10.917  2.320   2.364   1.00 0.00 ? 81  GLU A N    2  
ATOM   2592  C CA   . GLU A 1 81  ? 11.786  3.469   2.170   1.00 0.00 ? 81  GLU A CA   2  
ATOM   2593  C C    . GLU A 1 81  ? 11.425  4.194   0.872   1.00 0.00 ? 81  GLU A C    2  
ATOM   2594  O O    . GLU A 1 81  ? 10.884  5.299   0.904   1.00 0.00 ? 81  GLU A O    2  
ATOM   2595  C CB   . GLU A 1 81  ? 13.258  3.053   2.176   1.00 0.00 ? 81  GLU A CB   2  
ATOM   2596  C CG   . GLU A 1 81  ? 14.174  4.276   2.126   1.00 0.00 ? 81  GLU A CG   2  
ATOM   2597  C CD   . GLU A 1 81  ? 15.581  3.927   2.618   1.00 0.00 ? 81  GLU A CD   2  
ATOM   2598  O OE1  . GLU A 1 81  ? 15.778  3.966   3.853   1.00 0.00 ? 81  GLU A OE1  2  
ATOM   2599  O OE2  . GLU A 1 81  ? 16.429  3.632   1.748   1.00 0.00 ? 81  GLU A OE2  2  
ATOM   2600  H H    . GLU A 1 81  ? 11.376  1.497   2.701   1.00 0.00 ? 81  GLU A H    2  
ATOM   2601  H HA   . GLU A 1 81  ? 11.596  4.122   3.023   1.00 0.00 ? 81  GLU A HA   2  
ATOM   2602  H HB2  . GLU A 1 81  ? 13.471  2.469   3.072   1.00 0.00 ? 81  GLU A HB2  2  
ATOM   2603  H HB3  . GLU A 1 81  ? 13.460  2.409   1.321   1.00 0.00 ? 81  GLU A HB3  2  
ATOM   2604  H HG2  . GLU A 1 81  ? 14.225  4.656   1.107   1.00 0.00 ? 81  GLU A HG2  2  
ATOM   2605  H HG3  . GLU A 1 81  ? 13.756  5.073   2.743   1.00 0.00 ? 81  GLU A HG3  2  
ATOM   2606  N N    . LEU A 1 82  ? 11.739  3.543   -0.238  1.00 0.00 ? 82  LEU A N    2  
ATOM   2607  C CA   . LEU A 1 82  ? 11.456  4.112   -1.545  1.00 0.00 ? 82  LEU A CA   2  
ATOM   2608  C C    . LEU A 1 82  ? 9.964   4.432   -1.644  1.00 0.00 ? 82  LEU A C    2  
ATOM   2609  O O    . LEU A 1 82  ? 9.544   5.192   -2.516  1.00 0.00 ? 82  LEU A O    2  
ATOM   2610  C CB   . LEU A 1 82  ? 11.961  3.186   -2.653  1.00 0.00 ? 82  LEU A CB   2  
ATOM   2611  C CG   . LEU A 1 82  ? 12.271  3.853   -3.995  1.00 0.00 ? 82  LEU A CG   2  
ATOM   2612  C CD1  . LEU A 1 82  ? 11.065  4.645   -4.506  1.00 0.00 ? 82  LEU A CD1  2  
ATOM   2613  C CD2  . LEU A 1 82  ? 13.528  4.719   -3.900  1.00 0.00 ? 82  LEU A CD2  2  
ATOM   2614  H H    . LEU A 1 82  ? 12.180  2.645   -0.255  1.00 0.00 ? 82  LEU A H    2  
ATOM   2615  H HA   . LEU A 1 82  ? 12.016  5.044   -1.624  1.00 0.00 ? 82  LEU A HA   2  
ATOM   2616  H HB2  . LEU A 1 82  ? 12.865  2.688   -2.300  1.00 0.00 ? 82  LEU A HB2  2  
ATOM   2617  H HB3  . LEU A 1 82  ? 11.215  2.410   -2.819  1.00 0.00 ? 82  LEU A HB3  2  
ATOM   2618  H HG   . LEU A 1 82  ? 12.475  3.070   -4.726  1.00 0.00 ? 82  LEU A HG   2  
ATOM   2619  H HD11 . LEU A 1 82  ? 11.148  4.780   -5.583  1.00 0.00 ? 82  LEU A HD11 2  
ATOM   2620  H HD12 . LEU A 1 82  ? 10.149  4.098   -4.278  1.00 0.00 ? 82  LEU A HD12 2  
ATOM   2621  H HD13 . LEU A 1 82  ? 11.039  5.619   -4.019  1.00 0.00 ? 82  LEU A HD13 2  
ATOM   2622  H HD21 . LEU A 1 82  ? 13.344  5.551   -3.220  1.00 0.00 ? 82  LEU A HD21 2  
ATOM   2623  H HD22 . LEU A 1 82  ? 14.356  4.119   -3.524  1.00 0.00 ? 82  LEU A HD22 2  
ATOM   2624  H HD23 . LEU A 1 82  ? 13.779  5.106   -4.887  1.00 0.00 ? 82  LEU A HD23 2  
ATOM   2625  N N    . MET A 1 83  ? 9.203   3.838   -0.738  1.00 0.00 ? 83  MET A N    2  
ATOM   2626  C CA   . MET A 1 83  ? 7.765   4.050   -0.711  1.00 0.00 ? 83  MET A CA   2  
ATOM   2627  C C    . MET A 1 83  ? 7.383   5.096   0.339   1.00 0.00 ? 83  MET A C    2  
ATOM   2628  O O    . MET A 1 83  ? 6.215   5.457   0.465   1.00 0.00 ? 83  MET A O    2  
ATOM   2629  C CB   . MET A 1 83  ? 7.058   2.730   -0.398  1.00 0.00 ? 83  MET A CB   2  
ATOM   2630  C CG   . MET A 1 83  ? 5.946   2.449   -1.410  1.00 0.00 ? 83  MET A CG   2  
ATOM   2631  S SD   . MET A 1 83  ? 4.444   1.999   -0.558  1.00 0.00 ? 83  MET A SD   2  
ATOM   2632  C CE   . MET A 1 83  ? 5.124   1.009   0.764   1.00 0.00 ? 83  MET A CE   2  
ATOM   2633  H H    . MET A 1 83  ? 9.551   3.222   -0.031  1.00 0.00 ? 83  MET A H    2  
ATOM   2634  H HA   . MET A 1 83  ? 7.505   4.414   -1.706  1.00 0.00 ? 83  MET A HA   2  
ATOM   2635  H HB2  . MET A 1 83  ? 7.781   1.915   -0.413  1.00 0.00 ? 83  MET A HB2  2  
ATOM   2636  H HB3  . MET A 1 83  ? 6.640   2.767   0.607   1.00 0.00 ? 83  MET A HB3  2  
ATOM   2637  H HG2  . MET A 1 83  ? 5.773   3.332   -2.027  1.00 0.00 ? 83  MET A HG2  2  
ATOM   2638  H HG3  . MET A 1 83  ? 6.249   1.646   -2.082  1.00 0.00 ? 83  MET A HG3  2  
ATOM   2639  H HE1  . MET A 1 83  ? 5.040   1.553   1.704   1.00 0.00 ? 83  MET A HE1  2  
ATOM   2640  H HE2  . MET A 1 83  ? 4.573   0.071   0.837   1.00 0.00 ? 83  MET A HE2  2  
ATOM   2641  H HE3  . MET A 1 83  ? 6.173   0.800   0.558   1.00 0.00 ? 83  MET A HE3  2  
ATOM   2642  N N    . THR A 1 84  ? 8.393   5.550   1.067   1.00 0.00 ? 84  THR A N    2  
ATOM   2643  C CA   . THR A 1 84  ? 8.178   6.546   2.104   1.00 0.00 ? 84  THR A CA   2  
ATOM   2644  C C    . THR A 1 84  ? 8.248   7.955   1.512   1.00 0.00 ? 84  THR A C    2  
ATOM   2645  O O    . THR A 1 84  ? 7.297   8.728   1.621   1.00 0.00 ? 84  THR A O    2  
ATOM   2646  C CB   . THR A 1 84  ? 9.202   6.302   3.214   1.00 0.00 ? 84  THR A CB   2  
ATOM   2647  O OG1  . THR A 1 84  ? 8.949   4.963   3.632   1.00 0.00 ? 84  THR A OG1  2  
ATOM   2648  C CG2  . THR A 1 84  ? 8.926   7.143   4.461   1.00 0.00 ? 84  THR A CG2  2  
ATOM   2649  H H    . THR A 1 84  ? 9.340   5.251   0.959   1.00 0.00 ? 84  THR A H    2  
ATOM   2650  H HA   . THR A 1 84  ? 7.173   6.417   2.502   1.00 0.00 ? 84  THR A HA   2  
ATOM   2651  H HB   . THR A 1 84  ? 10.217  6.467   2.851   1.00 0.00 ? 84  THR A HB   2  
ATOM   2652  H HG1  . THR A 1 84  ? 9.672   4.358   3.304   1.00 0.00 ? 84  THR A HG1  2  
ATOM   2653  H HG21 . THR A 1 84  ? 8.967   8.201   4.204   1.00 0.00 ? 84  THR A HG21 2  
ATOM   2654  H HG22 . THR A 1 84  ? 7.936   6.902   4.849   1.00 0.00 ? 84  THR A HG22 2  
ATOM   2655  H HG23 . THR A 1 84  ? 9.676   6.923   5.222   1.00 0.00 ? 84  THR A HG23 2  
ATOM   2656  N N    . ARG A 1 85  ? 9.385   8.249   0.896   1.00 0.00 ? 85  ARG A N    2  
ATOM   2657  C CA   . ARG A 1 85  ? 9.593   9.552   0.288   1.00 0.00 ? 85  ARG A CA   2  
ATOM   2658  C C    . ARG A 1 85  ? 8.662   9.728   -0.913  1.00 0.00 ? 85  ARG A C    2  
ATOM   2659  O O    . ARG A 1 85  ? 9.122   9.939   -2.035  1.00 0.00 ? 85  ARG A O    2  
ATOM   2660  C CB   . ARG A 1 85  ? 11.043  9.722   -0.170  1.00 0.00 ? 85  ARG A CB   2  
ATOM   2661  C CG   . ARG A 1 85  ? 11.544  11.138  0.111   1.00 0.00 ? 85  ARG A CG   2  
ATOM   2662  C CD   . ARG A 1 85  ? 13.067  11.164  0.251   1.00 0.00 ? 85  ARG A CD   2  
ATOM   2663  N NE   . ARG A 1 85  ? 13.576  12.531  -0.005  1.00 0.00 ? 85  ARG A NE   2  
ATOM   2664  C CZ   . ARG A 1 85  ? 13.515  13.144  -1.195  1.00 0.00 ? 85  ARG A CZ   2  
ATOM   2665  N NH1  . ARG A 1 85  ? 12.967  12.518  -2.245  1.00 0.00 ? 85  ARG A NH1  2  
ATOM   2666  N NH2  . ARG A 1 85  ? 14.002  14.384  -1.334  1.00 0.00 ? 85  ARG A NH2  2  
ATOM   2667  H H    . ARG A 1 85  ? 10.154  7.615   0.813   1.00 0.00 ? 85  ARG A H    2  
ATOM   2668  H HA   . ARG A 1 85  ? 9.358   10.267  1.075   1.00 0.00 ? 85  ARG A HA   2  
ATOM   2669  H HB2  . ARG A 1 85  ? 11.677  9.000   0.345   1.00 0.00 ? 85  ARG A HB2  2  
ATOM   2670  H HB3  . ARG A 1 85  ? 11.119  9.509   -1.237  1.00 0.00 ? 85  ARG A HB3  2  
ATOM   2671  H HG2  . ARG A 1 85  ? 11.238  11.803  -0.698  1.00 0.00 ? 85  ARG A HG2  2  
ATOM   2672  H HG3  . ARG A 1 85  ? 11.084  11.517  1.024   1.00 0.00 ? 85  ARG A HG3  2  
ATOM   2673  H HD2  . ARG A 1 85  ? 13.353  10.843  1.252   1.00 0.00 ? 85  ARG A HD2  2  
ATOM   2674  H HD3  . ARG A 1 85  ? 13.517  10.463  -0.450  1.00 0.00 ? 85  ARG A HD3  2  
ATOM   2675  H HE   . ARG A 1 85  ? 13.992  13.027  0.758   1.00 0.00 ? 85  ARG A HE   2  
ATOM   2676  H HH11 . ARG A 1 85  ? 12.604  11.592  -2.139  1.00 0.00 ? 85  ARG A HH11 2  
ATOM   2677  H HH12 . ARG A 1 85  ? 12.922  12.975  -3.132  1.00 0.00 ? 85  ARG A HH12 2  
ATOM   2678  H HH21 . ARG A 1 85  ? 14.411  14.853  -0.550  1.00 0.00 ? 85  ARG A HH21 2  
ATOM   2679  H HH22 . ARG A 1 85  ? 13.956  14.843  -2.222  1.00 0.00 ? 85  ARG A HH22 2  
ATOM   2680  N N    . THR A 1 86  ? 7.368   9.639   -0.639  1.00 0.00 ? 86  THR A N    2  
ATOM   2681  C CA   . THR A 1 86  ? 6.368   9.787   -1.682  1.00 0.00 ? 86  THR A CA   2  
ATOM   2682  C C    . THR A 1 86  ? 6.002   11.261  -1.864  1.00 0.00 ? 86  THR A C    2  
ATOM   2683  O O    . THR A 1 86  ? 6.124   11.804  -2.962  1.00 0.00 ? 86  THR A O    2  
ATOM   2684  C CB   . THR A 1 86  ? 5.174   8.904   -1.321  1.00 0.00 ? 86  THR A CB   2  
ATOM   2685  O OG1  . THR A 1 86  ? 5.542   7.610   -1.796  1.00 0.00 ? 86  THR A OG1  2  
ATOM   2686  C CG2  . THR A 1 86  ? 3.921   9.255   -2.127  1.00 0.00 ? 86  THR A CG2  2  
ATOM   2687  H H    . THR A 1 86  ? 7.002   9.468   0.276   1.00 0.00 ? 86  THR A H    2  
ATOM   2688  H HA   . THR A 1 86  ? 6.802   9.447   -2.623  1.00 0.00 ? 86  THR A HA   2  
ATOM   2689  H HB   . THR A 1 86  ? 4.971   8.941   -0.251  1.00 0.00 ? 86  THR A HB   2  
ATOM   2690  H HG1  . THR A 1 86  ? 6.531   7.490   -1.726  1.00 0.00 ? 86  THR A HG1  2  
ATOM   2691  H HG21 . THR A 1 86  ? 3.452   8.339   -2.487  1.00 0.00 ? 86  THR A HG21 2  
ATOM   2692  H HG22 . THR A 1 86  ? 3.221   9.796   -1.492  1.00 0.00 ? 86  THR A HG22 2  
ATOM   2693  H HG23 . THR A 1 86  ? 4.200   9.879   -2.976  1.00 0.00 ? 86  THR A HG23 2  
ATOM   2694  N N    . SER A 1 87  ? 5.562   11.867  -0.771  1.00 0.00 ? 87  SER A N    2  
ATOM   2695  C CA   . SER A 1 87  ? 5.176   13.269  -0.795  1.00 0.00 ? 87  SER A CA   2  
ATOM   2696  C C    . SER A 1 87  ? 4.734   13.664  -2.205  1.00 0.00 ? 87  SER A C    2  
ATOM   2697  O O    . SER A 1 87  ? 5.464   14.352  -2.918  1.00 0.00 ? 87  SER A O    2  
ATOM   2698  C CB   . SER A 1 87  ? 6.326   14.163  -0.329  1.00 0.00 ? 87  SER A CB   2  
ATOM   2699  O OG   . SER A 1 87  ? 6.170   14.565  1.030   1.00 0.00 ? 87  SER A OG   2  
ATOM   2700  H H    . SER A 1 87  ? 5.467   11.418  0.118   1.00 0.00 ? 87  SER A H    2  
ATOM   2701  H HA   . SER A 1 87  ? 4.344   13.351  -0.096  1.00 0.00 ? 87  SER A HA   2  
ATOM   2702  H HB2  . SER A 1 87  ? 7.270   13.632  -0.444  1.00 0.00 ? 87  SER A HB2  2  
ATOM   2703  H HB3  . SER A 1 87  ? 6.378   15.048  -0.964  1.00 0.00 ? 87  SER A HB3  2  
ATOM   2704  H HG   . SER A 1 87  ? 6.280   15.556  1.109   1.00 0.00 ? 87  SER A HG   2  
ATOM   2705  N N    . SER A 1 88  ? 3.541   13.213  -2.566  1.00 0.00 ? 88  SER A N    2  
ATOM   2706  C CA   . SER A 1 88  ? 2.994   13.513  -3.879  1.00 0.00 ? 88  SER A CA   2  
ATOM   2707  C C    . SER A 1 88  ? 2.005   12.421  -4.294  1.00 0.00 ? 88  SER A C    2  
ATOM   2708  O O    . SER A 1 88  ? 0.811   12.681  -4.435  1.00 0.00 ? 88  SER A O    2  
ATOM   2709  C CB   . SER A 1 88  ? 4.104   13.646  -4.922  1.00 0.00 ? 88  SER A CB   2  
ATOM   2710  O OG   . SER A 1 88  ? 4.570   14.988  -5.036  1.00 0.00 ? 88  SER A OG   2  
ATOM   2711  H H    . SER A 1 88  ? 2.955   12.654  -1.981  1.00 0.00 ? 88  SER A H    2  
ATOM   2712  H HA   . SER A 1 88  ? 2.484   14.469  -3.768  1.00 0.00 ? 88  SER A HA   2  
ATOM   2713  H HB2  . SER A 1 88  ? 4.936   12.996  -4.652  1.00 0.00 ? 88  SER A HB2  2  
ATOM   2714  H HB3  . SER A 1 88  ? 3.737   13.307  -5.890  1.00 0.00 ? 88  SER A HB3  2  
ATOM   2715  H HG   . SER A 1 88  ? 4.994   15.127  -5.931  1.00 0.00 ? 88  SER A HG   2  
ATOM   2716  N N    . VAL A 1 89  ? 2.538   11.223  -4.478  1.00 0.00 ? 89  VAL A N    2  
ATOM   2717  C CA   . VAL A 1 89  ? 1.717   10.091  -4.875  1.00 0.00 ? 89  VAL A CA   2  
ATOM   2718  C C    . VAL A 1 89  ? 2.426   8.792   -4.483  1.00 0.00 ? 89  VAL A C    2  
ATOM   2719  O O    . VAL A 1 89  ? 3.633   8.656   -4.674  1.00 0.00 ? 89  VAL A O    2  
ATOM   2720  C CB   . VAL A 1 89  ? 1.400   10.173  -6.369  1.00 0.00 ? 89  VAL A CB   2  
ATOM   2721  C CG1  . VAL A 1 89  ? 2.601   9.734   -7.209  1.00 0.00 ? 89  VAL A CG1  2  
ATOM   2722  C CG2  . VAL A 1 89  ? 0.160   9.346   -6.712  1.00 0.00 ? 89  VAL A CG2  2  
ATOM   2723  H H    . VAL A 1 89  ? 3.511   11.018  -4.362  1.00 0.00 ? 89  VAL A H    2  
ATOM   2724  H HA   . VAL A 1 89  ? 0.778   10.157  -4.325  1.00 0.00 ? 89  VAL A HA   2  
ATOM   2725  H HB   . VAL A 1 89  ? 1.184   11.213  -6.610  1.00 0.00 ? 89  VAL A HB   2  
ATOM   2726  H HG11 . VAL A 1 89  ? 2.844   8.695   -6.981  1.00 0.00 ? 89  VAL A HG11 2  
ATOM   2727  H HG12 . VAL A 1 89  ? 2.355   9.826   -8.268  1.00 0.00 ? 89  VAL A HG12 2  
ATOM   2728  H HG13 . VAL A 1 89  ? 3.457   10.367  -6.977  1.00 0.00 ? 89  VAL A HG13 2  
ATOM   2729  H HG21 . VAL A 1 89  ? 0.248   8.355   -6.265  1.00 0.00 ? 89  VAL A HG21 2  
ATOM   2730  H HG22 . VAL A 1 89  ? -0.729  9.844   -6.320  1.00 0.00 ? 89  VAL A HG22 2  
ATOM   2731  H HG23 . VAL A 1 89  ? 0.074   9.250   -7.793  1.00 0.00 ? 89  VAL A HG23 2  
ATOM   2732  N N    . VAL A 1 90  ? 1.644   7.869   -3.943  1.00 0.00 ? 90  VAL A N    2  
ATOM   2733  C CA   . VAL A 1 90  ? 2.180   6.584   -3.524  1.00 0.00 ? 90  VAL A CA   2  
ATOM   2734  C C    . VAL A 1 90  ? 1.518   5.470   -4.337  1.00 0.00 ? 90  VAL A C    2  
ATOM   2735  O O    . VAL A 1 90  ? 0.398   5.057   -4.034  1.00 0.00 ? 90  VAL A O    2  
ATOM   2736  C CB   . VAL A 1 90  ? 2.002   6.411   -2.016  1.00 0.00 ? 90  VAL A CB   2  
ATOM   2737  C CG1  . VAL A 1 90  ? 3.356   6.271   -1.316  1.00 0.00 ? 90  VAL A CG1  2  
ATOM   2738  C CG2  . VAL A 1 90  ? 1.194   7.566   -1.422  1.00 0.00 ? 90  VAL A CG2  2  
ATOM   2739  H H    . VAL A 1 90  ? 0.661   7.987   -3.792  1.00 0.00 ? 90  VAL A H    2  
ATOM   2740  H HA   . VAL A 1 90  ? 3.249   6.588   -3.740  1.00 0.00 ? 90  VAL A HA   2  
ATOM   2741  H HB   . VAL A 1 90  ? 1.442   5.490   -1.848  1.00 0.00 ? 90  VAL A HB   2  
ATOM   2742  H HG11 . VAL A 1 90  ? 4.118   6.005   -2.049  1.00 0.00 ? 90  VAL A HG11 2  
ATOM   2743  H HG12 . VAL A 1 90  ? 3.620   7.217   -0.844  1.00 0.00 ? 90  VAL A HG12 2  
ATOM   2744  H HG13 . VAL A 1 90  ? 3.295   5.492   -0.557  1.00 0.00 ? 90  VAL A HG13 2  
ATOM   2745  H HG21 . VAL A 1 90  ? 0.197   7.577   -1.862  1.00 0.00 ? 90  VAL A HG21 2  
ATOM   2746  H HG22 . VAL A 1 90  ? 1.115   7.437   -0.342  1.00 0.00 ? 90  VAL A HG22 2  
ATOM   2747  H HG23 . VAL A 1 90  ? 1.696   8.510   -1.638  1.00 0.00 ? 90  VAL A HG23 2  
ATOM   2748  N N    . THR A 1 91  ? 2.235   5.015   -5.354  1.00 0.00 ? 91  THR A N    2  
ATOM   2749  C CA   . THR A 1 91  ? 1.731   3.957   -6.212  1.00 0.00 ? 91  THR A CA   2  
ATOM   2750  C C    . THR A 1 91  ? 2.209   2.592   -5.711  1.00 0.00 ? 91  THR A C    2  
ATOM   2751  O O    . THR A 1 91  ? 3.386   2.256   -5.844  1.00 0.00 ? 91  THR A O    2  
ATOM   2752  C CB   . THR A 1 91  ? 2.164   4.264   -7.647  1.00 0.00 ? 91  THR A CB   2  
ATOM   2753  O OG1  . THR A 1 91  ? 3.433   4.894   -7.499  1.00 0.00 ? 91  THR A OG1  2  
ATOM   2754  C CG2  . THR A 1 91  ? 1.291   5.335   -8.304  1.00 0.00 ? 91  THR A CG2  2  
ATOM   2755  H H    . THR A 1 91  ? 3.145   5.357   -5.593  1.00 0.00 ? 91  THR A H    2  
ATOM   2756  H HA   . THR A 1 91  ? 0.643   3.955   -6.152  1.00 0.00 ? 91  THR A HA   2  
ATOM   2757  H HB   . THR A 1 91  ? 2.187   3.356   -8.248  1.00 0.00 ? 91  THR A HB   2  
ATOM   2758  H HG1  . THR A 1 91  ? 3.316   5.883   -7.411  1.00 0.00 ? 91  THR A HG1  2  
ATOM   2759  H HG21 . THR A 1 91  ? 1.923   6.041   -8.843  1.00 0.00 ? 91  THR A HG21 2  
ATOM   2760  H HG22 . THR A 1 91  ? 0.599   4.863   -9.002  1.00 0.00 ? 91  THR A HG22 2  
ATOM   2761  H HG23 . THR A 1 91  ? 0.727   5.866   -7.536  1.00 0.00 ? 91  THR A HG23 2  
ATOM   2762  N N    . LEU A 1 92  ? 1.274   1.841   -5.149  1.00 0.00 ? 92  LEU A N    2  
ATOM   2763  C CA   . LEU A 1 92  ? 1.585   0.521   -4.630  1.00 0.00 ? 92  LEU A CA   2  
ATOM   2764  C C    . LEU A 1 92  ? 0.527   -0.474  -5.109  1.00 0.00 ? 92  LEU A C    2  
ATOM   2765  O O    . LEU A 1 92  ? -0.615  -0.095  -5.362  1.00 0.00 ? 92  LEU A O    2  
ATOM   2766  C CB   . LEU A 1 92  ? 1.743   0.567   -3.109  1.00 0.00 ? 92  LEU A CB   2  
ATOM   2767  C CG   . LEU A 1 92  ? 1.563   1.939   -2.457  1.00 0.00 ? 92  LEU A CG   2  
ATOM   2768  C CD1  . LEU A 1 92  ? 1.358   1.806   -0.946  1.00 0.00 ? 92  LEU A CD1  2  
ATOM   2769  C CD2  . LEU A 1 92  ? 2.730   2.867   -2.798  1.00 0.00 ? 92  LEU A CD2  2  
ATOM   2770  H H    . LEU A 1 92  ? 0.320   2.122   -5.046  1.00 0.00 ? 92  LEU A H    2  
ATOM   2771  H HA   . LEU A 1 92  ? 2.550   0.226   -5.045  1.00 0.00 ? 92  LEU A HA   2  
ATOM   2772  H HB2  . LEU A 1 92  ? 1.021   -0.121  -2.668  1.00 0.00 ? 92  LEU A HB2  2  
ATOM   2773  H HB3  . LEU A 1 92  ? 2.735   0.195   -2.855  1.00 0.00 ? 92  LEU A HB3  2  
ATOM   2774  H HG   . LEU A 1 92  ? 0.661   2.396   -2.865  1.00 0.00 ? 92  LEU A HG   2  
ATOM   2775  H HD11 . LEU A 1 92  ? 1.662   2.731   -0.456  1.00 0.00 ? 92  LEU A HD11 2  
ATOM   2776  H HD12 . LEU A 1 92  ? 0.305   1.613   -0.738  1.00 0.00 ? 92  LEU A HD12 2  
ATOM   2777  H HD13 . LEU A 1 92  ? 1.960   0.981   -0.570  1.00 0.00 ? 92  LEU A HD13 2  
ATOM   2778  H HD21 . LEU A 1 92  ? 3.605   2.269   -3.056  1.00 0.00 ? 92  LEU A HD21 2  
ATOM   2779  H HD22 . LEU A 1 92  ? 2.458   3.497   -3.644  1.00 0.00 ? 92  LEU A HD22 2  
ATOM   2780  H HD23 . LEU A 1 92  ? 2.961   3.493   -1.936  1.00 0.00 ? 92  LEU A HD23 2  
ATOM   2781  N N    . GLU A 1 93  ? 0.944   -1.726  -5.217  1.00 0.00 ? 93  GLU A N    2  
ATOM   2782  C CA   . GLU A 1 93  ? 0.044   -2.779  -5.662  1.00 0.00 ? 93  GLU A CA   2  
ATOM   2783  C C    . GLU A 1 93  ? -0.491  -3.560  -4.461  1.00 0.00 ? 93  GLU A C    2  
ATOM   2784  O O    . GLU A 1 93  ? 0.283   -4.035  -3.631  1.00 0.00 ? 93  GLU A O    2  
ATOM   2785  C CB   . GLU A 1 93  ? 0.740   -3.709  -6.657  1.00 0.00 ? 93  GLU A CB   2  
ATOM   2786  C CG   . GLU A 1 93  ? -0.190  -4.846  -7.087  1.00 0.00 ? 93  GLU A CG   2  
ATOM   2787  C CD   . GLU A 1 93  ? 0.216   -5.399  -8.455  1.00 0.00 ? 93  GLU A CD   2  
ATOM   2788  O OE1  . GLU A 1 93  ? 0.517   -4.567  -9.336  1.00 0.00 ? 93  GLU A OE1  2  
ATOM   2789  O OE2  . GLU A 1 93  ? 0.217   -6.643  -8.586  1.00 0.00 ? 93  GLU A OE2  2  
ATOM   2790  H H    . GLU A 1 93  ? 1.874   -2.027  -5.009  1.00 0.00 ? 93  GLU A H    2  
ATOM   2791  H HA   . GLU A 1 93  ? -0.775  -2.266  -6.165  1.00 0.00 ? 93  GLU A HA   2  
ATOM   2792  H HB2  . GLU A 1 93  ? 1.055   -3.142  -7.532  1.00 0.00 ? 93  GLU A HB2  2  
ATOM   2793  H HB3  . GLU A 1 93  ? 1.641   -4.125  -6.205  1.00 0.00 ? 93  GLU A HB3  2  
ATOM   2794  H HG2  . GLU A 1 93  ? -0.163  -5.643  -6.345  1.00 0.00 ? 93  GLU A HG2  2  
ATOM   2795  H HG3  . GLU A 1 93  ? -1.218  -4.484  -7.128  1.00 0.00 ? 93  GLU A HG3  2  
ATOM   2796  N N    . VAL A 1 94  ? -1.810  -3.670  -4.407  1.00 0.00 ? 94  VAL A N    2  
ATOM   2797  C CA   . VAL A 1 94  ? -2.458  -4.387  -3.323  1.00 0.00 ? 94  VAL A CA   2  
ATOM   2798  C C    . VAL A 1 94  ? -3.394  -5.449  -3.905  1.00 0.00 ? 94  VAL A C    2  
ATOM   2799  O O    . VAL A 1 94  ? -3.676  -5.443  -5.102  1.00 0.00 ? 94  VAL A O    2  
ATOM   2800  C CB   . VAL A 1 94  ? -3.175  -3.401  -2.398  1.00 0.00 ? 94  VAL A CB   2  
ATOM   2801  C CG1  . VAL A 1 94  ? -2.249  -2.251  -1.999  1.00 0.00 ? 94  VAL A CG1  2  
ATOM   2802  C CG2  . VAL A 1 94  ? -4.455  -2.871  -3.050  1.00 0.00 ? 94  VAL A CG2  2  
ATOM   2803  H H    . VAL A 1 94  ? -2.432  -3.281  -5.088  1.00 0.00 ? 94  VAL A H    2  
ATOM   2804  H HA   . VAL A 1 94  ? -1.679  -4.885  -2.745  1.00 0.00 ? 94  VAL A HA   2  
ATOM   2805  H HB   . VAL A 1 94  ? -3.458  -3.936  -1.491  1.00 0.00 ? 94  VAL A HB   2  
ATOM   2806  H HG11 . VAL A 1 94  ? -2.831  -1.337  -1.883  1.00 0.00 ? 94  VAL A HG11 2  
ATOM   2807  H HG12 . VAL A 1 94  ? -1.757  -2.492  -1.056  1.00 0.00 ? 94  VAL A HG12 2  
ATOM   2808  H HG13 . VAL A 1 94  ? -1.496  -2.105  -2.773  1.00 0.00 ? 94  VAL A HG13 2  
ATOM   2809  H HG21 . VAL A 1 94  ? -4.649  -1.858  -2.699  1.00 0.00 ? 94  VAL A HG21 2  
ATOM   2810  H HG22 . VAL A 1 94  ? -4.336  -2.865  -4.133  1.00 0.00 ? 94  VAL A HG22 2  
ATOM   2811  H HG23 . VAL A 1 94  ? -5.293  -3.515  -2.780  1.00 0.00 ? 94  VAL A HG23 2  
ATOM   2812  N N    . ALA A 1 95  ? -3.848  -6.334  -3.031  1.00 0.00 ? 95  ALA A N    2  
ATOM   2813  C CA   . ALA A 1 95  ? -4.745  -7.400  -3.443  1.00 0.00 ? 95  ALA A CA   2  
ATOM   2814  C C    . ALA A 1 95  ? -5.836  -7.581  -2.386  1.00 0.00 ? 95  ALA A C    2  
ATOM   2815  O O    . ALA A 1 95  ? -5.539  -7.759  -1.206  1.00 0.00 ? 95  ALA A O    2  
ATOM   2816  C CB   . ALA A 1 95  ? -3.943  -8.681  -3.678  1.00 0.00 ? 95  ALA A CB   2  
ATOM   2817  H H    . ALA A 1 95  ? -3.614  -6.332  -2.060  1.00 0.00 ? 95  ALA A H    2  
ATOM   2818  H HA   . ALA A 1 95  ? -5.208  -7.100  -4.384  1.00 0.00 ? 95  ALA A HA   2  
ATOM   2819  H HB1  . ALA A 1 95  ? -3.005  -8.628  -3.126  1.00 0.00 ? 95  ALA A HB1  2  
ATOM   2820  H HB2  . ALA A 1 95  ? -4.520  -9.539  -3.333  1.00 0.00 ? 95  ALA A HB2  2  
ATOM   2821  H HB3  . ALA A 1 95  ? -3.734  -8.790  -4.743  1.00 0.00 ? 95  ALA A HB3  2  
ATOM   2822  N N    . LYS A 1 96  ? -7.078  -7.528  -2.847  1.00 0.00 ? 96  LYS A N    2  
ATOM   2823  C CA   . LYS A 1 96  ? -8.214  -7.684  -1.955  1.00 0.00 ? 96  LYS A CA   2  
ATOM   2824  C C    . LYS A 1 96  ? -7.983  -8.893  -1.048  1.00 0.00 ? 96  LYS A C    2  
ATOM   2825  O O    . LYS A 1 96  ? -7.310  -9.846  -1.439  1.00 0.00 ? 96  LYS A O    2  
ATOM   2826  C CB   . LYS A 1 96  ? -9.517  -7.754  -2.755  1.00 0.00 ? 96  LYS A CB   2  
ATOM   2827  C CG   . LYS A 1 96  ? -10.298 -6.442  -2.646  1.00 0.00 ? 96  LYS A CG   2  
ATOM   2828  C CD   . LYS A 1 96  ? -11.518 -6.605  -1.736  1.00 0.00 ? 96  LYS A CD   2  
ATOM   2829  C CE   . LYS A 1 96  ? -11.746 -5.348  -0.894  1.00 0.00 ? 96  LYS A CE   2  
ATOM   2830  N NZ   . LYS A 1 96  ? -12.566 -5.663  0.297   1.00 0.00 ? 96  LYS A NZ   2  
ATOM   2831  H H    . LYS A 1 96  ? -7.312  -7.383  -3.809  1.00 0.00 ? 96  LYS A H    2  
ATOM   2832  H HA   . LYS A 1 96  ? -8.266  -6.790  -1.332  1.00 0.00 ? 96  LYS A HA   2  
ATOM   2833  H HB2  . LYS A 1 96  ? -9.295  -7.963  -3.801  1.00 0.00 ? 96  LYS A HB2  2  
ATOM   2834  H HB3  . LYS A 1 96  ? -10.128 -8.577  -2.388  1.00 0.00 ? 96  LYS A HB3  2  
ATOM   2835  H HG2  . LYS A 1 96  ? -9.649  -5.660  -2.253  1.00 0.00 ? 96  LYS A HG2  2  
ATOM   2836  H HG3  . LYS A 1 96  ? -10.620 -6.122  -3.637  1.00 0.00 ? 96  LYS A HG3  2  
ATOM   2837  H HD2  . LYS A 1 96  ? -12.402 -6.808  -2.340  1.00 0.00 ? 96  LYS A HD2  2  
ATOM   2838  H HD3  . LYS A 1 96  ? -11.376 -7.465  -1.082  1.00 0.00 ? 96  LYS A HD3  2  
ATOM   2839  H HE2  . LYS A 1 96  ? -10.788 -4.932  -0.584  1.00 0.00 ? 96  LYS A HE2  2  
ATOM   2840  H HE3  . LYS A 1 96  ? -12.244 -4.587  -1.493  1.00 0.00 ? 96  LYS A HE3  2  
ATOM   2841  H HZ1  . LYS A 1 96  ? -13.000 -4.828  0.634   1.00 0.00 ? 96  LYS A HZ1  2  
ATOM   2842  H HZ2  . LYS A 1 96  ? -13.269 -6.329  0.051   1.00 0.00 ? 96  LYS A HZ2  2  
ATOM   2843  H HZ3  . LYS A 1 96  ? -11.980 -6.046  1.012   1.00 0.00 ? 96  LYS A HZ3  2  
ATOM   2844  N N    . GLN A 1 97  ? -8.555  -8.817  0.145   1.00 0.00 ? 97  GLN A N    2  
ATOM   2845  C CA   . GLN A 1 97  ? -8.422  -9.893  1.110   1.00 0.00 ? 97  GLN A CA   2  
ATOM   2846  C C    . GLN A 1 97  ? -8.885  -9.430  2.493   1.00 0.00 ? 97  GLN A C    2  
ATOM   2847  O O    . GLN A 1 97  ? -8.821  -8.242  2.805   1.00 0.00 ? 97  GLN A O    2  
ATOM   2848  C CB   . GLN A 1 97  ? -6.983  -10.410 1.159   1.00 0.00 ? 97  GLN A CB   2  
ATOM   2849  C CG   . GLN A 1 97  ? -6.895  -11.842 0.628   1.00 0.00 ? 97  GLN A CG   2  
ATOM   2850  C CD   . GLN A 1 97  ? -5.554  -12.483 0.994   1.00 0.00 ? 97  GLN A CD   2  
ATOM   2851  O OE1  . GLN A 1 97  ? -4.726  -12.778 0.148   1.00 0.00 ? 97  GLN A OE1  2  
ATOM   2852  N NE2  . GLN A 1 97  ? -5.387  -12.679 2.299   1.00 0.00 ? 97  GLN A NE2  2  
ATOM   2853  H H    . GLN A 1 97  ? -9.103  -8.038  0.453   1.00 0.00 ? 97  GLN A H    2  
ATOM   2854  H HA   . GLN A 1 97  ? -9.074  -10.689 0.748   1.00 0.00 ? 97  GLN A HA   2  
ATOM   2855  H HB2  . GLN A 1 97  ? -6.339  -9.759  0.567   1.00 0.00 ? 97  GLN A HB2  2  
ATOM   2856  H HB3  . GLN A 1 97  ? -6.614  -10.376 2.184   1.00 0.00 ? 97  GLN A HB3  2  
ATOM   2857  H HG2  . GLN A 1 97  ? -7.710  -12.437 1.038   1.00 0.00 ? 97  GLN A HG2  2  
ATOM   2858  H HG3  . GLN A 1 97  ? -7.016  -11.839 -0.456  1.00 0.00 ? 97  GLN A HG3  2  
ATOM   2859  H HE21 . GLN A 1 97  ? -6.106  -12.413 2.942   1.00 0.00 ? 97  GLN A HE21 2  
ATOM   2860  H HE22 . GLN A 1 97  ? -4.541  -13.091 2.638   1.00 0.00 ? 97  GLN A HE22 2  
ATOM   2861  N N    . GLY A 1 98  ? -9.342  -10.390 3.282   1.00 0.00 ? 98  GLY A N    2  
ATOM   2862  C CA   . GLY A 1 98  ? -9.814  -10.095 4.624   1.00 0.00 ? 98  GLY A CA   2  
ATOM   2863  C C    . GLY A 1 98  ? -10.819 -8.940  4.608   1.00 0.00 ? 98  GLY A C    2  
ATOM   2864  O O    . GLY A 1 98  ? -11.633 -8.831  3.691   1.00 0.00 ? 98  GLY A O    2  
ATOM   2865  H H    . GLY A 1 98  ? -9.390  -11.354 3.019   1.00 0.00 ? 98  GLY A H    2  
ATOM   2866  H HA2  . GLY A 1 98  ? -10.281 -10.981 5.051   1.00 0.00 ? 98  GLY A HA2  2  
ATOM   2867  H HA3  . GLY A 1 98  ? -8.969  -9.838  5.263   1.00 0.00 ? 98  GLY A HA3  2  
ATOM   2868  N N    . ALA A 1 99  ? -10.730 -8.106  5.633   1.00 0.00 ? 99  ALA A N    2  
ATOM   2869  C CA   . ALA A 1 99  ? -11.620 -6.964  5.750   1.00 0.00 ? 99  ALA A CA   2  
ATOM   2870  C C    . ALA A 1 99  ? -11.163 -6.083  6.915   1.00 0.00 ? 99  ALA A C    2  
ATOM   2871  O O    . ALA A 1 99  ? -10.144 -6.359  7.544   1.00 0.00 ? 99  ALA A O    2  
ATOM   2872  C CB   . ALA A 1 99  ? -13.059 -7.453  5.919   1.00 0.00 ? 99  ALA A CB   2  
ATOM   2873  H H    . ALA A 1 99  ? -10.066 -8.202  6.375   1.00 0.00 ? 99  ALA A H    2  
ATOM   2874  H HA   . ALA A 1 99  ? -11.548 -6.392  4.824   1.00 0.00 ? 99  ALA A HA   2  
ATOM   2875  H HB1  . ALA A 1 99  ? -13.729 -6.597  5.986   1.00 0.00 ? 99  ALA A HB1  2  
ATOM   2876  H HB2  . ALA A 1 99  ? -13.339 -8.066  5.060   1.00 0.00 ? 99  ALA A HB2  2  
ATOM   2877  H HB3  . ALA A 1 99  ? -13.136 -8.048  6.829   1.00 0.00 ? 99  ALA A HB3  2  
ATOM   2878  N N    . ILE A 1 100 ? -11.941 -5.041  7.167   1.00 0.00 ? 100 ILE A N    2  
ATOM   2879  C CA   . ILE A 1 100 ? -11.629 -4.117  8.245   1.00 0.00 ? 100 ILE A CA   2  
ATOM   2880  C C    . ILE A 1 100 ? -11.323 -4.910  9.516   1.00 0.00 ? 100 ILE A C    2  
ATOM   2881  O O    . ILE A 1 100 ? -10.165 -5.021  9.920   1.00 0.00 ? 100 ILE A O    2  
ATOM   2882  C CB   . ILE A 1 100 ? -12.753 -3.094  8.415   1.00 0.00 ? 100 ILE A CB   2  
ATOM   2883  C CG1  . ILE A 1 100 ? -12.902 -2.228  7.161   1.00 0.00 ? 100 ILE A CG1  2  
ATOM   2884  C CG2  . ILE A 1 100 ? -12.539 -2.248  9.672   1.00 0.00 ? 100 ILE A CG2  2  
ATOM   2885  C CD1  . ILE A 1 100 ? -14.280 -1.566  7.112   1.00 0.00 ? 100 ILE A CD1  2  
ATOM   2886  H H    . ILE A 1 100 ? -12.769 -4.822  6.650   1.00 0.00 ? 100 ILE A H    2  
ATOM   2887  H HA   . ILE A 1 100 ? -10.734 -3.568  7.954   1.00 0.00 ? 100 ILE A HA   2  
ATOM   2888  H HB   . ILE A 1 100 ? -13.691 -3.633  8.546   1.00 0.00 ? 100 ILE A HB   2  
ATOM   2889  H HG12 . ILE A 1 100 ? -12.125 -1.463  7.150   1.00 0.00 ? 100 ILE A HG12 2  
ATOM   2890  H HG13 . ILE A 1 100 ? -12.758 -2.843  6.273   1.00 0.00 ? 100 ILE A HG13 2  
ATOM   2891  H HG21 . ILE A 1 100 ? -11.711 -2.659  10.250  1.00 0.00 ? 100 ILE A HG21 2  
ATOM   2892  H HG22 . ILE A 1 100 ? -12.308 -1.222  9.386   1.00 0.00 ? 100 ILE A HG22 2  
ATOM   2893  H HG23 . ILE A 1 100 ? -13.446 -2.260  10.277  1.00 0.00 ? 100 ILE A HG23 2  
ATOM   2894  H HD11 . ILE A 1 100 ? -14.175 -0.539  6.761   1.00 0.00 ? 100 ILE A HD11 2  
ATOM   2895  H HD12 . ILE A 1 100 ? -14.925 -2.120  6.430   1.00 0.00 ? 100 ILE A HD12 2  
ATOM   2896  H HD13 . ILE A 1 100 ? -14.718 -1.565  8.111   1.00 0.00 ? 100 ILE A HD13 2  
ATOM   2897  N N    . TYR A 1 101 ? -12.380 -5.442  10.114  1.00 0.00 ? 101 TYR A N    2  
ATOM   2898  C CA   . TYR A 1 101 ? -12.237 -6.222  11.331  1.00 0.00 ? 101 TYR A CA   2  
ATOM   2899  C C    . TYR A 1 101 ? -13.505 -7.032  11.615  1.00 0.00 ? 101 TYR A C    2  
ATOM   2900  O O    . TYR A 1 101 ? -13.655 -8.149  11.123  1.00 0.00 ? 101 TYR A O    2  
ATOM   2901  C CB   . TYR A 1 101 ? -12.031 -5.210  12.459  1.00 0.00 ? 101 TYR A CB   2  
ATOM   2902  C CG   . TYR A 1 101 ? -11.177 -5.732  13.616  1.00 0.00 ? 101 TYR A CG   2  
ATOM   2903  C CD1  . TYR A 1 101 ? -9.876  -6.127  13.390  1.00 0.00 ? 101 TYR A CD1  2  
ATOM   2904  C CD2  . TYR A 1 101 ? -11.712 -5.808  14.887  1.00 0.00 ? 101 TYR A CD2  2  
ATOM   2905  C CE1  . TYR A 1 101 ? -9.073  -6.621  14.480  1.00 0.00 ? 101 TYR A CE1  2  
ATOM   2906  C CE2  . TYR A 1 101 ? -10.908 -6.299  15.978  1.00 0.00 ? 101 TYR A CE2  2  
ATOM   2907  C CZ   . TYR A 1 101 ? -9.628  -6.682  15.719  1.00 0.00 ? 101 TYR A CZ   2  
ATOM   2908  O OH   . TYR A 1 101 ? -8.871  -7.147  16.748  1.00 0.00 ? 101 TYR A OH   2  
ATOM   2909  H H    . TYR A 1 101 ? -13.317 -5.348  9.779   1.00 0.00 ? 101 TYR A H    2  
ATOM   2910  H HA   . TYR A 1 101 ? -11.401 -6.908  11.196  1.00 0.00 ? 101 TYR A HA   2  
ATOM   2911  H HB2  . TYR A 1 101 ? -11.560 -4.316  12.048  1.00 0.00 ? 101 TYR A HB2  2  
ATOM   2912  H HB3  . TYR A 1 101 ? -13.004 -4.907  12.846  1.00 0.00 ? 101 TYR A HB3  2  
ATOM   2913  H HD1  . TYR A 1 101 ? -9.455  -6.069  12.386  1.00 0.00 ? 101 TYR A HD1  2  
ATOM   2914  H HD2  . TYR A 1 101 ? -12.740 -5.495  15.066  1.00 0.00 ? 101 TYR A HD2  2  
ATOM   2915  H HE1  . TYR A 1 101 ? -8.043  -6.936  14.315  1.00 0.00 ? 101 TYR A HE1  2  
ATOM   2916  H HE2  . TYR A 1 101 ? -11.318 -6.365  16.986  1.00 0.00 ? 101 TYR A HE2  2  
ATOM   2917  H HH   . TYR A 1 101 ? -8.537  -8.065  16.539  1.00 0.00 ? 101 TYR A HH   2  
ATOM   2918  N N    . GLY A 1 1   ? 0.673   5.682   -15.516 1.00 0.00 ? 1   GLY A N    3  
ATOM   2919  C CA   . GLY A 1 1   ? -0.371  6.574   -15.044 1.00 0.00 ? 1   GLY A CA   3  
ATOM   2920  C C    . GLY A 1 1   ? -1.751  5.934   -15.200 1.00 0.00 ? 1   GLY A C    3  
ATOM   2921  O O    . GLY A 1 1   ? -2.486  6.257   -16.133 1.00 0.00 ? 1   GLY A O    3  
ATOM   2922  H H1   . GLY A 1 1   ? 0.485   5.231   -16.389 1.00 0.00 ? 1   GLY A H1   3  
ATOM   2923  H HA2  . GLY A 1 1   ? -0.197  6.822   -13.997 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   2924  H HA3  . GLY A 1 1   ? -0.333  7.509   -15.603 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   2925  N N    . PRO A 1 2   ? -2.070  5.015   -14.251 1.00 0.00 ? 2   PRO A N    3  
ATOM   2926  C CA   . PRO A 1 2   ? -3.349  4.326   -14.274 1.00 0.00 ? 2   PRO A CA   3  
ATOM   2927  C C    . PRO A 1 2   ? -4.476  5.250   -13.807 1.00 0.00 ? 2   PRO A C    3  
ATOM   2928  O O    . PRO A 1 2   ? -4.221  6.349   -13.317 1.00 0.00 ? 2   PRO A O    3  
ATOM   2929  C CB   . PRO A 1 2   ? -3.161  3.116   -13.373 1.00 0.00 ? 2   PRO A CB   3  
ATOM   2930  C CG   . PRO A 1 2   ? -1.943  3.420   -12.517 1.00 0.00 ? 2   PRO A CG   3  
ATOM   2931  C CD   . PRO A 1 2   ? -1.223  4.606   -13.133 1.00 0.00 ? 2   PRO A CD   3  
ATOM   2932  H HA   . PRO A 1 2   ? -3.583  4.059   -15.209 1.00 0.00 ? 2   PRO A HA   3  
ATOM   2933  H HB2  . PRO A 1 2   ? -4.043  2.949   -12.754 1.00 0.00 ? 2   PRO A HB2  3  
ATOM   2934  H HB3  . PRO A 1 2   ? -3.008  2.210   -13.962 1.00 0.00 ? 2   PRO A HB3  3  
ATOM   2935  H HG2  . PRO A 1 2   ? -2.244  3.645   -11.493 1.00 0.00 ? 2   PRO A HG2  3  
ATOM   2936  H HG3  . PRO A 1 2   ? -1.283  2.553   -12.471 1.00 0.00 ? 2   PRO A HG3  3  
ATOM   2937  H HD2  . PRO A 1 2   ? -1.103  5.415   -12.412 1.00 0.00 ? 2   PRO A HD2  3  
ATOM   2938  H HD3  . PRO A 1 2   ? -0.223  4.331   -13.473 1.00 0.00 ? 2   PRO A HD3  3  
ATOM   2939  N N    . LEU A 1 3   ? -5.700  4.769   -13.977 1.00 0.00 ? 3   LEU A N    3  
ATOM   2940  C CA   . LEU A 1 3   ? -6.867  5.537   -13.581 1.00 0.00 ? 3   LEU A CA   3  
ATOM   2941  C C    . LEU A 1 3   ? -8.014  4.580   -13.253 1.00 0.00 ? 3   LEU A C    3  
ATOM   2942  O O    . LEU A 1 3   ? -7.853  3.362   -13.328 1.00 0.00 ? 3   LEU A O    3  
ATOM   2943  C CB   . LEU A 1 3   ? -7.217  6.572   -14.652 1.00 0.00 ? 3   LEU A CB   3  
ATOM   2944  C CG   . LEU A 1 3   ? -7.245  6.061   -16.093 1.00 0.00 ? 3   LEU A CG   3  
ATOM   2945  C CD1  . LEU A 1 3   ? -5.852  5.630   -16.551 1.00 0.00 ? 3   LEU A CD1  3  
ATOM   2946  C CD2  . LEU A 1 3   ? -8.277  4.942   -16.258 1.00 0.00 ? 3   LEU A CD2  3  
ATOM   2947  H H    . LEU A 1 3   ? -5.898  3.875   -14.378 1.00 0.00 ? 3   LEU A H    3  
ATOM   2948  H HA   . LEU A 1 3   ? -6.605  6.086   -12.677 1.00 0.00 ? 3   LEU A HA   3  
ATOM   2949  H HB2  . LEU A 1 3   ? -8.195  6.993   -14.416 1.00 0.00 ? 3   LEU A HB2  3  
ATOM   2950  H HB3  . LEU A 1 3   ? -6.496  7.388   -14.590 1.00 0.00 ? 3   LEU A HB3  3  
ATOM   2951  H HG   . LEU A 1 3   ? -7.558  6.881   -16.741 1.00 0.00 ? 3   LEU A HG   3  
ATOM   2952  H HD11 . LEU A 1 3   ? -5.772  5.744   -17.632 1.00 0.00 ? 3   LEU A HD11 3  
ATOM   2953  H HD12 . LEU A 1 3   ? -5.101  6.250   -16.062 1.00 0.00 ? 3   LEU A HD12 3  
ATOM   2954  H HD13 . LEU A 1 3   ? -5.691  4.584   -16.284 1.00 0.00 ? 3   LEU A HD13 3  
ATOM   2955  H HD21 . LEU A 1 3   ? -7.849  4.002   -15.911 1.00 0.00 ? 3   LEU A HD21 3  
ATOM   2956  H HD22 . LEU A 1 3   ? -9.165  5.175   -15.671 1.00 0.00 ? 3   LEU A HD22 3  
ATOM   2957  H HD23 . LEU A 1 3   ? -8.550  4.851   -17.309 1.00 0.00 ? 3   LEU A HD23 3  
ATOM   2958  N N    . GLY A 1 4   ? -9.147  5.166   -12.893 1.00 0.00 ? 4   GLY A N    3  
ATOM   2959  C CA   . GLY A 1 4   ? -10.321 4.380   -12.553 1.00 0.00 ? 4   GLY A CA   3  
ATOM   2960  C C    . GLY A 1 4   ? -10.499 3.212   -13.525 1.00 0.00 ? 4   GLY A C    3  
ATOM   2961  O O    . GLY A 1 4   ? -10.654 3.417   -14.727 1.00 0.00 ? 4   GLY A O    3  
ATOM   2962  H H    . GLY A 1 4   ? -9.269  6.157   -12.834 1.00 0.00 ? 4   GLY A H    3  
ATOM   2963  H HA2  . GLY A 1 4   ? -10.226 4.001   -11.535 1.00 0.00 ? 4   GLY A HA2  3  
ATOM   2964  H HA3  . GLY A 1 4   ? -11.207 5.016   -12.576 1.00 0.00 ? 4   GLY A HA3  3  
ATOM   2965  N N    . SER A 1 5   ? -10.473 2.011   -12.966 1.00 0.00 ? 5   SER A N    3  
ATOM   2966  C CA   . SER A 1 5   ? -10.629 0.808   -13.766 1.00 0.00 ? 5   SER A CA   3  
ATOM   2967  C C    . SER A 1 5   ? -12.026 0.220   -13.559 1.00 0.00 ? 5   SER A C    3  
ATOM   2968  O O    . SER A 1 5   ? -12.911 0.404   -14.393 1.00 0.00 ? 5   SER A O    3  
ATOM   2969  C CB   . SER A 1 5   ? -9.559  -0.229  -13.421 1.00 0.00 ? 5   SER A CB   3  
ATOM   2970  O OG   . SER A 1 5   ? -8.335  0.018   -14.106 1.00 0.00 ? 5   SER A OG   3  
ATOM   2971  H H    . SER A 1 5   ? -10.348 1.852   -11.986 1.00 0.00 ? 5   SER A H    3  
ATOM   2972  H HA   . SER A 1 5   ? -10.500 1.132   -14.800 1.00 0.00 ? 5   SER A HA   3  
ATOM   2973  H HB2  . SER A 1 5   ? -9.381  -0.219  -12.346 1.00 0.00 ? 5   SER A HB2  3  
ATOM   2974  H HB3  . SER A 1 5   ? -9.923  -1.224  -13.675 1.00 0.00 ? 5   SER A HB3  3  
ATOM   2975  H HG   . SER A 1 5   ? -8.066  -0.791  -14.627 1.00 0.00 ? 5   SER A HG   3  
ATOM   2976  N N    . LEU A 1 6   ? -12.180 -0.477  -12.445 1.00 0.00 ? 6   LEU A N    3  
ATOM   2977  C CA   . LEU A 1 6   ? -13.454 -1.095  -12.116 1.00 0.00 ? 6   LEU A CA   3  
ATOM   2978  C C    . LEU A 1 6   ? -13.692 -0.992  -10.608 1.00 0.00 ? 6   LEU A C    3  
ATOM   2979  O O    . LEU A 1 6   ? -13.026 -0.221  -9.921  1.00 0.00 ? 6   LEU A O    3  
ATOM   2980  C CB   . LEU A 1 6   ? -13.509 -2.526  -12.653 1.00 0.00 ? 6   LEU A CB   3  
ATOM   2981  C CG   . LEU A 1 6   ? -14.493 -2.775  -13.798 1.00 0.00 ? 6   LEU A CG   3  
ATOM   2982  C CD1  . LEU A 1 6   ? -14.123 -4.043  -14.573 1.00 0.00 ? 6   LEU A CD1  3  
ATOM   2983  C CD2  . LEU A 1 6   ? -15.934 -2.818  -13.283 1.00 0.00 ? 6   LEU A CD2  3  
ATOM   2984  H H    . LEU A 1 6   ? -11.454 -0.623  -11.772 1.00 0.00 ? 6   LEU A H    3  
ATOM   2985  H HA   . LEU A 1 6   ? -14.232 -0.529  -12.626 1.00 0.00 ? 6   LEU A HA   3  
ATOM   2986  H HB2  . LEU A 1 6   ? -12.511 -2.805  -12.990 1.00 0.00 ? 6   LEU A HB2  3  
ATOM   2987  H HB3  . LEU A 1 6   ? -13.765 -3.192  -11.829 1.00 0.00 ? 6   LEU A HB3  3  
ATOM   2988  H HG   . LEU A 1 6   ? -14.425 -1.940  -14.495 1.00 0.00 ? 6   LEU A HG   3  
ATOM   2989  H HD11 . LEU A 1 6   ? -14.984 -4.709  -14.609 1.00 0.00 ? 6   LEU A HD11 3  
ATOM   2990  H HD12 . LEU A 1 6   ? -13.829 -3.773  -15.588 1.00 0.00 ? 6   LEU A HD12 3  
ATOM   2991  H HD13 . LEU A 1 6   ? -13.294 -4.543  -14.075 1.00 0.00 ? 6   LEU A HD13 3  
ATOM   2992  H HD21 . LEU A 1 6   ? -16.580 -3.249  -14.047 1.00 0.00 ? 6   LEU A HD21 3  
ATOM   2993  H HD22 . LEU A 1 6   ? -15.980 -3.430  -12.383 1.00 0.00 ? 6   LEU A HD22 3  
ATOM   2994  H HD23 . LEU A 1 6   ? -16.269 -1.807  -13.054 1.00 0.00 ? 6   LEU A HD23 3  
ATOM   2995  N N    . ARG A 1 7   ? -14.644 -1.785  -10.137 1.00 0.00 ? 7   ARG A N    3  
ATOM   2996  C CA   . ARG A 1 7   ? -14.976 -1.796  -8.723  1.00 0.00 ? 7   ARG A CA   3  
ATOM   2997  C C    . ARG A 1 7   ? -13.837 -2.415  -7.911  1.00 0.00 ? 7   ARG A C    3  
ATOM   2998  O O    . ARG A 1 7   ? -12.834 -2.849  -8.477  1.00 0.00 ? 7   ARG A O    3  
ATOM   2999  C CB   . ARG A 1 7   ? -16.263 -2.585  -8.466  1.00 0.00 ? 7   ARG A CB   3  
ATOM   3000  C CG   . ARG A 1 7   ? -17.485 -1.822  -8.979  1.00 0.00 ? 7   ARG A CG   3  
ATOM   3001  C CD   . ARG A 1 7   ? -18.139 -1.014  -7.855  1.00 0.00 ? 7   ARG A CD   3  
ATOM   3002  N NE   . ARG A 1 7   ? -17.666 0.388   -7.900  1.00 0.00 ? 7   ARG A NE   3  
ATOM   3003  C CZ   . ARG A 1 7   ? -18.107 1.303   -8.774  1.00 0.00 ? 7   ARG A CZ   3  
ATOM   3004  N NH1  . ARG A 1 7   ? -19.035 0.969   -9.681  1.00 0.00 ? 7   ARG A NH1  3  
ATOM   3005  N NH2  . ARG A 1 7   ? -17.622 2.551   -8.741  1.00 0.00 ? 7   ARG A NH2  3  
ATOM   3006  H H    . ARG A 1 7   ? -15.180 -2.412  -10.702 1.00 0.00 ? 7   ARG A H    3  
ATOM   3007  H HA   . ARG A 1 7   ? -15.119 -0.748  -8.463  1.00 0.00 ? 7   ARG A HA   3  
ATOM   3008  H HB2  . ARG A 1 7   ? -16.203 -3.555  -8.957  1.00 0.00 ? 7   ARG A HB2  3  
ATOM   3009  H HB3  . ARG A 1 7   ? -16.369 -2.775  -7.398  1.00 0.00 ? 7   ARG A HB3  3  
ATOM   3010  H HG2  . ARG A 1 7   ? -17.189 -1.155  -9.787  1.00 0.00 ? 7   ARG A HG2  3  
ATOM   3011  H HG3  . ARG A 1 7   ? -18.209 -2.524  -9.393  1.00 0.00 ? 7   ARG A HG3  3  
ATOM   3012  H HD2  . ARG A 1 7   ? -19.222 -1.044  -7.957  1.00 0.00 ? 7   ARG A HD2  3  
ATOM   3013  H HD3  . ARG A 1 7   ? -17.897 -1.457  -6.889  1.00 0.00 ? 7   ARG A HD3  3  
ATOM   3014  H HE   . ARG A 1 7   ? -16.972 0.671   -7.237  1.00 0.00 ? 7   ARG A HE   3  
ATOM   3015  H HH11 . ARG A 1 7   ? -19.398 0.038   -9.707  1.00 0.00 ? 7   ARG A HH11 3  
ATOM   3016  H HH12 . ARG A 1 7   ? -19.365 1.651   -10.334 1.00 0.00 ? 7   ARG A HH12 3  
ATOM   3017  H HH21 . ARG A 1 7   ? -16.929 2.800   -8.064  1.00 0.00 ? 7   ARG A HH21 3  
ATOM   3018  H HH22 . ARG A 1 7   ? -17.951 3.235   -9.393  1.00 0.00 ? 7   ARG A HH22 3  
ATOM   3019  N N    . LYS A 1 8   ? -14.027 -2.434  -6.601  1.00 0.00 ? 8   LYS A N    3  
ATOM   3020  C CA   . LYS A 1 8   ? -13.027 -2.992  -5.707  1.00 0.00 ? 8   LYS A CA   3  
ATOM   3021  C C    . LYS A 1 8   ? -12.468 -4.280  -6.315  1.00 0.00 ? 8   LYS A C    3  
ATOM   3022  O O    . LYS A 1 8   ? -13.225 -5.134  -6.774  1.00 0.00 ? 8   LYS A O    3  
ATOM   3023  C CB   . LYS A 1 8   ? -13.606 -3.177  -4.304  1.00 0.00 ? 8   LYS A CB   3  
ATOM   3024  C CG   . LYS A 1 8   ? -12.639 -2.656  -3.239  1.00 0.00 ? 8   LYS A CG   3  
ATOM   3025  C CD   . LYS A 1 8   ? -12.520 -1.131  -3.305  1.00 0.00 ? 8   LYS A CD   3  
ATOM   3026  C CE   . LYS A 1 8   ? -11.064 -0.704  -3.512  1.00 0.00 ? 8   LYS A CE   3  
ATOM   3027  N NZ   . LYS A 1 8   ? -11.001 0.687   -4.015  1.00 0.00 ? 8   LYS A NZ   3  
ATOM   3028  H H    . LYS A 1 8   ? -14.845 -2.078  -6.150  1.00 0.00 ? 8   LYS A H    3  
ATOM   3029  H HA   . LYS A 1 8   ? -12.217 -2.267  -5.630  1.00 0.00 ? 8   LYS A HA   3  
ATOM   3030  H HB2  . LYS A 1 8   ? -14.558 -2.649  -4.225  1.00 0.00 ? 8   LYS A HB2  3  
ATOM   3031  H HB3  . LYS A 1 8   ? -13.812 -4.232  -4.126  1.00 0.00 ? 8   LYS A HB3  3  
ATOM   3032  H HG2  . LYS A 1 8   ? -12.986 -2.953  -2.250  1.00 0.00 ? 8   LYS A HG2  3  
ATOM   3033  H HG3  . LYS A 1 8   ? -11.658 -3.107  -3.382  1.00 0.00 ? 8   LYS A HG3  3  
ATOM   3034  H HD2  . LYS A 1 8   ? -13.135 -0.750  -4.120  1.00 0.00 ? 8   LYS A HD2  3  
ATOM   3035  H HD3  . LYS A 1 8   ? -12.905 -0.692  -2.384  1.00 0.00 ? 8   LYS A HD3  3  
ATOM   3036  H HE2  . LYS A 1 8   ? -10.520 -0.782  -2.572  1.00 0.00 ? 8   LYS A HE2  3  
ATOM   3037  H HE3  . LYS A 1 8   ? -10.580 -1.376  -4.220  1.00 0.00 ? 8   LYS A HE3  3  
ATOM   3038  H HZ1  . LYS A 1 8   ? -11.271 0.706   -4.978  1.00 0.00 ? 8   LYS A HZ1  3  
ATOM   3039  H HZ2  . LYS A 1 8   ? -11.621 1.264   -3.484  1.00 0.00 ? 8   LYS A HZ2  3  
ATOM   3040  H HZ3  . LYS A 1 8   ? -10.066 1.031   -3.925  1.00 0.00 ? 8   LYS A HZ3  3  
ATOM   3041  N N    . GLU A 1 9   ? -11.147 -4.378  -6.299  1.00 0.00 ? 9   GLU A N    3  
ATOM   3042  C CA   . GLU A 1 9   ? -10.477 -5.548  -6.843  1.00 0.00 ? 9   GLU A CA   3  
ATOM   3043  C C    . GLU A 1 9   ? -8.966  -5.441  -6.631  1.00 0.00 ? 9   GLU A C    3  
ATOM   3044  O O    . GLU A 1 9   ? -8.435  -4.345  -6.465  1.00 0.00 ? 9   GLU A O    3  
ATOM   3045  C CB   . GLU A 1 9   ? -10.812 -5.732  -8.324  1.00 0.00 ? 9   GLU A CB   3  
ATOM   3046  C CG   . GLU A 1 9   ? -10.145 -4.649  -9.176  1.00 0.00 ? 9   GLU A CG   3  
ATOM   3047  C CD   . GLU A 1 9   ? -10.486 -4.828  -10.656 1.00 0.00 ? 9   GLU A CD   3  
ATOM   3048  O OE1  . GLU A 1 9   ? -11.662 -4.586  -11.001 1.00 0.00 ? 9   GLU A OE1  3  
ATOM   3049  O OE2  . GLU A 1 9   ? -9.561  -5.202  -11.409 1.00 0.00 ? 9   GLU A OE2  3  
ATOM   3050  H H    . GLU A 1 9   ? -10.539 -3.680  -5.925  1.00 0.00 ? 9   GLU A H    3  
ATOM   3051  H HA   . GLU A 1 9   ? -10.871 -6.395  -6.281  1.00 0.00 ? 9   GLU A HA   3  
ATOM   3052  H HB2  . GLU A 1 9   ? -10.481 -6.716  -8.658  1.00 0.00 ? 9   GLU A HB2  3  
ATOM   3053  H HB3  . GLU A 1 9   ? -11.892 -5.695  -8.465  1.00 0.00 ? 9   GLU A HB3  3  
ATOM   3054  H HG2  . GLU A 1 9   ? -10.472 -3.665  -8.840  1.00 0.00 ? 9   GLU A HG2  3  
ATOM   3055  H HG3  . GLU A 1 9   ? -9.063  -4.691  -9.041  1.00 0.00 ? 9   GLU A HG3  3  
ATOM   3056  N N    . PRO A 1 10  ? -8.300  -6.626  -6.644  1.00 0.00 ? 10  PRO A N    3  
ATOM   3057  C CA   . PRO A 1 10  ? -6.859  -6.677  -6.456  1.00 0.00 ? 10  PRO A CA   3  
ATOM   3058  C C    . PRO A 1 10  ? -6.123  -6.210  -7.713  1.00 0.00 ? 10  PRO A C    3  
ATOM   3059  O O    . PRO A 1 10  ? -6.380  -6.710  -8.808  1.00 0.00 ? 10  PRO A O    3  
ATOM   3060  C CB   . PRO A 1 10  ? -6.559  -8.123  -6.095  1.00 0.00 ? 10  PRO A CB   3  
ATOM   3061  C CG   . PRO A 1 10  ? -7.768  -8.924  -6.548  1.00 0.00 ? 10  PRO A CG   3  
ATOM   3062  C CD   . PRO A 1 10  ? -8.895  -7.946  -6.838  1.00 0.00 ? 10  PRO A CD   3  
ATOM   3063  H HA   . PRO A 1 10  ? -6.582  -6.048  -5.728  1.00 0.00 ? 10  PRO A HA   3  
ATOM   3064  H HB2  . PRO A 1 10  ? -5.653  -8.469  -6.591  1.00 0.00 ? 10  PRO A HB2  3  
ATOM   3065  H HB3  . PRO A 1 10  ? -6.397  -8.232  -5.023  1.00 0.00 ? 10  PRO A HB3  3  
ATOM   3066  H HG2  . PRO A 1 10  ? -7.529  -9.506  -7.438  1.00 0.00 ? 10  PRO A HG2  3  
ATOM   3067  H HG3  . PRO A 1 10  ? -8.070  -9.632  -5.775  1.00 0.00 ? 10  PRO A HG3  3  
ATOM   3068  H HD2  . PRO A 1 10  ? -9.271  -8.064  -7.854  1.00 0.00 ? 10  PRO A HD2  3  
ATOM   3069  H HD3  . PRO A 1 10  ? -9.738  -8.101  -6.165  1.00 0.00 ? 10  PRO A HD3  3  
ATOM   3070  N N    . GLU A 1 11  ? -5.226  -5.255  -7.516  1.00 0.00 ? 11  GLU A N    3  
ATOM   3071  C CA   . GLU A 1 11  ? -4.454  -4.716  -8.621  1.00 0.00 ? 11  GLU A CA   3  
ATOM   3072  C C    . GLU A 1 11  ? -3.472  -3.656  -8.116  1.00 0.00 ? 11  GLU A C    3  
ATOM   3073  O O    . GLU A 1 11  ? -3.003  -3.731  -6.980  1.00 0.00 ? 11  GLU A O    3  
ATOM   3074  C CB   . GLU A 1 11  ? -5.370  -4.142  -9.704  1.00 0.00 ? 11  GLU A CB   3  
ATOM   3075  C CG   . GLU A 1 11  ? -4.799  -4.401  -11.099 1.00 0.00 ? 11  GLU A CG   3  
ATOM   3076  C CD   . GLU A 1 11  ? -5.688  -5.367  -11.885 1.00 0.00 ? 11  GLU A CD   3  
ATOM   3077  O OE1  . GLU A 1 11  ? -6.011  -6.431  -11.316 1.00 0.00 ? 11  GLU A OE1  3  
ATOM   3078  O OE2  . GLU A 1 11  ? -6.024  -5.018  -13.038 1.00 0.00 ? 11  GLU A OE2  3  
ATOM   3079  H H    . GLU A 1 11  ? -5.024  -4.854  -6.623  1.00 0.00 ? 11  GLU A H    3  
ATOM   3080  H HA   . GLU A 1 11  ? -3.903  -5.563  -9.031  1.00 0.00 ? 11  GLU A HA   3  
ATOM   3081  H HB2  . GLU A 1 11  ? -6.360  -4.593  -9.623  1.00 0.00 ? 11  GLU A HB2  3  
ATOM   3082  H HB3  . GLU A 1 11  ? -5.494  -3.070  -9.550  1.00 0.00 ? 11  GLU A HB3  3  
ATOM   3083  H HG2  . GLU A 1 11  ? -4.712  -3.459  -11.641 1.00 0.00 ? 11  GLU A HG2  3  
ATOM   3084  H HG3  . GLU A 1 11  ? -3.794  -4.813  -11.014 1.00 0.00 ? 11  GLU A HG3  3  
ATOM   3085  N N    . ILE A 1 12  ? -3.194  -2.692  -8.982  1.00 0.00 ? 12  ILE A N    3  
ATOM   3086  C CA   . ILE A 1 12  ? -2.278  -1.618  -8.636  1.00 0.00 ? 12  ILE A CA   3  
ATOM   3087  C C    . ILE A 1 12  ? -3.078  -0.393  -8.192  1.00 0.00 ? 12  ILE A C    3  
ATOM   3088  O O    . ILE A 1 12  ? -3.867  0.151   -8.964  1.00 0.00 ? 12  ILE A O    3  
ATOM   3089  C CB   . ILE A 1 12  ? -1.318  -1.338  -9.796  1.00 0.00 ? 12  ILE A CB   3  
ATOM   3090  C CG1  . ILE A 1 12  ? -0.390  -0.167  -9.468  1.00 0.00 ? 12  ILE A CG1  3  
ATOM   3091  C CG2  . ILE A 1 12  ? -2.085  -1.114  -11.099 1.00 0.00 ? 12  ILE A CG2  3  
ATOM   3092  C CD1  . ILE A 1 12  ? -0.999  1.159   -9.928  1.00 0.00 ? 12  ILE A CD1  3  
ATOM   3093  H H    . ILE A 1 12  ? -3.580  -2.640  -9.902  1.00 0.00 ? 12  ILE A H    3  
ATOM   3094  H HA   . ILE A 1 12  ? -1.675  -1.961  -7.795  1.00 0.00 ? 12  ILE A HA   3  
ATOM   3095  H HB   . ILE A 1 12  ? -0.690  -2.217  -9.939  1.00 0.00 ? 12  ILE A HB   3  
ATOM   3096  H HG12 . ILE A 1 12  ? -0.205  -0.134  -8.394  1.00 0.00 ? 12  ILE A HG12 3  
ATOM   3097  H HG13 . ILE A 1 12  ? 0.574   -0.317  -9.953  1.00 0.00 ? 12  ILE A HG13 3  
ATOM   3098  H HG21 . ILE A 1 12  ? -2.936  -0.460  -10.913 1.00 0.00 ? 12  ILE A HG21 3  
ATOM   3099  H HG22 . ILE A 1 12  ? -1.426  -0.653  -11.835 1.00 0.00 ? 12  ILE A HG22 3  
ATOM   3100  H HG23 . ILE A 1 12  ? -2.442  -2.072  -11.481 1.00 0.00 ? 12  ILE A HG23 3  
ATOM   3101  H HD11 . ILE A 1 12  ? -0.539  1.980   -9.377  1.00 0.00 ? 12  ILE A HD11 3  
ATOM   3102  H HD12 . ILE A 1 12  ? -0.816  1.292   -10.995 1.00 0.00 ? 12  ILE A HD12 3  
ATOM   3103  H HD13 . ILE A 1 12  ? -2.071  1.152   -9.740  1.00 0.00 ? 12  ILE A HD13 3  
ATOM   3104  N N    . ILE A 1 13  ? -2.850  0.005   -6.949  1.00 0.00 ? 13  ILE A N    3  
ATOM   3105  C CA   . ILE A 1 13  ? -3.541  1.156   -6.393  1.00 0.00 ? 13  ILE A CA   3  
ATOM   3106  C C    . ILE A 1 13  ? -2.555  2.317   -6.250  1.00 0.00 ? 13  ILE A C    3  
ATOM   3107  O O    . ILE A 1 13  ? -1.347  2.103   -6.168  1.00 0.00 ? 13  ILE A O    3  
ATOM   3108  C CB   . ILE A 1 13  ? -4.242  0.779   -5.086  1.00 0.00 ? 13  ILE A CB   3  
ATOM   3109  C CG1  . ILE A 1 13  ? -4.955  -0.570  -5.214  1.00 0.00 ? 13  ILE A CG1  3  
ATOM   3110  C CG2  . ILE A 1 13  ? -5.196  1.890   -4.635  1.00 0.00 ? 13  ILE A CG2  3  
ATOM   3111  C CD1  . ILE A 1 13  ? -6.068  -0.505  -6.260  1.00 0.00 ? 13  ILE A CD1  3  
ATOM   3112  H H    . ILE A 1 13  ? -2.208  -0.444  -6.328  1.00 0.00 ? 13  ILE A H    3  
ATOM   3113  H HA   . ILE A 1 13  ? -4.315  1.446   -7.103  1.00 0.00 ? 13  ILE A HA   3  
ATOM   3114  H HB   . ILE A 1 13  ? -3.486  0.671   -4.310  1.00 0.00 ? 13  ILE A HB   3  
ATOM   3115  H HG12 . ILE A 1 13  ? -4.235  -1.340  -5.492  1.00 0.00 ? 13  ILE A HG12 3  
ATOM   3116  H HG13 . ILE A 1 13  ? -5.373  -0.857  -4.250  1.00 0.00 ? 13  ILE A HG13 3  
ATOM   3117  H HG21 . ILE A 1 13  ? -4.659  2.591   -3.997  1.00 0.00 ? 13  ILE A HG21 3  
ATOM   3118  H HG22 . ILE A 1 13  ? -5.580  2.415   -5.509  1.00 0.00 ? 13  ILE A HG22 3  
ATOM   3119  H HG23 . ILE A 1 13  ? -6.025  1.452   -4.080  1.00 0.00 ? 13  ILE A HG23 3  
ATOM   3120  H HD11 . ILE A 1 13  ? -6.186  0.524   -6.602  1.00 0.00 ? 13  ILE A HD11 3  
ATOM   3121  H HD12 . ILE A 1 13  ? -5.809  -1.141  -7.107  1.00 0.00 ? 13  ILE A HD12 3  
ATOM   3122  H HD13 . ILE A 1 13  ? -7.002  -0.850  -5.820  1.00 0.00 ? 13  ILE A HD13 3  
ATOM   3123  N N    . THR A 1 14  ? -3.109  3.521   -6.222  1.00 0.00 ? 14  THR A N    3  
ATOM   3124  C CA   . THR A 1 14  ? -2.294  4.716   -6.090  1.00 0.00 ? 14  THR A CA   3  
ATOM   3125  C C    . THR A 1 14  ? -2.930  5.689   -5.094  1.00 0.00 ? 14  THR A C    3  
ATOM   3126  O O    . THR A 1 14  ? -4.147  5.869   -5.091  1.00 0.00 ? 14  THR A O    3  
ATOM   3127  C CB   . THR A 1 14  ? -2.101  5.313   -7.484  1.00 0.00 ? 14  THR A CB   3  
ATOM   3128  O OG1  . THR A 1 14  ? -1.539  6.599   -7.238  1.00 0.00 ? 14  THR A OG1  3  
ATOM   3129  C CG2  . THR A 1 14  ? -3.428  5.615   -8.182  1.00 0.00 ? 14  THR A CG2  3  
ATOM   3130  H H    . THR A 1 14  ? -4.093  3.686   -6.289  1.00 0.00 ? 14  THR A H    3  
ATOM   3131  H HA   . THR A 1 14  ? -1.326  4.428   -5.680  1.00 0.00 ? 14  THR A HA   3  
ATOM   3132  H HB   . THR A 1 14  ? -1.475  4.668   -8.101  1.00 0.00 ? 14  THR A HB   3  
ATOM   3133  H HG1  . THR A 1 14  ? -2.223  7.197   -6.821  1.00 0.00 ? 14  THR A HG1  3  
ATOM   3134  H HG21 . THR A 1 14  ? -3.398  5.238   -9.203  1.00 0.00 ? 14  THR A HG21 3  
ATOM   3135  H HG22 . THR A 1 14  ? -4.241  5.131   -7.640  1.00 0.00 ? 14  THR A HG22 3  
ATOM   3136  H HG23 . THR A 1 14  ? -3.594  6.692   -8.198  1.00 0.00 ? 14  THR A HG23 3  
ATOM   3137  N N    . VAL A 1 15  ? -2.079  6.288   -4.276  1.00 0.00 ? 15  VAL A N    3  
ATOM   3138  C CA   . VAL A 1 15  ? -2.544  7.239   -3.279  1.00 0.00 ? 15  VAL A CA   3  
ATOM   3139  C C    . VAL A 1 15  ? -1.757  8.543   -3.418  1.00 0.00 ? 15  VAL A C    3  
ATOM   3140  O O    . VAL A 1 15  ? -0.575  8.599   -3.079  1.00 0.00 ? 15  VAL A O    3  
ATOM   3141  C CB   . VAL A 1 15  ? -2.440  6.622   -1.882  1.00 0.00 ? 15  VAL A CB   3  
ATOM   3142  C CG1  . VAL A 1 15  ? -3.797  6.634   -1.175  1.00 0.00 ? 15  VAL A CG1  3  
ATOM   3143  C CG2  . VAL A 1 15  ? -1.868  5.205   -1.948  1.00 0.00 ? 15  VAL A CG2  3  
ATOM   3144  H H    . VAL A 1 15  ? -1.091  6.136   -4.286  1.00 0.00 ? 15  VAL A H    3  
ATOM   3145  H HA   . VAL A 1 15  ? -3.595  7.439   -3.481  1.00 0.00 ? 15  VAL A HA   3  
ATOM   3146  H HB   . VAL A 1 15  ? -1.752  7.234   -1.297  1.00 0.00 ? 15  VAL A HB   3  
ATOM   3147  H HG11 . VAL A 1 15  ? -4.500  6.013   -1.730  1.00 0.00 ? 15  VAL A HG11 3  
ATOM   3148  H HG12 . VAL A 1 15  ? -3.682  6.241   -0.165  1.00 0.00 ? 15  VAL A HG12 3  
ATOM   3149  H HG13 . VAL A 1 15  ? -4.172  7.657   -1.128  1.00 0.00 ? 15  VAL A HG13 3  
ATOM   3150  H HG21 . VAL A 1 15  ? -1.983  4.721   -0.979  1.00 0.00 ? 15  VAL A HG21 3  
ATOM   3151  H HG22 . VAL A 1 15  ? -2.402  4.634   -2.706  1.00 0.00 ? 15  VAL A HG22 3  
ATOM   3152  H HG23 . VAL A 1 15  ? -0.809  5.251   -2.208  1.00 0.00 ? 15  VAL A HG23 3  
ATOM   3153  N N    . THR A 1 16  ? -2.443  9.560   -3.916  1.00 0.00 ? 16  THR A N    3  
ATOM   3154  C CA   . THR A 1 16  ? -1.823  10.861  -4.104  1.00 0.00 ? 16  THR A CA   3  
ATOM   3155  C C    . THR A 1 16  ? -1.954  11.704  -2.835  1.00 0.00 ? 16  THR A C    3  
ATOM   3156  O O    . THR A 1 16  ? -2.885  11.511  -2.051  1.00 0.00 ? 16  THR A O    3  
ATOM   3157  C CB   . THR A 1 16  ? -2.455  11.513  -5.335  1.00 0.00 ? 16  THR A CB   3  
ATOM   3158  O OG1  . THR A 1 16  ? -2.393  10.500  -6.336  1.00 0.00 ? 16  THR A OG1  3  
ATOM   3159  C CG2  . THR A 1 16  ? -1.601  12.649  -5.900  1.00 0.00 ? 16  THR A CG2  3  
ATOM   3160  H H    . THR A 1 16  ? -3.404  9.507   -4.190  1.00 0.00 ? 16  THR A H    3  
ATOM   3161  H HA   . THR A 1 16  ? -0.757  10.712  -4.278  1.00 0.00 ? 16  THR A HA   3  
ATOM   3162  H HB   . THR A 1 16  ? -3.466  11.858  -5.117  1.00 0.00 ? 16  THR A HB   3  
ATOM   3163  H HG1  . THR A 1 16  ? -3.278  10.040  -6.411  1.00 0.00 ? 16  THR A HG1  3  
ATOM   3164  H HG21 . THR A 1 16  ? -0.785  12.867  -5.211  1.00 0.00 ? 16  THR A HG21 3  
ATOM   3165  H HG22 . THR A 1 16  ? -1.190  12.349  -6.865  1.00 0.00 ? 16  THR A HG22 3  
ATOM   3166  H HG23 . THR A 1 16  ? -2.217  13.539  -6.029  1.00 0.00 ? 16  THR A HG23 3  
ATOM   3167  N N    . LEU A 1 17  ? -1.013  12.620  -2.669  1.00 0.00 ? 17  LEU A N    3  
ATOM   3168  C CA   . LEU A 1 17  ? -1.014  13.492  -1.507  1.00 0.00 ? 17  LEU A CA   3  
ATOM   3169  C C    . LEU A 1 17  ? -1.863  14.728  -1.804  1.00 0.00 ? 17  LEU A C    3  
ATOM   3170  O O    . LEU A 1 17  ? -1.365  15.717  -2.339  1.00 0.00 ? 17  LEU A O    3  
ATOM   3171  C CB   . LEU A 1 17  ? 0.420   13.821  -1.084  1.00 0.00 ? 17  LEU A CB   3  
ATOM   3172  C CG   . LEU A 1 17  ? 1.052   12.870  -0.062  1.00 0.00 ? 17  LEU A CG   3  
ATOM   3173  C CD1  . LEU A 1 17  ? 1.510   13.631  1.183   1.00 0.00 ? 17  LEU A CD1  3  
ATOM   3174  C CD2  . LEU A 1 17  ? 0.098   11.725  0.282   1.00 0.00 ? 17  LEU A CD2  3  
ATOM   3175  H H    . LEU A 1 17  ? -0.261  12.770  -3.311  1.00 0.00 ? 17  LEU A H    3  
ATOM   3176  H HA   . LEU A 1 17  ? -1.474  12.944  -0.687  1.00 0.00 ? 17  LEU A HA   3  
ATOM   3177  H HB2  . LEU A 1 17  ? 1.047   13.834  -1.973  1.00 0.00 ? 17  LEU A HB2  3  
ATOM   3178  H HB3  . LEU A 1 17  ? 0.434   14.829  -0.669  1.00 0.00 ? 17  LEU A HB3  3  
ATOM   3179  H HG   . LEU A 1 17  ? 1.939   12.427  -0.513  1.00 0.00 ? 17  LEU A HG   3  
ATOM   3180  H HD11 . LEU A 1 17  ? 1.929   14.593  0.889   1.00 0.00 ? 17  LEU A HD11 3  
ATOM   3181  H HD12 . LEU A 1 17  ? 0.658   13.793  1.845   1.00 0.00 ? 17  LEU A HD12 3  
ATOM   3182  H HD13 . LEU A 1 17  ? 2.270   13.049  1.705   1.00 0.00 ? 17  LEU A HD13 3  
ATOM   3183  H HD21 . LEU A 1 17  ? 0.648   10.937  0.798   1.00 0.00 ? 17  LEU A HD21 3  
ATOM   3184  H HD22 . LEU A 1 17  ? -0.696  12.096  0.931   1.00 0.00 ? 17  LEU A HD22 3  
ATOM   3185  H HD23 . LEU A 1 17  ? -0.336  11.326  -0.633  1.00 0.00 ? 17  LEU A HD23 3  
ATOM   3186  N N    . LYS A 1 18  ? -3.136  14.632  -1.441  1.00 0.00 ? 18  LYS A N    3  
ATOM   3187  C CA   . LYS A 1 18  ? -4.061  15.732  -1.662  1.00 0.00 ? 18  LYS A CA   3  
ATOM   3188  C C    . LYS A 1 18  ? -3.820  16.815  -0.609  1.00 0.00 ? 18  LYS A C    3  
ATOM   3189  O O    . LYS A 1 18  ? -3.457  17.941  -0.944  1.00 0.00 ? 18  LYS A O    3  
ATOM   3190  C CB   . LYS A 1 18  ? -5.502  15.218  -1.697  1.00 0.00 ? 18  LYS A CB   3  
ATOM   3191  C CG   . LYS A 1 18  ? -6.446  16.275  -2.275  1.00 0.00 ? 18  LYS A CG   3  
ATOM   3192  C CD   . LYS A 1 18  ? -7.839  15.691  -2.521  1.00 0.00 ? 18  LYS A CD   3  
ATOM   3193  C CE   . LYS A 1 18  ? -8.726  16.686  -3.270  1.00 0.00 ? 18  LYS A CE   3  
ATOM   3194  N NZ   . LYS A 1 18  ? -8.877  16.282  -4.686  1.00 0.00 ? 18  LYS A NZ   3  
ATOM   3195  H H    . LYS A 1 18  ? -3.533  13.826  -1.006  1.00 0.00 ? 18  LYS A H    3  
ATOM   3196  H HA   . LYS A 1 18  ? -3.843  16.149  -2.645  1.00 0.00 ? 18  LYS A HA   3  
ATOM   3197  H HB2  . LYS A 1 18  ? -5.555  14.311  -2.298  1.00 0.00 ? 18  LYS A HB2  3  
ATOM   3198  H HB3  . LYS A 1 18  ? -5.823  14.951  -0.690  1.00 0.00 ? 18  LYS A HB3  3  
ATOM   3199  H HG2  . LYS A 1 18  ? -6.517  17.119  -1.588  1.00 0.00 ? 18  LYS A HG2  3  
ATOM   3200  H HG3  . LYS A 1 18  ? -6.038  16.659  -3.210  1.00 0.00 ? 18  LYS A HG3  3  
ATOM   3201  H HD2  . LYS A 1 18  ? -7.754  14.769  -3.096  1.00 0.00 ? 18  LYS A HD2  3  
ATOM   3202  H HD3  . LYS A 1 18  ? -8.301  15.431  -1.568  1.00 0.00 ? 18  LYS A HD3  3  
ATOM   3203  H HE2  . LYS A 1 18  ? -9.705  16.738  -2.794  1.00 0.00 ? 18  LYS A HE2  3  
ATOM   3204  H HE3  . LYS A 1 18  ? -8.291  17.684  -3.214  1.00 0.00 ? 18  LYS A HE3  3  
ATOM   3205  H HZ1  . LYS A 1 18  ? -8.935  17.098  -5.260  1.00 0.00 ? 18  LYS A HZ1  3  
ATOM   3206  H HZ2  . LYS A 1 18  ? -8.086  15.737  -4.962  1.00 0.00 ? 18  LYS A HZ2  3  
ATOM   3207  H HZ3  . LYS A 1 18  ? -9.711  15.739  -4.791  1.00 0.00 ? 18  LYS A HZ3  3  
ATOM   3208  N N    . LYS A 1 19  ? -4.031  16.436  0.643   1.00 0.00 ? 19  LYS A N    3  
ATOM   3209  C CA   . LYS A 1 19  ? -3.840  17.362  1.747   1.00 0.00 ? 19  LYS A CA   3  
ATOM   3210  C C    . LYS A 1 19  ? -2.358  17.408  2.118   1.00 0.00 ? 19  LYS A C    3  
ATOM   3211  O O    . LYS A 1 19  ? -1.954  18.181  2.987   1.00 0.00 ? 19  LYS A O    3  
ATOM   3212  C CB   . LYS A 1 19  ? -4.754  16.995  2.918   1.00 0.00 ? 19  LYS A CB   3  
ATOM   3213  C CG   . LYS A 1 19  ? -4.757  18.096  3.979   1.00 0.00 ? 19  LYS A CG   3  
ATOM   3214  C CD   . LYS A 1 19  ? -5.810  17.822  5.054   1.00 0.00 ? 19  LYS A CD   3  
ATOM   3215  C CE   . LYS A 1 19  ? -5.151  17.486  6.393   1.00 0.00 ? 19  LYS A CE   3  
ATOM   3216  N NZ   . LYS A 1 19  ? -6.166  17.042  7.373   1.00 0.00 ? 19  LYS A NZ   3  
ATOM   3217  H H    . LYS A 1 19  ? -4.325  15.518  0.908   1.00 0.00 ? 19  LYS A H    3  
ATOM   3218  H HA   . LYS A 1 19  ? -4.141  18.350  1.400   1.00 0.00 ? 19  LYS A HA   3  
ATOM   3219  H HB2  . LYS A 1 19  ? -5.770  16.833  2.554   1.00 0.00 ? 19  LYS A HB2  3  
ATOM   3220  H HB3  . LYS A 1 19  ? -4.424  16.057  3.363   1.00 0.00 ? 19  LYS A HB3  3  
ATOM   3221  H HG2  . LYS A 1 19  ? -3.772  18.165  4.440   1.00 0.00 ? 19  LYS A HG2  3  
ATOM   3222  H HG3  . LYS A 1 19  ? -4.955  19.059  3.508   1.00 0.00 ? 19  LYS A HG3  3  
ATOM   3223  H HD2  . LYS A 1 19  ? -6.453  18.694  5.169   1.00 0.00 ? 19  LYS A HD2  3  
ATOM   3224  H HD3  . LYS A 1 19  ? -6.447  16.994  4.740   1.00 0.00 ? 19  LYS A HD3  3  
ATOM   3225  H HE2  . LYS A 1 19  ? -4.406  16.702  6.253   1.00 0.00 ? 19  LYS A HE2  3  
ATOM   3226  H HE3  . LYS A 1 19  ? -4.625  18.360  6.775   1.00 0.00 ? 19  LYS A HE3  3  
ATOM   3227  H HZ1  . LYS A 1 19  ? -5.710  16.651  8.172   1.00 0.00 ? 19  LYS A HZ1  3  
ATOM   3228  H HZ2  . LYS A 1 19  ? -6.720  17.825  7.657   1.00 0.00 ? 19  LYS A HZ2  3  
ATOM   3229  H HZ3  . LYS A 1 19  ? -6.757  16.352  6.955   1.00 0.00 ? 19  LYS A HZ3  3  
ATOM   3230  N N    . GLN A 1 20  ? -1.584  16.573  1.440   1.00 0.00 ? 20  GLN A N    3  
ATOM   3231  C CA   . GLN A 1 20  ? -0.153  16.509  1.688   1.00 0.00 ? 20  GLN A CA   3  
ATOM   3232  C C    . GLN A 1 20  ? 0.120   16.311  3.181   1.00 0.00 ? 20  GLN A C    3  
ATOM   3233  O O    . GLN A 1 20  ? 1.026   16.928  3.738   1.00 0.00 ? 20  GLN A O    3  
ATOM   3234  C CB   . GLN A 1 20  ? 0.550   17.761  1.164   1.00 0.00 ? 20  GLN A CB   3  
ATOM   3235  C CG   . GLN A 1 20  ? 1.101   17.534  -0.245  1.00 0.00 ? 20  GLN A CG   3  
ATOM   3236  C CD   . GLN A 1 20  ? 1.702   18.820  -0.815  1.00 0.00 ? 20  GLN A CD   3  
ATOM   3237  O OE1  . GLN A 1 20  ? 1.263   19.921  -0.525  1.00 0.00 ? 20  GLN A OE1  3  
ATOM   3238  N NE2  . GLN A 1 20  ? 2.726   18.620  -1.639  1.00 0.00 ? 20  GLN A NE2  3  
ATOM   3239  H H    . GLN A 1 20  ? -1.920  15.947  0.736   1.00 0.00 ? 20  GLN A H    3  
ATOM   3240  H HA   . GLN A 1 20  ? 0.199   15.642  1.131   1.00 0.00 ? 20  GLN A HA   3  
ATOM   3241  H HB2  . GLN A 1 20  ? -0.149  18.599  1.153   1.00 0.00 ? 20  GLN A HB2  3  
ATOM   3242  H HB3  . GLN A 1 20  ? 1.364   18.035  1.836   1.00 0.00 ? 20  GLN A HB3  3  
ATOM   3243  H HG2  . GLN A 1 20  ? 1.861   16.753  -0.219  1.00 0.00 ? 20  GLN A HG2  3  
ATOM   3244  H HG3  . GLN A 1 20  ? 0.303   17.179  -0.898  1.00 0.00 ? 20  GLN A HG3  3  
ATOM   3245  H HE21 . GLN A 1 20  ? 3.036   17.690  -1.836  1.00 0.00 ? 20  GLN A HE21 3  
ATOM   3246  H HE22 . GLN A 1 20  ? 3.185   19.400  -2.063  1.00 0.00 ? 20  GLN A HE22 3  
ATOM   3247  N N    . ASN A 1 21  ? -0.683  15.448  3.786   1.00 0.00 ? 21  ASN A N    3  
ATOM   3248  C CA   . ASN A 1 21  ? -0.539  15.161  5.204   1.00 0.00 ? 21  ASN A CA   3  
ATOM   3249  C C    . ASN A 1 21  ? 0.403   13.968  5.385   1.00 0.00 ? 21  ASN A C    3  
ATOM   3250  O O    . ASN A 1 21  ? 0.205   13.148  6.279   1.00 0.00 ? 21  ASN A O    3  
ATOM   3251  C CB   . ASN A 1 21  ? -1.887  14.799  5.832   1.00 0.00 ? 21  ASN A CB   3  
ATOM   3252  C CG   . ASN A 1 21  ? -1.776  14.708  7.355   1.00 0.00 ? 21  ASN A CG   3  
ATOM   3253  O OD1  . ASN A 1 21  ? -1.768  13.638  7.940   1.00 0.00 ? 21  ASN A OD1  3  
ATOM   3254  N ND2  . ASN A 1 21  ? -1.688  15.889  7.961   1.00 0.00 ? 21  ASN A ND2  3  
ATOM   3255  H H    . ASN A 1 21  ? -1.417  14.949  3.327   1.00 0.00 ? 21  ASN A H    3  
ATOM   3256  H HA   . ASN A 1 21  ? -0.142  16.076  5.643   1.00 0.00 ? 21  ASN A HA   3  
ATOM   3257  H HB2  . ASN A 1 21  ? -2.631  15.550  5.562   1.00 0.00 ? 21  ASN A HB2  3  
ATOM   3258  H HB3  . ASN A 1 21  ? -2.234  13.847  5.431   1.00 0.00 ? 21  ASN A HB3  3  
ATOM   3259  H HD21 . ASN A 1 21  ? -1.698  16.731  7.422   1.00 0.00 ? 21  ASN A HD21 3  
ATOM   3260  H HD22 . ASN A 1 21  ? -1.611  15.935  8.958   1.00 0.00 ? 21  ASN A HD22 3  
ATOM   3261  N N    . GLY A 1 22  ? 1.406   13.911  4.522   1.00 0.00 ? 22  GLY A N    3  
ATOM   3262  C CA   . GLY A 1 22  ? 2.380   12.833  4.579   1.00 0.00 ? 22  GLY A CA   3  
ATOM   3263  C C    . GLY A 1 22  ? 1.839   11.573  3.901   1.00 0.00 ? 22  GLY A C    3  
ATOM   3264  O O    . GLY A 1 22  ? 2.443   11.062  2.958   1.00 0.00 ? 22  GLY A O    3  
ATOM   3265  H H    . GLY A 1 22  ? 1.561   14.583  3.799   1.00 0.00 ? 22  GLY A H    3  
ATOM   3266  H HA2  . GLY A 1 22  ? 3.302   13.145  4.089   1.00 0.00 ? 22  GLY A HA2  3  
ATOM   3267  H HA3  . GLY A 1 22  ? 2.627   12.615  5.616   1.00 0.00 ? 22  GLY A HA3  3  
ATOM   3268  N N    . MET A 1 23  ? 0.707   11.107  4.407   1.00 0.00 ? 23  MET A N    3  
ATOM   3269  C CA   . MET A 1 23  ? 0.078   9.914   3.862   1.00 0.00 ? 23  MET A CA   3  
ATOM   3270  C C    . MET A 1 23  ? -0.990  9.376   4.814   1.00 0.00 ? 23  MET A C    3  
ATOM   3271  O O    . MET A 1 23  ? -2.185  9.555   4.579   1.00 0.00 ? 23  MET A O    3  
ATOM   3272  C CB   . MET A 1 23  ? 1.140   8.840   3.625   1.00 0.00 ? 23  MET A CB   3  
ATOM   3273  C CG   . MET A 1 23  ? 1.241   8.485   2.140   1.00 0.00 ? 23  MET A CG   3  
ATOM   3274  S SD   . MET A 1 23  ? 2.906   8.762   1.559   1.00 0.00 ? 23  MET A SD   3  
ATOM   3275  C CE   . MET A 1 23  ? 3.573   7.115   1.738   1.00 0.00 ? 23  MET A CE   3  
ATOM   3276  H H    . MET A 1 23  ? 0.222   11.527  5.174   1.00 0.00 ? 23  MET A H    3  
ATOM   3277  H HA   . MET A 1 23  ? -0.384  10.229  2.926   1.00 0.00 ? 23  MET A HA   3  
ATOM   3278  H HB2  . MET A 1 23  ? 2.107   9.194   3.986   1.00 0.00 ? 23  MET A HB2  3  
ATOM   3279  H HB3  . MET A 1 23  ? 0.894   7.947   4.199   1.00 0.00 ? 23  MET A HB3  3  
ATOM   3280  H HG2  . MET A 1 23  ? 0.960   7.444   1.986   1.00 0.00 ? 23  MET A HG2  3  
ATOM   3281  H HG3  . MET A 1 23  ? 0.542   9.093   1.565   1.00 0.00 ? 23  MET A HG3  3  
ATOM   3282  H HE1  . MET A 1 23  ? 4.486   7.026   1.147   1.00 0.00 ? 23  MET A HE1  3  
ATOM   3283  H HE2  . MET A 1 23  ? 3.801   6.927   2.786   1.00 0.00 ? 23  MET A HE2  3  
ATOM   3284  H HE3  . MET A 1 23  ? 2.841   6.387   1.387   1.00 0.00 ? 23  MET A HE3  3  
ATOM   3285  N N    . GLY A 1 24  ? -0.524  8.724   5.870   1.00 0.00 ? 24  GLY A N    3  
ATOM   3286  C CA   . GLY A 1 24  ? -1.425  8.156   6.859   1.00 0.00 ? 24  GLY A CA   3  
ATOM   3287  C C    . GLY A 1 24  ? -1.616  6.656   6.630   1.00 0.00 ? 24  GLY A C    3  
ATOM   3288  O O    . GLY A 1 24  ? -2.212  5.969   7.457   1.00 0.00 ? 24  GLY A O    3  
ATOM   3289  H H    . GLY A 1 24  ? 0.448   8.581   6.054   1.00 0.00 ? 24  GLY A H    3  
ATOM   3290  H HA2  . GLY A 1 24  ? -1.029  8.330   7.859   1.00 0.00 ? 24  GLY A HA2  3  
ATOM   3291  H HA3  . GLY A 1 24  ? -2.390  8.661   6.807   1.00 0.00 ? 24  GLY A HA3  3  
ATOM   3292  N N    . LEU A 1 25  ? -1.094  6.190   5.504   1.00 0.00 ? 25  LEU A N    3  
ATOM   3293  C CA   . LEU A 1 25  ? -1.199  4.784   5.157   1.00 0.00 ? 25  LEU A CA   3  
ATOM   3294  C C    . LEU A 1 25  ? -0.450  3.949   6.196   1.00 0.00 ? 25  LEU A C    3  
ATOM   3295  O O    . LEU A 1 25  ? 0.470   4.442   6.849   1.00 0.00 ? 25  LEU A O    3  
ATOM   3296  C CB   . LEU A 1 25  ? -0.725  4.549   3.722   1.00 0.00 ? 25  LEU A CB   3  
ATOM   3297  C CG   . LEU A 1 25  ? -1.777  4.738   2.628   1.00 0.00 ? 25  LEU A CG   3  
ATOM   3298  C CD1  . LEU A 1 25  ? -1.602  3.701   1.515   1.00 0.00 ? 25  LEU A CD1  3  
ATOM   3299  C CD2  . LEU A 1 25  ? -3.190  4.713   3.216   1.00 0.00 ? 25  LEU A CD2  3  
ATOM   3300  H H    . LEU A 1 25  ? -0.610  6.755   4.836   1.00 0.00 ? 25  LEU A H    3  
ATOM   3301  H HA   . LEU A 1 25  ? -2.255  4.515   5.195   1.00 0.00 ? 25  LEU A HA   3  
ATOM   3302  H HB2  . LEU A 1 25  ? 0.107   5.225   3.519   1.00 0.00 ? 25  LEU A HB2  3  
ATOM   3303  H HB3  . LEU A 1 25  ? -0.333  3.534   3.651   1.00 0.00 ? 25  LEU A HB3  3  
ATOM   3304  H HG   . LEU A 1 25  ? -1.632  5.721   2.179   1.00 0.00 ? 25  LEU A HG   3  
ATOM   3305  H HD11 . LEU A 1 25  ? -0.629  3.838   1.042   1.00 0.00 ? 25  LEU A HD11 3  
ATOM   3306  H HD12 . LEU A 1 25  ? -1.664  2.699   1.938   1.00 0.00 ? 25  LEU A HD12 3  
ATOM   3307  H HD13 . LEU A 1 25  ? -2.388  3.832   0.771   1.00 0.00 ? 25  LEU A HD13 3  
ATOM   3308  H HD21 . LEU A 1 25  ? -3.342  3.778   3.755   1.00 0.00 ? 25  LEU A HD21 3  
ATOM   3309  H HD22 . LEU A 1 25  ? -3.312  5.552   3.900   1.00 0.00 ? 25  LEU A HD22 3  
ATOM   3310  H HD23 . LEU A 1 25  ? -3.920  4.791   2.410   1.00 0.00 ? 25  LEU A HD23 3  
ATOM   3311  N N    . SER A 1 26  ? -0.867  2.697   6.318   1.00 0.00 ? 26  SER A N    3  
ATOM   3312  C CA   . SER A 1 26  ? -0.246  1.790   7.268   1.00 0.00 ? 26  SER A CA   3  
ATOM   3313  C C    . SER A 1 26  ? -0.192  0.377   6.683   1.00 0.00 ? 26  SER A C    3  
ATOM   3314  O O    . SER A 1 26  ? -1.212  -0.304  6.597   1.00 0.00 ? 26  SER A O    3  
ATOM   3315  C CB   . SER A 1 26  ? -1.003  1.783   8.599   1.00 0.00 ? 26  SER A CB   3  
ATOM   3316  O OG   . SER A 1 26  ? -0.117  1.758   9.716   1.00 0.00 ? 26  SER A OG   3  
ATOM   3317  H H    . SER A 1 26  ? -1.616  2.304   5.784   1.00 0.00 ? 26  SER A H    3  
ATOM   3318  H HA   . SER A 1 26  ? 0.759   2.179   7.426   1.00 0.00 ? 26  SER A HA   3  
ATOM   3319  H HB2  . SER A 1 26  ? -1.638  2.666   8.660   1.00 0.00 ? 26  SER A HB2  3  
ATOM   3320  H HB3  . SER A 1 26  ? -1.659  0.914   8.638   1.00 0.00 ? 26  SER A HB3  3  
ATOM   3321  H HG   . SER A 1 26  ? -0.638  1.674   10.564  1.00 0.00 ? 26  SER A HG   3  
ATOM   3322  N N    . ILE A 1 27  ? 1.012   -0.020  6.295   1.00 0.00 ? 27  ILE A N    3  
ATOM   3323  C CA   . ILE A 1 27  ? 1.215   -1.339  5.718   1.00 0.00 ? 27  ILE A CA   3  
ATOM   3324  C C    . ILE A 1 27  ? 2.317   -2.064  6.491   1.00 0.00 ? 27  ILE A C    3  
ATOM   3325  O O    . ILE A 1 27  ? 3.032   -1.451  7.284   1.00 0.00 ? 27  ILE A O    3  
ATOM   3326  C CB   . ILE A 1 27  ? 1.484   -1.232  4.216   1.00 0.00 ? 27  ILE A CB   3  
ATOM   3327  C CG1  . ILE A 1 27  ? 2.982   -1.323  3.921   1.00 0.00 ? 27  ILE A CG1  3  
ATOM   3328  C CG2  . ILE A 1 27  ? 0.861   0.037   3.636   1.00 0.00 ? 27  ILE A CG2  3  
ATOM   3329  C CD1  . ILE A 1 27  ? 3.240   -1.403  2.415   1.00 0.00 ? 27  ILE A CD1  3  
ATOM   3330  H H    . ILE A 1 27  ? 1.836   0.540   6.367   1.00 0.00 ? 27  ILE A H    3  
ATOM   3331  H HA   . ILE A 1 27  ? 0.285   -1.894  5.841   1.00 0.00 ? 27  ILE A HA   3  
ATOM   3332  H HB   . ILE A 1 27  ? 1.007   -2.079  3.723   1.00 0.00 ? 27  ILE A HB   3  
ATOM   3333  H HG12 . ILE A 1 27  ? 3.490   -0.450  4.335   1.00 0.00 ? 27  ILE A HG12 3  
ATOM   3334  H HG13 . ILE A 1 27  ? 3.402   -2.199  4.413   1.00 0.00 ? 27  ILE A HG13 3  
ATOM   3335  H HG21 . ILE A 1 27  ? 0.552   -0.146  2.607   1.00 0.00 ? 27  ILE A HG21 3  
ATOM   3336  H HG22 . ILE A 1 27  ? -0.010  0.321   4.231   1.00 0.00 ? 27  ILE A HG22 3  
ATOM   3337  H HG23 . ILE A 1 27  ? 1.593   0.845   3.658   1.00 0.00 ? 27  ILE A HG23 3  
ATOM   3338  H HD11 . ILE A 1 27  ? 2.439   -1.967  1.939   1.00 0.00 ? 27  ILE A HD11 3  
ATOM   3339  H HD12 . ILE A 1 27  ? 3.273   -0.396  1.998   1.00 0.00 ? 27  ILE A HD12 3  
ATOM   3340  H HD13 . ILE A 1 27  ? 4.192   -1.900  2.236   1.00 0.00 ? 27  ILE A HD13 3  
ATOM   3341  N N    . VAL A 1 28  ? 2.422   -3.361  6.235   1.00 0.00 ? 28  VAL A N    3  
ATOM   3342  C CA   . VAL A 1 28  ? 3.426   -4.175  6.896   1.00 0.00 ? 28  VAL A CA   3  
ATOM   3343  C C    . VAL A 1 28  ? 3.823   -5.333  5.979   1.00 0.00 ? 28  VAL A C    3  
ATOM   3344  O O    . VAL A 1 28  ? 3.098   -5.663  5.041   1.00 0.00 ? 28  VAL A O    3  
ATOM   3345  C CB   . VAL A 1 28  ? 2.908   -4.642  8.259   1.00 0.00 ? 28  VAL A CB   3  
ATOM   3346  C CG1  . VAL A 1 28  ? 3.829   -5.703  8.862   1.00 0.00 ? 28  VAL A CG1  3  
ATOM   3347  C CG2  . VAL A 1 28  ? 2.732   -3.459  9.213   1.00 0.00 ? 28  VAL A CG2  3  
ATOM   3348  H H    . VAL A 1 28  ? 1.838   -3.851  5.590   1.00 0.00 ? 28  VAL A H    3  
ATOM   3349  H HA   . VAL A 1 28  ? 4.301   -3.546  7.065   1.00 0.00 ? 28  VAL A HA   3  
ATOM   3350  H HB   . VAL A 1 28  ? 1.928   -5.096  8.105   1.00 0.00 ? 28  VAL A HB   3  
ATOM   3351  H HG11 . VAL A 1 28  ? 3.821   -6.593  8.231   1.00 0.00 ? 28  VAL A HG11 3  
ATOM   3352  H HG12 . VAL A 1 28  ? 4.844   -5.312  8.923   1.00 0.00 ? 28  VAL A HG12 3  
ATOM   3353  H HG13 . VAL A 1 28  ? 3.479   -5.965  9.860   1.00 0.00 ? 28  VAL A HG13 3  
ATOM   3354  H HG21 . VAL A 1 28  ? 3.542   -2.745  9.060   1.00 0.00 ? 28  VAL A HG21 3  
ATOM   3355  H HG22 . VAL A 1 28  ? 1.777   -2.972  9.019   1.00 0.00 ? 28  VAL A HG22 3  
ATOM   3356  H HG23 . VAL A 1 28  ? 2.755   -3.818  10.242  1.00 0.00 ? 28  VAL A HG23 3  
ATOM   3357  N N    . ALA A 1 29  ? 4.971   -5.919  6.281   1.00 0.00 ? 29  ALA A N    3  
ATOM   3358  C CA   . ALA A 1 29  ? 5.474   -7.034  5.495   1.00 0.00 ? 29  ALA A CA   3  
ATOM   3359  C C    . ALA A 1 29  ? 5.928   -8.152  6.435   1.00 0.00 ? 29  ALA A C    3  
ATOM   3360  O O    . ALA A 1 29  ? 6.414   -7.885  7.533   1.00 0.00 ? 29  ALA A O    3  
ATOM   3361  C CB   . ALA A 1 29  ? 6.599   -6.547  4.578   1.00 0.00 ? 29  ALA A CB   3  
ATOM   3362  H H    . ALA A 1 29  ? 5.556   -5.646  7.046   1.00 0.00 ? 29  ALA A H    3  
ATOM   3363  H HA   . ALA A 1 29  ? 4.653   -7.400  4.878   1.00 0.00 ? 29  ALA A HA   3  
ATOM   3364  H HB1  . ALA A 1 29  ? 7.244   -7.386  4.320   1.00 0.00 ? 29  ALA A HB1  3  
ATOM   3365  H HB2  . ALA A 1 29  ? 6.171   -6.123  3.670   1.00 0.00 ? 29  ALA A HB2  3  
ATOM   3366  H HB3  . ALA A 1 29  ? 7.183   -5.785  5.094   1.00 0.00 ? 29  ALA A HB3  3  
ATOM   3367  N N    . ALA A 1 30  ? 5.755   -9.379  5.969   1.00 0.00 ? 30  ALA A N    3  
ATOM   3368  C CA   . ALA A 1 30  ? 6.142   -10.539 6.754   1.00 0.00 ? 30  ALA A CA   3  
ATOM   3369  C C    . ALA A 1 30  ? 7.302   -11.255 6.061   1.00 0.00 ? 30  ALA A C    3  
ATOM   3370  O O    . ALA A 1 30  ? 7.359   -11.309 4.834   1.00 0.00 ? 30  ALA A O    3  
ATOM   3371  C CB   . ALA A 1 30  ? 4.929   -11.450 6.952   1.00 0.00 ? 30  ALA A CB   3  
ATOM   3372  H H    . ALA A 1 30  ? 5.360   -9.589  5.075   1.00 0.00 ? 30  ALA A H    3  
ATOM   3373  H HA   . ALA A 1 30  ? 6.476   -10.183 7.730   1.00 0.00 ? 30  ALA A HA   3  
ATOM   3374  H HB1  . ALA A 1 30  ? 5.237   -12.491 6.847   1.00 0.00 ? 30  ALA A HB1  3  
ATOM   3375  H HB2  . ALA A 1 30  ? 4.513   -11.291 7.946   1.00 0.00 ? 30  ALA A HB2  3  
ATOM   3376  H HB3  . ALA A 1 30  ? 4.174   -11.218 6.201   1.00 0.00 ? 30  ALA A HB3  3  
ATOM   3377  N N    . LYS A 1 31  ? 8.202   -11.787 6.878   1.00 0.00 ? 31  LYS A N    3  
ATOM   3378  C CA   . LYS A 1 31  ? 9.357   -12.497 6.358   1.00 0.00 ? 31  LYS A CA   3  
ATOM   3379  C C    . LYS A 1 31  ? 9.780   -13.575 7.358   1.00 0.00 ? 31  LYS A C    3  
ATOM   3380  O O    . LYS A 1 31  ? 10.287  -13.263 8.436   1.00 0.00 ? 31  LYS A O    3  
ATOM   3381  C CB   . LYS A 1 31  ? 10.475  -11.514 6.004   1.00 0.00 ? 31  LYS A CB   3  
ATOM   3382  C CG   . LYS A 1 31  ? 10.760  -10.563 7.170   1.00 0.00 ? 31  LYS A CG   3  
ATOM   3383  C CD   . LYS A 1 31  ? 10.062  -9.218  6.962   1.00 0.00 ? 31  LYS A CD   3  
ATOM   3384  C CE   . LYS A 1 31  ? 9.508   -8.679  8.282   1.00 0.00 ? 31  LYS A CE   3  
ATOM   3385  N NZ   . LYS A 1 31  ? 9.226   -7.229  8.173   1.00 0.00 ? 31  LYS A NZ   3  
ATOM   3386  H H    . LYS A 1 31  ? 8.149   -11.738 7.875   1.00 0.00 ? 31  LYS A H    3  
ATOM   3387  H HA   . LYS A 1 31  ? 9.052   -12.986 5.433   1.00 0.00 ? 31  LYS A HA   3  
ATOM   3388  H HB2  . LYS A 1 31  ? 11.381  -12.064 5.750   1.00 0.00 ? 31  LYS A HB2  3  
ATOM   3389  H HB3  . LYS A 1 31  ? 10.194  -10.940 5.122   1.00 0.00 ? 31  LYS A HB3  3  
ATOM   3390  H HG2  . LYS A 1 31  ? 10.419  -11.013 8.102   1.00 0.00 ? 31  LYS A HG2  3  
ATOM   3391  H HG3  . LYS A 1 31  ? 11.834  -10.409 7.263   1.00 0.00 ? 31  LYS A HG3  3  
ATOM   3392  H HD2  . LYS A 1 31  ? 10.764  -8.500  6.538   1.00 0.00 ? 31  LYS A HD2  3  
ATOM   3393  H HD3  . LYS A 1 31  ? 9.252   -9.331  6.243   1.00 0.00 ? 31  LYS A HD3  3  
ATOM   3394  H HE2  . LYS A 1 31  ? 8.595   -9.213  8.547   1.00 0.00 ? 31  LYS A HE2  3  
ATOM   3395  H HE3  . LYS A 1 31  ? 10.225  -8.856  9.084   1.00 0.00 ? 31  LYS A HE3  3  
ATOM   3396  H HZ1  . LYS A 1 31  ? 10.036  -6.711  8.449   1.00 0.00 ? 31  LYS A HZ1  3  
ATOM   3397  H HZ2  . LYS A 1 31  ? 8.995   -7.006  7.226   1.00 0.00 ? 31  LYS A HZ2  3  
ATOM   3398  H HZ3  . LYS A 1 31  ? 8.458   -6.993  8.768   1.00 0.00 ? 31  LYS A HZ3  3  
ATOM   3399  N N    . GLY A 1 32  ? 9.556   -14.820 6.967   1.00 0.00 ? 32  GLY A N    3  
ATOM   3400  C CA   . GLY A 1 32  ? 9.907   -15.946 7.815   1.00 0.00 ? 32  GLY A CA   3  
ATOM   3401  C C    . GLY A 1 32  ? 9.005   -16.004 9.050   1.00 0.00 ? 32  GLY A C    3  
ATOM   3402  O O    . GLY A 1 32  ? 8.317   -17.000 9.275   1.00 0.00 ? 32  GLY A O    3  
ATOM   3403  H H    . GLY A 1 32  ? 9.144   -15.065 6.090   1.00 0.00 ? 32  GLY A H    3  
ATOM   3404  H HA2  . GLY A 1 32  ? 9.816   -16.874 7.251   1.00 0.00 ? 32  GLY A HA2  3  
ATOM   3405  H HA3  . GLY A 1 32  ? 10.948  -15.861 8.125   1.00 0.00 ? 32  GLY A HA3  3  
ATOM   3406  N N    . ALA A 1 33  ? 9.038   -14.927 9.819   1.00 0.00 ? 33  ALA A N    3  
ATOM   3407  C CA   . ALA A 1 33  ? 8.233   -14.841 11.026  1.00 0.00 ? 33  ALA A CA   3  
ATOM   3408  C C    . ALA A 1 33  ? 6.770   -14.609 10.641  1.00 0.00 ? 33  ALA A C    3  
ATOM   3409  O O    . ALA A 1 33  ? 6.479   -13.827 9.735   1.00 0.00 ? 33  ALA A O    3  
ATOM   3410  C CB   . ALA A 1 33  ? 8.781   -13.735 11.930  1.00 0.00 ? 33  ALA A CB   3  
ATOM   3411  H H    . ALA A 1 33  ? 9.601   -14.121 9.630   1.00 0.00 ? 33  ALA A H    3  
ATOM   3412  H HA   . ALA A 1 33  ? 8.316   -15.794 11.547  1.00 0.00 ? 33  ALA A HA   3  
ATOM   3413  H HB1  . ALA A 1 33  ? 8.035   -12.948 12.036  1.00 0.00 ? 33  ALA A HB1  3  
ATOM   3414  H HB2  . ALA A 1 33  ? 9.013   -14.151 12.911  1.00 0.00 ? 33  ALA A HB2  3  
ATOM   3415  H HB3  . ALA A 1 33  ? 9.686   -13.321 11.487  1.00 0.00 ? 33  ALA A HB3  3  
ATOM   3416  N N    . GLY A 1 34  ? 5.888   -15.299 11.349  1.00 0.00 ? 34  GLY A N    3  
ATOM   3417  C CA   . GLY A 1 34  ? 4.463   -15.177 11.095  1.00 0.00 ? 34  GLY A CA   3  
ATOM   3418  C C    . GLY A 1 34  ? 4.071   -15.914 9.812   1.00 0.00 ? 34  GLY A C    3  
ATOM   3419  O O    . GLY A 1 34  ? 3.330   -16.894 9.857   1.00 0.00 ? 34  GLY A O    3  
ATOM   3420  H H    . GLY A 1 34  ? 6.133   -15.930 12.085  1.00 0.00 ? 34  GLY A H    3  
ATOM   3421  H HA2  . GLY A 1 34  ? 3.903   -15.583 11.937  1.00 0.00 ? 34  GLY A HA2  3  
ATOM   3422  H HA3  . GLY A 1 34  ? 4.194   -14.124 11.010  1.00 0.00 ? 34  GLY A HA3  3  
ATOM   3423  N N    . GLN A 1 35  ? 4.586   -15.413 8.699   1.00 0.00 ? 35  GLN A N    3  
ATOM   3424  C CA   . GLN A 1 35  ? 4.299   -16.012 7.406   1.00 0.00 ? 35  GLN A CA   3  
ATOM   3425  C C    . GLN A 1 35  ? 5.595   -16.452 6.725   1.00 0.00 ? 35  GLN A C    3  
ATOM   3426  O O    . GLN A 1 35  ? 6.217   -15.673 6.002   1.00 0.00 ? 35  GLN A O    3  
ATOM   3427  C CB   . GLN A 1 35  ? 3.512   -15.045 6.517   1.00 0.00 ? 35  GLN A CB   3  
ATOM   3428  C CG   . GLN A 1 35  ? 2.210   -15.685 6.030   1.00 0.00 ? 35  GLN A CG   3  
ATOM   3429  C CD   . GLN A 1 35  ? 1.755   -15.063 4.709   1.00 0.00 ? 35  GLN A CD   3  
ATOM   3430  O OE1  . GLN A 1 35  ? 2.154   -13.971 4.336   1.00 0.00 ? 35  GLN A OE1  3  
ATOM   3431  N NE2  . GLN A 1 35  ? 0.900   -15.817 4.021   1.00 0.00 ? 35  GLN A NE2  3  
ATOM   3432  H H    . GLN A 1 35  ? 5.187   -14.614 8.671   1.00 0.00 ? 35  GLN A H    3  
ATOM   3433  H HA   . GLN A 1 35  ? 3.679   -16.882 7.621   1.00 0.00 ? 35  GLN A HA   3  
ATOM   3434  H HB2  . GLN A 1 35  ? 3.289   -14.136 7.072   1.00 0.00 ? 35  GLN A HB2  3  
ATOM   3435  H HB3  . GLN A 1 35  ? 4.122   -14.756 5.662   1.00 0.00 ? 35  GLN A HB3  3  
ATOM   3436  H HG2  . GLN A 1 35  ? 2.354   -16.758 5.901   1.00 0.00 ? 35  GLN A HG2  3  
ATOM   3437  H HG3  . GLN A 1 35  ? 1.434   -15.557 6.782   1.00 0.00 ? 35  GLN A HG3  3  
ATOM   3438  H HE21 . GLN A 1 35  ? 0.615   -16.703 4.383   1.00 0.00 ? 35  GLN A HE21 3  
ATOM   3439  H HE22 . GLN A 1 35  ? 0.546   -15.496 3.143   1.00 0.00 ? 35  GLN A HE22 3  
ATOM   3440  N N    . ASP A 1 36  ? 5.966   -17.698 6.979   1.00 0.00 ? 36  ASP A N    3  
ATOM   3441  C CA   . ASP A 1 36  ? 7.178   -18.251 6.399   1.00 0.00 ? 36  ASP A CA   3  
ATOM   3442  C C    . ASP A 1 36  ? 7.334   -17.738 4.966   1.00 0.00 ? 36  ASP A C    3  
ATOM   3443  O O    . ASP A 1 36  ? 8.451   -17.563 4.482   1.00 0.00 ? 36  ASP A O    3  
ATOM   3444  C CB   . ASP A 1 36  ? 7.118   -19.779 6.351   1.00 0.00 ? 36  ASP A CB   3  
ATOM   3445  C CG   . ASP A 1 36  ? 5.740   -20.362 6.036   1.00 0.00 ? 36  ASP A CG   3  
ATOM   3446  O OD1  . ASP A 1 36  ? 5.462   -20.544 4.831   1.00 0.00 ? 36  ASP A OD1  3  
ATOM   3447  O OD2  . ASP A 1 36  ? 4.995   -20.614 7.008   1.00 0.00 ? 36  ASP A OD2  3  
ATOM   3448  H H    . ASP A 1 36  ? 5.456   -18.324 7.566   1.00 0.00 ? 36  ASP A H    3  
ATOM   3449  H HA   . ASP A 1 36  ? 7.986   -17.916 7.051   1.00 0.00 ? 36  ASP A HA   3  
ATOM   3450  H HB2  . ASP A 1 36  ? 7.825   -20.131 5.599   1.00 0.00 ? 36  ASP A HB2  3  
ATOM   3451  H HB3  . ASP A 1 36  ? 7.453   -20.170 7.310   1.00 0.00 ? 36  ASP A HB3  3  
ATOM   3452  N N    . LYS A 1 37  ? 6.196   -17.512 4.325   1.00 0.00 ? 37  LYS A N    3  
ATOM   3453  C CA   . LYS A 1 37  ? 6.190   -17.022 2.958   1.00 0.00 ? 37  LYS A CA   3  
ATOM   3454  C C    . LYS A 1 37  ? 6.040   -15.500 2.966   1.00 0.00 ? 37  LYS A C    3  
ATOM   3455  O O    . LYS A 1 37  ? 4.948   -14.981 3.196   1.00 0.00 ? 37  LYS A O    3  
ATOM   3456  C CB   . LYS A 1 37  ? 5.119   -17.742 2.135   1.00 0.00 ? 37  LYS A CB   3  
ATOM   3457  C CG   . LYS A 1 37  ? 5.670   -18.171 0.775   1.00 0.00 ? 37  LYS A CG   3  
ATOM   3458  C CD   . LYS A 1 37  ? 5.801   -19.692 0.691   1.00 0.00 ? 37  LYS A CD   3  
ATOM   3459  C CE   . LYS A 1 37  ? 4.854   -20.269 -0.364  1.00 0.00 ? 37  LYS A CE   3  
ATOM   3460  N NZ   . LYS A 1 37  ? 5.365   -19.989 -1.725  1.00 0.00 ? 37  LYS A NZ   3  
ATOM   3461  H H    . LYS A 1 37  ? 5.290   -17.656 4.727   1.00 0.00 ? 37  LYS A H    3  
ATOM   3462  H HA   . LYS A 1 37  ? 7.156   -17.273 2.518   1.00 0.00 ? 37  LYS A HA   3  
ATOM   3463  H HB2  . LYS A 1 37  ? 4.764   -18.617 2.681   1.00 0.00 ? 37  LYS A HB2  3  
ATOM   3464  H HB3  . LYS A 1 37  ? 4.262   -17.084 1.995   1.00 0.00 ? 37  LYS A HB3  3  
ATOM   3465  H HG2  . LYS A 1 37  ? 5.010   -17.815 -0.018  1.00 0.00 ? 37  LYS A HG2  3  
ATOM   3466  H HG3  . LYS A 1 37  ? 6.643   -17.709 0.609   1.00 0.00 ? 37  LYS A HG3  3  
ATOM   3467  H HD2  . LYS A 1 37  ? 6.828   -19.960 0.446   1.00 0.00 ? 37  LYS A HD2  3  
ATOM   3468  H HD3  . LYS A 1 37  ? 5.581   -20.135 1.662   1.00 0.00 ? 37  LYS A HD3  3  
ATOM   3469  H HE2  . LYS A 1 37  ? 4.751   -21.344 -0.220  1.00 0.00 ? 37  LYS A HE2  3  
ATOM   3470  H HE3  . LYS A 1 37  ? 3.861   -19.834 -0.246  1.00 0.00 ? 37  LYS A HE3  3  
ATOM   3471  H HZ1  . LYS A 1 37  ? 5.581   -20.853 -2.182  1.00 0.00 ? 37  LYS A HZ1  3  
ATOM   3472  H HZ2  . LYS A 1 37  ? 4.667   -19.502 -2.250  1.00 0.00 ? 37  LYS A HZ2  3  
ATOM   3473  H HZ3  . LYS A 1 37  ? 6.189   -19.428 -1.663  1.00 0.00 ? 37  LYS A HZ3  3  
ATOM   3474  N N    . LEU A 1 38  ? 7.152   -14.826 2.712   1.00 0.00 ? 38  LEU A N    3  
ATOM   3475  C CA   . LEU A 1 38  ? 7.158   -13.372 2.686   1.00 0.00 ? 38  LEU A CA   3  
ATOM   3476  C C    . LEU A 1 38  ? 5.874   -12.874 2.018   1.00 0.00 ? 38  LEU A C    3  
ATOM   3477  O O    . LEU A 1 38  ? 5.392   -13.479 1.062   1.00 0.00 ? 38  LEU A O    3  
ATOM   3478  C CB   . LEU A 1 38  ? 8.437   -12.853 2.027   1.00 0.00 ? 38  LEU A CB   3  
ATOM   3479  C CG   . LEU A 1 38  ? 8.390   -11.412 1.515   1.00 0.00 ? 38  LEU A CG   3  
ATOM   3480  C CD1  . LEU A 1 38  ? 8.518   -10.416 2.667   1.00 0.00 ? 38  LEU A CD1  3  
ATOM   3481  C CD2  . LEU A 1 38  ? 9.448   -11.181 0.436   1.00 0.00 ? 38  LEU A CD2  3  
ATOM   3482  H H    . LEU A 1 38  ? 8.035   -15.255 2.524   1.00 0.00 ? 38  LEU A H    3  
ATOM   3483  H HA   . LEU A 1 38  ? 7.166   -13.029 3.720   1.00 0.00 ? 38  LEU A HA   3  
ATOM   3484  H HB2  . LEU A 1 38  ? 9.252   -12.936 2.746   1.00 0.00 ? 38  LEU A HB2  3  
ATOM   3485  H HB3  . LEU A 1 38  ? 8.682   -13.507 1.190   1.00 0.00 ? 38  LEU A HB3  3  
ATOM   3486  H HG   . LEU A 1 38  ? 7.417   -11.246 1.053   1.00 0.00 ? 38  LEU A HG   3  
ATOM   3487  H HD11 . LEU A 1 38  ? 7.525   -10.105 2.993   1.00 0.00 ? 38  LEU A HD11 3  
ATOM   3488  H HD12 . LEU A 1 38  ? 9.040   -10.889 3.500   1.00 0.00 ? 38  LEU A HD12 3  
ATOM   3489  H HD13 . LEU A 1 38  ? 9.082   -9.544  2.335   1.00 0.00 ? 38  LEU A HD13 3  
ATOM   3490  H HD21 . LEU A 1 38  ? 10.198  -11.969 0.484   1.00 0.00 ? 38  LEU A HD21 3  
ATOM   3491  H HD22 . LEU A 1 38  ? 8.974   -11.191 -0.546  1.00 0.00 ? 38  LEU A HD22 3  
ATOM   3492  H HD23 . LEU A 1 38  ? 9.926   -10.214 0.597   1.00 0.00 ? 38  LEU A HD23 3  
ATOM   3493  N N    . GLY A 1 39  ? 5.359   -11.774 2.548   1.00 0.00 ? 39  GLY A N    3  
ATOM   3494  C CA   . GLY A 1 39  ? 4.141   -11.187 2.016   1.00 0.00 ? 39  GLY A CA   3  
ATOM   3495  C C    . GLY A 1 39  ? 3.853   -9.834  2.669   1.00 0.00 ? 39  GLY A C    3  
ATOM   3496  O O    . GLY A 1 39  ? 4.002   -9.681  3.881   1.00 0.00 ? 39  GLY A O    3  
ATOM   3497  H H    . GLY A 1 39  ? 5.758   -11.288 3.326   1.00 0.00 ? 39  GLY A H    3  
ATOM   3498  H HA2  . GLY A 1 39  ? 4.235   -11.061 0.937   1.00 0.00 ? 39  GLY A HA2  3  
ATOM   3499  H HA3  . GLY A 1 39  ? 3.303   -11.863 2.184   1.00 0.00 ? 39  GLY A HA3  3  
ATOM   3500  N N    . ILE A 1 40  ? 3.448   -8.885  1.838   1.00 0.00 ? 40  ILE A N    3  
ATOM   3501  C CA   . ILE A 1 40  ? 3.139   -7.549  2.321   1.00 0.00 ? 40  ILE A CA   3  
ATOM   3502  C C    . ILE A 1 40  ? 1.620   -7.380  2.400   1.00 0.00 ? 40  ILE A C    3  
ATOM   3503  O O    . ILE A 1 40  ? 0.885   -7.957  1.600   1.00 0.00 ? 40  ILE A O    3  
ATOM   3504  C CB   . ILE A 1 40  ? 3.831   -6.495  1.457   1.00 0.00 ? 40  ILE A CB   3  
ATOM   3505  C CG1  . ILE A 1 40  ? 5.173   -7.010  0.930   1.00 0.00 ? 40  ILE A CG1  3  
ATOM   3506  C CG2  . ILE A 1 40  ? 3.983   -5.175  2.217   1.00 0.00 ? 40  ILE A CG2  3  
ATOM   3507  C CD1  . ILE A 1 40  ? 5.453   -6.473  -0.474  1.00 0.00 ? 40  ILE A CD1  3  
ATOM   3508  H H    . ILE A 1 40  ? 3.331   -9.017  0.854   1.00 0.00 ? 40  ILE A H    3  
ATOM   3509  H HA   . ILE A 1 40  ? 3.549   -7.462  3.326   1.00 0.00 ? 40  ILE A HA   3  
ATOM   3510  H HB   . ILE A 1 40  ? 3.200   -6.294  0.590   1.00 0.00 ? 40  ILE A HB   3  
ATOM   3511  H HG12 . ILE A 1 40  ? 5.972   -6.708  1.605   1.00 0.00 ? 40  ILE A HG12 3  
ATOM   3512  H HG13 . ILE A 1 40  ? 5.164   -8.100  0.912   1.00 0.00 ? 40  ILE A HG13 3  
ATOM   3513  H HG21 . ILE A 1 40  ? 4.297   -5.381  3.242   1.00 0.00 ? 40  ILE A HG21 3  
ATOM   3514  H HG22 . ILE A 1 40  ? 4.733   -4.556  1.726   1.00 0.00 ? 40  ILE A HG22 3  
ATOM   3515  H HG23 . ILE A 1 40  ? 3.029   -4.650  2.228   1.00 0.00 ? 40  ILE A HG23 3  
ATOM   3516  H HD11 . ILE A 1 40  ? 4.515   -6.170  -0.942  1.00 0.00 ? 40  ILE A HD11 3  
ATOM   3517  H HD12 . ILE A 1 40  ? 6.121   -5.614  -0.409  1.00 0.00 ? 40  ILE A HD12 3  
ATOM   3518  H HD13 . ILE A 1 40  ? 5.923   -7.253  -1.075  1.00 0.00 ? 40  ILE A HD13 3  
ATOM   3519  N N    . TYR A 1 41  ? 1.195   -6.586  3.371   1.00 0.00 ? 41  TYR A N    3  
ATOM   3520  C CA   . TYR A 1 41  ? -0.222  -6.334  3.566   1.00 0.00 ? 41  TYR A CA   3  
ATOM   3521  C C    . TYR A 1 41  ? -0.457  -4.925  4.116   1.00 0.00 ? 41  TYR A C    3  
ATOM   3522  O O    . TYR A 1 41  ? 0.443   -4.325  4.699   1.00 0.00 ? 41  TYR A O    3  
ATOM   3523  C CB   . TYR A 1 41  ? -0.695  -7.357  4.597   1.00 0.00 ? 41  TYR A CB   3  
ATOM   3524  C CG   . TYR A 1 41  ? -0.425  -8.810  4.204   1.00 0.00 ? 41  TYR A CG   3  
ATOM   3525  C CD1  . TYR A 1 41  ? -1.152  -9.396  3.186   1.00 0.00 ? 41  TYR A CD1  3  
ATOM   3526  C CD2  . TYR A 1 41  ? 0.547   -9.535  4.863   1.00 0.00 ? 41  TYR A CD2  3  
ATOM   3527  C CE1  . TYR A 1 41  ? -0.897  -10.764 2.814   1.00 0.00 ? 41  TYR A CE1  3  
ATOM   3528  C CE2  . TYR A 1 41  ? 0.801   -10.903 4.490   1.00 0.00 ? 41  TYR A CE2  3  
ATOM   3529  C CZ   . TYR A 1 41  ? 0.066   -11.450 3.485   1.00 0.00 ? 41  TYR A CZ   3  
ATOM   3530  O OH   . TYR A 1 41  ? 0.307   -12.741 3.133   1.00 0.00 ? 41  TYR A OH   3  
ATOM   3531  H H    . TYR A 1 41  ? 1.801   -6.121  4.018   1.00 0.00 ? 41  TYR A H    3  
ATOM   3532  H HA   . TYR A 1 41  ? -0.716  -6.424  2.598   1.00 0.00 ? 41  TYR A HA   3  
ATOM   3533  H HB2  . TYR A 1 41  ? -0.204  -7.153  5.550   1.00 0.00 ? 41  TYR A HB2  3  
ATOM   3534  H HB3  . TYR A 1 41  ? -1.765  -7.228  4.758   1.00 0.00 ? 41  TYR A HB3  3  
ATOM   3535  H HD1  . TYR A 1 41  ? -1.919  -8.824  2.664   1.00 0.00 ? 41  TYR A HD1  3  
ATOM   3536  H HD2  . TYR A 1 41  ? 1.120   -9.074  5.666   1.00 0.00 ? 41  TYR A HD2  3  
ATOM   3537  H HE1  . TYR A 1 41  ? -1.464  -11.238 2.013   1.00 0.00 ? 41  TYR A HE1  3  
ATOM   3538  H HE2  . TYR A 1 41  ? 1.565   -11.488 5.004   1.00 0.00 ? 41  TYR A HE2  3  
ATOM   3539  H HH   . TYR A 1 41  ? -0.427  -13.078 2.542   1.00 0.00 ? 41  TYR A HH   3  
ATOM   3540  N N    . VAL A 1 42  ? -1.672  -4.440  3.910   1.00 0.00 ? 42  VAL A N    3  
ATOM   3541  C CA   . VAL A 1 42  ? -2.039  -3.113  4.380   1.00 0.00 ? 42  VAL A CA   3  
ATOM   3542  C C    . VAL A 1 42  ? -2.764  -3.234  5.721   1.00 0.00 ? 42  VAL A C    3  
ATOM   3543  O O    . VAL A 1 42  ? -3.770  -3.933  5.825   1.00 0.00 ? 42  VAL A O    3  
ATOM   3544  C CB   . VAL A 1 42  ? -2.866  -2.392  3.313   1.00 0.00 ? 42  VAL A CB   3  
ATOM   3545  C CG1  . VAL A 1 42  ? -3.409  -1.065  3.848   1.00 0.00 ? 42  VAL A CG1  3  
ATOM   3546  C CG2  . VAL A 1 42  ? -2.049  -2.177  2.038   1.00 0.00 ? 42  VAL A CG2  3  
ATOM   3547  H H    . VAL A 1 42  ? -2.400  -4.935  3.435   1.00 0.00 ? 42  VAL A H    3  
ATOM   3548  H HA   . VAL A 1 42  ? -1.116  -2.552  4.528   1.00 0.00 ? 42  VAL A HA   3  
ATOM   3549  H HB   . VAL A 1 42  ? -3.717  -3.026  3.063   1.00 0.00 ? 42  VAL A HB   3  
ATOM   3550  H HG11 . VAL A 1 42  ? -2.609  -0.325  3.863   1.00 0.00 ? 42  VAL A HG11 3  
ATOM   3551  H HG12 . VAL A 1 42  ? -4.215  -0.716  3.201   1.00 0.00 ? 42  VAL A HG12 3  
ATOM   3552  H HG13 . VAL A 1 42  ? -3.791  -1.210  4.859   1.00 0.00 ? 42  VAL A HG13 3  
ATOM   3553  H HG21 . VAL A 1 42  ? -1.288  -1.418  2.218   1.00 0.00 ? 42  VAL A HG21 3  
ATOM   3554  H HG22 . VAL A 1 42  ? -1.569  -3.113  1.751   1.00 0.00 ? 42  VAL A HG22 3  
ATOM   3555  H HG23 . VAL A 1 42  ? -2.708  -1.846  1.236   1.00 0.00 ? 42  VAL A HG23 3  
ATOM   3556  N N    . LYS A 1 43  ? -2.225  -2.539  6.713   1.00 0.00 ? 43  LYS A N    3  
ATOM   3557  C CA   . LYS A 1 43  ? -2.809  -2.561  8.042   1.00 0.00 ? 43  LYS A CA   3  
ATOM   3558  C C    . LYS A 1 43  ? -4.092  -1.726  8.045   1.00 0.00 ? 43  LYS A C    3  
ATOM   3559  O O    . LYS A 1 43  ? -5.180  -2.252  8.272   1.00 0.00 ? 43  LYS A O    3  
ATOM   3560  C CB   . LYS A 1 43  ? -1.783  -2.113  9.086   1.00 0.00 ? 43  LYS A CB   3  
ATOM   3561  C CG   . LYS A 1 43  ? -2.393  -2.114  10.489  1.00 0.00 ? 43  LYS A CG   3  
ATOM   3562  C CD   . LYS A 1 43  ? -1.886  -0.924  11.306  1.00 0.00 ? 43  LYS A CD   3  
ATOM   3563  C CE   . LYS A 1 43  ? -1.848  -1.259  12.799  1.00 0.00 ? 43  LYS A CE   3  
ATOM   3564  N NZ   . LYS A 1 43  ? -3.071  -0.770  13.472  1.00 0.00 ? 43  LYS A NZ   3  
ATOM   3565  H H    . LYS A 1 43  ? -1.407  -1.975  6.618   1.00 0.00 ? 43  LYS A H    3  
ATOM   3566  H HA   . LYS A 1 43  ? -3.070  -3.595  8.269   1.00 0.00 ? 43  LYS A HA   3  
ATOM   3567  H HB2  . LYS A 1 43  ? -0.920  -2.778  9.060   1.00 0.00 ? 43  LYS A HB2  3  
ATOM   3568  H HB3  . LYS A 1 43  ? -1.422  -1.115  8.842   1.00 0.00 ? 43  LYS A HB3  3  
ATOM   3569  H HG2  . LYS A 1 43  ? -3.479  -2.075  10.419  1.00 0.00 ? 43  LYS A HG2  3  
ATOM   3570  H HG3  . LYS A 1 43  ? -2.139  -3.044  10.999  1.00 0.00 ? 43  LYS A HG3  3  
ATOM   3571  H HD2  . LYS A 1 43  ? -0.889  -0.642  10.967  1.00 0.00 ? 43  LYS A HD2  3  
ATOM   3572  H HD3  . LYS A 1 43  ? -2.534  -0.063  11.141  1.00 0.00 ? 43  LYS A HD3  3  
ATOM   3573  H HE2  . LYS A 1 43  ? -1.758  -2.337  12.933  1.00 0.00 ? 43  LYS A HE2  3  
ATOM   3574  H HE3  . LYS A 1 43  ? -0.968  -0.807  13.256  1.00 0.00 ? 43  LYS A HE3  3  
ATOM   3575  H HZ1  . LYS A 1 43  ? -2.821  -0.303  14.320  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM   3576  H HZ2  . LYS A 1 43  ? -3.551  -0.132  12.870  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM   3577  H HZ3  . LYS A 1 43  ? -3.669  -1.544  13.681  1.00 0.00 ? 43  LYS A HZ3  3  
ATOM   3578  N N    . SER A 1 44  ? -3.920  -0.436  7.791   1.00 0.00 ? 44  SER A N    3  
ATOM   3579  C CA   . SER A 1 44  ? -5.051  0.477   7.761   1.00 0.00 ? 44  SER A CA   3  
ATOM   3580  C C    . SER A 1 44  ? -4.563  1.905   7.510   1.00 0.00 ? 44  SER A C    3  
ATOM   3581  O O    . SER A 1 44  ? -3.359  2.150   7.436   1.00 0.00 ? 44  SER A O    3  
ATOM   3582  C CB   . SER A 1 44  ? -5.847  0.411   9.064   1.00 0.00 ? 44  SER A CB   3  
ATOM   3583  O OG   . SER A 1 44  ? -5.200  1.112   10.123  1.00 0.00 ? 44  SER A OG   3  
ATOM   3584  H H    . SER A 1 44  ? -3.032  -0.015  7.608   1.00 0.00 ? 44  SER A H    3  
ATOM   3585  H HA   . SER A 1 44  ? -5.675  0.135   6.936   1.00 0.00 ? 44  SER A HA   3  
ATOM   3586  H HB2  . SER A 1 44  ? -6.840  0.831   8.905   1.00 0.00 ? 44  SER A HB2  3  
ATOM   3587  H HB3  . SER A 1 44  ? -5.986  -0.632  9.351   1.00 0.00 ? 44  SER A HB3  3  
ATOM   3588  H HG   . SER A 1 44  ? -5.397  2.091   10.056  1.00 0.00 ? 44  SER A HG   3  
ATOM   3589  N N    . VAL A 1 45  ? -5.521  2.811   7.385   1.00 0.00 ? 45  VAL A N    3  
ATOM   3590  C CA   . VAL A 1 45  ? -5.204  4.208   7.144   1.00 0.00 ? 45  VAL A CA   3  
ATOM   3591  C C    . VAL A 1 45  ? -5.334  4.990   8.453   1.00 0.00 ? 45  VAL A C    3  
ATOM   3592  O O    . VAL A 1 45  ? -6.363  4.919   9.123   1.00 0.00 ? 45  VAL A O    3  
ATOM   3593  C CB   . VAL A 1 45  ? -6.091  4.761   6.027   1.00 0.00 ? 45  VAL A CB   3  
ATOM   3594  C CG1  . VAL A 1 45  ? -6.012  3.882   4.778   1.00 0.00 ? 45  VAL A CG1  3  
ATOM   3595  C CG2  . VAL A 1 45  ? -7.539  4.911   6.501   1.00 0.00 ? 45  VAL A CG2  3  
ATOM   3596  H H    . VAL A 1 45  ? -6.498  2.605   7.446   1.00 0.00 ? 45  VAL A H    3  
ATOM   3597  H HA   . VAL A 1 45  ? -4.168  4.258   6.807   1.00 0.00 ? 45  VAL A HA   3  
ATOM   3598  H HB   . VAL A 1 45  ? -5.721  5.752   5.764   1.00 0.00 ? 45  VAL A HB   3  
ATOM   3599  H HG11 . VAL A 1 45  ? -5.565  2.922   5.036   1.00 0.00 ? 45  VAL A HG11 3  
ATOM   3600  H HG12 . VAL A 1 45  ? -7.013  3.723   4.381   1.00 0.00 ? 45  VAL A HG12 3  
ATOM   3601  H HG13 . VAL A 1 45  ? -5.397  4.376   4.025   1.00 0.00 ? 45  VAL A HG13 3  
ATOM   3602  H HG21 . VAL A 1 45  ? -7.684  4.331   7.413   1.00 0.00 ? 45  VAL A HG21 3  
ATOM   3603  H HG22 . VAL A 1 45  ? -7.749  5.962   6.701   1.00 0.00 ? 45  VAL A HG22 3  
ATOM   3604  H HG23 . VAL A 1 45  ? -8.214  4.547   5.727   1.00 0.00 ? 45  VAL A HG23 3  
ATOM   3605  N N    . VAL A 1 46  ? -4.274  5.717   8.778   1.00 0.00 ? 46  VAL A N    3  
ATOM   3606  C CA   . VAL A 1 46  ? -4.258  6.511   9.996   1.00 0.00 ? 46  VAL A CA   3  
ATOM   3607  C C    . VAL A 1 46  ? -5.617  7.187   10.177  1.00 0.00 ? 46  VAL A C    3  
ATOM   3608  O O    . VAL A 1 46  ? -6.032  7.461   11.303  1.00 0.00 ? 46  VAL A O    3  
ATOM   3609  C CB   . VAL A 1 46  ? -3.096  7.507   9.955   1.00 0.00 ? 46  VAL A CB   3  
ATOM   3610  C CG1  . VAL A 1 46  ? -3.413  8.754   10.782  1.00 0.00 ? 46  VAL A CG1  3  
ATOM   3611  C CG2  . VAL A 1 46  ? -1.797  6.851   10.428  1.00 0.00 ? 46  VAL A CG2  3  
ATOM   3612  H H    . VAL A 1 46  ? -3.441  5.769   8.228   1.00 0.00 ? 46  VAL A H    3  
ATOM   3613  H HA   . VAL A 1 46  ? -4.088  5.829   10.830  1.00 0.00 ? 46  VAL A HA   3  
ATOM   3614  H HB   . VAL A 1 46  ? -2.956  7.816   8.919   1.00 0.00 ? 46  VAL A HB   3  
ATOM   3615  H HG11 . VAL A 1 46  ? -3.531  8.475   11.829  1.00 0.00 ? 46  VAL A HG11 3  
ATOM   3616  H HG12 . VAL A 1 46  ? -2.598  9.470   10.685  1.00 0.00 ? 46  VAL A HG12 3  
ATOM   3617  H HG13 . VAL A 1 46  ? -4.338  9.203   10.419  1.00 0.00 ? 46  VAL A HG13 3  
ATOM   3618  H HG21 . VAL A 1 46  ? -1.004  7.599   10.466  1.00 0.00 ? 46  VAL A HG21 3  
ATOM   3619  H HG22 . VAL A 1 46  ? -1.943  6.427   11.420  1.00 0.00 ? 46  VAL A HG22 3  
ATOM   3620  H HG23 . VAL A 1 46  ? -1.514  6.060   9.732   1.00 0.00 ? 46  VAL A HG23 3  
ATOM   3621  N N    . LYS A 1 47  ? -6.275  7.436   9.054   1.00 0.00 ? 47  LYS A N    3  
ATOM   3622  C CA   . LYS A 1 47  ? -7.579  8.075   9.076   1.00 0.00 ? 47  LYS A CA   3  
ATOM   3623  C C    . LYS A 1 47  ? -7.409  9.562   9.395   1.00 0.00 ? 47  LYS A C    3  
ATOM   3624  O O    . LYS A 1 47  ? -8.275  10.169  10.023  1.00 0.00 ? 47  LYS A O    3  
ATOM   3625  C CB   . LYS A 1 47  ? -8.518  7.344   10.038  1.00 0.00 ? 47  LYS A CB   3  
ATOM   3626  C CG   . LYS A 1 47  ? -9.960  7.823   9.868   1.00 0.00 ? 47  LYS A CG   3  
ATOM   3627  C CD   . LYS A 1 47  ? -10.781 6.818   9.057   1.00 0.00 ? 47  LYS A CD   3  
ATOM   3628  C CE   . LYS A 1 47  ? -12.149 7.395   8.691   1.00 0.00 ? 47  LYS A CE   3  
ATOM   3629  N NZ   . LYS A 1 47  ? -12.681 6.739   7.476   1.00 0.00 ? 47  LYS A NZ   3  
ATOM   3630  H H    . LYS A 1 47  ? -5.929  7.211   8.143   1.00 0.00 ? 47  LYS A H    3  
ATOM   3631  H HA   . LYS A 1 47  ? -8.005  7.983   8.077   1.00 0.00 ? 47  LYS A HA   3  
ATOM   3632  H HB2  . LYS A 1 47  ? -8.464  6.268   9.858   1.00 0.00 ? 47  LYS A HB2  3  
ATOM   3633  H HB3  . LYS A 1 47  ? -8.194  7.510   11.066  1.00 0.00 ? 47  LYS A HB3  3  
ATOM   3634  H HG2  . LYS A 1 47  ? -10.417 7.967   10.845  1.00 0.00 ? 47  LYS A HG2  3  
ATOM   3635  H HG3  . LYS A 1 47  ? -9.967  8.791   9.365   1.00 0.00 ? 47  LYS A HG3  3  
ATOM   3636  H HD2  . LYS A 1 47  ? -10.241 6.550   8.148   1.00 0.00 ? 47  LYS A HD2  3  
ATOM   3637  H HD3  . LYS A 1 47  ? -10.910 5.901   9.633   1.00 0.00 ? 47  LYS A HD3  3  
ATOM   3638  H HE2  . LYS A 1 47  ? -12.844 7.254   9.521   1.00 0.00 ? 47  LYS A HE2  3  
ATOM   3639  H HE3  . LYS A 1 47  ? -12.065 8.469   8.526   1.00 0.00 ? 47  LYS A HE3  3  
ATOM   3640  H HZ1  . LYS A 1 47  ? -12.255 5.840   7.369   1.00 0.00 ? 47  LYS A HZ1  3  
ATOM   3641  H HZ2  . LYS A 1 47  ? -13.672 6.630   7.562   1.00 0.00 ? 47  LYS A HZ2  3  
ATOM   3642  H HZ3  . LYS A 1 47  ? -12.476 7.303   6.676   1.00 0.00 ? 47  LYS A HZ3  3  
ATOM   3643  N N    . GLY A 1 48  ? -6.286  10.106  8.947   1.00 0.00 ? 48  GLY A N    3  
ATOM   3644  C CA   . GLY A 1 48  ? -5.991  11.509  9.179   1.00 0.00 ? 48  GLY A CA   3  
ATOM   3645  C C    . GLY A 1 48  ? -4.848  11.984  8.279   1.00 0.00 ? 48  GLY A C    3  
ATOM   3646  O O    . GLY A 1 48  ? -4.111  12.901  8.639   1.00 0.00 ? 48  GLY A O    3  
ATOM   3647  H H    . GLY A 1 48  ? -5.587  9.605   8.438   1.00 0.00 ? 48  GLY A H    3  
ATOM   3648  H HA2  . GLY A 1 48  ? -6.881  12.109  8.986   1.00 0.00 ? 48  GLY A HA2  3  
ATOM   3649  H HA3  . GLY A 1 48  ? -5.726  11.662  10.224  1.00 0.00 ? 48  GLY A HA3  3  
ATOM   3650  N N    . GLY A 1 49  ? -4.734  11.336  7.129   1.00 0.00 ? 49  GLY A N    3  
ATOM   3651  C CA   . GLY A 1 49  ? -3.692  11.681  6.176   1.00 0.00 ? 49  GLY A CA   3  
ATOM   3652  C C    . GLY A 1 49  ? -4.295  12.110  4.837   1.00 0.00 ? 49  GLY A C    3  
ATOM   3653  O O    . GLY A 1 49  ? -5.513  12.093  4.666   1.00 0.00 ? 49  GLY A O    3  
ATOM   3654  H H    . GLY A 1 49  ? -5.337  10.592  6.844   1.00 0.00 ? 49  GLY A H    3  
ATOM   3655  H HA2  . GLY A 1 49  ? -3.079  12.488  6.579   1.00 0.00 ? 49  GLY A HA2  3  
ATOM   3656  H HA3  . GLY A 1 49  ? -3.035  10.825  6.027   1.00 0.00 ? 49  GLY A HA3  3  
ATOM   3657  N N    . ALA A 1 50  ? -3.413  12.484  3.920   1.00 0.00 ? 50  ALA A N    3  
ATOM   3658  C CA   . ALA A 1 50  ? -3.843  12.918  2.602   1.00 0.00 ? 50  ALA A CA   3  
ATOM   3659  C C    . ALA A 1 50  ? -4.406  11.719  1.836   1.00 0.00 ? 50  ALA A C    3  
ATOM   3660  O O    . ALA A 1 50  ? -5.599  11.673  1.539   1.00 0.00 ? 50  ALA A O    3  
ATOM   3661  C CB   . ALA A 1 50  ? -2.667  13.574  1.873   1.00 0.00 ? 50  ALA A CB   3  
ATOM   3662  H H    . ALA A 1 50  ? -2.424  12.495  4.069   1.00 0.00 ? 50  ALA A H    3  
ATOM   3663  H HA   . ALA A 1 50  ? -4.631  13.657  2.736   1.00 0.00 ? 50  ALA A HA   3  
ATOM   3664  H HB1  . ALA A 1 50  ? -2.681  13.281  0.824   1.00 0.00 ? 50  ALA A HB1  3  
ATOM   3665  H HB2  . ALA A 1 50  ? -2.757  14.659  1.948   1.00 0.00 ? 50  ALA A HB2  3  
ATOM   3666  H HB3  . ALA A 1 50  ? -1.732  13.253  2.330   1.00 0.00 ? 50  ALA A HB3  3  
ATOM   3667  N N    . ALA A 1 51  ? -3.523  10.780  1.536   1.00 0.00 ? 51  ALA A N    3  
ATOM   3668  C CA   . ALA A 1 51  ? -3.916  9.584   0.810   1.00 0.00 ? 51  ALA A CA   3  
ATOM   3669  C C    . ALA A 1 51  ? -4.745  8.685   1.728   1.00 0.00 ? 51  ALA A C    3  
ATOM   3670  O O    . ALA A 1 51  ? -5.256  7.651   1.297   1.00 0.00 ? 51  ALA A O    3  
ATOM   3671  C CB   . ALA A 1 51  ? -2.670  8.878   0.272   1.00 0.00 ? 51  ALA A CB   3  
ATOM   3672  H H    . ALA A 1 51  ? -2.553  10.824  1.780   1.00 0.00 ? 51  ALA A H    3  
ATOM   3673  H HA   . ALA A 1 51  ? -4.535  9.897   -0.033  1.00 0.00 ? 51  ALA A HA   3  
ATOM   3674  H HB1  . ALA A 1 51  ? -1.780  9.367   0.664   1.00 0.00 ? 51  ALA A HB1  3  
ATOM   3675  H HB2  . ALA A 1 51  ? -2.681  7.833   0.587   1.00 0.00 ? 51  ALA A HB2  3  
ATOM   3676  H HB3  . ALA A 1 51  ? -2.666  8.929   -0.816  1.00 0.00 ? 51  ALA A HB3  3  
ATOM   3677  N N    . ASP A 1 52  ? -4.855  9.110   2.978   1.00 0.00 ? 52  ASP A N    3  
ATOM   3678  C CA   . ASP A 1 52  ? -5.614  8.356   3.963   1.00 0.00 ? 52  ASP A CA   3  
ATOM   3679  C C    . ASP A 1 52  ? -7.106  8.642   3.779   1.00 0.00 ? 52  ASP A C    3  
ATOM   3680  O O    . ASP A 1 52  ? -7.910  7.718   3.669   1.00 0.00 ? 52  ASP A O    3  
ATOM   3681  C CB   . ASP A 1 52  ? -5.227  8.761   5.386   1.00 0.00 ? 52  ASP A CB   3  
ATOM   3682  C CG   . ASP A 1 52  ? -4.464  7.696   6.177   1.00 0.00 ? 52  ASP A CG   3  
ATOM   3683  O OD1  . ASP A 1 52  ? -3.881  6.809   5.517   1.00 0.00 ? 52  ASP A OD1  3  
ATOM   3684  O OD2  . ASP A 1 52  ? -4.484  7.792   7.423   1.00 0.00 ? 52  ASP A OD2  3  
ATOM   3685  H H    . ASP A 1 52  ? -4.438  9.952   3.321   1.00 0.00 ? 52  ASP A H    3  
ATOM   3686  H HA   . ASP A 1 52  ? -5.364  7.312   3.777   1.00 0.00 ? 52  ASP A HA   3  
ATOM   3687  H HB2  . ASP A 1 52  ? -4.614  9.662   5.336   1.00 0.00 ? 52  ASP A HB2  3  
ATOM   3688  H HB3  . ASP A 1 52  ? -6.132  9.021   5.932   1.00 0.00 ? 52  ASP A HB3  3  
ATOM   3689  N N    . VAL A 1 53  ? -7.430  9.927   3.749   1.00 0.00 ? 53  VAL A N    3  
ATOM   3690  C CA   . VAL A 1 53  ? -8.811  10.346  3.580   1.00 0.00 ? 53  VAL A CA   3  
ATOM   3691  C C    . VAL A 1 53  ? -9.185  10.272  2.099   1.00 0.00 ? 53  VAL A C    3  
ATOM   3692  O O    . VAL A 1 53  ? -10.331 9.988   1.758   1.00 0.00 ? 53  VAL A O    3  
ATOM   3693  C CB   . VAL A 1 53  ? -9.011  11.740  4.178   1.00 0.00 ? 53  VAL A CB   3  
ATOM   3694  C CG1  . VAL A 1 53  ? -10.495 12.108  4.229   1.00 0.00 ? 53  VAL A CG1  3  
ATOM   3695  C CG2  . VAL A 1 53  ? -8.376  11.837  5.568   1.00 0.00 ? 53  VAL A CG2  3  
ATOM   3696  H H    . VAL A 1 53  ? -6.769  10.673  3.839   1.00 0.00 ? 53  VAL A H    3  
ATOM   3697  H HA   . VAL A 1 53  ? -9.436  9.648   4.136   1.00 0.00 ? 53  VAL A HA   3  
ATOM   3698  H HB   . VAL A 1 53  ? -8.509  12.458  3.530   1.00 0.00 ? 53  VAL A HB   3  
ATOM   3699  H HG11 . VAL A 1 53  ? -10.867 11.984  5.245   1.00 0.00 ? 53  VAL A HG11 3  
ATOM   3700  H HG12 . VAL A 1 53  ? -10.622 13.147  3.919   1.00 0.00 ? 53  VAL A HG12 3  
ATOM   3701  H HG13 . VAL A 1 53  ? -11.053 11.458  3.554   1.00 0.00 ? 53  VAL A HG13 3  
ATOM   3702  H HG21 . VAL A 1 53  ? -9.007  11.323  6.293   1.00 0.00 ? 53  VAL A HG21 3  
ATOM   3703  H HG22 . VAL A 1 53  ? -7.391  11.372  5.550   1.00 0.00 ? 53  VAL A HG22 3  
ATOM   3704  H HG23 . VAL A 1 53  ? -8.277  12.886  5.849   1.00 0.00 ? 53  VAL A HG23 3  
ATOM   3705  N N    . ASP A 1 54  ? -8.194  10.534  1.258   1.00 0.00 ? 54  ASP A N    3  
ATOM   3706  C CA   . ASP A 1 54  ? -8.405  10.501  -0.179  1.00 0.00 ? 54  ASP A CA   3  
ATOM   3707  C C    . ASP A 1 54  ? -8.376  9.048   -0.661  1.00 0.00 ? 54  ASP A C    3  
ATOM   3708  O O    . ASP A 1 54  ? -9.326  8.576   -1.281  1.00 0.00 ? 54  ASP A O    3  
ATOM   3709  C CB   . ASP A 1 54  ? -7.303  11.265  -0.915  1.00 0.00 ? 54  ASP A CB   3  
ATOM   3710  C CG   . ASP A 1 54  ? -7.577  11.529  -2.397  1.00 0.00 ? 54  ASP A CG   3  
ATOM   3711  O OD1  . ASP A 1 54  ? -8.775  11.605  -2.747  1.00 0.00 ? 54  ASP A OD1  3  
ATOM   3712  O OD2  . ASP A 1 54  ? -6.583  11.648  -3.146  1.00 0.00 ? 54  ASP A OD2  3  
ATOM   3713  H H    . ASP A 1 54  ? -7.264  10.766  1.543   1.00 0.00 ? 54  ASP A H    3  
ATOM   3714  H HA   . ASP A 1 54  ? -9.374  10.973  -0.338  1.00 0.00 ? 54  ASP A HA   3  
ATOM   3715  H HB2  . ASP A 1 54  ? -7.149  12.221  -0.414  1.00 0.00 ? 54  ASP A HB2  3  
ATOM   3716  H HB3  . ASP A 1 54  ? -6.371  10.705  -0.828  1.00 0.00 ? 54  ASP A HB3  3  
ATOM   3717  N N    . GLY A 1 55  ? -7.272  8.380   -0.356  1.00 0.00 ? 55  GLY A N    3  
ATOM   3718  C CA   . GLY A 1 55  ? -7.106  6.992   -0.751  1.00 0.00 ? 55  GLY A CA   3  
ATOM   3719  C C    . GLY A 1 55  ? -8.290  6.143   -0.281  1.00 0.00 ? 55  GLY A C    3  
ATOM   3720  O O    . GLY A 1 55  ? -8.954  5.496   -1.090  1.00 0.00 ? 55  GLY A O    3  
ATOM   3721  H H    . GLY A 1 55  ? -6.503  8.770   0.149   1.00 0.00 ? 55  GLY A H    3  
ATOM   3722  H HA2  . GLY A 1 55  ? -7.015  6.926   -1.835  1.00 0.00 ? 55  GLY A HA2  3  
ATOM   3723  H HA3  . GLY A 1 55  ? -6.181  6.599   -0.328  1.00 0.00 ? 55  GLY A HA3  3  
ATOM   3724  N N    . ARG A 1 56  ? -8.518  6.174   1.023   1.00 0.00 ? 56  ARG A N    3  
ATOM   3725  C CA   . ARG A 1 56  ? -9.610  5.415   1.610   1.00 0.00 ? 56  ARG A CA   3  
ATOM   3726  C C    . ARG A 1 56  ? -9.498  3.939   1.225   1.00 0.00 ? 56  ARG A C    3  
ATOM   3727  O O    . ARG A 1 56  ? -10.494 3.306   0.880   1.00 0.00 ? 56  ARG A O    3  
ATOM   3728  C CB   . ARG A 1 56  ? -10.965 5.954   1.146   1.00 0.00 ? 56  ARG A CB   3  
ATOM   3729  C CG   . ARG A 1 56  ? -12.099 5.407   2.017   1.00 0.00 ? 56  ARG A CG   3  
ATOM   3730  C CD   . ARG A 1 56  ? -13.250 4.888   1.154   1.00 0.00 ? 56  ARG A CD   3  
ATOM   3731  N NE   . ARG A 1 56  ? -14.510 5.574   1.523   1.00 0.00 ? 56  ARG A NE   3  
ATOM   3732  C CZ   . ARG A 1 56  ? -14.781 6.853   1.231   1.00 0.00 ? 56  ARG A CZ   3  
ATOM   3733  N NH1  . ARG A 1 56  ? -13.887 7.591   0.561   1.00 0.00 ? 56  ARG A NH1  3  
ATOM   3734  N NH2  . ARG A 1 56  ? -15.949 7.391   1.606   1.00 0.00 ? 56  ARG A NH2  3  
ATOM   3735  H H    . ARG A 1 56  ? -7.974  6.702   1.674   1.00 0.00 ? 56  ARG A H    3  
ATOM   3736  H HA   . ARG A 1 56  ? -9.497  5.550   2.685   1.00 0.00 ? 56  ARG A HA   3  
ATOM   3737  H HB2  . ARG A 1 56  ? -10.962 7.044   1.192   1.00 0.00 ? 56  ARG A HB2  3  
ATOM   3738  H HB3  . ARG A 1 56  ? -11.135 5.678   0.106   1.00 0.00 ? 56  ARG A HB3  3  
ATOM   3739  H HG2  . ARG A 1 56  ? -11.721 4.601   2.649   1.00 0.00 ? 56  ARG A HG2  3  
ATOM   3740  H HG3  . ARG A 1 56  ? -12.462 6.188   2.682   1.00 0.00 ? 56  ARG A HG3  3  
ATOM   3741  H HD2  . ARG A 1 56  ? -13.032 5.057   0.100   1.00 0.00 ? 56  ARG A HD2  3  
ATOM   3742  H HD3  . ARG A 1 56  ? -13.361 3.812   1.289   1.00 0.00 ? 56  ARG A HD3  3  
ATOM   3743  H HE   . ARG A 1 56  ? -15.199 5.050   2.025   1.00 0.00 ? 56  ARG A HE   3  
ATOM   3744  H HH11 . ARG A 1 56  ? -13.015 7.189   0.281   1.00 0.00 ? 56  ARG A HH11 3  
ATOM   3745  H HH12 . ARG A 1 56  ? -14.091 8.546   0.342   1.00 0.00 ? 56  ARG A HH12 3  
ATOM   3746  H HH21 . ARG A 1 56  ? -16.617 6.839   2.106   1.00 0.00 ? 56  ARG A HH21 3  
ATOM   3747  H HH22 . ARG A 1 56  ? -16.153 8.345   1.386   1.00 0.00 ? 56  ARG A HH22 3  
ATOM   3748  N N    . LEU A 1 57  ? -8.276  3.433   1.298   1.00 0.00 ? 57  LEU A N    3  
ATOM   3749  C CA   . LEU A 1 57  ? -8.020  2.042   0.963   1.00 0.00 ? 57  LEU A CA   3  
ATOM   3750  C C    . LEU A 1 57  ? -8.605  1.142   2.053   1.00 0.00 ? 57  LEU A C    3  
ATOM   3751  O O    . LEU A 1 57  ? -9.014  1.627   3.108   1.00 0.00 ? 57  LEU A O    3  
ATOM   3752  C CB   . LEU A 1 57  ? -6.527  1.817   0.713   1.00 0.00 ? 57  LEU A CB   3  
ATOM   3753  C CG   . LEU A 1 57  ? -5.897  2.663   -0.396  1.00 0.00 ? 57  LEU A CG   3  
ATOM   3754  C CD1  . LEU A 1 57  ? -4.404  2.874   -0.142  1.00 0.00 ? 57  LEU A CD1  3  
ATOM   3755  C CD2  . LEU A 1 57  ? -6.164  2.046   -1.771  1.00 0.00 ? 57  LEU A CD2  3  
ATOM   3756  H H    . LEU A 1 57  ? -7.469  3.955   1.581   1.00 0.00 ? 57  LEU A H    3  
ATOM   3757  H HA   . LEU A 1 57  ? -8.538  1.831   0.027   1.00 0.00 ? 57  LEU A HA   3  
ATOM   3758  H HB2  . LEU A 1 57  ? -5.991  2.015   1.641   1.00 0.00 ? 57  LEU A HB2  3  
ATOM   3759  H HB3  . LEU A 1 57  ? -6.374  0.765   0.473   1.00 0.00 ? 57  LEU A HB3  3  
ATOM   3760  H HG   . LEU A 1 57  ? -6.368  3.645   -0.386  1.00 0.00 ? 57  LEU A HG   3  
ATOM   3761  H HD11 . LEU A 1 57  ? -3.830  2.442   -0.963  1.00 0.00 ? 57  LEU A HD11 3  
ATOM   3762  H HD12 . LEU A 1 57  ? -4.194  3.942   -0.076  1.00 0.00 ? 57  LEU A HD12 3  
ATOM   3763  H HD13 . LEU A 1 57  ? -4.122  2.389   0.792   1.00 0.00 ? 57  LEU A HD13 3  
ATOM   3764  H HD21 . LEU A 1 57  ? -6.070  2.817   -2.538  1.00 0.00 ? 57  LEU A HD21 3  
ATOM   3765  H HD22 . LEU A 1 57  ? -5.440  1.254   -1.961  1.00 0.00 ? 57  LEU A HD22 3  
ATOM   3766  H HD23 . LEU A 1 57  ? -7.171  1.632   -1.795  1.00 0.00 ? 57  LEU A HD23 3  
ATOM   3767  N N    . ALA A 1 58  ? -8.622  -0.150  1.763   1.00 0.00 ? 58  ALA A N    3  
ATOM   3768  C CA   . ALA A 1 58  ? -9.149  -1.120  2.706   1.00 0.00 ? 58  ALA A CA   3  
ATOM   3769  C C    . ALA A 1 58  ? -8.026  -1.584  3.636   1.00 0.00 ? 58  ALA A C    3  
ATOM   3770  O O    . ALA A 1 58  ? -6.864  -1.630  3.237   1.00 0.00 ? 58  ALA A O    3  
ATOM   3771  C CB   . ALA A 1 58  ? -9.788  -2.283  1.940   1.00 0.00 ? 58  ALA A CB   3  
ATOM   3772  H H    . ALA A 1 58  ? -8.286  -0.535  0.903   1.00 0.00 ? 58  ALA A H    3  
ATOM   3773  H HA   . ALA A 1 58  ? -9.919  -0.626  3.297   1.00 0.00 ? 58  ALA A HA   3  
ATOM   3774  H HB1  . ALA A 1 58  ? -9.006  -2.935  1.552   1.00 0.00 ? 58  ALA A HB1  3  
ATOM   3775  H HB2  . ALA A 1 58  ? -10.435 -2.847  2.612   1.00 0.00 ? 58  ALA A HB2  3  
ATOM   3776  H HB3  . ALA A 1 58  ? -10.378 -1.890  1.112   1.00 0.00 ? 58  ALA A HB3  3  
ATOM   3777  N N    . ALA A 1 59  ? -8.413  -1.915  4.858   1.00 0.00 ? 59  ALA A N    3  
ATOM   3778  C CA   . ALA A 1 59  ? -7.453  -2.374  5.850   1.00 0.00 ? 59  ALA A CA   3  
ATOM   3779  C C    . ALA A 1 59  ? -7.371  -3.901  5.807   1.00 0.00 ? 59  ALA A C    3  
ATOM   3780  O O    . ALA A 1 59  ? -8.353  -4.586  6.096   1.00 0.00 ? 59  ALA A O    3  
ATOM   3781  C CB   . ALA A 1 59  ? -7.852  -1.849  7.229   1.00 0.00 ? 59  ALA A CB   3  
ATOM   3782  H H    . ALA A 1 59  ? -9.360  -1.876  5.175   1.00 0.00 ? 59  ALA A H    3  
ATOM   3783  H HA   . ALA A 1 59  ? -6.480  -1.959  5.585   1.00 0.00 ? 59  ALA A HA   3  
ATOM   3784  H HB1  . ALA A 1 59  ? -7.144  -1.085  7.548   1.00 0.00 ? 59  ALA A HB1  3  
ATOM   3785  H HB2  . ALA A 1 59  ? -8.853  -1.418  7.178   1.00 0.00 ? 59  ALA A HB2  3  
ATOM   3786  H HB3  . ALA A 1 59  ? -7.847  -2.670  7.946   1.00 0.00 ? 59  ALA A HB3  3  
ATOM   3787  N N    . GLY A 1 60  ? -6.194  -4.390  5.445   1.00 0.00 ? 60  GLY A N    3  
ATOM   3788  C CA   . GLY A 1 60  ? -5.974  -5.824  5.361   1.00 0.00 ? 60  GLY A CA   3  
ATOM   3789  C C    . GLY A 1 60  ? -5.676  -6.249  3.922   1.00 0.00 ? 60  GLY A C    3  
ATOM   3790  O O    . GLY A 1 60  ? -5.857  -7.412  3.566   1.00 0.00 ? 60  GLY A O    3  
ATOM   3791  H H    . GLY A 1 60  ? -5.403  -3.826  5.212   1.00 0.00 ? 60  GLY A H    3  
ATOM   3792  H HA2  . GLY A 1 60  ? -5.142  -6.105  6.008   1.00 0.00 ? 60  GLY A HA2  3  
ATOM   3793  H HA3  . GLY A 1 60  ? -6.853  -6.352  5.727   1.00 0.00 ? 60  GLY A HA3  3  
ATOM   3794  N N    . ASP A 1 61  ? -5.223  -5.284  3.135   1.00 0.00 ? 61  ASP A N    3  
ATOM   3795  C CA   . ASP A 1 61  ? -4.899  -5.544  1.744   1.00 0.00 ? 61  ASP A CA   3  
ATOM   3796  C C    . ASP A 1 61  ? -3.579  -6.315  1.667   1.00 0.00 ? 61  ASP A C    3  
ATOM   3797  O O    . ASP A 1 61  ? -2.888  -6.471  2.672   1.00 0.00 ? 61  ASP A O    3  
ATOM   3798  C CB   . ASP A 1 61  ? -4.730  -4.239  0.964   1.00 0.00 ? 61  ASP A CB   3  
ATOM   3799  C CG   . ASP A 1 61  ? -5.850  -3.218  1.164   1.00 0.00 ? 61  ASP A CG   3  
ATOM   3800  O OD1  . ASP A 1 61  ? -6.927  -3.640  1.636   1.00 0.00 ? 61  ASP A OD1  3  
ATOM   3801  O OD2  . ASP A 1 61  ? -5.604  -2.035  0.841   1.00 0.00 ? 61  ASP A OD2  3  
ATOM   3802  H H    . ASP A 1 61  ? -5.078  -4.341  3.434   1.00 0.00 ? 61  ASP A H    3  
ATOM   3803  H HA   . ASP A 1 61  ? -5.739  -6.119  1.356   1.00 0.00 ? 61  ASP A HA   3  
ATOM   3804  H HB2  . ASP A 1 61  ? -3.784  -3.781  1.253   1.00 0.00 ? 61  ASP A HB2  3  
ATOM   3805  H HB3  . ASP A 1 61  ? -4.658  -4.475  -0.099  1.00 0.00 ? 61  ASP A HB3  3  
ATOM   3806  N N    . GLN A 1 62  ? -3.270  -6.779  0.464   1.00 0.00 ? 62  GLN A N    3  
ATOM   3807  C CA   . GLN A 1 62  ? -2.045  -7.530  0.245   1.00 0.00 ? 62  GLN A CA   3  
ATOM   3808  C C    . GLN A 1 62  ? -1.170  -6.825  -0.795  1.00 0.00 ? 62  GLN A C    3  
ATOM   3809  O O    . GLN A 1 62  ? -1.501  -6.806  -1.980  1.00 0.00 ? 62  GLN A O    3  
ATOM   3810  C CB   . GLN A 1 62  ? -2.352  -8.966  -0.180  1.00 0.00 ? 62  GLN A CB   3  
ATOM   3811  C CG   . GLN A 1 62  ? -1.068  -9.717  -0.544  1.00 0.00 ? 62  GLN A CG   3  
ATOM   3812  C CD   . GLN A 1 62  ? -1.295  -11.231 -0.525  1.00 0.00 ? 62  GLN A CD   3  
ATOM   3813  O OE1  . GLN A 1 62  ? -0.603  -11.981 0.142   1.00 0.00 ? 62  GLN A OE1  3  
ATOM   3814  N NE2  . GLN A 1 62  ? -2.303  -11.636 -1.294  1.00 0.00 ? 62  GLN A NE2  3  
ATOM   3815  H H    . GLN A 1 62  ? -3.837  -6.649  -0.348  1.00 0.00 ? 62  GLN A H    3  
ATOM   3816  H HA   . GLN A 1 62  ? -1.538  -7.543  1.208   1.00 0.00 ? 62  GLN A HA   3  
ATOM   3817  H HB2  . GLN A 1 62  ? -2.867  -9.486  0.629   1.00 0.00 ? 62  GLN A HB2  3  
ATOM   3818  H HB3  . GLN A 1 62  ? -3.029  -8.960  -1.036  1.00 0.00 ? 62  GLN A HB3  3  
ATOM   3819  H HG2  . GLN A 1 62  ? -0.729  -9.408  -1.532  1.00 0.00 ? 62  GLN A HG2  3  
ATOM   3820  H HG3  . GLN A 1 62  ? -0.280  -9.456  0.163   1.00 0.00 ? 62  GLN A HG3  3  
ATOM   3821  H HE21 . GLN A 1 62  ? -2.831  -10.969 -1.818  1.00 0.00 ? 62  GLN A HE21 3  
ATOM   3822  H HE22 . GLN A 1 62  ? -2.529  -12.608 -1.350  1.00 0.00 ? 62  GLN A HE22 3  
ATOM   3823  N N    . LEU A 1 63  ? -0.072  -6.264  -0.314  1.00 0.00 ? 63  LEU A N    3  
ATOM   3824  C CA   . LEU A 1 63  ? 0.853   -5.560  -1.185  1.00 0.00 ? 63  LEU A CA   3  
ATOM   3825  C C    . LEU A 1 63  ? 1.829   -6.563  -1.802  1.00 0.00 ? 63  LEU A C    3  
ATOM   3826  O O    . LEU A 1 63  ? 2.067   -7.630  -1.238  1.00 0.00 ? 63  LEU A O    3  
ATOM   3827  C CB   . LEU A 1 63  ? 1.538   -4.418  -0.432  1.00 0.00 ? 63  LEU A CB   3  
ATOM   3828  C CG   . LEU A 1 63  ? 2.696   -3.733  -1.162  1.00 0.00 ? 63  LEU A CG   3  
ATOM   3829  C CD1  . LEU A 1 63  ? 2.219   -2.471  -1.883  1.00 0.00 ? 63  LEU A CD1  3  
ATOM   3830  C CD2  . LEU A 1 63  ? 3.852   -3.442  -0.202  1.00 0.00 ? 63  LEU A CD2  3  
ATOM   3831  H H    . LEU A 1 63  ? 0.190   -6.284  0.651   1.00 0.00 ? 63  LEU A H    3  
ATOM   3832  H HA   . LEU A 1 63  ? 0.268   -5.110  -1.988  1.00 0.00 ? 63  LEU A HA   3  
ATOM   3833  H HB2  . LEU A 1 63  ? 0.787   -3.664  -0.196  1.00 0.00 ? 63  LEU A HB2  3  
ATOM   3834  H HB3  . LEU A 1 63  ? 1.910   -4.807  0.516   1.00 0.00 ? 63  LEU A HB3  3  
ATOM   3835  H HG   . LEU A 1 63  ? 3.073   -4.416  -1.921  1.00 0.00 ? 63  LEU A HG   3  
ATOM   3836  H HD11 . LEU A 1 63  ? 1.686   -2.752  -2.792  1.00 0.00 ? 63  LEU A HD11 3  
ATOM   3837  H HD12 . LEU A 1 63  ? 1.552   -1.908  -1.230  1.00 0.00 ? 63  LEU A HD12 3  
ATOM   3838  H HD13 . LEU A 1 63  ? 3.080   -1.854  -2.142  1.00 0.00 ? 63  LEU A HD13 3  
ATOM   3839  H HD21 . LEU A 1 63  ? 4.357   -2.527  -0.509  1.00 0.00 ? 63  LEU A HD21 3  
ATOM   3840  H HD22 . LEU A 1 63  ? 3.463   -3.319  0.809   1.00 0.00 ? 63  LEU A HD22 3  
ATOM   3841  H HD23 . LEU A 1 63  ? 4.558   -4.271  -0.221  1.00 0.00 ? 63  LEU A HD23 3  
ATOM   3842  N N    . LEU A 1 64  ? 2.370   -6.185  -2.951  1.00 0.00 ? 64  LEU A N    3  
ATOM   3843  C CA   . LEU A 1 64  ? 3.316   -7.038  -3.650  1.00 0.00 ? 64  LEU A CA   3  
ATOM   3844  C C    . LEU A 1 64  ? 4.432   -6.176  -4.244  1.00 0.00 ? 64  LEU A C    3  
ATOM   3845  O O    . LEU A 1 64  ? 5.607   -6.531  -4.158  1.00 0.00 ? 64  LEU A O    3  
ATOM   3846  C CB   . LEU A 1 64  ? 2.594   -7.906  -4.683  1.00 0.00 ? 64  LEU A CB   3  
ATOM   3847  C CG   . LEU A 1 64  ? 1.977   -9.203  -4.156  1.00 0.00 ? 64  LEU A CG   3  
ATOM   3848  C CD1  . LEU A 1 64  ? 3.027   -10.060 -3.443  1.00 0.00 ? 64  LEU A CD1  3  
ATOM   3849  C CD2  . LEU A 1 64  ? 0.772   -8.912  -3.260  1.00 0.00 ? 64  LEU A CD2  3  
ATOM   3850  H H    . LEU A 1 64  ? 2.172   -5.315  -3.403  1.00 0.00 ? 64  LEU A H    3  
ATOM   3851  H HA   . LEU A 1 64  ? 3.755   -7.712  -2.913  1.00 0.00 ? 64  LEU A HA   3  
ATOM   3852  H HB2  . LEU A 1 64  ? 1.803   -7.310  -5.140  1.00 0.00 ? 64  LEU A HB2  3  
ATOM   3853  H HB3  . LEU A 1 64  ? 3.300   -8.158  -5.473  1.00 0.00 ? 64  LEU A HB3  3  
ATOM   3854  H HG   . LEU A 1 64  ? 1.615   -9.780  -5.006  1.00 0.00 ? 64  LEU A HG   3  
ATOM   3855  H HD11 . LEU A 1 64  ? 2.648   -11.076 -3.326  1.00 0.00 ? 64  LEU A HD11 3  
ATOM   3856  H HD12 . LEU A 1 64  ? 3.941   -10.078 -4.035  1.00 0.00 ? 64  LEU A HD12 3  
ATOM   3857  H HD13 . LEU A 1 64  ? 3.237   -9.635  -2.461  1.00 0.00 ? 64  LEU A HD13 3  
ATOM   3858  H HD21 . LEU A 1 64  ? -0.089  -9.482  -3.612  1.00 0.00 ? 64  LEU A HD21 3  
ATOM   3859  H HD22 . LEU A 1 64  ? 1.002   -9.202  -2.234  1.00 0.00 ? 64  LEU A HD22 3  
ATOM   3860  H HD23 . LEU A 1 64  ? 0.542   -7.847  -3.293  1.00 0.00 ? 64  LEU A HD23 3  
ATOM   3861  N N    . SER A 1 65  ? 4.026   -5.061  -4.833  1.00 0.00 ? 65  SER A N    3  
ATOM   3862  C CA   . SER A 1 65  ? 4.978   -4.146  -5.440  1.00 0.00 ? 65  SER A CA   3  
ATOM   3863  C C    . SER A 1 65  ? 4.863   -2.765  -4.789  1.00 0.00 ? 65  SER A C    3  
ATOM   3864  O O    . SER A 1 65  ? 3.915   -2.500  -4.052  1.00 0.00 ? 65  SER A O    3  
ATOM   3865  C CB   . SER A 1 65  ? 4.753   -4.043  -6.950  1.00 0.00 ? 65  SER A CB   3  
ATOM   3866  O OG   . SER A 1 65  ? 4.587   -2.692  -7.374  1.00 0.00 ? 65  SER A OG   3  
ATOM   3867  H H    . SER A 1 65  ? 3.069   -4.781  -4.897  1.00 0.00 ? 65  SER A H    3  
ATOM   3868  H HA   . SER A 1 65  ? 5.958   -4.580  -5.247  1.00 0.00 ? 65  SER A HA   3  
ATOM   3869  H HB2  . SER A 1 65  ? 5.602   -4.484  -7.473  1.00 0.00 ? 65  SER A HB2  3  
ATOM   3870  H HB3  . SER A 1 65  ? 3.872   -4.620  -7.227  1.00 0.00 ? 65  SER A HB3  3  
ATOM   3871  H HG   . SER A 1 65  ? 4.562   -2.646  -8.371  1.00 0.00 ? 65  SER A HG   3  
ATOM   3872  N N    . VAL A 1 66  ? 5.842   -1.924  -5.087  1.00 0.00 ? 66  VAL A N    3  
ATOM   3873  C CA   . VAL A 1 66  ? 5.864   -0.578  -4.542  1.00 0.00 ? 66  VAL A CA   3  
ATOM   3874  C C    . VAL A 1 66  ? 6.006   0.429   -5.684  1.00 0.00 ? 66  VAL A C    3  
ATOM   3875  O O    . VAL A 1 66  ? 6.305   0.051   -6.815  1.00 0.00 ? 66  VAL A O    3  
ATOM   3876  C CB   . VAL A 1 66  ? 6.975   -0.454  -3.495  1.00 0.00 ? 66  VAL A CB   3  
ATOM   3877  C CG1  . VAL A 1 66  ? 8.356   -0.518  -4.152  1.00 0.00 ? 66  VAL A CG1  3  
ATOM   3878  C CG2  . VAL A 1 66  ? 6.816   0.827   -2.676  1.00 0.00 ? 66  VAL A CG2  3  
ATOM   3879  H H    . VAL A 1 66  ? 6.608   -2.148  -5.689  1.00 0.00 ? 66  VAL A H    3  
ATOM   3880  H HA   . VAL A 1 66  ? 4.910   -0.410  -4.042  1.00 0.00 ? 66  VAL A HA   3  
ATOM   3881  H HB   . VAL A 1 66  ? 6.888   -1.302  -2.814  1.00 0.00 ? 66  VAL A HB   3  
ATOM   3882  H HG11 . VAL A 1 66  ? 8.707   -1.550  -4.157  1.00 0.00 ? 66  VAL A HG11 3  
ATOM   3883  H HG12 . VAL A 1 66  ? 8.288   -0.152  -5.177  1.00 0.00 ? 66  VAL A HG12 3  
ATOM   3884  H HG13 . VAL A 1 66  ? 9.053   0.101   -3.589  1.00 0.00 ? 66  VAL A HG13 3  
ATOM   3885  H HG21 . VAL A 1 66  ? 5.759   1.000   -2.476  1.00 0.00 ? 66  VAL A HG21 3  
ATOM   3886  H HG22 . VAL A 1 66  ? 7.351   0.721   -1.732  1.00 0.00 ? 66  VAL A HG22 3  
ATOM   3887  H HG23 . VAL A 1 66  ? 7.223   1.668   -3.235  1.00 0.00 ? 66  VAL A HG23 3  
ATOM   3888  N N    . ASP A 1 67  ? 5.785   1.691   -5.349  1.00 0.00 ? 67  ASP A N    3  
ATOM   3889  C CA   . ASP A 1 67  ? 5.884   2.756   -6.334  1.00 0.00 ? 67  ASP A CA   3  
ATOM   3890  C C    . ASP A 1 67  ? 7.349   2.949   -6.723  1.00 0.00 ? 67  ASP A C    3  
ATOM   3891  O O    . ASP A 1 67  ? 8.217   3.053   -5.857  1.00 0.00 ? 67  ASP A O    3  
ATOM   3892  C CB   . ASP A 1 67  ? 5.365   4.080   -5.767  1.00 0.00 ? 67  ASP A CB   3  
ATOM   3893  C CG   . ASP A 1 67  ? 5.430   5.265   -6.732  1.00 0.00 ? 67  ASP A CG   3  
ATOM   3894  O OD1  . ASP A 1 67  ? 6.209   5.163   -7.704  1.00 0.00 ? 67  ASP A OD1  3  
ATOM   3895  O OD2  . ASP A 1 67  ? 4.701   6.247   -6.475  1.00 0.00 ? 67  ASP A OD2  3  
ATOM   3896  H H    . ASP A 1 67  ? 5.541   1.991   -4.426  1.00 0.00 ? 67  ASP A H    3  
ATOM   3897  H HA   . ASP A 1 67  ? 5.268   2.428   -7.172  1.00 0.00 ? 67  ASP A HA   3  
ATOM   3898  H HB2  . ASP A 1 67  ? 4.330   3.943   -5.453  1.00 0.00 ? 67  ASP A HB2  3  
ATOM   3899  H HB3  . ASP A 1 67  ? 5.940   4.325   -4.874  1.00 0.00 ? 67  ASP A HB3  3  
ATOM   3900  N N    . GLY A 1 68  ? 7.581   2.992   -8.027  1.00 0.00 ? 68  GLY A N    3  
ATOM   3901  C CA   . GLY A 1 68  ? 8.929   3.172   -8.540  1.00 0.00 ? 68  GLY A CA   3  
ATOM   3902  C C    . GLY A 1 68  ? 9.687   1.843   -8.569  1.00 0.00 ? 68  GLY A C    3  
ATOM   3903  O O    . GLY A 1 68  ? 10.753  1.745   -9.173  1.00 0.00 ? 68  GLY A O    3  
ATOM   3904  H H    . GLY A 1 68  ? 6.872   2.907   -8.724  1.00 0.00 ? 68  GLY A H    3  
ATOM   3905  H HA2  . GLY A 1 68  ? 8.884   3.590   -9.547  1.00 0.00 ? 68  GLY A HA2  3  
ATOM   3906  H HA3  . GLY A 1 68  ? 9.467   3.889   -7.921  1.00 0.00 ? 68  GLY A HA3  3  
ATOM   3907  N N    . ARG A 1 69  ? 9.106   0.854   -7.904  1.00 0.00 ? 69  ARG A N    3  
ATOM   3908  C CA   . ARG A 1 69  ? 9.714   -0.464  -7.845  1.00 0.00 ? 69  ARG A CA   3  
ATOM   3909  C C    . ARG A 1 69  ? 8.635   -1.540  -7.709  1.00 0.00 ? 69  ARG A C    3  
ATOM   3910  O O    . ARG A 1 69  ? 7.983   -1.643  -6.670  1.00 0.00 ? 69  ARG A O    3  
ATOM   3911  C CB   . ARG A 1 69  ? 10.684  -0.572  -6.665  1.00 0.00 ? 69  ARG A CB   3  
ATOM   3912  C CG   . ARG A 1 69  ? 11.694  0.579   -6.681  1.00 0.00 ? 69  ARG A CG   3  
ATOM   3913  C CD   . ARG A 1 69  ? 12.817  0.332   -5.671  1.00 0.00 ? 69  ARG A CD   3  
ATOM   3914  N NE   . ARG A 1 69  ? 13.937  -0.382  -6.323  1.00 0.00 ? 69  ARG A NE   3  
ATOM   3915  C CZ   . ARG A 1 69  ? 14.738  0.161   -7.250  1.00 0.00 ? 69  ARG A CZ   3  
ATOM   3916  N NH1  . ARG A 1 69  ? 14.547  1.430   -7.638  1.00 0.00 ? 69  ARG A NH1  3  
ATOM   3917  N NH2  . ARG A 1 69  ? 15.727  -0.563  -7.788  1.00 0.00 ? 69  ARG A NH2  3  
ATOM   3918  H H    . ARG A 1 69  ? 8.239   0.943   -7.415  1.00 0.00 ? 69  ARG A H    3  
ATOM   3919  H HA   . ARG A 1 69  ? 10.253  -0.565  -8.787  1.00 0.00 ? 69  ARG A HA   3  
ATOM   3920  H HB2  . ARG A 1 69  ? 10.125  -0.559  -5.729  1.00 0.00 ? 69  ARG A HB2  3  
ATOM   3921  H HB3  . ARG A 1 69  ? 11.212  -1.524  -6.709  1.00 0.00 ? 69  ARG A HB3  3  
ATOM   3922  H HG2  . ARG A 1 69  ? 12.113  0.684   -7.680  1.00 0.00 ? 69  ARG A HG2  3  
ATOM   3923  H HG3  . ARG A 1 69  ? 11.187  1.515   -6.445  1.00 0.00 ? 69  ARG A HG3  3  
ATOM   3924  H HD2  . ARG A 1 69  ? 13.167  1.283   -5.267  1.00 0.00 ? 69  ARG A HD2  3  
ATOM   3925  H HD3  . ARG A 1 69  ? 12.442  -0.251  -4.831  1.00 0.00 ? 69  ARG A HD3  3  
ATOM   3926  H HE   . ARG A 1 69  ? 14.105  -1.330  -6.057  1.00 0.00 ? 69  ARG A HE   3  
ATOM   3927  H HH11 . ARG A 1 69  ? 13.809  1.971   -7.236  1.00 0.00 ? 69  ARG A HH11 3  
ATOM   3928  H HH12 . ARG A 1 69  ? 15.146  1.837   -8.328  1.00 0.00 ? 69  ARG A HH12 3  
ATOM   3929  H HH21 . ARG A 1 69  ? 15.869  -1.509  -7.498  1.00 0.00 ? 69  ARG A HH21 3  
ATOM   3930  H HH22 . ARG A 1 69  ? 16.326  -0.158  -8.479  1.00 0.00 ? 69  ARG A HH22 3  
ATOM   3931  N N    . SER A 1 70  ? 8.482   -2.317  -8.771  1.00 0.00 ? 70  SER A N    3  
ATOM   3932  C CA   . SER A 1 70  ? 7.492   -3.382  -8.782  1.00 0.00 ? 70  SER A CA   3  
ATOM   3933  C C    . SER A 1 70  ? 8.041   -4.614  -8.058  1.00 0.00 ? 70  SER A C    3  
ATOM   3934  O O    . SER A 1 70  ? 8.597   -5.510  -8.690  1.00 0.00 ? 70  SER A O    3  
ATOM   3935  C CB   . SER A 1 70  ? 7.088   -3.742  -10.214 1.00 0.00 ? 70  SER A CB   3  
ATOM   3936  O OG   . SER A 1 70  ? 6.389   -2.680  -10.855 1.00 0.00 ? 70  SER A OG   3  
ATOM   3937  H H    . SER A 1 70  ? 9.016   -2.228  -9.611  1.00 0.00 ? 70  SER A H    3  
ATOM   3938  H HA   . SER A 1 70  ? 6.630   -2.980  -8.253  1.00 0.00 ? 70  SER A HA   3  
ATOM   3939  H HB2  . SER A 1 70  ? 7.980   -3.990  -10.790 1.00 0.00 ? 70  SER A HB2  3  
ATOM   3940  H HB3  . SER A 1 70  ? 6.460   -4.633  -10.198 1.00 0.00 ? 70  SER A HB3  3  
ATOM   3941  H HG   . SER A 1 70  ? 6.909   -1.830  -10.774 1.00 0.00 ? 70  SER A HG   3  
ATOM   3942  N N    . LEU A 1 71  ? 7.865   -4.615  -6.746  1.00 0.00 ? 71  LEU A N    3  
ATOM   3943  C CA   . LEU A 1 71  ? 8.336   -5.723  -5.930  1.00 0.00 ? 71  LEU A CA   3  
ATOM   3944  C C    . LEU A 1 71  ? 7.702   -7.023  -6.427  1.00 0.00 ? 71  LEU A C    3  
ATOM   3945  O O    . LEU A 1 71  ? 8.405   -7.992  -6.712  1.00 0.00 ? 71  LEU A O    3  
ATOM   3946  C CB   . LEU A 1 71  ? 8.082   -5.442  -4.449  1.00 0.00 ? 71  LEU A CB   3  
ATOM   3947  C CG   . LEU A 1 71  ? 8.484   -4.052  -3.949  1.00 0.00 ? 71  LEU A CG   3  
ATOM   3948  C CD1  . LEU A 1 71  ? 7.537   -3.569  -2.851  1.00 0.00 ? 71  LEU A CD1  3  
ATOM   3949  C CD2  . LEU A 1 71  ? 9.945   -4.035  -3.495  1.00 0.00 ? 71  LEU A CD2  3  
ATOM   3950  H H    . LEU A 1 71  ? 7.411   -3.881  -6.241  1.00 0.00 ? 71  LEU A H    3  
ATOM   3951  H HA   . LEU A 1 71  ? 9.417   -5.791  -6.065  1.00 0.00 ? 71  LEU A HA   3  
ATOM   3952  H HB2  . LEU A 1 71  ? 7.020   -5.584  -4.249  1.00 0.00 ? 71  LEU A HB2  3  
ATOM   3953  H HB3  . LEU A 1 71  ? 8.619   -6.187  -3.861  1.00 0.00 ? 71  LEU A HB3  3  
ATOM   3954  H HG   . LEU A 1 71  ? 8.398   -3.353  -4.780  1.00 0.00 ? 71  LEU A HG   3  
ATOM   3955  H HD11 . LEU A 1 71  ? 7.242   -4.411  -2.227  1.00 0.00 ? 71  LEU A HD11 3  
ATOM   3956  H HD12 . LEU A 1 71  ? 8.044   -2.822  -2.237  1.00 0.00 ? 71  LEU A HD12 3  
ATOM   3957  H HD13 . LEU A 1 71  ? 6.651   -3.125  -3.305  1.00 0.00 ? 71  LEU A HD13 3  
ATOM   3958  H HD21 . LEU A 1 71  ? 10.017  -4.437  -2.484  1.00 0.00 ? 71  LEU A HD21 3  
ATOM   3959  H HD22 . LEU A 1 71  ? 10.543  -4.648  -4.171  1.00 0.00 ? 71  LEU A HD22 3  
ATOM   3960  H HD23 . LEU A 1 71  ? 10.319  -3.011  -3.508  1.00 0.00 ? 71  LEU A HD23 3  
ATOM   3961  N N    . VAL A 1 72  ? 6.380   -7.002  -6.519  1.00 0.00 ? 72  VAL A N    3  
ATOM   3962  C CA   . VAL A 1 72  ? 5.643   -8.168  -6.977  1.00 0.00 ? 72  VAL A CA   3  
ATOM   3963  C C    . VAL A 1 72  ? 5.520   -9.171  -5.829  1.00 0.00 ? 72  VAL A C    3  
ATOM   3964  O O    . VAL A 1 72  ? 4.847   -10.192 -5.962  1.00 0.00 ? 72  VAL A O    3  
ATOM   3965  C CB   . VAL A 1 72  ? 6.316   -8.758  -8.219  1.00 0.00 ? 72  VAL A CB   3  
ATOM   3966  C CG1  . VAL A 1 72  ? 7.039   -7.672  -9.018  1.00 0.00 ? 72  VAL A CG1  3  
ATOM   3967  C CG2  . VAL A 1 72  ? 7.275   -9.888  -7.837  1.00 0.00 ? 72  VAL A CG2  3  
ATOM   3968  H H    . VAL A 1 72  ? 5.816   -6.210  -6.287  1.00 0.00 ? 72  VAL A H    3  
ATOM   3969  H HA   . VAL A 1 72  ? 4.645   -7.835  -7.260  1.00 0.00 ? 72  VAL A HA   3  
ATOM   3970  H HB   . VAL A 1 72  ? 5.537   -9.178  -8.853  1.00 0.00 ? 72  VAL A HB   3  
ATOM   3971  H HG11 . VAL A 1 72  ? 6.845   -7.814  -10.080 1.00 0.00 ? 72  VAL A HG11 3  
ATOM   3972  H HG12 . VAL A 1 72  ? 6.676   -6.691  -8.710  1.00 0.00 ? 72  VAL A HG12 3  
ATOM   3973  H HG13 . VAL A 1 72  ? 8.112   -7.737  -8.833  1.00 0.00 ? 72  VAL A HG13 3  
ATOM   3974  H HG21 . VAL A 1 72  ? 6.842   -10.844 -8.132  1.00 0.00 ? 72  VAL A HG21 3  
ATOM   3975  H HG22 . VAL A 1 72  ? 8.225   -9.746  -8.351  1.00 0.00 ? 72  VAL A HG22 3  
ATOM   3976  H HG23 . VAL A 1 72  ? 7.438   -9.878  -6.759  1.00 0.00 ? 72  VAL A HG23 3  
ATOM   3977  N N    . GLY A 1 73  ? 6.183   -8.848  -4.728  1.00 0.00 ? 73  GLY A N    3  
ATOM   3978  C CA   . GLY A 1 73  ? 6.156   -9.708  -3.558  1.00 0.00 ? 73  GLY A CA   3  
ATOM   3979  C C    . GLY A 1 73  ? 7.502   -9.688  -2.831  1.00 0.00 ? 73  GLY A C    3  
ATOM   3980  O O    . GLY A 1 73  ? 8.037   -10.738 -2.479  1.00 0.00 ? 73  GLY A O    3  
ATOM   3981  H H    . GLY A 1 73  ? 6.728   -8.016  -4.629  1.00 0.00 ? 73  GLY A H    3  
ATOM   3982  H HA2  . GLY A 1 73  ? 5.367   -9.382  -2.880  1.00 0.00 ? 73  GLY A HA2  3  
ATOM   3983  H HA3  . GLY A 1 73  ? 5.917   -10.729 -3.859  1.00 0.00 ? 73  GLY A HA3  3  
ATOM   3984  N N    . LEU A 1 74  ? 8.010   -8.480  -2.628  1.00 0.00 ? 74  LEU A N    3  
ATOM   3985  C CA   . LEU A 1 74  ? 9.283   -8.308  -1.950  1.00 0.00 ? 74  LEU A CA   3  
ATOM   3986  C C    . LEU A 1 74  ? 9.040   -7.723  -0.558  1.00 0.00 ? 74  LEU A C    3  
ATOM   3987  O O    . LEU A 1 74  ? 7.913   -7.358  -0.222  1.00 0.00 ? 74  LEU A O    3  
ATOM   3988  C CB   . LEU A 1 74  ? 10.240  -7.479  -2.808  1.00 0.00 ? 74  LEU A CB   3  
ATOM   3989  C CG   . LEU A 1 74  ? 10.358  -7.895  -4.276  1.00 0.00 ? 74  LEU A CG   3  
ATOM   3990  C CD1  . LEU A 1 74  ? 11.482  -7.128  -4.973  1.00 0.00 ? 74  LEU A CD1  3  
ATOM   3991  C CD2  . LEU A 1 74  ? 10.531  -9.409  -4.403  1.00 0.00 ? 74  LEU A CD2  3  
ATOM   3992  H H    . LEU A 1 74  ? 7.568   -7.632  -2.918  1.00 0.00 ? 74  LEU A H    3  
ATOM   3993  H HA   . LEU A 1 74  ? 9.729   -9.297  -1.835  1.00 0.00 ? 74  LEU A HA   3  
ATOM   3994  H HB2  . LEU A 1 74  ? 9.920   -6.437  -2.770  1.00 0.00 ? 74  LEU A HB2  3  
ATOM   3995  H HB3  . LEU A 1 74  ? 11.232  -7.522  -2.357  1.00 0.00 ? 74  LEU A HB3  3  
ATOM   3996  H HG   . LEU A 1 74  ? 9.427   -7.633  -4.780  1.00 0.00 ? 74  LEU A HG   3  
ATOM   3997  H HD11 . LEU A 1 74  ? 11.774  -6.273  -4.362  1.00 0.00 ? 74  LEU A HD11 3  
ATOM   3998  H HD12 . LEU A 1 74  ? 12.341  -7.786  -5.110  1.00 0.00 ? 74  LEU A HD12 3  
ATOM   3999  H HD13 . LEU A 1 74  ? 11.134  -6.778  -5.945  1.00 0.00 ? 74  LEU A HD13 3  
ATOM   4000  H HD21 . LEU A 1 74  ? 10.995  -9.642  -5.363  1.00 0.00 ? 74  LEU A HD21 3  
ATOM   4001  H HD22 . LEU A 1 74  ? 11.167  -9.772  -3.595  1.00 0.00 ? 74  LEU A HD22 3  
ATOM   4002  H HD23 . LEU A 1 74  ? 9.555   -9.893  -4.344  1.00 0.00 ? 74  LEU A HD23 3  
ATOM   4003  N N    . SER A 1 75  ? 10.113  -7.650  0.215   1.00 0.00 ? 75  SER A N    3  
ATOM   4004  C CA   . SER A 1 75  ? 10.031  -7.115  1.562   1.00 0.00 ? 75  SER A CA   3  
ATOM   4005  C C    . SER A 1 75  ? 9.842   -5.597  1.514   1.00 0.00 ? 75  SER A C    3  
ATOM   4006  O O    . SER A 1 75  ? 10.310  -4.940  0.583   1.00 0.00 ? 75  SER A O    3  
ATOM   4007  C CB   . SER A 1 75  ? 11.278  -7.468  2.375   1.00 0.00 ? 75  SER A CB   3  
ATOM   4008  O OG   . SER A 1 75  ? 12.351  -7.902  1.543   1.00 0.00 ? 75  SER A OG   3  
ATOM   4009  H H    . SER A 1 75  ? 11.026  -7.947  -0.065  1.00 0.00 ? 75  SER A H    3  
ATOM   4010  H HA   . SER A 1 75  ? 9.160   -7.593  2.010   1.00 0.00 ? 75  SER A HA   3  
ATOM   4011  H HB2  . SER A 1 75  ? 11.595  -6.597  2.949   1.00 0.00 ? 75  SER A HB2  3  
ATOM   4012  H HB3  . SER A 1 75  ? 11.037  -8.252  3.090   1.00 0.00 ? 75  SER A HB3  3  
ATOM   4013  H HG   . SER A 1 75  ? 13.120  -7.266  1.616   1.00 0.00 ? 75  SER A HG   3  
ATOM   4014  N N    . GLN A 1 76  ? 9.156   -5.083  2.524   1.00 0.00 ? 76  GLN A N    3  
ATOM   4015  C CA   . GLN A 1 76  ? 8.901   -3.655  2.605   1.00 0.00 ? 76  GLN A CA   3  
ATOM   4016  C C    . GLN A 1 76  ? 10.213  -2.891  2.796   1.00 0.00 ? 76  GLN A C    3  
ATOM   4017  O O    . GLN A 1 76  ? 10.248  -1.670  2.664   1.00 0.00 ? 76  GLN A O    3  
ATOM   4018  C CB   . GLN A 1 76  ? 7.913   -3.338  3.730   1.00 0.00 ? 76  GLN A CB   3  
ATOM   4019  C CG   . GLN A 1 76  ? 8.648   -3.053  5.041   1.00 0.00 ? 76  GLN A CG   3  
ATOM   4020  C CD   . GLN A 1 76  ? 9.513   -4.244  5.457   1.00 0.00 ? 76  GLN A CD   3  
ATOM   4021  O OE1  . GLN A 1 76  ? 9.314   -5.368  5.027   1.00 0.00 ? 76  GLN A OE1  3  
ATOM   4022  N NE2  . GLN A 1 76  ? 10.481  -3.936  6.314   1.00 0.00 ? 76  GLN A NE2  3  
ATOM   4023  H H    . GLN A 1 76  ? 8.779   -5.624  3.275   1.00 0.00 ? 76  GLN A H    3  
ATOM   4024  H HA   . GLN A 1 76  ? 8.452   -3.386  1.650   1.00 0.00 ? 76  GLN A HA   3  
ATOM   4025  H HB2  . GLN A 1 76  ? 7.305   -2.478  3.454   1.00 0.00 ? 76  GLN A HB2  3  
ATOM   4026  H HB3  . GLN A 1 76  ? 7.232   -4.178  3.869   1.00 0.00 ? 76  GLN A HB3  3  
ATOM   4027  H HG2  . GLN A 1 76  ? 9.274   -2.167  4.924   1.00 0.00 ? 76  GLN A HG2  3  
ATOM   4028  H HG3  . GLN A 1 76  ? 7.925   -2.832  5.826   1.00 0.00 ? 76  GLN A HG3  3  
ATOM   4029  H HE21 . GLN A 1 76  ? 10.590  -2.992  6.627   1.00 0.00 ? 76  GLN A HE21 3  
ATOM   4030  H HE22 . GLN A 1 76  ? 11.101  -4.647  6.646   1.00 0.00 ? 76  GLN A HE22 3  
ATOM   4031  N N    . GLU A 1 77  ? 11.258  -3.644  3.107   1.00 0.00 ? 77  GLU A N    3  
ATOM   4032  C CA   . GLU A 1 77  ? 12.569  -3.052  3.318   1.00 0.00 ? 77  GLU A CA   3  
ATOM   4033  C C    . GLU A 1 77  ? 12.847  -1.986  2.258   1.00 0.00 ? 77  GLU A C    3  
ATOM   4034  O O    . GLU A 1 77  ? 12.702  -0.792  2.518   1.00 0.00 ? 77  GLU A O    3  
ATOM   4035  C CB   . GLU A 1 77  ? 13.660  -4.124  3.320   1.00 0.00 ? 77  GLU A CB   3  
ATOM   4036  C CG   . GLU A 1 77  ? 13.393  -5.177  4.397   1.00 0.00 ? 77  GLU A CG   3  
ATOM   4037  C CD   . GLU A 1 77  ? 14.521  -5.201  5.431   1.00 0.00 ? 77  GLU A CD   3  
ATOM   4038  O OE1  . GLU A 1 77  ? 15.489  -5.956  5.198   1.00 0.00 ? 77  GLU A OE1  3  
ATOM   4039  O OE2  . GLU A 1 77  ? 14.390  -4.461  6.430   1.00 0.00 ? 77  GLU A OE2  3  
ATOM   4040  H H    . GLU A 1 77  ? 11.221  -4.637  3.214   1.00 0.00 ? 77  GLU A H    3  
ATOM   4041  H HA   . GLU A 1 77  ? 12.522  -2.589  4.304   1.00 0.00 ? 77  GLU A HA   3  
ATOM   4042  H HB2  . GLU A 1 77  ? 13.705  -4.603  2.342   1.00 0.00 ? 77  GLU A HB2  3  
ATOM   4043  H HB3  . GLU A 1 77  ? 14.631  -3.660  3.492   1.00 0.00 ? 77  GLU A HB3  3  
ATOM   4044  H HG2  . GLU A 1 77  ? 12.446  -4.965  4.891   1.00 0.00 ? 77  GLU A HG2  3  
ATOM   4045  H HG3  . GLU A 1 77  ? 13.299  -6.161  3.935   1.00 0.00 ? 77  GLU A HG3  3  
ATOM   4046  N N    . ARG A 1 78  ? 13.242  -2.456  1.083   1.00 0.00 ? 78  ARG A N    3  
ATOM   4047  C CA   . ARG A 1 78  ? 13.542  -1.558  -0.019  1.00 0.00 ? 78  ARG A CA   3  
ATOM   4048  C C    . ARG A 1 78  ? 12.444  -0.502  -0.160  1.00 0.00 ? 78  ARG A C    3  
ATOM   4049  O O    . ARG A 1 78  ? 12.685  0.685   0.057   1.00 0.00 ? 78  ARG A O    3  
ATOM   4050  C CB   . ARG A 1 78  ? 13.673  -2.325  -1.336  1.00 0.00 ? 78  ARG A CB   3  
ATOM   4051  C CG   . ARG A 1 78  ? 14.867  -3.282  -1.297  1.00 0.00 ? 78  ARG A CG   3  
ATOM   4052  C CD   . ARG A 1 78  ? 14.403  -4.737  -1.230  1.00 0.00 ? 78  ARG A CD   3  
ATOM   4053  N NE   . ARG A 1 78  ? 15.462  -5.631  -1.749  1.00 0.00 ? 78  ARG A NE   3  
ATOM   4054  C CZ   . ARG A 1 78  ? 16.607  -5.894  -1.102  1.00 0.00 ? 78  ARG A CZ   3  
ATOM   4055  N NH1  . ARG A 1 78  ? 16.844  -5.333  0.092   1.00 0.00 ? 78  ARG A NH1  3  
ATOM   4056  N NH2  . ARG A 1 78  ? 17.510  -6.717  -1.647  1.00 0.00 ? 78  ARG A NH2  3  
ATOM   4057  H H    . ARG A 1 78  ? 13.356  -3.428  0.879   1.00 0.00 ? 78  ARG A H    3  
ATOM   4058  H HA   . ARG A 1 78  ? 14.494  -1.099  0.246   1.00 0.00 ? 78  ARG A HA   3  
ATOM   4059  H HB2  . ARG A 1 78  ? 12.759  -2.889  -1.525  1.00 0.00 ? 78  ARG A HB2  3  
ATOM   4060  H HB3  . ARG A 1 78  ? 13.792  -1.622  -2.161  1.00 0.00 ? 78  ARG A HB3  3  
ATOM   4061  H HG2  . ARG A 1 78  ? 15.485  -3.133  -2.183  1.00 0.00 ? 78  ARG A HG2  3  
ATOM   4062  H HG3  . ARG A 1 78  ? 15.492  -3.055  -0.432  1.00 0.00 ? 78  ARG A HG3  3  
ATOM   4063  H HD2  . ARG A 1 78  ? 14.161  -5.003  -0.201  1.00 0.00 ? 78  ARG A HD2  3  
ATOM   4064  H HD3  . ARG A 1 78  ? 13.491  -4.865  -1.816  1.00 0.00 ? 78  ARG A HD3  3  
ATOM   4065  H HE   . ARG A 1 78  ? 15.317  -6.067  -2.637  1.00 0.00 ? 78  ARG A HE   3  
ATOM   4066  H HH11 . ARG A 1 78  ? 16.168  -4.718  0.501   1.00 0.00 ? 78  ARG A HH11 3  
ATOM   4067  H HH12 . ARG A 1 78  ? 17.698  -5.529  0.576   1.00 0.00 ? 78  ARG A HH12 3  
ATOM   4068  H HH21 . ARG A 1 78  ? 17.333  -7.136  -2.537  1.00 0.00 ? 78  ARG A HH21 3  
ATOM   4069  H HH22 . ARG A 1 78  ? 18.365  -6.914  -1.162  1.00 0.00 ? 78  ARG A HH22 3  
ATOM   4070  N N    . ALA A 1 79  ? 11.257  -0.974  -0.520  1.00 0.00 ? 79  ALA A N    3  
ATOM   4071  C CA   . ALA A 1 79  ? 10.121  -0.085  -0.691  1.00 0.00 ? 79  ALA A CA   3  
ATOM   4072  C C    . ALA A 1 79  ? 10.062  0.893   0.484   1.00 0.00 ? 79  ALA A C    3  
ATOM   4073  O O    . ALA A 1 79  ? 10.600  1.997   0.404   1.00 0.00 ? 79  ALA A O    3  
ATOM   4074  C CB   . ALA A 1 79  ? 8.841   -0.912  -0.824  1.00 0.00 ? 79  ALA A CB   3  
ATOM   4075  H H    . ALA A 1 79  ? 11.070  -1.941  -0.694  1.00 0.00 ? 79  ALA A H    3  
ATOM   4076  H HA   . ALA A 1 79  ? 10.274  0.476   -1.613  1.00 0.00 ? 79  ALA A HA   3  
ATOM   4077  H HB1  . ALA A 1 79  ? 8.040   -0.438  -0.262  1.00 0.00 ? 79  ALA A HB1  3  
ATOM   4078  H HB2  . ALA A 1 79  ? 8.559   -0.978  -1.877  1.00 0.00 ? 79  ALA A HB2  3  
ATOM   4079  H HB3  . ALA A 1 79  ? 9.015   -1.915  -0.433  1.00 0.00 ? 79  ALA A HB3  3  
ATOM   4080  N N    . ALA A 1 80  ? 9.404   0.453   1.546   1.00 0.00 ? 80  ALA A N    3  
ATOM   4081  C CA   . ALA A 1 80  ? 9.267   1.276   2.736   1.00 0.00 ? 80  ALA A CA   3  
ATOM   4082  C C    . ALA A 1 80  ? 9.939   2.630   2.495   1.00 0.00 ? 80  ALA A C    3  
ATOM   4083  O O    . ALA A 1 80  ? 9.279   3.595   2.109   1.00 0.00 ? 80  ALA A O    3  
ATOM   4084  C CB   . ALA A 1 80  ? 9.858   0.538   3.938   1.00 0.00 ? 80  ALA A CB   3  
ATOM   4085  H H    . ALA A 1 80  ? 8.969   -0.445  1.601   1.00 0.00 ? 80  ALA A H    3  
ATOM   4086  H HA   . ALA A 1 80  ? 8.202   1.434   2.910   1.00 0.00 ? 80  ALA A HA   3  
ATOM   4087  H HB1  . ALA A 1 80  ? 10.875  0.222   3.705   1.00 0.00 ? 80  ALA A HB1  3  
ATOM   4088  H HB2  . ALA A 1 80  ? 9.872   1.202   4.802   1.00 0.00 ? 80  ALA A HB2  3  
ATOM   4089  H HB3  . ALA A 1 80  ? 9.249   -0.337  4.164   1.00 0.00 ? 80  ALA A HB3  3  
ATOM   4090  N N    . GLU A 1 81  ? 11.241  2.657   2.729   1.00 0.00 ? 81  GLU A N    3  
ATOM   4091  C CA   . GLU A 1 81  ? 12.011  3.877   2.543   1.00 0.00 ? 81  GLU A CA   3  
ATOM   4092  C C    . GLU A 1 81  ? 11.641  4.538   1.212   1.00 0.00 ? 81  GLU A C    3  
ATOM   4093  O O    . GLU A 1 81  ? 11.080  5.632   1.194   1.00 0.00 ? 81  GLU A O    3  
ATOM   4094  C CB   . GLU A 1 81  ? 13.512  3.595   2.616   1.00 0.00 ? 81  GLU A CB   3  
ATOM   4095  C CG   . GLU A 1 81  ? 14.322  4.867   2.353   1.00 0.00 ? 81  GLU A CG   3  
ATOM   4096  C CD   . GLU A 1 81  ? 15.695  4.790   3.022   1.00 0.00 ? 81  GLU A CD   3  
ATOM   4097  O OE1  . GLU A 1 81  ? 16.448  3.856   2.671   1.00 0.00 ? 81  GLU A OE1  3  
ATOM   4098  O OE2  . GLU A 1 81  ? 15.963  5.668   3.872   1.00 0.00 ? 81  GLU A OE2  3  
ATOM   4099  H H    . GLU A 1 81  ? 11.771  1.868   3.042   1.00 0.00 ? 81  GLU A H    3  
ATOM   4100  H HA   . GLU A 1 81  ? 11.728  4.527   3.370   1.00 0.00 ? 81  GLU A HA   3  
ATOM   4101  H HB2  . GLU A 1 81  ? 13.764  3.197   3.599   1.00 0.00 ? 81  GLU A HB2  3  
ATOM   4102  H HB3  . GLU A 1 81  ? 13.779  2.832   1.884   1.00 0.00 ? 81  GLU A HB3  3  
ATOM   4103  H HG2  . GLU A 1 81  ? 14.445  5.008   1.280   1.00 0.00 ? 81  GLU A HG2  3  
ATOM   4104  H HG3  . GLU A 1 81  ? 13.778  5.733   2.728   1.00 0.00 ? 81  GLU A HG3  3  
ATOM   4105  N N    . LEU A 1 82  ? 11.969  3.846   0.133   1.00 0.00 ? 82  LEU A N    3  
ATOM   4106  C CA   . LEU A 1 82  ? 11.680  4.352   -1.199  1.00 0.00 ? 82  LEU A CA   3  
ATOM   4107  C C    . LEU A 1 82  ? 10.171  4.289   -1.446  1.00 0.00 ? 82  LEU A C    3  
ATOM   4108  O O    . LEU A 1 82  ? 9.715   4.468   -2.574  1.00 0.00 ? 82  LEU A O    3  
ATOM   4109  C CB   . LEU A 1 82  ? 12.507  3.605   -2.247  1.00 0.00 ? 82  LEU A CB   3  
ATOM   4110  C CG   . LEU A 1 82  ? 12.871  4.401   -3.502  1.00 0.00 ? 82  LEU A CG   3  
ATOM   4111  C CD1  . LEU A 1 82  ? 11.724  5.319   -3.925  1.00 0.00 ? 82  LEU A CD1  3  
ATOM   4112  C CD2  . LEU A 1 82  ? 14.179  5.170   -3.305  1.00 0.00 ? 82  LEU A CD2  3  
ATOM   4113  H H    . LEU A 1 82  ? 12.425  2.955   0.156   1.00 0.00 ? 82  LEU A H    3  
ATOM   4114  H HA   . LEU A 1 82  ? 11.992  5.396   -1.226  1.00 0.00 ? 82  LEU A HA   3  
ATOM   4115  H HB2  . LEU A 1 82  ? 13.429  3.263   -1.778  1.00 0.00 ? 82  LEU A HB2  3  
ATOM   4116  H HB3  . LEU A 1 82  ? 11.954  2.717   -2.552  1.00 0.00 ? 82  LEU A HB3  3  
ATOM   4117  H HG   . LEU A 1 82  ? 13.034  3.696   -4.318  1.00 0.00 ? 82  LEU A HG   3  
ATOM   4118  H HD11 . LEU A 1 82  ? 10.927  4.725   -4.373  1.00 0.00 ? 82  LEU A HD11 3  
ATOM   4119  H HD12 . LEU A 1 82  ? 11.338  5.840   -3.048  1.00 0.00 ? 82  LEU A HD12 3  
ATOM   4120  H HD13 . LEU A 1 82  ? 12.087  6.047   -4.648  1.00 0.00 ? 82  LEU A HD13 3  
ATOM   4121  H HD21 . LEU A 1 82  ? 15.015  4.558   -3.643  1.00 0.00 ? 82  LEU A HD21 3  
ATOM   4122  H HD22 . LEU A 1 82  ? 14.148  6.095   -3.881  1.00 0.00 ? 82  LEU A HD22 3  
ATOM   4123  H HD23 . LEU A 1 82  ? 14.305  5.405   -2.247  1.00 0.00 ? 82  LEU A HD23 3  
ATOM   4124  N N    . MET A 1 83  ? 9.438   4.033   -0.373  1.00 0.00 ? 83  MET A N    3  
ATOM   4125  C CA   . MET A 1 83  ? 7.991   3.943   -0.459  1.00 0.00 ? 83  MET A CA   3  
ATOM   4126  C C    . MET A 1 83  ? 7.323   5.022   0.396   1.00 0.00 ? 83  MET A C    3  
ATOM   4127  O O    . MET A 1 83  ? 6.150   5.337   0.200   1.00 0.00 ? 83  MET A O    3  
ATOM   4128  C CB   . MET A 1 83  ? 7.535   2.562   0.016   1.00 0.00 ? 83  MET A CB   3  
ATOM   4129  C CG   . MET A 1 83  ? 6.059   2.329   -0.314  1.00 0.00 ? 83  MET A CG   3  
ATOM   4130  S SD   . MET A 1 83  ? 5.619   0.633   0.021   1.00 0.00 ? 83  MET A SD   3  
ATOM   4131  C CE   . MET A 1 83  ? 5.355   0.722   1.785   1.00 0.00 ? 83  MET A CE   3  
ATOM   4132  H H    . MET A 1 83  ? 9.818   3.886   0.541   1.00 0.00 ? 83  MET A H    3  
ATOM   4133  H HA   . MET A 1 83  ? 7.750   4.102   -1.510  1.00 0.00 ? 83  MET A HA   3  
ATOM   4134  H HB2  . MET A 1 83  ? 8.143   1.791   -0.462  1.00 0.00 ? 83  MET A HB2  3  
ATOM   4135  H HB3  . MET A 1 83  ? 7.691   2.472   1.090   1.00 0.00 ? 83  MET A HB3  3  
ATOM   4136  H HG2  . MET A 1 83  ? 5.436   2.999   0.281   1.00 0.00 ? 83  MET A HG2  3  
ATOM   4137  H HG3  . MET A 1 83  ? 5.869   2.562   -1.362  1.00 0.00 ? 83  MET A HG3  3  
ATOM   4138  H HE1  . MET A 1 83  ? 4.400   1.211   1.984   1.00 0.00 ? 83  MET A HE1  3  
ATOM   4139  H HE2  . MET A 1 83  ? 5.342   -0.284  2.203   1.00 0.00 ? 83  MET A HE2  3  
ATOM   4140  H HE3  . MET A 1 83  ? 6.160   1.295   2.243   1.00 0.00 ? 83  MET A HE3  3  
ATOM   4141  N N    . THR A 1 84  ? 8.099   5.557   1.327   1.00 0.00 ? 84  THR A N    3  
ATOM   4142  C CA   . THR A 1 84  ? 7.597   6.594   2.214   1.00 0.00 ? 84  THR A CA   3  
ATOM   4143  C C    . THR A 1 84  ? 7.793   7.974   1.586   1.00 0.00 ? 84  THR A C    3  
ATOM   4144  O O    . THR A 1 84  ? 6.844   8.749   1.471   1.00 0.00 ? 84  THR A O    3  
ATOM   4145  C CB   . THR A 1 84  ? 8.294   6.437   3.567   1.00 0.00 ? 84  THR A CB   3  
ATOM   4146  O OG1  . THR A 1 84  ? 8.415   5.027   3.735   1.00 0.00 ? 84  THR A OG1  3  
ATOM   4147  C CG2  . THR A 1 84  ? 7.410   6.877   4.736   1.00 0.00 ? 84  THR A CG2  3  
ATOM   4148  H H    . THR A 1 84  ? 9.050   5.294   1.481   1.00 0.00 ? 84  THR A H    3  
ATOM   4149  H HA   . THR A 1 84  ? 6.524   6.448   2.339   1.00 0.00 ? 84  THR A HA   3  
ATOM   4150  H HB   . THR A 1 84  ? 9.246   6.968   3.578   1.00 0.00 ? 84  THR A HB   3  
ATOM   4151  H HG1  . THR A 1 84  ? 9.255   4.702   3.300   1.00 0.00 ? 84  THR A HG1  3  
ATOM   4152  H HG21 . THR A 1 84  ? 7.909   6.643   5.677   1.00 0.00 ? 84  THR A HG21 3  
ATOM   4153  H HG22 . THR A 1 84  ? 7.234   7.951   4.675   1.00 0.00 ? 84  THR A HG22 3  
ATOM   4154  H HG23 . THR A 1 84  ? 6.457   6.350   4.690   1.00 0.00 ? 84  THR A HG23 3  
ATOM   4155  N N    . ARG A 1 85  ? 9.030   8.240   1.194   1.00 0.00 ? 85  ARG A N    3  
ATOM   4156  C CA   . ARG A 1 85  ? 9.365   9.514   0.579   1.00 0.00 ? 85  ARG A CA   3  
ATOM   4157  C C    . ARG A 1 85  ? 8.663   9.649   -0.775  1.00 0.00 ? 85  ARG A C    3  
ATOM   4158  O O    . ARG A 1 85  ? 9.319   9.804   -1.805  1.00 0.00 ? 85  ARG A O    3  
ATOM   4159  C CB   . ARG A 1 85  ? 10.875  9.651   0.381   1.00 0.00 ? 85  ARG A CB   3  
ATOM   4160  C CG   . ARG A 1 85  ? 11.318  11.108  0.527   1.00 0.00 ? 85  ARG A CG   3  
ATOM   4161  C CD   . ARG A 1 85  ? 12.722  11.315  -0.042  1.00 0.00 ? 85  ARG A CD   3  
ATOM   4162  N NE   . ARG A 1 85  ? 12.665  12.203  -1.224  1.00 0.00 ? 85  ARG A NE   3  
ATOM   4163  C CZ   . ARG A 1 85  ? 13.711  12.463  -2.021  1.00 0.00 ? 85  ARG A CZ   3  
ATOM   4164  N NH1  . ARG A 1 85  ? 14.901  11.903  -1.769  1.00 0.00 ? 85  ARG A NH1  3  
ATOM   4165  N NH2  . ARG A 1 85  ? 13.564  13.282  -3.072  1.00 0.00 ? 85  ARG A NH2  3  
ATOM   4166  H H    . ARG A 1 85  ? 9.796   7.605   1.292   1.00 0.00 ? 85  ARG A H    3  
ATOM   4167  H HA   . ARG A 1 85  ? 9.005   10.265  1.283   1.00 0.00 ? 85  ARG A HA   3  
ATOM   4168  H HB2  . ARG A 1 85  ? 11.399  9.033   1.110   1.00 0.00 ? 85  ARG A HB2  3  
ATOM   4169  H HB3  . ARG A 1 85  ? 11.151  9.281   -0.607  1.00 0.00 ? 85  ARG A HB3  3  
ATOM   4170  H HG2  . ARG A 1 85  ? 10.613  11.759  0.010   1.00 0.00 ? 85  ARG A HG2  3  
ATOM   4171  H HG3  . ARG A 1 85  ? 11.303  11.392  1.578   1.00 0.00 ? 85  ARG A HG3  3  
ATOM   4172  H HD2  . ARG A 1 85  ? 13.372  11.749  0.717   1.00 0.00 ? 85  ARG A HD2  3  
ATOM   4173  H HD3  . ARG A 1 85  ? 13.155  10.354  -0.321  1.00 0.00 ? 85  ARG A HD3  3  
ATOM   4174  H HE   . ARG A 1 85  ? 11.791  12.639  -1.442  1.00 0.00 ? 85  ARG A HE   3  
ATOM   4175  H HH11 . ARG A 1 85  ? 15.009  11.291  -0.985  1.00 0.00 ? 85  ARG A HH11 3  
ATOM   4176  H HH12 . ARG A 1 85  ? 15.681  12.095  -2.364  1.00 0.00 ? 85  ARG A HH12 3  
ATOM   4177  H HH21 . ARG A 1 85  ? 12.676  13.700  -3.261  1.00 0.00 ? 85  ARG A HH21 3  
ATOM   4178  H HH22 . ARG A 1 85  ? 14.346  13.476  -3.667  1.00 0.00 ? 85  ARG A HH22 3  
ATOM   4179  N N    . THR A 1 86  ? 7.341   9.587   -0.730  1.00 0.00 ? 86  THR A N    3  
ATOM   4180  C CA   . THR A 1 86  ? 6.546   9.700   -1.939  1.00 0.00 ? 86  THR A CA   3  
ATOM   4181  C C    . THR A 1 86  ? 6.300   11.172  -2.281  1.00 0.00 ? 86  THR A C    3  
ATOM   4182  O O    . THR A 1 86  ? 6.641   11.625  -3.371  1.00 0.00 ? 86  THR A O    3  
ATOM   4183  C CB   . THR A 1 86  ? 5.257   8.902   -1.734  1.00 0.00 ? 86  THR A CB   3  
ATOM   4184  O OG1  . THR A 1 86  ? 5.454   7.719   -2.504  1.00 0.00 ? 86  THR A OG1  3  
ATOM   4185  C CG2  . THR A 1 86  ? 4.043   9.571   -2.384  1.00 0.00 ? 86  THR A CG2  3  
ATOM   4186  H H    . THR A 1 86  ? 6.816   9.462   0.112   1.00 0.00 ? 86  THR A H    3  
ATOM   4187  H HA   . THR A 1 86  ? 7.111   9.270   -2.765  1.00 0.00 ? 86  THR A HA   3  
ATOM   4188  H HB   . THR A 1 86  ? 5.078   8.717   -0.675  1.00 0.00 ? 86  THR A HB   3  
ATOM   4189  H HG1  . THR A 1 86  ? 6.393   7.395   -2.399  1.00 0.00 ? 86  THR A HG1  3  
ATOM   4190  H HG21 . THR A 1 86  ? 3.194   8.887   -2.360  1.00 0.00 ? 86  THR A HG21 3  
ATOM   4191  H HG22 . THR A 1 86  ? 3.794   10.480  -1.835  1.00 0.00 ? 86  THR A HG22 3  
ATOM   4192  H HG23 . THR A 1 86  ? 4.278   9.824   -3.418  1.00 0.00 ? 86  THR A HG23 3  
ATOM   4193  N N    . SER A 1 87  ? 5.714   11.878  -1.326  1.00 0.00 ? 87  SER A N    3  
ATOM   4194  C CA   . SER A 1 87  ? 5.418   13.288  -1.512  1.00 0.00 ? 87  SER A CA   3  
ATOM   4195  C C    . SER A 1 87  ? 4.360   13.465  -2.602  1.00 0.00 ? 87  SER A C    3  
ATOM   4196  O O    . SER A 1 87  ? 3.290   14.017  -2.352  1.00 0.00 ? 87  SER A O    3  
ATOM   4197  C CB   . SER A 1 87  ? 6.683   14.072  -1.870  1.00 0.00 ? 87  SER A CB   3  
ATOM   4198  O OG   . SER A 1 87  ? 7.685   13.957  -0.863  1.00 0.00 ? 87  SER A OG   3  
ATOM   4199  H H    . SER A 1 87  ? 5.439   11.501  -0.440  1.00 0.00 ? 87  SER A H    3  
ATOM   4200  H HA   . SER A 1 87  ? 5.037   13.633  -0.550  1.00 0.00 ? 87  SER A HA   3  
ATOM   4201  H HB2  . SER A 1 87  ? 7.079   13.709  -2.817  1.00 0.00 ? 87  SER A HB2  3  
ATOM   4202  H HB3  . SER A 1 87  ? 6.431   15.123  -2.011  1.00 0.00 ? 87  SER A HB3  3  
ATOM   4203  H HG   . SER A 1 87  ? 8.594   13.995  -1.278  1.00 0.00 ? 87  SER A HG   3  
ATOM   4204  N N    . SER A 1 88  ? 4.694   12.980  -3.789  1.00 0.00 ? 88  SER A N    3  
ATOM   4205  C CA   . SER A 1 88  ? 3.786   13.076  -4.920  1.00 0.00 ? 88  SER A CA   3  
ATOM   4206  C C    . SER A 1 88  ? 2.628   12.091  -4.744  1.00 0.00 ? 88  SER A C    3  
ATOM   4207  O O    . SER A 1 88  ? 1.543   12.474  -4.308  1.00 0.00 ? 88  SER A O    3  
ATOM   4208  C CB   . SER A 1 88  ? 4.514   12.808  -6.237  1.00 0.00 ? 88  SER A CB   3  
ATOM   4209  O OG   . SER A 1 88  ? 5.154   13.978  -6.741  1.00 0.00 ? 88  SER A OG   3  
ATOM   4210  H H    . SER A 1 88  ? 5.565   12.531  -3.986  1.00 0.00 ? 88  SER A H    3  
ATOM   4211  H HA   . SER A 1 88  ? 3.420   14.103  -4.910  1.00 0.00 ? 88  SER A HA   3  
ATOM   4212  H HB2  . SER A 1 88  ? 5.259   12.025  -6.087  1.00 0.00 ? 88  SER A HB2  3  
ATOM   4213  H HB3  . SER A 1 88  ? 3.804   12.436  -6.976  1.00 0.00 ? 88  SER A HB3  3  
ATOM   4214  H HG   . SER A 1 88  ? 4.502   14.736  -6.774  1.00 0.00 ? 88  SER A HG   3  
ATOM   4215  N N    . VAL A 1 89  ? 2.896   10.842  -5.095  1.00 0.00 ? 89  VAL A N    3  
ATOM   4216  C CA   . VAL A 1 89  ? 1.890   9.801   -4.980  1.00 0.00 ? 89  VAL A CA   3  
ATOM   4217  C C    . VAL A 1 89  ? 2.566   8.486   -4.589  1.00 0.00 ? 89  VAL A C    3  
ATOM   4218  O O    . VAL A 1 89  ? 3.751   8.290   -4.852  1.00 0.00 ? 89  VAL A O    3  
ATOM   4219  C CB   . VAL A 1 89  ? 1.095   9.697   -6.285  1.00 0.00 ? 89  VAL A CB   3  
ATOM   4220  C CG1  . VAL A 1 89  ? 2.001   9.291   -7.449  1.00 0.00 ? 89  VAL A CG1  3  
ATOM   4221  C CG2  . VAL A 1 89  ? -0.076  8.725   -6.137  1.00 0.00 ? 89  VAL A CG2  3  
ATOM   4222  H H    . VAL A 1 89  ? 3.781   10.539  -5.450  1.00 0.00 ? 89  VAL A H    3  
ATOM   4223  H HA   . VAL A 1 89  ? 1.202   10.093  -4.189  1.00 0.00 ? 89  VAL A HA   3  
ATOM   4224  H HB   . VAL A 1 89  ? 0.686   10.683  -6.507  1.00 0.00 ? 89  VAL A HB   3  
ATOM   4225  H HG11 . VAL A 1 89  ? 1.426   9.294   -8.375  1.00 0.00 ? 89  VAL A HG11 3  
ATOM   4226  H HG12 . VAL A 1 89  ? 2.826   10.000  -7.533  1.00 0.00 ? 89  VAL A HG12 3  
ATOM   4227  H HG13 . VAL A 1 89  ? 2.397   8.292   -7.270  1.00 0.00 ? 89  VAL A HG13 3  
ATOM   4228  H HG21 . VAL A 1 89  ? 0.275   7.798   -5.683  1.00 0.00 ? 89  VAL A HG21 3  
ATOM   4229  H HG22 . VAL A 1 89  ? -0.843  9.172   -5.503  1.00 0.00 ? 89  VAL A HG22 3  
ATOM   4230  H HG23 . VAL A 1 89  ? -0.498  8.511   -7.119  1.00 0.00 ? 89  VAL A HG23 3  
ATOM   4231  N N    . VAL A 1 90  ? 1.783   7.618   -3.964  1.00 0.00 ? 90  VAL A N    3  
ATOM   4232  C CA   . VAL A 1 90  ? 2.291   6.328   -3.530  1.00 0.00 ? 90  VAL A CA   3  
ATOM   4233  C C    . VAL A 1 90  ? 1.577   5.218   -4.303  1.00 0.00 ? 90  VAL A C    3  
ATOM   4234  O O    . VAL A 1 90  ? 0.514   4.753   -3.890  1.00 0.00 ? 90  VAL A O    3  
ATOM   4235  C CB   . VAL A 1 90  ? 2.145   6.190   -2.013  1.00 0.00 ? 90  VAL A CB   3  
ATOM   4236  C CG1  . VAL A 1 90  ? 3.497   6.342   -1.316  1.00 0.00 ? 90  VAL A CG1  3  
ATOM   4237  C CG2  . VAL A 1 90  ? 1.129   7.196   -1.466  1.00 0.00 ? 90  VAL A CG2  3  
ATOM   4238  H H    . VAL A 1 90  ? 0.819   7.787   -3.751  1.00 0.00 ? 90  VAL A H    3  
ATOM   4239  H HA   . VAL A 1 90  ? 3.353   6.295   -3.771  1.00 0.00 ? 90  VAL A HA   3  
ATOM   4240  H HB   . VAL A 1 90  ? 1.769   5.188   -1.802  1.00 0.00 ? 90  VAL A HB   3  
ATOM   4241  H HG11 . VAL A 1 90  ? 4.288   5.995   -1.979  1.00 0.00 ? 90  VAL A HG11 3  
ATOM   4242  H HG12 . VAL A 1 90  ? 3.664   7.390   -1.070  1.00 0.00 ? 90  VAL A HG12 3  
ATOM   4243  H HG13 . VAL A 1 90  ? 3.502   5.749   -0.402  1.00 0.00 ? 90  VAL A HG13 3  
ATOM   4244  H HG21 . VAL A 1 90  ? 1.407   8.201   -1.784  1.00 0.00 ? 90  VAL A HG21 3  
ATOM   4245  H HG22 . VAL A 1 90  ? 0.137   6.956   -1.849  1.00 0.00 ? 90  VAL A HG22 3  
ATOM   4246  H HG23 . VAL A 1 90  ? 1.120   7.148   -0.378  1.00 0.00 ? 90  VAL A HG23 3  
ATOM   4247  N N    . THR A 1 91  ? 2.185   4.826   -5.412  1.00 0.00 ? 91  THR A N    3  
ATOM   4248  C CA   . THR A 1 91  ? 1.620   3.780   -6.247  1.00 0.00 ? 91  THR A CA   3  
ATOM   4249  C C    . THR A 1 91  ? 2.218   2.422   -5.876  1.00 0.00 ? 91  THR A C    3  
ATOM   4250  O O    . THR A 1 91  ? 3.388   2.156   -6.153  1.00 0.00 ? 91  THR A O    3  
ATOM   4251  C CB   . THR A 1 91  ? 1.851   4.167   -7.709  1.00 0.00 ? 91  THR A CB   3  
ATOM   4252  O OG1  . THR A 1 91  ? 3.182   4.670   -7.730  1.00 0.00 ? 91  THR A OG1  3  
ATOM   4253  C CG2  . THR A 1 91  ? 0.994   5.359   -8.143  1.00 0.00 ? 91  THR A CG2  3  
ATOM   4254  H H    . THR A 1 91  ? 3.049   5.210   -5.741  1.00 0.00 ? 91  THR A H    3  
ATOM   4255  H HA   . THR A 1 91  ? 0.550   3.724   -6.049  1.00 0.00 ? 91  THR A HA   3  
ATOM   4256  H HB   . THR A 1 91  ? 1.690   3.312   -8.368  1.00 0.00 ? 91  THR A HB   3  
ATOM   4257  H HG1  . THR A 1 91  ? 3.179   5.654   -7.547  1.00 0.00 ? 91  THR A HG1  3  
ATOM   4258  H HG21 . THR A 1 91  ? 0.268   5.032   -8.887  1.00 0.00 ? 91  THR A HG21 3  
ATOM   4259  H HG22 . THR A 1 91  ? 0.469   5.761   -7.276  1.00 0.00 ? 91  THR A HG22 3  
ATOM   4260  H HG23 . THR A 1 91  ? 1.634   6.129   -8.573  1.00 0.00 ? 91  THR A HG23 3  
ATOM   4261  N N    . LEU A 1 92  ? 1.388   1.595   -5.256  1.00 0.00 ? 92  LEU A N    3  
ATOM   4262  C CA   . LEU A 1 92  ? 1.820   0.271   -4.844  1.00 0.00 ? 92  LEU A CA   3  
ATOM   4263  C C    . LEU A 1 92  ? 0.811   -0.766  -5.340  1.00 0.00 ? 92  LEU A C    3  
ATOM   4264  O O    . LEU A 1 92  ? -0.347  -0.439  -5.596  1.00 0.00 ? 92  LEU A O    3  
ATOM   4265  C CB   . LEU A 1 92  ? 2.052   0.228   -3.332  1.00 0.00 ? 92  LEU A CB   3  
ATOM   4266  C CG   . LEU A 1 92  ? 1.887   1.556   -2.590  1.00 0.00 ? 92  LEU A CG   3  
ATOM   4267  C CD1  . LEU A 1 92  ? 1.728   1.328   -1.087  1.00 0.00 ? 92  LEU A CD1  3  
ATOM   4268  C CD2  . LEU A 1 92  ? 3.044   2.507   -2.907  1.00 0.00 ? 92  LEU A CD2  3  
ATOM   4269  H H    . LEU A 1 92  ? 0.439   1.818   -5.034  1.00 0.00 ? 92  LEU A H    3  
ATOM   4270  H HA   . LEU A 1 92  ? 2.780   0.075   -5.323  1.00 0.00 ? 92  LEU A HA   3  
ATOM   4271  H HB2  . LEU A 1 92  ? 1.362   -0.495  -2.899  1.00 0.00 ? 92  LEU A HB2  3  
ATOM   4272  H HB3  . LEU A 1 92  ? 3.060   -0.144  -3.150  1.00 0.00 ? 92  LEU A HB3  3  
ATOM   4273  H HG   . LEU A 1 92  ? 0.973   2.034   -2.944  1.00 0.00 ? 92  LEU A HG   3  
ATOM   4274  H HD11 . LEU A 1 92  ? 2.198   0.384   -0.810  1.00 0.00 ? 92  LEU A HD11 3  
ATOM   4275  H HD12 . LEU A 1 92  ? 2.204   2.144   -0.543  1.00 0.00 ? 92  LEU A HD12 3  
ATOM   4276  H HD13 . LEU A 1 92  ? 0.667   1.295   -0.835  1.00 0.00 ? 92  LEU A HD13 3  
ATOM   4277  H HD21 . LEU A 1 92  ? 3.492   2.231   -3.861  1.00 0.00 ? 92  LEU A HD21 3  
ATOM   4278  H HD22 . LEU A 1 92  ? 2.668   3.529   -2.964  1.00 0.00 ? 92  LEU A HD22 3  
ATOM   4279  H HD23 . LEU A 1 92  ? 3.795   2.440   -2.120  1.00 0.00 ? 92  LEU A HD23 3  
ATOM   4280  N N    . GLU A 1 93  ? 1.286   -1.997  -5.462  1.00 0.00 ? 93  GLU A N    3  
ATOM   4281  C CA   . GLU A 1 93  ? 0.441   -3.085  -5.921  1.00 0.00 ? 93  GLU A CA   3  
ATOM   4282  C C    . GLU A 1 93  ? -0.169  -3.826  -4.730  1.00 0.00 ? 93  GLU A C    3  
ATOM   4283  O O    . GLU A 1 93  ? 0.536   -4.516  -3.997  1.00 0.00 ? 93  GLU A O    3  
ATOM   4284  C CB   . GLU A 1 93  ? 1.223   -4.044  -6.822  1.00 0.00 ? 93  GLU A CB   3  
ATOM   4285  C CG   . GLU A 1 93  ? 0.418   -4.398  -8.074  1.00 0.00 ? 93  GLU A CG   3  
ATOM   4286  C CD   . GLU A 1 93  ? 0.432   -5.907  -8.327  1.00 0.00 ? 93  GLU A CD   3  
ATOM   4287  O OE1  . GLU A 1 93  ? 0.291   -6.650  -7.333  1.00 0.00 ? 93  GLU A OE1  3  
ATOM   4288  O OE2  . GLU A 1 93  ? 0.585   -6.282  -9.509  1.00 0.00 ? 93  GLU A OE2  3  
ATOM   4289  H H    . GLU A 1 93  ? 2.229   -2.256  -5.250  1.00 0.00 ? 93  GLU A H    3  
ATOM   4290  H HA   . GLU A 1 93  ? -0.349  -2.610  -6.506  1.00 0.00 ? 93  GLU A HA   3  
ATOM   4291  H HB2  . GLU A 1 93  ? 2.169   -3.588  -7.110  1.00 0.00 ? 93  GLU A HB2  3  
ATOM   4292  H HB3  . GLU A 1 93  ? 1.461   -4.953  -6.270  1.00 0.00 ? 93  GLU A HB3  3  
ATOM   4293  H HG2  . GLU A 1 93  ? -0.610  -4.055  -7.961  1.00 0.00 ? 93  GLU A HG2  3  
ATOM   4294  H HG3  . GLU A 1 93  ? 0.834   -3.877  -8.937  1.00 0.00 ? 93  GLU A HG3  3  
ATOM   4295  N N    . VAL A 1 94  ? -1.474  -3.657  -4.574  1.00 0.00 ? 94  VAL A N    3  
ATOM   4296  C CA   . VAL A 1 94  ? -2.186  -4.301  -3.483  1.00 0.00 ? 94  VAL A CA   3  
ATOM   4297  C C    . VAL A 1 94  ? -3.217  -5.274  -4.058  1.00 0.00 ? 94  VAL A C    3  
ATOM   4298  O O    . VAL A 1 94  ? -3.549  -5.206  -5.240  1.00 0.00 ? 94  VAL A O    3  
ATOM   4299  C CB   . VAL A 1 94  ? -2.807  -3.245  -2.567  1.00 0.00 ? 94  VAL A CB   3  
ATOM   4300  C CG1  . VAL A 1 94  ? -1.724  -2.483  -1.796  1.00 0.00 ? 94  VAL A CG1  3  
ATOM   4301  C CG2  . VAL A 1 94  ? -3.692  -2.283  -3.361  1.00 0.00 ? 94  VAL A CG2  3  
ATOM   4302  H H    . VAL A 1 94  ? -2.041  -3.094  -5.174  1.00 0.00 ? 94  VAL A H    3  
ATOM   4303  H HA   . VAL A 1 94  ? -1.456  -4.865  -2.902  1.00 0.00 ? 94  VAL A HA   3  
ATOM   4304  H HB   . VAL A 1 94  ? -3.437  -3.758  -1.841  1.00 0.00 ? 94  VAL A HB   3  
ATOM   4305  H HG11 . VAL A 1 94  ? -2.095  -1.493  -1.533  1.00 0.00 ? 94  VAL A HG11 3  
ATOM   4306  H HG12 . VAL A 1 94  ? -1.473  -3.032  -0.886  1.00 0.00 ? 94  VAL A HG12 3  
ATOM   4307  H HG13 . VAL A 1 94  ? -0.835  -2.386  -2.418  1.00 0.00 ? 94  VAL A HG13 3  
ATOM   4308  H HG21 . VAL A 1 94  ? -4.402  -1.801  -2.687  1.00 0.00 ? 94  VAL A HG21 3  
ATOM   4309  H HG22 . VAL A 1 94  ? -3.070  -1.524  -3.834  1.00 0.00 ? 94  VAL A HG22 3  
ATOM   4310  H HG23 . VAL A 1 94  ? -4.236  -2.837  -4.125  1.00 0.00 ? 94  VAL A HG23 3  
ATOM   4311  N N    . ALA A 1 95  ? -3.695  -6.157  -3.193  1.00 0.00 ? 95  ALA A N    3  
ATOM   4312  C CA   . ALA A 1 95  ? -4.683  -7.143  -3.600  1.00 0.00 ? 95  ALA A CA   3  
ATOM   4313  C C    . ALA A 1 95  ? -5.709  -7.323  -2.478  1.00 0.00 ? 95  ALA A C    3  
ATOM   4314  O O    . ALA A 1 95  ? -5.343  -7.574  -1.331  1.00 0.00 ? 95  ALA A O    3  
ATOM   4315  C CB   . ALA A 1 95  ? -3.980  -8.452  -3.962  1.00 0.00 ? 95  ALA A CB   3  
ATOM   4316  H H    . ALA A 1 95  ? -3.421  -6.205  -2.232  1.00 0.00 ? 95  ALA A H    3  
ATOM   4317  H HA   . ALA A 1 95  ? -5.191  -6.759  -4.486  1.00 0.00 ? 95  ALA A HA   3  
ATOM   4318  H HB1  . ALA A 1 95  ? -4.693  -9.275  -3.912  1.00 0.00 ? 95  ALA A HB1  3  
ATOM   4319  H HB2  . ALA A 1 95  ? -3.577  -8.380  -4.972  1.00 0.00 ? 95  ALA A HB2  3  
ATOM   4320  H HB3  . ALA A 1 95  ? -3.167  -8.632  -3.259  1.00 0.00 ? 95  ALA A HB3  3  
ATOM   4321  N N    . LYS A 1 96  ? -6.973  -7.189  -2.850  1.00 0.00 ? 96  LYS A N    3  
ATOM   4322  C CA   . LYS A 1 96  ? -8.055  -7.333  -1.890  1.00 0.00 ? 96  LYS A CA   3  
ATOM   4323  C C    . LYS A 1 96  ? -8.085  -8.774  -1.376  1.00 0.00 ? 96  LYS A C    3  
ATOM   4324  O O    . LYS A 1 96  ? -8.727  -9.637  -1.973  1.00 0.00 ? 96  LYS A O    3  
ATOM   4325  C CB   . LYS A 1 96  ? -9.380  -6.872  -2.502  1.00 0.00 ? 96  LYS A CB   3  
ATOM   4326  C CG   . LYS A 1 96  ? -9.884  -5.599  -1.820  1.00 0.00 ? 96  LYS A CG   3  
ATOM   4327  C CD   . LYS A 1 96  ? -10.755 -5.933  -0.607  1.00 0.00 ? 96  LYS A CD   3  
ATOM   4328  C CE   . LYS A 1 96  ? -11.544 -4.709  -0.143  1.00 0.00 ? 96  LYS A CE   3  
ATOM   4329  N NZ   . LYS A 1 96  ? -12.893 -5.104  0.319   1.00 0.00 ? 96  LYS A NZ   3  
ATOM   4330  H H    . LYS A 1 96  ? -7.264  -6.986  -3.785  1.00 0.00 ? 96  LYS A H    3  
ATOM   4331  H HA   . LYS A 1 96  ? -7.840  -6.671  -1.052  1.00 0.00 ? 96  LYS A HA   3  
ATOM   4332  H HB2  . LYS A 1 96  ? -9.250  -6.689  -3.568  1.00 0.00 ? 96  LYS A HB2  3  
ATOM   4333  H HB3  . LYS A 1 96  ? -10.124 -7.662  -2.403  1.00 0.00 ? 96  LYS A HB3  3  
ATOM   4334  H HG2  . LYS A 1 96  ? -9.036  -4.991  -1.506  1.00 0.00 ? 96  LYS A HG2  3  
ATOM   4335  H HG3  . LYS A 1 96  ? -10.458 -5.004  -2.532  1.00 0.00 ? 96  LYS A HG3  3  
ATOM   4336  H HD2  . LYS A 1 96  ? -11.444 -6.741  -0.862  1.00 0.00 ? 96  LYS A HD2  3  
ATOM   4337  H HD3  . LYS A 1 96  ? -10.126 -6.295  0.207   1.00 0.00 ? 96  LYS A HD3  3  
ATOM   4338  H HE2  . LYS A 1 96  ? -11.008 -4.209  0.664   1.00 0.00 ? 96  LYS A HE2  3  
ATOM   4339  H HE3  . LYS A 1 96  ? -11.629 -3.993  -0.961  1.00 0.00 ? 96  LYS A HE3  3  
ATOM   4340  H HZ1  . LYS A 1 96  ? -13.253 -4.405  0.936   1.00 0.00 ? 96  LYS A HZ1  3  
ATOM   4341  H HZ2  . LYS A 1 96  ? -13.501 -5.200  -0.468  1.00 0.00 ? 96  LYS A HZ2  3  
ATOM   4342  H HZ3  . LYS A 1 96  ? -12.836 -5.978  0.803   1.00 0.00 ? 96  LYS A HZ3  3  
ATOM   4343  N N    . GLN A 1 97  ? -7.383  -8.989  -0.273  1.00 0.00 ? 97  GLN A N    3  
ATOM   4344  C CA   . GLN A 1 97  ? -7.320  -10.310 0.328   1.00 0.00 ? 97  GLN A CA   3  
ATOM   4345  C C    . GLN A 1 97  ? -6.442  -10.281 1.581   1.00 0.00 ? 97  GLN A C    3  
ATOM   4346  O O    . GLN A 1 97  ? -5.233  -10.067 1.492   1.00 0.00 ? 97  GLN A O    3  
ATOM   4347  C CB   . GLN A 1 97  ? -6.810  -11.346 -0.675  1.00 0.00 ? 97  GLN A CB   3  
ATOM   4348  C CG   . GLN A 1 97  ? -7.945  -12.255 -1.151  1.00 0.00 ? 97  GLN A CG   3  
ATOM   4349  C CD   . GLN A 1 97  ? -7.477  -13.707 -1.256  1.00 0.00 ? 97  GLN A CD   3  
ATOM   4350  O OE1  . GLN A 1 97  ? -7.005  -14.161 -2.286  1.00 0.00 ? 97  GLN A OE1  3  
ATOM   4351  N NE2  . GLN A 1 97  ? -7.634  -14.410 -0.138  1.00 0.00 ? 97  GLN A NE2  3  
ATOM   4352  H H    . GLN A 1 97  ? -6.864  -8.281  0.207   1.00 0.00 ? 97  GLN A H    3  
ATOM   4353  H HA   . GLN A 1 97  ? -8.347  -10.553 0.602   1.00 0.00 ? 97  GLN A HA   3  
ATOM   4354  H HB2  . GLN A 1 97  ? -6.363  -10.840 -1.531  1.00 0.00 ? 97  GLN A HB2  3  
ATOM   4355  H HB3  . GLN A 1 97  ? -6.026  -11.947 -0.215  1.00 0.00 ? 97  GLN A HB3  3  
ATOM   4356  H HG2  . GLN A 1 97  ? -8.784  -12.189 -0.456  1.00 0.00 ? 97  GLN A HG2  3  
ATOM   4357  H HG3  . GLN A 1 97  ? -8.307  -11.915 -2.120  1.00 0.00 ? 97  GLN A HG3  3  
ATOM   4358  H HE21 . GLN A 1 97  ? -8.029  -13.977 0.672   1.00 0.00 ? 97  GLN A HE21 3  
ATOM   4359  H HE22 . GLN A 1 97  ? -7.358  -15.371 -0.107  1.00 0.00 ? 97  GLN A HE22 3  
ATOM   4360  N N    . GLY A 1 98  ? -7.084  -10.501 2.720   1.00 0.00 ? 98  GLY A N    3  
ATOM   4361  C CA   . GLY A 1 98  ? -6.376  -10.503 3.988   1.00 0.00 ? 98  GLY A CA   3  
ATOM   4362  C C    . GLY A 1 98  ? -7.178  -9.768  5.066   1.00 0.00 ? 98  GLY A C    3  
ATOM   4363  O O    . GLY A 1 98  ? -8.188  -9.133  4.766   1.00 0.00 ? 98  GLY A O    3  
ATOM   4364  H H    . GLY A 1 98  ? -8.066  -10.675 2.784   1.00 0.00 ? 98  GLY A H    3  
ATOM   4365  H HA2  . GLY A 1 98  ? -6.192  -11.530 4.305   1.00 0.00 ? 98  GLY A HA2  3  
ATOM   4366  H HA3  . GLY A 1 98  ? -5.402  -10.028 3.868   1.00 0.00 ? 98  GLY A HA3  3  
ATOM   4367  N N    . ALA A 1 99  ? -6.697  -9.879  6.294   1.00 0.00 ? 99  ALA A N    3  
ATOM   4368  C CA   . ALA A 1 99  ? -7.357  -9.232  7.417   1.00 0.00 ? 99  ALA A CA   3  
ATOM   4369  C C    . ALA A 1 99  ? -6.515  -9.428  8.679   1.00 0.00 ? 99  ALA A C    3  
ATOM   4370  O O    . ALA A 1 99  ? -5.917  -10.486 8.872   1.00 0.00 ? 99  ALA A O    3  
ATOM   4371  C CB   . ALA A 1 99  ? -8.774  -9.791  7.567   1.00 0.00 ? 99  ALA A CB   3  
ATOM   4372  H H    . ALA A 1 99  ? -5.874  -10.397 6.529   1.00 0.00 ? 99  ALA A H    3  
ATOM   4373  H HA   . ALA A 1 99  ? -7.421  -8.166  7.195   1.00 0.00 ? 99  ALA A HA   3  
ATOM   4374  H HB1  . ALA A 1 99  ? -9.415  -9.367  6.794   1.00 0.00 ? 99  ALA A HB1  3  
ATOM   4375  H HB2  . ALA A 1 99  ? -8.750  -10.876 7.464   1.00 0.00 ? 99  ALA A HB2  3  
ATOM   4376  H HB3  . ALA A 1 99  ? -9.164  -9.526  8.550   1.00 0.00 ? 99  ALA A HB3  3  
ATOM   4377  N N    . ILE A 1 100 ? -6.495  -8.395  9.506   1.00 0.00 ? 100 ILE A N    3  
ATOM   4378  C CA   . ILE A 1 100 ? -5.738  -8.439  10.744  1.00 0.00 ? 100 ILE A CA   3  
ATOM   4379  C C    . ILE A 1 100 ? -6.649  -8.053  11.912  1.00 0.00 ? 100 ILE A C    3  
ATOM   4380  O O    . ILE A 1 100 ? -7.805  -7.684  11.704  1.00 0.00 ? 100 ILE A O    3  
ATOM   4381  C CB   . ILE A 1 100 ? -4.480  -7.575  10.635  1.00 0.00 ? 100 ILE A CB   3  
ATOM   4382  C CG1  . ILE A 1 100 ? -4.834  -6.087  10.637  1.00 0.00 ? 100 ILE A CG1  3  
ATOM   4383  C CG2  . ILE A 1 100 ? -3.652  -7.964  9.409   1.00 0.00 ? 100 ILE A CG2  3  
ATOM   4384  C CD1  . ILE A 1 100 ? -5.301  -5.632  9.254   1.00 0.00 ? 100 ILE A CD1  3  
ATOM   4385  H H    . ILE A 1 100 ? -6.985  -7.537  9.341   1.00 0.00 ? 100 ILE A H    3  
ATOM   4386  H HA   . ILE A 1 100 ? -5.409  -9.468  10.889  1.00 0.00 ? 100 ILE A HA   3  
ATOM   4387  H HB   . ILE A 1 100 ? -3.861  -7.760  11.512  1.00 0.00 ? 100 ILE A HB   3  
ATOM   4388  H HG12 . ILE A 1 100 ? -5.621  -5.898  11.370  1.00 0.00 ? 100 ILE A HG12 3  
ATOM   4389  H HG13 . ILE A 1 100 ? -3.967  -5.504  10.943  1.00 0.00 ? 100 ILE A HG13 3  
ATOM   4390  H HG21 . ILE A 1 100 ? -3.143  -7.083  9.018   1.00 0.00 ? 100 ILE A HG21 3  
ATOM   4391  H HG22 . ILE A 1 100 ? -2.912  -8.714  9.692   1.00 0.00 ? 100 ILE A HG22 3  
ATOM   4392  H HG23 . ILE A 1 100 ? -4.310  -8.374  8.642   1.00 0.00 ? 100 ILE A HG23 3  
ATOM   4393  H HD11 . ILE A 1 100 ? -4.536  -4.998  8.803   1.00 0.00 ? 100 ILE A HD11 3  
ATOM   4394  H HD12 . ILE A 1 100 ? -5.468  -6.503  8.621   1.00 0.00 ? 100 ILE A HD12 3  
ATOM   4395  H HD13 . ILE A 1 100 ? -6.229  -5.068  9.348   1.00 0.00 ? 100 ILE A HD13 3  
ATOM   4396  N N    . TYR A 1 101 ? -6.097  -8.149  13.110  1.00 0.00 ? 101 TYR A N    3  
ATOM   4397  C CA   . TYR A 1 101 ? -6.845  -7.814  14.310  1.00 0.00 ? 101 TYR A CA   3  
ATOM   4398  C C    . TYR A 1 101 ? -7.410  -6.394  14.224  1.00 0.00 ? 101 TYR A C    3  
ATOM   4399  O O    . TYR A 1 101 ? -6.669  -5.441  13.990  1.00 0.00 ? 101 TYR A O    3  
ATOM   4400  C CB   . TYR A 1 101 ? -5.846  -7.884  15.465  1.00 0.00 ? 101 TYR A CB   3  
ATOM   4401  C CG   . TYR A 1 101 ? -6.281  -7.115  16.713  1.00 0.00 ? 101 TYR A CG   3  
ATOM   4402  C CD1  . TYR A 1 101 ? -7.486  -7.411  17.320  1.00 0.00 ? 101 TYR A CD1  3  
ATOM   4403  C CD2  . TYR A 1 101 ? -5.472  -6.127  17.233  1.00 0.00 ? 101 TYR A CD2  3  
ATOM   4404  C CE1  . TYR A 1 101 ? -7.898  -6.687  18.495  1.00 0.00 ? 101 TYR A CE1  3  
ATOM   4405  C CE2  . TYR A 1 101 ? -5.884  -5.403  18.408  1.00 0.00 ? 101 TYR A CE2  3  
ATOM   4406  C CZ   . TYR A 1 101 ? -7.075  -5.718  18.981  1.00 0.00 ? 101 TYR A CZ   3  
ATOM   4407  O OH   . TYR A 1 101 ? -7.464  -5.036  20.091  1.00 0.00 ? 101 TYR A OH   3  
ATOM   4408  H H    . TYR A 1 101 ? -5.155  -8.451  13.270  1.00 0.00 ? 101 TYR A H    3  
ATOM   4409  H HA   . TYR A 1 101 ? -7.671  -8.521  14.399  1.00 0.00 ? 101 TYR A HA   3  
ATOM   4410  H HB2  . TYR A 1 101 ? -5.687  -8.930  15.732  1.00 0.00 ? 101 TYR A HB2  3  
ATOM   4411  H HB3  . TYR A 1 101 ? -4.887  -7.492  15.125  1.00 0.00 ? 101 TYR A HB3  3  
ATOM   4412  H HD1  . TYR A 1 101 ? -8.126  -8.191  16.909  1.00 0.00 ? 101 TYR A HD1  3  
ATOM   4413  H HD2  . TYR A 1 101 ? -4.521  -5.894  16.755  1.00 0.00 ? 101 TYR A HD2  3  
ATOM   4414  H HE1  . TYR A 1 101 ? -8.846  -6.909  18.983  1.00 0.00 ? 101 TYR A HE1  3  
ATOM   4415  H HE2  . TYR A 1 101 ? -5.254  -4.619  18.829  1.00 0.00 ? 101 TYR A HE2  3  
ATOM   4416  H HH   . TYR A 1 101 ? -7.250  -5.565  20.911  1.00 0.00 ? 101 TYR A HH   3  
ATOM   4417  N N    . GLY A 1 1   ? -11.674 -21.216 -29.402 1.00 0.00 ? 1   GLY A N    4  
ATOM   4418  C CA   . GLY A 1 1   ? -11.882 -19.920 -28.778 1.00 0.00 ? 1   GLY A CA   4  
ATOM   4419  C C    . GLY A 1 1   ? -12.201 -20.074 -27.289 1.00 0.00 ? 1   GLY A C    4  
ATOM   4420  O O    . GLY A 1 1   ? -13.358 -20.259 -26.914 1.00 0.00 ? 1   GLY A O    4  
ATOM   4421  H H1   . GLY A 1 1   ? -12.347 -21.462 -30.099 1.00 0.00 ? 1   GLY A H1   4  
ATOM   4422  H HA2  . GLY A 1 1   ? -10.991 -19.306 -28.901 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   4423  H HA3  . GLY A 1 1   ? -12.699 -19.399 -29.277 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   4424  N N    . PRO A 1 2   ? -11.127 -19.987 -26.459 1.00 0.00 ? 2   PRO A N    4  
ATOM   4425  C CA   . PRO A 1 2   ? -11.283 -20.114 -25.019 1.00 0.00 ? 2   PRO A CA   4  
ATOM   4426  C C    . PRO A 1 2   ? -11.893 -18.845 -24.420 1.00 0.00 ? 2   PRO A C    4  
ATOM   4427  O O    . PRO A 1 2   ? -12.119 -17.866 -25.129 1.00 0.00 ? 2   PRO A O    4  
ATOM   4428  C CB   . PRO A 1 2   ? -9.886  -20.405 -24.498 1.00 0.00 ? 2   PRO A CB   4  
ATOM   4429  C CG   . PRO A 1 2   ? -8.931  -19.972 -25.598 1.00 0.00 ? 2   PRO A CG   4  
ATOM   4430  C CD   . PRO A 1 2   ? -9.744  -19.767 -26.866 1.00 0.00 ? 2   PRO A CD   4  
ATOM   4431  H HA   . PRO A 1 2   ? -11.921 -20.852 -24.802 1.00 0.00 ? 2   PRO A HA   4  
ATOM   4432  H HB2  . PRO A 1 2   ? -9.691  -19.858 -23.576 1.00 0.00 ? 2   PRO A HB2  4  
ATOM   4433  H HB3  . PRO A 1 2   ? -9.767  -21.466 -24.271 1.00 0.00 ? 2   PRO A HB3  4  
ATOM   4434  H HG2  . PRO A 1 2   ? -8.419  -19.051 -25.319 1.00 0.00 ? 2   PRO A HG2  4  
ATOM   4435  H HG3  . PRO A 1 2   ? -8.163  -20.728 -25.757 1.00 0.00 ? 2   PRO A HG3  4  
ATOM   4436  H HD2  . PRO A 1 2   ? -9.603  -18.764 -27.268 1.00 0.00 ? 2   PRO A HD2  4  
ATOM   4437  H HD3  . PRO A 1 2   ? -9.445  -20.468 -27.647 1.00 0.00 ? 2   PRO A HD3  4  
ATOM   4438  N N    . LEU A 1 3   ? -12.141 -18.904 -23.119 1.00 0.00 ? 3   LEU A N    4  
ATOM   4439  C CA   . LEU A 1 3   ? -12.720 -17.771 -22.415 1.00 0.00 ? 3   LEU A CA   4  
ATOM   4440  C C    . LEU A 1 3   ? -12.312 -17.830 -20.943 1.00 0.00 ? 3   LEU A C    4  
ATOM   4441  O O    . LEU A 1 3   ? -11.965 -18.894 -20.432 1.00 0.00 ? 3   LEU A O    4  
ATOM   4442  C CB   . LEU A 1 3   ? -14.233 -17.722 -22.634 1.00 0.00 ? 3   LEU A CB   4  
ATOM   4443  C CG   . LEU A 1 3   ? -14.730 -16.711 -23.669 1.00 0.00 ? 3   LEU A CG   4  
ATOM   4444  C CD1  . LEU A 1 3   ? -15.249 -17.418 -24.922 1.00 0.00 ? 3   LEU A CD1  4  
ATOM   4445  C CD2  . LEU A 1 3   ? -15.779 -15.777 -23.063 1.00 0.00 ? 3   LEU A CD2  4  
ATOM   4446  H H    . LEU A 1 3   ? -11.954 -19.703 -22.551 1.00 0.00 ? 3   LEU A H    4  
ATOM   4447  H HA   . LEU A 1 3   ? -12.302 -16.866 -22.855 1.00 0.00 ? 3   LEU A HA   4  
ATOM   4448  H HB2  . LEU A 1 3   ? -14.570 -18.714 -22.935 1.00 0.00 ? 3   LEU A HB2  4  
ATOM   4449  H HB3  . LEU A 1 3   ? -14.712 -17.500 -21.680 1.00 0.00 ? 3   LEU A HB3  4  
ATOM   4450  H HG   . LEU A 1 3   ? -13.886 -16.092 -23.974 1.00 0.00 ? 3   LEU A HG   4  
ATOM   4451  H HD11 . LEU A 1 3   ? -16.152 -17.975 -24.678 1.00 0.00 ? 3   LEU A HD11 4  
ATOM   4452  H HD12 . LEU A 1 3   ? -15.474 -16.678 -25.691 1.00 0.00 ? 3   LEU A HD12 4  
ATOM   4453  H HD13 . LEU A 1 3   ? -14.487 -18.106 -25.292 1.00 0.00 ? 3   LEU A HD13 4  
ATOM   4454  H HD21 . LEU A 1 3   ? -16.292 -16.286 -22.247 1.00 0.00 ? 3   LEU A HD21 4  
ATOM   4455  H HD22 . LEU A 1 3   ? -15.290 -14.879 -22.683 1.00 0.00 ? 3   LEU A HD22 4  
ATOM   4456  H HD23 . LEU A 1 3   ? -16.504 -15.499 -23.829 1.00 0.00 ? 3   LEU A HD23 4  
ATOM   4457  N N    . GLY A 1 4   ? -12.367 -16.672 -20.300 1.00 0.00 ? 4   GLY A N    4  
ATOM   4458  C CA   . GLY A 1 4   ? -12.008 -16.578 -18.896 1.00 0.00 ? 4   GLY A CA   4  
ATOM   4459  C C    . GLY A 1 4   ? -10.535 -16.929 -18.682 1.00 0.00 ? 4   GLY A C    4  
ATOM   4460  O O    . GLY A 1 4   ? -9.654  -16.111 -18.943 1.00 0.00 ? 4   GLY A O    4  
ATOM   4461  H H    . GLY A 1 4   ? -12.650 -15.810 -20.723 1.00 0.00 ? 4   GLY A H    4  
ATOM   4462  H HA2  . GLY A 1 4   ? -12.200 -15.567 -18.535 1.00 0.00 ? 4   GLY A HA2  4  
ATOM   4463  H HA3  . GLY A 1 4   ? -12.635 -17.249 -18.311 1.00 0.00 ? 4   GLY A HA3  4  
ATOM   4464  N N    . SER A 1 5   ? -10.313 -18.147 -18.209 1.00 0.00 ? 5   SER A N    4  
ATOM   4465  C CA   . SER A 1 5   ? -8.961  -18.617 -17.957 1.00 0.00 ? 5   SER A CA   4  
ATOM   4466  C C    . SER A 1 5   ? -8.421  -17.992 -16.668 1.00 0.00 ? 5   SER A C    4  
ATOM   4467  O O    . SER A 1 5   ? -7.804  -16.928 -16.699 1.00 0.00 ? 5   SER A O    4  
ATOM   4468  C CB   . SER A 1 5   ? -8.037  -18.291 -19.131 1.00 0.00 ? 5   SER A CB   4  
ATOM   4469  O OG   . SER A 1 5   ? -7.134  -19.356 -19.411 1.00 0.00 ? 5   SER A OG   4  
ATOM   4470  H H    . SER A 1 5   ? -11.036 -18.805 -17.998 1.00 0.00 ? 5   SER A H    4  
ATOM   4471  H HA   . SER A 1 5   ? -9.046  -19.699 -17.851 1.00 0.00 ? 5   SER A HA   4  
ATOM   4472  H HB2  . SER A 1 5   ? -8.637  -18.081 -20.017 1.00 0.00 ? 5   SER A HB2  4  
ATOM   4473  H HB3  . SER A 1 5   ? -7.471  -17.386 -18.908 1.00 0.00 ? 5   SER A HB3  4  
ATOM   4474  H HG   . SER A 1 5   ? -7.622  -20.231 -19.395 1.00 0.00 ? 5   SER A HG   4  
ATOM   4475  N N    . LEU A 1 6   ? -8.674  -18.681 -15.564 1.00 0.00 ? 6   LEU A N    4  
ATOM   4476  C CA   . LEU A 1 6   ? -8.221  -18.208 -14.267 1.00 0.00 ? 6   LEU A CA   4  
ATOM   4477  C C    . LEU A 1 6   ? -8.705  -16.771 -14.055 1.00 0.00 ? 6   LEU A C    4  
ATOM   4478  O O    . LEU A 1 6   ? -9.386  -16.210 -14.912 1.00 0.00 ? 6   LEU A O    4  
ATOM   4479  C CB   . LEU A 1 6   ? -6.707  -18.371 -14.135 1.00 0.00 ? 6   LEU A CB   4  
ATOM   4480  C CG   . LEU A 1 6   ? -6.220  -19.720 -13.600 1.00 0.00 ? 6   LEU A CG   4  
ATOM   4481  C CD1  . LEU A 1 6   ? -6.713  -19.951 -12.170 1.00 0.00 ? 6   LEU A CD1  4  
ATOM   4482  C CD2  . LEU A 1 6   ? -6.626  -20.860 -14.537 1.00 0.00 ? 6   LEU A CD2  4  
ATOM   4483  H H    . LEU A 1 6   ? -9.176  -19.545 -15.546 1.00 0.00 ? 6   LEU A H    4  
ATOM   4484  H HA   . LEU A 1 6   ? -8.681  -18.842 -13.509 1.00 0.00 ? 6   LEU A HA   4  
ATOM   4485  H HB2  . LEU A 1 6   ? -6.257  -18.209 -15.115 1.00 0.00 ? 6   LEU A HB2  4  
ATOM   4486  H HB3  . LEU A 1 6   ? -6.330  -17.587 -13.479 1.00 0.00 ? 6   LEU A HB3  4  
ATOM   4487  H HG   . LEU A 1 6   ? -5.131  -19.703 -13.566 1.00 0.00 ? 6   LEU A HG   4  
ATOM   4488  H HD11 . LEU A 1 6   ? -7.391  -20.804 -12.154 1.00 0.00 ? 6   LEU A HD11 4  
ATOM   4489  H HD12 . LEU A 1 6   ? -5.861  -20.151 -11.520 1.00 0.00 ? 6   LEU A HD12 4  
ATOM   4490  H HD13 . LEU A 1 6   ? -7.237  -19.063 -11.819 1.00 0.00 ? 6   LEU A HD13 4  
ATOM   4491  H HD21 . LEU A 1 6   ? -6.225  -20.672 -15.531 1.00 0.00 ? 6   LEU A HD21 4  
ATOM   4492  H HD22 . LEU A 1 6   ? -6.230  -21.802 -14.157 1.00 0.00 ? 6   LEU A HD22 4  
ATOM   4493  H HD23 . LEU A 1 6   ? -7.713  -20.918 -14.589 1.00 0.00 ? 6   LEU A HD23 4  
ATOM   4494  N N    . ARG A 1 7   ? -8.332  -16.218 -12.911 1.00 0.00 ? 7   ARG A N    4  
ATOM   4495  C CA   . ARG A 1 7   ? -8.720  -14.858 -12.576 1.00 0.00 ? 7   ARG A CA   4  
ATOM   4496  C C    . ARG A 1 7   ? -7.492  -14.042 -12.166 1.00 0.00 ? 7   ARG A C    4  
ATOM   4497  O O    . ARG A 1 7   ? -6.390  -14.579 -12.070 1.00 0.00 ? 7   ARG A O    4  
ATOM   4498  C CB   . ARG A 1 7   ? -9.742  -14.839 -11.438 1.00 0.00 ? 7   ARG A CB   4  
ATOM   4499  C CG   . ARG A 1 7   ? -9.162  -15.474 -10.173 1.00 0.00 ? 7   ARG A CG   4  
ATOM   4500  C CD   . ARG A 1 7   ? -10.037 -16.633 -9.690  1.00 0.00 ? 7   ARG A CD   4  
ATOM   4501  N NE   . ARG A 1 7   ? -9.459  -17.228 -8.464  1.00 0.00 ? 7   ARG A NE   4  
ATOM   4502  C CZ   . ARG A 1 7   ? -9.891  -18.368 -7.905  1.00 0.00 ? 7   ARG A CZ   4  
ATOM   4503  N NH1  . ARG A 1 7   ? -10.909 -19.040 -8.458  1.00 0.00 ? 7   ARG A NH1  4  
ATOM   4504  N NH2  . ARG A 1 7   ? -9.305  -18.832 -6.794  1.00 0.00 ? 7   ARG A NH2  4  
ATOM   4505  H H    . ARG A 1 7   ? -7.778  -16.681 -12.220 1.00 0.00 ? 7   ARG A H    4  
ATOM   4506  H HA   . ARG A 1 7   ? -9.166  -14.463 -13.490 1.00 0.00 ? 7   ARG A HA   4  
ATOM   4507  H HB2  . ARG A 1 7   ? -10.040 -13.813 -11.229 1.00 0.00 ? 7   ARG A HB2  4  
ATOM   4508  H HB3  . ARG A 1 7   ? -10.639 -15.379 -11.741 1.00 0.00 ? 7   ARG A HB3  4  
ATOM   4509  H HG2  . ARG A 1 7   ? -8.151  -15.835 -10.371 1.00 0.00 ? 7   ARG A HG2  4  
ATOM   4510  H HG3  . ARG A 1 7   ? -9.082  -14.723 -9.387  1.00 0.00 ? 7   ARG A HG3  4  
ATOM   4511  H HD2  . ARG A 1 7   ? -11.047 -16.278 -9.489  1.00 0.00 ? 7   ARG A HD2  4  
ATOM   4512  H HD3  . ARG A 1 7   ? -10.115 -17.390 -10.468 1.00 0.00 ? 7   ARG A HD3  4  
ATOM   4513  H HE   . ARG A 1 7   ? -8.697  -16.752 -8.025  1.00 0.00 ? 7   ARG A HE   4  
ATOM   4514  H HH11 . ARG A 1 7   ? -11.346 -18.692 -9.289  1.00 0.00 ? 7   ARG A HH11 4  
ATOM   4515  H HH12 . ARG A 1 7   ? -11.231 -19.890 -8.042  1.00 0.00 ? 7   ARG A HH12 4  
ATOM   4516  H HH21 . ARG A 1 7   ? -8.546  -18.329 -6.380  1.00 0.00 ? 7   ARG A HH21 4  
ATOM   4517  H HH22 . ARG A 1 7   ? -9.629  -19.681 -6.377  1.00 0.00 ? 7   ARG A HH22 4  
ATOM   4518  N N    . LYS A 1 8   ? -7.726  -12.758 -11.932 1.00 0.00 ? 8   LYS A N    4  
ATOM   4519  C CA   . LYS A 1 8   ? -6.652  -11.864 -11.534 1.00 0.00 ? 8   LYS A CA   4  
ATOM   4520  C C    . LYS A 1 8   ? -6.397  -12.018 -10.032 1.00 0.00 ? 8   LYS A C    4  
ATOM   4521  O O    . LYS A 1 8   ? -6.711  -13.055 -9.450  1.00 0.00 ? 8   LYS A O    4  
ATOM   4522  C CB   . LYS A 1 8   ? -6.966  -10.429 -11.961 1.00 0.00 ? 8   LYS A CB   4  
ATOM   4523  C CG   . LYS A 1 8   ? -5.823  -9.842  -12.793 1.00 0.00 ? 8   LYS A CG   4  
ATOM   4524  C CD   . LYS A 1 8   ? -6.321  -8.694  -13.673 1.00 0.00 ? 8   LYS A CD   4  
ATOM   4525  C CE   . LYS A 1 8   ? -5.298  -8.351  -14.757 1.00 0.00 ? 8   LYS A CE   4  
ATOM   4526  N NZ   . LYS A 1 8   ? -4.471  -7.195  -14.345 1.00 0.00 ? 8   LYS A NZ   4  
ATOM   4527  H H    . LYS A 1 8   ? -8.625  -12.331 -12.014 1.00 0.00 ? 8   LYS A H    4  
ATOM   4528  H HA   . LYS A 1 8   ? -5.755  -12.171 -12.070 1.00 0.00 ? 8   LYS A HA   4  
ATOM   4529  H HB2  . LYS A 1 8   ? -7.890  -10.410 -12.538 1.00 0.00 ? 8   LYS A HB2  4  
ATOM   4530  H HB3  . LYS A 1 8   ? -7.131  -9.811  -11.077 1.00 0.00 ? 8   LYS A HB3  4  
ATOM   4531  H HG2  . LYS A 1 8   ? -5.034  -9.484  -12.133 1.00 0.00 ? 8   LYS A HG2  4  
ATOM   4532  H HG3  . LYS A 1 8   ? -5.389  -10.621 -13.418 1.00 0.00 ? 8   LYS A HG3  4  
ATOM   4533  H HD2  . LYS A 1 8   ? -7.269  -8.968  -14.135 1.00 0.00 ? 8   LYS A HD2  4  
ATOM   4534  H HD3  . LYS A 1 8   ? -6.510  -7.814  -13.056 1.00 0.00 ? 8   LYS A HD3  4  
ATOM   4535  H HE2  . LYS A 1 8   ? -4.658  -9.214  -14.947 1.00 0.00 ? 8   LYS A HE2  4  
ATOM   4536  H HE3  . LYS A 1 8   ? -5.812  -8.123  -15.690 1.00 0.00 ? 8   LYS A HE3  4  
ATOM   4537  H HZ1  . LYS A 1 8   ? -4.244  -6.645  -15.148 1.00 0.00 ? 8   LYS A HZ1  4  
ATOM   4538  H HZ2  . LYS A 1 8   ? -4.982  -6.636  -13.692 1.00 0.00 ? 8   LYS A HZ2  4  
ATOM   4539  H HZ3  . LYS A 1 8   ? -3.629  -7.522  -13.916 1.00 0.00 ? 8   LYS A HZ3  4  
ATOM   4540  N N    . GLU A 1 9   ? -5.831  -10.970 -9.450  1.00 0.00 ? 9   GLU A N    4  
ATOM   4541  C CA   . GLU A 1 9   ? -5.531  -10.978 -8.029  1.00 0.00 ? 9   GLU A CA   4  
ATOM   4542  C C    . GLU A 1 9   ? -4.796  -9.694  -7.637  1.00 0.00 ? 9   GLU A C    4  
ATOM   4543  O O    . GLU A 1 9   ? -5.251  -8.956  -6.763  1.00 0.00 ? 9   GLU A O    4  
ATOM   4544  C CB   . GLU A 1 9   ? -4.717  -12.215 -7.646  1.00 0.00 ? 9   GLU A CB   4  
ATOM   4545  C CG   . GLU A 1 9   ? -5.539  -13.162 -6.771  1.00 0.00 ? 9   GLU A CG   4  
ATOM   4546  C CD   . GLU A 1 9   ? -4.834  -14.512 -6.611  1.00 0.00 ? 9   GLU A CD   4  
ATOM   4547  O OE1  . GLU A 1 9   ? -4.056  -14.858 -7.528  1.00 0.00 ? 9   GLU A OE1  4  
ATOM   4548  O OE2  . GLU A 1 9   ? -5.089  -15.167 -5.579  1.00 0.00 ? 9   GLU A OE2  4  
ATOM   4549  H H    . GLU A 1 9   ? -5.581  -10.132 -9.932  1.00 0.00 ? 9   GLU A H    4  
ATOM   4550  H HA   . GLU A 1 9   ? -6.499  -11.018 -7.528  1.00 0.00 ? 9   GLU A HA   4  
ATOM   4551  H HB2  . GLU A 1 9   ? -4.394  -12.735 -8.548  1.00 0.00 ? 9   GLU A HB2  4  
ATOM   4552  H HB3  . GLU A 1 9   ? -3.815  -11.910 -7.113  1.00 0.00 ? 9   GLU A HB3  4  
ATOM   4553  H HG2  . GLU A 1 9   ? -5.696  -12.713 -5.791  1.00 0.00 ? 9   GLU A HG2  4  
ATOM   4554  H HG3  . GLU A 1 9   ? -6.522  -13.312 -7.214  1.00 0.00 ? 9   GLU A HG3  4  
ATOM   4555  N N    . PRO A 1 10  ? -3.643  -9.461  -8.318  1.00 0.00 ? 10  PRO A N    4  
ATOM   4556  C CA   . PRO A 1 10  ? -2.842  -8.279  -8.050  1.00 0.00 ? 10  PRO A CA   4  
ATOM   4557  C C    . PRO A 1 10  ? -3.488  -7.029  -8.648  1.00 0.00 ? 10  PRO A C    4  
ATOM   4558  O O    . PRO A 1 10  ? -3.833  -7.008  -9.828  1.00 0.00 ? 10  PRO A O    4  
ATOM   4559  C CB   . PRO A 1 10  ? -1.477  -8.585  -8.647  1.00 0.00 ? 10  PRO A CB   4  
ATOM   4560  C CG   . PRO A 1 10  ? -1.699  -9.724  -9.630  1.00 0.00 ? 10  PRO A CG   4  
ATOM   4561  C CD   . PRO A 1 10  ? -3.074  -10.310 -9.359  1.00 0.00 ? 10  PRO A CD   4  
ATOM   4562  H HA   . PRO A 1 10  ? -2.786  -8.114  -7.064  1.00 0.00 ? 10  PRO A HA   4  
ATOM   4563  H HB2  . PRO A 1 10  ? -1.066  -7.711  -9.150  1.00 0.00 ? 10  PRO A HB2  4  
ATOM   4564  H HB3  . PRO A 1 10  ? -0.766  -8.871  -7.872  1.00 0.00 ? 10  PRO A HB3  4  
ATOM   4565  H HG2  . PRO A 1 10  ? -1.633  -9.361  -10.655 1.00 0.00 ? 10  PRO A HG2  4  
ATOM   4566  H HG3  . PRO A 1 10  ? -0.929  -10.487 -9.509  1.00 0.00 ? 10  PRO A HG3  4  
ATOM   4567  H HD2  . PRO A 1 10  ? -3.692  -10.304 -10.258 1.00 0.00 ? 10  PRO A HD2  4  
ATOM   4568  H HD3  . PRO A 1 10  ? -3.004  -11.348 -9.028  1.00 0.00 ? 10  PRO A HD3  4  
ATOM   4569  N N    . GLU A 1 11  ? -3.636  -6.017  -7.806  1.00 0.00 ? 11  GLU A N    4  
ATOM   4570  C CA   . GLU A 1 11  ? -4.236  -4.766  -8.236  1.00 0.00 ? 11  GLU A CA   4  
ATOM   4571  C C    . GLU A 1 11  ? -3.301  -3.595  -7.927  1.00 0.00 ? 11  GLU A C    4  
ATOM   4572  O O    . GLU A 1 11  ? -2.929  -3.380  -6.773  1.00 0.00 ? 11  GLU A O    4  
ATOM   4573  C CB   . GLU A 1 11  ? -5.606  -4.561  -7.585  1.00 0.00 ? 11  GLU A CB   4  
ATOM   4574  C CG   . GLU A 1 11  ? -6.534  -3.763  -8.501  1.00 0.00 ? 11  GLU A CG   4  
ATOM   4575  C CD   . GLU A 1 11  ? -7.404  -4.694  -9.348  1.00 0.00 ? 11  GLU A CD   4  
ATOM   4576  O OE1  . GLU A 1 11  ? -6.928  -5.080  -10.438 1.00 0.00 ? 11  GLU A OE1  4  
ATOM   4577  O OE2  . GLU A 1 11  ? -8.524  -4.999  -8.887  1.00 0.00 ? 11  GLU A OE2  4  
ATOM   4578  H H    . GLU A 1 11  ? -3.353  -6.042  -6.846  1.00 0.00 ? 11  GLU A H    4  
ATOM   4579  H HA   . GLU A 1 11  ? -4.364  -4.862  -9.315  1.00 0.00 ? 11  GLU A HA   4  
ATOM   4580  H HB2  . GLU A 1 11  ? -6.053  -5.530  -7.362  1.00 0.00 ? 11  GLU A HB2  4  
ATOM   4581  H HB3  . GLU A 1 11  ? -5.486  -4.039  -6.635  1.00 0.00 ? 11  GLU A HB3  4  
ATOM   4582  H HG2  . GLU A 1 11  ? -7.170  -3.112  -7.902  1.00 0.00 ? 11  GLU A HG2  4  
ATOM   4583  H HG3  . GLU A 1 11  ? -5.943  -3.119  -9.152  1.00 0.00 ? 11  GLU A HG3  4  
ATOM   4584  N N    . ILE A 1 12  ? -2.949  -2.867  -8.977  1.00 0.00 ? 12  ILE A N    4  
ATOM   4585  C CA   . ILE A 1 12  ? -2.065  -1.722  -8.831  1.00 0.00 ? 12  ILE A CA   4  
ATOM   4586  C C    . ILE A 1 12  ? -2.900  -0.471  -8.554  1.00 0.00 ? 12  ILE A C    4  
ATOM   4587  O O    . ILE A 1 12  ? -3.659  -0.022  -9.412  1.00 0.00 ? 12  ILE A O    4  
ATOM   4588  C CB   . ILE A 1 12  ? -1.151  -1.592  -10.052 1.00 0.00 ? 12  ILE A CB   4  
ATOM   4589  C CG1  . ILE A 1 12  ? 0.117   -0.809  -9.706  1.00 0.00 ? 12  ILE A CG1  4  
ATOM   4590  C CG2  . ILE A 1 12  ? -1.899  -0.977  -11.235 1.00 0.00 ? 12  ILE A CG2  4  
ATOM   4591  C CD1  . ILE A 1 12  ? 1.361   -1.514  -10.249 1.00 0.00 ? 12  ILE A CD1  4  
ATOM   4592  H H    . ILE A 1 12  ? -3.255  -3.046  -9.911  1.00 0.00 ? 12  ILE A H    4  
ATOM   4593  H HA   . ILE A 1 12  ? -1.427  -1.910  -7.968  1.00 0.00 ? 12  ILE A HA   4  
ATOM   4594  H HB   . ILE A 1 12  ? -0.840  -2.593  -10.353 1.00 0.00 ? 12  ILE A HB   4  
ATOM   4595  H HG12 . ILE A 1 12  ? 0.051   0.196   -10.122 1.00 0.00 ? 12  ILE A HG12 4  
ATOM   4596  H HG13 . ILE A 1 12  ? 0.200   -0.703  -8.624  1.00 0.00 ? 12  ILE A HG13 4  
ATOM   4597  H HG21 . ILE A 1 12  ? -1.506  -1.385  -12.166 1.00 0.00 ? 12  ILE A HG21 4  
ATOM   4598  H HG22 . ILE A 1 12  ? -2.961  -1.212  -11.156 1.00 0.00 ? 12  ILE A HG22 4  
ATOM   4599  H HG23 . ILE A 1 12  ? -1.767  0.104   -11.227 1.00 0.00 ? 12  ILE A HG23 4  
ATOM   4600  H HD11 . ILE A 1 12  ? 1.365   -2.553  -9.922  1.00 0.00 ? 12  ILE A HD11 4  
ATOM   4601  H HD12 . ILE A 1 12  ? 1.352   -1.476  -11.340 1.00 0.00 ? 12  ILE A HD12 4  
ATOM   4602  H HD13 . ILE A 1 12  ? 2.255   -1.012  -9.878  1.00 0.00 ? 12  ILE A HD13 4  
ATOM   4603  N N    . ILE A 1 13  ? -2.733  0.059   -7.350  1.00 0.00 ? 13  ILE A N    4  
ATOM   4604  C CA   . ILE A 1 13  ? -3.462  1.249   -6.948  1.00 0.00 ? 13  ILE A CA   4  
ATOM   4605  C C    . ILE A 1 13  ? -2.481  2.412   -6.790  1.00 0.00 ? 13  ILE A C    4  
ATOM   4606  O O    . ILE A 1 13  ? -1.321  2.207   -6.439  1.00 0.00 ? 13  ILE A O    4  
ATOM   4607  C CB   . ILE A 1 13  ? -4.293  0.972   -5.694  1.00 0.00 ? 13  ILE A CB   4  
ATOM   4608  C CG1  . ILE A 1 13  ? -4.854  -0.452  -5.713  1.00 0.00 ? 13  ILE A CG1  4  
ATOM   4609  C CG2  . ILE A 1 13  ? -5.395  2.020   -5.524  1.00 0.00 ? 13  ILE A CG2  4  
ATOM   4610  C CD1  . ILE A 1 13  ? -5.851  -0.664  -4.571  1.00 0.00 ? 13  ILE A CD1  4  
ATOM   4611  H H    . ILE A 1 13  ? -2.115  -0.313  -6.657  1.00 0.00 ? 13  ILE A H    4  
ATOM   4612  H HA   . ILE A 1 13  ? -4.159  1.492   -7.751  1.00 0.00 ? 13  ILE A HA   4  
ATOM   4613  H HB   . ILE A 1 13  ? -3.638  1.049   -4.826  1.00 0.00 ? 13  ILE A HB   4  
ATOM   4614  H HG12 . ILE A 1 13  ? -5.344  -0.641  -6.668  1.00 0.00 ? 13  ILE A HG12 4  
ATOM   4615  H HG13 . ILE A 1 13  ? -4.038  -1.169  -5.627  1.00 0.00 ? 13  ILE A HG13 4  
ATOM   4616  H HG21 . ILE A 1 13  ? -6.363  1.521   -5.456  1.00 0.00 ? 13  ILE A HG21 4  
ATOM   4617  H HG22 . ILE A 1 13  ? -5.215  2.590   -4.613  1.00 0.00 ? 13  ILE A HG22 4  
ATOM   4618  H HG23 . ILE A 1 13  ? -5.393  2.692   -6.380  1.00 0.00 ? 13  ILE A HG23 4  
ATOM   4619  H HD11 . ILE A 1 13  ? -6.834  -0.308  -4.877  1.00 0.00 ? 13  ILE A HD11 4  
ATOM   4620  H HD12 . ILE A 1 13  ? -5.908  -1.726  -4.331  1.00 0.00 ? 13  ILE A HD12 4  
ATOM   4621  H HD13 . ILE A 1 13  ? -5.519  -0.109  -3.694  1.00 0.00 ? 13  ILE A HD13 4  
ATOM   4622  N N    . THR A 1 14  ? -2.985  3.609   -7.056  1.00 0.00 ? 14  THR A N    4  
ATOM   4623  C CA   . THR A 1 14  ? -2.166  4.807   -6.947  1.00 0.00 ? 14  THR A CA   4  
ATOM   4624  C C    . THR A 1 14  ? -2.809  5.806   -5.984  1.00 0.00 ? 14  THR A C    4  
ATOM   4625  O O    . THR A 1 14  ? -3.854  6.380   -6.285  1.00 0.00 ? 14  THR A O    4  
ATOM   4626  C CB   . THR A 1 14  ? -1.961  5.366   -8.356  1.00 0.00 ? 14  THR A CB   4  
ATOM   4627  O OG1  . THR A 1 14  ? -3.277  5.700   -8.793  1.00 0.00 ? 14  THR A OG1  4  
ATOM   4628  C CG2  . THR A 1 14  ? -1.497  4.300   -9.350  1.00 0.00 ? 14  THR A CG2  4  
ATOM   4629  H H    . THR A 1 14  ? -3.930  3.768   -7.341  1.00 0.00 ? 14  THR A H    4  
ATOM   4630  H HA   . THR A 1 14  ? -1.203  4.526   -6.521  1.00 0.00 ? 14  THR A HA   4  
ATOM   4631  H HB   . THR A 1 14  ? -1.273  6.211   -8.340  1.00 0.00 ? 14  THR A HB   4  
ATOM   4632  H HG1  . THR A 1 14  ? -3.581  6.541   -8.350  1.00 0.00 ? 14  THR A HG1  4  
ATOM   4633  H HG21 . THR A 1 14  ? -0.686  3.720   -8.906  1.00 0.00 ? 14  THR A HG21 4  
ATOM   4634  H HG22 . THR A 1 14  ? -2.329  3.639   -9.587  1.00 0.00 ? 14  THR A HG22 4  
ATOM   4635  H HG23 . THR A 1 14  ? -1.142  4.782   -10.260 1.00 0.00 ? 14  THR A HG23 4  
ATOM   4636  N N    . VAL A 1 15  ? -2.159  5.980   -4.843  1.00 0.00 ? 15  VAL A N    4  
ATOM   4637  C CA   . VAL A 1 15  ? -2.653  6.900   -3.832  1.00 0.00 ? 15  VAL A CA   4  
ATOM   4638  C C    . VAL A 1 15  ? -1.944  8.248   -3.984  1.00 0.00 ? 15  VAL A C    4  
ATOM   4639  O O    . VAL A 1 15  ? -0.733  8.341   -3.786  1.00 0.00 ? 15  VAL A O    4  
ATOM   4640  C CB   . VAL A 1 15  ? -2.483  6.288   -2.441  1.00 0.00 ? 15  VAL A CB   4  
ATOM   4641  C CG1  . VAL A 1 15  ? -1.151  6.710   -1.815  1.00 0.00 ? 15  VAL A CG1  4  
ATOM   4642  C CG2  . VAL A 1 15  ? -3.656  6.659   -1.532  1.00 0.00 ? 15  VAL A CG2  4  
ATOM   4643  H H    . VAL A 1 15  ? -1.309  5.509   -4.606  1.00 0.00 ? 15  VAL A H    4  
ATOM   4644  H HA   . VAL A 1 15  ? -3.718  7.043   -4.010  1.00 0.00 ? 15  VAL A HA   4  
ATOM   4645  H HB   . VAL A 1 15  ? -2.473  5.204   -2.550  1.00 0.00 ? 15  VAL A HB   4  
ATOM   4646  H HG11 . VAL A 1 15  ? -1.118  7.796   -1.732  1.00 0.00 ? 15  VAL A HG11 4  
ATOM   4647  H HG12 . VAL A 1 15  ? -1.060  6.266   -0.823  1.00 0.00 ? 15  VAL A HG12 4  
ATOM   4648  H HG13 . VAL A 1 15  ? -0.330  6.368   -2.444  1.00 0.00 ? 15  VAL A HG13 4  
ATOM   4649  H HG21 . VAL A 1 15  ? -4.552  6.130   -1.861  1.00 0.00 ? 15  VAL A HG21 4  
ATOM   4650  H HG22 . VAL A 1 15  ? -3.426  6.376   -0.505  1.00 0.00 ? 15  VAL A HG22 4  
ATOM   4651  H HG23 . VAL A 1 15  ? -3.830  7.735   -1.583  1.00 0.00 ? 15  VAL A HG23 4  
ATOM   4652  N N    . THR A 1 16  ? -2.727  9.257   -4.333  1.00 0.00 ? 16  THR A N    4  
ATOM   4653  C CA   . THR A 1 16  ? -2.189  10.594  -4.514  1.00 0.00 ? 16  THR A CA   4  
ATOM   4654  C C    . THR A 1 16  ? -2.317  11.401  -3.220  1.00 0.00 ? 16  THR A C    4  
ATOM   4655  O O    . THR A 1 16  ? -3.097  11.044  -2.338  1.00 0.00 ? 16  THR A O    4  
ATOM   4656  C CB   . THR A 1 16  ? -2.907  11.236  -5.704  1.00 0.00 ? 16  THR A CB   4  
ATOM   4657  O OG1  . THR A 1 16  ? -2.783  10.271  -6.745  1.00 0.00 ? 16  THR A OG1  4  
ATOM   4658  C CG2  . THR A 1 16  ? -2.165  12.462  -6.241  1.00 0.00 ? 16  THR A CG2  4  
ATOM   4659  H H    . THR A 1 16  ? -3.712  9.172   -4.493  1.00 0.00 ? 16  THR A H    4  
ATOM   4660  H HA   . THR A 1 16  ? -1.126  10.511  -4.734  1.00 0.00 ? 16  THR A HA   4  
ATOM   4661  H HB   . THR A 1 16  ? -3.936  11.484  -5.450  1.00 0.00 ? 16  THR A HB   4  
ATOM   4662  H HG1  . THR A 1 16  ? -3.127  9.384   -6.433  1.00 0.00 ? 16  THR A HG1  4  
ATOM   4663  H HG21 . THR A 1 16  ? -1.116  12.408  -5.956  1.00 0.00 ? 16  THR A HG21 4  
ATOM   4664  H HG22 . THR A 1 16  ? -2.245  12.486  -7.329  1.00 0.00 ? 16  THR A HG22 4  
ATOM   4665  H HG23 . THR A 1 16  ? -2.609  13.367  -5.827  1.00 0.00 ? 16  THR A HG23 4  
ATOM   4666  N N    . LEU A 1 17  ? -1.541  12.471  -3.147  1.00 0.00 ? 17  LEU A N    4  
ATOM   4667  C CA   . LEU A 1 17  ? -1.558  13.331  -1.975  1.00 0.00 ? 17  LEU A CA   4  
ATOM   4668  C C    . LEU A 1 17  ? -2.471  14.529  -2.242  1.00 0.00 ? 17  LEU A C    4  
ATOM   4669  O O    . LEU A 1 17  ? -2.104  15.441  -2.983  1.00 0.00 ? 17  LEU A O    4  
ATOM   4670  C CB   . LEU A 1 17  ? -0.134  13.717  -1.573  1.00 0.00 ? 17  LEU A CB   4  
ATOM   4671  C CG   . LEU A 1 17  ? 0.623   12.699  -0.720  1.00 0.00 ? 17  LEU A CG   4  
ATOM   4672  C CD1  . LEU A 1 17  ? 1.379   13.390  0.416   1.00 0.00 ? 17  LEU A CD1  4  
ATOM   4673  C CD2  . LEU A 1 17  ? -0.320  11.609  -0.203  1.00 0.00 ? 17  LEU A CD2  4  
ATOM   4674  H H    . LEU A 1 17  ? -0.910  12.753  -3.869  1.00 0.00 ? 17  LEU A H    4  
ATOM   4675  H HA   . LEU A 1 17  ? -1.980  12.753  -1.152  1.00 0.00 ? 17  LEU A HA   4  
ATOM   4676  H HB2  . LEU A 1 17  ? 0.440   13.901  -2.482  1.00 0.00 ? 17  LEU A HB2  4  
ATOM   4677  H HB3  . LEU A 1 17  ? -0.176  14.660  -1.028  1.00 0.00 ? 17  LEU A HB3  4  
ATOM   4678  H HG   . LEU A 1 17  ? 1.364   12.210  -1.350  1.00 0.00 ? 17  LEU A HG   4  
ATOM   4679  H HD11 . LEU A 1 17  ? 0.703   14.060  0.947   1.00 0.00 ? 17  LEU A HD11 4  
ATOM   4680  H HD12 . LEU A 1 17  ? 1.761   12.639  1.108   1.00 0.00 ? 17  LEU A HD12 4  
ATOM   4681  H HD13 . LEU A 1 17  ? 2.210   13.962  0.005   1.00 0.00 ? 17  LEU A HD13 4  
ATOM   4682  H HD21 . LEU A 1 17  ? -0.836  11.146  -1.045  1.00 0.00 ? 17  LEU A HD21 4  
ATOM   4683  H HD22 . LEU A 1 17  ? 0.258   10.853  0.329   1.00 0.00 ? 17  LEU A HD22 4  
ATOM   4684  H HD23 . LEU A 1 17  ? -1.049  12.052  0.474   1.00 0.00 ? 17  LEU A HD23 4  
ATOM   4685  N N    . LYS A 1 18  ? -3.641  14.490  -1.622  1.00 0.00 ? 18  LYS A N    4  
ATOM   4686  C CA   . LYS A 1 18  ? -4.609  15.563  -1.783  1.00 0.00 ? 18  LYS A CA   4  
ATOM   4687  C C    . LYS A 1 18  ? -4.346  16.642  -0.731  1.00 0.00 ? 18  LYS A C    4  
ATOM   4688  O O    . LYS A 1 18  ? -4.146  17.808  -1.067  1.00 0.00 ? 18  LYS A O    4  
ATOM   4689  C CB   . LYS A 1 18  ? -6.034  15.009  -1.755  1.00 0.00 ? 18  LYS A CB   4  
ATOM   4690  C CG   . LYS A 1 18  ? -7.058  16.113  -2.023  1.00 0.00 ? 18  LYS A CG   4  
ATOM   4691  C CD   . LYS A 1 18  ? -8.029  16.257  -0.849  1.00 0.00 ? 18  LYS A CD   4  
ATOM   4692  C CE   . LYS A 1 18  ? -9.331  16.926  -1.295  1.00 0.00 ? 18  LYS A CE   4  
ATOM   4693  N NZ   . LYS A 1 18  ? -10.449 15.955  -1.269  1.00 0.00 ? 18  LYS A NZ   4  
ATOM   4694  H H    . LYS A 1 18  ? -3.931  13.746  -1.022  1.00 0.00 ? 18  LYS A H    4  
ATOM   4695  H HA   . LYS A 1 18  ? -4.452  15.998  -2.770  1.00 0.00 ? 18  LYS A HA   4  
ATOM   4696  H HB2  . LYS A 1 18  ? -6.139  14.222  -2.502  1.00 0.00 ? 18  LYS A HB2  4  
ATOM   4697  H HB3  . LYS A 1 18  ? -6.232  14.553  -0.784  1.00 0.00 ? 18  LYS A HB3  4  
ATOM   4698  H HG2  . LYS A 1 18  ? -6.543  17.058  -2.191  1.00 0.00 ? 18  LYS A HG2  4  
ATOM   4699  H HG3  . LYS A 1 18  ? -7.613  15.886  -2.933  1.00 0.00 ? 18  LYS A HG3  4  
ATOM   4700  H HD2  . LYS A 1 18  ? -8.247  15.274  -0.430  1.00 0.00 ? 18  LYS A HD2  4  
ATOM   4701  H HD3  . LYS A 1 18  ? -7.566  16.846  -0.059  1.00 0.00 ? 18  LYS A HD3  4  
ATOM   4702  H HE2  . LYS A 1 18  ? -9.557  17.767  -0.639  1.00 0.00 ? 18  LYS A HE2  4  
ATOM   4703  H HE3  . LYS A 1 18  ? -9.215  17.328  -2.301  1.00 0.00 ? 18  LYS A HE3  4  
ATOM   4704  H HZ1  . LYS A 1 18  ? -10.082 15.026  -1.251  1.00 0.00 ? 18  LYS A HZ1  4  
ATOM   4705  H HZ2  . LYS A 1 18  ? -11.006 16.112  -0.453  1.00 0.00 ? 18  LYS A HZ2  4  
ATOM   4706  H HZ3  . LYS A 1 18  ? -11.014 16.075  -2.086  1.00 0.00 ? 18  LYS A HZ3  4  
ATOM   4707  N N    . LYS A 1 19  ? -4.359  16.217  0.523   1.00 0.00 ? 19  LYS A N    4  
ATOM   4708  C CA   . LYS A 1 19  ? -4.125  17.131  1.629   1.00 0.00 ? 19  LYS A CA   4  
ATOM   4709  C C    . LYS A 1 19  ? -2.633  17.459  1.705   1.00 0.00 ? 19  LYS A C    4  
ATOM   4710  O O    . LYS A 1 19  ? -2.212  18.253  2.545   1.00 0.00 ? 19  LYS A O    4  
ATOM   4711  C CB   . LYS A 1 19  ? -4.698  16.560  2.926   1.00 0.00 ? 19  LYS A CB   4  
ATOM   4712  C CG   . LYS A 1 19  ? -4.580  17.570  4.067   1.00 0.00 ? 19  LYS A CG   4  
ATOM   4713  C CD   . LYS A 1 19  ? -5.411  17.133  5.276   1.00 0.00 ? 19  LYS A CD   4  
ATOM   4714  C CE   . LYS A 1 19  ? -6.489  18.167  5.605   1.00 0.00 ? 19  LYS A CE   4  
ATOM   4715  N NZ   . LYS A 1 19  ? -5.908  19.303  6.355   1.00 0.00 ? 19  LYS A NZ   4  
ATOM   4716  H H    . LYS A 1 19  ? -4.524  15.266  0.789   1.00 0.00 ? 19  LYS A H    4  
ATOM   4717  H HA   . LYS A 1 19  ? -4.671  18.049  1.411   1.00 0.00 ? 19  LYS A HA   4  
ATOM   4718  H HB2  . LYS A 1 19  ? -5.744  16.291  2.780   1.00 0.00 ? 19  LYS A HB2  4  
ATOM   4719  H HB3  . LYS A 1 19  ? -4.168  15.643  3.190   1.00 0.00 ? 19  LYS A HB3  4  
ATOM   4720  H HG2  . LYS A 1 19  ? -3.535  17.675  4.361   1.00 0.00 ? 19  LYS A HG2  4  
ATOM   4721  H HG3  . LYS A 1 19  ? -4.916  18.550  3.729   1.00 0.00 ? 19  LYS A HG3  4  
ATOM   4722  H HD2  . LYS A 1 19  ? -5.877  16.169  5.072   1.00 0.00 ? 19  LYS A HD2  4  
ATOM   4723  H HD3  . LYS A 1 19  ? -4.760  16.995  6.140   1.00 0.00 ? 19  LYS A HD3  4  
ATOM   4724  H HE2  . LYS A 1 19  ? -6.947  18.529  4.684   1.00 0.00 ? 19  LYS A HE2  4  
ATOM   4725  H HE3  . LYS A 1 19  ? -7.281  17.702  6.192   1.00 0.00 ? 19  LYS A HE3  4  
ATOM   4726  H HZ1  . LYS A 1 19  ? -5.498  19.952  5.715   1.00 0.00 ? 19  LYS A HZ1  4  
ATOM   4727  H HZ2  . LYS A 1 19  ? -6.628  19.759  6.879   1.00 0.00 ? 19  LYS A HZ2  4  
ATOM   4728  H HZ3  . LYS A 1 19  ? -5.205  18.962  6.982   1.00 0.00 ? 19  LYS A HZ3  4  
ATOM   4729  N N    . GLN A 1 20  ? -1.876  16.831  0.818   1.00 0.00 ? 20  GLN A N    4  
ATOM   4730  C CA   . GLN A 1 20  ? -0.438  17.046  0.777   1.00 0.00 ? 20  GLN A CA   4  
ATOM   4731  C C    . GLN A 1 20  ? 0.183   16.755  2.145   1.00 0.00 ? 20  GLN A C    4  
ATOM   4732  O O    . GLN A 1 20  ? 1.143   17.411  2.546   1.00 0.00 ? 20  GLN A O    4  
ATOM   4733  C CB   . GLN A 1 20  ? -0.112  18.469  0.319   1.00 0.00 ? 20  GLN A CB   4  
ATOM   4734  C CG   . GLN A 1 20  ? 0.589   18.458  -1.042  1.00 0.00 ? 20  GLN A CG   4  
ATOM   4735  C CD   . GLN A 1 20  ? 1.716   19.492  -1.087  1.00 0.00 ? 20  GLN A CD   4  
ATOM   4736  O OE1  . GLN A 1 20  ? 1.806   20.387  -0.262  1.00 0.00 ? 20  GLN A OE1  4  
ATOM   4737  N NE2  . GLN A 1 20  ? 2.570   19.318  -2.091  1.00 0.00 ? 20  GLN A NE2  4  
ATOM   4738  H H    . GLN A 1 20  ? -2.226  16.187  0.139   1.00 0.00 ? 20  GLN A H    4  
ATOM   4739  H HA   . GLN A 1 20  ? -0.061  16.337  0.040   1.00 0.00 ? 20  GLN A HA   4  
ATOM   4740  H HB2  . GLN A 1 20  ? -1.029  19.055  0.254   1.00 0.00 ? 20  GLN A HB2  4  
ATOM   4741  H HB3  . GLN A 1 20  ? 0.527   18.955  1.055   1.00 0.00 ? 20  GLN A HB3  4  
ATOM   4742  H HG2  . GLN A 1 20  ? 0.992   17.464  -1.240  1.00 0.00 ? 20  GLN A HG2  4  
ATOM   4743  H HG3  . GLN A 1 20  ? -0.134  18.671  -1.829  1.00 0.00 ? 20  GLN A HG3  4  
ATOM   4744  H HE21 . GLN A 1 20  ? 2.439   18.562  -2.733  1.00 0.00 ? 20  GLN A HE21 4  
ATOM   4745  H HE22 . GLN A 1 20  ? 3.343   19.943  -2.206  1.00 0.00 ? 20  GLN A HE22 4  
ATOM   4746  N N    . ASN A 1 21  ? -0.391  15.772  2.822   1.00 0.00 ? 21  ASN A N    4  
ATOM   4747  C CA   . ASN A 1 21  ? 0.094   15.385  4.136   1.00 0.00 ? 21  ASN A CA   4  
ATOM   4748  C C    . ASN A 1 21  ? 1.004   14.164  3.999   1.00 0.00 ? 21  ASN A C    4  
ATOM   4749  O O    . ASN A 1 21  ? 0.932   13.439  3.009   1.00 0.00 ? 21  ASN A O    4  
ATOM   4750  C CB   . ASN A 1 21  ? -1.064  15.010  5.062   1.00 0.00 ? 21  ASN A CB   4  
ATOM   4751  C CG   . ASN A 1 21  ? -0.857  15.592  6.462   1.00 0.00 ? 21  ASN A CG   4  
ATOM   4752  O OD1  . ASN A 1 21  ? -0.862  14.891  7.462   1.00 0.00 ? 21  ASN A OD1  4  
ATOM   4753  N ND2  . ASN A 1 21  ? -0.674  16.909  6.480   1.00 0.00 ? 21  ASN A ND2  4  
ATOM   4754  H H    . ASN A 1 21  ? -1.173  15.245  2.488   1.00 0.00 ? 21  ASN A H    4  
ATOM   4755  H HA   . ASN A 1 21  ? 0.623   16.259  4.514   1.00 0.00 ? 21  ASN A HA   4  
ATOM   4756  H HB2  . ASN A 1 21  ? -2.002  15.383  4.647   1.00 0.00 ? 21  ASN A HB2  4  
ATOM   4757  H HB3  . ASN A 1 21  ? -1.149  13.926  5.124   1.00 0.00 ? 21  ASN A HB3  4  
ATOM   4758  H HD21 . ASN A 1 21  ? -0.681  17.427  5.624   1.00 0.00 ? 21  ASN A HD21 4  
ATOM   4759  H HD22 . ASN A 1 21  ? -0.529  17.382  7.349   1.00 0.00 ? 21  ASN A HD22 4  
ATOM   4760  N N    . GLY A 1 22  ? 1.839   13.972  5.011   1.00 0.00 ? 22  GLY A N    4  
ATOM   4761  C CA   . GLY A 1 22  ? 2.763   12.850  5.015   1.00 0.00 ? 22  GLY A CA   4  
ATOM   4762  C C    . GLY A 1 22  ? 2.204   11.676  4.209   1.00 0.00 ? 22  GLY A C    4  
ATOM   4763  O O    . GLY A 1 22  ? 2.795   11.267  3.210   1.00 0.00 ? 22  GLY A O    4  
ATOM   4764  H H    . GLY A 1 22  ? 1.891   14.566  5.813   1.00 0.00 ? 22  GLY A H    4  
ATOM   4765  H HA2  . GLY A 1 22  ? 3.720   13.160  4.597   1.00 0.00 ? 22  GLY A HA2  4  
ATOM   4766  H HA3  . GLY A 1 22  ? 2.950   12.535  6.041   1.00 0.00 ? 22  GLY A HA3  4  
ATOM   4767  N N    . MET A 1 23  ? 1.072   11.167  4.671   1.00 0.00 ? 23  MET A N    4  
ATOM   4768  C CA   . MET A 1 23  ? 0.427   10.048  4.006   1.00 0.00 ? 23  MET A CA   4  
ATOM   4769  C C    . MET A 1 23  ? -0.607  9.389   4.919   1.00 0.00 ? 23  MET A C    4  
ATOM   4770  O O    . MET A 1 23  ? -1.778  9.273   4.559   1.00 0.00 ? 23  MET A O    4  
ATOM   4771  C CB   . MET A 1 23  ? 1.481   9.019   3.600   1.00 0.00 ? 23  MET A CB   4  
ATOM   4772  C CG   . MET A 1 23  ? 1.489   8.809   2.083   1.00 0.00 ? 23  MET A CG   4  
ATOM   4773  S SD   . MET A 1 23  ? 3.092   9.227   1.417   1.00 0.00 ? 23  MET A SD   4  
ATOM   4774  C CE   . MET A 1 23  ? 3.886   7.631   1.496   1.00 0.00 ? 23  MET A CE   4  
ATOM   4775  H H    . MET A 1 23  ? 0.596   11.507  5.483   1.00 0.00 ? 23  MET A H    4  
ATOM   4776  H HA   . MET A 1 23  ? -0.069  10.474  3.132   1.00 0.00 ? 23  MET A HA   4  
ATOM   4777  H HB2  . MET A 1 23  ? 2.466   9.352   3.928   1.00 0.00 ? 23  MET A HB2  4  
ATOM   4778  H HB3  . MET A 1 23  ? 1.283   8.070   4.099   1.00 0.00 ? 23  MET A HB3  4  
ATOM   4779  H HG2  . MET A 1 23  ? 1.248   7.771   1.851   1.00 0.00 ? 23  MET A HG2  4  
ATOM   4780  H HG3  . MET A 1 23  ? 0.721   9.427   1.618   1.00 0.00 ? 23  MET A HG3  4  
ATOM   4781  H HE1  . MET A 1 23  ? 4.027   7.347   2.539   1.00 0.00 ? 23  MET A HE1  4  
ATOM   4782  H HE2  . MET A 1 23  ? 3.262   6.889   0.997   1.00 0.00 ? 23  MET A HE2  4  
ATOM   4783  H HE3  . MET A 1 23  ? 4.855   7.683   0.999   1.00 0.00 ? 23  MET A HE3  4  
ATOM   4784  N N    . GLY A 1 24  ? -0.137  8.972   6.086   1.00 0.00 ? 24  GLY A N    4  
ATOM   4785  C CA   . GLY A 1 24  ? -1.005  8.325   7.055   1.00 0.00 ? 24  GLY A CA   4  
ATOM   4786  C C    . GLY A 1 24  ? -1.428  6.938   6.572   1.00 0.00 ? 24  GLY A C    4  
ATOM   4787  O O    . GLY A 1 24  ? -2.619  6.652   6.454   1.00 0.00 ? 24  GLY A O    4  
ATOM   4788  H H    . GLY A 1 24  ? 0.816   9.070   6.372   1.00 0.00 ? 24  GLY A H    4  
ATOM   4789  H HA2  . GLY A 1 24  ? -0.489  8.240   8.012   1.00 0.00 ? 24  GLY A HA2  4  
ATOM   4790  H HA3  . GLY A 1 24  ? -1.890  8.940   7.223   1.00 0.00 ? 24  GLY A HA3  4  
ATOM   4791  N N    . LEU A 1 25  ? -0.428  6.108   6.307   1.00 0.00 ? 25  LEU A N    4  
ATOM   4792  C CA   . LEU A 1 25  ? -0.681  4.755   5.840   1.00 0.00 ? 25  LEU A CA   4  
ATOM   4793  C C    . LEU A 1 25  ? -0.054  3.757   6.817   1.00 0.00 ? 25  LEU A C    4  
ATOM   4794  O O    . LEU A 1 25  ? 0.810   4.122   7.612   1.00 0.00 ? 25  LEU A O    4  
ATOM   4795  C CB   . LEU A 1 25  ? -0.201  4.589   4.398   1.00 0.00 ? 25  LEU A CB   4  
ATOM   4796  C CG   . LEU A 1 25  ? -1.241  4.859   3.308   1.00 0.00 ? 25  LEU A CG   4  
ATOM   4797  C CD1  . LEU A 1 25  ? -1.033  3.932   2.110   1.00 0.00 ? 25  LEU A CD1  4  
ATOM   4798  C CD2  . LEU A 1 25  ? -2.661  4.760   3.871   1.00 0.00 ? 25  LEU A CD2  4  
ATOM   4799  H H    . LEU A 1 25  ? 0.536   6.347   6.408   1.00 0.00 ? 25  LEU A H    4  
ATOM   4800  H HA   . LEU A 1 25  ? -1.761  4.607   5.841   1.00 0.00 ? 25  LEU A HA   4  
ATOM   4801  H HB2  . LEU A 1 25  ? 0.646   5.257   4.238   1.00 0.00 ? 25  LEU A HB2  4  
ATOM   4802  H HB3  . LEU A 1 25  ? 0.170   3.571   4.274   1.00 0.00 ? 25  LEU A HB3  4  
ATOM   4803  H HG   . LEU A 1 25  ? -1.107  5.881   2.953   1.00 0.00 ? 25  LEU A HG   4  
ATOM   4804  H HD11 . LEU A 1 25  ? -1.884  4.017   1.432   1.00 0.00 ? 25  LEU A HD11 4  
ATOM   4805  H HD12 . LEU A 1 25  ? -0.123  4.215   1.586   1.00 0.00 ? 25  LEU A HD12 4  
ATOM   4806  H HD13 . LEU A 1 25  ? -0.947  2.902   2.457   1.00 0.00 ? 25  LEU A HD13 4  
ATOM   4807  H HD21 . LEU A 1 25  ? -2.773  3.819   4.413   1.00 0.00 ? 25  LEU A HD21 4  
ATOM   4808  H HD22 . LEU A 1 25  ? -2.842  5.593   4.549   1.00 0.00 ? 25  LEU A HD22 4  
ATOM   4809  H HD23 . LEU A 1 25  ? -3.380  4.795   3.052   1.00 0.00 ? 25  LEU A HD23 4  
ATOM   4810  N N    . SER A 1 26  ? -0.513  2.519   6.723   1.00 0.00 ? 26  SER A N    4  
ATOM   4811  C CA   . SER A 1 26  ? -0.009  1.465   7.588   1.00 0.00 ? 26  SER A CA   4  
ATOM   4812  C C    . SER A 1 26  ? 0.019   0.137   6.832   1.00 0.00 ? 26  SER A C    4  
ATOM   4813  O O    . SER A 1 26  ? -1.027  -0.385  6.449   1.00 0.00 ? 26  SER A O    4  
ATOM   4814  C CB   . SER A 1 26  ? -0.856  1.340   8.855   1.00 0.00 ? 26  SER A CB   4  
ATOM   4815  O OG   . SER A 1 26  ? -0.095  0.864   9.962   1.00 0.00 ? 26  SER A OG   4  
ATOM   4816  H H    . SER A 1 26  ? -1.216  2.230   6.073   1.00 0.00 ? 26  SER A H    4  
ATOM   4817  H HA   . SER A 1 26  ? 1.003   1.774   7.856   1.00 0.00 ? 26  SER A HA   4  
ATOM   4818  H HB2  . SER A 1 26  ? -1.287  2.311   9.102   1.00 0.00 ? 26  SER A HB2  4  
ATOM   4819  H HB3  . SER A 1 26  ? -1.688  0.660   8.668   1.00 0.00 ? 26  SER A HB3  4  
ATOM   4820  H HG   . SER A 1 26  ? 0.173   1.630   10.546  1.00 0.00 ? 26  SER A HG   4  
ATOM   4821  N N    . ILE A 1 27  ? 1.226   -0.375  6.641   1.00 0.00 ? 27  ILE A N    4  
ATOM   4822  C CA   . ILE A 1 27  ? 1.402   -1.634  5.938   1.00 0.00 ? 27  ILE A CA   4  
ATOM   4823  C C    . ILE A 1 27  ? 2.366   -2.524  6.729   1.00 0.00 ? 27  ILE A C    4  
ATOM   4824  O O    . ILE A 1 27  ? 2.988   -2.072  7.689   1.00 0.00 ? 27  ILE A O    4  
ATOM   4825  C CB   . ILE A 1 27  ? 1.840   -1.386  4.494   1.00 0.00 ? 27  ILE A CB   4  
ATOM   4826  C CG1  . ILE A 1 27  ? 3.316   -1.743  4.299   1.00 0.00 ? 27  ILE A CG1  4  
ATOM   4827  C CG2  . ILE A 1 27  ? 1.540   0.054   4.070   1.00 0.00 ? 27  ILE A CG2  4  
ATOM   4828  C CD1  . ILE A 1 27  ? 3.918   -0.966  3.125   1.00 0.00 ? 27  ILE A CD1  4  
ATOM   4829  H H    . ILE A 1 27  ? 2.072   0.055   6.956   1.00 0.00 ? 27  ILE A H    4  
ATOM   4830  H HA   . ILE A 1 27  ? 0.431   -2.127  5.899   1.00 0.00 ? 27  ILE A HA   4  
ATOM   4831  H HB   . ILE A 1 27  ? 1.261   -2.041  3.843   1.00 0.00 ? 27  ILE A HB   4  
ATOM   4832  H HG12 . ILE A 1 27  ? 3.871   -1.521  5.210   1.00 0.00 ? 27  ILE A HG12 4  
ATOM   4833  H HG13 . ILE A 1 27  ? 3.413   -2.814  4.118   1.00 0.00 ? 27  ILE A HG13 4  
ATOM   4834  H HG21 . ILE A 1 27  ? 1.422   0.097   2.988   1.00 0.00 ? 27  ILE A HG21 4  
ATOM   4835  H HG22 . ILE A 1 27  ? 0.619   0.387   4.549   1.00 0.00 ? 27  ILE A HG22 4  
ATOM   4836  H HG23 . ILE A 1 27  ? 2.362   0.702   4.373   1.00 0.00 ? 27  ILE A HG23 4  
ATOM   4837  H HD11 . ILE A 1 27  ? 3.137   -0.744  2.398   1.00 0.00 ? 27  ILE A HD11 4  
ATOM   4838  H HD12 . ILE A 1 27  ? 4.350   -0.035  3.491   1.00 0.00 ? 27  ILE A HD12 4  
ATOM   4839  H HD13 . ILE A 1 27  ? 4.695   -1.568  2.652   1.00 0.00 ? 27  ILE A HD13 4  
ATOM   4840  N N    . VAL A 1 28  ? 2.460   -3.772  6.294   1.00 0.00 ? 28  VAL A N    4  
ATOM   4841  C CA   . VAL A 1 28  ? 3.337   -4.728  6.948   1.00 0.00 ? 28  VAL A CA   4  
ATOM   4842  C C    . VAL A 1 28  ? 3.778   -5.786  5.934   1.00 0.00 ? 28  VAL A C    4  
ATOM   4843  O O    . VAL A 1 28  ? 3.047   -6.093  4.994   1.00 0.00 ? 28  VAL A O    4  
ATOM   4844  C CB   . VAL A 1 28  ? 2.639   -5.327  8.170   1.00 0.00 ? 28  VAL A CB   4  
ATOM   4845  C CG1  . VAL A 1 28  ? 1.283   -5.927  7.788   1.00 0.00 ? 28  VAL A CG1  4  
ATOM   4846  C CG2  . VAL A 1 28  ? 3.526   -6.369  8.854   1.00 0.00 ? 28  VAL A CG2  4  
ATOM   4847  H H    . VAL A 1 28  ? 1.951   -4.131  5.510   1.00 0.00 ? 28  VAL A H    4  
ATOM   4848  H HA   . VAL A 1 28  ? 4.216   -4.186  7.293   1.00 0.00 ? 28  VAL A HA   4  
ATOM   4849  H HB   . VAL A 1 28  ? 2.461   -4.521  8.882   1.00 0.00 ? 28  VAL A HB   4  
ATOM   4850  H HG11 . VAL A 1 28  ? 0.622   -5.908  8.655   1.00 0.00 ? 28  VAL A HG11 4  
ATOM   4851  H HG12 . VAL A 1 28  ? 0.841   -5.342  6.982   1.00 0.00 ? 28  VAL A HG12 4  
ATOM   4852  H HG13 . VAL A 1 28  ? 1.421   -6.955  7.460   1.00 0.00 ? 28  VAL A HG13 4  
ATOM   4853  H HG21 . VAL A 1 28  ? 3.796   -7.142  8.134   1.00 0.00 ? 28  VAL A HG21 4  
ATOM   4854  H HG22 . VAL A 1 28  ? 4.430   -5.887  9.226   1.00 0.00 ? 28  VAL A HG22 4  
ATOM   4855  H HG23 . VAL A 1 28  ? 2.986   -6.819  9.686   1.00 0.00 ? 28  VAL A HG23 4  
ATOM   4856  N N    . ALA A 1 29  ? 4.972   -6.313  6.158   1.00 0.00 ? 29  ALA A N    4  
ATOM   4857  C CA   . ALA A 1 29  ? 5.519   -7.330  5.276   1.00 0.00 ? 29  ALA A CA   4  
ATOM   4858  C C    . ALA A 1 29  ? 5.890   -8.566  6.099   1.00 0.00 ? 29  ALA A C    4  
ATOM   4859  O O    . ALA A 1 29  ? 6.315   -8.448  7.248   1.00 0.00 ? 29  ALA A O    4  
ATOM   4860  C CB   . ALA A 1 29  ? 6.716   -6.754  4.516   1.00 0.00 ? 29  ALA A CB   4  
ATOM   4861  H H    . ALA A 1 29  ? 5.561   -6.058  6.925   1.00 0.00 ? 29  ALA A H    4  
ATOM   4862  H HA   . ALA A 1 29  ? 4.743   -7.600  4.559   1.00 0.00 ? 29  ALA A HA   4  
ATOM   4863  H HB1  . ALA A 1 29  ? 7.631   -6.959  5.071   1.00 0.00 ? 29  ALA A HB1  4  
ATOM   4864  H HB2  . ALA A 1 29  ? 6.776   -7.219  3.530   1.00 0.00 ? 29  ALA A HB2  4  
ATOM   4865  H HB3  . ALA A 1 29  ? 6.592   -5.678  4.402   1.00 0.00 ? 29  ALA A HB3  4  
ATOM   4866  N N    . ALA A 1 30  ? 5.717   -9.723  5.478   1.00 0.00 ? 30  ALA A N    4  
ATOM   4867  C CA   . ALA A 1 30  ? 6.029   -10.980 6.136   1.00 0.00 ? 30  ALA A CA   4  
ATOM   4868  C C    . ALA A 1 30  ? 7.139   -11.694 5.364   1.00 0.00 ? 30  ALA A C    4  
ATOM   4869  O O    . ALA A 1 30  ? 7.207   -11.603 4.141   1.00 0.00 ? 30  ALA A O    4  
ATOM   4870  C CB   . ALA A 1 30  ? 4.760   -11.826 6.248   1.00 0.00 ? 30  ALA A CB   4  
ATOM   4871  H H    . ALA A 1 30  ? 5.372   -9.810  4.543   1.00 0.00 ? 30  ALA A H    4  
ATOM   4872  H HA   . ALA A 1 30  ? 6.386   -10.749 7.140   1.00 0.00 ? 30  ALA A HA   4  
ATOM   4873  H HB1  . ALA A 1 30  ? 5.024   -12.884 6.239   1.00 0.00 ? 30  ALA A HB1  4  
ATOM   4874  H HB2  . ALA A 1 30  ? 4.245   -11.589 7.180   1.00 0.00 ? 30  ALA A HB2  4  
ATOM   4875  H HB3  . ALA A 1 30  ? 4.102   -11.608 5.406   1.00 0.00 ? 30  ALA A HB3  4  
ATOM   4876  N N    . LYS A 1 31  ? 7.984   -12.390 6.112   1.00 0.00 ? 31  LYS A N    4  
ATOM   4877  C CA   . LYS A 1 31  ? 9.087   -13.121 5.513   1.00 0.00 ? 31  LYS A CA   4  
ATOM   4878  C C    . LYS A 1 31  ? 9.356   -14.389 6.327   1.00 0.00 ? 31  LYS A C    4  
ATOM   4879  O O    . LYS A 1 31  ? 9.247   -14.379 7.552   1.00 0.00 ? 31  LYS A O    4  
ATOM   4880  C CB   . LYS A 1 31  ? 10.311  -12.215 5.365   1.00 0.00 ? 31  LYS A CB   4  
ATOM   4881  C CG   . LYS A 1 31  ? 10.835  -11.774 6.735   1.00 0.00 ? 31  LYS A CG   4  
ATOM   4882  C CD   . LYS A 1 31  ? 10.327  -10.376 7.090   1.00 0.00 ? 31  LYS A CD   4  
ATOM   4883  C CE   . LYS A 1 31  ? 9.830   -10.326 8.537   1.00 0.00 ? 31  LYS A CE   4  
ATOM   4884  N NZ   . LYS A 1 31  ? 8.582   -9.533  8.630   1.00 0.00 ? 31  LYS A NZ   4  
ATOM   4885  H H    . LYS A 1 31  ? 7.920   -12.461 7.108   1.00 0.00 ? 31  LYS A H    4  
ATOM   4886  H HA   . LYS A 1 31  ? 8.780   -13.413 4.509   1.00 0.00 ? 31  LYS A HA   4  
ATOM   4887  H HB2  . LYS A 1 31  ? 11.096  -12.743 4.824   1.00 0.00 ? 31  LYS A HB2  4  
ATOM   4888  H HB3  . LYS A 1 31  ? 10.049  -11.338 4.773   1.00 0.00 ? 31  LYS A HB3  4  
ATOM   4889  H HG2  . LYS A 1 31  ? 10.517  -12.485 7.496   1.00 0.00 ? 31  LYS A HG2  4  
ATOM   4890  H HG3  . LYS A 1 31  ? 11.925  -11.777 6.728   1.00 0.00 ? 31  LYS A HG3  4  
ATOM   4891  H HD2  . LYS A 1 31  ? 11.127  -9.648  6.952   1.00 0.00 ? 31  LYS A HD2  4  
ATOM   4892  H HD3  . LYS A 1 31  ? 9.520   -10.094 6.415   1.00 0.00 ? 31  LYS A HD3  4  
ATOM   4893  H HE2  . LYS A 1 31  ? 9.652   -11.338 8.902   1.00 0.00 ? 31  LYS A HE2  4  
ATOM   4894  H HE3  . LYS A 1 31  ? 10.596  -9.887  9.176   1.00 0.00 ? 31  LYS A HE3  4  
ATOM   4895  H HZ1  . LYS A 1 31  ? 8.019   -9.703  7.822   1.00 0.00 ? 31  LYS A HZ1  4  
ATOM   4896  H HZ2  . LYS A 1 31  ? 8.078   -9.799  9.450   1.00 0.00 ? 31  LYS A HZ2  4  
ATOM   4897  H HZ3  . LYS A 1 31  ? 8.810   -8.561  8.679   1.00 0.00 ? 31  LYS A HZ3  4  
ATOM   4898  N N    . GLY A 1 32  ? 9.700   -15.451 5.612   1.00 0.00 ? 32  GLY A N    4  
ATOM   4899  C CA   . GLY A 1 32  ? 9.984   -16.723 6.252   1.00 0.00 ? 32  GLY A CA   4  
ATOM   4900  C C    . GLY A 1 32  ? 10.646  -17.693 5.272   1.00 0.00 ? 32  GLY A C    4  
ATOM   4901  O O    . GLY A 1 32  ? 11.163  -17.279 4.236   1.00 0.00 ? 32  GLY A O    4  
ATOM   4902  H H    . GLY A 1 32  ? 9.785   -15.450 4.616   1.00 0.00 ? 32  GLY A H    4  
ATOM   4903  H HA2  . GLY A 1 32  ? 10.637  -16.565 7.110   1.00 0.00 ? 32  GLY A HA2  4  
ATOM   4904  H HA3  . GLY A 1 32  ? 9.059   -17.159 6.631   1.00 0.00 ? 32  GLY A HA3  4  
ATOM   4905  N N    . ALA A 1 33  ? 10.609  -18.968 5.635   1.00 0.00 ? 33  ALA A N    4  
ATOM   4906  C CA   . ALA A 1 33  ? 11.199  -20.001 4.800   1.00 0.00 ? 33  ALA A CA   4  
ATOM   4907  C C    . ALA A 1 33  ? 10.375  -21.285 4.925   1.00 0.00 ? 33  ALA A C    4  
ATOM   4908  O O    . ALA A 1 33  ? 9.501   -21.384 5.786   1.00 0.00 ? 33  ALA A O    4  
ATOM   4909  C CB   . ALA A 1 33  ? 12.661  -20.206 5.198   1.00 0.00 ? 33  ALA A CB   4  
ATOM   4910  H H    . ALA A 1 33  ? 10.185  -19.296 6.478   1.00 0.00 ? 33  ALA A H    4  
ATOM   4911  H HA   . ALA A 1 33  ? 11.162  -19.655 3.768   1.00 0.00 ? 33  ALA A HA   4  
ATOM   4912  H HB1  . ALA A 1 33  ? 12.728  -20.999 5.943   1.00 0.00 ? 33  ALA A HB1  4  
ATOM   4913  H HB2  . ALA A 1 33  ? 13.242  -20.484 4.318   1.00 0.00 ? 33  ALA A HB2  4  
ATOM   4914  H HB3  . ALA A 1 33  ? 13.057  -19.279 5.616   1.00 0.00 ? 33  ALA A HB3  4  
ATOM   4915  N N    . GLY A 1 34  ? 10.683  -22.233 4.055   1.00 0.00 ? 34  GLY A N    4  
ATOM   4916  C CA   . GLY A 1 34  ? 9.982   -23.508 4.059   1.00 0.00 ? 34  GLY A CA   4  
ATOM   4917  C C    . GLY A 1 34  ? 8.593   -23.370 3.432   1.00 0.00 ? 34  GLY A C    4  
ATOM   4918  O O    . GLY A 1 34  ? 8.339   -23.904 2.354   1.00 0.00 ? 34  GLY A O    4  
ATOM   4919  H H    . GLY A 1 34  ? 11.395  -22.145 3.358   1.00 0.00 ? 34  GLY A H    4  
ATOM   4920  H HA2  . GLY A 1 34  ? 10.562  -24.247 3.506   1.00 0.00 ? 34  GLY A HA2  4  
ATOM   4921  H HA3  . GLY A 1 34  ? 9.890   -23.874 5.080   1.00 0.00 ? 34  GLY A HA3  4  
ATOM   4922  N N    . GLN A 1 35  ? 7.730   -22.652 4.135   1.00 0.00 ? 35  GLN A N    4  
ATOM   4923  C CA   . GLN A 1 35  ? 6.373   -22.438 3.662   1.00 0.00 ? 35  GLN A CA   4  
ATOM   4924  C C    . GLN A 1 35  ? 5.991   -20.962 3.795   1.00 0.00 ? 35  GLN A C    4  
ATOM   4925  O O    . GLN A 1 35  ? 5.061   -20.621 4.525   1.00 0.00 ? 35  GLN A O    4  
ATOM   4926  C CB   . GLN A 1 35  ? 5.382   -23.330 4.413   1.00 0.00 ? 35  GLN A CB   4  
ATOM   4927  C CG   . GLN A 1 35  ? 4.902   -24.482 3.528   1.00 0.00 ? 35  GLN A CG   4  
ATOM   4928  C CD   . GLN A 1 35  ? 4.114   -23.956 2.325   1.00 0.00 ? 35  GLN A CD   4  
ATOM   4929  O OE1  . GLN A 1 35  ? 3.670   -22.821 2.290   1.00 0.00 ? 35  GLN A OE1  4  
ATOM   4930  N NE2  . GLN A 1 35  ? 3.969   -24.843 1.345   1.00 0.00 ? 35  GLN A NE2  4  
ATOM   4931  H H    . GLN A 1 35  ? 7.944   -22.221 5.013   1.00 0.00 ? 35  GLN A H    4  
ATOM   4932  H HA   . GLN A 1 35  ? 6.384   -22.724 2.611   1.00 0.00 ? 35  GLN A HA   4  
ATOM   4933  H HB2  . GLN A 1 35  ? 5.856   -23.729 5.312   1.00 0.00 ? 35  GLN A HB2  4  
ATOM   4934  H HB3  . GLN A 1 35  ? 4.528   -22.736 4.741   1.00 0.00 ? 35  GLN A HB3  4  
ATOM   4935  H HG2  . GLN A 1 35  ? 5.757   -25.060 3.183   1.00 0.00 ? 35  GLN A HG2  4  
ATOM   4936  H HG3  . GLN A 1 35  ? 4.274   -25.155 4.111   1.00 0.00 ? 35  GLN A HG3  4  
ATOM   4937  H HE21 . GLN A 1 35  ? 4.361   -25.759 1.436   1.00 0.00 ? 35  GLN A HE21 4  
ATOM   4938  H HE22 . GLN A 1 35  ? 3.470   -24.594 0.516   1.00 0.00 ? 35  GLN A HE22 4  
ATOM   4939  N N    . ASP A 1 36  ? 6.729   -20.125 3.080   1.00 0.00 ? 36  ASP A N    4  
ATOM   4940  C CA   . ASP A 1 36  ? 6.481   -18.695 3.109   1.00 0.00 ? 36  ASP A CA   4  
ATOM   4941  C C    . ASP A 1 36  ? 7.674   -17.961 2.496   1.00 0.00 ? 36  ASP A C    4  
ATOM   4942  O O    . ASP A 1 36  ? 8.824   -18.314 2.753   1.00 0.00 ? 36  ASP A O    4  
ATOM   4943  C CB   . ASP A 1 36  ? 6.303   -18.195 4.543   1.00 0.00 ? 36  ASP A CB   4  
ATOM   4944  C CG   . ASP A 1 36  ? 4.852   -18.015 4.993   1.00 0.00 ? 36  ASP A CG   4  
ATOM   4945  O OD1  . ASP A 1 36  ? 4.142   -17.238 4.319   1.00 0.00 ? 36  ASP A OD1  4  
ATOM   4946  O OD2  . ASP A 1 36  ? 4.485   -18.661 5.998   1.00 0.00 ? 36  ASP A OD2  4  
ATOM   4947  H H    . ASP A 1 36  ? 7.484   -20.411 2.489   1.00 0.00 ? 36  ASP A H    4  
ATOM   4948  H HA   . ASP A 1 36  ? 5.564   -18.552 2.535   1.00 0.00 ? 36  ASP A HA   4  
ATOM   4949  H HB2  . ASP A 1 36  ? 6.792   -18.897 5.221   1.00 0.00 ? 36  ASP A HB2  4  
ATOM   4950  H HB3  . ASP A 1 36  ? 6.821   -17.242 4.646   1.00 0.00 ? 36  ASP A HB3  4  
ATOM   4951  N N    . LYS A 1 37  ? 7.361   -16.952 1.696   1.00 0.00 ? 37  LYS A N    4  
ATOM   4952  C CA   . LYS A 1 37  ? 8.394   -16.165 1.045   1.00 0.00 ? 37  LYS A CA   4  
ATOM   4953  C C    . LYS A 1 37  ? 8.283   -14.709 1.501   1.00 0.00 ? 37  LYS A C    4  
ATOM   4954  O O    . LYS A 1 37  ? 8.942   -14.303 2.457   1.00 0.00 ? 37  LYS A O    4  
ATOM   4955  C CB   . LYS A 1 37  ? 8.324   -16.341 -0.473  1.00 0.00 ? 37  LYS A CB   4  
ATOM   4956  C CG   . LYS A 1 37  ? 9.456   -17.240 -0.973  1.00 0.00 ? 37  LYS A CG   4  
ATOM   4957  C CD   . LYS A 1 37  ? 9.272   -17.585 -2.452  1.00 0.00 ? 37  LYS A CD   4  
ATOM   4958  C CE   . LYS A 1 37  ? 8.561   -18.929 -2.618  1.00 0.00 ? 37  LYS A CE   4  
ATOM   4959  N NZ   . LYS A 1 37  ? 8.577   -19.353 -4.036  1.00 0.00 ? 37  LYS A NZ   4  
ATOM   4960  H H    . LYS A 1 37  ? 6.424   -16.671 1.492   1.00 0.00 ? 37  LYS A H    4  
ATOM   4961  H HA   . LYS A 1 37  ? 9.358   -16.556 1.372   1.00 0.00 ? 37  LYS A HA   4  
ATOM   4962  H HB2  . LYS A 1 37  ? 7.364   -16.774 -0.749  1.00 0.00 ? 37  LYS A HB2  4  
ATOM   4963  H HB3  . LYS A 1 37  ? 8.388   -15.368 -0.959  1.00 0.00 ? 37  LYS A HB3  4  
ATOM   4964  H HG2  . LYS A 1 37  ? 10.414  -16.740 -0.831  1.00 0.00 ? 37  LYS A HG2  4  
ATOM   4965  H HG3  . LYS A 1 37  ? 9.486   -18.157 -0.384  1.00 0.00 ? 37  LYS A HG3  4  
ATOM   4966  H HD2  . LYS A 1 37  ? 8.694   -16.801 -2.941  1.00 0.00 ? 37  LYS A HD2  4  
ATOM   4967  H HD3  . LYS A 1 37  ? 10.242  -17.619 -2.945  1.00 0.00 ? 37  LYS A HD3  4  
ATOM   4968  H HE2  . LYS A 1 37  ? 9.049   -19.684 -2.001  1.00 0.00 ? 37  LYS A HE2  4  
ATOM   4969  H HE3  . LYS A 1 37  ? 7.530   -18.848 -2.268  1.00 0.00 ? 37  LYS A HE3  4  
ATOM   4970  H HZ1  . LYS A 1 37  ? 8.144   -20.251 -4.121  1.00 0.00 ? 37  LYS A HZ1  4  
ATOM   4971  H HZ2  . LYS A 1 37  ? 8.077   -18.687 -4.588  1.00 0.00 ? 37  LYS A HZ2  4  
ATOM   4972  H HZ3  . LYS A 1 37  ? 9.523   -19.409 -4.355  1.00 0.00 ? 37  LYS A HZ3  4  
ATOM   4973  N N    . LEU A 1 38  ? 7.446   -13.963 0.794   1.00 0.00 ? 38  LEU A N    4  
ATOM   4974  C CA   . LEU A 1 38  ? 7.242   -12.560 1.114   1.00 0.00 ? 38  LEU A CA   4  
ATOM   4975  C C    . LEU A 1 38  ? 5.767   -12.205 0.906   1.00 0.00 ? 38  LEU A C    4  
ATOM   4976  O O    . LEU A 1 38  ? 5.227   -12.393 -0.183  1.00 0.00 ? 38  LEU A O    4  
ATOM   4977  C CB   . LEU A 1 38  ? 8.204   -11.681 0.314   1.00 0.00 ? 38  LEU A CB   4  
ATOM   4978  C CG   . LEU A 1 38  ? 9.097   -10.747 1.132   1.00 0.00 ? 38  LEU A CG   4  
ATOM   4979  C CD1  . LEU A 1 38  ? 8.257   -9.770  1.959   1.00 0.00 ? 38  LEU A CD1  4  
ATOM   4980  C CD2  . LEU A 1 38  ? 10.071  -11.543 2.003   1.00 0.00 ? 38  LEU A CD2  4  
ATOM   4981  H H    . LEU A 1 38  ? 6.916   -14.301 0.018   1.00 0.00 ? 38  LEU A H    4  
ATOM   4982  H HA   . LEU A 1 38  ? 7.484   -12.428 2.168   1.00 0.00 ? 38  LEU A HA   4  
ATOM   4983  H HB2  . LEU A 1 38  ? 8.844   -12.330 -0.286  1.00 0.00 ? 38  LEU A HB2  4  
ATOM   4984  H HB3  . LEU A 1 38  ? 7.621   -11.078 -0.382  1.00 0.00 ? 38  LEU A HB3  4  
ATOM   4985  H HG   . LEU A 1 38  ? 9.695   -10.152 0.440   1.00 0.00 ? 38  LEU A HG   4  
ATOM   4986  H HD11 . LEU A 1 38  ? 7.874   -8.982  1.310   1.00 0.00 ? 38  LEU A HD11 4  
ATOM   4987  H HD12 . LEU A 1 38  ? 7.423   -10.304 2.414   1.00 0.00 ? 38  LEU A HD12 4  
ATOM   4988  H HD13 . LEU A 1 38  ? 8.877   -9.330  2.740   1.00 0.00 ? 38  LEU A HD13 4  
ATOM   4989  H HD21 . LEU A 1 38  ? 10.679  -10.855 2.589   1.00 0.00 ? 38  LEU A HD21 4  
ATOM   4990  H HD22 . LEU A 1 38  ? 9.511   -12.195 2.672   1.00 0.00 ? 38  LEU A HD22 4  
ATOM   4991  H HD23 . LEU A 1 38  ? 10.720  -12.145 1.366   1.00 0.00 ? 38  LEU A HD23 4  
ATOM   4992  N N    . GLY A 1 39  ? 5.159   -11.698 1.969   1.00 0.00 ? 39  GLY A N    4  
ATOM   4993  C CA   . GLY A 1 39  ? 3.759   -11.314 1.918   1.00 0.00 ? 39  GLY A CA   4  
ATOM   4994  C C    . GLY A 1 39  ? 3.542   -9.941  2.555   1.00 0.00 ? 39  GLY A C    4  
ATOM   4995  O O    . GLY A 1 39  ? 3.720   -9.778  3.763   1.00 0.00 ? 39  GLY A O    4  
ATOM   4996  H H    . GLY A 1 39  ? 5.605   -11.548 2.851   1.00 0.00 ? 39  GLY A H    4  
ATOM   4997  H HA2  . GLY A 1 39  ? 3.422   -11.294 0.880   1.00 0.00 ? 39  GLY A HA2  4  
ATOM   4998  H HA3  . GLY A 1 39  ? 3.154   -12.060 2.434   1.00 0.00 ? 39  GLY A HA3  4  
ATOM   4999  N N    . ILE A 1 40  ? 3.158   -8.988  1.719   1.00 0.00 ? 40  ILE A N    4  
ATOM   5000  C CA   . ILE A 1 40  ? 2.915   -7.635  2.187   1.00 0.00 ? 40  ILE A CA   4  
ATOM   5001  C C    . ILE A 1 40  ? 1.408   -7.411  2.328   1.00 0.00 ? 40  ILE A C    4  
ATOM   5002  O O    . ILE A 1 40  ? 0.620   -7.987  1.582   1.00 0.00 ? 40  ILE A O    4  
ATOM   5003  C CB   . ILE A 1 40  ? 3.604   -6.619  1.274   1.00 0.00 ? 40  ILE A CB   4  
ATOM   5004  C CG1  . ILE A 1 40  ? 4.750   -7.272  0.495   1.00 0.00 ? 40  ILE A CG1  4  
ATOM   5005  C CG2  . ILE A 1 40  ? 4.076   -5.397  2.067   1.00 0.00 ? 40  ILE A CG2  4  
ATOM   5006  C CD1  . ILE A 1 40  ? 5.335   -6.301  -0.535  1.00 0.00 ? 40  ILE A CD1  4  
ATOM   5007  H H    . ILE A 1 40  ? 3.015   -9.129  0.740   1.00 0.00 ? 40  ILE A H    4  
ATOM   5008  H HA   . ILE A 1 40  ? 3.372   -7.542  3.174   1.00 0.00 ? 40  ILE A HA   4  
ATOM   5009  H HB   . ILE A 1 40  ? 2.877   -6.268  0.543   1.00 0.00 ? 40  ILE A HB   4  
ATOM   5010  H HG12 . ILE A 1 40  ? 5.529   -7.590  1.186   1.00 0.00 ? 40  ILE A HG12 4  
ATOM   5011  H HG13 . ILE A 1 40  ? 4.386   -8.166  -0.010  1.00 0.00 ? 40  ILE A HG13 4  
ATOM   5012  H HG21 . ILE A 1 40  ? 3.210   -4.815  2.384   1.00 0.00 ? 40  ILE A HG21 4  
ATOM   5013  H HG22 . ILE A 1 40  ? 4.633   -5.727  2.943   1.00 0.00 ? 40  ILE A HG22 4  
ATOM   5014  H HG23 . ILE A 1 40  ? 4.717   -4.782  1.437   1.00 0.00 ? 40  ILE A HG23 4  
ATOM   5015  H HD11 . ILE A 1 40  ? 5.985   -5.586  -0.029  1.00 0.00 ? 40  ILE A HD11 4  
ATOM   5016  H HD12 . ILE A 1 40  ? 5.910   -6.859  -1.272  1.00 0.00 ? 40  ILE A HD12 4  
ATOM   5017  H HD13 . ILE A 1 40  ? 4.525   -5.766  -1.031  1.00 0.00 ? 40  ILE A HD13 4  
ATOM   5018  N N    . TYR A 1 41  ? 1.055   -6.573  3.292   1.00 0.00 ? 41  TYR A N    4  
ATOM   5019  C CA   . TYR A 1 41  ? -0.344  -6.266  3.540   1.00 0.00 ? 41  TYR A CA   4  
ATOM   5020  C C    . TYR A 1 41  ? -0.504  -4.851  4.101   1.00 0.00 ? 41  TYR A C    4  
ATOM   5021  O O    . TYR A 1 41  ? 0.471   -4.238  4.533   1.00 0.00 ? 41  TYR A O    4  
ATOM   5022  C CB   . TYR A 1 41  ? -0.816  -7.274  4.589   1.00 0.00 ? 41  TYR A CB   4  
ATOM   5023  C CG   . TYR A 1 41  ? -0.581  -8.735  4.199   1.00 0.00 ? 41  TYR A CG   4  
ATOM   5024  C CD1  . TYR A 1 41  ? -1.330  -9.309  3.191   1.00 0.00 ? 41  TYR A CD1  4  
ATOM   5025  C CD2  . TYR A 1 41  ? 0.379   -9.477  4.855   1.00 0.00 ? 41  TYR A CD2  4  
ATOM   5026  C CE1  . TYR A 1 41  ? -1.108  -10.683 2.824   1.00 0.00 ? 41  TYR A CE1  4  
ATOM   5027  C CE2  . TYR A 1 41  ? 0.602   -10.853 4.488   1.00 0.00 ? 41  TYR A CE2  4  
ATOM   5028  C CZ   . TYR A 1 41  ? -0.153  -11.388 3.490   1.00 0.00 ? 41  TYR A CZ   4  
ATOM   5029  O OH   . TYR A 1 41  ? 0.056   -12.686 3.144   1.00 0.00 ? 41  TYR A OH   4  
ATOM   5030  H H    . TYR A 1 41  ? 1.702   -6.107  3.896   1.00 0.00 ? 41  TYR A H    4  
ATOM   5031  H HA   . TYR A 1 41  ? -0.877  -6.335  2.591   1.00 0.00 ? 41  TYR A HA   4  
ATOM   5032  H HB2  . TYR A 1 41  ? -0.304  -7.072  5.529   1.00 0.00 ? 41  TYR A HB2  4  
ATOM   5033  H HB3  . TYR A 1 41  ? -1.881  -7.123  4.769   1.00 0.00 ? 41  TYR A HB3  4  
ATOM   5034  H HD1  . TYR A 1 41  ? -2.089  -8.722  2.674   1.00 0.00 ? 41  TYR A HD1  4  
ATOM   5035  H HD2  . TYR A 1 41  ? 0.971   -9.025  5.649   1.00 0.00 ? 41  TYR A HD2  4  
ATOM   5036  H HE1  . TYR A 1 41  ? -1.692  -11.149 2.032   1.00 0.00 ? 41  TYR A HE1  4  
ATOM   5037  H HE2  . TYR A 1 41  ? 1.356   -11.450 4.996   1.00 0.00 ? 41  TYR A HE2  4  
ATOM   5038  H HH   . TYR A 1 41  ? -0.662  -13.263 3.530   1.00 0.00 ? 41  TYR A HH   4  
ATOM   5039  N N    . VAL A 1 42  ? -1.741  -4.376  4.076   1.00 0.00 ? 42  VAL A N    4  
ATOM   5040  C CA   . VAL A 1 42  ? -2.040  -3.045  4.577   1.00 0.00 ? 42  VAL A CA   4  
ATOM   5041  C C    . VAL A 1 42  ? -2.711  -3.159  5.946   1.00 0.00 ? 42  VAL A C    4  
ATOM   5042  O O    . VAL A 1 42  ? -3.758  -3.791  6.079   1.00 0.00 ? 42  VAL A O    4  
ATOM   5043  C CB   . VAL A 1 42  ? -2.888  -2.281  3.557   1.00 0.00 ? 42  VAL A CB   4  
ATOM   5044  C CG1  . VAL A 1 42  ? -3.468  -1.005  4.173   1.00 0.00 ? 42  VAL A CG1  4  
ATOM   5045  C CG2  . VAL A 1 42  ? -2.080  -1.964  2.298   1.00 0.00 ? 42  VAL A CG2  4  
ATOM   5046  H H    . VAL A 1 42  ? -2.527  -4.881  3.722   1.00 0.00 ? 42  VAL A H    4  
ATOM   5047  H HA   . VAL A 1 42  ? -1.094  -2.516  4.693   1.00 0.00 ? 42  VAL A HA   4  
ATOM   5048  H HB   . VAL A 1 42  ? -3.722  -2.922  3.270   1.00 0.00 ? 42  VAL A HB   4  
ATOM   5049  H HG11 . VAL A 1 42  ? -3.911  -1.238  5.140   1.00 0.00 ? 42  VAL A HG11 4  
ATOM   5050  H HG12 . VAL A 1 42  ? -2.673  -0.272  4.305   1.00 0.00 ? 42  VAL A HG12 4  
ATOM   5051  H HG13 . VAL A 1 42  ? -4.232  -0.597  3.511   1.00 0.00 ? 42  VAL A HG13 4  
ATOM   5052  H HG21 . VAL A 1 42  ? -2.637  -1.265  1.675   1.00 0.00 ? 42  VAL A HG21 4  
ATOM   5053  H HG22 . VAL A 1 42  ? -1.125  -1.519  2.582   1.00 0.00 ? 42  VAL A HG22 4  
ATOM   5054  H HG23 . VAL A 1 42  ? -1.900  -2.884  1.741   1.00 0.00 ? 42  VAL A HG23 4  
ATOM   5055  N N    . LYS A 1 43  ? -2.080  -2.539  6.933   1.00 0.00 ? 43  LYS A N    4  
ATOM   5056  C CA   . LYS A 1 43  ? -2.604  -2.562  8.288   1.00 0.00 ? 43  LYS A CA   4  
ATOM   5057  C C    . LYS A 1 43  ? -3.821  -1.642  8.377   1.00 0.00 ? 43  LYS A C    4  
ATOM   5058  O O    . LYS A 1 43  ? -4.842  -2.011  8.955   1.00 0.00 ? 43  LYS A O    4  
ATOM   5059  C CB   . LYS A 1 43  ? -1.500  -2.222  9.294   1.00 0.00 ? 43  LYS A CB   4  
ATOM   5060  C CG   . LYS A 1 43  ? -2.059  -2.146  10.715  1.00 0.00 ? 43  LYS A CG   4  
ATOM   5061  C CD   . LYS A 1 43  ? -2.536  -3.521  11.193  1.00 0.00 ? 43  LYS A CD   4  
ATOM   5062  C CE   . LYS A 1 43  ? -1.633  -4.058  12.305  1.00 0.00 ? 43  LYS A CE   4  
ATOM   5063  N NZ   . LYS A 1 43  ? -0.637  -5.004  11.752  1.00 0.00 ? 43  LYS A NZ   4  
ATOM   5064  H H    . LYS A 1 43  ? -1.229  -2.027  6.817   1.00 0.00 ? 43  LYS A H    4  
ATOM   5065  H HA   . LYS A 1 43  ? -2.924  -3.583  8.496   1.00 0.00 ? 43  LYS A HA   4  
ATOM   5066  H HB2  . LYS A 1 43  ? -0.716  -2.978  9.249   1.00 0.00 ? 43  LYS A HB2  4  
ATOM   5067  H HB3  . LYS A 1 43  ? -1.042  -1.271  9.028   1.00 0.00 ? 43  LYS A HB3  4  
ATOM   5068  H HG2  . LYS A 1 43  ? -1.294  -1.768  11.393  1.00 0.00 ? 43  LYS A HG2  4  
ATOM   5069  H HG3  . LYS A 1 43  ? -2.889  -1.440  10.746  1.00 0.00 ? 43  LYS A HG3  4  
ATOM   5070  H HD2  . LYS A 1 43  ? -3.561  -3.448  11.555  1.00 0.00 ? 43  LYS A HD2  4  
ATOM   5071  H HD3  . LYS A 1 43  ? -2.542  -4.218  10.356  1.00 0.00 ? 43  LYS A HD3  4  
ATOM   5072  H HE2  . LYS A 1 43  ? -1.123  -3.230  12.799  1.00 0.00 ? 43  LYS A HE2  4  
ATOM   5073  H HE3  . LYS A 1 43  ? -2.236  -4.558  13.063  1.00 0.00 ? 43  LYS A HE3  4  
ATOM   5074  H HZ1  . LYS A 1 43  ? 0.097   -5.141  12.418  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM   5075  H HZ2  . LYS A 1 43  ? -1.081  -5.878  11.560  1.00 0.00 ? 43  LYS A HZ2  4  
ATOM   5076  H HZ3  . LYS A 1 43  ? -0.255  -4.629  10.908  1.00 0.00 ? 43  LYS A HZ3  4  
ATOM   5077  N N    . SER A 1 44  ? -3.673  -0.460  7.797   1.00 0.00 ? 44  SER A N    4  
ATOM   5078  C CA   . SER A 1 44  ? -4.749  0.517   7.803   1.00 0.00 ? 44  SER A CA   4  
ATOM   5079  C C    . SER A 1 44  ? -4.181  1.923   7.607   1.00 0.00 ? 44  SER A C    4  
ATOM   5080  O O    . SER A 1 44  ? -2.965  2.106   7.575   1.00 0.00 ? 44  SER A O    4  
ATOM   5081  C CB   . SER A 1 44  ? -5.551  0.446   9.104   1.00 0.00 ? 44  SER A CB   4  
ATOM   5082  O OG   . SER A 1 44  ? -4.712  0.225   10.235  1.00 0.00 ? 44  SER A OG   4  
ATOM   5083  H H    . SER A 1 44  ? -2.840  -0.168  7.329   1.00 0.00 ? 44  SER A H    4  
ATOM   5084  H HA   . SER A 1 44  ? -5.393  0.243   6.966   1.00 0.00 ? 44  SER A HA   4  
ATOM   5085  H HB2  . SER A 1 44  ? -6.106  1.373   9.239   1.00 0.00 ? 44  SER A HB2  4  
ATOM   5086  H HB3  . SER A 1 44  ? -6.284  -0.358  9.034   1.00 0.00 ? 44  SER A HB3  4  
ATOM   5087  H HG   . SER A 1 44  ? -3.752  0.340   9.979   1.00 0.00 ? 44  SER A HG   4  
ATOM   5088  N N    . VAL A 1 45  ? -5.086  2.881   7.477   1.00 0.00 ? 45  VAL A N    4  
ATOM   5089  C CA   . VAL A 1 45  ? -4.691  4.266   7.285   1.00 0.00 ? 45  VAL A CA   4  
ATOM   5090  C C    . VAL A 1 45  ? -4.609  4.962   8.645   1.00 0.00 ? 45  VAL A C    4  
ATOM   5091  O O    . VAL A 1 45  ? -5.559  4.920   9.426   1.00 0.00 ? 45  VAL A O    4  
ATOM   5092  C CB   . VAL A 1 45  ? -5.654  4.956   6.318   1.00 0.00 ? 45  VAL A CB   4  
ATOM   5093  C CG1  . VAL A 1 45  ? -5.714  4.211   4.981   1.00 0.00 ? 45  VAL A CG1  4  
ATOM   5094  C CG2  . VAL A 1 45  ? -7.048  5.091   6.933   1.00 0.00 ? 45  VAL A CG2  4  
ATOM   5095  H H    . VAL A 1 45  ? -6.074  2.723   7.505   1.00 0.00 ? 45  VAL A H    4  
ATOM   5096  H HA   . VAL A 1 45  ? -3.699  4.264   6.832   1.00 0.00 ? 45  VAL A HA   4  
ATOM   5097  H HB   . VAL A 1 45  ? -5.273  5.959   6.125   1.00 0.00 ? 45  VAL A HB   4  
ATOM   5098  H HG11 . VAL A 1 45  ? -6.716  4.299   4.561   1.00 0.00 ? 45  VAL A HG11 4  
ATOM   5099  H HG12 . VAL A 1 45  ? -4.991  4.647   4.290   1.00 0.00 ? 45  VAL A HG12 4  
ATOM   5100  H HG13 . VAL A 1 45  ? -5.476  3.159   5.140   1.00 0.00 ? 45  VAL A HG13 4  
ATOM   5101  H HG21 . VAL A 1 45  ? -7.155  4.377   7.748   1.00 0.00 ? 45  VAL A HG21 4  
ATOM   5102  H HG22 . VAL A 1 45  ? -7.179  6.102   7.316   1.00 0.00 ? 45  VAL A HG22 4  
ATOM   5103  H HG23 . VAL A 1 45  ? -7.801  4.890   6.172   1.00 0.00 ? 45  VAL A HG23 4  
ATOM   5104  N N    . VAL A 1 46  ? -3.465  5.586   8.887   1.00 0.00 ? 46  VAL A N    4  
ATOM   5105  C CA   . VAL A 1 46  ? -3.247  6.291   10.139  1.00 0.00 ? 46  VAL A CA   4  
ATOM   5106  C C    . VAL A 1 46  ? -4.517  7.056   10.516  1.00 0.00 ? 46  VAL A C    4  
ATOM   5107  O O    . VAL A 1 46  ? -4.825  7.212   11.695  1.00 0.00 ? 46  VAL A O    4  
ATOM   5108  C CB   . VAL A 1 46  ? -2.016  7.192   10.025  1.00 0.00 ? 46  VAL A CB   4  
ATOM   5109  C CG1  . VAL A 1 46  ? -2.007  8.250   11.129  1.00 0.00 ? 46  VAL A CG1  4  
ATOM   5110  C CG2  . VAL A 1 46  ? -0.729  6.367   10.046  1.00 0.00 ? 46  VAL A CG2  4  
ATOM   5111  H H    . VAL A 1 46  ? -2.698  5.615   8.246   1.00 0.00 ? 46  VAL A H    4  
ATOM   5112  H HA   . VAL A 1 46  ? -3.047  5.543   10.907  1.00 0.00 ? 46  VAL A HA   4  
ATOM   5113  H HB   . VAL A 1 46  ? -2.068  7.708   9.067   1.00 0.00 ? 46  VAL A HB   4  
ATOM   5114  H HG11 . VAL A 1 46  ? -1.817  7.773   12.090  1.00 0.00 ? 46  VAL A HG11 4  
ATOM   5115  H HG12 . VAL A 1 46  ? -1.225  8.982   10.926  1.00 0.00 ? 46  VAL A HG12 4  
ATOM   5116  H HG13 . VAL A 1 46  ? -2.974  8.752   11.158  1.00 0.00 ? 46  VAL A HG13 4  
ATOM   5117  H HG21 . VAL A 1 46  ? 0.111   6.994   9.744   1.00 0.00 ? 46  VAL A HG21 4  
ATOM   5118  H HG22 . VAL A 1 46  ? -0.556  5.988   11.054  1.00 0.00 ? 46  VAL A HG22 4  
ATOM   5119  H HG23 . VAL A 1 46  ? -0.822  5.529   9.355   1.00 0.00 ? 46  VAL A HG23 4  
ATOM   5120  N N    . LYS A 1 47  ? -5.219  7.517   9.490   1.00 0.00 ? 47  LYS A N    4  
ATOM   5121  C CA   . LYS A 1 47  ? -6.447  8.262   9.698   1.00 0.00 ? 47  LYS A CA   4  
ATOM   5122  C C    . LYS A 1 47  ? -6.114  9.744   9.887   1.00 0.00 ? 47  LYS A C    4  
ATOM   5123  O O    . LYS A 1 47  ? -6.896  10.490  10.473  1.00 0.00 ? 47  LYS A O    4  
ATOM   5124  C CB   . LYS A 1 47  ? -7.252  7.661   10.853  1.00 0.00 ? 47  LYS A CB   4  
ATOM   5125  C CG   . LYS A 1 47  ? -8.716  8.093   10.786  1.00 0.00 ? 47  LYS A CG   4  
ATOM   5126  C CD   . LYS A 1 47  ? -9.595  6.969   10.232  1.00 0.00 ? 47  LYS A CD   4  
ATOM   5127  C CE   . LYS A 1 47  ? -11.001 7.479   9.913   1.00 0.00 ? 47  LYS A CE   4  
ATOM   5128  N NZ   . LYS A 1 47  ? -11.555 6.771   8.736   1.00 0.00 ? 47  LYS A NZ   4  
ATOM   5129  H H    . LYS A 1 47  ? -4.961  7.385   8.532   1.00 0.00 ? 47  LYS A H    4  
ATOM   5130  H HA   . LYS A 1 47  ? -7.052  8.156   8.797   1.00 0.00 ? 47  LYS A HA   4  
ATOM   5131  H HB2  . LYS A 1 47  ? -7.187  6.573   10.818  1.00 0.00 ? 47  LYS A HB2  4  
ATOM   5132  H HB3  . LYS A 1 47  ? -6.818  7.975   11.804  1.00 0.00 ? 47  LYS A HB3  4  
ATOM   5133  H HG2  . LYS A 1 47  ? -9.063  8.374   11.780  1.00 0.00 ? 47  LYS A HG2  4  
ATOM   5134  H HG3  . LYS A 1 47  ? -8.810  8.976   10.155  1.00 0.00 ? 47  LYS A HG3  4  
ATOM   5135  H HD2  . LYS A 1 47  ? -9.140  6.557   9.332   1.00 0.00 ? 47  LYS A HD2  4  
ATOM   5136  H HD3  . LYS A 1 47  ? -9.655  6.159   10.959  1.00 0.00 ? 47  LYS A HD3  4  
ATOM   5137  H HE2  . LYS A 1 47  ? -11.652 7.332   10.773  1.00 0.00 ? 47  LYS A HE2  4  
ATOM   5138  H HE3  . LYS A 1 47  ? -10.969 8.551   9.717   1.00 0.00 ? 47  LYS A HE3  4  
ATOM   5139  H HZ1  . LYS A 1 47  ? -12.409 6.322   8.990   1.00 0.00 ? 47  LYS A HZ1  4  
ATOM   5140  H HZ2  . LYS A 1 47  ? -11.728 7.428   8.004   1.00 0.00 ? 47  LYS A HZ2  4  
ATOM   5141  H HZ3  . LYS A 1 47  ? -10.897 6.086   8.421   1.00 0.00 ? 47  LYS A HZ3  4  
ATOM   5142  N N    . GLY A 1 48  ? -4.951  10.125  9.379   1.00 0.00 ? 48  GLY A N    4  
ATOM   5143  C CA   . GLY A 1 48  ? -4.505  11.504  9.484   1.00 0.00 ? 48  GLY A CA   4  
ATOM   5144  C C    . GLY A 1 48  ? -3.467  11.826  8.407   1.00 0.00 ? 48  GLY A C    4  
ATOM   5145  O O    . GLY A 1 48  ? -2.412  12.383  8.704   1.00 0.00 ? 48  GLY A O    4  
ATOM   5146  H H    . GLY A 1 48  ? -4.320  9.511   8.904   1.00 0.00 ? 48  GLY A H    4  
ATOM   5147  H HA2  . GLY A 1 48  ? -5.357  12.175  9.386   1.00 0.00 ? 48  GLY A HA2  4  
ATOM   5148  H HA3  . GLY A 1 48  ? -4.074  11.676  10.471  1.00 0.00 ? 48  GLY A HA3  4  
ATOM   5149  N N    . GLY A 1 49  ? -3.805  11.465  7.177   1.00 0.00 ? 49  GLY A N    4  
ATOM   5150  C CA   . GLY A 1 49  ? -2.915  11.710  6.055   1.00 0.00 ? 49  GLY A CA   4  
ATOM   5151  C C    . GLY A 1 49  ? -3.710  12.024  4.785   1.00 0.00 ? 49  GLY A C    4  
ATOM   5152  O O    . GLY A 1 49  ? -4.920  11.811  4.736   1.00 0.00 ? 49  GLY A O    4  
ATOM   5153  H H    . GLY A 1 49  ? -4.666  11.013  6.944   1.00 0.00 ? 49  GLY A H    4  
ATOM   5154  H HA2  . GLY A 1 49  ? -2.251  12.542  6.287   1.00 0.00 ? 49  GLY A HA2  4  
ATOM   5155  H HA3  . GLY A 1 49  ? -2.286  10.837  5.887   1.00 0.00 ? 49  GLY A HA3  4  
ATOM   5156  N N    . ALA A 1 50  ? -2.996  12.526  3.789   1.00 0.00 ? 50  ALA A N    4  
ATOM   5157  C CA   . ALA A 1 50  ? -3.618  12.870  2.520   1.00 0.00 ? 50  ALA A CA   4  
ATOM   5158  C C    . ALA A 1 50  ? -4.174  11.602  1.868   1.00 0.00 ? 50  ALA A C    4  
ATOM   5159  O O    . ALA A 1 50  ? -5.362  11.530  1.559   1.00 0.00 ? 50  ALA A O    4  
ATOM   5160  C CB   . ALA A 1 50  ? -2.602  13.588  1.632   1.00 0.00 ? 50  ALA A CB   4  
ATOM   5161  H H    . ALA A 1 50  ? -2.013  12.696  3.835   1.00 0.00 ? 50  ALA A H    4  
ATOM   5162  H HA   . ALA A 1 50  ? -4.443  13.553  2.731   1.00 0.00 ? 50  ALA A HA   4  
ATOM   5163  H HB1  . ALA A 1 50  ? -2.805  14.658  1.638   1.00 0.00 ? 50  ALA A HB1  4  
ATOM   5164  H HB2  . ALA A 1 50  ? -1.595  13.406  2.009   1.00 0.00 ? 50  ALA A HB2  4  
ATOM   5165  H HB3  . ALA A 1 50  ? -2.682  13.208  0.611   1.00 0.00 ? 50  ALA A HB3  4  
ATOM   5166  N N    . ALA A 1 51  ? -3.288  10.636  1.681   1.00 0.00 ? 51  ALA A N    4  
ATOM   5167  C CA   . ALA A 1 51  ? -3.676  9.375   1.072   1.00 0.00 ? 51  ALA A CA   4  
ATOM   5168  C C    . ALA A 1 51  ? -4.595  8.612   2.026   1.00 0.00 ? 51  ALA A C    4  
ATOM   5169  O O    . ALA A 1 51  ? -5.387  7.776   1.597   1.00 0.00 ? 51  ALA A O    4  
ATOM   5170  C CB   . ALA A 1 51  ? -2.421  8.577   0.709   1.00 0.00 ? 51  ALA A CB   4  
ATOM   5171  H H    . ALA A 1 51  ? -2.324  10.703  1.936   1.00 0.00 ? 51  ALA A H    4  
ATOM   5172  H HA   . ALA A 1 51  ? -4.224  9.603   0.157   1.00 0.00 ? 51  ALA A HA   4  
ATOM   5173  H HB1  . ALA A 1 51  ? -2.429  7.626   1.238   1.00 0.00 ? 51  ALA A HB1  4  
ATOM   5174  H HB2  . ALA A 1 51  ? -2.406  8.394   -0.366  1.00 0.00 ? 51  ALA A HB2  4  
ATOM   5175  H HB3  . ALA A 1 51  ? -1.535  9.145   0.993   1.00 0.00 ? 51  ALA A HB3  4  
ATOM   5176  N N    . ASP A 1 52  ? -4.460  8.930   3.306   1.00 0.00 ? 52  ASP A N    4  
ATOM   5177  C CA   . ASP A 1 52  ? -5.268  8.285   4.326   1.00 0.00 ? 52  ASP A CA   4  
ATOM   5178  C C    . ASP A 1 52  ? -6.746  8.591   4.068   1.00 0.00 ? 52  ASP A C    4  
ATOM   5179  O O    . ASP A 1 52  ? -7.570  7.679   3.995   1.00 0.00 ? 52  ASP A O    4  
ATOM   5180  C CB   . ASP A 1 52  ? -4.915  8.806   5.721   1.00 0.00 ? 52  ASP A CB   4  
ATOM   5181  C CG   . ASP A 1 52  ? -6.112  9.221   6.579   1.00 0.00 ? 52  ASP A CG   4  
ATOM   5182  O OD1  . ASP A 1 52  ? -7.076  8.425   6.632   1.00 0.00 ? 52  ASP A OD1  4  
ATOM   5183  O OD2  . ASP A 1 52  ? -6.037  10.323  7.161   1.00 0.00 ? 52  ASP A OD2  4  
ATOM   5184  H H    . ASP A 1 52  ? -3.814  9.611   3.648   1.00 0.00 ? 52  ASP A H    4  
ATOM   5185  H HA   . ASP A 1 52  ? -5.042  7.222   4.243   1.00 0.00 ? 52  ASP A HA   4  
ATOM   5186  H HB2  . ASP A 1 52  ? -4.359  8.032   6.251   1.00 0.00 ? 52  ASP A HB2  4  
ATOM   5187  H HB3  . ASP A 1 52  ? -4.249  9.662   5.614   1.00 0.00 ? 52  ASP A HB3  4  
ATOM   5188  N N    . VAL A 1 53  ? -7.038  9.876   3.935   1.00 0.00 ? 53  VAL A N    4  
ATOM   5189  C CA   . VAL A 1 53  ? -8.401  10.312  3.686   1.00 0.00 ? 53  VAL A CA   4  
ATOM   5190  C C    . VAL A 1 53  ? -8.720  10.155  2.198   1.00 0.00 ? 53  VAL A C    4  
ATOM   5191  O O    . VAL A 1 53  ? -9.678  9.478   1.833   1.00 0.00 ? 53  VAL A O    4  
ATOM   5192  C CB   . VAL A 1 53  ? -8.591  11.745  4.189   1.00 0.00 ? 53  VAL A CB   4  
ATOM   5193  C CG1  . VAL A 1 53  ? -10.068 12.142  4.169   1.00 0.00 ? 53  VAL A CG1  4  
ATOM   5194  C CG2  . VAL A 1 53  ? -7.997  11.918  5.588   1.00 0.00 ? 53  VAL A CG2  4  
ATOM   5195  H H    . VAL A 1 53  ? -6.362  10.612  3.994   1.00 0.00 ? 53  VAL A H    4  
ATOM   5196  H HA   . VAL A 1 53  ? -9.064  9.664   4.256   1.00 0.00 ? 53  VAL A HA   4  
ATOM   5197  H HB   . VAL A 1 53  ? -8.056  12.412  3.514   1.00 0.00 ? 53  VAL A HB   4  
ATOM   5198  H HG11 . VAL A 1 53  ? -10.523 11.799  3.239   1.00 0.00 ? 53  VAL A HG11 4  
ATOM   5199  H HG12 . VAL A 1 53  ? -10.580 11.682  5.013   1.00 0.00 ? 53  VAL A HG12 4  
ATOM   5200  H HG13 . VAL A 1 53  ? -10.154 13.227  4.236   1.00 0.00 ? 53  VAL A HG13 4  
ATOM   5201  H HG21 . VAL A 1 53  ? -7.980  12.977  5.849   1.00 0.00 ? 53  VAL A HG21 4  
ATOM   5202  H HG22 . VAL A 1 53  ? -8.607  11.377  6.312   1.00 0.00 ? 53  VAL A HG22 4  
ATOM   5203  H HG23 . VAL A 1 53  ? -6.981  11.523  5.603   1.00 0.00 ? 53  VAL A HG23 4  
ATOM   5204  N N    . ASP A 1 54  ? -7.894  10.792  1.379   1.00 0.00 ? 54  ASP A N    4  
ATOM   5205  C CA   . ASP A 1 54  ? -8.077  10.731  -0.062  1.00 0.00 ? 54  ASP A CA   4  
ATOM   5206  C C    . ASP A 1 54  ? -8.070  9.268   -0.510  1.00 0.00 ? 54  ASP A C    4  
ATOM   5207  O O    . ASP A 1 54  ? -9.067  8.770   -1.031  1.00 0.00 ? 54  ASP A O    4  
ATOM   5208  C CB   . ASP A 1 54  ? -6.943  11.455  -0.791  1.00 0.00 ? 54  ASP A CB   4  
ATOM   5209  C CG   . ASP A 1 54  ? -7.072  11.488  -2.316  1.00 0.00 ? 54  ASP A CG   4  
ATOM   5210  O OD1  . ASP A 1 54  ? -8.157  11.894  -2.784  1.00 0.00 ? 54  ASP A OD1  4  
ATOM   5211  O OD2  . ASP A 1 54  ? -6.082  11.104  -2.976  1.00 0.00 ? 54  ASP A OD2  4  
ATOM   5212  H H    . ASP A 1 54  ? -7.118  11.341  1.684   1.00 0.00 ? 54  ASP A H    4  
ATOM   5213  H HA   . ASP A 1 54  ? -9.032  11.221  -0.251  1.00 0.00 ? 54  ASP A HA   4  
ATOM   5214  H HB2  . ASP A 1 54  ? -6.891  12.480  -0.423  1.00 0.00 ? 54  ASP A HB2  4  
ATOM   5215  H HB3  . ASP A 1 54  ? -6.000  10.975  -0.531  1.00 0.00 ? 54  ASP A HB3  4  
ATOM   5216  N N    . GLY A 1 55  ? -6.934  8.621   -0.292  1.00 0.00 ? 55  GLY A N    4  
ATOM   5217  C CA   . GLY A 1 55  ? -6.784  7.226   -0.667  1.00 0.00 ? 55  GLY A CA   4  
ATOM   5218  C C    . GLY A 1 55  ? -7.945  6.385   -0.131  1.00 0.00 ? 55  GLY A C    4  
ATOM   5219  O O    . GLY A 1 55  ? -8.645  5.725   -0.897  1.00 0.00 ? 55  GLY A O    4  
ATOM   5220  H H    . GLY A 1 55  ? -6.128  9.034   0.132   1.00 0.00 ? 55  GLY A H    4  
ATOM   5221  H HA2  . GLY A 1 55  ? -6.741  7.139   -1.753  1.00 0.00 ? 55  GLY A HA2  4  
ATOM   5222  H HA3  . GLY A 1 55  ? -5.841  6.840   -0.279  1.00 0.00 ? 55  GLY A HA3  4  
ATOM   5223  N N    . ARG A 1 56  ? -8.114  6.437   1.183   1.00 0.00 ? 56  ARG A N    4  
ATOM   5224  C CA   . ARG A 1 56  ? -9.179  5.690   1.832   1.00 0.00 ? 56  ARG A CA   4  
ATOM   5225  C C    . ARG A 1 56  ? -9.077  4.206   1.474   1.00 0.00 ? 56  ARG A C    4  
ATOM   5226  O O    . ARG A 1 56  ? -10.082 3.572   1.152   1.00 0.00 ? 56  ARG A O    4  
ATOM   5227  C CB   . ARG A 1 56  ? -10.552 6.217   1.414   1.00 0.00 ? 56  ARG A CB   4  
ATOM   5228  C CG   . ARG A 1 56  ? -11.625 5.810   2.427   1.00 0.00 ? 56  ARG A CG   4  
ATOM   5229  C CD   . ARG A 1 56  ? -12.997 6.352   2.021   1.00 0.00 ? 56  ARG A CD   4  
ATOM   5230  N NE   . ARG A 1 56  ? -13.680 6.934   3.198   1.00 0.00 ? 56  ARG A NE   4  
ATOM   5231  C CZ   . ARG A 1 56  ? -14.720 7.775   3.122   1.00 0.00 ? 56  ARG A CZ   4  
ATOM   5232  N NH1  . ARG A 1 56  ? -15.204 8.136   1.925   1.00 0.00 ? 56  ARG A NH1  4  
ATOM   5233  N NH2  . ARG A 1 56  ? -15.277 8.256   4.242   1.00 0.00 ? 56  ARG A NH2  4  
ATOM   5234  H H    . ARG A 1 56  ? -7.541  6.978   1.799   1.00 0.00 ? 56  ARG A H    4  
ATOM   5235  H HA   . ARG A 1 56  ? -9.020  5.849   2.898   1.00 0.00 ? 56  ARG A HA   4  
ATOM   5236  H HB2  . ARG A 1 56  ? -10.521 7.301   1.329   1.00 0.00 ? 56  ARG A HB2  4  
ATOM   5237  H HB3  . ARG A 1 56  ? -10.813 5.826   0.430   1.00 0.00 ? 56  ARG A HB3  4  
ATOM   5238  H HG2  . ARG A 1 56  ? -11.667 4.724   2.504   1.00 0.00 ? 56  ARG A HG2  4  
ATOM   5239  H HG3  . ARG A 1 56  ? -11.358 6.188   3.415   1.00 0.00 ? 56  ARG A HG3  4  
ATOM   5240  H HD2  . ARG A 1 56  ? -12.884 7.106   1.245   1.00 0.00 ? 56  ARG A HD2  4  
ATOM   5241  H HD3  . ARG A 1 56  ? -13.603 5.549   1.600   1.00 0.00 ? 56  ARG A HD3  4  
ATOM   5242  H HE   . ARG A 1 56  ? -13.344 6.685   4.107   1.00 0.00 ? 56  ARG A HE   4  
ATOM   5243  H HH11 . ARG A 1 56  ? -14.788 7.778   1.088   1.00 0.00 ? 56  ARG A HH11 4  
ATOM   5244  H HH12 . ARG A 1 56  ? -15.980 8.764   1.868   1.00 0.00 ? 56  ARG A HH12 4  
ATOM   5245  H HH21 . ARG A 1 56  ? -14.917 7.985   5.134   1.00 0.00 ? 56  ARG A HH21 4  
ATOM   5246  H HH22 . ARG A 1 56  ? -16.053 8.884   4.185   1.00 0.00 ? 56  ARG A HH22 4  
ATOM   5247  N N    . LEU A 1 57  ? -7.856  3.694   1.542   1.00 0.00 ? 57  LEU A N    4  
ATOM   5248  C CA   . LEU A 1 57  ? -7.612  2.296   1.231   1.00 0.00 ? 57  LEU A CA   4  
ATOM   5249  C C    . LEU A 1 57  ? -8.222  1.421   2.326   1.00 0.00 ? 57  LEU A C    4  
ATOM   5250  O O    . LEU A 1 57  ? -8.466  1.889   3.435   1.00 0.00 ? 57  LEU A O    4  
ATOM   5251  C CB   . LEU A 1 57  ? -6.118  2.051   1.005   1.00 0.00 ? 57  LEU A CB   4  
ATOM   5252  C CG   . LEU A 1 57  ? -5.502  2.737   -0.215  1.00 0.00 ? 57  LEU A CG   4  
ATOM   5253  C CD1  . LEU A 1 57  ? -3.982  2.840   -0.078  1.00 0.00 ? 57  LEU A CD1  4  
ATOM   5254  C CD2  . LEU A 1 57  ? -5.914  2.030   -1.508  1.00 0.00 ? 57  LEU A CD2  4  
ATOM   5255  H H    . LEU A 1 57  ? -7.045  4.217   1.804   1.00 0.00 ? 57  LEU A H    4  
ATOM   5256  H HA   . LEU A 1 57  ? -8.120  2.079   0.290   1.00 0.00 ? 57  LEU A HA   4  
ATOM   5257  H HB2  . LEU A 1 57  ? -5.579  2.381   1.894   1.00 0.00 ? 57  LEU A HB2  4  
ATOM   5258  H HB3  . LEU A 1 57  ? -5.957  0.977   0.915   1.00 0.00 ? 57  LEU A HB3  4  
ATOM   5259  H HG   . LEU A 1 57  ? -5.889  3.754   -0.267  1.00 0.00 ? 57  LEU A HG   4  
ATOM   5260  H HD11 . LEU A 1 57  ? -3.715  3.832   0.284   1.00 0.00 ? 57  LEU A HD11 4  
ATOM   5261  H HD12 . LEU A 1 57  ? -3.629  2.088   0.629   1.00 0.00 ? 57  LEU A HD12 4  
ATOM   5262  H HD13 . LEU A 1 57  ? -3.517  2.669   -1.048  1.00 0.00 ? 57  LEU A HD13 4  
ATOM   5263  H HD21 . LEU A 1 57  ? -6.999  2.065   -1.612  1.00 0.00 ? 57  LEU A HD21 4  
ATOM   5264  H HD22 . LEU A 1 57  ? -5.449  2.528   -2.359  1.00 0.00 ? 57  LEU A HD22 4  
ATOM   5265  H HD23 . LEU A 1 57  ? -5.588  0.990   -1.473  1.00 0.00 ? 57  LEU A HD23 4  
ATOM   5266  N N    . ALA A 1 58  ? -8.449  0.163   1.974   1.00 0.00 ? 58  ALA A N    4  
ATOM   5267  C CA   . ALA A 1 58  ? -9.027  -0.784  2.914   1.00 0.00 ? 58  ALA A CA   4  
ATOM   5268  C C    . ALA A 1 58  ? -7.918  -1.347  3.808   1.00 0.00 ? 58  ALA A C    4  
ATOM   5269  O O    . ALA A 1 58  ? -6.785  -1.518  3.363   1.00 0.00 ? 58  ALA A O    4  
ATOM   5270  C CB   . ALA A 1 58  ? -9.768  -1.878  2.145   1.00 0.00 ? 58  ALA A CB   4  
ATOM   5271  H H    . ALA A 1 58  ? -8.248  -0.209  1.069   1.00 0.00 ? 58  ALA A H    4  
ATOM   5272  H HA   . ALA A 1 58  ? -9.741  -0.243  3.534   1.00 0.00 ? 58  ALA A HA   4  
ATOM   5273  H HB1  . ALA A 1 58  ? -10.805 -1.917  2.479   1.00 0.00 ? 58  ALA A HB1  4  
ATOM   5274  H HB2  . ALA A 1 58  ? -9.737  -1.658  1.079   1.00 0.00 ? 58  ALA A HB2  4  
ATOM   5275  H HB3  . ALA A 1 58  ? -9.291  -2.840  2.332   1.00 0.00 ? 58  ALA A HB3  4  
ATOM   5276  N N    . ALA A 1 59  ? -8.287  -1.620  5.051   1.00 0.00 ? 59  ALA A N    4  
ATOM   5277  C CA   . ALA A 1 59  ? -7.339  -2.160  6.010   1.00 0.00 ? 59  ALA A CA   4  
ATOM   5278  C C    . ALA A 1 59  ? -7.364  -3.688  5.940   1.00 0.00 ? 59  ALA A C    4  
ATOM   5279  O O    . ALA A 1 59  ? -8.373  -4.312  6.263   1.00 0.00 ? 59  ALA A O    4  
ATOM   5280  C CB   . ALA A 1 59  ? -7.672  -1.635  7.409   1.00 0.00 ? 59  ALA A CB   4  
ATOM   5281  H H    . ALA A 1 59  ? -9.212  -1.477  5.405   1.00 0.00 ? 59  ALA A H    4  
ATOM   5282  H HA   . ALA A 1 59  ? -6.347  -1.807  5.732   1.00 0.00 ? 59  ALA A HA   4  
ATOM   5283  H HB1  . ALA A 1 59  ? -7.062  -2.154  8.147   1.00 0.00 ? 59  ALA A HB1  4  
ATOM   5284  H HB2  . ALA A 1 59  ? -7.469  -0.566  7.454   1.00 0.00 ? 59  ALA A HB2  4  
ATOM   5285  H HB3  . ALA A 1 59  ? -8.727  -1.813  7.621   1.00 0.00 ? 59  ALA A HB3  4  
ATOM   5286  N N    . GLY A 1 60  ? -6.240  -4.247  5.515   1.00 0.00 ? 60  GLY A N    4  
ATOM   5287  C CA   . GLY A 1 60  ? -6.121  -5.690  5.397   1.00 0.00 ? 60  GLY A CA   4  
ATOM   5288  C C    . GLY A 1 60  ? -5.815  -6.100  3.955   1.00 0.00 ? 60  GLY A C    4  
ATOM   5289  O O    . GLY A 1 60  ? -6.004  -7.256  3.582   1.00 0.00 ? 60  GLY A O    4  
ATOM   5290  H H    . GLY A 1 60  ? -5.423  -3.732  5.254   1.00 0.00 ? 60  GLY A H    4  
ATOM   5291  H HA2  . GLY A 1 60  ? -5.328  -6.048  6.056   1.00 0.00 ? 60  GLY A HA2  4  
ATOM   5292  H HA3  . GLY A 1 60  ? -7.045  -6.164  5.726   1.00 0.00 ? 60  GLY A HA3  4  
ATOM   5293  N N    . ASP A 1 61  ? -5.347  -5.129  3.185   1.00 0.00 ? 61  ASP A N    4  
ATOM   5294  C CA   . ASP A 1 61  ? -5.014  -5.374  1.792   1.00 0.00 ? 61  ASP A CA   4  
ATOM   5295  C C    . ASP A 1 61  ? -3.712  -6.174  1.717   1.00 0.00 ? 61  ASP A C    4  
ATOM   5296  O O    . ASP A 1 61  ? -3.040  -6.370  2.728   1.00 0.00 ? 61  ASP A O    4  
ATOM   5297  C CB   . ASP A 1 61  ? -4.805  -4.061  1.036   1.00 0.00 ? 61  ASP A CB   4  
ATOM   5298  C CG   . ASP A 1 61  ? -5.952  -3.055  1.160   1.00 0.00 ? 61  ASP A CG   4  
ATOM   5299  O OD1  . ASP A 1 61  ? -7.105  -3.520  1.282   1.00 0.00 ? 61  ASP A OD1  4  
ATOM   5300  O OD2  . ASP A 1 61  ? -5.650  -1.841  1.128   1.00 0.00 ? 61  ASP A OD2  4  
ATOM   5301  H H    . ASP A 1 61  ? -5.195  -4.192  3.497   1.00 0.00 ? 61  ASP A H    4  
ATOM   5302  H HA   . ASP A 1 61  ? -5.866  -5.922  1.386   1.00 0.00 ? 61  ASP A HA   4  
ATOM   5303  H HB2  . ASP A 1 61  ? -3.891  -3.591  1.397   1.00 0.00 ? 61  ASP A HB2  4  
ATOM   5304  H HB3  . ASP A 1 61  ? -4.652  -4.285  -0.019  1.00 0.00 ? 61  ASP A HB3  4  
ATOM   5305  N N    . GLN A 1 62  ? -3.396  -6.616  0.508   1.00 0.00 ? 62  GLN A N    4  
ATOM   5306  C CA   . GLN A 1 62  ? -2.186  -7.390  0.288   1.00 0.00 ? 62  GLN A CA   4  
ATOM   5307  C C    . GLN A 1 62  ? -1.283  -6.685  -0.726  1.00 0.00 ? 62  GLN A C    4  
ATOM   5308  O O    . GLN A 1 62  ? -1.582  -6.664  -1.920  1.00 0.00 ? 62  GLN A O    4  
ATOM   5309  C CB   . GLN A 1 62  ? -2.520  -8.811  -0.170  1.00 0.00 ? 62  GLN A CB   4  
ATOM   5310  C CG   . GLN A 1 62  ? -1.250  -9.585  -0.528  1.00 0.00 ? 62  GLN A CG   4  
ATOM   5311  C CD   . GLN A 1 62  ? -1.590  -10.954 -1.122  1.00 0.00 ? 62  GLN A CD   4  
ATOM   5312  O OE1  . GLN A 1 62  ? -2.539  -11.115 -1.873  1.00 0.00 ? 62  GLN A OE1  4  
ATOM   5313  N NE2  . GLN A 1 62  ? -0.769  -11.927 -0.741  1.00 0.00 ? 62  GLN A NE2  4  
ATOM   5314  H H    . GLN A 1 62  ? -3.947  -6.451  -0.309  1.00 0.00 ? 62  GLN A H    4  
ATOM   5315  H HA   . GLN A 1 62  ? -1.689  -7.434  1.256   1.00 0.00 ? 62  GLN A HA   4  
ATOM   5316  H HB2  . GLN A 1 62  ? -3.059  -9.333  0.621   1.00 0.00 ? 62  GLN A HB2  4  
ATOM   5317  H HB3  . GLN A 1 62  ? -3.182  -8.771  -1.036  1.00 0.00 ? 62  GLN A HB3  4  
ATOM   5318  H HG2  . GLN A 1 62  ? -0.661  -9.011  -1.244  1.00 0.00 ? 62  GLN A HG2  4  
ATOM   5319  H HG3  . GLN A 1 62  ? -0.636  -9.713  0.362   1.00 0.00 ? 62  GLN A HG3  4  
ATOM   5320  H HE21 . GLN A 1 62  ? -0.010  -11.728 -0.121  1.00 0.00 ? 62  GLN A HE21 4  
ATOM   5321  H HE22 . GLN A 1 62  ? -0.909  -12.859 -1.075  1.00 0.00 ? 62  GLN A HE22 4  
ATOM   5322  N N    . LEU A 1 63  ? -0.195  -6.127  -0.215  1.00 0.00 ? 63  LEU A N    4  
ATOM   5323  C CA   . LEU A 1 63  ? 0.755   -5.424  -1.061  1.00 0.00 ? 63  LEU A CA   4  
ATOM   5324  C C    . LEU A 1 63  ? 1.767   -6.424  -1.626  1.00 0.00 ? 63  LEU A C    4  
ATOM   5325  O O    . LEU A 1 63  ? 2.011   -7.470  -1.026  1.00 0.00 ? 63  LEU A O    4  
ATOM   5326  C CB   . LEU A 1 63  ? 1.397   -4.265  -0.299  1.00 0.00 ? 63  LEU A CB   4  
ATOM   5327  C CG   . LEU A 1 63  ? 2.498   -3.505  -1.036  1.00 0.00 ? 63  LEU A CG   4  
ATOM   5328  C CD1  . LEU A 1 63  ? 1.956   -2.215  -1.655  1.00 0.00 ? 63  LEU A CD1  4  
ATOM   5329  C CD2  . LEU A 1 63  ? 3.693   -3.241  -0.117  1.00 0.00 ? 63  LEU A CD2  4  
ATOM   5330  H H    . LEU A 1 63  ? 0.042   -6.151  0.756   1.00 0.00 ? 63  LEU A H    4  
ATOM   5331  H HA   . LEU A 1 63  ? 0.195   -4.994  -1.891  1.00 0.00 ? 63  LEU A HA   4  
ATOM   5332  H HB2  . LEU A 1 63  ? 0.613   -3.556  -0.027  1.00 0.00 ? 63  LEU A HB2  4  
ATOM   5333  H HB3  . LEU A 1 63  ? 1.811   -4.654  0.634   1.00 0.00 ? 63  LEU A HB3  4  
ATOM   5334  H HG   . LEU A 1 63  ? 2.856   -4.129  -1.856  1.00 0.00 ? 63  LEU A HG   4  
ATOM   5335  H HD11 . LEU A 1 63  ? 0.917   -2.078  -1.356  1.00 0.00 ? 63  LEU A HD11 4  
ATOM   5336  H HD12 . LEU A 1 63  ? 2.549   -1.368  -1.309  1.00 0.00 ? 63  LEU A HD12 4  
ATOM   5337  H HD13 . LEU A 1 63  ? 2.016   -2.279  -2.741  1.00 0.00 ? 63  LEU A HD13 4  
ATOM   5338  H HD21 . LEU A 1 63  ? 4.508   -3.917  -0.375  1.00 0.00 ? 63  LEU A HD21 4  
ATOM   5339  H HD22 . LEU A 1 63  ? 4.026   -2.210  -0.240  1.00 0.00 ? 63  LEU A HD22 4  
ATOM   5340  H HD23 . LEU A 1 63  ? 3.398   -3.405  0.919   1.00 0.00 ? 63  LEU A HD23 4  
ATOM   5341  N N    . LEU A 1 64  ? 2.325   -6.068  -2.773  1.00 0.00 ? 64  LEU A N    4  
ATOM   5342  C CA   . LEU A 1 64  ? 3.304   -6.921  -3.425  1.00 0.00 ? 64  LEU A CA   4  
ATOM   5343  C C    . LEU A 1 64  ? 4.371   -6.048  -4.090  1.00 0.00 ? 64  LEU A C    4  
ATOM   5344  O O    . LEU A 1 64  ? 5.560   -6.352  -4.015  1.00 0.00 ? 64  LEU A O    4  
ATOM   5345  C CB   . LEU A 1 64  ? 2.615   -7.890  -4.388  1.00 0.00 ? 64  LEU A CB   4  
ATOM   5346  C CG   . LEU A 1 64  ? 1.874   -9.061  -3.741  1.00 0.00 ? 64  LEU A CG   4  
ATOM   5347  C CD1  . LEU A 1 64  ? 0.439   -9.160  -4.267  1.00 0.00 ? 64  LEU A CD1  4  
ATOM   5348  C CD2  . LEU A 1 64  ? 2.644   -10.370 -3.930  1.00 0.00 ? 64  LEU A CD2  4  
ATOM   5349  H H    . LEU A 1 64  ? 2.119   -5.216  -3.254  1.00 0.00 ? 64  LEU A H    4  
ATOM   5350  H HA   . LEU A 1 64  ? 3.781   -7.521  -2.650  1.00 0.00 ? 64  LEU A HA   4  
ATOM   5351  H HB2  . LEU A 1 64  ? 1.904   -7.327  -4.993  1.00 0.00 ? 64  LEU A HB2  4  
ATOM   5352  H HB3  . LEU A 1 64  ? 3.366   -8.291  -5.068  1.00 0.00 ? 64  LEU A HB3  4  
ATOM   5353  H HG   . LEU A 1 64  ? 1.811   -8.877  -2.669  1.00 0.00 ? 64  LEU A HG   4  
ATOM   5354  H HD11 . LEU A 1 64  ? 0.429   -8.950  -5.337  1.00 0.00 ? 64  LEU A HD11 4  
ATOM   5355  H HD12 . LEU A 1 64  ? 0.056   -10.167 -4.091  1.00 0.00 ? 64  LEU A HD12 4  
ATOM   5356  H HD13 . LEU A 1 64  ? -0.189  -8.436  -3.748  1.00 0.00 ? 64  LEU A HD13 4  
ATOM   5357  H HD21 . LEU A 1 64  ? 3.625   -10.285 -3.459  1.00 0.00 ? 64  LEU A HD21 4  
ATOM   5358  H HD22 . LEU A 1 64  ? 2.090   -11.188 -3.470  1.00 0.00 ? 64  LEU A HD22 4  
ATOM   5359  H HD23 . LEU A 1 64  ? 2.768   -10.567 -4.996  1.00 0.00 ? 64  LEU A HD23 4  
ATOM   5360  N N    . SER A 1 65  ? 3.906   -4.983  -4.726  1.00 0.00 ? 65  SER A N    4  
ATOM   5361  C CA   . SER A 1 65  ? 4.806   -4.065  -5.404  1.00 0.00 ? 65  SER A CA   4  
ATOM   5362  C C    . SER A 1 65  ? 4.745   -2.687  -4.742  1.00 0.00 ? 65  SER A C    4  
ATOM   5363  O O    . SER A 1 65  ? 3.851   -2.418  -3.941  1.00 0.00 ? 65  SER A O    4  
ATOM   5364  C CB   . SER A 1 65  ? 4.462   -3.954  -6.891  1.00 0.00 ? 65  SER A CB   4  
ATOM   5365  O OG   . SER A 1 65  ? 3.455   -4.887  -7.277  1.00 0.00 ? 65  SER A OG   4  
ATOM   5366  H H    . SER A 1 65  ? 2.937   -4.744  -4.783  1.00 0.00 ? 65  SER A H    4  
ATOM   5367  H HA   . SER A 1 65  ? 5.799   -4.499  -5.292  1.00 0.00 ? 65  SER A HA   4  
ATOM   5368  H HB2  . SER A 1 65  ? 4.121   -2.942  -7.110  1.00 0.00 ? 65  SER A HB2  4  
ATOM   5369  H HB3  . SER A 1 65  ? 5.360   -4.124  -7.484  1.00 0.00 ? 65  SER A HB3  4  
ATOM   5370  H HG   . SER A 1 65  ? 3.266   -4.798  -8.255  1.00 0.00 ? 65  SER A HG   4  
ATOM   5371  N N    . VAL A 1 66  ? 5.707   -1.850  -5.099  1.00 0.00 ? 66  VAL A N    4  
ATOM   5372  C CA   . VAL A 1 66  ? 5.774   -0.507  -4.550  1.00 0.00 ? 66  VAL A CA   4  
ATOM   5373  C C    . VAL A 1 66  ? 5.907   0.501   -5.692  1.00 0.00 ? 66  VAL A C    4  
ATOM   5374  O O    . VAL A 1 66  ? 6.202   0.124   -6.825  1.00 0.00 ? 66  VAL A O    4  
ATOM   5375  C CB   . VAL A 1 66  ? 6.916   -0.414  -3.535  1.00 0.00 ? 66  VAL A CB   4  
ATOM   5376  C CG1  . VAL A 1 66  ? 8.275   -0.562  -4.222  1.00 0.00 ? 66  VAL A CG1  4  
ATOM   5377  C CG2  . VAL A 1 66  ? 6.841   0.895   -2.745  1.00 0.00 ? 66  VAL A CG2  4  
ATOM   5378  H H    . VAL A 1 66  ? 6.431   -2.076  -5.753  1.00 0.00 ? 66  VAL A H    4  
ATOM   5379  H HA   . VAL A 1 66  ? 4.838   -0.320  -4.024  1.00 0.00 ? 66  VAL A HA   4  
ATOM   5380  H HB   . VAL A 1 66  ? 6.805   -1.237  -2.829  1.00 0.00 ? 66  VAL A HB   4  
ATOM   5381  H HG11 . VAL A 1 66  ? 8.188   -0.260  -5.265  1.00 0.00 ? 66  VAL A HG11 4  
ATOM   5382  H HG12 . VAL A 1 66  ? 9.008   0.070   -3.720  1.00 0.00 ? 66  VAL A HG12 4  
ATOM   5383  H HG13 . VAL A 1 66  ? 8.596   -1.602  -4.171  1.00 0.00 ? 66  VAL A HG13 4  
ATOM   5384  H HG21 . VAL A 1 66  ? 5.796   1.171   -2.601  1.00 0.00 ? 66  VAL A HG21 4  
ATOM   5385  H HG22 . VAL A 1 66  ? 7.317   0.760   -1.773  1.00 0.00 ? 66  VAL A HG22 4  
ATOM   5386  H HG23 . VAL A 1 66  ? 7.354   1.682   -3.295  1.00 0.00 ? 66  VAL A HG23 4  
ATOM   5387  N N    . ASP A 1 67  ? 5.682   1.762   -5.355  1.00 0.00 ? 67  ASP A N    4  
ATOM   5388  C CA   . ASP A 1 67  ? 5.774   2.829   -6.340  1.00 0.00 ? 67  ASP A CA   4  
ATOM   5389  C C    . ASP A 1 67  ? 7.241   3.044   -6.716  1.00 0.00 ? 67  ASP A C    4  
ATOM   5390  O O    . ASP A 1 67  ? 8.089   3.232   -5.844  1.00 0.00 ? 67  ASP A O    4  
ATOM   5391  C CB   . ASP A 1 67  ? 5.230   4.143   -5.779  1.00 0.00 ? 67  ASP A CB   4  
ATOM   5392  C CG   . ASP A 1 67  ? 6.220   4.941   -4.926  1.00 0.00 ? 67  ASP A CG   4  
ATOM   5393  O OD1  . ASP A 1 67  ? 6.489   4.483   -3.793  1.00 0.00 ? 67  ASP A OD1  4  
ATOM   5394  O OD2  . ASP A 1 67  ? 6.684   5.989   -5.423  1.00 0.00 ? 67  ASP A OD2  4  
ATOM   5395  H H    . ASP A 1 67  ? 5.443   2.060   -4.431  1.00 0.00 ? 67  ASP A H    4  
ATOM   5396  H HA   . ASP A 1 67  ? 5.171   2.491   -7.183  1.00 0.00 ? 67  ASP A HA   4  
ATOM   5397  H HB2  . ASP A 1 67  ? 4.906   4.769   -6.610  1.00 0.00 ? 67  ASP A HB2  4  
ATOM   5398  H HB3  . ASP A 1 67  ? 4.347   3.928   -5.177  1.00 0.00 ? 67  ASP A HB3  4  
ATOM   5399  N N    . GLY A 1 68  ? 7.496   3.012   -8.016  1.00 0.00 ? 68  GLY A N    4  
ATOM   5400  C CA   . GLY A 1 68  ? 8.845   3.202   -8.519  1.00 0.00 ? 68  GLY A CA   4  
ATOM   5401  C C    . GLY A 1 68  ? 9.593   1.870   -8.599  1.00 0.00 ? 68  GLY A C    4  
ATOM   5402  O O    . GLY A 1 68  ? 10.622  1.772   -9.266  1.00 0.00 ? 68  GLY A O    4  
ATOM   5403  H H    . GLY A 1 68  ? 6.801   2.858   -8.718  1.00 0.00 ? 68  GLY A H    4  
ATOM   5404  H HA2  . GLY A 1 68  ? 8.809   3.662   -9.505  1.00 0.00 ? 68  GLY A HA2  4  
ATOM   5405  H HA3  . GLY A 1 68  ? 9.388   3.888   -7.867  1.00 0.00 ? 68  GLY A HA3  4  
ATOM   5406  N N    . ARG A 1 69  ? 9.048   0.878   -7.911  1.00 0.00 ? 69  ARG A N    4  
ATOM   5407  C CA   . ARG A 1 69  ? 9.650   -0.443  -7.897  1.00 0.00 ? 69  ARG A CA   4  
ATOM   5408  C C    . ARG A 1 69  ? 8.564   -1.522  -7.834  1.00 0.00 ? 69  ARG A C    4  
ATOM   5409  O O    . ARG A 1 69  ? 7.810   -1.591  -6.865  1.00 0.00 ? 69  ARG A O    4  
ATOM   5410  C CB   . ARG A 1 69  ? 10.592  -0.607  -6.701  1.00 0.00 ? 69  ARG A CB   4  
ATOM   5411  C CG   . ARG A 1 69  ? 11.552  0.579   -6.594  1.00 0.00 ? 69  ARG A CG   4  
ATOM   5412  C CD   . ARG A 1 69  ? 10.885  1.764   -5.895  1.00 0.00 ? 69  ARG A CD   4  
ATOM   5413  N NE   . ARG A 1 69  ? 11.248  3.026   -6.579  1.00 0.00 ? 69  ARG A NE   4  
ATOM   5414  C CZ   . ARG A 1 69  ? 10.952  4.245   -6.111  1.00 0.00 ? 69  ARG A CZ   4  
ATOM   5415  N NH1  . ARG A 1 69  ? 10.288  4.378   -4.955  1.00 0.00 ? 69  ARG A NH1  4  
ATOM   5416  N NH2  . ARG A 1 69  ? 11.322  5.335   -6.800  1.00 0.00 ? 69  ARG A NH2  4  
ATOM   5417  H H    . ARG A 1 69  ? 8.210   0.966   -7.371  1.00 0.00 ? 69  ARG A H    4  
ATOM   5418  H HA   . ARG A 1 69  ? 10.210  -0.505  -8.830  1.00 0.00 ? 69  ARG A HA   4  
ATOM   5419  H HB2  . ARG A 1 69  ? 10.009  -0.690  -5.784  1.00 0.00 ? 69  ARG A HB2  4  
ATOM   5420  H HB3  . ARG A 1 69  ? 11.159  -1.531  -6.805  1.00 0.00 ? 69  ARG A HB3  4  
ATOM   5421  H HG2  . ARG A 1 69  ? 12.444  0.280   -6.043  1.00 0.00 ? 69  ARG A HG2  4  
ATOM   5422  H HG3  . ARG A 1 69  ? 11.880  0.877   -7.591  1.00 0.00 ? 69  ARG A HG3  4  
ATOM   5423  H HD2  . ARG A 1 69  ? 9.803   1.637   -5.899  1.00 0.00 ? 69  ARG A HD2  4  
ATOM   5424  H HD3  . ARG A 1 69  ? 11.196  1.804   -4.852  1.00 0.00 ? 69  ARG A HD3  4  
ATOM   5425  H HE   . ARG A 1 69  ? 11.745  2.964   -7.444  1.00 0.00 ? 69  ARG A HE   4  
ATOM   5426  H HH11 . ARG A 1 69  ? 10.013  3.566   -4.442  1.00 0.00 ? 69  ARG A HH11 4  
ATOM   5427  H HH12 . ARG A 1 69  ? 10.066  5.289   -4.607  1.00 0.00 ? 69  ARG A HH12 4  
ATOM   5428  H HH21 . ARG A 1 69  ? 11.818  5.237   -7.662  1.00 0.00 ? 69  ARG A HH21 4  
ATOM   5429  H HH22 . ARG A 1 69  ? 11.101  6.246   -6.451  1.00 0.00 ? 69  ARG A HH22 4  
ATOM   5430  N N    . SER A 1 70  ? 8.523   -2.335  -8.879  1.00 0.00 ? 70  SER A N    4  
ATOM   5431  C CA   . SER A 1 70  ? 7.543   -3.405  -8.954  1.00 0.00 ? 70  SER A CA   4  
ATOM   5432  C C    . SER A 1 70  ? 8.062   -4.641  -8.218  1.00 0.00 ? 70  SER A C    4  
ATOM   5433  O O    . SER A 1 70  ? 8.598   -5.558  -8.837  1.00 0.00 ? 70  SER A O    4  
ATOM   5434  C CB   . SER A 1 70  ? 7.218   -3.752  -10.408 1.00 0.00 ? 70  SER A CB   4  
ATOM   5435  O OG   . SER A 1 70  ? 6.215   -2.895  -10.949 1.00 0.00 ? 70  SER A OG   4  
ATOM   5436  H H    . SER A 1 70  ? 9.141   -2.271  -9.662  1.00 0.00 ? 70  SER A H    4  
ATOM   5437  H HA   . SER A 1 70  ? 6.652   -3.014  -8.466  1.00 0.00 ? 70  SER A HA   4  
ATOM   5438  H HB2  . SER A 1 70  ? 8.122   -3.676  -11.010 1.00 0.00 ? 70  SER A HB2  4  
ATOM   5439  H HB3  . SER A 1 70  ? 6.880   -4.786  -10.467 1.00 0.00 ? 70  SER A HB3  4  
ATOM   5440  H HG   . SER A 1 70  ? 5.433   -2.848  -10.329 1.00 0.00 ? 70  SER A HG   4  
ATOM   5441  N N    . LEU A 1 71  ? 7.882   -4.626  -6.904  1.00 0.00 ? 71  LEU A N    4  
ATOM   5442  C CA   . LEU A 1 71  ? 8.325   -5.734  -6.077  1.00 0.00 ? 71  LEU A CA   4  
ATOM   5443  C C    . LEU A 1 71  ? 7.643   -7.022  -6.546  1.00 0.00 ? 71  LEU A C    4  
ATOM   5444  O O    . LEU A 1 71  ? 8.310   -8.016  -6.829  1.00 0.00 ? 71  LEU A O    4  
ATOM   5445  C CB   . LEU A 1 71  ? 8.099   -5.424  -4.597  1.00 0.00 ? 71  LEU A CB   4  
ATOM   5446  C CG   . LEU A 1 71  ? 8.567   -4.047  -4.122  1.00 0.00 ? 71  LEU A CG   4  
ATOM   5447  C CD1  . LEU A 1 71  ? 7.618   -3.478  -3.065  1.00 0.00 ? 71  LEU A CD1  4  
ATOM   5448  C CD2  . LEU A 1 71  ? 10.012  -4.102  -3.622  1.00 0.00 ? 71  LEU A CD2  4  
ATOM   5449  H H    . LEU A 1 71  ? 7.446   -3.877  -6.409  1.00 0.00 ? 71  LEU A H    4  
ATOM   5450  H HA   . LEU A 1 71  ? 9.401   -5.842  -6.222  1.00 0.00 ? 71  LEU A HA   4  
ATOM   5451  H HB2  . LEU A 1 71  ? 7.033   -5.516  -4.386  1.00 0.00 ? 71  LEU A HB2  4  
ATOM   5452  H HB3  . LEU A 1 71  ? 8.606   -6.183  -4.003  1.00 0.00 ? 71  LEU A HB3  4  
ATOM   5453  H HG   . LEU A 1 71  ? 8.547   -3.367  -4.973  1.00 0.00 ? 71  LEU A HG   4  
ATOM   5454  H HD11 . LEU A 1 71  ? 7.302   -4.276  -2.394  1.00 0.00 ? 71  LEU A HD11 4  
ATOM   5455  H HD12 . LEU A 1 71  ? 8.129   -2.703  -2.496  1.00 0.00 ? 71  LEU A HD12 4  
ATOM   5456  H HD13 . LEU A 1 71  ? 6.744   -3.050  -3.557  1.00 0.00 ? 71  LEU A HD13 4  
ATOM   5457  H HD21 . LEU A 1 71  ? 10.018  -4.232  -2.539  1.00 0.00 ? 71  LEU A HD21 4  
ATOM   5458  H HD22 . LEU A 1 71  ? 10.527  -4.940  -4.092  1.00 0.00 ? 71  LEU A HD22 4  
ATOM   5459  H HD23 . LEU A 1 71  ? 10.521  -3.174  -3.877  1.00 0.00 ? 71  LEU A HD23 4  
ATOM   5460  N N    . VAL A 1 72  ? 6.321   -6.960  -6.614  1.00 0.00 ? 72  VAL A N    4  
ATOM   5461  C CA   . VAL A 1 72  ? 5.542   -8.108  -7.044  1.00 0.00 ? 72  VAL A CA   4  
ATOM   5462  C C    . VAL A 1 72  ? 5.365   -9.072  -5.868  1.00 0.00 ? 72  VAL A C    4  
ATOM   5463  O O    . VAL A 1 72  ? 4.640   -10.059 -5.973  1.00 0.00 ? 72  VAL A O    4  
ATOM   5464  C CB   . VAL A 1 72  ? 6.199   -8.764  -8.260  1.00 0.00 ? 72  VAL A CB   4  
ATOM   5465  C CG1  . VAL A 1 72  ? 6.952   -7.729  -9.100  1.00 0.00 ? 72  VAL A CG1  4  
ATOM   5466  C CG2  . VAL A 1 72  ? 7.126   -9.903  -7.832  1.00 0.00 ? 72  VAL A CG2  4  
ATOM   5467  H H    . VAL A 1 72  ? 5.785   -6.149  -6.382  1.00 0.00 ? 72  VAL A H    4  
ATOM   5468  H HA   . VAL A 1 72  ? 4.560   -7.742  -7.349  1.00 0.00 ? 72  VAL A HA   4  
ATOM   5469  H HB   . VAL A 1 72  ? 5.410   -9.188  -8.882  1.00 0.00 ? 72  VAL A HB   4  
ATOM   5470  H HG11 . VAL A 1 72  ? 6.700   -7.863  -10.152 1.00 0.00 ? 72  VAL A HG11 4  
ATOM   5471  H HG12 . VAL A 1 72  ? 6.665   -6.726  -8.783  1.00 0.00 ? 72  VAL A HG12 4  
ATOM   5472  H HG13 . VAL A 1 72  ? 8.025   -7.862  -8.962  1.00 0.00 ? 72  VAL A HG13 4  
ATOM   5473  H HG21 . VAL A 1 72  ? 6.681   -10.858 -8.112  1.00 0.00 ? 72  VAL A HG21 4  
ATOM   5474  H HG22 . VAL A 1 72  ? 8.091   -9.792  -8.330  1.00 0.00 ? 72  VAL A HG22 4  
ATOM   5475  H HG23 . VAL A 1 72  ? 7.269   -9.870  -6.753  1.00 0.00 ? 72  VAL A HG23 4  
ATOM   5476  N N    . GLY A 1 73  ? 6.041   -8.747  -4.775  1.00 0.00 ? 73  GLY A N    4  
ATOM   5477  C CA   . GLY A 1 73  ? 5.969   -9.570  -3.580  1.00 0.00 ? 73  GLY A CA   4  
ATOM   5478  C C    . GLY A 1 73  ? 7.314   -9.600  -2.853  1.00 0.00 ? 73  GLY A C    4  
ATOM   5479  O O    . GLY A 1 73  ? 7.869   -10.671 -2.611  1.00 0.00 ? 73  GLY A O    4  
ATOM   5480  H H    . GLY A 1 73  ? 6.627   -7.941  -4.697  1.00 0.00 ? 73  GLY A H    4  
ATOM   5481  H HA2  . GLY A 1 73  ? 5.199   -9.183  -2.913  1.00 0.00 ? 73  GLY A HA2  4  
ATOM   5482  H HA3  . GLY A 1 73  ? 5.675   -10.585 -3.849  1.00 0.00 ? 73  GLY A HA3  4  
ATOM   5483  N N    . LEU A 1 74  ? 7.801   -8.412  -2.526  1.00 0.00 ? 74  LEU A N    4  
ATOM   5484  C CA   . LEU A 1 74  ? 9.071   -8.289  -1.830  1.00 0.00 ? 74  LEU A CA   4  
ATOM   5485  C C    . LEU A 1 74  ? 8.838   -7.655  -0.459  1.00 0.00 ? 74  LEU A C    4  
ATOM   5486  O O    . LEU A 1 74  ? 7.724   -7.234  -0.146  1.00 0.00 ? 74  LEU A O    4  
ATOM   5487  C CB   . LEU A 1 74  ? 10.082  -7.532  -2.694  1.00 0.00 ? 74  LEU A CB   4  
ATOM   5488  C CG   . LEU A 1 74  ? 10.257  -8.042  -4.126  1.00 0.00 ? 74  LEU A CG   4  
ATOM   5489  C CD1  . LEU A 1 74  ? 11.426  -7.343  -4.819  1.00 0.00 ? 74  LEU A CD1  4  
ATOM   5490  C CD2  . LEU A 1 74  ? 10.402  -9.563  -4.152  1.00 0.00 ? 74  LEU A CD2  4  
ATOM   5491  H H    . LEU A 1 74  ? 7.342   -7.547  -2.727  1.00 0.00 ? 74  LEU A H    4  
ATOM   5492  H HA   . LEU A 1 74  ? 9.461   -9.296  -1.684  1.00 0.00 ? 74  LEU A HA   4  
ATOM   5493  H HB2  . LEU A 1 74  ? 9.781   -6.485  -2.736  1.00 0.00 ? 74  LEU A HB2  4  
ATOM   5494  H HB3  . LEU A 1 74  ? 11.051  -7.566  -2.198  1.00 0.00 ? 74  LEU A HB3  4  
ATOM   5495  H HG   . LEU A 1 74  ? 9.356   -7.795  -4.688  1.00 0.00 ? 74  LEU A HG   4  
ATOM   5496  H HD11 . LEU A 1 74  ? 12.143  -8.087  -5.165  1.00 0.00 ? 74  LEU A HD11 4  
ATOM   5497  H HD12 . LEU A 1 74  ? 11.057  -6.771  -5.670  1.00 0.00 ? 74  LEU A HD12 4  
ATOM   5498  H HD13 . LEU A 1 74  ? 11.916  -6.668  -4.114  1.00 0.00 ? 74  LEU A HD13 4  
ATOM   5499  H HD21 . LEU A 1 74  ? 9.417   -10.021 -4.239  1.00 0.00 ? 74  LEU A HD21 4  
ATOM   5500  H HD22 . LEU A 1 74  ? 11.014  -9.857  -5.006  1.00 0.00 ? 74  LEU A HD22 4  
ATOM   5501  H HD23 . LEU A 1 74  ? 10.879  -9.899  -3.231  1.00 0.00 ? 74  LEU A HD23 4  
ATOM   5502  N N    . SER A 1 75  ? 9.905   -7.607  0.325   1.00 0.00 ? 75  SER A N    4  
ATOM   5503  C CA   . SER A 1 75  ? 9.830   -7.031  1.658   1.00 0.00 ? 75  SER A CA   4  
ATOM   5504  C C    . SER A 1 75  ? 9.686   -5.510  1.563   1.00 0.00 ? 75  SER A C    4  
ATOM   5505  O O    . SER A 1 75  ? 10.214  -4.890  0.641   1.00 0.00 ? 75  SER A O    4  
ATOM   5506  C CB   . SER A 1 75  ? 11.062  -7.397  2.486   1.00 0.00 ? 75  SER A CB   4  
ATOM   5507  O OG   . SER A 1 75  ? 10.985  -8.723  3.002   1.00 0.00 ? 75  SER A OG   4  
ATOM   5508  H H    . SER A 1 75  ? 10.806  -7.951  0.064   1.00 0.00 ? 75  SER A H    4  
ATOM   5509  H HA   . SER A 1 75  ? 8.944   -7.472  2.114   1.00 0.00 ? 75  SER A HA   4  
ATOM   5510  H HB2  . SER A 1 75  ? 11.956  -7.300  1.869   1.00 0.00 ? 75  SER A HB2  4  
ATOM   5511  H HB3  . SER A 1 75  ? 11.168  -6.692  3.311   1.00 0.00 ? 75  SER A HB3  4  
ATOM   5512  H HG   . SER A 1 75  ? 11.120  -8.714  3.992   1.00 0.00 ? 75  SER A HG   4  
ATOM   5513  N N    . GLN A 1 76  ? 8.968   -4.956  2.529   1.00 0.00 ? 76  GLN A N    4  
ATOM   5514  C CA   . GLN A 1 76  ? 8.748   -3.521  2.566   1.00 0.00 ? 76  GLN A CA   4  
ATOM   5515  C C    . GLN A 1 76  ? 10.066  -2.787  2.820   1.00 0.00 ? 76  GLN A C    4  
ATOM   5516  O O    . GLN A 1 76  ? 10.133  -1.564  2.708   1.00 0.00 ? 76  GLN A O    4  
ATOM   5517  C CB   . GLN A 1 76  ? 7.704   -3.152  3.622   1.00 0.00 ? 76  GLN A CB   4  
ATOM   5518  C CG   . GLN A 1 76  ? 8.341   -3.042  5.009   1.00 0.00 ? 76  GLN A CG   4  
ATOM   5519  C CD   . GLN A 1 76  ? 8.533   -4.424  5.635   1.00 0.00 ? 76  GLN A CD   4  
ATOM   5520  O OE1  . GLN A 1 76  ? 7.628   -5.003  6.215   1.00 0.00 ? 76  GLN A OE1  4  
ATOM   5521  N NE2  . GLN A 1 76  ? 9.758   -4.920  5.488   1.00 0.00 ? 76  GLN A NE2  4  
ATOM   5522  H H    . GLN A 1 76  ? 8.541   -5.468  3.274   1.00 0.00 ? 76  GLN A H    4  
ATOM   5523  H HA   . GLN A 1 76  ? 8.364   -3.259  1.579   1.00 0.00 ? 76  GLN A HA   4  
ATOM   5524  H HB2  . GLN A 1 76  ? 7.231   -2.206  3.359   1.00 0.00 ? 76  GLN A HB2  4  
ATOM   5525  H HB3  . GLN A 1 76  ? 6.916   -3.907  3.639   1.00 0.00 ? 76  GLN A HB3  4  
ATOM   5526  H HG2  . GLN A 1 76  ? 9.304   -2.538  4.930   1.00 0.00 ? 76  GLN A HG2  4  
ATOM   5527  H HG3  . GLN A 1 76  ? 7.712   -2.430  5.654   1.00 0.00 ? 76  GLN A HG3  4  
ATOM   5528  H HE21 . GLN A 1 76  ? 10.455  -4.393  5.002   1.00 0.00 ? 76  GLN A HE21 4  
ATOM   5529  H HE22 . GLN A 1 76  ? 9.983   -5.820  5.864   1.00 0.00 ? 76  GLN A HE22 4  
ATOM   5530  N N    . GLU A 1 77  ? 11.084  -3.566  3.159   1.00 0.00 ? 77  GLU A N    4  
ATOM   5531  C CA   . GLU A 1 77  ? 12.396  -3.005  3.431   1.00 0.00 ? 77  GLU A CA   4  
ATOM   5532  C C    . GLU A 1 77  ? 12.747  -1.944  2.387   1.00 0.00 ? 77  GLU A C    4  
ATOM   5533  O O    . GLU A 1 77  ? 12.680  -0.748  2.666   1.00 0.00 ? 77  GLU A O    4  
ATOM   5534  C CB   . GLU A 1 77  ? 13.462  -4.104  3.476   1.00 0.00 ? 77  GLU A CB   4  
ATOM   5535  C CG   . GLU A 1 77  ? 13.207  -5.068  4.635   1.00 0.00 ? 77  GLU A CG   4  
ATOM   5536  C CD   . GLU A 1 77  ? 14.281  -6.156  4.691   1.00 0.00 ? 77  GLU A CD   4  
ATOM   5537  O OE1  . GLU A 1 77  ? 14.153  -7.121  3.908   1.00 0.00 ? 77  GLU A OE1  4  
ATOM   5538  O OE2  . GLU A 1 77  ? 15.208  -5.995  5.515   1.00 0.00 ? 77  GLU A OE2  4  
ATOM   5539  H H    . GLU A 1 77  ? 11.021  -4.560  3.249   1.00 0.00 ? 77  GLU A H    4  
ATOM   5540  H HA   . GLU A 1 77  ? 12.316  -2.544  4.415   1.00 0.00 ? 77  GLU A HA   4  
ATOM   5541  H HB2  . GLU A 1 77  ? 13.462  -4.653  2.535   1.00 0.00 ? 77  GLU A HB2  4  
ATOM   5542  H HB3  . GLU A 1 77  ? 14.448  -3.653  3.583   1.00 0.00 ? 77  GLU A HB3  4  
ATOM   5543  H HG2  . GLU A 1 77  ? 13.193  -4.516  5.576   1.00 0.00 ? 77  GLU A HG2  4  
ATOM   5544  H HG3  . GLU A 1 77  ? 12.225  -5.528  4.522   1.00 0.00 ? 77  GLU A HG3  4  
ATOM   5545  N N    . ARG A 1 78  ? 13.113  -2.419  1.206   1.00 0.00 ? 78  ARG A N    4  
ATOM   5546  C CA   . ARG A 1 78  ? 13.475  -1.525  0.118   1.00 0.00 ? 78  ARG A CA   4  
ATOM   5547  C C    . ARG A 1 78  ? 12.394  -0.460  -0.075  1.00 0.00 ? 78  ARG A C    4  
ATOM   5548  O O    . ARG A 1 78  ? 12.642  0.727   0.129   1.00 0.00 ? 78  ARG A O    4  
ATOM   5549  C CB   . ARG A 1 78  ? 13.661  -2.296  -1.190  1.00 0.00 ? 78  ARG A CB   4  
ATOM   5550  C CG   . ARG A 1 78  ? 14.707  -3.401  -1.031  1.00 0.00 ? 78  ARG A CG   4  
ATOM   5551  C CD   . ARG A 1 78  ? 14.138  -4.760  -1.446  1.00 0.00 ? 78  ARG A CD   4  
ATOM   5552  N NE   . ARG A 1 78  ? 15.229  -5.753  -1.560  1.00 0.00 ? 78  ARG A NE   4  
ATOM   5553  C CZ   . ARG A 1 78  ? 15.853  -6.307  -0.512  1.00 0.00 ? 78  ARG A CZ   4  
ATOM   5554  N NH1  . ARG A 1 78  ? 15.497  -5.970  0.734   1.00 0.00 ? 78  ARG A NH1  4  
ATOM   5555  N NH2  . ARG A 1 78  ? 16.832  -7.200  -0.710  1.00 0.00 ? 78  ARG A NH2  4  
ATOM   5556  H H    . ARG A 1 78  ? 13.167  -3.393  0.987   1.00 0.00 ? 78  ARG A H    4  
ATOM   5557  H HA   . ARG A 1 78  ? 14.417  -1.076  0.430   1.00 0.00 ? 78  ARG A HA   4  
ATOM   5558  H HB2  . ARG A 1 78  ? 12.710  -2.732  -1.497  1.00 0.00 ? 78  ARG A HB2  4  
ATOM   5559  H HB3  . ARG A 1 78  ? 13.968  -1.611  -1.981  1.00 0.00 ? 78  ARG A HB3  4  
ATOM   5560  H HG2  . ARG A 1 78  ? 15.582  -3.169  -1.638  1.00 0.00 ? 78  ARG A HG2  4  
ATOM   5561  H HG3  . ARG A 1 78  ? 15.042  -3.443  0.005   1.00 0.00 ? 78  ARG A HG3  4  
ATOM   5562  H HD2  . ARG A 1 78  ? 13.405  -5.095  -0.712  1.00 0.00 ? 78  ARG A HD2  4  
ATOM   5563  H HD3  . ARG A 1 78  ? 13.617  -4.668  -2.399  1.00 0.00 ? 78  ARG A HD3  4  
ATOM   5564  H HE   . ARG A 1 78  ? 15.520  -6.026  -2.476  1.00 0.00 ? 78  ARG A HE   4  
ATOM   5565  H HH11 . ARG A 1 78  ? 14.766  -5.304  0.882   1.00 0.00 ? 78  ARG A HH11 4  
ATOM   5566  H HH12 . ARG A 1 78  ? 15.962  -6.383  1.518   1.00 0.00 ? 78  ARG A HH12 4  
ATOM   5567  H HH21 . ARG A 1 78  ? 17.099  -7.451  -1.639  1.00 0.00 ? 78  ARG A HH21 4  
ATOM   5568  H HH22 . ARG A 1 78  ? 17.299  -7.614  0.072   1.00 0.00 ? 78  ARG A HH22 4  
ATOM   5569  N N    . ALA A 1 79  ? 11.216  -0.923  -0.465  1.00 0.00 ? 79  ALA A N    4  
ATOM   5570  C CA   . ALA A 1 79  ? 10.095  -0.026  -0.689  1.00 0.00 ? 79  ALA A CA   4  
ATOM   5571  C C    . ALA A 1 79  ? 9.996   0.960   0.478   1.00 0.00 ? 79  ALA A C    4  
ATOM   5572  O O    . ALA A 1 79  ? 10.549  2.057   0.417   1.00 0.00 ? 79  ALA A O    4  
ATOM   5573  C CB   . ALA A 1 79  ? 8.815   -0.842  -0.872  1.00 0.00 ? 79  ALA A CB   4  
ATOM   5574  H H    . ALA A 1 79  ? 11.021  -1.891  -0.630  1.00 0.00 ? 79  ALA A H    4  
ATOM   5575  H HA   . ALA A 1 79  ? 10.292  0.529   -1.606  1.00 0.00 ? 79  ALA A HA   4  
ATOM   5576  H HB1  . ALA A 1 79  ? 8.013   -0.399  -0.279  1.00 0.00 ? 79  ALA A HB1  4  
ATOM   5577  H HB2  . ALA A 1 79  ? 8.531   -0.840  -1.924  1.00 0.00 ? 79  ALA A HB2  4  
ATOM   5578  H HB3  . ALA A 1 79  ? 8.987   -1.867  -0.544  1.00 0.00 ? 79  ALA A HB3  4  
ATOM   5579  N N    . ALA A 1 80  ? 9.290   0.532   1.513   1.00 0.00 ? 80  ALA A N    4  
ATOM   5580  C CA   . ALA A 1 80  ? 9.112   1.363   2.694   1.00 0.00 ? 80  ALA A CA   4  
ATOM   5581  C C    . ALA A 1 80  ? 9.851   2.687   2.495   1.00 0.00 ? 80  ALA A C    4  
ATOM   5582  O O    . ALA A 1 80  ? 9.262   3.673   2.056   1.00 0.00 ? 80  ALA A O    4  
ATOM   5583  C CB   . ALA A 1 80  ? 9.596   0.603   3.931   1.00 0.00 ? 80  ALA A CB   4  
ATOM   5584  H H    . ALA A 1 80  ? 8.842   -0.362  1.556   1.00 0.00 ? 80  ALA A H    4  
ATOM   5585  H HA   . ALA A 1 80  ? 8.046   1.563   2.800   1.00 0.00 ? 80  ALA A HA   4  
ATOM   5586  H HB1  . ALA A 1 80  ? 9.524   1.251   4.805   1.00 0.00 ? 80  ALA A HB1  4  
ATOM   5587  H HB2  . ALA A 1 80  ? 8.975   -0.279  4.081   1.00 0.00 ? 80  ALA A HB2  4  
ATOM   5588  H HB3  . ALA A 1 80  ? 10.633  0.299   3.787   1.00 0.00 ? 80  ALA A HB3  4  
ATOM   5589  N N    . GLU A 1 81  ? 11.134  2.667   2.828   1.00 0.00 ? 81  GLU A N    4  
ATOM   5590  C CA   . GLU A 1 81  ? 11.961  3.853   2.692   1.00 0.00 ? 81  GLU A CA   4  
ATOM   5591  C C    . GLU A 1 81  ? 11.669  4.556   1.365   1.00 0.00 ? 81  GLU A C    4  
ATOM   5592  O O    . GLU A 1 81  ? 11.141  5.667   1.349   1.00 0.00 ? 81  GLU A O    4  
ATOM   5593  C CB   . GLU A 1 81  ? 13.446  3.505   2.812   1.00 0.00 ? 81  GLU A CB   4  
ATOM   5594  C CG   . GLU A 1 81  ? 14.309  4.768   2.811   1.00 0.00 ? 81  GLU A CG   4  
ATOM   5595  C CD   . GLU A 1 81  ? 15.591  4.556   3.620   1.00 0.00 ? 81  GLU A CD   4  
ATOM   5596  O OE1  . GLU A 1 81  ? 15.473  4.483   4.863   1.00 0.00 ? 81  GLU A OE1  4  
ATOM   5597  O OE2  . GLU A 1 81  ? 16.659  4.474   2.978   1.00 0.00 ? 81  GLU A OE2  4  
ATOM   5598  H H    . GLU A 1 81  ? 11.606  1.862   3.184   1.00 0.00 ? 81  GLU A H    4  
ATOM   5599  H HA   . GLU A 1 81  ? 11.679  4.500   3.522   1.00 0.00 ? 81  GLU A HA   4  
ATOM   5600  H HB2  . GLU A 1 81  ? 13.618  2.942   3.728   1.00 0.00 ? 81  GLU A HB2  4  
ATOM   5601  H HB3  . GLU A 1 81  ? 13.739  2.860   1.982   1.00 0.00 ? 81  GLU A HB3  4  
ATOM   5602  H HG2  . GLU A 1 81  ? 14.561  5.040   1.787   1.00 0.00 ? 81  GLU A HG2  4  
ATOM   5603  H HG3  . GLU A 1 81  ? 13.741  5.600   3.233   1.00 0.00 ? 81  GLU A HG3  4  
ATOM   5604  N N    . LEU A 1 82  ? 12.025  3.879   0.282   1.00 0.00 ? 82  LEU A N    4  
ATOM   5605  C CA   . LEU A 1 82  ? 11.806  4.425   -1.047  1.00 0.00 ? 82  LEU A CA   4  
ATOM   5606  C C    . LEU A 1 82  ? 10.309  4.406   -1.362  1.00 0.00 ? 82  LEU A C    4  
ATOM   5607  O O    . LEU A 1 82  ? 9.909   4.611   -2.507  1.00 0.00 ? 82  LEU A O    4  
ATOM   5608  C CB   . LEU A 1 82  ? 12.661  3.682   -2.077  1.00 0.00 ? 82  LEU A CB   4  
ATOM   5609  C CG   . LEU A 1 82  ? 13.456  4.559   -3.046  1.00 0.00 ? 82  LEU A CG   4  
ATOM   5610  C CD1  . LEU A 1 82  ? 12.604  5.723   -3.557  1.00 0.00 ? 82  LEU A CD1  4  
ATOM   5611  C CD2  . LEU A 1 82  ? 14.759  5.041   -2.405  1.00 0.00 ? 82  LEU A CD2  4  
ATOM   5612  H H    . LEU A 1 82  ? 12.453  2.976   0.303   1.00 0.00 ? 82  LEU A H    4  
ATOM   5613  H HA   . LEU A 1 82  ? 12.143  5.460   -1.035  1.00 0.00 ? 82  LEU A HA   4  
ATOM   5614  H HB2  . LEU A 1 82  ? 13.360  3.038   -1.543  1.00 0.00 ? 82  LEU A HB2  4  
ATOM   5615  H HB3  . LEU A 1 82  ? 12.009  3.032   -2.659  1.00 0.00 ? 82  LEU A HB3  4  
ATOM   5616  H HG   . LEU A 1 82  ? 13.725  3.955   -3.911  1.00 0.00 ? 82  LEU A HG   4  
ATOM   5617  H HD11 . LEU A 1 82  ? 13.162  6.653   -3.453  1.00 0.00 ? 82  LEU A HD11 4  
ATOM   5618  H HD12 . LEU A 1 82  ? 12.361  5.562   -4.607  1.00 0.00 ? 82  LEU A HD12 4  
ATOM   5619  H HD13 . LEU A 1 82  ? 11.684  5.784   -2.975  1.00 0.00 ? 82  LEU A HD13 4  
ATOM   5620  H HD21 . LEU A 1 82  ? 14.590  5.248   -1.349  1.00 0.00 ? 82  LEU A HD21 4  
ATOM   5621  H HD22 . LEU A 1 82  ? 15.521  4.267   -2.507  1.00 0.00 ? 82  LEU A HD22 4  
ATOM   5622  H HD23 . LEU A 1 82  ? 15.096  5.950   -2.905  1.00 0.00 ? 82  LEU A HD23 4  
ATOM   5623  N N    . MET A 1 83  ? 9.522   4.157   -0.325  1.00 0.00 ? 83  MET A N    4  
ATOM   5624  C CA   . MET A 1 83  ? 8.078   4.111   -0.475  1.00 0.00 ? 83  MET A CA   4  
ATOM   5625  C C    . MET A 1 83  ? 7.399   5.148   0.420   1.00 0.00 ? 83  MET A C    4  
ATOM   5626  O O    . MET A 1 83  ? 6.216   5.444   0.248   1.00 0.00 ? 83  MET A O    4  
ATOM   5627  C CB   . MET A 1 83  ? 7.571   2.714   -0.114  1.00 0.00 ? 83  MET A CB   4  
ATOM   5628  C CG   . MET A 1 83  ? 6.096   2.551   -0.485  1.00 0.00 ? 83  MET A CG   4  
ATOM   5629  S SD   . MET A 1 83  ? 5.552   0.893   -0.112  1.00 0.00 ? 83  MET A SD   4  
ATOM   5630  C CE   . MET A 1 83  ? 5.502   0.978   1.671   1.00 0.00 ? 83  MET A CE   4  
ATOM   5631  H H    . MET A 1 83  ? 9.856   3.993   0.604   1.00 0.00 ? 83  MET A H    4  
ATOM   5632  H HA   . MET A 1 83  ? 7.886   4.344   -1.523  1.00 0.00 ? 83  MET A HA   4  
ATOM   5633  H HB2  . MET A 1 83  ? 8.167   1.962   -0.634  1.00 0.00 ? 83  MET A HB2  4  
ATOM   5634  H HB3  . MET A 1 83  ? 7.704   2.540   0.955   1.00 0.00 ? 83  MET A HB3  4  
ATOM   5635  H HG2  . MET A 1 83  ? 5.493   3.272   0.066   1.00 0.00 ? 83  MET A HG2  4  
ATOM   5636  H HG3  . MET A 1 83  ? 5.954   2.760   -1.544  1.00 0.00 ? 83  MET A HG3  4  
ATOM   5637  H HE1  . MET A 1 83  ? 6.190   1.747   2.018   1.00 0.00 ? 83  MET A HE1  4  
ATOM   5638  H HE2  . MET A 1 83  ? 4.490   1.221   1.995   1.00 0.00 ? 83  MET A HE2  4  
ATOM   5639  H HE3  . MET A 1 83  ? 5.796   0.014   2.089   1.00 0.00 ? 83  MET A HE3  4  
ATOM   5640  N N    . THR A 1 84  ? 8.173   5.672   1.358   1.00 0.00 ? 84  THR A N    4  
ATOM   5641  C CA   . THR A 1 84  ? 7.661   6.670   2.282   1.00 0.00 ? 84  THR A CA   4  
ATOM   5642  C C    . THR A 1 84  ? 7.894   8.079   1.729   1.00 0.00 ? 84  THR A C    4  
ATOM   5643  O O    . THR A 1 84  ? 6.964   8.878   1.646   1.00 0.00 ? 84  THR A O    4  
ATOM   5644  C CB   . THR A 1 84  ? 8.317   6.436   3.643   1.00 0.00 ? 84  THR A CB   4  
ATOM   5645  O OG1  . THR A 1 84  ? 8.390   5.017   3.753   1.00 0.00 ? 84  THR A OG1  4  
ATOM   5646  C CG2  . THR A 1 84  ? 7.417   6.855   4.807   1.00 0.00 ? 84  THR A CG2  4  
ATOM   5647  H H    . THR A 1 84  ? 9.134   5.426   1.491   1.00 0.00 ? 84  THR A H    4  
ATOM   5648  H HA   . THR A 1 84  ? 6.584   6.536   2.369   1.00 0.00 ? 84  THR A HA   4  
ATOM   5649  H HB   . THR A 1 84  ? 9.285   6.934   3.699   1.00 0.00 ? 84  THR A HB   4  
ATOM   5650  H HG1  . THR A 1 84  ? 9.282   4.694   3.439   1.00 0.00 ? 84  THR A HG1  4  
ATOM   5651  H HG21 . THR A 1 84  ? 7.253   7.932   4.771   1.00 0.00 ? 84  THR A HG21 4  
ATOM   5652  H HG22 . THR A 1 84  ? 6.459   6.338   4.730   1.00 0.00 ? 84  THR A HG22 4  
ATOM   5653  H HG23 . THR A 1 84  ? 7.897   6.592   5.751   1.00 0.00 ? 84  THR A HG23 4  
ATOM   5654  N N    . ARG A 1 85  ? 9.142   8.338   1.365   1.00 0.00 ? 85  ARG A N    4  
ATOM   5655  C CA   . ARG A 1 85  ? 9.510   9.635   0.825   1.00 0.00 ? 85  ARG A CA   4  
ATOM   5656  C C    . ARG A 1 85  ? 8.862   9.840   -0.547  1.00 0.00 ? 85  ARG A C    4  
ATOM   5657  O O    . ARG A 1 85  ? 9.545   10.150  -1.520  1.00 0.00 ? 85  ARG A O    4  
ATOM   5658  C CB   . ARG A 1 85  ? 11.028  9.764   0.687   1.00 0.00 ? 85  ARG A CB   4  
ATOM   5659  C CG   . ARG A 1 85  ? 11.513  11.118  1.212   1.00 0.00 ? 85  ARG A CG   4  
ATOM   5660  C CD   . ARG A 1 85  ? 13.028  11.113  1.426   1.00 0.00 ? 85  ARG A CD   4  
ATOM   5661  N NE   . ARG A 1 85  ? 13.407  12.179  2.380   1.00 0.00 ? 85  ARG A NE   4  
ATOM   5662  C CZ   . ARG A 1 85  ? 14.671  12.508  2.674   1.00 0.00 ? 85  ARG A CZ   4  
ATOM   5663  N NH1  . ARG A 1 85  ? 15.686  11.857  2.089   1.00 0.00 ? 85  ARG A NH1  4  
ATOM   5664  N NH2  . ARG A 1 85  ? 14.922  13.488  3.552   1.00 0.00 ? 85  ARG A NH2  4  
ATOM   5665  H H    . ARG A 1 85  ? 9.894   7.682   1.438   1.00 0.00 ? 85  ARG A H    4  
ATOM   5666  H HA   . ARG A 1 85  ? 9.133   10.357  1.550   1.00 0.00 ? 85  ARG A HA   4  
ATOM   5667  H HB2  . ARG A 1 85  ? 11.516  8.960   1.239   1.00 0.00 ? 85  ARG A HB2  4  
ATOM   5668  H HB3  . ARG A 1 85  ? 11.313  9.651   -0.359  1.00 0.00 ? 85  ARG A HB3  4  
ATOM   5669  H HG2  . ARG A 1 85  ? 11.244  11.903  0.504   1.00 0.00 ? 85  ARG A HG2  4  
ATOM   5670  H HG3  . ARG A 1 85  ? 11.009  11.350  2.150   1.00 0.00 ? 85  ARG A HG3  4  
ATOM   5671  H HD2  . ARG A 1 85  ? 13.345  10.143  1.805   1.00 0.00 ? 85  ARG A HD2  4  
ATOM   5672  H HD3  . ARG A 1 85  ? 13.537  11.266  0.475   1.00 0.00 ? 85  ARG A HD3  4  
ATOM   5673  H HE   . ARG A 1 85  ? 12.673  12.684  2.833   1.00 0.00 ? 85  ARG A HE   4  
ATOM   5674  H HH11 . ARG A 1 85  ? 15.500  11.125  1.435   1.00 0.00 ? 85  ARG A HH11 4  
ATOM   5675  H HH12 . ARG A 1 85  ? 16.632  12.102  2.309   1.00 0.00 ? 85  ARG A HH12 4  
ATOM   5676  H HH21 . ARG A 1 85  ? 14.165  13.976  3.987   1.00 0.00 ? 85  ARG A HH21 4  
ATOM   5677  H HH22 . ARG A 1 85  ? 15.866  13.735  3.771   1.00 0.00 ? 85  ARG A HH22 4  
ATOM   5678  N N    . THR A 1 86  ? 7.549   9.659   -0.578  1.00 0.00 ? 86  THR A N    4  
ATOM   5679  C CA   . THR A 1 86  ? 6.802   9.822   -1.813  1.00 0.00 ? 86  THR A CA   4  
ATOM   5680  C C    . THR A 1 86  ? 6.337   11.270  -1.969  1.00 0.00 ? 86  THR A C    4  
ATOM   5681  O O    . THR A 1 86  ? 6.626   11.914  -2.977  1.00 0.00 ? 86  THR A O    4  
ATOM   5682  C CB   . THR A 1 86  ? 5.651   8.811   -1.806  1.00 0.00 ? 86  THR A CB   4  
ATOM   5683  O OG1  . THR A 1 86  ? 6.258   7.592   -2.223  1.00 0.00 ? 86  THR A OG1  4  
ATOM   5684  C CG2  . THR A 1 86  ? 4.612   9.101   -2.890  1.00 0.00 ? 86  THR A CG2  4  
ATOM   5685  H H    . THR A 1 86  ? 7.001   9.409   0.219   1.00 0.00 ? 86  THR A H    4  
ATOM   5686  H HA   . THR A 1 86  ? 7.467   9.607   -2.649  1.00 0.00 ? 86  THR A HA   4  
ATOM   5687  H HB   . THR A 1 86  ? 5.185   8.761   -0.822  1.00 0.00 ? 86  THR A HB   4  
ATOM   5688  H HG1  . THR A 1 86  ? 7.160   7.496   -1.800  1.00 0.00 ? 86  THR A HG1  4  
ATOM   5689  H HG21 . THR A 1 86  ? 5.116   9.421   -3.801  1.00 0.00 ? 86  THR A HG21 4  
ATOM   5690  H HG22 . THR A 1 86  ? 4.036   8.197   -3.091  1.00 0.00 ? 86  THR A HG22 4  
ATOM   5691  H HG23 . THR A 1 86  ? 3.941   9.891   -2.549  1.00 0.00 ? 86  THR A HG23 4  
ATOM   5692  N N    . SER A 1 87  ? 5.625   11.743  -0.957  1.00 0.00 ? 87  SER A N    4  
ATOM   5693  C CA   . SER A 1 87  ? 5.116   13.104  -0.969  1.00 0.00 ? 87  SER A CA   4  
ATOM   5694  C C    . SER A 1 87  ? 4.814   13.537  -2.405  1.00 0.00 ? 87  SER A C    4  
ATOM   5695  O O    . SER A 1 87  ? 5.622   14.216  -3.037  1.00 0.00 ? 87  SER A O    4  
ATOM   5696  C CB   . SER A 1 87  ? 6.114   14.070  -0.323  1.00 0.00 ? 87  SER A CB   4  
ATOM   5697  O OG   . SER A 1 87  ? 5.828   14.288  1.055   1.00 0.00 ? 87  SER A OG   4  
ATOM   5698  H H    . SER A 1 87  ? 5.393   11.213  -0.141  1.00 0.00 ? 87  SER A H    4  
ATOM   5699  H HA   . SER A 1 87  ? 4.202   13.077  -0.377  1.00 0.00 ? 87  SER A HA   4  
ATOM   5700  H HB2  . SER A 1 87  ? 7.122   13.669  -0.425  1.00 0.00 ? 87  SER A HB2  4  
ATOM   5701  H HB3  . SER A 1 87  ? 6.093   15.021  -0.854  1.00 0.00 ? 87  SER A HB3  4  
ATOM   5702  H HG   . SER A 1 87  ? 4.844   14.202  1.218   1.00 0.00 ? 87  SER A HG   4  
ATOM   5703  N N    . SER A 1 88  ? 3.646   13.127  -2.880  1.00 0.00 ? 88  SER A N    4  
ATOM   5704  C CA   . SER A 1 88  ? 3.227   13.462  -4.228  1.00 0.00 ? 88  SER A CA   4  
ATOM   5705  C C    . SER A 1 88  ? 2.267   12.396  -4.759  1.00 0.00 ? 88  SER A C    4  
ATOM   5706  O O    . SER A 1 88  ? 1.178   12.716  -5.232  1.00 0.00 ? 88  SER A O    4  
ATOM   5707  C CB   . SER A 1 88  ? 4.431   13.603  -5.160  1.00 0.00 ? 88  SER A CB   4  
ATOM   5708  O OG   . SER A 1 88  ? 4.924   14.940  -5.197  1.00 0.00 ? 88  SER A OG   4  
ATOM   5709  H H    . SER A 1 88  ? 2.995   12.574  -2.358  1.00 0.00 ? 88  SER A H    4  
ATOM   5710  H HA   . SER A 1 88  ? 2.720   14.424  -4.141  1.00 0.00 ? 88  SER A HA   4  
ATOM   5711  H HB2  . SER A 1 88  ? 5.225   12.933  -4.832  1.00 0.00 ? 88  SER A HB2  4  
ATOM   5712  H HB3  . SER A 1 88  ? 4.148   13.294  -6.168  1.00 0.00 ? 88  SER A HB3  4  
ATOM   5713  H HG   . SER A 1 88  ? 5.540   15.098  -4.425  1.00 0.00 ? 88  SER A HG   4  
ATOM   5714  N N    . VAL A 1 89  ? 2.705   11.149  -4.663  1.00 0.00 ? 89  VAL A N    4  
ATOM   5715  C CA   . VAL A 1 89  ? 1.899   10.034  -5.127  1.00 0.00 ? 89  VAL A CA   4  
ATOM   5716  C C    . VAL A 1 89  ? 2.628   8.722   -4.826  1.00 0.00 ? 89  VAL A C    4  
ATOM   5717  O O    . VAL A 1 89  ? 3.762   8.525   -5.263  1.00 0.00 ? 89  VAL A O    4  
ATOM   5718  C CB   . VAL A 1 89  ? 1.570   10.208  -6.610  1.00 0.00 ? 89  VAL A CB   4  
ATOM   5719  C CG1  . VAL A 1 89  ? 2.582   9.467   -7.487  1.00 0.00 ? 89  VAL A CG1  4  
ATOM   5720  C CG2  . VAL A 1 89  ? 0.142   9.749   -6.913  1.00 0.00 ? 89  VAL A CG2  4  
ATOM   5721  H H    . VAL A 1 89  ? 3.592   10.897  -4.276  1.00 0.00 ? 89  VAL A H    4  
ATOM   5722  H HA   . VAL A 1 89  ? 0.962   10.051  -4.569  1.00 0.00 ? 89  VAL A HA   4  
ATOM   5723  H HB   . VAL A 1 89  ? 1.636   11.270  -6.846  1.00 0.00 ? 89  VAL A HB   4  
ATOM   5724  H HG11 . VAL A 1 89  ? 2.284   9.550   -8.533  1.00 0.00 ? 89  VAL A HG11 4  
ATOM   5725  H HG12 . VAL A 1 89  ? 3.568   9.907   -7.353  1.00 0.00 ? 89  VAL A HG12 4  
ATOM   5726  H HG13 . VAL A 1 89  ? 2.609   8.416   -7.200  1.00 0.00 ? 89  VAL A HG13 4  
ATOM   5727  H HG21 . VAL A 1 89  ? -0.504  10.621  -7.021  1.00 0.00 ? 89  VAL A HG21 4  
ATOM   5728  H HG22 . VAL A 1 89  ? 0.134   9.173   -7.837  1.00 0.00 ? 89  VAL A HG22 4  
ATOM   5729  H HG23 . VAL A 1 89  ? -0.220  9.127   -6.094  1.00 0.00 ? 89  VAL A HG23 4  
ATOM   5730  N N    . VAL A 1 90  ? 1.949   7.862   -4.082  1.00 0.00 ? 90  VAL A N    4  
ATOM   5731  C CA   . VAL A 1 90  ? 2.518   6.575   -3.718  1.00 0.00 ? 90  VAL A CA   4  
ATOM   5732  C C    . VAL A 1 90  ? 1.715   5.459   -4.389  1.00 0.00 ? 90  VAL A C    4  
ATOM   5733  O O    . VAL A 1 90  ? 0.632   5.104   -3.925  1.00 0.00 ? 90  VAL A O    4  
ATOM   5734  C CB   . VAL A 1 90  ? 2.574   6.440   -2.196  1.00 0.00 ? 90  VAL A CB   4  
ATOM   5735  C CG1  . VAL A 1 90  ? 4.006   6.183   -1.721  1.00 0.00 ? 90  VAL A CG1  4  
ATOM   5736  C CG2  . VAL A 1 90  ? 1.983   7.675   -1.513  1.00 0.00 ? 90  VAL A CG2  4  
ATOM   5737  H H    . VAL A 1 90  ? 1.029   8.032   -3.731  1.00 0.00 ? 90  VAL A H    4  
ATOM   5738  H HA   . VAL A 1 90  ? 3.541   6.548   -4.098  1.00 0.00 ? 90  VAL A HA   4  
ATOM   5739  H HB   . VAL A 1 90  ? 1.969   5.579   -1.914  1.00 0.00 ? 90  VAL A HB   4  
ATOM   5740  H HG11 . VAL A 1 90  ? 4.674   6.154   -2.581  1.00 0.00 ? 90  VAL A HG11 4  
ATOM   5741  H HG12 . VAL A 1 90  ? 4.314   6.983   -1.047  1.00 0.00 ? 90  VAL A HG12 4  
ATOM   5742  H HG13 . VAL A 1 90  ? 4.049   5.229   -1.194  1.00 0.00 ? 90  VAL A HG13 4  
ATOM   5743  H HG21 . VAL A 1 90  ? 2.019   7.544   -0.432  1.00 0.00 ? 90  VAL A HG21 4  
ATOM   5744  H HG22 . VAL A 1 90  ? 2.560   8.556   -1.793  1.00 0.00 ? 90  VAL A HG22 4  
ATOM   5745  H HG23 . VAL A 1 90  ? 0.947   7.804   -1.829  1.00 0.00 ? 90  VAL A HG23 4  
ATOM   5746  N N    . THR A 1 91  ? 2.277   4.938   -5.470  1.00 0.00 ? 91  THR A N    4  
ATOM   5747  C CA   . THR A 1 91  ? 1.625   3.869   -6.208  1.00 0.00 ? 91  THR A CA   4  
ATOM   5748  C C    . THR A 1 91  ? 2.164   2.507   -5.764  1.00 0.00 ? 91  THR A C    4  
ATOM   5749  O O    . THR A 1 91  ? 3.329   2.188   -6.002  1.00 0.00 ? 91  THR A O    4  
ATOM   5750  C CB   . THR A 1 91  ? 1.819   4.140   -7.702  1.00 0.00 ? 91  THR A CB   4  
ATOM   5751  O OG1  . THR A 1 91  ? 3.210   4.420   -7.826  1.00 0.00 ? 91  THR A OG1  4  
ATOM   5752  C CG2  . THR A 1 91  ? 1.136   5.432   -8.156  1.00 0.00 ? 91  THR A CG2  4  
ATOM   5753  H H    . THR A 1 91  ? 3.157   5.232   -5.841  1.00 0.00 ? 91  THR A H    4  
ATOM   5754  H HA   . THR A 1 91  ? 0.563   3.884   -5.971  1.00 0.00 ? 91  THR A HA   4  
ATOM   5755  H HB   . THR A 1 91  ? 1.484   3.291   -8.299  1.00 0.00 ? 91  THR A HB   4  
ATOM   5756  H HG1  . THR A 1 91  ? 3.385   4.912   -8.679  1.00 0.00 ? 91  THR A HG1  4  
ATOM   5757  H HG21 . THR A 1 91  ? 1.882   6.220   -8.262  1.00 0.00 ? 91  THR A HG21 4  
ATOM   5758  H HG22 . THR A 1 91  ? 0.644   5.265   -9.114  1.00 0.00 ? 91  THR A HG22 4  
ATOM   5759  H HG23 . THR A 1 91  ? 0.395   5.730   -7.414  1.00 0.00 ? 91  THR A HG23 4  
ATOM   5760  N N    . LEU A 1 92  ? 1.292   1.741   -5.125  1.00 0.00 ? 92  LEU A N    4  
ATOM   5761  C CA   . LEU A 1 92  ? 1.666   0.421   -4.643  1.00 0.00 ? 92  LEU A CA   4  
ATOM   5762  C C    . LEU A 1 92  ? 0.675   -0.612  -5.182  1.00 0.00 ? 92  LEU A C    4  
ATOM   5763  O O    . LEU A 1 92  ? -0.474  -0.282  -5.475  1.00 0.00 ? 92  LEU A O    4  
ATOM   5764  C CB   . LEU A 1 92  ? 1.788   0.422   -3.119  1.00 0.00 ? 92  LEU A CB   4  
ATOM   5765  C CG   . LEU A 1 92  ? 1.813   1.797   -2.447  1.00 0.00 ? 92  LEU A CG   4  
ATOM   5766  C CD1  . LEU A 1 92  ? 1.779   1.663   -0.925  1.00 0.00 ? 92  LEU A CD1  4  
ATOM   5767  C CD2  . LEU A 1 92  ? 3.014   2.617   -2.924  1.00 0.00 ? 92  LEU A CD2  4  
ATOM   5768  H H    . LEU A 1 92  ? 0.348   2.009   -4.935  1.00 0.00 ? 92  LEU A H    4  
ATOM   5769  H HA   . LEU A 1 92  ? 2.654   0.196   -5.046  1.00 0.00 ? 92  LEU A HA   4  
ATOM   5770  H HB2  . LEU A 1 92  ? 0.952   -0.146  -2.708  1.00 0.00 ? 92  LEU A HB2  4  
ATOM   5771  H HB3  . LEU A 1 92  ? 2.699   -0.109  -2.847  1.00 0.00 ? 92  LEU A HB3  4  
ATOM   5772  H HG   . LEU A 1 92  ? 0.915   2.338   -2.744  1.00 0.00 ? 92  LEU A HG   4  
ATOM   5773  H HD11 . LEU A 1 92  ? 0.970   2.275   -0.526  1.00 0.00 ? 92  LEU A HD11 4  
ATOM   5774  H HD12 . LEU A 1 92  ? 1.614   0.621   -0.654  1.00 0.00 ? 92  LEU A HD12 4  
ATOM   5775  H HD13 . LEU A 1 92  ? 2.730   2.001   -0.508  1.00 0.00 ? 92  LEU A HD13 4  
ATOM   5776  H HD21 . LEU A 1 92  ? 2.666   3.442   -3.546  1.00 0.00 ? 92  LEU A HD21 4  
ATOM   5777  H HD22 . LEU A 1 92  ? 3.548   3.014   -2.062  1.00 0.00 ? 92  LEU A HD22 4  
ATOM   5778  H HD23 . LEU A 1 92  ? 3.682   1.980   -3.507  1.00 0.00 ? 92  LEU A HD23 4  
ATOM   5779  N N    . GLU A 1 93  ? 1.155   -1.841  -5.297  1.00 0.00 ? 93  GLU A N    4  
ATOM   5780  C CA   . GLU A 1 93  ? 0.325   -2.926  -5.795  1.00 0.00 ? 93  GLU A CA   4  
ATOM   5781  C C    . GLU A 1 93  ? -0.274  -3.713  -4.629  1.00 0.00 ? 93  GLU A C    4  
ATOM   5782  O O    . GLU A 1 93  ? 0.433   -4.454  -3.946  1.00 0.00 ? 93  GLU A O    4  
ATOM   5783  C CB   . GLU A 1 93  ? 1.123   -3.844  -6.725  1.00 0.00 ? 93  GLU A CB   4  
ATOM   5784  C CG   . GLU A 1 93  ? 0.250   -4.352  -7.873  1.00 0.00 ? 93  GLU A CG   4  
ATOM   5785  C CD   . GLU A 1 93  ? 0.915   -5.532  -8.586  1.00 0.00 ? 93  GLU A CD   4  
ATOM   5786  O OE1  . GLU A 1 93  ? 0.836   -6.649  -8.030  1.00 0.00 ? 93  GLU A OE1  4  
ATOM   5787  O OE2  . GLU A 1 93  ? 1.486   -5.289  -9.669  1.00 0.00 ? 93  GLU A OE2  4  
ATOM   5788  H H    . GLU A 1 93  ? 2.091   -2.101  -5.057  1.00 0.00 ? 93  GLU A H    4  
ATOM   5789  H HA   . GLU A 1 93  ? -0.468  -2.444  -6.365  1.00 0.00 ? 93  GLU A HA   4  
ATOM   5790  H HB2  . GLU A 1 93  ? 1.980   -3.304  -7.126  1.00 0.00 ? 93  GLU A HB2  4  
ATOM   5791  H HB3  . GLU A 1 93  ? 1.515   -4.688  -6.158  1.00 0.00 ? 93  GLU A HB3  4  
ATOM   5792  H HG2  . GLU A 1 93  ? -0.723  -4.658  -7.486  1.00 0.00 ? 93  GLU A HG2  4  
ATOM   5793  H HG3  . GLU A 1 93  ? 0.071   -3.546  -8.584  1.00 0.00 ? 93  GLU A HG3  4  
ATOM   5794  N N    . VAL A 1 94  ? -1.572  -3.527  -4.437  1.00 0.00 ? 94  VAL A N    4  
ATOM   5795  C CA   . VAL A 1 94  ? -2.275  -4.212  -3.365  1.00 0.00 ? 94  VAL A CA   4  
ATOM   5796  C C    . VAL A 1 94  ? -3.273  -5.203  -3.966  1.00 0.00 ? 94  VAL A C    4  
ATOM   5797  O O    . VAL A 1 94  ? -3.599  -5.121  -5.149  1.00 0.00 ? 94  VAL A O    4  
ATOM   5798  C CB   . VAL A 1 94  ? -2.934  -3.190  -2.435  1.00 0.00 ? 94  VAL A CB   4  
ATOM   5799  C CG1  . VAL A 1 94  ? -1.880  -2.364  -1.695  1.00 0.00 ? 94  VAL A CG1  4  
ATOM   5800  C CG2  . VAL A 1 94  ? -3.896  -2.288  -3.208  1.00 0.00 ? 94  VAL A CG2  4  
ATOM   5801  H H    . VAL A 1 94  ? -2.139  -2.923  -4.997  1.00 0.00 ? 94  VAL A H    4  
ATOM   5802  H HA   . VAL A 1 94  ? -1.535  -4.765  -2.787  1.00 0.00 ? 94  VAL A HA   4  
ATOM   5803  H HB   . VAL A 1 94  ? -3.512  -3.738  -1.691  1.00 0.00 ? 94  VAL A HB   4  
ATOM   5804  H HG11 . VAL A 1 94  ? -1.024  -2.196  -2.349  1.00 0.00 ? 94  VAL A HG11 4  
ATOM   5805  H HG12 . VAL A 1 94  ? -2.308  -1.404  -1.404  1.00 0.00 ? 94  VAL A HG12 4  
ATOM   5806  H HG13 . VAL A 1 94  ? -1.558  -2.901  -0.803  1.00 0.00 ? 94  VAL A HG13 4  
ATOM   5807  H HG21 . VAL A 1 94  ? -3.522  -1.263  -3.197  1.00 0.00 ? 94  VAL A HG21 4  
ATOM   5808  H HG22 . VAL A 1 94  ? -3.973  -2.636  -4.238  1.00 0.00 ? 94  VAL A HG22 4  
ATOM   5809  H HG23 . VAL A 1 94  ? -4.880  -2.319  -2.739  1.00 0.00 ? 94  VAL A HG23 4  
ATOM   5810  N N    . ALA A 1 95  ? -3.729  -6.119  -3.126  1.00 0.00 ? 95  ALA A N    4  
ATOM   5811  C CA   . ALA A 1 95  ? -4.685  -7.125  -3.559  1.00 0.00 ? 95  ALA A CA   4  
ATOM   5812  C C    . ALA A 1 95  ? -5.741  -7.321  -2.470  1.00 0.00 ? 95  ALA A C    4  
ATOM   5813  O O    . ALA A 1 95  ? -5.408  -7.457  -1.294  1.00 0.00 ? 95  ALA A O    4  
ATOM   5814  C CB   . ALA A 1 95  ? -3.942  -8.421  -3.893  1.00 0.00 ? 95  ALA A CB   4  
ATOM   5815  H H    . ALA A 1 95  ? -3.460  -6.180  -2.164  1.00 0.00 ? 95  ALA A H    4  
ATOM   5816  H HA   . ALA A 1 95  ? -5.169  -6.754  -4.463  1.00 0.00 ? 95  ALA A HA   4  
ATOM   5817  H HB1  . ALA A 1 95  ? -3.178  -8.218  -4.643  1.00 0.00 ? 95  ALA A HB1  4  
ATOM   5818  H HB2  . ALA A 1 95  ? -3.474  -8.815  -2.991  1.00 0.00 ? 95  ALA A HB2  4  
ATOM   5819  H HB3  . ALA A 1 95  ? -4.650  -9.152  -4.284  1.00 0.00 ? 95  ALA A HB3  4  
ATOM   5820  N N    . LYS A 1 96  ? -6.993  -7.331  -2.902  1.00 0.00 ? 96  LYS A N    4  
ATOM   5821  C CA   . LYS A 1 96  ? -8.102  -7.510  -1.979  1.00 0.00 ? 96  LYS A CA   4  
ATOM   5822  C C    . LYS A 1 96  ? -8.119  -8.957  -1.483  1.00 0.00 ? 96  LYS A C    4  
ATOM   5823  O O    . LYS A 1 96  ? -7.938  -9.888  -2.266  1.00 0.00 ? 96  LYS A O    4  
ATOM   5824  C CB   . LYS A 1 96  ? -9.416  -7.066  -2.626  1.00 0.00 ? 96  LYS A CB   4  
ATOM   5825  C CG   . LYS A 1 96  ? -10.086 -5.964  -1.805  1.00 0.00 ? 96  LYS A CG   4  
ATOM   5826  C CD   . LYS A 1 96  ? -11.149 -6.546  -0.872  1.00 0.00 ? 96  LYS A CD   4  
ATOM   5827  C CE   . LYS A 1 96  ? -11.197 -5.779  0.452   1.00 0.00 ? 96  LYS A CE   4  
ATOM   5828  N NZ   . LYS A 1 96  ? -12.595 -5.457  0.816   1.00 0.00 ? 96  LYS A NZ   4  
ATOM   5829  H H    . LYS A 1 96  ? -7.256  -7.222  -3.862  1.00 0.00 ? 96  LYS A H    4  
ATOM   5830  H HA   . LYS A 1 96  ? -7.925  -6.855  -1.127  1.00 0.00 ? 96  LYS A HA   4  
ATOM   5831  H HB2  . LYS A 1 96  ? -9.224  -6.706  -3.637  1.00 0.00 ? 96  LYS A HB2  4  
ATOM   5832  H HB3  . LYS A 1 96  ? -10.088 -7.920  -2.715  1.00 0.00 ? 96  LYS A HB3  4  
ATOM   5833  H HG2  . LYS A 1 96  ? -9.336  -5.433  -1.220  1.00 0.00 ? 96  LYS A HG2  4  
ATOM   5834  H HG3  . LYS A 1 96  ? -10.545 -5.235  -2.474  1.00 0.00 ? 96  LYS A HG3  4  
ATOM   5835  H HD2  . LYS A 1 96  ? -12.125 -6.505  -1.354  1.00 0.00 ? 96  LYS A HD2  4  
ATOM   5836  H HD3  . LYS A 1 96  ? -10.934 -7.597  -0.678  1.00 0.00 ? 96  LYS A HD3  4  
ATOM   5837  H HE2  . LYS A 1 96  ? -10.738 -6.375  1.241   1.00 0.00 ? 96  LYS A HE2  4  
ATOM   5838  H HE3  . LYS A 1 96  ? -10.616 -4.860  0.368   1.00 0.00 ? 96  LYS A HE3  4  
ATOM   5839  H HZ1  . LYS A 1 96  ? -12.789 -5.803  1.735   1.00 0.00 ? 96  LYS A HZ1  4  
ATOM   5840  H HZ2  . LYS A 1 96  ? -12.724 -4.467  0.797   1.00 0.00 ? 96  LYS A HZ2  4  
ATOM   5841  H HZ3  . LYS A 1 96  ? -13.217 -5.888  0.160   1.00 0.00 ? 96  LYS A HZ3  4  
ATOM   5842  N N    . GLN A 1 97  ? -8.338  -9.102  -0.184  1.00 0.00 ? 97  GLN A N    4  
ATOM   5843  C CA   . GLN A 1 97  ? -8.382  -10.421 0.425   1.00 0.00 ? 97  GLN A CA   4  
ATOM   5844  C C    . GLN A 1 97  ? -9.131  -10.365 1.759   1.00 0.00 ? 97  GLN A C    4  
ATOM   5845  O O    . GLN A 1 97  ? -10.215 -10.927 1.890   1.00 0.00 ? 97  GLN A O    4  
ATOM   5846  C CB   . GLN A 1 97  ? -6.972  -10.985 0.611   1.00 0.00 ? 97  GLN A CB   4  
ATOM   5847  C CG   . GLN A 1 97  ? -7.021  -12.430 1.110   1.00 0.00 ? 97  GLN A CG   4  
ATOM   5848  C CD   . GLN A 1 97  ? -6.058  -13.317 0.318   1.00 0.00 ? 97  GLN A CD   4  
ATOM   5849  O OE1  . GLN A 1 97  ? -4.885  -13.437 0.629   1.00 0.00 ? 97  GLN A OE1  4  
ATOM   5850  N NE2  . GLN A 1 97  ? -6.619  -13.930 -0.721  1.00 0.00 ? 97  GLN A NE2  4  
ATOM   5851  H H    . GLN A 1 97  ? -8.484  -8.340  0.446   1.00 0.00 ? 97  GLN A H    4  
ATOM   5852  H HA   . GLN A 1 97  ? -8.927  -11.048 -0.280  1.00 0.00 ? 97  GLN A HA   4  
ATOM   5853  H HB2  . GLN A 1 97  ? -6.431  -10.941 -0.336  1.00 0.00 ? 97  GLN A HB2  4  
ATOM   5854  H HB3  . GLN A 1 97  ? -6.420  -10.369 1.321   1.00 0.00 ? 97  GLN A HB3  4  
ATOM   5855  H HG2  . GLN A 1 97  ? -6.763  -12.462 2.170   1.00 0.00 ? 97  GLN A HG2  4  
ATOM   5856  H HG3  . GLN A 1 97  ? -8.037  -12.816 1.018   1.00 0.00 ? 97  GLN A HG3  4  
ATOM   5857  H HE21 . GLN A 1 97  ? -7.587  -13.789 -0.922  1.00 0.00 ? 97  GLN A HE21 4  
ATOM   5858  H HE22 . GLN A 1 97  ? -6.070  -14.533 -1.301  1.00 0.00 ? 97  GLN A HE22 4  
ATOM   5859  N N    . GLY A 1 98  ? -8.519  -9.680  2.715   1.00 0.00 ? 98  GLY A N    4  
ATOM   5860  C CA   . GLY A 1 98  ? -9.114  -9.544  4.033   1.00 0.00 ? 98  GLY A CA   4  
ATOM   5861  C C    . GLY A 1 98  ? -8.279  -10.269 5.090   1.00 0.00 ? 98  GLY A C    4  
ATOM   5862  O O    . GLY A 1 98  ? -8.165  -11.494 5.064   1.00 0.00 ? 98  GLY A O    4  
ATOM   5863  H H    . GLY A 1 98  ? -7.636  -9.224  2.600   1.00 0.00 ? 98  GLY A H    4  
ATOM   5864  H HA2  . GLY A 1 98  ? -9.195  -8.487  4.292   1.00 0.00 ? 98  GLY A HA2  4  
ATOM   5865  H HA3  . GLY A 1 98  ? -10.126 -9.947  4.024   1.00 0.00 ? 98  GLY A HA3  4  
ATOM   5866  N N    . ALA A 1 99  ? -7.713  -9.483  5.993   1.00 0.00 ? 99  ALA A N    4  
ATOM   5867  C CA   . ALA A 1 99  ? -6.891  -10.035 7.057   1.00 0.00 ? 99  ALA A CA   4  
ATOM   5868  C C    . ALA A 1 99  ? -6.579  -8.938  8.076   1.00 0.00 ? 99  ALA A C    4  
ATOM   5869  O O    . ALA A 1 99  ? -6.833  -7.761  7.826   1.00 0.00 ? 99  ALA A O    4  
ATOM   5870  C CB   . ALA A 1 99  ? -5.626  -10.651 6.457   1.00 0.00 ? 99  ALA A CB   4  
ATOM   5871  H H    . ALA A 1 99  ? -7.809  -8.487  6.008   1.00 0.00 ? 99  ALA A H    4  
ATOM   5872  H HA   . ALA A 1 99  ? -7.465  -10.821 7.546   1.00 0.00 ? 99  ALA A HA   4  
ATOM   5873  H HB1  . ALA A 1 99  ? -5.095  -11.213 7.226   1.00 0.00 ? 99  ALA A HB1  4  
ATOM   5874  H HB2  . ALA A 1 99  ? -5.899  -11.320 5.641   1.00 0.00 ? 99  ALA A HB2  4  
ATOM   5875  H HB3  . ALA A 1 99  ? -4.982  -9.858  6.076   1.00 0.00 ? 99  ALA A HB3  4  
ATOM   5876  N N    . ILE A 1 100 ? -6.032  -9.363  9.207   1.00 0.00 ? 100 ILE A N    4  
ATOM   5877  C CA   . ILE A 1 100 ? -5.681  -8.430  10.266  1.00 0.00 ? 100 ILE A CA   4  
ATOM   5878  C C    . ILE A 1 100 ? -4.870  -9.165  11.336  1.00 0.00 ? 100 ILE A C    4  
ATOM   5879  O O    . ILE A 1 100 ? -4.932  -10.388 11.436  1.00 0.00 ? 100 ILE A O    4  
ATOM   5880  C CB   . ILE A 1 100 ? -6.936  -7.741  10.807  1.00 0.00 ? 100 ILE A CB   4  
ATOM   5881  C CG1  . ILE A 1 100 ? -6.567  -6.637  11.801  1.00 0.00 ? 100 ILE A CG1  4  
ATOM   5882  C CG2  . ILE A 1 100 ? -7.902  -8.760  11.413  1.00 0.00 ? 100 ILE A CG2  4  
ATOM   5883  C CD1  . ILE A 1 100 ? -7.678  -5.590  11.893  1.00 0.00 ? 100 ILE A CD1  4  
ATOM   5884  H H    . ILE A 1 100 ? -5.827  -10.322 9.403   1.00 0.00 ? 100 ILE A H    4  
ATOM   5885  H HA   . ILE A 1 100 ? -5.052  -7.657  9.825   1.00 0.00 ? 100 ILE A HA   4  
ATOM   5886  H HB   . ILE A 1 100 ? -7.451  -7.265  9.973   1.00 0.00 ? 100 ILE A HB   4  
ATOM   5887  H HG12 . ILE A 1 100 ? -6.390  -7.074  12.785  1.00 0.00 ? 100 ILE A HG12 4  
ATOM   5888  H HG13 . ILE A 1 100 ? -5.638  -6.161  11.492  1.00 0.00 ? 100 ILE A HG13 4  
ATOM   5889  H HG21 . ILE A 1 100 ? -8.655  -8.239  12.004  1.00 0.00 ? 100 ILE A HG21 4  
ATOM   5890  H HG22 . ILE A 1 100 ? -8.390  -9.319  10.616  1.00 0.00 ? 100 ILE A HG22 4  
ATOM   5891  H HG23 . ILE A 1 100 ? -7.350  -9.447  12.055  1.00 0.00 ? 100 ILE A HG23 4  
ATOM   5892  H HD11 . ILE A 1 100 ? -7.685  -4.987  10.984  1.00 0.00 ? 100 ILE A HD11 4  
ATOM   5893  H HD12 . ILE A 1 100 ? -8.641  -6.089  12.006  1.00 0.00 ? 100 ILE A HD12 4  
ATOM   5894  H HD13 . ILE A 1 100 ? -7.500  -4.945  12.754  1.00 0.00 ? 100 ILE A HD13 4  
ATOM   5895  N N    . TYR A 1 101 ? -4.129  -8.384  12.109  1.00 0.00 ? 101 TYR A N    4  
ATOM   5896  C CA   . TYR A 1 101 ? -3.307  -8.943  13.169  1.00 0.00 ? 101 TYR A CA   4  
ATOM   5897  C C    . TYR A 1 101 ? -2.636  -7.836  13.984  1.00 0.00 ? 101 TYR A C    4  
ATOM   5898  O O    . TYR A 1 101 ? -3.306  -7.105  14.713  1.00 0.00 ? 101 TYR A O    4  
ATOM   5899  C CB   . TYR A 1 101 ? -2.228  -9.773  12.471  1.00 0.00 ? 101 TYR A CB   4  
ATOM   5900  C CG   . TYR A 1 101 ? -1.358  -10.592 13.427  1.00 0.00 ? 101 TYR A CG   4  
ATOM   5901  C CD1  . TYR A 1 101 ? -0.236  -10.029 13.997  1.00 0.00 ? 101 TYR A CD1  4  
ATOM   5902  C CD2  . TYR A 1 101 ? -1.698  -11.899 13.718  1.00 0.00 ? 101 TYR A CD2  4  
ATOM   5903  C CE1  . TYR A 1 101 ? 0.581   -10.801 14.897  1.00 0.00 ? 101 TYR A CE1  4  
ATOM   5904  C CE2  . TYR A 1 101 ? -0.880  -12.672 14.616  1.00 0.00 ? 101 TYR A CE2  4  
ATOM   5905  C CZ   . TYR A 1 101 ? 0.218   -12.085 15.161  1.00 0.00 ? 101 TYR A CZ   4  
ATOM   5906  O OH   . TYR A 1 101 ? 0.991   -12.815 16.011  1.00 0.00 ? 101 TYR A OH   4  
ATOM   5907  H H    . TYR A 1 101 ? -4.084  -7.388  12.020  1.00 0.00 ? 101 TYR A H    4  
ATOM   5908  H HA   . TYR A 1 101 ? -3.954  -9.527  13.823  1.00 0.00 ? 101 TYR A HA   4  
ATOM   5909  H HB2  . TYR A 1 101 ? -2.702  -10.446 11.759  1.00 0.00 ? 101 TYR A HB2  4  
ATOM   5910  H HB3  . TYR A 1 101 ? -1.586  -9.105  11.896  1.00 0.00 ? 101 TYR A HB3  4  
ATOM   5911  H HD1  . TYR A 1 101 ? 0.031   -8.997  13.767  1.00 0.00 ? 101 TYR A HD1  4  
ATOM   5912  H HD2  . TYR A 1 101 ? -2.584  -12.346 13.267  1.00 0.00 ? 101 TYR A HD2  4  
ATOM   5913  H HE1  . TYR A 1 101 ? 1.469   -10.367 15.353  1.00 0.00 ? 101 TYR A HE1  4  
ATOM   5914  H HE2  . TYR A 1 101 ? -1.137  -13.704 14.855  1.00 0.00 ? 101 TYR A HE2  4  
ATOM   5915  H HH   . TYR A 1 101 ? 1.404   -13.583 15.522  1.00 0.00 ? 101 TYR A HH   4  
ATOM   5916  N N    . GLY A 1 1   ? -31.627 -13.452 -17.779 1.00 0.00 ? 1   GLY A N    5  
ATOM   5917  C CA   . GLY A 1 1   ? -30.495 -14.055 -18.461 1.00 0.00 ? 1   GLY A CA   5  
ATOM   5918  C C    . GLY A 1 1   ? -29.274 -14.122 -17.543 1.00 0.00 ? 1   GLY A C    5  
ATOM   5919  O O    . GLY A 1 1   ? -29.382 -14.540 -16.392 1.00 0.00 ? 1   GLY A O    5  
ATOM   5920  H H1   . GLY A 1 1   ? -31.803 -12.496 -18.015 1.00 0.00 ? 1   GLY A H1   5  
ATOM   5921  H HA2  . GLY A 1 1   ? -30.760 -15.058 -18.797 1.00 0.00 ? 1   GLY A HA2  5  
ATOM   5922  H HA3  . GLY A 1 1   ? -30.253 -13.475 -19.352 1.00 0.00 ? 1   GLY A HA3  5  
ATOM   5923  N N    . PRO A 1 2   ? -28.110 -13.696 -18.101 1.00 0.00 ? 2   PRO A N    5  
ATOM   5924  C CA   . PRO A 1 2   ? -26.869 -13.704 -17.346 1.00 0.00 ? 2   PRO A CA   5  
ATOM   5925  C C    . PRO A 1 2   ? -26.839 -12.563 -16.327 1.00 0.00 ? 2   PRO A C    5  
ATOM   5926  O O    . PRO A 1 2   ? -27.593 -11.599 -16.449 1.00 0.00 ? 2   PRO A O    5  
ATOM   5927  C CB   . PRO A 1 2   ? -25.770 -13.597 -18.390 1.00 0.00 ? 2   PRO A CB   5  
ATOM   5928  C CG   . PRO A 1 2   ? -26.441 -13.065 -19.647 1.00 0.00 ? 2   PRO A CG   5  
ATOM   5929  C CD   . PRO A 1 2   ? -27.946 -13.195 -19.463 1.00 0.00 ? 2   PRO A CD   5  
ATOM   5930  H HA   . PRO A 1 2   ? -26.794 -14.547 -16.813 1.00 0.00 ? 2   PRO A HA   5  
ATOM   5931  H HB2  . PRO A 1 2   ? -24.979 -12.926 -18.057 1.00 0.00 ? 2   PRO A HB2  5  
ATOM   5932  H HB3  . PRO A 1 2   ? -25.310 -14.567 -18.573 1.00 0.00 ? 2   PRO A HB3  5  
ATOM   5933  H HG2  . PRO A 1 2   ? -26.165 -12.024 -19.816 1.00 0.00 ? 2   PRO A HG2  5  
ATOM   5934  H HG3  . PRO A 1 2   ? -26.115 -13.628 -20.520 1.00 0.00 ? 2   PRO A HG3  5  
ATOM   5935  H HD2  . PRO A 1 2   ? -28.444 -12.235 -19.595 1.00 0.00 ? 2   PRO A HD2  5  
ATOM   5936  H HD3  . PRO A 1 2   ? -28.375 -13.879 -20.193 1.00 0.00 ? 2   PRO A HD3  5  
ATOM   5937  N N    . LEU A 1 3   ? -25.961 -12.710 -15.346 1.00 0.00 ? 3   LEU A N    5  
ATOM   5938  C CA   . LEU A 1 3   ? -25.824 -11.703 -14.307 1.00 0.00 ? 3   LEU A CA   5  
ATOM   5939  C C    . LEU A 1 3   ? -24.373 -11.677 -13.816 1.00 0.00 ? 3   LEU A C    5  
ATOM   5940  O O    . LEU A 1 3   ? -23.822 -12.714 -13.450 1.00 0.00 ? 3   LEU A O    5  
ATOM   5941  C CB   . LEU A 1 3   ? -26.846 -11.940 -13.195 1.00 0.00 ? 3   LEU A CB   5  
ATOM   5942  C CG   . LEU A 1 3   ? -27.286 -10.698 -12.414 1.00 0.00 ? 3   LEU A CG   5  
ATOM   5943  C CD1  . LEU A 1 3   ? -26.095 -10.037 -11.718 1.00 0.00 ? 3   LEU A CD1  5  
ATOM   5944  C CD2  . LEU A 1 3   ? -28.038 -9.720  -13.320 1.00 0.00 ? 3   LEU A CD2  5  
ATOM   5945  H H    . LEU A 1 3   ? -25.351 -13.497 -15.255 1.00 0.00 ? 3   LEU A H    5  
ATOM   5946  H HA   . LEU A 1 3   ? -26.052 -10.737 -14.756 1.00 0.00 ? 3   LEU A HA   5  
ATOM   5947  H HB2  . LEU A 1 3   ? -27.731 -12.402 -13.632 1.00 0.00 ? 3   LEU A HB2  5  
ATOM   5948  H HB3  . LEU A 1 3   ? -26.427 -12.657 -12.489 1.00 0.00 ? 3   LEU A HB3  5  
ATOM   5949  H HG   . LEU A 1 3   ? -27.981 -11.014 -11.635 1.00 0.00 ? 3   LEU A HG   5  
ATOM   5950  H HD11 . LEU A 1 3   ? -25.568 -9.399  -12.428 1.00 0.00 ? 3   LEU A HD11 5  
ATOM   5951  H HD12 . LEU A 1 3   ? -26.453 -9.434  -10.883 1.00 0.00 ? 3   LEU A HD12 5  
ATOM   5952  H HD13 . LEU A 1 3   ? -25.418 -10.805 -11.347 1.00 0.00 ? 3   LEU A HD13 5  
ATOM   5953  H HD21 . LEU A 1 3   ? -27.380 -8.893  -13.585 1.00 0.00 ? 3   LEU A HD21 5  
ATOM   5954  H HD22 . LEU A 1 3   ? -28.356 -10.236 -14.227 1.00 0.00 ? 3   LEU A HD22 5  
ATOM   5955  H HD23 . LEU A 1 3   ? -28.912 -9.336  -12.793 1.00 0.00 ? 3   LEU A HD23 5  
ATOM   5956  N N    . GLY A 1 4   ? -23.801 -10.484 -13.826 1.00 0.00 ? 4   GLY A N    5  
ATOM   5957  C CA   . GLY A 1 4   ? -22.427 -10.309 -13.387 1.00 0.00 ? 4   GLY A CA   5  
ATOM   5958  C C    . GLY A 1 4   ? -22.322 -9.197  -12.342 1.00 0.00 ? 4   GLY A C    5  
ATOM   5959  O O    . GLY A 1 4   ? -23.055 -8.211  -12.403 1.00 0.00 ? 4   GLY A O    5  
ATOM   5960  H H    . GLY A 1 4   ? -24.259 -9.647  -14.127 1.00 0.00 ? 4   GLY A H    5  
ATOM   5961  H HA2  . GLY A 1 4   ? -22.054 -11.244 -12.967 1.00 0.00 ? 4   GLY A HA2  5  
ATOM   5962  H HA3  . GLY A 1 4   ? -21.796 -10.070 -14.243 1.00 0.00 ? 4   GLY A HA3  5  
ATOM   5963  N N    . SER A 1 5   ? -21.406 -9.394  -11.406 1.00 0.00 ? 5   SER A N    5  
ATOM   5964  C CA   . SER A 1 5   ? -21.196 -8.418  -10.348 1.00 0.00 ? 5   SER A CA   5  
ATOM   5965  C C    . SER A 1 5   ? -20.098 -8.904  -9.399  1.00 0.00 ? 5   SER A C    5  
ATOM   5966  O O    . SER A 1 5   ? -19.763 -10.087 -9.385  1.00 0.00 ? 5   SER A O    5  
ATOM   5967  C CB   . SER A 1 5   ? -22.489 -8.157  -9.575  1.00 0.00 ? 5   SER A CB   5  
ATOM   5968  O OG   . SER A 1 5   ? -22.540 -6.835  -9.051  1.00 0.00 ? 5   SER A OG   5  
ATOM   5969  H H    . SER A 1 5   ? -20.813 -10.198 -11.362 1.00 0.00 ? 5   SER A H    5  
ATOM   5970  H HA   . SER A 1 5   ? -20.886 -7.504  -10.856 1.00 0.00 ? 5   SER A HA   5  
ATOM   5971  H HB2  . SER A 1 5   ? -23.344 -8.321  -10.231 1.00 0.00 ? 5   SER A HB2  5  
ATOM   5972  H HB3  . SER A 1 5   ? -22.575 -8.876  -8.759  1.00 0.00 ? 5   SER A HB3  5  
ATOM   5973  H HG   . SER A 1 5   ? -23.411 -6.685  -8.581  1.00 0.00 ? 5   SER A HG   5  
ATOM   5974  N N    . LEU A 1 6   ? -19.567 -7.965  -8.631  1.00 0.00 ? 6   LEU A N    5  
ATOM   5975  C CA   . LEU A 1 6   ? -18.514 -8.282  -7.680  1.00 0.00 ? 6   LEU A CA   5  
ATOM   5976  C C    . LEU A 1 6   ? -17.219 -8.574  -8.439  1.00 0.00 ? 6   LEU A C    5  
ATOM   5977  O O    . LEU A 1 6   ? -17.253 -9.037  -9.579  1.00 0.00 ? 6   LEU A O    5  
ATOM   5978  C CB   . LEU A 1 6   ? -18.952 -9.419  -6.754  1.00 0.00 ? 6   LEU A CB   5  
ATOM   5979  C CG   . LEU A 1 6   ? -18.522 -9.297  -5.291  1.00 0.00 ? 6   LEU A CG   5  
ATOM   5980  C CD1  . LEU A 1 6   ? -19.309 -8.192  -4.581  1.00 0.00 ? 6   LEU A CD1  5  
ATOM   5981  C CD2  . LEU A 1 6   ? -18.642 -10.640 -4.571  1.00 0.00 ? 6   LEU A CD2  5  
ATOM   5982  H H    . LEU A 1 6   ? -19.844 -7.005  -8.647  1.00 0.00 ? 6   LEU A H    5  
ATOM   5983  H HA   . LEU A 1 6   ? -18.360 -7.401  -7.058  1.00 0.00 ? 6   LEU A HA   5  
ATOM   5984  H HB2  . LEU A 1 6   ? -20.039 -9.490  -6.789  1.00 0.00 ? 6   LEU A HB2  5  
ATOM   5985  H HB3  . LEU A 1 6   ? -18.559 -10.355 -7.151  1.00 0.00 ? 6   LEU A HB3  5  
ATOM   5986  H HG   . LEU A 1 6   ? -17.472 -9.010  -5.267  1.00 0.00 ? 6   LEU A HG   5  
ATOM   5987  H HD11 . LEU A 1 6   ? -19.665 -7.470  -5.316  1.00 0.00 ? 6   LEU A HD11 5  
ATOM   5988  H HD12 . LEU A 1 6   ? -20.159 -8.631  -4.059  1.00 0.00 ? 6   LEU A HD12 5  
ATOM   5989  H HD13 . LEU A 1 6   ? -18.660 -7.691  -3.862  1.00 0.00 ? 6   LEU A HD13 5  
ATOM   5990  H HD21 . LEU A 1 6   ? -18.300 -11.438 -5.229  1.00 0.00 ? 6   LEU A HD21 5  
ATOM   5991  H HD22 . LEU A 1 6   ? -18.027 -10.625 -3.670  1.00 0.00 ? 6   LEU A HD22 5  
ATOM   5992  H HD23 . LEU A 1 6   ? -19.683 -10.814 -4.297  1.00 0.00 ? 6   LEU A HD23 5  
ATOM   5993  N N    . ARG A 1 7   ? -16.106 -8.288  -7.780  1.00 0.00 ? 7   ARG A N    5  
ATOM   5994  C CA   . ARG A 1 7   ? -14.801 -8.513  -8.379  1.00 0.00 ? 7   ARG A CA   5  
ATOM   5995  C C    . ARG A 1 7   ? -13.701 -7.941  -7.485  1.00 0.00 ? 7   ARG A C    5  
ATOM   5996  O O    . ARG A 1 7   ? -13.748 -6.770  -7.107  1.00 0.00 ? 7   ARG A O    5  
ATOM   5997  C CB   . ARG A 1 7   ? -14.712 -7.868  -9.763  1.00 0.00 ? 7   ARG A CB   5  
ATOM   5998  C CG   . ARG A 1 7   ? -14.228 -8.875  -10.807 1.00 0.00 ? 7   ARG A CG   5  
ATOM   5999  C CD   . ARG A 1 7   ? -15.401 -9.426  -11.620 1.00 0.00 ? 7   ARG A CD   5  
ATOM   6000  N NE   . ARG A 1 7   ? -14.948 -9.779  -12.985 1.00 0.00 ? 7   ARG A NE   5  
ATOM   6001  C CZ   . ARG A 1 7   ? -15.765 -10.196 -13.963 1.00 0.00 ? 7   ARG A CZ   5  
ATOM   6002  N NH1  . ARG A 1 7   ? -17.079 -10.314 -13.732 1.00 0.00 ? 7   ARG A NH1  5  
ATOM   6003  N NH2  . ARG A 1 7   ? -15.267 -10.491 -15.171 1.00 0.00 ? 7   ARG A NH2  5  
ATOM   6004  H H    . ARG A 1 7   ? -16.086 -7.913  -6.854  1.00 0.00 ? 7   ARG A H    5  
ATOM   6005  H HA   . ARG A 1 7   ? -14.716 -9.597  -8.461  1.00 0.00 ? 7   ARG A HA   5  
ATOM   6006  H HB2  . ARG A 1 7   ? -15.689 -7.480  -10.051 1.00 0.00 ? 7   ARG A HB2  5  
ATOM   6007  H HB3  . ARG A 1 7   ? -14.031 -7.018  -9.728  1.00 0.00 ? 7   ARG A HB3  5  
ATOM   6008  H HG2  . ARG A 1 7   ? -13.511 -8.395  -11.476 1.00 0.00 ? 7   ARG A HG2  5  
ATOM   6009  H HG3  . ARG A 1 7   ? -13.705 -9.692  -10.314 1.00 0.00 ? 7   ARG A HG3  5  
ATOM   6010  H HD2  . ARG A 1 7   ? -15.812 -10.309 -11.126 1.00 0.00 ? 7   ARG A HD2  5  
ATOM   6011  H HD3  . ARG A 1 7   ? -16.198 -8.688  -11.672 1.00 0.00 ? 7   ARG A HD3  5  
ATOM   6012  H HE   . ARG A 1 7   ? -13.974 -9.700  -13.192 1.00 0.00 ? 7   ARG A HE   5  
ATOM   6013  H HH11 . ARG A 1 7   ? -17.452 -10.093 -12.831 1.00 0.00 ? 7   ARG A HH11 5  
ATOM   6014  H HH12 . ARG A 1 7   ? -17.690 -10.624 -14.462 1.00 0.00 ? 7   ARG A HH12 5  
ATOM   6015  H HH21 . ARG A 1 7   ? -14.286 -10.402 -15.343 1.00 0.00 ? 7   ARG A HH21 5  
ATOM   6016  H HH22 . ARG A 1 7   ? -15.876 -10.802 -15.900 1.00 0.00 ? 7   ARG A HH22 5  
ATOM   6017  N N    . LYS A 1 8   ? -12.734 -8.792  -7.169  1.00 0.00 ? 8   LYS A N    5  
ATOM   6018  C CA   . LYS A 1 8   ? -11.624 -8.386  -6.325  1.00 0.00 ? 8   LYS A CA   5  
ATOM   6019  C C    . LYS A 1 8   ? -10.357 -9.117  -6.772  1.00 0.00 ? 8   LYS A C    5  
ATOM   6020  O O    . LYS A 1 8   ? -10.432 -10.184 -7.378  1.00 0.00 ? 8   LYS A O    5  
ATOM   6021  C CB   . LYS A 1 8   ? -11.968 -8.593  -4.851  1.00 0.00 ? 8   LYS A CB   5  
ATOM   6022  C CG   . LYS A 1 8   ? -12.531 -7.311  -4.233  1.00 0.00 ? 8   LYS A CG   5  
ATOM   6023  C CD   . LYS A 1 8   ? -12.481 -7.370  -2.704  1.00 0.00 ? 8   LYS A CD   5  
ATOM   6024  C CE   . LYS A 1 8   ? -13.874 -7.164  -2.102  1.00 0.00 ? 8   LYS A CE   5  
ATOM   6025  N NZ   . LYS A 1 8   ? -14.675 -8.402  -2.214  1.00 0.00 ? 8   LYS A NZ   5  
ATOM   6026  H H    . LYS A 1 8   ? -12.703 -9.741  -7.481  1.00 0.00 ? 8   LYS A H    5  
ATOM   6027  H HA   . LYS A 1 8   ? -11.476 -7.315  -6.474  1.00 0.00 ? 8   LYS A HA   5  
ATOM   6028  H HB2  . LYS A 1 8   ? -12.696 -9.399  -4.751  1.00 0.00 ? 8   LYS A HB2  5  
ATOM   6029  H HB3  . LYS A 1 8   ? -11.075 -8.901  -4.305  1.00 0.00 ? 8   LYS A HB3  5  
ATOM   6030  H HG2  . LYS A 1 8   ? -11.961 -6.453  -4.584  1.00 0.00 ? 8   LYS A HG2  5  
ATOM   6031  H HG3  . LYS A 1 8   ? -13.560 -7.167  -4.562  1.00 0.00 ? 8   LYS A HG3  5  
ATOM   6032  H HD2  . LYS A 1 8   ? -12.084 -8.335  -2.387  1.00 0.00 ? 8   LYS A HD2  5  
ATOM   6033  H HD3  . LYS A 1 8   ? -11.801 -6.606  -2.329  1.00 0.00 ? 8   LYS A HD3  5  
ATOM   6034  H HE2  . LYS A 1 8   ? -13.783 -6.876  -1.055  1.00 0.00 ? 8   LYS A HE2  5  
ATOM   6035  H HE3  . LYS A 1 8   ? -14.380 -6.346  -2.616  1.00 0.00 ? 8   LYS A HE3  5  
ATOM   6036  H HZ1  . LYS A 1 8   ? -15.606 -8.227  -1.893  1.00 0.00 ? 8   LYS A HZ1  5  
ATOM   6037  H HZ2  . LYS A 1 8   ? -14.703 -8.696  -3.170  1.00 0.00 ? 8   LYS A HZ2  5  
ATOM   6038  H HZ3  . LYS A 1 8   ? -14.260 -9.121  -1.658  1.00 0.00 ? 8   LYS A HZ3  5  
ATOM   6039  N N    . GLU A 1 9   ? -9.221  -8.514  -6.453  1.00 0.00 ? 9   GLU A N    5  
ATOM   6040  C CA   . GLU A 1 9   ? -7.938  -9.095  -6.811  1.00 0.00 ? 9   GLU A CA   5  
ATOM   6041  C C    . GLU A 1 9   ? -6.818  -8.070  -6.624  1.00 0.00 ? 9   GLU A C    5  
ATOM   6042  O O    . GLU A 1 9   ? -7.082  -6.907  -6.323  1.00 0.00 ? 9   GLU A O    5  
ATOM   6043  C CB   . GLU A 1 9   ? -7.961  -9.627  -8.247  1.00 0.00 ? 9   GLU A CB   5  
ATOM   6044  C CG   . GLU A 1 9   ? -7.827  -11.150 -8.268  1.00 0.00 ? 9   GLU A CG   5  
ATOM   6045  C CD   . GLU A 1 9   ? -7.152  -11.623 -9.559  1.00 0.00 ? 9   GLU A CD   5  
ATOM   6046  O OE1  . GLU A 1 9   ? -7.426  -10.999 -10.605 1.00 0.00 ? 9   GLU A OE1  5  
ATOM   6047  O OE2  . GLU A 1 9   ? -6.377  -12.599 -9.468  1.00 0.00 ? 9   GLU A OE2  5  
ATOM   6048  H H    . GLU A 1 9   ? -9.167  -7.646  -5.958  1.00 0.00 ? 9   GLU A H    5  
ATOM   6049  H HA   . GLU A 1 9   ? -7.795  -9.929  -6.125  1.00 0.00 ? 9   GLU A HA   5  
ATOM   6050  H HB2  . GLU A 1 9   ? -8.889  -9.332  -8.733  1.00 0.00 ? 9   GLU A HB2  5  
ATOM   6051  H HB3  . GLU A 1 9   ? -7.146  -9.179  -8.816  1.00 0.00 ? 9   GLU A HB3  5  
ATOM   6052  H HG2  . GLU A 1 9   ? -7.246  -11.482 -7.409  1.00 0.00 ? 9   GLU A HG2  5  
ATOM   6053  H HG3  . GLU A 1 9   ? -8.814  -11.606 -8.182  1.00 0.00 ? 9   GLU A HG3  5  
ATOM   6054  N N    . PRO A 1 10  ? -5.561  -8.550  -6.816  1.00 0.00 ? 10  PRO A N    5  
ATOM   6055  C CA   . PRO A 1 10  ? -4.400  -7.687  -6.671  1.00 0.00 ? 10  PRO A CA   5  
ATOM   6056  C C    . PRO A 1 10  ? -4.262  -6.748  -7.871  1.00 0.00 ? 10  PRO A C    5  
ATOM   6057  O O    . PRO A 1 10  ? -4.324  -7.188  -9.018  1.00 0.00 ? 10  PRO A O    5  
ATOM   6058  C CB   . PRO A 1 10  ? -3.222  -8.636  -6.519  1.00 0.00 ? 10  PRO A CB   5  
ATOM   6059  C CG   . PRO A 1 10  ? -3.698  -9.979  -7.048  1.00 0.00 ? 10  PRO A CG   5  
ATOM   6060  C CD   . PRO A 1 10  ? -5.211  -9.921  -7.175  1.00 0.00 ? 10  PRO A CD   5  
ATOM   6061  H HA   . PRO A 1 10  ? -4.505  -7.095  -5.871  1.00 0.00 ? 10  PRO A HA   5  
ATOM   6062  H HB2  . PRO A 1 10  ? -2.359  -8.278  -7.080  1.00 0.00 ? 10  PRO A HB2  5  
ATOM   6063  H HB3  . PRO A 1 10  ? -2.915  -8.713  -5.476  1.00 0.00 ? 10  PRO A HB3  5  
ATOM   6064  H HG2  . PRO A 1 10  ? -3.242  -10.192 -8.014  1.00 0.00 ? 10  PRO A HG2  5  
ATOM   6065  H HG3  . PRO A 1 10  ? -3.402  -10.782 -6.373  1.00 0.00 ? 10  PRO A HG3  5  
ATOM   6066  H HD2  . PRO A 1 10  ? -5.534  -10.160 -8.187  1.00 0.00 ? 10  PRO A HD2  5  
ATOM   6067  H HD3  . PRO A 1 10  ? -5.692  -10.639 -6.509  1.00 0.00 ? 10  PRO A HD3  5  
ATOM   6068  N N    . GLU A 1 11  ? -4.078  -5.472  -7.565  1.00 0.00 ? 11  GLU A N    5  
ATOM   6069  C CA   . GLU A 1 11  ? -3.929  -4.467  -8.604  1.00 0.00 ? 11  GLU A CA   5  
ATOM   6070  C C    . GLU A 1 11  ? -2.982  -3.358  -8.139  1.00 0.00 ? 11  GLU A C    5  
ATOM   6071  O O    . GLU A 1 11  ? -2.643  -3.282  -6.959  1.00 0.00 ? 11  GLU A O    5  
ATOM   6072  C CB   . GLU A 1 11  ? -5.289  -3.895  -9.010  1.00 0.00 ? 11  GLU A CB   5  
ATOM   6073  C CG   . GLU A 1 11  ? -5.656  -4.314  -10.435 1.00 0.00 ? 11  GLU A CG   5  
ATOM   6074  C CD   . GLU A 1 11  ? -6.551  -3.266  -11.101 1.00 0.00 ? 11  GLU A CD   5  
ATOM   6075  O OE1  . GLU A 1 11  ? -7.774  -3.325  -10.854 1.00 0.00 ? 11  GLU A OE1  5  
ATOM   6076  O OE2  . GLU A 1 11  ? -5.990  -2.430  -11.842 1.00 0.00 ? 11  GLU A OE2  5  
ATOM   6077  H H    . GLU A 1 11  ? -4.027  -5.123  -6.629  1.00 0.00 ? 11  GLU A H    5  
ATOM   6078  H HA   . GLU A 1 11  ? -3.492  -4.993  -9.455  1.00 0.00 ? 11  GLU A HA   5  
ATOM   6079  H HB2  . GLU A 1 11  ? -6.055  -4.242  -8.317  1.00 0.00 ? 11  GLU A HB2  5  
ATOM   6080  H HB3  . GLU A 1 11  ? -5.264  -2.807  -8.942  1.00 0.00 ? 11  GLU A HB3  5  
ATOM   6081  H HG2  . GLU A 1 11  ? -4.748  -4.449  -11.024 1.00 0.00 ? 11  GLU A HG2  5  
ATOM   6082  H HG3  . GLU A 1 11  ? -6.168  -5.275  -10.415 1.00 0.00 ? 11  GLU A HG3  5  
ATOM   6083  N N    . ILE A 1 12  ? -2.586  -2.525  -9.090  1.00 0.00 ? 12  ILE A N    5  
ATOM   6084  C CA   . ILE A 1 12  ? -1.687  -1.423  -8.793  1.00 0.00 ? 12  ILE A CA   5  
ATOM   6085  C C    . ILE A 1 12  ? -2.508  -0.186  -8.425  1.00 0.00 ? 12  ILE A C    5  
ATOM   6086  O O    . ILE A 1 12  ? -3.152  0.414   -9.284  1.00 0.00 ? 12  ILE A O    5  
ATOM   6087  C CB   . ILE A 1 12  ? -0.717  -1.196  -9.953  1.00 0.00 ? 12  ILE A CB   5  
ATOM   6088  C CG1  . ILE A 1 12  ? 0.477   -0.347  -9.511  1.00 0.00 ? 12  ILE A CG1  5  
ATOM   6089  C CG2  . ILE A 1 12  ? -1.437  -0.588  -11.158 1.00 0.00 ? 12  ILE A CG2  5  
ATOM   6090  C CD1  . ILE A 1 12  ? 1.712   -0.655  -10.359 1.00 0.00 ? 12  ILE A CD1  5  
ATOM   6091  H H    . ILE A 1 12  ? -2.869  -2.594  -10.048 1.00 0.00 ? 12  ILE A H    5  
ATOM   6092  H HA   . ILE A 1 12  ? -1.092  -1.714  -7.926  1.00 0.00 ? 12  ILE A HA   5  
ATOM   6093  H HB   . ILE A 1 12  ? -0.326  -2.164  -10.266 1.00 0.00 ? 12  ILE A HB   5  
ATOM   6094  H HG12 . ILE A 1 12  ? 0.228   0.710   -9.596  1.00 0.00 ? 12  ILE A HG12 5  
ATOM   6095  H HG13 . ILE A 1 12  ? 0.696   -0.539  -8.461  1.00 0.00 ? 12  ILE A HG13 5  
ATOM   6096  H HG21 . ILE A 1 12  ? -0.958  -0.928  -12.077 1.00 0.00 ? 12  ILE A HG21 5  
ATOM   6097  H HG22 . ILE A 1 12  ? -2.480  -0.902  -11.154 1.00 0.00 ? 12  ILE A HG22 5  
ATOM   6098  H HG23 . ILE A 1 12  ? -1.384  0.499   -11.103 1.00 0.00 ? 12  ILE A HG23 5  
ATOM   6099  H HD11 . ILE A 1 12  ? 2.010   -1.693  -10.204 1.00 0.00 ? 12  ILE A HD11 5  
ATOM   6100  H HD12 . ILE A 1 12  ? 1.480   -0.498  -11.411 1.00 0.00 ? 12  ILE A HD12 5  
ATOM   6101  H HD13 . ILE A 1 12  ? 2.528   0.005   -10.066 1.00 0.00 ? 12  ILE A HD13 5  
ATOM   6102  N N    . ILE A 1 13  ? -2.459  0.159   -7.146  1.00 0.00 ? 13  ILE A N    5  
ATOM   6103  C CA   . ILE A 1 13  ? -3.191  1.316   -6.655  1.00 0.00 ? 13  ILE A CA   5  
ATOM   6104  C C    . ILE A 1 13  ? -2.267  2.535   -6.655  1.00 0.00 ? 13  ILE A C    5  
ATOM   6105  O O    . ILE A 1 13  ? -1.052  2.399   -6.512  1.00 0.00 ? 13  ILE A O    5  
ATOM   6106  C CB   . ILE A 1 13  ? -3.811  1.014   -5.290  1.00 0.00 ? 13  ILE A CB   5  
ATOM   6107  C CG1  . ILE A 1 13  ? -4.217  -0.458  -5.184  1.00 0.00 ? 13  ILE A CG1  5  
ATOM   6108  C CG2  . ILE A 1 13  ? -4.985  1.954   -5.002  1.00 0.00 ? 13  ILE A CG2  5  
ATOM   6109  C CD1  . ILE A 1 13  ? -5.079  -0.877  -6.376  1.00 0.00 ? 13  ILE A CD1  5  
ATOM   6110  H H    . ILE A 1 13  ? -1.933  -0.333  -6.453  1.00 0.00 ? 13  ILE A H    5  
ATOM   6111  H HA   . ILE A 1 13  ? -4.010  1.502   -7.349  1.00 0.00 ? 13  ILE A HA   5  
ATOM   6112  H HB   . ILE A 1 13  ? -3.059  1.197   -4.525  1.00 0.00 ? 13  ILE A HB   5  
ATOM   6113  H HG12 . ILE A 1 13  ? -3.324  -1.081  -5.139  1.00 0.00 ? 13  ILE A HG12 5  
ATOM   6114  H HG13 . ILE A 1 13  ? -4.768  -0.621  -4.258  1.00 0.00 ? 13  ILE A HG13 5  
ATOM   6115  H HG21 . ILE A 1 13  ? -5.542  1.586   -4.142  1.00 0.00 ? 13  ILE A HG21 5  
ATOM   6116  H HG22 . ILE A 1 13  ? -4.607  2.954   -4.791  1.00 0.00 ? 13  ILE A HG22 5  
ATOM   6117  H HG23 . ILE A 1 13  ? -5.641  1.990   -5.872  1.00 0.00 ? 13  ILE A HG23 5  
ATOM   6118  H HD11 . ILE A 1 13  ? -4.482  -1.479  -7.061  1.00 0.00 ? 13  ILE A HD11 5  
ATOM   6119  H HD12 . ILE A 1 13  ? -5.929  -1.460  -6.023  1.00 0.00 ? 13  ILE A HD12 5  
ATOM   6120  H HD13 . ILE A 1 13  ? -5.439  0.014   -6.895  1.00 0.00 ? 13  ILE A HD13 5  
ATOM   6121  N N    . THR A 1 14  ? -2.878  3.699   -6.818  1.00 0.00 ? 14  THR A N    5  
ATOM   6122  C CA   . THR A 1 14  ? -2.126  4.942   -6.840  1.00 0.00 ? 14  THR A CA   5  
ATOM   6123  C C    . THR A 1 14  ? -2.865  6.026   -6.052  1.00 0.00 ? 14  THR A C    5  
ATOM   6124  O O    . THR A 1 14  ? -3.974  6.415   -6.417  1.00 0.00 ? 14  THR A O    5  
ATOM   6125  C CB   . THR A 1 14  ? -1.874  5.318   -8.300  1.00 0.00 ? 14  THR A CB   5  
ATOM   6126  O OG1  . THR A 1 14  ? -1.279  6.612   -8.230  1.00 0.00 ? 14  THR A OG1  5  
ATOM   6127  C CG2  . THR A 1 14  ? -3.172  5.547   -9.079  1.00 0.00 ? 14  THR A CG2  5  
ATOM   6128  H H    . THR A 1 14  ? -3.867  3.801   -6.935  1.00 0.00 ? 14  THR A H    5  
ATOM   6129  H HA   . THR A 1 14  ? -1.173  4.777   -6.337  1.00 0.00 ? 14  THR A HA   5  
ATOM   6130  H HB   . THR A 1 14  ? -1.252  4.571   -8.793  1.00 0.00 ? 14  THR A HB   5  
ATOM   6131  H HG1  . THR A 1 14  ? -0.439  6.632   -8.772  1.00 0.00 ? 14  THR A HG1  5  
ATOM   6132  H HG21 . THR A 1 14  ? -3.821  4.680   -8.966  1.00 0.00 ? 14  THR A HG21 5  
ATOM   6133  H HG22 . THR A 1 14  ? -3.676  6.432   -8.691  1.00 0.00 ? 14  THR A HG22 5  
ATOM   6134  H HG23 . THR A 1 14  ? -2.941  5.695   -10.134 1.00 0.00 ? 14  THR A HG23 5  
ATOM   6135  N N    . VAL A 1 15  ? -2.222  6.483   -4.988  1.00 0.00 ? 15  VAL A N    5  
ATOM   6136  C CA   . VAL A 1 15  ? -2.804  7.513   -4.146  1.00 0.00 ? 15  VAL A CA   5  
ATOM   6137  C C    . VAL A 1 15  ? -1.990  8.803   -4.288  1.00 0.00 ? 15  VAL A C    5  
ATOM   6138  O O    . VAL A 1 15  ? -0.782  8.755   -4.515  1.00 0.00 ? 15  VAL A O    5  
ATOM   6139  C CB   . VAL A 1 15  ? -2.895  7.020   -2.702  1.00 0.00 ? 15  VAL A CB   5  
ATOM   6140  C CG1  . VAL A 1 15  ? -4.220  7.439   -2.060  1.00 0.00 ? 15  VAL A CG1  5  
ATOM   6141  C CG2  . VAL A 1 15  ? -2.705  5.503   -2.628  1.00 0.00 ? 15  VAL A CG2  5  
ATOM   6142  H H    . VAL A 1 15  ? -1.319  6.160   -4.700  1.00 0.00 ? 15  VAL A H    5  
ATOM   6143  H HA   . VAL A 1 15  ? -3.816  7.698   -4.504  1.00 0.00 ? 15  VAL A HA   5  
ATOM   6144  H HB   . VAL A 1 15  ? -2.087  7.486   -2.136  1.00 0.00 ? 15  VAL A HB   5  
ATOM   6145  H HG11 . VAL A 1 15  ? -4.320  8.523   -2.109  1.00 0.00 ? 15  VAL A HG11 5  
ATOM   6146  H HG12 . VAL A 1 15  ? -5.046  6.973   -2.598  1.00 0.00 ? 15  VAL A HG12 5  
ATOM   6147  H HG13 . VAL A 1 15  ? -4.238  7.119   -1.019  1.00 0.00 ? 15  VAL A HG13 5  
ATOM   6148  H HG21 . VAL A 1 15  ? -1.640  5.272   -2.616  1.00 0.00 ? 15  VAL A HG21 5  
ATOM   6149  H HG22 . VAL A 1 15  ? -3.168  5.125   -1.717  1.00 0.00 ? 15  VAL A HG22 5  
ATOM   6150  H HG23 . VAL A 1 15  ? -3.171  5.036   -3.494  1.00 0.00 ? 15  VAL A HG23 5  
ATOM   6151  N N    . THR A 1 16  ? -2.685  9.922   -4.148  1.00 0.00 ? 16  THR A N    5  
ATOM   6152  C CA   . THR A 1 16  ? -2.042  11.220  -4.258  1.00 0.00 ? 16  THR A CA   5  
ATOM   6153  C C    . THR A 1 16  ? -2.318  12.058  -3.008  1.00 0.00 ? 16  THR A C    5  
ATOM   6154  O O    . THR A 1 16  ? -3.374  11.931  -2.390  1.00 0.00 ? 16  THR A O    5  
ATOM   6155  C CB   . THR A 1 16  ? -2.526  11.880  -5.550  1.00 0.00 ? 16  THR A CB   5  
ATOM   6156  O OG1  . THR A 1 16  ? -1.932  11.096  -6.583  1.00 0.00 ? 16  THR A OG1  5  
ATOM   6157  C CG2  . THR A 1 16  ? -1.932  13.276  -5.754  1.00 0.00 ? 16  THR A CG2  5  
ATOM   6158  H H    . THR A 1 16  ? -3.667  9.950   -3.964  1.00 0.00 ? 16  THR A H    5  
ATOM   6159  H HA   . THR A 1 16  ? -0.964  11.066  -4.309  1.00 0.00 ? 16  THR A HA   5  
ATOM   6160  H HB   . THR A 1 16  ? -3.613  11.910  -5.588  1.00 0.00 ? 16  THR A HB   5  
ATOM   6161  H HG1  . THR A 1 16  ? -2.430  10.233  -6.686  1.00 0.00 ? 16  THR A HG1  5  
ATOM   6162  H HG21 . THR A 1 16  ? -1.241  13.497  -4.942  1.00 0.00 ? 16  THR A HG21 5  
ATOM   6163  H HG22 . THR A 1 16  ? -1.399  13.307  -6.704  1.00 0.00 ? 16  THR A HG22 5  
ATOM   6164  H HG23 . THR A 1 16  ? -2.733  14.013  -5.761  1.00 0.00 ? 16  THR A HG23 5  
ATOM   6165  N N    . LEU A 1 17  ? -1.349  12.898  -2.673  1.00 0.00 ? 17  LEU A N    5  
ATOM   6166  C CA   . LEU A 1 17  ? -1.474  13.756  -1.508  1.00 0.00 ? 17  LEU A CA   5  
ATOM   6167  C C    . LEU A 1 17  ? -2.397  14.931  -1.842  1.00 0.00 ? 17  LEU A C    5  
ATOM   6168  O O    . LEU A 1 17  ? -1.983  15.883  -2.499  1.00 0.00 ? 17  LEU A O    5  
ATOM   6169  C CB   . LEU A 1 17  ? -0.093  14.185  -1.008  1.00 0.00 ? 17  LEU A CB   5  
ATOM   6170  C CG   . LEU A 1 17  ? 0.588   13.233  -0.020  1.00 0.00 ? 17  LEU A CG   5  
ATOM   6171  C CD1  . LEU A 1 17  ? 1.061   13.985  1.226   1.00 0.00 ? 17  LEU A CD1  5  
ATOM   6172  C CD2  . LEU A 1 17  ? -0.330  12.061  0.331   1.00 0.00 ? 17  LEU A CD2  5  
ATOM   6173  H H    . LEU A 1 17  ? -0.492  12.995  -3.180  1.00 0.00 ? 17  LEU A H    5  
ATOM   6174  H HA   . LEU A 1 17  ? -1.936  13.168  -0.716  1.00 0.00 ? 17  LEU A HA   5  
ATOM   6175  H HB2  . LEU A 1 17  ? 0.562   14.311  -1.870  1.00 0.00 ? 17  LEU A HB2  5  
ATOM   6176  H HB3  . LEU A 1 17  ? -0.186  15.162  -0.535  1.00 0.00 ? 17  LEU A HB3  5  
ATOM   6177  H HG   . LEU A 1 17  ? 1.472   12.818  -0.501  1.00 0.00 ? 17  LEU A HG   5  
ATOM   6178  H HD11 . LEU A 1 17  ? 1.499   14.937  0.932   1.00 0.00 ? 17  LEU A HD11 5  
ATOM   6179  H HD12 . LEU A 1 17  ? 0.212   14.163  1.887   1.00 0.00 ? 17  LEU A HD12 5  
ATOM   6180  H HD13 . LEU A 1 17  ? 1.808   13.386  1.749   1.00 0.00 ? 17  LEU A HD13 5  
ATOM   6181  H HD21 . LEU A 1 17  ? -0.725  11.623  -0.585  1.00 0.00 ? 17  LEU A HD21 5  
ATOM   6182  H HD22 . LEU A 1 17  ? 0.237   11.308  0.879   1.00 0.00 ? 17  LEU A HD22 5  
ATOM   6183  H HD23 . LEU A 1 17  ? -1.153  12.417  0.951   1.00 0.00 ? 17  LEU A HD23 5  
ATOM   6184  N N    . LYS A 1 18  ? -3.631  14.822  -1.372  1.00 0.00 ? 18  LYS A N    5  
ATOM   6185  C CA   . LYS A 1 18  ? -4.618  15.862  -1.612  1.00 0.00 ? 18  LYS A CA   5  
ATOM   6186  C C    . LYS A 1 18  ? -4.533  16.905  -0.498  1.00 0.00 ? 18  LYS A C    5  
ATOM   6187  O O    . LYS A 1 18  ? -4.439  18.103  -0.770  1.00 0.00 ? 18  LYS A O    5  
ATOM   6188  C CB   . LYS A 1 18  ? -6.010  15.251  -1.778  1.00 0.00 ? 18  LYS A CB   5  
ATOM   6189  C CG   . LYS A 1 18  ? -6.988  16.267  -2.375  1.00 0.00 ? 18  LYS A CG   5  
ATOM   6190  C CD   . LYS A 1 18  ? -8.364  16.158  -1.716  1.00 0.00 ? 18  LYS A CD   5  
ATOM   6191  C CE   . LYS A 1 18  ? -8.661  17.390  -0.857  1.00 0.00 ? 18  LYS A CE   5  
ATOM   6192  N NZ   . LYS A 1 18  ? -8.983  18.552  -1.715  1.00 0.00 ? 18  LYS A NZ   5  
ATOM   6193  H H    . LYS A 1 18  ? -3.961  14.043  -0.837  1.00 0.00 ? 18  LYS A H    5  
ATOM   6194  H HA   . LYS A 1 18  ? -4.362  16.344  -2.557  1.00 0.00 ? 18  LYS A HA   5  
ATOM   6195  H HB2  . LYS A 1 18  ? -5.954  14.375  -2.422  1.00 0.00 ? 18  LYS A HB2  5  
ATOM   6196  H HB3  . LYS A 1 18  ? -6.381  14.911  -0.811  1.00 0.00 ? 18  LYS A HB3  5  
ATOM   6197  H HG2  . LYS A 1 18  ? -6.595  17.276  -2.240  1.00 0.00 ? 18  LYS A HG2  5  
ATOM   6198  H HG3  . LYS A 1 18  ? -7.080  16.101  -3.448  1.00 0.00 ? 18  LYS A HG3  5  
ATOM   6199  H HD2  . LYS A 1 18  ? -9.130  16.050  -2.483  1.00 0.00 ? 18  LYS A HD2  5  
ATOM   6200  H HD3  . LYS A 1 18  ? -8.405  15.261  -1.097  1.00 0.00 ? 18  LYS A HD3  5  
ATOM   6201  H HE2  . LYS A 1 18  ? -9.496  17.182  -0.189  1.00 0.00 ? 18  LYS A HE2  5  
ATOM   6202  H HE3  . LYS A 1 18  ? -7.799  17.620  -0.232  1.00 0.00 ? 18  LYS A HE3  5  
ATOM   6203  H HZ1  . LYS A 1 18  ? -8.635  18.391  -2.640  1.00 0.00 ? 18  LYS A HZ1  5  
ATOM   6204  H HZ2  . LYS A 1 18  ? -9.973  18.678  -1.748  1.00 0.00 ? 18  LYS A HZ2  5  
ATOM   6205  H HZ3  . LYS A 1 18  ? -8.554  19.374  -1.338  1.00 0.00 ? 18  LYS A HZ3  5  
ATOM   6206  N N    . LYS A 1 19  ? -4.568  16.416  0.733   1.00 0.00 ? 19  LYS A N    5  
ATOM   6207  C CA   . LYS A 1 19  ? -4.495  17.294  1.890   1.00 0.00 ? 19  LYS A CA   5  
ATOM   6208  C C    . LYS A 1 19  ? -3.028  17.514  2.265   1.00 0.00 ? 19  LYS A C    5  
ATOM   6209  O O    . LYS A 1 19  ? -2.726  18.300  3.163   1.00 0.00 ? 19  LYS A O    5  
ATOM   6210  C CB   . LYS A 1 19  ? -5.346  16.740  3.035   1.00 0.00 ? 19  LYS A CB   5  
ATOM   6211  C CG   . LYS A 1 19  ? -5.336  17.691  4.232   1.00 0.00 ? 19  LYS A CG   5  
ATOM   6212  C CD   . LYS A 1 19  ? -6.712  17.744  4.903   1.00 0.00 ? 19  LYS A CD   5  
ATOM   6213  C CE   . LYS A 1 19  ? -7.531  18.926  4.380   1.00 0.00 ? 19  LYS A CE   5  
ATOM   6214  N NZ   . LYS A 1 19  ? -6.986  20.202  4.895   1.00 0.00 ? 19  LYS A NZ   5  
ATOM   6215  H H    . LYS A 1 19  ? -4.642  15.442  0.945   1.00 0.00 ? 19  LYS A H    5  
ATOM   6216  H HA   . LYS A 1 19  ? -4.926  18.251  1.601   1.00 0.00 ? 19  LYS A HA   5  
ATOM   6217  H HB2  . LYS A 1 19  ? -6.371  16.592  2.693   1.00 0.00 ? 19  LYS A HB2  5  
ATOM   6218  H HB3  . LYS A 1 19  ? -4.967  15.764  3.335   1.00 0.00 ? 19  LYS A HB3  5  
ATOM   6219  H HG2  . LYS A 1 19  ? -4.589  17.362  4.955   1.00 0.00 ? 19  LYS A HG2  5  
ATOM   6220  H HG3  . LYS A 1 19  ? -5.047  18.690  3.909   1.00 0.00 ? 19  LYS A HG3  5  
ATOM   6221  H HD2  . LYS A 1 19  ? -7.248  16.814  4.715   1.00 0.00 ? 19  LYS A HD2  5  
ATOM   6222  H HD3  . LYS A 1 19  ? -6.591  17.828  5.982   1.00 0.00 ? 19  LYS A HD3  5  
ATOM   6223  H HE2  . LYS A 1 19  ? -7.516  18.931  3.289   1.00 0.00 ? 19  LYS A HE2  5  
ATOM   6224  H HE3  . LYS A 1 19  ? -8.571  18.819  4.685   1.00 0.00 ? 19  LYS A HE3  5  
ATOM   6225  H HZ1  . LYS A 1 19  ? -5.987  20.150  4.927   1.00 0.00 ? 19  LYS A HZ1  5  
ATOM   6226  H HZ2  . LYS A 1 19  ? -7.259  20.951  4.289   1.00 0.00 ? 19  LYS A HZ2  5  
ATOM   6227  H HZ3  . LYS A 1 19  ? -7.342  20.370  5.814   1.00 0.00 ? 19  LYS A HZ3  5  
ATOM   6228  N N    . GLN A 1 20  ? -2.156  16.807  1.562   1.00 0.00 ? 20  GLN A N    5  
ATOM   6229  C CA   . GLN A 1 20  ? -0.730  16.917  1.810   1.00 0.00 ? 20  GLN A CA   5  
ATOM   6230  C C    . GLN A 1 20  ? -0.428  16.662  3.289   1.00 0.00 ? 20  GLN A C    5  
ATOM   6231  O O    . GLN A 1 20  ? 0.414   17.337  3.880   1.00 0.00 ? 20  GLN A O    5  
ATOM   6232  C CB   . GLN A 1 20  ? -0.199  18.283  1.370   1.00 0.00 ? 20  GLN A CB   5  
ATOM   6233  C CG   . GLN A 1 20  ? -0.068  18.356  -0.152  1.00 0.00 ? 20  GLN A CG   5  
ATOM   6234  C CD   . GLN A 1 20  ? 0.490   19.712  -0.589  1.00 0.00 ? 20  GLN A CD   5  
ATOM   6235  O OE1  . GLN A 1 20  ? -0.235  20.665  -0.820  1.00 0.00 ? 20  GLN A OE1  5  
ATOM   6236  N NE2  . GLN A 1 20  ? 1.816   19.744  -0.691  1.00 0.00 ? 20  GLN A NE2  5  
ATOM   6237  H H    . GLN A 1 20  ? -2.411  16.171  0.834   1.00 0.00 ? 20  GLN A H    5  
ATOM   6238  H HA   . GLN A 1 20  ? -0.269  16.140  1.199   1.00 0.00 ? 20  GLN A HA   5  
ATOM   6239  H HB2  . GLN A 1 20  ? -0.871  19.067  1.719   1.00 0.00 ? 20  GLN A HB2  5  
ATOM   6240  H HB3  . GLN A 1 20  ? 0.772   18.466  1.832   1.00 0.00 ? 20  GLN A HB3  5  
ATOM   6241  H HG2  . GLN A 1 20  ? 0.587   17.559  -0.502  1.00 0.00 ? 20  GLN A HG2  5  
ATOM   6242  H HG3  . GLN A 1 20  ? -1.043  18.193  -0.612  1.00 0.00 ? 20  GLN A HG3  5  
ATOM   6243  H HE21 . GLN A 1 20  ? 2.352   18.924  -0.488  1.00 0.00 ? 20  GLN A HE21 5  
ATOM   6244  H HE22 . GLN A 1 20  ? 2.276   20.586  -0.971  1.00 0.00 ? 20  GLN A HE22 5  
ATOM   6245  N N    . ASN A 1 21  ? -1.130  15.683  3.843   1.00 0.00 ? 21  ASN A N    5  
ATOM   6246  C CA   . ASN A 1 21  ? -0.947  15.330  5.239   1.00 0.00 ? 21  ASN A CA   5  
ATOM   6247  C C    . ASN A 1 21  ? 0.114   14.234  5.350   1.00 0.00 ? 21  ASN A C    5  
ATOM   6248  O O    . ASN A 1 21  ? 0.006   13.342  6.192   1.00 0.00 ? 21  ASN A O    5  
ATOM   6249  C CB   . ASN A 1 21  ? -2.245  14.795  5.847   1.00 0.00 ? 21  ASN A CB   5  
ATOM   6250  C CG   . ASN A 1 21  ? -2.614  15.565  7.117   1.00 0.00 ? 21  ASN A CG   5  
ATOM   6251  O OD1  . ASN A 1 21  ? -3.614  16.261  7.184   1.00 0.00 ? 21  ASN A OD1  5  
ATOM   6252  N ND2  . ASN A 1 21  ? -1.753  15.403  8.118   1.00 0.00 ? 21  ASN A ND2  5  
ATOM   6253  H H    . ASN A 1 21  ? -1.810  15.138  3.354   1.00 0.00 ? 21  ASN A H    5  
ATOM   6254  H HA   . ASN A 1 21  ? -0.643  16.254  5.731   1.00 0.00 ? 21  ASN A HA   5  
ATOM   6255  H HB2  . ASN A 1 21  ? -3.052  14.879  5.120   1.00 0.00 ? 21  ASN A HB2  5  
ATOM   6256  H HB3  . ASN A 1 21  ? -2.133  13.737  6.080   1.00 0.00 ? 21  ASN A HB3  5  
ATOM   6257  H HD21 . ASN A 1 21  ? -0.953  14.816  7.998   1.00 0.00 ? 21  ASN A HD21 5  
ATOM   6258  H HD22 . ASN A 1 21  ? -1.909  15.866  8.991   1.00 0.00 ? 21  ASN A HD22 5  
ATOM   6259  N N    . GLY A 1 22  ? 1.115   14.332  4.487   1.00 0.00 ? 22  GLY A N    5  
ATOM   6260  C CA   . GLY A 1 22  ? 2.195   13.360  4.477   1.00 0.00 ? 22  GLY A CA   5  
ATOM   6261  C C    . GLY A 1 22  ? 1.752   12.057  3.806   1.00 0.00 ? 22  GLY A C    5  
ATOM   6262  O O    . GLY A 1 22  ? 2.407   11.578  2.881   1.00 0.00 ? 22  GLY A O    5  
ATOM   6263  H H    . GLY A 1 22  ? 1.196   15.060  3.806   1.00 0.00 ? 22  GLY A H    5  
ATOM   6264  H HA2  . GLY A 1 22  ? 3.055   13.771  3.950   1.00 0.00 ? 22  GLY A HA2  5  
ATOM   6265  H HA3  . GLY A 1 22  ? 2.515   13.155  5.498   1.00 0.00 ? 22  GLY A HA3  5  
ATOM   6266  N N    . MET A 1 23  ? 0.643   11.522  4.296   1.00 0.00 ? 23  MET A N    5  
ATOM   6267  C CA   . MET A 1 23  ? 0.106   10.286  3.757   1.00 0.00 ? 23  MET A CA   5  
ATOM   6268  C C    . MET A 1 23  ? -0.948  9.691   4.692   1.00 0.00 ? 23  MET A C    5  
ATOM   6269  O O    . MET A 1 23  ? -2.146  9.840   4.458   1.00 0.00 ? 23  MET A O    5  
ATOM   6270  C CB   . MET A 1 23  ? 1.240   9.279   3.559   1.00 0.00 ? 23  MET A CB   5  
ATOM   6271  C CG   . MET A 1 23  ? 1.404   8.919   2.082   1.00 0.00 ? 23  MET A CG   5  
ATOM   6272  S SD   . MET A 1 23  ? 3.055   9.314   1.534   1.00 0.00 ? 23  MET A SD   5  
ATOM   6273  C CE   . MET A 1 23  ? 3.871   7.760   1.861   1.00 0.00 ? 23  MET A CE   5  
ATOM   6274  H H    . MET A 1 23  ? 0.117   11.920  5.049   1.00 0.00 ? 23  MET A H    5  
ATOM   6275  H HA   . MET A 1 23  ? -0.353  10.557  2.806   1.00 0.00 ? 23  MET A HA   5  
ATOM   6276  H HB2  . MET A 1 23  ? 2.173   9.698   3.940   1.00 0.00 ? 23  MET A HB2  5  
ATOM   6277  H HB3  . MET A 1 23  ? 1.036   8.378   4.136   1.00 0.00 ? 23  MET A HB3  5  
ATOM   6278  H HG2  . MET A 1 23  ? 1.208   7.856   1.934   1.00 0.00 ? 23  MET A HG2  5  
ATOM   6279  H HG3  . MET A 1 23  ? 0.672   9.463   1.483   1.00 0.00 ? 23  MET A HG3  5  
ATOM   6280  H HE1  . MET A 1 23  ? 4.496   7.858   2.750   1.00 0.00 ? 23  MET A HE1  5  
ATOM   6281  H HE2  . MET A 1 23  ? 3.123   6.986   2.026   1.00 0.00 ? 23  MET A HE2  5  
ATOM   6282  H HE3  . MET A 1 23  ? 4.494   7.490   1.008   1.00 0.00 ? 23  MET A HE3  5  
ATOM   6283  N N    . GLY A 1 24  ? -0.464  9.028   5.732   1.00 0.00 ? 24  GLY A N    5  
ATOM   6284  C CA   . GLY A 1 24  ? -1.349  8.410   6.705   1.00 0.00 ? 24  GLY A CA   5  
ATOM   6285  C C    . GLY A 1 24  ? -1.757  7.005   6.259   1.00 0.00 ? 24  GLY A C    5  
ATOM   6286  O O    . GLY A 1 24  ? -2.943  6.714   6.118   1.00 0.00 ? 24  GLY A O    5  
ATOM   6287  H H    . GLY A 1 24  ? 0.512   8.912   5.916   1.00 0.00 ? 24  GLY A H    5  
ATOM   6288  H HA2  . GLY A 1 24  ? -0.852  8.359   7.673   1.00 0.00 ? 24  GLY A HA2  5  
ATOM   6289  H HA3  . GLY A 1 24  ? -2.239  9.027   6.835   1.00 0.00 ? 24  GLY A HA3  5  
ATOM   6290  N N    . LEU A 1 25  ? -0.750  6.171   6.048   1.00 0.00 ? 25  LEU A N    5  
ATOM   6291  C CA   . LEU A 1 25  ? -0.988  4.802   5.621   1.00 0.00 ? 25  LEU A CA   5  
ATOM   6292  C C    . LEU A 1 25  ? -0.314  3.841   6.603   1.00 0.00 ? 25  LEU A C    5  
ATOM   6293  O O    . LEU A 1 25  ? 0.505   4.257   7.421   1.00 0.00 ? 25  LEU A O    5  
ATOM   6294  C CB   . LEU A 1 25  ? -0.545  4.608   4.170   1.00 0.00 ? 25  LEU A CB   5  
ATOM   6295  C CG   . LEU A 1 25  ? -1.615  4.851   3.103   1.00 0.00 ? 25  LEU A CG   5  
ATOM   6296  C CD1  . LEU A 1 25  ? -1.403  3.936   1.896   1.00 0.00 ? 25  LEU A CD1  5  
ATOM   6297  C CD2  . LEU A 1 25  ? -3.019  4.704   3.694   1.00 0.00 ? 25  LEU A CD2  5  
ATOM   6298  H H    . LEU A 1 25  ? 0.214   6.414   6.164   1.00 0.00 ? 25  LEU A H    5  
ATOM   6299  H HA   . LEU A 1 25  ? -2.064  4.632   5.654   1.00 0.00 ? 25  LEU A HA   5  
ATOM   6300  H HB2  . LEU A 1 25  ? 0.292   5.278   3.975   1.00 0.00 ? 25  LEU A HB2  5  
ATOM   6301  H HB3  . LEU A 1 25  ? -0.172  3.590   4.057   1.00 0.00 ? 25  LEU A HB3  5  
ATOM   6302  H HG   . LEU A 1 25  ? -1.519  5.877   2.750   1.00 0.00 ? 25  LEU A HG   5  
ATOM   6303  H HD11 . LEU A 1 25  ? -0.582  4.319   1.290   1.00 0.00 ? 25  LEU A HD11 5  
ATOM   6304  H HD12 . LEU A 1 25  ? -1.162  2.930   2.241   1.00 0.00 ? 25  LEU A HD12 5  
ATOM   6305  H HD13 . LEU A 1 25  ? -2.313  3.907   1.297   1.00 0.00 ? 25  LEU A HD13 5  
ATOM   6306  H HD21 . LEU A 1 25  ? -3.237  5.562   4.331   1.00 0.00 ? 25  LEU A HD21 5  
ATOM   6307  H HD22 . LEU A 1 25  ? -3.749  4.658   2.886   1.00 0.00 ? 25  LEU A HD22 5  
ATOM   6308  H HD23 . LEU A 1 25  ? -3.071  3.790   4.284   1.00 0.00 ? 25  LEU A HD23 5  
ATOM   6309  N N    . SER A 1 26  ? -0.685  2.574   6.490   1.00 0.00 ? 26  SER A N    5  
ATOM   6310  C CA   . SER A 1 26  ? -0.128  1.551   7.357   1.00 0.00 ? 26  SER A CA   5  
ATOM   6311  C C    . SER A 1 26  ? -0.046  0.218   6.611   1.00 0.00 ? 26  SER A C    5  
ATOM   6312  O O    . SER A 1 26  ? -1.061  -0.298  6.142   1.00 0.00 ? 26  SER A O    5  
ATOM   6313  C CB   . SER A 1 26  ? -0.959  1.395   8.632   1.00 0.00 ? 26  SER A CB   5  
ATOM   6314  O OG   . SER A 1 26  ? -0.167  0.977   9.740   1.00 0.00 ? 26  SER A OG   5  
ATOM   6315  H H    . SER A 1 26  ? -1.352  2.243   5.822   1.00 0.00 ? 26  SER A H    5  
ATOM   6316  H HA   . SER A 1 26  ? 0.870   1.904   7.617   1.00 0.00 ? 26  SER A HA   5  
ATOM   6317  H HB2  . SER A 1 26  ? -1.440  2.345   8.868   1.00 0.00 ? 26  SER A HB2  5  
ATOM   6318  H HB3  . SER A 1 26  ? -1.754  0.671   8.459   1.00 0.00 ? 26  SER A HB3  5  
ATOM   6319  H HG   . SER A 1 26  ? -0.362  1.548   10.537  1.00 0.00 ? 26  SER A HG   5  
ATOM   6320  N N    . ILE A 1 27  ? 1.169   -0.302  6.522   1.00 0.00 ? 27  ILE A N    5  
ATOM   6321  C CA   . ILE A 1 27  ? 1.395   -1.565  5.838   1.00 0.00 ? 27  ILE A CA   5  
ATOM   6322  C C    . ILE A 1 27  ? 2.402   -2.396  6.635   1.00 0.00 ? 27  ILE A C    5  
ATOM   6323  O O    . ILE A 1 27  ? 2.955   -1.926  7.627   1.00 0.00 ? 27  ILE A O    5  
ATOM   6324  C CB   . ILE A 1 27  ? 1.807   -1.323  4.386   1.00 0.00 ? 27  ILE A CB   5  
ATOM   6325  C CG1  . ILE A 1 27  ? 3.327   -1.195  4.262   1.00 0.00 ? 27  ILE A CG1  5  
ATOM   6326  C CG2  . ILE A 1 27  ? 1.082   -0.107  3.805   1.00 0.00 ? 27  ILE A CG2  5  
ATOM   6327  C CD1  . ILE A 1 27  ? 3.879   -2.195  3.244   1.00 0.00 ? 27  ILE A CD1  5  
ATOM   6328  H H    . ILE A 1 27  ? 1.989   0.124   6.904   1.00 0.00 ? 27  ILE A H    5  
ATOM   6329  H HA   . ILE A 1 27  ? 0.445   -2.100  5.820   1.00 0.00 ? 27  ILE A HA   5  
ATOM   6330  H HB   . ILE A 1 27  ? 1.507   -2.189  3.797   1.00 0.00 ? 27  ILE A HB   5  
ATOM   6331  H HG12 . ILE A 1 27  ? 3.586   -0.182  3.959   1.00 0.00 ? 27  ILE A HG12 5  
ATOM   6332  H HG13 . ILE A 1 27  ? 3.791   -1.367  5.234   1.00 0.00 ? 27  ILE A HG13 5  
ATOM   6333  H HG21 . ILE A 1 27  ? 0.061   -0.078  4.185   1.00 0.00 ? 27  ILE A HG21 5  
ATOM   6334  H HG22 . ILE A 1 27  ? 1.604   0.802   4.098   1.00 0.00 ? 27  ILE A HG22 5  
ATOM   6335  H HG23 . ILE A 1 27  ? 1.062   -0.181  2.717   1.00 0.00 ? 27  ILE A HG23 5  
ATOM   6336  H HD11 . ILE A 1 27  ? 4.959   -2.281  3.369   1.00 0.00 ? 27  ILE A HD11 5  
ATOM   6337  H HD12 . ILE A 1 27  ? 3.416   -3.169  3.403   1.00 0.00 ? 27  ILE A HD12 5  
ATOM   6338  H HD13 . ILE A 1 27  ? 3.656   -1.847  2.235   1.00 0.00 ? 27  ILE A HD13 5  
ATOM   6339  N N    . VAL A 1 28  ? 2.613   -3.619  6.168   1.00 0.00 ? 28  VAL A N    5  
ATOM   6340  C CA   . VAL A 1 28  ? 3.544   -4.520  6.823   1.00 0.00 ? 28  VAL A CA   5  
ATOM   6341  C C    . VAL A 1 28  ? 4.111   -5.498  5.792   1.00 0.00 ? 28  VAL A C    5  
ATOM   6342  O O    . VAL A 1 28  ? 3.635   -5.558  4.660   1.00 0.00 ? 28  VAL A O    5  
ATOM   6343  C CB   . VAL A 1 28  ? 2.858   -5.220  7.998   1.00 0.00 ? 28  VAL A CB   5  
ATOM   6344  C CG1  . VAL A 1 28  ? 2.121   -6.477  7.532   1.00 0.00 ? 28  VAL A CG1  5  
ATOM   6345  C CG2  . VAL A 1 28  ? 3.863   -5.549  9.103   1.00 0.00 ? 28  VAL A CG2  5  
ATOM   6346  H H    . VAL A 1 28  ? 2.159   -3.994  5.359   1.00 0.00 ? 28  VAL A H    5  
ATOM   6347  H HA   . VAL A 1 28  ? 4.362   -3.916  7.221   1.00 0.00 ? 28  VAL A HA   5  
ATOM   6348  H HB   . VAL A 1 28  ? 2.120   -4.534  8.412   1.00 0.00 ? 28  VAL A HB   5  
ATOM   6349  H HG11 . VAL A 1 28  ? 1.586   -6.917  8.374   1.00 0.00 ? 28  VAL A HG11 5  
ATOM   6350  H HG12 . VAL A 1 28  ? 1.412   -6.213  6.748   1.00 0.00 ? 28  VAL A HG12 5  
ATOM   6351  H HG13 . VAL A 1 28  ? 2.842   -7.198  7.143   1.00 0.00 ? 28  VAL A HG13 5  
ATOM   6352  H HG21 . VAL A 1 28  ? 4.623   -4.770  9.148   1.00 0.00 ? 28  VAL A HG21 5  
ATOM   6353  H HG22 . VAL A 1 28  ? 3.345   -5.609  10.060  1.00 0.00 ? 28  VAL A HG22 5  
ATOM   6354  H HG23 . VAL A 1 28  ? 4.338   -6.507  8.888   1.00 0.00 ? 28  VAL A HG23 5  
ATOM   6355  N N    . ALA A 1 29  ? 5.120   -6.242  6.223   1.00 0.00 ? 29  ALA A N    5  
ATOM   6356  C CA   . ALA A 1 29  ? 5.756   -7.215  5.351   1.00 0.00 ? 29  ALA A CA   5  
ATOM   6357  C C    . ALA A 1 29  ? 6.134   -8.454  6.167   1.00 0.00 ? 29  ALA A C    5  
ATOM   6358  O O    . ALA A 1 29  ? 6.481   -8.344  7.342   1.00 0.00 ? 29  ALA A O    5  
ATOM   6359  C CB   . ALA A 1 29  ? 6.968   -6.576  4.669   1.00 0.00 ? 29  ALA A CB   5  
ATOM   6360  H H    . ALA A 1 29  ? 5.501   -6.187  7.145   1.00 0.00 ? 29  ALA A H    5  
ATOM   6361  H HA   . ALA A 1 29  ? 5.034   -7.501  4.588   1.00 0.00 ? 29  ALA A HA   5  
ATOM   6362  H HB1  . ALA A 1 29  ? 7.802   -7.278  4.674   1.00 0.00 ? 29  ALA A HB1  5  
ATOM   6363  H HB2  . ALA A 1 29  ? 6.713   -6.322  3.640   1.00 0.00 ? 29  ALA A HB2  5  
ATOM   6364  H HB3  . ALA A 1 29  ? 7.251   -5.670  5.207   1.00 0.00 ? 29  ALA A HB3  5  
ATOM   6365  N N    . ALA A 1 30  ? 6.054   -9.601  5.510   1.00 0.00 ? 30  ALA A N    5  
ATOM   6366  C CA   . ALA A 1 30  ? 6.385   -10.860 6.159   1.00 0.00 ? 30  ALA A CA   5  
ATOM   6367  C C    . ALA A 1 30  ? 7.501   -11.554 5.380   1.00 0.00 ? 30  ALA A C    5  
ATOM   6368  O O    . ALA A 1 30  ? 7.621   -11.376 4.169   1.00 0.00 ? 30  ALA A O    5  
ATOM   6369  C CB   . ALA A 1 30  ? 5.125   -11.723 6.268   1.00 0.00 ? 30  ALA A CB   5  
ATOM   6370  H H    . ALA A 1 30  ? 5.771   -9.681  4.554   1.00 0.00 ? 30  ALA A H    5  
ATOM   6371  H HA   . ALA A 1 30  ? 6.740   -10.631 7.164   1.00 0.00 ? 30  ALA A HA   5  
ATOM   6372  H HB1  . ALA A 1 30  ? 4.693   -11.862 5.277   1.00 0.00 ? 30  ALA A HB1  5  
ATOM   6373  H HB2  . ALA A 1 30  ? 5.385   -12.694 6.689   1.00 0.00 ? 30  ALA A HB2  5  
ATOM   6374  H HB3  . ALA A 1 30  ? 4.399   -11.229 6.915   1.00 0.00 ? 30  ALA A HB3  5  
ATOM   6375  N N    . LYS A 1 31  ? 8.292   -12.330 6.107   1.00 0.00 ? 31  LYS A N    5  
ATOM   6376  C CA   . LYS A 1 31  ? 9.396   -13.051 5.498   1.00 0.00 ? 31  LYS A CA   5  
ATOM   6377  C C    . LYS A 1 31  ? 9.569   -14.399 6.202   1.00 0.00 ? 31  LYS A C    5  
ATOM   6378  O O    . LYS A 1 31  ? 9.807   -14.449 7.408   1.00 0.00 ? 31  LYS A O    5  
ATOM   6379  C CB   . LYS A 1 31  ? 10.662  -12.193 5.496   1.00 0.00 ? 31  LYS A CB   5  
ATOM   6380  C CG   . LYS A 1 31  ? 10.973  -11.672 6.902   1.00 0.00 ? 31  LYS A CG   5  
ATOM   6381  C CD   . LYS A 1 31  ? 10.297  -10.321 7.146   1.00 0.00 ? 31  LYS A CD   5  
ATOM   6382  C CE   . LYS A 1 31  ? 9.801   -10.208 8.589   1.00 0.00 ? 31  LYS A CE   5  
ATOM   6383  N NZ   . LYS A 1 31  ? 8.786   -9.140  8.707   1.00 0.00 ? 31  LYS A NZ   5  
ATOM   6384  H H    . LYS A 1 31  ? 8.188   -12.470 7.091   1.00 0.00 ? 31  LYS A H    5  
ATOM   6385  H HA   . LYS A 1 31  ? 9.132   -13.237 4.458   1.00 0.00 ? 31  LYS A HA   5  
ATOM   6386  H HB2  . LYS A 1 31  ? 11.504  -12.779 5.128   1.00 0.00 ? 31  LYS A HB2  5  
ATOM   6387  H HB3  . LYS A 1 31  ? 10.536  -11.354 4.813   1.00 0.00 ? 31  LYS A HB3  5  
ATOM   6388  H HG2  . LYS A 1 31  ? 10.631  -12.393 7.643   1.00 0.00 ? 31  LYS A HG2  5  
ATOM   6389  H HG3  . LYS A 1 31  ? 12.050  -11.571 7.026   1.00 0.00 ? 31  LYS A HG3  5  
ATOM   6390  H HD2  . LYS A 1 31  ? 11.000  -9.514  6.936   1.00 0.00 ? 31  LYS A HD2  5  
ATOM   6391  H HD3  . LYS A 1 31  ? 9.460   -10.199 6.460   1.00 0.00 ? 31  LYS A HD3  5  
ATOM   6392  H HE2  . LYS A 1 31  ? 9.376   -11.160 8.909   1.00 0.00 ? 31  LYS A HE2  5  
ATOM   6393  H HE3  . LYS A 1 31  ? 10.641  -9.997  9.252   1.00 0.00 ? 31  LYS A HE3  5  
ATOM   6394  H HZ1  . LYS A 1 31  ? 9.240   -8.249  8.735   1.00 0.00 ? 31  LYS A HZ1  5  
ATOM   6395  H HZ2  . LYS A 1 31  ? 8.171   -9.176  7.918   1.00 0.00 ? 31  LYS A HZ2  5  
ATOM   6396  H HZ3  . LYS A 1 31  ? 8.259   -9.272  9.548   1.00 0.00 ? 31  LYS A HZ3  5  
ATOM   6397  N N    . GLY A 1 32  ? 9.441   -15.460 5.418   1.00 0.00 ? 32  GLY A N    5  
ATOM   6398  C CA   . GLY A 1 32  ? 9.581   -16.806 5.952   1.00 0.00 ? 32  GLY A CA   5  
ATOM   6399  C C    . GLY A 1 32  ? 8.276   -17.275 6.599   1.00 0.00 ? 32  GLY A C    5  
ATOM   6400  O O    . GLY A 1 32  ? 8.022   -16.993 7.768   1.00 0.00 ? 32  GLY A O    5  
ATOM   6401  H H    . GLY A 1 32  ? 9.248   -15.413 4.439   1.00 0.00 ? 32  GLY A H    5  
ATOM   6402  H HA2  . GLY A 1 32  ? 9.861   -17.490 5.152   1.00 0.00 ? 32  GLY A HA2  5  
ATOM   6403  H HA3  . GLY A 1 32  ? 10.384  -16.827 6.687   1.00 0.00 ? 32  GLY A HA3  5  
ATOM   6404  N N    . ALA A 1 33  ? 7.483   -17.986 5.809   1.00 0.00 ? 33  ALA A N    5  
ATOM   6405  C CA   . ALA A 1 33  ? 6.212   -18.498 6.291   1.00 0.00 ? 33  ALA A CA   5  
ATOM   6406  C C    . ALA A 1 33  ? 5.945   -19.865 5.655   1.00 0.00 ? 33  ALA A C    5  
ATOM   6407  O O    . ALA A 1 33  ? 6.573   -20.225 4.662   1.00 0.00 ? 33  ALA A O    5  
ATOM   6408  C CB   . ALA A 1 33  ? 5.105   -17.487 5.985   1.00 0.00 ? 33  ALA A CB   5  
ATOM   6409  H H    . ALA A 1 33  ? 7.698   -18.212 4.858   1.00 0.00 ? 33  ALA A H    5  
ATOM   6410  H HA   . ALA A 1 33  ? 6.290   -18.618 7.371   1.00 0.00 ? 33  ALA A HA   5  
ATOM   6411  H HB1  . ALA A 1 33  ? 4.581   -17.234 6.908   1.00 0.00 ? 33  ALA A HB1  5  
ATOM   6412  H HB2  . ALA A 1 33  ? 5.545   -16.587 5.559   1.00 0.00 ? 33  ALA A HB2  5  
ATOM   6413  H HB3  . ALA A 1 33  ? 4.403   -17.920 5.275   1.00 0.00 ? 33  ALA A HB3  5  
ATOM   6414  N N    . GLY A 1 34  ? 5.009   -20.588 6.255   1.00 0.00 ? 34  GLY A N    5  
ATOM   6415  C CA   . GLY A 1 34  ? 4.651   -21.906 5.761   1.00 0.00 ? 34  GLY A CA   5  
ATOM   6416  C C    . GLY A 1 34  ? 3.672   -21.804 4.589   1.00 0.00 ? 34  GLY A C    5  
ATOM   6417  O O    . GLY A 1 34  ? 2.632   -22.457 4.585   1.00 0.00 ? 34  GLY A O    5  
ATOM   6418  H H    . GLY A 1 34  ? 4.502   -20.287 7.062   1.00 0.00 ? 34  GLY A H    5  
ATOM   6419  H HA2  . GLY A 1 34  ? 5.548   -22.436 5.445   1.00 0.00 ? 34  GLY A HA2  5  
ATOM   6420  H HA3  . GLY A 1 34  ? 4.202   -22.489 6.563   1.00 0.00 ? 34  GLY A HA3  5  
ATOM   6421  N N    . GLN A 1 35  ? 4.045   -20.979 3.620   1.00 0.00 ? 35  GLN A N    5  
ATOM   6422  C CA   . GLN A 1 35  ? 3.213   -20.784 2.444   1.00 0.00 ? 35  GLN A CA   5  
ATOM   6423  C C    . GLN A 1 35  ? 3.909   -19.851 1.451   1.00 0.00 ? 35  GLN A C    5  
ATOM   6424  O O    . GLN A 1 35  ? 3.802   -20.036 0.240   1.00 0.00 ? 35  GLN A O    5  
ATOM   6425  C CB   . GLN A 1 35  ? 1.834   -20.242 2.831   1.00 0.00 ? 35  GLN A CB   5  
ATOM   6426  C CG   . GLN A 1 35  ? 0.747   -21.293 2.594   1.00 0.00 ? 35  GLN A CG   5  
ATOM   6427  C CD   . GLN A 1 35  ? 0.691   -21.701 1.121   1.00 0.00 ? 35  GLN A CD   5  
ATOM   6428  O OE1  . GLN A 1 35  ? 1.106   -20.976 0.232   1.00 0.00 ? 35  GLN A OE1  5  
ATOM   6429  N NE2  . GLN A 1 35  ? 0.154   -22.899 0.911   1.00 0.00 ? 35  GLN A NE2  5  
ATOM   6430  H H    . GLN A 1 35  ? 4.893   -20.451 3.630   1.00 0.00 ? 35  GLN A H    5  
ATOM   6431  H HA   . GLN A 1 35  ? 3.097   -21.774 2.003   1.00 0.00 ? 35  GLN A HA   5  
ATOM   6432  H HB2  . GLN A 1 35  ? 1.838   -19.947 3.880   1.00 0.00 ? 35  GLN A HB2  5  
ATOM   6433  H HB3  . GLN A 1 35  ? 1.614   -19.348 2.248   1.00 0.00 ? 35  GLN A HB3  5  
ATOM   6434  H HG2  . GLN A 1 35  ? 0.943   -22.170 3.212   1.00 0.00 ? 35  GLN A HG2  5  
ATOM   6435  H HG3  . GLN A 1 35  ? -0.219  -20.894 2.903   1.00 0.00 ? 35  GLN A HG3  5  
ATOM   6436  H HE21 . GLN A 1 35  ? -0.168  -23.445 1.686   1.00 0.00 ? 35  GLN A HE21 5  
ATOM   6437  H HE22 . GLN A 1 35  ? 0.073   -23.256 -0.018  1.00 0.00 ? 35  GLN A HE22 5  
ATOM   6438  N N    . ASP A 1 36  ? 4.608   -18.868 2.000   1.00 0.00 ? 36  ASP A N    5  
ATOM   6439  C CA   . ASP A 1 36  ? 5.322   -17.907 1.178   1.00 0.00 ? 36  ASP A CA   5  
ATOM   6440  C C    . ASP A 1 36  ? 6.448   -17.276 1.999   1.00 0.00 ? 36  ASP A C    5  
ATOM   6441  O O    . ASP A 1 36  ? 6.255   -16.935 3.166   1.00 0.00 ? 36  ASP A O    5  
ATOM   6442  C CB   . ASP A 1 36  ? 4.392   -16.785 0.711   1.00 0.00 ? 36  ASP A CB   5  
ATOM   6443  C CG   . ASP A 1 36  ? 4.145   -16.737 -0.799  1.00 0.00 ? 36  ASP A CG   5  
ATOM   6444  O OD1  . ASP A 1 36  ? 3.320   -17.553 -1.264  1.00 0.00 ? 36  ASP A OD1  5  
ATOM   6445  O OD2  . ASP A 1 36  ? 4.786   -15.888 -1.453  1.00 0.00 ? 36  ASP A OD2  5  
ATOM   6446  H H    . ASP A 1 36  ? 4.689   -18.724 2.986   1.00 0.00 ? 36  ASP A H    5  
ATOM   6447  H HA   . ASP A 1 36  ? 5.695   -18.478 0.329   1.00 0.00 ? 36  ASP A HA   5  
ATOM   6448  H HB2  . ASP A 1 36  ? 3.434   -16.892 1.216   1.00 0.00 ? 36  ASP A HB2  5  
ATOM   6449  H HB3  . ASP A 1 36  ? 4.812   -15.831 1.024   1.00 0.00 ? 36  ASP A HB3  5  
ATOM   6450  N N    . LYS A 1 37  ? 7.599   -17.139 1.358   1.00 0.00 ? 37  LYS A N    5  
ATOM   6451  C CA   . LYS A 1 37  ? 8.756   -16.554 2.015   1.00 0.00 ? 37  LYS A CA   5  
ATOM   6452  C C    . LYS A 1 37  ? 8.769   -15.045 1.769   1.00 0.00 ? 37  LYS A C    5  
ATOM   6453  O O    . LYS A 1 37  ? 9.832   -14.448 1.598   1.00 0.00 ? 37  LYS A O    5  
ATOM   6454  C CB   . LYS A 1 37  ? 10.038  -17.261 1.571   1.00 0.00 ? 37  LYS A CB   5  
ATOM   6455  C CG   . LYS A 1 37  ? 10.179  -18.622 2.255   1.00 0.00 ? 37  LYS A CG   5  
ATOM   6456  C CD   . LYS A 1 37  ? 11.302  -19.443 1.618   1.00 0.00 ? 37  LYS A CD   5  
ATOM   6457  C CE   . LYS A 1 37  ? 10.770  -20.303 0.471   1.00 0.00 ? 37  LYS A CE   5  
ATOM   6458  N NZ   . LYS A 1 37  ? 11.448  -21.618 0.449   1.00 0.00 ? 37  LYS A NZ   5  
ATOM   6459  H H    . LYS A 1 37  ? 7.748   -17.417 0.410   1.00 0.00 ? 37  LYS A H    5  
ATOM   6460  H HA   . LYS A 1 37  ? 8.647   -16.728 3.086   1.00 0.00 ? 37  LYS A HA   5  
ATOM   6461  H HB2  . LYS A 1 37  ? 10.029  -17.392 0.489   1.00 0.00 ? 37  LYS A HB2  5  
ATOM   6462  H HB3  . LYS A 1 37  ? 10.901  -16.640 1.809   1.00 0.00 ? 37  LYS A HB3  5  
ATOM   6463  H HG2  . LYS A 1 37  ? 10.386  -18.480 3.316   1.00 0.00 ? 37  LYS A HG2  5  
ATOM   6464  H HG3  . LYS A 1 37  ? 9.240   -19.169 2.184   1.00 0.00 ? 37  LYS A HG3  5  
ATOM   6465  H HD2  . LYS A 1 37  ? 12.079  -18.774 1.245   1.00 0.00 ? 37  LYS A HD2  5  
ATOM   6466  H HD3  . LYS A 1 37  ? 11.764  -20.080 2.370   1.00 0.00 ? 37  LYS A HD3  5  
ATOM   6467  H HE2  . LYS A 1 37  ? 9.693   -20.443 0.583   1.00 0.00 ? 37  LYS A HE2  5  
ATOM   6468  H HE3  . LYS A 1 37  ? 10.925  -19.791 -0.479  1.00 0.00 ? 37  LYS A HE3  5  
ATOM   6469  H HZ1  . LYS A 1 37  ? 11.968  -21.710 -0.399  1.00 0.00 ? 37  LYS A HZ1  5  
ATOM   6470  H HZ2  . LYS A 1 37  ? 12.069  -21.684 1.229   1.00 0.00 ? 37  LYS A HZ2  5  
ATOM   6471  H HZ3  . LYS A 1 37  ? 10.764  -22.346 0.503   1.00 0.00 ? 37  LYS A HZ3  5  
ATOM   6472  N N    . LEU A 1 38  ? 7.575   -14.468 1.758   1.00 0.00 ? 38  LEU A N    5  
ATOM   6473  C CA   . LEU A 1 38  ? 7.437   -13.040 1.535   1.00 0.00 ? 38  LEU A CA   5  
ATOM   6474  C C    . LEU A 1 38  ? 5.962   -12.706 1.297   1.00 0.00 ? 38  LEU A C    5  
ATOM   6475  O O    . LEU A 1 38  ? 5.347   -13.224 0.366   1.00 0.00 ? 38  LEU A O    5  
ATOM   6476  C CB   . LEU A 1 38  ? 8.360   -12.581 0.406   1.00 0.00 ? 38  LEU A CB   5  
ATOM   6477  C CG   . LEU A 1 38  ? 9.507   -11.653 0.812   1.00 0.00 ? 38  LEU A CG   5  
ATOM   6478  C CD1  . LEU A 1 38  ? 10.461  -11.414 -0.361  1.00 0.00 ? 38  LEU A CD1  5  
ATOM   6479  C CD2  . LEU A 1 38  ? 8.973   -10.342 1.392   1.00 0.00 ? 38  LEU A CD2  5  
ATOM   6480  H H    . LEU A 1 38  ? 6.717   -14.960 1.898   1.00 0.00 ? 38  LEU A H    5  
ATOM   6481  H HA   . LEU A 1 38  ? 7.763   -12.534 2.443   1.00 0.00 ? 38  LEU A HA   5  
ATOM   6482  H HB2  . LEU A 1 38  ? 8.786   -13.465 -0.071  1.00 0.00 ? 38  LEU A HB2  5  
ATOM   6483  H HB3  . LEU A 1 38  ? 7.756   -12.072 -0.348  1.00 0.00 ? 38  LEU A HB3  5  
ATOM   6484  H HG   . LEU A 1 38  ? 10.082  -12.142 1.598   1.00 0.00 ? 38  LEU A HG   5  
ATOM   6485  H HD11 . LEU A 1 38  ? 9.904   -11.458 -1.296  1.00 0.00 ? 38  LEU A HD11 5  
ATOM   6486  H HD12 . LEU A 1 38  ? 10.923  -10.432 -0.259  1.00 0.00 ? 38  LEU A HD12 5  
ATOM   6487  H HD13 . LEU A 1 38  ? 11.235  -12.182 -0.362  1.00 0.00 ? 38  LEU A HD13 5  
ATOM   6488  H HD21 . LEU A 1 38  ? 8.308   -9.869  0.669   1.00 0.00 ? 38  LEU A HD21 5  
ATOM   6489  H HD22 . LEU A 1 38  ? 8.423   -10.549 2.309   1.00 0.00 ? 38  LEU A HD22 5  
ATOM   6490  H HD23 . LEU A 1 38  ? 9.806   -9.673  1.609   1.00 0.00 ? 38  LEU A HD23 5  
ATOM   6491  N N    . GLY A 1 39  ? 5.438   -11.843 2.157   1.00 0.00 ? 39  GLY A N    5  
ATOM   6492  C CA   . GLY A 1 39  ? 4.048   -11.436 2.051   1.00 0.00 ? 39  GLY A CA   5  
ATOM   6493  C C    . GLY A 1 39  ? 3.838   -10.043 2.650   1.00 0.00 ? 39  GLY A C    5  
ATOM   6494  O O    . GLY A 1 39  ? 4.109   -9.824  3.830   1.00 0.00 ? 39  GLY A O    5  
ATOM   6495  H H    . GLY A 1 39  ? 5.944   -11.428 2.911   1.00 0.00 ? 39  GLY A H    5  
ATOM   6496  H HA2  . GLY A 1 39  ? 3.743   -11.433 1.005   1.00 0.00 ? 39  GLY A HA2  5  
ATOM   6497  H HA3  . GLY A 1 39  ? 3.413   -12.156 2.566   1.00 0.00 ? 39  GLY A HA3  5  
ATOM   6498  N N    . ILE A 1 40  ? 3.358   -9.139  1.810   1.00 0.00 ? 40  ILE A N    5  
ATOM   6499  C CA   . ILE A 1 40  ? 3.109   -7.774  2.242   1.00 0.00 ? 40  ILE A CA   5  
ATOM   6500  C C    . ILE A 1 40  ? 1.601   -7.548  2.363   1.00 0.00 ? 40  ILE A C    5  
ATOM   6501  O O    . ILE A 1 40  ? 0.820   -8.127  1.609   1.00 0.00 ? 40  ILE A O    5  
ATOM   6502  C CB   . ILE A 1 40  ? 3.805   -6.781  1.308   1.00 0.00 ? 40  ILE A CB   5  
ATOM   6503  C CG1  . ILE A 1 40  ? 4.886   -7.476  0.475   1.00 0.00 ? 40  ILE A CG1  5  
ATOM   6504  C CG2  . ILE A 1 40  ? 4.363   -5.590  2.093   1.00 0.00 ? 40  ILE A CG2  5  
ATOM   6505  C CD1  . ILE A 1 40  ? 5.406   -6.552  -0.627  1.00 0.00 ? 40  ILE A CD1  5  
ATOM   6506  H H    . ILE A 1 40  ? 3.140   -9.325  0.852   1.00 0.00 ? 40  ILE A H    5  
ATOM   6507  H HA   . ILE A 1 40  ? 3.557   -7.657  3.229   1.00 0.00 ? 40  ILE A HA   5  
ATOM   6508  H HB   . ILE A 1 40  ? 3.064   -6.390  0.611   1.00 0.00 ? 40  ILE A HB   5  
ATOM   6509  H HG12 . ILE A 1 40  ? 5.709   -7.777  1.123   1.00 0.00 ? 40  ILE A HG12 5  
ATOM   6510  H HG13 . ILE A 1 40  ? 4.478   -8.384  0.033   1.00 0.00 ? 40  ILE A HG13 5  
ATOM   6511  H HG21 . ILE A 1 40  ? 4.907   -5.953  2.963   1.00 0.00 ? 40  ILE A HG21 5  
ATOM   6512  H HG22 . ILE A 1 40  ? 5.037   -5.020  1.454   1.00 0.00 ? 40  ILE A HG22 5  
ATOM   6513  H HG23 . ILE A 1 40  ? 3.541   -4.953  2.416   1.00 0.00 ? 40  ILE A HG23 5  
ATOM   6514  H HD11 . ILE A 1 40  ? 4.565   -6.137  -1.181  1.00 0.00 ? 40  ILE A HD11 5  
ATOM   6515  H HD12 . ILE A 1 40  ? 5.982   -5.742  -0.181  1.00 0.00 ? 40  ILE A HD12 5  
ATOM   6516  H HD13 . ILE A 1 40  ? 6.043   -7.120  -1.305  1.00 0.00 ? 40  ILE A HD13 5  
ATOM   6517  N N    . TYR A 1 41  ? 1.235   -6.705  3.318   1.00 0.00 ? 41  TYR A N    5  
ATOM   6518  C CA   . TYR A 1 41  ? -0.167  -6.398  3.548   1.00 0.00 ? 41  TYR A CA   5  
ATOM   6519  C C    . TYR A 1 41  ? -0.333  -4.974  4.086   1.00 0.00 ? 41  TYR A C    5  
ATOM   6520  O O    . TYR A 1 41  ? 0.637   -4.353  4.520   1.00 0.00 ? 41  TYR A O    5  
ATOM   6521  C CB   . TYR A 1 41  ? -0.648  -7.389  4.607   1.00 0.00 ? 41  TYR A CB   5  
ATOM   6522  C CG   . TYR A 1 41  ? -0.376  -8.854  4.257   1.00 0.00 ? 41  TYR A CG   5  
ATOM   6523  C CD1  . TYR A 1 41  ? -1.067  -9.457  3.226   1.00 0.00 ? 41  TYR A CD1  5  
ATOM   6524  C CD2  . TYR A 1 41  ? 0.559   -9.573  4.973   1.00 0.00 ? 41  TYR A CD2  5  
ATOM   6525  C CE1  . TYR A 1 41  ? -0.812  -10.836 2.896   1.00 0.00 ? 41  TYR A CE1  5  
ATOM   6526  C CE2  . TYR A 1 41  ? 0.815   -10.951 4.644   1.00 0.00 ? 41  TYR A CE2  5  
ATOM   6527  C CZ   . TYR A 1 41  ? 0.117   -11.515 3.621   1.00 0.00 ? 41  TYR A CZ   5  
ATOM   6528  O OH   . TYR A 1 41  ? 0.359   -12.816 3.311   1.00 0.00 ? 41  TYR A OH   5  
ATOM   6529  H H    . TYR A 1 41  ? 1.877   -6.240  3.927   1.00 0.00 ? 41  TYR A H    5  
ATOM   6530  H HA   . TYR A 1 41  ? -0.690  -6.481  2.596   1.00 0.00 ? 41  TYR A HA   5  
ATOM   6531  H HB2  . TYR A 1 41  ? -0.164  -7.158  5.555   1.00 0.00 ? 41  TYR A HB2  5  
ATOM   6532  H HB3  . TYR A 1 41  ? -1.720  -7.255  4.756   1.00 0.00 ? 41  TYR A HB3  5  
ATOM   6533  H HD1  . TYR A 1 41  ? -1.807  -8.889  2.660   1.00 0.00 ? 41  TYR A HD1  5  
ATOM   6534  H HD2  . TYR A 1 41  ? 1.105   -9.097  5.787   1.00 0.00 ? 41  TYR A HD2  5  
ATOM   6535  H HE1  . TYR A 1 41  ? -1.351  -11.323 2.084   1.00 0.00 ? 41  TYR A HE1  5  
ATOM   6536  H HE2  . TYR A 1 41  ? 1.553   -11.530 5.200   1.00 0.00 ? 41  TYR A HE2  5  
ATOM   6537  H HH   . TYR A 1 41  ? 1.233   -13.105 3.701   1.00 0.00 ? 41  TYR A HH   5  
ATOM   6538  N N    . VAL A 1 42  ? -1.568  -4.500  4.038   1.00 0.00 ? 42  VAL A N    5  
ATOM   6539  C CA   . VAL A 1 42  ? -1.875  -3.161  4.515   1.00 0.00 ? 42  VAL A CA   5  
ATOM   6540  C C    . VAL A 1 42  ? -2.570  -3.257  5.876   1.00 0.00 ? 42  VAL A C    5  
ATOM   6541  O O    . VAL A 1 42  ? -3.589  -3.931  6.010   1.00 0.00 ? 42  VAL A O    5  
ATOM   6542  C CB   . VAL A 1 42  ? -2.704  -2.411  3.472   1.00 0.00 ? 42  VAL A CB   5  
ATOM   6543  C CG1  . VAL A 1 42  ? -3.414  -1.208  4.097   1.00 0.00 ? 42  VAL A CG1  5  
ATOM   6544  C CG2  . VAL A 1 42  ? -1.837  -1.980  2.287   1.00 0.00 ? 42  VAL A CG2  5  
ATOM   6545  H H    . VAL A 1 42  ? -2.351  -5.010  3.683   1.00 0.00 ? 42  VAL A H    5  
ATOM   6546  H HA   . VAL A 1 42  ? -0.931  -2.632  4.639   1.00 0.00 ? 42  VAL A HA   5  
ATOM   6547  H HB   . VAL A 1 42  ? -3.468  -3.092  3.098   1.00 0.00 ? 42  VAL A HB   5  
ATOM   6548  H HG11 . VAL A 1 42  ? -2.675  -0.454  4.374   1.00 0.00 ? 42  VAL A HG11 5  
ATOM   6549  H HG12 . VAL A 1 42  ? -4.113  -0.785  3.378   1.00 0.00 ? 42  VAL A HG12 5  
ATOM   6550  H HG13 . VAL A 1 42  ? -3.957  -1.529  4.985   1.00 0.00 ? 42  VAL A HG13 5  
ATOM   6551  H HG21 . VAL A 1 42  ? -2.421  -1.349  1.619   1.00 0.00 ? 42  VAL A HG21 5  
ATOM   6552  H HG22 . VAL A 1 42  ? -0.974  -1.425  2.653   1.00 0.00 ? 42  VAL A HG22 5  
ATOM   6553  H HG23 . VAL A 1 42  ? -1.497  -2.864  1.747   1.00 0.00 ? 42  VAL A HG23 5  
ATOM   6554  N N    . LYS A 1 43  ? -1.988  -2.571  6.850   1.00 0.00 ? 43  LYS A N    5  
ATOM   6555  C CA   . LYS A 1 43  ? -2.538  -2.569  8.195   1.00 0.00 ? 43  LYS A CA   5  
ATOM   6556  C C    . LYS A 1 43  ? -3.799  -1.703  8.225   1.00 0.00 ? 43  LYS A C    5  
ATOM   6557  O O    . LYS A 1 43  ? -4.804  -2.083  8.825   1.00 0.00 ? 43  LYS A O    5  
ATOM   6558  C CB   . LYS A 1 43  ? -1.474  -2.143  9.208   1.00 0.00 ? 43  LYS A CB   5  
ATOM   6559  C CG   . LYS A 1 43  ? -2.032  -2.171  10.633  1.00 0.00 ? 43  LYS A CG   5  
ATOM   6560  C CD   . LYS A 1 43  ? -0.999  -1.652  11.636  1.00 0.00 ? 43  LYS A CD   5  
ATOM   6561  C CE   . LYS A 1 43  ? -0.246  -2.808  12.295  1.00 0.00 ? 43  LYS A CE   5  
ATOM   6562  N NZ   . LYS A 1 43  ? -0.734  -3.023  13.676  1.00 0.00 ? 43  LYS A NZ   5  
ATOM   6563  H H    . LYS A 1 43  ? -1.157  -2.026  6.732   1.00 0.00 ? 43  LYS A H    5  
ATOM   6564  H HA   . LYS A 1 43  ? -2.817  -3.596  8.435   1.00 0.00 ? 43  LYS A HA   5  
ATOM   6565  H HB2  . LYS A 1 43  ? -0.611  -2.806  9.137   1.00 0.00 ? 43  LYS A HB2  5  
ATOM   6566  H HB3  . LYS A 1 43  ? -1.125  -1.138  8.971   1.00 0.00 ? 43  LYS A HB3  5  
ATOM   6567  H HG2  . LYS A 1 43  ? -2.935  -1.564  10.686  1.00 0.00 ? 43  LYS A HG2  5  
ATOM   6568  H HG3  . LYS A 1 43  ? -2.319  -3.190  10.895  1.00 0.00 ? 43  LYS A HG3  5  
ATOM   6569  H HD2  . LYS A 1 43  ? -0.293  -0.994  11.128  1.00 0.00 ? 43  LYS A HD2  5  
ATOM   6570  H HD3  . LYS A 1 43  ? -1.497  -1.055  12.399  1.00 0.00 ? 43  LYS A HD3  5  
ATOM   6571  H HE2  . LYS A 1 43  ? -0.380  -3.719  11.710  1.00 0.00 ? 43  LYS A HE2  5  
ATOM   6572  H HE3  . LYS A 1 43  ? 0.822   -2.593  12.311  1.00 0.00 ? 43  LYS A HE3  5  
ATOM   6573  H HZ1  . LYS A 1 43  ? -1.109  -2.168  14.036  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM   6574  H HZ2  . LYS A 1 43  ? -1.447  -3.724  13.674  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM   6575  H HZ3  . LYS A 1 43  ? 0.025   -3.323  14.255  1.00 0.00 ? 43  LYS A HZ3  5  
ATOM   6576  N N    . SER A 1 44  ? -3.706  -0.557  7.568   1.00 0.00 ? 44  SER A N    5  
ATOM   6577  C CA   . SER A 1 44  ? -4.826  0.367   7.513   1.00 0.00 ? 44  SER A CA   5  
ATOM   6578  C C    . SER A 1 44  ? -4.316  1.799   7.343   1.00 0.00 ? 44  SER A C    5  
ATOM   6579  O O    . SER A 1 44  ? -3.110  2.038   7.351   1.00 0.00 ? 44  SER A O    5  
ATOM   6580  C CB   . SER A 1 44  ? -5.694  0.257   8.767   1.00 0.00 ? 44  SER A CB   5  
ATOM   6581  O OG   . SER A 1 44  ? -6.381  1.473   9.050   1.00 0.00 ? 44  SER A OG   5  
ATOM   6582  H H    . SER A 1 44  ? -2.885  -0.255  7.083   1.00 0.00 ? 44  SER A H    5  
ATOM   6583  H HA   . SER A 1 44  ? -5.407  0.062   6.642   1.00 0.00 ? 44  SER A HA   5  
ATOM   6584  H HB2  . SER A 1 44  ? -6.418  -0.548  8.638   1.00 0.00 ? 44  SER A HB2  5  
ATOM   6585  H HB3  . SER A 1 44  ? -5.068  -0.011  9.619   1.00 0.00 ? 44  SER A HB3  5  
ATOM   6586  H HG   . SER A 1 44  ? -7.277  1.469   8.609   1.00 0.00 ? 44  SER A HG   5  
ATOM   6587  N N    . VAL A 1 45  ? -5.261  2.717   7.195   1.00 0.00 ? 45  VAL A N    5  
ATOM   6588  C CA   . VAL A 1 45  ? -4.923  4.119   7.024   1.00 0.00 ? 45  VAL A CA   5  
ATOM   6589  C C    . VAL A 1 45  ? -4.790  4.777   8.398   1.00 0.00 ? 45  VAL A C    5  
ATOM   6590  O O    . VAL A 1 45  ? -5.657  4.615   9.255   1.00 0.00 ? 45  VAL A O    5  
ATOM   6591  C CB   . VAL A 1 45  ? -5.960  4.803   6.131   1.00 0.00 ? 45  VAL A CB   5  
ATOM   6592  C CG1  . VAL A 1 45  ? -6.086  4.082   4.787   1.00 0.00 ? 45  VAL A CG1  5  
ATOM   6593  C CG2  . VAL A 1 45  ? -7.315  4.893   6.834   1.00 0.00 ? 45  VAL A CG2  5  
ATOM   6594  H H    . VAL A 1 45  ? -6.241  2.515   7.190   1.00 0.00 ? 45  VAL A H    5  
ATOM   6595  H HA   . VAL A 1 45  ? -3.959  4.166   6.519   1.00 0.00 ? 45  VAL A HA   5  
ATOM   6596  H HB   . VAL A 1 45  ? -5.616  5.819   5.937   1.00 0.00 ? 45  VAL A HB   5  
ATOM   6597  H HG11 . VAL A 1 45  ? -5.347  4.479   4.092   1.00 0.00 ? 45  VAL A HG11 5  
ATOM   6598  H HG12 . VAL A 1 45  ? -5.916  3.015   4.930   1.00 0.00 ? 45  VAL A HG12 5  
ATOM   6599  H HG13 . VAL A 1 45  ? -7.086  4.241   4.383   1.00 0.00 ? 45  VAL A HG13 5  
ATOM   6600  H HG21 . VAL A 1 45  ? -8.046  5.342   6.162   1.00 0.00 ? 45  VAL A HG21 5  
ATOM   6601  H HG22 . VAL A 1 45  ? -7.647  3.892   7.113   1.00 0.00 ? 45  VAL A HG22 5  
ATOM   6602  H HG23 . VAL A 1 45  ? -7.220  5.506   7.731   1.00 0.00 ? 45  VAL A HG23 5  
ATOM   6603  N N    . VAL A 1 46  ? -3.697  5.508   8.567   1.00 0.00 ? 46  VAL A N    5  
ATOM   6604  C CA   . VAL A 1 46  ? -3.440  6.192   9.822   1.00 0.00 ? 46  VAL A CA   5  
ATOM   6605  C C    . VAL A 1 46  ? -4.713  6.904   10.280  1.00 0.00 ? 46  VAL A C    5  
ATOM   6606  O O    . VAL A 1 46  ? -4.900  7.143   11.472  1.00 0.00 ? 46  VAL A O    5  
ATOM   6607  C CB   . VAL A 1 46  ? -2.247  7.139   9.667   1.00 0.00 ? 46  VAL A CB   5  
ATOM   6608  C CG1  . VAL A 1 46  ? -2.233  8.188   10.781  1.00 0.00 ? 46  VAL A CG1  5  
ATOM   6609  C CG2  . VAL A 1 46  ? -0.931  6.362   9.627   1.00 0.00 ? 46  VAL A CG2  5  
ATOM   6610  H H    . VAL A 1 46  ? -2.996  5.636   7.865   1.00 0.00 ? 46  VAL A H    5  
ATOM   6611  H HA   . VAL A 1 46  ? -3.174  5.435   10.560  1.00 0.00 ? 46  VAL A HA   5  
ATOM   6612  H HB   . VAL A 1 46  ? -2.356  7.661   8.716   1.00 0.00 ? 46  VAL A HB   5  
ATOM   6613  H HG11 . VAL A 1 46  ? -2.142  7.690   11.748  1.00 0.00 ? 46  VAL A HG11 5  
ATOM   6614  H HG12 . VAL A 1 46  ? -1.384  8.858   10.637  1.00 0.00 ? 46  VAL A HG12 5  
ATOM   6615  H HG13 . VAL A 1 46  ? -3.158  8.762   10.753  1.00 0.00 ? 46  VAL A HG13 5  
ATOM   6616  H HG21 . VAL A 1 46  ? -0.660  6.052   10.637  1.00 0.00 ? 46  VAL A HG21 5  
ATOM   6617  H HG22 . VAL A 1 46  ? -1.048  5.479   8.997   1.00 0.00 ? 46  VAL A HG22 5  
ATOM   6618  H HG23 . VAL A 1 46  ? -0.146  6.998   9.219   1.00 0.00 ? 46  VAL A HG23 5  
ATOM   6619  N N    . LYS A 1 47  ? -5.557  7.224   9.310   1.00 0.00 ? 47  LYS A N    5  
ATOM   6620  C CA   . LYS A 1 47  ? -6.807  7.904   9.599   1.00 0.00 ? 47  LYS A CA   5  
ATOM   6621  C C    . LYS A 1 47  ? -6.529  9.386   9.858   1.00 0.00 ? 47  LYS A C    5  
ATOM   6622  O O    . LYS A 1 47  ? -6.085  9.758   10.943  1.00 0.00 ? 47  LYS A O    5  
ATOM   6623  C CB   . LYS A 1 47  ? -7.544  7.207   10.744  1.00 0.00 ? 47  LYS A CB   5  
ATOM   6624  C CG   . LYS A 1 47  ? -8.965  7.757   10.898  1.00 0.00 ? 47  LYS A CG   5  
ATOM   6625  C CD   . LYS A 1 47  ? -9.993  6.624   10.889  1.00 0.00 ? 47  LYS A CD   5  
ATOM   6626  C CE   . LYS A 1 47  ? -10.322 6.193   9.458   1.00 0.00 ? 47  LYS A CE   5  
ATOM   6627  N NZ   . LYS A 1 47  ? -10.816 4.799   9.437   1.00 0.00 ? 47  LYS A NZ   5  
ATOM   6628  H H    . LYS A 1 47  ? -5.397  7.026   8.342   1.00 0.00 ? 47  LYS A H    5  
ATOM   6629  H HA   . LYS A 1 47  ? -7.436  7.820   8.714   1.00 0.00 ? 47  LYS A HA   5  
ATOM   6630  H HB2  . LYS A 1 47  ? -7.583  6.134   10.557  1.00 0.00 ? 47  LYS A HB2  5  
ATOM   6631  H HB3  . LYS A 1 47  ? -6.993  7.348   11.674  1.00 0.00 ? 47  LYS A HB3  5  
ATOM   6632  H HG2  . LYS A 1 47  ? -9.043  8.317   11.829  1.00 0.00 ? 47  LYS A HG2  5  
ATOM   6633  H HG3  . LYS A 1 47  ? -9.178  8.452   10.087  1.00 0.00 ? 47  LYS A HG3  5  
ATOM   6634  H HD2  . LYS A 1 47  ? -9.608  5.772   11.448  1.00 0.00 ? 47  LYS A HD2  5  
ATOM   6635  H HD3  . LYS A 1 47  ? -10.903 6.950   11.391  1.00 0.00 ? 47  LYS A HD3  5  
ATOM   6636  H HE2  . LYS A 1 47  ? -11.075 6.858   9.035   1.00 0.00 ? 47  LYS A HE2  5  
ATOM   6637  H HE3  . LYS A 1 47  ? -9.433  6.278   8.832   1.00 0.00 ? 47  LYS A HE3  5  
ATOM   6638  H HZ1  . LYS A 1 47  ? -11.456 4.682   8.676   1.00 0.00 ? 47  LYS A HZ1  5  
ATOM   6639  H HZ2  . LYS A 1 47  ? -10.045 4.172   9.322   1.00 0.00 ? 47  LYS A HZ2  5  
ATOM   6640  H HZ3  . LYS A 1 47  ? -11.282 4.596   10.299  1.00 0.00 ? 47  LYS A HZ3  5  
ATOM   6641  N N    . GLY A 1 48  ? -6.802  10.192  8.842   1.00 0.00 ? 48  GLY A N    5  
ATOM   6642  C CA   . GLY A 1 48  ? -6.587  11.626  8.946   1.00 0.00 ? 48  GLY A CA   5  
ATOM   6643  C C    . GLY A 1 48  ? -5.472  12.083  8.003   1.00 0.00 ? 48  GLY A C    5  
ATOM   6644  O O    . GLY A 1 48  ? -4.986  13.208  8.108   1.00 0.00 ? 48  GLY A O    5  
ATOM   6645  H H    . GLY A 1 48  ? -7.163  9.883   7.964   1.00 0.00 ? 48  GLY A H    5  
ATOM   6646  H HA2  . GLY A 1 48  ? -7.510  12.154  8.708   1.00 0.00 ? 48  GLY A HA2  5  
ATOM   6647  H HA3  . GLY A 1 48  ? -6.328  11.884  9.973   1.00 0.00 ? 48  GLY A HA3  5  
ATOM   6648  N N    . GLY A 1 49  ? -5.099  11.186  7.102   1.00 0.00 ? 49  GLY A N    5  
ATOM   6649  C CA   . GLY A 1 49  ? -4.050  11.483  6.142   1.00 0.00 ? 49  GLY A CA   5  
ATOM   6650  C C    . GLY A 1 49  ? -4.642  11.984  4.822   1.00 0.00 ? 49  GLY A C    5  
ATOM   6651  O O    . GLY A 1 49  ? -5.859  11.995  4.650   1.00 0.00 ? 49  GLY A O    5  
ATOM   6652  H H    . GLY A 1 49  ? -5.497  10.273  7.024   1.00 0.00 ? 49  GLY A H    5  
ATOM   6653  H HA2  . GLY A 1 49  ? -3.378  12.237  6.551   1.00 0.00 ? 49  GLY A HA2  5  
ATOM   6654  H HA3  . GLY A 1 49  ? -3.454  10.588  5.961   1.00 0.00 ? 49  GLY A HA3  5  
ATOM   6655  N N    . ALA A 1 50  ? -3.752  12.385  3.926   1.00 0.00 ? 50  ALA A N    5  
ATOM   6656  C CA   . ALA A 1 50  ? -4.172  12.886  2.627   1.00 0.00 ? 50  ALA A CA   5  
ATOM   6657  C C    . ALA A 1 50  ? -4.638  11.714  1.760   1.00 0.00 ? 50  ALA A C    5  
ATOM   6658  O O    . ALA A 1 50  ? -5.776  11.694  1.297   1.00 0.00 ? 50  ALA A O    5  
ATOM   6659  C CB   . ALA A 1 50  ? -3.023  13.665  1.986   1.00 0.00 ? 50  ALA A CB   5  
ATOM   6660  H H    . ALA A 1 50  ? -2.763  12.373  4.074   1.00 0.00 ? 50  ALA A H    5  
ATOM   6661  H HA   . ALA A 1 50  ? -5.010  13.564  2.789   1.00 0.00 ? 50  ALA A HA   5  
ATOM   6662  H HB1  . ALA A 1 50  ? -2.089  13.419  2.492   1.00 0.00 ? 50  ALA A HB1  5  
ATOM   6663  H HB2  . ALA A 1 50  ? -2.946  13.398  0.931   1.00 0.00 ? 50  ALA A HB2  5  
ATOM   6664  H HB3  . ALA A 1 50  ? -3.214  14.734  2.075   1.00 0.00 ? 50  ALA A HB3  5  
ATOM   6665  N N    . ALA A 1 51  ? -3.732  10.766  1.567   1.00 0.00 ? 51  ALA A N    5  
ATOM   6666  C CA   . ALA A 1 51  ? -4.036  9.594   0.764   1.00 0.00 ? 51  ALA A CA   5  
ATOM   6667  C C    . ALA A 1 51  ? -4.909  8.637   1.576   1.00 0.00 ? 51  ALA A C    5  
ATOM   6668  O O    . ALA A 1 51  ? -5.427  7.657   1.041   1.00 0.00 ? 51  ALA A O    5  
ATOM   6669  C CB   . ALA A 1 51  ? -2.732  8.942   0.299   1.00 0.00 ? 51  ALA A CB   5  
ATOM   6670  H H    . ALA A 1 51  ? -2.807  10.790  1.947   1.00 0.00 ? 51  ALA A H    5  
ATOM   6671  H HA   . ALA A 1 51  ? -4.594  9.928   -0.112  1.00 0.00 ? 51  ALA A HA   5  
ATOM   6672  H HB1  . ALA A 1 51  ? -2.751  8.826   -0.786  1.00 0.00 ? 51  ALA A HB1  5  
ATOM   6673  H HB2  . ALA A 1 51  ? -1.889  9.571   0.583   1.00 0.00 ? 51  ALA A HB2  5  
ATOM   6674  H HB3  . ALA A 1 51  ? -2.630  7.962   0.765   1.00 0.00 ? 51  ALA A HB3  5  
ATOM   6675  N N    . ASP A 1 52  ? -5.047  8.952   2.855   1.00 0.00 ? 52  ASP A N    5  
ATOM   6676  C CA   . ASP A 1 52  ? -5.848  8.132   3.748   1.00 0.00 ? 52  ASP A CA   5  
ATOM   6677  C C    . ASP A 1 52  ? -7.327  8.470   3.553   1.00 0.00 ? 52  ASP A C    5  
ATOM   6678  O O    . ASP A 1 52  ? -8.143  7.582   3.304   1.00 0.00 ? 52  ASP A O    5  
ATOM   6679  C CB   . ASP A 1 52  ? -5.492  8.400   5.212   1.00 0.00 ? 52  ASP A CB   5  
ATOM   6680  C CG   . ASP A 1 52  ? -6.686  8.491   6.162   1.00 0.00 ? 52  ASP A CG   5  
ATOM   6681  O OD1  . ASP A 1 52  ? -7.176  7.412   6.564   1.00 0.00 ? 52  ASP A OD1  5  
ATOM   6682  O OD2  . ASP A 1 52  ? -7.085  9.636   6.466   1.00 0.00 ? 52  ASP A OD2  5  
ATOM   6683  H H    . ASP A 1 52  ? -4.622  9.750   3.282   1.00 0.00 ? 52  ASP A H    5  
ATOM   6684  H HA   . ASP A 1 52  ? -5.616  7.103   3.475   1.00 0.00 ? 52  ASP A HA   5  
ATOM   6685  H HB2  . ASP A 1 52  ? -4.830  7.606   5.559   1.00 0.00 ? 52  ASP A HB2  5  
ATOM   6686  H HB3  . ASP A 1 52  ? -4.928  9.332   5.268   1.00 0.00 ? 52  ASP A HB3  5  
ATOM   6687  N N    . VAL A 1 53  ? -7.629  9.754   3.671   1.00 0.00 ? 53  VAL A N    5  
ATOM   6688  C CA   . VAL A 1 53  ? -8.996  10.220  3.512   1.00 0.00 ? 53  VAL A CA   5  
ATOM   6689  C C    . VAL A 1 53  ? -9.356  10.229  2.024   1.00 0.00 ? 53  VAL A C    5  
ATOM   6690  O O    . VAL A 1 53  ? -10.503 9.976   1.659   1.00 0.00 ? 53  VAL A O    5  
ATOM   6691  C CB   . VAL A 1 53  ? -9.164  11.590  4.174   1.00 0.00 ? 53  VAL A CB   5  
ATOM   6692  C CG1  . VAL A 1 53  ? -10.586 12.119  3.987   1.00 0.00 ? 53  VAL A CG1  5  
ATOM   6693  C CG2  . VAL A 1 53  ? -8.792  11.528  5.656   1.00 0.00 ? 53  VAL A CG2  5  
ATOM   6694  H H    . VAL A 1 53  ? -6.960  10.470  3.873   1.00 0.00 ? 53  VAL A H    5  
ATOM   6695  H HA   . VAL A 1 53  ? -9.647  9.514   4.027   1.00 0.00 ? 53  VAL A HA   5  
ATOM   6696  H HB   . VAL A 1 53  ? -8.481  12.285  3.685   1.00 0.00 ? 53  VAL A HB   5  
ATOM   6697  H HG11 . VAL A 1 53  ? -11.290 11.448  4.479   1.00 0.00 ? 53  VAL A HG11 5  
ATOM   6698  H HG12 . VAL A 1 53  ? -10.665 13.114  4.424   1.00 0.00 ? 53  VAL A HG12 5  
ATOM   6699  H HG13 . VAL A 1 53  ? -10.817 12.170  2.923   1.00 0.00 ? 53  VAL A HG13 5  
ATOM   6700  H HG21 . VAL A 1 53  ? -7.722  11.711  5.770   1.00 0.00 ? 53  VAL A HG21 5  
ATOM   6701  H HG22 . VAL A 1 53  ? -9.349  12.289  6.202   1.00 0.00 ? 53  VAL A HG22 5  
ATOM   6702  H HG23 . VAL A 1 53  ? -9.037  10.544  6.054   1.00 0.00 ? 53  VAL A HG23 5  
ATOM   6703  N N    . ASP A 1 54  ? -8.354  10.521  1.206   1.00 0.00 ? 54  ASP A N    5  
ATOM   6704  C CA   . ASP A 1 54  ? -8.552  10.565  -0.231  1.00 0.00 ? 54  ASP A CA   5  
ATOM   6705  C C    . ASP A 1 54  ? -8.564  9.139   -0.785  1.00 0.00 ? 54  ASP A C    5  
ATOM   6706  O O    . ASP A 1 54  ? -9.457  8.770   -1.546  1.00 0.00 ? 54  ASP A O    5  
ATOM   6707  C CB   . ASP A 1 54  ? -7.419  11.329  -0.920  1.00 0.00 ? 54  ASP A CB   5  
ATOM   6708  C CG   . ASP A 1 54  ? -7.654  11.640  -2.399  1.00 0.00 ? 54  ASP A CG   5  
ATOM   6709  O OD1  . ASP A 1 54  ? -8.843  11.722  -2.779  1.00 0.00 ? 54  ASP A OD1  5  
ATOM   6710  O OD2  . ASP A 1 54  ? -6.640  11.789  -3.116  1.00 0.00 ? 54  ASP A OD2  5  
ATOM   6711  H H    . ASP A 1 54  ? -7.425  10.724  1.513   1.00 0.00 ? 54  ASP A H    5  
ATOM   6712  H HA   . ASP A 1 54  ? -9.505  11.075  -0.375  1.00 0.00 ? 54  ASP A HA   5  
ATOM   6713  H HB2  . ASP A 1 54  ? -7.258  12.267  -0.388  1.00 0.00 ? 54  ASP A HB2  5  
ATOM   6714  H HB3  . ASP A 1 54  ? -6.501  10.749  -0.827  1.00 0.00 ? 54  ASP A HB3  5  
ATOM   6715  N N    . GLY A 1 55  ? -7.561  8.372   -0.379  1.00 0.00 ? 55  GLY A N    5  
ATOM   6716  C CA   . GLY A 1 55  ? -7.444  6.995   -0.825  1.00 0.00 ? 55  GLY A CA   5  
ATOM   6717  C C    . GLY A 1 55  ? -8.546  6.126   -0.216  1.00 0.00 ? 55  GLY A C    5  
ATOM   6718  O O    . GLY A 1 55  ? -9.226  5.389   -0.928  1.00 0.00 ? 55  GLY A O    5  
ATOM   6719  H H    . GLY A 1 55  ? -6.838  8.680   0.240   1.00 0.00 ? 55  GLY A H    5  
ATOM   6720  H HA2  . GLY A 1 55  ? -7.502  6.954   -1.912  1.00 0.00 ? 55  GLY A HA2  5  
ATOM   6721  H HA3  . GLY A 1 55  ? -6.467  6.598   -0.544  1.00 0.00 ? 55  GLY A HA3  5  
ATOM   6722  N N    . ARG A 1 56  ? -8.689  6.243   1.095   1.00 0.00 ? 56  ARG A N    5  
ATOM   6723  C CA   . ARG A 1 56  ? -9.699  5.478   1.809   1.00 0.00 ? 56  ARG A CA   5  
ATOM   6724  C C    . ARG A 1 56  ? -9.526  3.984   1.532   1.00 0.00 ? 56  ARG A C    5  
ATOM   6725  O O    . ARG A 1 56  ? -10.499 3.281   1.262   1.00 0.00 ? 56  ARG A O    5  
ATOM   6726  C CB   . ARG A 1 56  ? -11.109 5.906   1.397   1.00 0.00 ? 56  ARG A CB   5  
ATOM   6727  C CG   . ARG A 1 56  ? -12.156 5.341   2.359   1.00 0.00 ? 56  ARG A CG   5  
ATOM   6728  C CD   . ARG A 1 56  ? -13.390 6.243   2.417   1.00 0.00 ? 56  ARG A CD   5  
ATOM   6729  N NE   . ARG A 1 56  ? -13.902 6.313   3.803   1.00 0.00 ? 56  ARG A NE   5  
ATOM   6730  C CZ   . ARG A 1 56  ? -14.883 7.133   4.204   1.00 0.00 ? 56  ARG A CZ   5  
ATOM   6731  N NH1  . ARG A 1 56  ? -15.465 7.960   3.323   1.00 0.00 ? 56  ARG A NH1  5  
ATOM   6732  N NH2  . ARG A 1 56  ? -15.283 7.128   5.481   1.00 0.00 ? 56  ARG A NH2  5  
ATOM   6733  H H    . ARG A 1 56  ? -8.134  6.844   1.669   1.00 0.00 ? 56  ARG A H    5  
ATOM   6734  H HA   . ARG A 1 56  ? -9.527  5.703   2.862   1.00 0.00 ? 56  ARG A HA   5  
ATOM   6735  H HB2  . ARG A 1 56  ? -11.171 6.993   1.383   1.00 0.00 ? 56  ARG A HB2  5  
ATOM   6736  H HB3  . ARG A 1 56  ? -11.316 5.561   0.385   1.00 0.00 ? 56  ARG A HB3  5  
ATOM   6737  H HG2  . ARG A 1 56  ? -12.448 4.341   2.038   1.00 0.00 ? 56  ARG A HG2  5  
ATOM   6738  H HG3  . ARG A 1 56  ? -11.725 5.243   3.355   1.00 0.00 ? 56  ARG A HG3  5  
ATOM   6739  H HD2  . ARG A 1 56  ? -13.136 7.242   2.063   1.00 0.00 ? 56  ARG A HD2  5  
ATOM   6740  H HD3  . ARG A 1 56  ? -14.165 5.858   1.754   1.00 0.00 ? 56  ARG A HD3  5  
ATOM   6741  H HE   . ARG A 1 56  ? -13.488 5.709   4.486   1.00 0.00 ? 56  ARG A HE   5  
ATOM   6742  H HH11 . ARG A 1 56  ? -15.166 7.964   2.369   1.00 0.00 ? 56  ARG A HH11 5  
ATOM   6743  H HH12 . ARG A 1 56  ? -16.196 8.571   3.621   1.00 0.00 ? 56  ARG A HH12 5  
ATOM   6744  H HH21 . ARG A 1 56  ? -14.848 6.511   6.138   1.00 0.00 ? 56  ARG A HH21 5  
ATOM   6745  H HH22 . ARG A 1 56  ? -16.014 7.740   5.780   1.00 0.00 ? 56  ARG A HH22 5  
ATOM   6746  N N    . LEU A 1 57  ? -8.279  3.539   1.606   1.00 0.00 ? 57  LEU A N    5  
ATOM   6747  C CA   . LEU A 1 57  ? -7.967  2.141   1.367   1.00 0.00 ? 57  LEU A CA   5  
ATOM   6748  C C    . LEU A 1 57  ? -8.530  1.294   2.508   1.00 0.00 ? 57  LEU A C    5  
ATOM   6749  O O    . LEU A 1 57  ? -8.871  1.819   3.567   1.00 0.00 ? 57  LEU A O    5  
ATOM   6750  C CB   . LEU A 1 57  ? -6.463  1.957   1.150   1.00 0.00 ? 57  LEU A CB   5  
ATOM   6751  C CG   . LEU A 1 57  ? -5.862  2.700   -0.044  1.00 0.00 ? 57  LEU A CG   5  
ATOM   6752  C CD1  . LEU A 1 57  ? -4.346  2.850   0.108   1.00 0.00 ? 57  LEU A CD1  5  
ATOM   6753  C CD2  . LEU A 1 57  ? -6.241  2.020   -1.361  1.00 0.00 ? 57  LEU A CD2  5  
ATOM   6754  H H    . LEU A 1 57  ? -7.493  4.117   1.827   1.00 0.00 ? 57  LEU A H    5  
ATOM   6755  H HA   . LEU A 1 57  ? -8.463  1.849   0.442   1.00 0.00 ? 57  LEU A HA   5  
ATOM   6756  H HB2  . LEU A 1 57  ? -5.945  2.282   2.052   1.00 0.00 ? 57  LEU A HB2  5  
ATOM   6757  H HB3  . LEU A 1 57  ? -6.260  0.893   1.031   1.00 0.00 ? 57  LEU A HB3  5  
ATOM   6758  H HG   . LEU A 1 57  ? -6.284  3.705   -0.069  1.00 0.00 ? 57  LEU A HG   5  
ATOM   6759  H HD11 . LEU A 1 57  ? -4.103  3.895   0.307   1.00 0.00 ? 57  LEU A HD11 5  
ATOM   6760  H HD12 . LEU A 1 57  ? -4.002  2.232   0.938   1.00 0.00 ? 57  LEU A HD12 5  
ATOM   6761  H HD13 . LEU A 1 57  ? -3.855  2.531   -0.811  1.00 0.00 ? 57  LEU A HD13 5  
ATOM   6762  H HD21 . LEU A 1 57  ? -7.323  1.900   -1.409  1.00 0.00 ? 57  LEU A HD21 5  
ATOM   6763  H HD22 . LEU A 1 57  ? -5.905  2.632   -2.197  1.00 0.00 ? 57  LEU A HD22 5  
ATOM   6764  H HD23 . LEU A 1 57  ? -5.764  1.040   -1.414  1.00 0.00 ? 57  LEU A HD23 5  
ATOM   6765  N N    . ALA A 1 58  ? -8.614  -0.005  2.255   1.00 0.00 ? 58  ALA A N    5  
ATOM   6766  C CA   . ALA A 1 58  ? -9.132  -0.929  3.248   1.00 0.00 ? 58  ALA A CA   5  
ATOM   6767  C C    . ALA A 1 58  ? -7.962  -1.594  3.978   1.00 0.00 ? 58  ALA A C    5  
ATOM   6768  O O    . ALA A 1 58  ? -6.829  -1.562  3.499   1.00 0.00 ? 58  ALA A O    5  
ATOM   6769  C CB   . ALA A 1 58  ? -10.047 -1.948  2.568   1.00 0.00 ? 58  ALA A CB   5  
ATOM   6770  H H    . ALA A 1 58  ? -8.334  -0.424  1.391   1.00 0.00 ? 58  ALA A H    5  
ATOM   6771  H HA   . ALA A 1 58  ? -9.716  -0.354  3.965   1.00 0.00 ? 58  ALA A HA   5  
ATOM   6772  H HB1  . ALA A 1 58  ? -10.708 -1.433  1.869   1.00 0.00 ? 58  ALA A HB1  5  
ATOM   6773  H HB2  . ALA A 1 58  ? -9.444  -2.678  2.028   1.00 0.00 ? 58  ALA A HB2  5  
ATOM   6774  H HB3  . ALA A 1 58  ? -10.647 -2.458  3.323   1.00 0.00 ? 58  ALA A HB3  5  
ATOM   6775  N N    . ALA A 1 59  ? -8.277  -2.179  5.125   1.00 0.00 ? 59  ALA A N    5  
ATOM   6776  C CA   . ALA A 1 59  ? -7.268  -2.850  5.924   1.00 0.00 ? 59  ALA A CA   5  
ATOM   6777  C C    . ALA A 1 59  ? -7.226  -4.332  5.551   1.00 0.00 ? 59  ALA A C    5  
ATOM   6778  O O    . ALA A 1 59  ? -8.236  -5.028  5.643   1.00 0.00 ? 59  ALA A O    5  
ATOM   6779  C CB   . ALA A 1 59  ? -7.564  -2.632  7.411   1.00 0.00 ? 59  ALA A CB   5  
ATOM   6780  H H    . ALA A 1 59  ? -9.202  -2.200  5.505   1.00 0.00 ? 59  ALA A H    5  
ATOM   6781  H HA   . ALA A 1 59  ? -6.303  -2.398  5.690   1.00 0.00 ? 59  ALA A HA   5  
ATOM   6782  H HB1  . ALA A 1 59  ? -7.858  -1.596  7.573   1.00 0.00 ? 59  ALA A HB1  5  
ATOM   6783  H HB2  . ALA A 1 59  ? -8.375  -3.292  7.718   1.00 0.00 ? 59  ALA A HB2  5  
ATOM   6784  H HB3  . ALA A 1 59  ? -6.673  -2.855  7.995   1.00 0.00 ? 59  ALA A HB3  5  
ATOM   6785  N N    . GLY A 1 60  ? -6.048  -4.773  5.133   1.00 0.00 ? 60  GLY A N    5  
ATOM   6786  C CA   . GLY A 1 60  ? -5.862  -6.160  4.744   1.00 0.00 ? 60  GLY A CA   5  
ATOM   6787  C C    . GLY A 1 60  ? -5.442  -6.266  3.275   1.00 0.00 ? 60  GLY A C    5  
ATOM   6788  O O    . GLY A 1 60  ? -5.492  -7.345  2.690   1.00 0.00 ? 60  GLY A O    5  
ATOM   6789  H H    . GLY A 1 60  ? -5.231  -4.200  5.059   1.00 0.00 ? 60  GLY A H    5  
ATOM   6790  H HA2  . GLY A 1 60  ? -5.105  -6.621  5.378   1.00 0.00 ? 60  GLY A HA2  5  
ATOM   6791  H HA3  . GLY A 1 60  ? -6.790  -6.712  4.900   1.00 0.00 ? 60  GLY A HA3  5  
ATOM   6792  N N    . ASP A 1 61  ? -5.036  -5.129  2.726   1.00 0.00 ? 61  ASP A N    5  
ATOM   6793  C CA   . ASP A 1 61  ? -4.607  -5.081  1.340   1.00 0.00 ? 61  ASP A CA   5  
ATOM   6794  C C    . ASP A 1 61  ? -3.228  -5.736  1.213   1.00 0.00 ? 61  ASP A C    5  
ATOM   6795  O O    . ASP A 1 61  ? -2.247  -5.235  1.760   1.00 0.00 ? 61  ASP A O    5  
ATOM   6796  C CB   . ASP A 1 61  ? -4.489  -3.637  0.849   1.00 0.00 ? 61  ASP A CB   5  
ATOM   6797  C CG   . ASP A 1 61  ? -5.532  -2.673  1.424   1.00 0.00 ? 61  ASP A CG   5  
ATOM   6798  O OD1  . ASP A 1 61  ? -6.660  -3.145  1.679   1.00 0.00 ? 61  ASP A OD1  5  
ATOM   6799  O OD2  . ASP A 1 61  ? -5.176  -1.488  1.593   1.00 0.00 ? 61  ASP A OD2  5  
ATOM   6800  H H    . ASP A 1 61  ? -4.998  -4.257  3.212   1.00 0.00 ? 61  ASP A H    5  
ATOM   6801  H HA   . ASP A 1 61  ? -5.374  -5.617  0.782   1.00 0.00 ? 61  ASP A HA   5  
ATOM   6802  H HB2  . ASP A 1 61  ? -3.497  -3.264  1.096   1.00 0.00 ? 61  ASP A HB2  5  
ATOM   6803  H HB3  . ASP A 1 61  ? -4.571  -3.631  -0.237  1.00 0.00 ? 61  ASP A HB3  5  
ATOM   6804  N N    . GLN A 1 62  ? -3.200  -6.845  0.489   1.00 0.00 ? 62  GLN A N    5  
ATOM   6805  C CA   . GLN A 1 62  ? -1.959  -7.572  0.284   1.00 0.00 ? 62  GLN A CA   5  
ATOM   6806  C C    . GLN A 1 62  ? -1.063  -6.827  -0.709  1.00 0.00 ? 62  GLN A C    5  
ATOM   6807  O O    . GLN A 1 62  ? -1.370  -6.763  -1.898  1.00 0.00 ? 62  GLN A O    5  
ATOM   6808  C CB   . GLN A 1 62  ? -2.233  -9.001  -0.189  1.00 0.00 ? 62  GLN A CB   5  
ATOM   6809  C CG   . GLN A 1 62  ? -0.926  -9.761  -0.424  1.00 0.00 ? 62  GLN A CG   5  
ATOM   6810  C CD   . GLN A 1 62  ? -1.065  -10.745 -1.588  1.00 0.00 ? 62  GLN A CD   5  
ATOM   6811  O OE1  . GLN A 1 62  ? -1.673  -10.461 -2.606  1.00 0.00 ? 62  GLN A OE1  5  
ATOM   6812  N NE2  . GLN A 1 62  ? -0.468  -11.916 -1.380  1.00 0.00 ? 62  GLN A NE2  5  
ATOM   6813  H H    . GLN A 1 62  ? -4.002  -7.245  0.048   1.00 0.00 ? 62  GLN A H    5  
ATOM   6814  H HA   . GLN A 1 62  ? -1.478  -7.606  1.261   1.00 0.00 ? 62  GLN A HA   5  
ATOM   6815  H HB2  . GLN A 1 62  ? -2.834  -9.525  0.553   1.00 0.00 ? 62  GLN A HB2  5  
ATOM   6816  H HB3  . GLN A 1 62  ? -2.813  -8.977  -1.111  1.00 0.00 ? 62  GLN A HB3  5  
ATOM   6817  H HG2  . GLN A 1 62  ? -0.123  -9.054  -0.635  1.00 0.00 ? 62  GLN A HG2  5  
ATOM   6818  H HG3  . GLN A 1 62  ? -0.646  -10.300 0.481   1.00 0.00 ? 62  GLN A HG3  5  
ATOM   6819  H HE21 . GLN A 1 62  ? 0.015   -12.086 -0.522  1.00 0.00 ? 62  GLN A HE21 5  
ATOM   6820  H HE22 . GLN A 1 62  ? -0.503  -12.626 -2.082  1.00 0.00 ? 62  GLN A HE22 5  
ATOM   6821  N N    . LEU A 1 63  ? 0.023   -6.283  -0.183  1.00 0.00 ? 63  LEU A N    5  
ATOM   6822  C CA   . LEU A 1 63  ? 0.964   -5.545  -1.008  1.00 0.00 ? 63  LEU A CA   5  
ATOM   6823  C C    . LEU A 1 63  ? 2.007   -6.511  -1.573  1.00 0.00 ? 63  LEU A C    5  
ATOM   6824  O O    . LEU A 1 63  ? 2.281   -7.551  -0.978  1.00 0.00 ? 63  LEU A O    5  
ATOM   6825  C CB   . LEU A 1 63  ? 1.568   -4.379  -0.222  1.00 0.00 ? 63  LEU A CB   5  
ATOM   6826  C CG   . LEU A 1 63  ? 2.643   -3.567  -0.946  1.00 0.00 ? 63  LEU A CG   5  
ATOM   6827  C CD1  . LEU A 1 63  ? 2.130   -2.169  -1.297  1.00 0.00 ? 63  LEU A CD1  5  
ATOM   6828  C CD2  . LEU A 1 63  ? 3.935   -3.513  -0.126  1.00 0.00 ? 63  LEU A CD2  5  
ATOM   6829  H H    . LEU A 1 63  ? 0.265   -6.339  0.785   1.00 0.00 ? 63  LEU A H    5  
ATOM   6830  H HA   . LEU A 1 63  ? 0.404   -5.116  -1.839  1.00 0.00 ? 63  LEU A HA   5  
ATOM   6831  H HB2  . LEU A 1 63  ? 0.761   -3.704  0.065   1.00 0.00 ? 63  LEU A HB2  5  
ATOM   6832  H HB3  . LEU A 1 63  ? 1.997   -4.772  0.701   1.00 0.00 ? 63  LEU A HB3  5  
ATOM   6833  H HG   . LEU A 1 63  ? 2.877   -4.069  -1.884  1.00 0.00 ? 63  LEU A HG   5  
ATOM   6834  H HD11 . LEU A 1 63  ? 2.955   -1.561  -1.668  1.00 0.00 ? 63  LEU A HD11 5  
ATOM   6835  H HD12 . LEU A 1 63  ? 1.364   -2.247  -2.068  1.00 0.00 ? 63  LEU A HD12 5  
ATOM   6836  H HD13 . LEU A 1 63  ? 1.707   -1.703  -0.408  1.00 0.00 ? 63  LEU A HD13 5  
ATOM   6837  H HD21 . LEU A 1 63  ? 3.701   -3.644  0.930   1.00 0.00 ? 63  LEU A HD21 5  
ATOM   6838  H HD22 . LEU A 1 63  ? 4.604   -4.310  -0.451  1.00 0.00 ? 63  LEU A HD22 5  
ATOM   6839  H HD23 . LEU A 1 63  ? 4.420   -2.549  -0.276  1.00 0.00 ? 63  LEU A HD23 5  
ATOM   6840  N N    . LEU A 1 64  ? 2.561   -6.132  -2.715  1.00 0.00 ? 64  LEU A N    5  
ATOM   6841  C CA   . LEU A 1 64  ? 3.568   -6.951  -3.368  1.00 0.00 ? 64  LEU A CA   5  
ATOM   6842  C C    . LEU A 1 64  ? 4.616   -6.044  -4.017  1.00 0.00 ? 64  LEU A C    5  
ATOM   6843  O O    . LEU A 1 64  ? 5.811   -6.330  -3.960  1.00 0.00 ? 64  LEU A O    5  
ATOM   6844  C CB   . LEU A 1 64  ? 2.913   -7.930  -4.344  1.00 0.00 ? 64  LEU A CB   5  
ATOM   6845  C CG   . LEU A 1 64  ? 2.059   -9.033  -3.715  1.00 0.00 ? 64  LEU A CG   5  
ATOM   6846  C CD1  . LEU A 1 64  ? 0.667   -9.077  -4.345  1.00 0.00 ? 64  LEU A CD1  5  
ATOM   6847  C CD2  . LEU A 1 64  ? 2.768   -10.387 -3.797  1.00 0.00 ? 64  LEU A CD2  5  
ATOM   6848  H H    . LEU A 1 64  ? 2.333   -5.283  -3.193  1.00 0.00 ? 64  LEU A H    5  
ATOM   6849  H HA   . LEU A 1 64  ? 4.056   -7.544  -2.595  1.00 0.00 ? 64  LEU A HA   5  
ATOM   6850  H HB2  . LEU A 1 64  ? 2.286   -7.362  -5.031  1.00 0.00 ? 64  LEU A HB2  5  
ATOM   6851  H HB3  . LEU A 1 64  ? 3.696   -8.397  -4.939  1.00 0.00 ? 64  LEU A HB3  5  
ATOM   6852  H HG   . LEU A 1 64  ? 1.928   -8.804  -2.658  1.00 0.00 ? 64  LEU A HG   5  
ATOM   6853  H HD11 . LEU A 1 64  ? 0.207   -10.044 -4.146  1.00 0.00 ? 64  LEU A HD11 5  
ATOM   6854  H HD12 . LEU A 1 64  ? 0.049   -8.286  -3.918  1.00 0.00 ? 64  LEU A HD12 5  
ATOM   6855  H HD13 . LEU A 1 64  ? 0.750   -8.929  -5.422  1.00 0.00 ? 64  LEU A HD13 5  
ATOM   6856  H HD21 . LEU A 1 64  ? 3.810   -10.272 -3.500  1.00 0.00 ? 64  LEU A HD21 5  
ATOM   6857  H HD22 . LEU A 1 64  ? 2.276   -11.097 -3.131  1.00 0.00 ? 64  LEU A HD22 5  
ATOM   6858  H HD23 . LEU A 1 64  ? 2.722   -10.760 -4.821  1.00 0.00 ? 64  LEU A HD23 5  
ATOM   6859  N N    . SER A 1 65  ? 4.129   -4.969  -4.620  1.00 0.00 ? 65  SER A N    5  
ATOM   6860  C CA   . SER A 1 65  ? 5.008   -4.019  -5.280  1.00 0.00 ? 65  SER A CA   5  
ATOM   6861  C C    . SER A 1 65  ? 4.864   -2.640  -4.635  1.00 0.00 ? 65  SER A C    5  
ATOM   6862  O O    . SER A 1 65  ? 3.953   -2.413  -3.842  1.00 0.00 ? 65  SER A O    5  
ATOM   6863  C CB   . SER A 1 65  ? 4.708   -3.939  -6.778  1.00 0.00 ? 65  SER A CB   5  
ATOM   6864  O OG   . SER A 1 65  ? 5.332   -4.994  -7.504  1.00 0.00 ? 65  SER A OG   5  
ATOM   6865  H H    . SER A 1 65  ? 3.155   -4.745  -4.662  1.00 0.00 ? 65  SER A H    5  
ATOM   6866  H HA   . SER A 1 65  ? 6.017   -4.407  -5.132  1.00 0.00 ? 65  SER A HA   5  
ATOM   6867  H HB2  . SER A 1 65  ? 3.630   -3.979  -6.934  1.00 0.00 ? 65  SER A HB2  5  
ATOM   6868  H HB3  . SER A 1 65  ? 5.051   -2.979  -7.165  1.00 0.00 ? 65  SER A HB3  5  
ATOM   6869  H HG   . SER A 1 65  ? 4.640   -5.533  -7.985  1.00 0.00 ? 65  SER A HG   5  
ATOM   6870  N N    . VAL A 1 66  ? 5.780   -1.752  -5.000  1.00 0.00 ? 66  VAL A N    5  
ATOM   6871  C CA   . VAL A 1 66  ? 5.767   -0.401  -4.469  1.00 0.00 ? 66  VAL A CA   5  
ATOM   6872  C C    . VAL A 1 66  ? 5.649   0.597   -5.621  1.00 0.00 ? 66  VAL A C    5  
ATOM   6873  O O    . VAL A 1 66  ? 5.494   0.201   -6.776  1.00 0.00 ? 66  VAL A O    5  
ATOM   6874  C CB   . VAL A 1 66  ? 7.005   -0.168  -3.601  1.00 0.00 ? 66  VAL A CB   5  
ATOM   6875  C CG1  . VAL A 1 66  ? 6.668   0.694   -2.383  1.00 0.00 ? 66  VAL A CG1  5  
ATOM   6876  C CG2  . VAL A 1 66  ? 7.634   -1.497  -3.174  1.00 0.00 ? 66  VAL A CG2  5  
ATOM   6877  H H    . VAL A 1 66  ? 6.519   -1.945  -5.646  1.00 0.00 ? 66  VAL A H    5  
ATOM   6878  H HA   . VAL A 1 66  ? 4.887   -0.307  -3.832  1.00 0.00 ? 66  VAL A HA   5  
ATOM   6879  H HB   . VAL A 1 66  ? 7.738   0.371   -4.201  1.00 0.00 ? 66  VAL A HB   5  
ATOM   6880  H HG11 . VAL A 1 66  ? 5.590   0.697   -2.227  1.00 0.00 ? 66  VAL A HG11 5  
ATOM   6881  H HG12 . VAL A 1 66  ? 7.162   0.287   -1.501  1.00 0.00 ? 66  VAL A HG12 5  
ATOM   6882  H HG13 . VAL A 1 66  ? 7.013   1.714   -2.554  1.00 0.00 ? 66  VAL A HG13 5  
ATOM   6883  H HG21 . VAL A 1 66  ? 8.604   -1.308  -2.714  1.00 0.00 ? 66  VAL A HG21 5  
ATOM   6884  H HG22 . VAL A 1 66  ? 6.981   -1.994  -2.456  1.00 0.00 ? 66  VAL A HG22 5  
ATOM   6885  H HG23 . VAL A 1 66  ? 7.764   -2.134  -4.049  1.00 0.00 ? 66  VAL A HG23 5  
ATOM   6886  N N    . ASP A 1 67  ? 5.726   1.871   -5.271  1.00 0.00 ? 67  ASP A N    5  
ATOM   6887  C CA   . ASP A 1 67  ? 5.630   2.928   -6.261  1.00 0.00 ? 67  ASP A CA   5  
ATOM   6888  C C    . ASP A 1 67  ? 6.833   2.850   -7.203  1.00 0.00 ? 67  ASP A C    5  
ATOM   6889  O O    . ASP A 1 67  ? 7.968   3.076   -6.785  1.00 0.00 ? 67  ASP A O    5  
ATOM   6890  C CB   . ASP A 1 67  ? 5.637   4.308   -5.600  1.00 0.00 ? 67  ASP A CB   5  
ATOM   6891  C CG   . ASP A 1 67  ? 5.554   5.490   -6.568  1.00 0.00 ? 67  ASP A CG   5  
ATOM   6892  O OD1  . ASP A 1 67  ? 5.579   5.227   -7.789  1.00 0.00 ? 67  ASP A OD1  5  
ATOM   6893  O OD2  . ASP A 1 67  ? 5.469   6.631   -6.063  1.00 0.00 ? 67  ASP A OD2  5  
ATOM   6894  H H    . ASP A 1 67  ? 5.851   2.184   -4.330  1.00 0.00 ? 67  ASP A H    5  
ATOM   6895  H HA   . ASP A 1 67  ? 4.686   2.752   -6.777  1.00 0.00 ? 67  ASP A HA   5  
ATOM   6896  H HB2  . ASP A 1 67  ? 4.798   4.365   -4.907  1.00 0.00 ? 67  ASP A HB2  5  
ATOM   6897  H HB3  . ASP A 1 67  ? 6.545   4.406   -5.008  1.00 0.00 ? 67  ASP A HB3  5  
ATOM   6898  N N    . GLY A 1 68  ? 6.546   2.529   -8.457  1.00 0.00 ? 68  GLY A N    5  
ATOM   6899  C CA   . GLY A 1 68  ? 7.591   2.419   -9.459  1.00 0.00 ? 68  GLY A CA   5  
ATOM   6900  C C    . GLY A 1 68  ? 8.652   1.403   -9.035  1.00 0.00 ? 68  GLY A C    5  
ATOM   6901  O O    . GLY A 1 68  ? 9.733   1.346   -9.621  1.00 0.00 ? 68  GLY A O    5  
ATOM   6902  H H    . GLY A 1 68  ? 5.620   2.348   -8.789  1.00 0.00 ? 68  GLY A H    5  
ATOM   6903  H HA2  . GLY A 1 68  ? 7.155   2.119   -10.412 1.00 0.00 ? 68  GLY A HA2  5  
ATOM   6904  H HA3  . GLY A 1 68  ? 8.057   3.392   -9.615  1.00 0.00 ? 68  GLY A HA3  5  
ATOM   6905  N N    . ARG A 1 69  ? 8.310   0.624   -8.019  1.00 0.00 ? 69  ARG A N    5  
ATOM   6906  C CA   . ARG A 1 69  ? 9.220   -0.387  -7.510  1.00 0.00 ? 69  ARG A CA   5  
ATOM   6907  C C    . ARG A 1 69  ? 8.508   -1.737  -7.403  1.00 0.00 ? 69  ARG A C    5  
ATOM   6908  O O    . ARG A 1 69  ? 8.196   -2.193  -6.303  1.00 0.00 ? 69  ARG A O    5  
ATOM   6909  C CB   . ARG A 1 69  ? 9.764   0.006   -6.135  1.00 0.00 ? 69  ARG A CB   5  
ATOM   6910  C CG   . ARG A 1 69  ? 11.141  0.659   -6.256  1.00 0.00 ? 69  ARG A CG   5  
ATOM   6911  C CD   . ARG A 1 69  ? 12.194  -0.127  -5.472  1.00 0.00 ? 69  ARG A CD   5  
ATOM   6912  N NE   . ARG A 1 69  ? 12.695  -1.253  -6.291  1.00 0.00 ? 69  ARG A NE   5  
ATOM   6913  C CZ   . ARG A 1 69  ? 13.524  -1.114  -7.334  1.00 0.00 ? 69  ARG A CZ   5  
ATOM   6914  N NH1  . ARG A 1 69  ? 13.947  0.106   -7.693  1.00 0.00 ? 69  ARG A NH1  5  
ATOM   6915  N NH2  . ARG A 1 69  ? 13.928  -2.192  -8.021  1.00 0.00 ? 69  ARG A NH2  5  
ATOM   6916  H H    . ARG A 1 69  ? 7.430   0.677   -7.547  1.00 0.00 ? 69  ARG A H    5  
ATOM   6917  H HA   . ARG A 1 69  ? 10.029  -0.427  -8.239  1.00 0.00 ? 69  ARG A HA   5  
ATOM   6918  H HB2  . ARG A 1 69  ? 9.071   0.693   -5.648  1.00 0.00 ? 69  ARG A HB2  5  
ATOM   6919  H HB3  . ARG A 1 69  ? 9.832   -0.880  -5.501  1.00 0.00 ? 69  ARG A HB3  5  
ATOM   6920  H HG2  . ARG A 1 69  ? 11.430  0.715   -7.305  1.00 0.00 ? 69  ARG A HG2  5  
ATOM   6921  H HG3  . ARG A 1 69  ? 11.095  1.682   -5.883  1.00 0.00 ? 69  ARG A HG3  5  
ATOM   6922  H HD2  . ARG A 1 69  ? 13.018  0.528   -5.196  1.00 0.00 ? 69  ARG A HD2  5  
ATOM   6923  H HD3  . ARG A 1 69  ? 11.763  -0.505  -4.545  1.00 0.00 ? 69  ARG A HD3  5  
ATOM   6924  H HE   . ARG A 1 69  ? 12.397  -2.178  -6.050  1.00 0.00 ? 69  ARG A HE   5  
ATOM   6925  H HH11 . ARG A 1 69  ? 13.646  0.910   -7.183  1.00 0.00 ? 69  ARG A HH11 5  
ATOM   6926  H HH12 . ARG A 1 69  ? 14.566  0.210   -8.473  1.00 0.00 ? 69  ARG A HH12 5  
ATOM   6927  H HH21 . ARG A 1 69  ? 13.610  -3.101  -7.752  1.00 0.00 ? 69  ARG A HH21 5  
ATOM   6928  H HH22 . ARG A 1 69  ? 14.545  -2.087  -8.798  1.00 0.00 ? 69  ARG A HH22 5  
ATOM   6929  N N    . SER A 1 70  ? 8.270   -2.338  -8.560  1.00 0.00 ? 70  SER A N    5  
ATOM   6930  C CA   . SER A 1 70  ? 7.601   -3.625  -8.611  1.00 0.00 ? 70  SER A CA   5  
ATOM   6931  C C    . SER A 1 70  ? 8.449   -4.685  -7.905  1.00 0.00 ? 70  SER A C    5  
ATOM   6932  O O    . SER A 1 70  ? 9.553   -4.999  -8.350  1.00 0.00 ? 70  SER A O    5  
ATOM   6933  C CB   . SER A 1 70  ? 7.322   -4.045  -10.055 1.00 0.00 ? 70  SER A CB   5  
ATOM   6934  O OG   . SER A 1 70  ? 8.382   -3.676  -10.933 1.00 0.00 ? 70  SER A OG   5  
ATOM   6935  H H    . SER A 1 70  ? 8.526   -1.959  -9.449  1.00 0.00 ? 70  SER A H    5  
ATOM   6936  H HA   . SER A 1 70  ? 6.656   -3.481  -8.087  1.00 0.00 ? 70  SER A HA   5  
ATOM   6937  H HB2  . SER A 1 70  ? 7.175   -5.124  -10.098 1.00 0.00 ? 70  SER A HB2  5  
ATOM   6938  H HB3  . SER A 1 70  ? 6.394   -3.584  -10.395 1.00 0.00 ? 70  SER A HB3  5  
ATOM   6939  H HG   . SER A 1 70  ? 9.264   -3.833  -10.488 1.00 0.00 ? 70  SER A HG   5  
ATOM   6940  N N    . LEU A 1 71  ? 7.903   -5.206  -6.816  1.00 0.00 ? 71  LEU A N    5  
ATOM   6941  C CA   . LEU A 1 71  ? 8.595   -6.224  -6.045  1.00 0.00 ? 71  LEU A CA   5  
ATOM   6942  C C    . LEU A 1 71  ? 7.967   -7.590  -6.328  1.00 0.00 ? 71  LEU A C    5  
ATOM   6943  O O    . LEU A 1 71  ? 8.659   -8.606  -6.332  1.00 0.00 ? 71  LEU A O    5  
ATOM   6944  C CB   . LEU A 1 71  ? 8.614   -5.851  -4.562  1.00 0.00 ? 71  LEU A CB   5  
ATOM   6945  C CG   . LEU A 1 71  ? 8.331   -4.384  -4.235  1.00 0.00 ? 71  LEU A CG   5  
ATOM   6946  C CD1  . LEU A 1 71  ? 7.375   -4.259  -3.047  1.00 0.00 ? 71  LEU A CD1  5  
ATOM   6947  C CD2  . LEU A 1 71  ? 9.635   -3.611  -4.005  1.00 0.00 ? 71  LEU A CD2  5  
ATOM   6948  H H    . LEU A 1 71  ? 7.005   -4.945  -6.462  1.00 0.00 ? 71  LEU A H    5  
ATOM   6949  H HA   . LEU A 1 71  ? 9.632   -6.242  -6.386  1.00 0.00 ? 71  LEU A HA   5  
ATOM   6950  H HB2  . LEU A 1 71  ? 7.878   -6.466  -4.043  1.00 0.00 ? 71  LEU A HB2  5  
ATOM   6951  H HB3  . LEU A 1 71  ? 9.591   -6.112  -4.154  1.00 0.00 ? 71  LEU A HB3  5  
ATOM   6952  H HG   . LEU A 1 71  ? 7.838   -3.930  -5.095  1.00 0.00 ? 71  LEU A HG   5  
ATOM   6953  H HD11 . LEU A 1 71  ? 7.860   -3.701  -2.247  1.00 0.00 ? 71  LEU A HD11 5  
ATOM   6954  H HD12 . LEU A 1 71  ? 6.473   -3.735  -3.361  1.00 0.00 ? 71  LEU A HD12 5  
ATOM   6955  H HD13 . LEU A 1 71  ? 7.111   -5.255  -2.689  1.00 0.00 ? 71  LEU A HD13 5  
ATOM   6956  H HD21 . LEU A 1 71  ? 9.624   -2.698  -4.598  1.00 0.00 ? 71  LEU A HD21 5  
ATOM   6957  H HD22 . LEU A 1 71  ? 9.725   -3.361  -2.948  1.00 0.00 ? 71  LEU A HD22 5  
ATOM   6958  H HD23 . LEU A 1 71  ? 10.480  -4.231  -4.305  1.00 0.00 ? 71  LEU A HD23 5  
ATOM   6959  N N    . VAL A 1 72  ? 6.664   -7.568  -6.559  1.00 0.00 ? 72  VAL A N    5  
ATOM   6960  C CA   . VAL A 1 72  ? 5.933   -8.792  -6.842  1.00 0.00 ? 72  VAL A CA   5  
ATOM   6961  C C    . VAL A 1 72  ? 5.658   -9.532  -5.532  1.00 0.00 ? 72  VAL A C    5  
ATOM   6962  O O    . VAL A 1 72  ? 4.941   -10.532 -5.517  1.00 0.00 ? 72  VAL A O    5  
ATOM   6963  C CB   . VAL A 1 72  ? 6.705   -9.639  -7.855  1.00 0.00 ? 72  VAL A CB   5  
ATOM   6964  C CG1  . VAL A 1 72  ? 7.568   -8.758  -8.763  1.00 0.00 ? 72  VAL A CG1  5  
ATOM   6965  C CG2  . VAL A 1 72  ? 7.555   -10.698 -7.151  1.00 0.00 ? 72  VAL A CG2  5  
ATOM   6966  H H    . VAL A 1 72  ? 6.108   -6.736  -6.554  1.00 0.00 ? 72  VAL A H    5  
ATOM   6967  H HA   . VAL A 1 72  ? 4.982   -8.510  -7.293  1.00 0.00 ? 72  VAL A HA   5  
ATOM   6968  H HB   . VAL A 1 72  ? 5.979   -10.157 -8.483  1.00 0.00 ? 72  VAL A HB   5  
ATOM   6969  H HG11 . VAL A 1 72  ? 8.610   -8.829  -8.452  1.00 0.00 ? 72  VAL A HG11 5  
ATOM   6970  H HG12 . VAL A 1 72  ? 7.471   -9.095  -9.795  1.00 0.00 ? 72  VAL A HG12 5  
ATOM   6971  H HG13 . VAL A 1 72  ? 7.235   -7.723  -8.686  1.00 0.00 ? 72  VAL A HG13 5  
ATOM   6972  H HG21 . VAL A 1 72  ? 7.079   -11.673 -7.252  1.00 0.00 ? 72  VAL A HG21 5  
ATOM   6973  H HG22 . VAL A 1 72  ? 8.547   -10.729 -7.604  1.00 0.00 ? 72  VAL A HG22 5  
ATOM   6974  H HG23 . VAL A 1 72  ? 7.648   -10.446 -6.094  1.00 0.00 ? 72  VAL A HG23 5  
ATOM   6975  N N    . GLY A 1 73  ? 6.241   -9.013  -4.461  1.00 0.00 ? 73  GLY A N    5  
ATOM   6976  C CA   . GLY A 1 73  ? 6.068   -9.612  -3.149  1.00 0.00 ? 73  GLY A CA   5  
ATOM   6977  C C    . GLY A 1 73  ? 7.377   -9.588  -2.358  1.00 0.00 ? 73  GLY A C    5  
ATOM   6978  O O    . GLY A 1 73  ? 7.892   -10.637 -1.974  1.00 0.00 ? 73  GLY A O    5  
ATOM   6979  H H    . GLY A 1 73  ? 6.822   -8.200  -4.482  1.00 0.00 ? 73  GLY A H    5  
ATOM   6980  H HA2  . GLY A 1 73  ? 5.297   -9.072  -2.599  1.00 0.00 ? 73  GLY A HA2  5  
ATOM   6981  H HA3  . GLY A 1 73  ? 5.722   -10.639 -3.257  1.00 0.00 ? 73  GLY A HA3  5  
ATOM   6982  N N    . LEU A 1 74  ? 7.879   -8.382  -2.139  1.00 0.00 ? 74  LEU A N    5  
ATOM   6983  C CA   . LEU A 1 74  ? 9.118   -8.208  -1.402  1.00 0.00 ? 74  LEU A CA   5  
ATOM   6984  C C    . LEU A 1 74  ? 8.810   -7.613  -0.026  1.00 0.00 ? 74  LEU A C    5  
ATOM   6985  O O    . LEU A 1 74  ? 7.670   -7.240  0.250   1.00 0.00 ? 74  LEU A O    5  
ATOM   6986  C CB   . LEU A 1 74  ? 10.116  -7.385  -2.217  1.00 0.00 ? 74  LEU A CB   5  
ATOM   6987  C CG   . LEU A 1 74  ? 10.625  -8.033  -3.507  1.00 0.00 ? 74  LEU A CG   5  
ATOM   6988  C CD1  . LEU A 1 74  ? 11.702  -7.170  -4.167  1.00 0.00 ? 74  LEU A CD1  5  
ATOM   6989  C CD2  . LEU A 1 74  ? 11.116  -9.460  -3.247  1.00 0.00 ? 74  LEU A CD2  5  
ATOM   6990  H H    . LEU A 1 74  ? 7.453   -7.533  -2.457  1.00 0.00 ? 74  LEU A H    5  
ATOM   6991  H HA   . LEU A 1 74  ? 9.555   -9.197  -1.260  1.00 0.00 ? 74  LEU A HA   5  
ATOM   6992  H HB2  . LEU A 1 74  ? 9.650   -6.434  -2.473  1.00 0.00 ? 74  LEU A HB2  5  
ATOM   6993  H HB3  . LEU A 1 74  ? 10.975  -7.160  -1.585  1.00 0.00 ? 74  LEU A HB3  5  
ATOM   6994  H HG   . LEU A 1 74  ? 9.793   -8.102  -4.207  1.00 0.00 ? 74  LEU A HG   5  
ATOM   6995  H HD11 . LEU A 1 74  ? 12.686  -7.575  -3.935  1.00 0.00 ? 74  LEU A HD11 5  
ATOM   6996  H HD12 . LEU A 1 74  ? 11.555  -7.169  -5.247  1.00 0.00 ? 74  LEU A HD12 5  
ATOM   6997  H HD13 . LEU A 1 74  ? 11.630  -6.150  -3.790  1.00 0.00 ? 74  LEU A HD13 5  
ATOM   6998  H HD21 . LEU A 1 74  ? 11.592  -9.508  -2.267  1.00 0.00 ? 74  LEU A HD21 5  
ATOM   6999  H HD22 . LEU A 1 74  ? 10.268  -10.144 -3.272  1.00 0.00 ? 74  LEU A HD22 5  
ATOM   7000  H HD23 . LEU A 1 74  ? 11.835  -9.742  -4.015  1.00 0.00 ? 74  LEU A HD23 5  
ATOM   7001  N N    . SER A 1 75  ? 9.844   -7.545  0.799   1.00 0.00 ? 75  SER A N    5  
ATOM   7002  C CA   . SER A 1 75  ? 9.697   -7.001  2.138   1.00 0.00 ? 75  SER A CA   5  
ATOM   7003  C C    . SER A 1 75  ? 9.573   -5.478  2.074   1.00 0.00 ? 75  SER A C    5  
ATOM   7004  O O    . SER A 1 75  ? 9.899   -4.867  1.058   1.00 0.00 ? 75  SER A O    5  
ATOM   7005  C CB   . SER A 1 75  ? 10.876  -7.402  3.027   1.00 0.00 ? 75  SER A CB   5  
ATOM   7006  O OG   . SER A 1 75  ? 12.044  -7.695  2.265   1.00 0.00 ? 75  SER A OG   5  
ATOM   7007  H H    . SER A 1 75  ? 10.766  -7.851  0.565   1.00 0.00 ? 75  SER A H    5  
ATOM   7008  H HA   . SER A 1 75  ? 8.781   -7.443  2.530   1.00 0.00 ? 75  SER A HA   5  
ATOM   7009  H HB2  . SER A 1 75  ? 11.094  -6.594  3.727   1.00 0.00 ? 75  SER A HB2  5  
ATOM   7010  H HB3  . SER A 1 75  ? 10.604  -8.273  3.622   1.00 0.00 ? 75  SER A HB3  5  
ATOM   7011  H HG   . SER A 1 75  ? 12.022  -8.647  1.960   1.00 0.00 ? 75  SER A HG   5  
ATOM   7012  N N    . GLN A 1 76  ? 9.101   -4.909  3.174   1.00 0.00 ? 76  GLN A N    5  
ATOM   7013  C CA   . GLN A 1 76  ? 8.930   -3.467  3.255   1.00 0.00 ? 76  GLN A CA   5  
ATOM   7014  C C    . GLN A 1 76  ? 10.293  -2.771  3.277   1.00 0.00 ? 76  GLN A C    5  
ATOM   7015  O O    . GLN A 1 76  ? 10.376  -1.554  3.119   1.00 0.00 ? 76  GLN A O    5  
ATOM   7016  C CB   . GLN A 1 76  ? 8.098   -3.082  4.481   1.00 0.00 ? 76  GLN A CB   5  
ATOM   7017  C CG   . GLN A 1 76  ? 8.957   -3.083  5.748   1.00 0.00 ? 76  GLN A CG   5  
ATOM   7018  C CD   . GLN A 1 76  ? 9.439   -4.497  6.081   1.00 0.00 ? 76  GLN A CD   5  
ATOM   7019  O OE1  . GLN A 1 76  ? 10.291  -5.064  5.417   1.00 0.00 ? 76  GLN A OE1  5  
ATOM   7020  N NE2  . GLN A 1 76  ? 8.850   -5.031  7.147   1.00 0.00 ? 76  GLN A NE2  5  
ATOM   7021  H H    . GLN A 1 76  ? 8.838   -5.412  3.997   1.00 0.00 ? 76  GLN A H    5  
ATOM   7022  H HA   . GLN A 1 76  ? 8.387   -3.188  2.353   1.00 0.00 ? 76  GLN A HA   5  
ATOM   7023  H HB2  . GLN A 1 76  ? 7.664   -2.094  4.334   1.00 0.00 ? 76  GLN A HB2  5  
ATOM   7024  H HB3  . GLN A 1 76  ? 7.271   -3.781  4.598   1.00 0.00 ? 76  GLN A HB3  5  
ATOM   7025  H HG2  . GLN A 1 76  ? 9.815   -2.426  5.612   1.00 0.00 ? 76  GLN A HG2  5  
ATOM   7026  H HG3  . GLN A 1 76  ? 8.380   -2.685  6.583   1.00 0.00 ? 76  GLN A HG3  5  
ATOM   7027  H HE21 . GLN A 1 76  ? 8.158   -4.512  7.649   1.00 0.00 ? 76  GLN A HE21 5  
ATOM   7028  H HE22 . GLN A 1 76  ? 9.098   -5.953  7.447   1.00 0.00 ? 76  GLN A HE22 5  
ATOM   7029  N N    . GLU A 1 77  ? 11.328  -3.574  3.473   1.00 0.00 ? 77  GLU A N    5  
ATOM   7030  C CA   . GLU A 1 77  ? 12.684  -3.051  3.517   1.00 0.00 ? 77  GLU A CA   5  
ATOM   7031  C C    . GLU A 1 77  ? 12.900  -2.041  2.389   1.00 0.00 ? 77  GLU A C    5  
ATOM   7032  O O    . GLU A 1 77  ? 12.925  -0.834  2.626   1.00 0.00 ? 77  GLU A O    5  
ATOM   7033  C CB   . GLU A 1 77  ? 13.712  -4.183  3.447   1.00 0.00 ? 77  GLU A CB   5  
ATOM   7034  C CG   . GLU A 1 77  ? 13.374  -5.294  4.441   1.00 0.00 ? 77  GLU A CG   5  
ATOM   7035  C CD   . GLU A 1 77  ? 14.568  -5.597  5.350   1.00 0.00 ? 77  GLU A CD   5  
ATOM   7036  O OE1  . GLU A 1 77  ? 15.240  -4.622  5.747   1.00 0.00 ? 77  GLU A OE1  5  
ATOM   7037  O OE2  . GLU A 1 77  ? 14.781  -6.798  5.624   1.00 0.00 ? 77  GLU A OE2  5  
ATOM   7038  H H    . GLU A 1 77  ? 11.253  -4.562  3.601   1.00 0.00 ? 77  GLU A H    5  
ATOM   7039  H HA   . GLU A 1 77  ? 12.770  -2.551  4.482   1.00 0.00 ? 77  GLU A HA   5  
ATOM   7040  H HB2  . GLU A 1 77  ? 13.738  -4.592  2.435   1.00 0.00 ? 77  GLU A HB2  5  
ATOM   7041  H HB3  . GLU A 1 77  ? 14.706  -3.789  3.656   1.00 0.00 ? 77  GLU A HB3  5  
ATOM   7042  H HG2  . GLU A 1 77  ? 12.519  -4.996  5.048   1.00 0.00 ? 77  GLU A HG2  5  
ATOM   7043  H HG3  . GLU A 1 77  ? 13.084  -6.195  3.902   1.00 0.00 ? 77  GLU A HG3  5  
ATOM   7044  N N    . ARG A 1 78  ? 13.050  -2.572  1.184   1.00 0.00 ? 78  ARG A N    5  
ATOM   7045  C CA   . ARG A 1 78  ? 13.263  -1.733  0.016   1.00 0.00 ? 78  ARG A CA   5  
ATOM   7046  C C    . ARG A 1 78  ? 12.069  -0.800  -0.191  1.00 0.00 ? 78  ARG A C    5  
ATOM   7047  O O    . ARG A 1 78  ? 12.238  0.409   -0.338  1.00 0.00 ? 78  ARG A O    5  
ATOM   7048  C CB   . ARG A 1 78  ? 13.466  -2.579  -1.241  1.00 0.00 ? 78  ARG A CB   5  
ATOM   7049  C CG   . ARG A 1 78  ? 14.639  -3.546  -1.069  1.00 0.00 ? 78  ARG A CG   5  
ATOM   7050  C CD   . ARG A 1 78  ? 14.154  -4.997  -1.043  1.00 0.00 ? 78  ARG A CD   5  
ATOM   7051  N NE   . ARG A 1 78  ? 15.074  -5.825  -0.233  1.00 0.00 ? 78  ARG A NE   5  
ATOM   7052  C CZ   . ARG A 1 78  ? 16.243  -6.307  -0.680  1.00 0.00 ? 78  ARG A CZ   5  
ATOM   7053  N NH1  . ARG A 1 78  ? 16.638  -6.047  -1.934  1.00 0.00 ? 78  ARG A NH1  5  
ATOM   7054  N NH2  . ARG A 1 78  ? 17.014  -7.048  0.125   1.00 0.00 ? 78  ARG A NH2  5  
ATOM   7055  H H    . ARG A 1 78  ? 13.029  -3.554  0.999   1.00 0.00 ? 78  ARG A H    5  
ATOM   7056  H HA   . ARG A 1 78  ? 14.167  -1.168  0.242   1.00 0.00 ? 78  ARG A HA   5  
ATOM   7057  H HB2  . ARG A 1 78  ? 12.556  -3.140  -1.457  1.00 0.00 ? 78  ARG A HB2  5  
ATOM   7058  H HB3  . ARG A 1 78  ? 13.650  -1.928  -2.097  1.00 0.00 ? 78  ARG A HB3  5  
ATOM   7059  H HG2  . ARG A 1 78  ? 15.349  -3.411  -1.883  1.00 0.00 ? 78  ARG A HG2  5  
ATOM   7060  H HG3  . ARG A 1 78  ? 15.167  -3.319  -0.142  1.00 0.00 ? 78  ARG A HG3  5  
ATOM   7061  H HD2  . ARG A 1 78  ? 13.147  -5.047  -0.627  1.00 0.00 ? 78  ARG A HD2  5  
ATOM   7062  H HD3  . ARG A 1 78  ? 14.098  -5.389  -2.059  1.00 0.00 ? 78  ARG A HD3  5  
ATOM   7063  H HE   . ARG A 1 78  ? 14.809  -6.038  0.708   1.00 0.00 ? 78  ARG A HE   5  
ATOM   7064  H HH11 . ARG A 1 78  ? 16.062  -5.493  -2.535  1.00 0.00 ? 78  ARG A HH11 5  
ATOM   7065  H HH12 . ARG A 1 78  ? 17.510  -6.406  -2.268  1.00 0.00 ? 78  ARG A HH12 5  
ATOM   7066  H HH21 . ARG A 1 78  ? 16.720  -7.243  1.061   1.00 0.00 ? 78  ARG A HH21 5  
ATOM   7067  H HH22 . ARG A 1 78  ? 17.886  -7.409  -0.209  1.00 0.00 ? 78  ARG A HH22 5  
ATOM   7068  N N    . ALA A 1 79  ? 10.886  -1.398  -0.195  1.00 0.00 ? 79  ALA A N    5  
ATOM   7069  C CA   . ALA A 1 79  ? 9.663   -0.636  -0.384  1.00 0.00 ? 79  ALA A CA   5  
ATOM   7070  C C    . ALA A 1 79  ? 9.645   0.539   0.595   1.00 0.00 ? 79  ALA A C    5  
ATOM   7071  O O    . ALA A 1 79  ? 10.065  1.644   0.253   1.00 0.00 ? 79  ALA A O    5  
ATOM   7072  C CB   . ALA A 1 79  ? 8.455   -1.558  -0.211  1.00 0.00 ? 79  ALA A CB   5  
ATOM   7073  H H    . ALA A 1 79  ? 10.757  -2.381  -0.075  1.00 0.00 ? 79  ALA A H    5  
ATOM   7074  H HA   . ALA A 1 79  ? 9.666   -0.249  -1.402  1.00 0.00 ? 79  ALA A HA   5  
ATOM   7075  H HB1  . ALA A 1 79  ? 8.567   -2.135  0.708   1.00 0.00 ? 79  ALA A HB1  5  
ATOM   7076  H HB2  . ALA A 1 79  ? 7.546   -0.959  -0.153  1.00 0.00 ? 79  ALA A HB2  5  
ATOM   7077  H HB3  . ALA A 1 79  ? 8.389   -2.236  -1.060  1.00 0.00 ? 79  ALA A HB3  5  
ATOM   7078  N N    . ALA A 1 80  ? 9.153   0.263   1.795   1.00 0.00 ? 80  ALA A N    5  
ATOM   7079  C CA   . ALA A 1 80  ? 9.075   1.282   2.825   1.00 0.00 ? 80  ALA A CA   5  
ATOM   7080  C C    . ALA A 1 80  ? 9.809   2.539   2.351   1.00 0.00 ? 80  ALA A C    5  
ATOM   7081  O O    . ALA A 1 80  ? 9.180   3.509   1.930   1.00 0.00 ? 80  ALA A O    5  
ATOM   7082  C CB   . ALA A 1 80  ? 9.647   0.733   4.133   1.00 0.00 ? 80  ALA A CB   5  
ATOM   7083  H H    . ALA A 1 80  ? 8.814   -0.637  2.064   1.00 0.00 ? 80  ALA A H    5  
ATOM   7084  H HA   . ALA A 1 80  ? 8.022   1.523   2.976   1.00 0.00 ? 80  ALA A HA   5  
ATOM   7085  H HB1  . ALA A 1 80  ? 9.610   1.508   4.900   1.00 0.00 ? 80  ALA A HB1  5  
ATOM   7086  H HB2  . ALA A 1 80  ? 9.056   -0.124  4.456   1.00 0.00 ? 80  ALA A HB2  5  
ATOM   7087  H HB3  . ALA A 1 80  ? 10.679  0.424   3.976   1.00 0.00 ? 80  ALA A HB3  5  
ATOM   7088  N N    . GLU A 1 81  ? 11.130  2.480   2.433   1.00 0.00 ? 81  GLU A N    5  
ATOM   7089  C CA   . GLU A 1 81  ? 11.956  3.600   2.017   1.00 0.00 ? 81  GLU A CA   5  
ATOM   7090  C C    . GLU A 1 81  ? 11.393  4.232   0.743   1.00 0.00 ? 81  GLU A C    5  
ATOM   7091  O O    . GLU A 1 81  ? 10.852  5.336   0.780   1.00 0.00 ? 81  GLU A O    5  
ATOM   7092  C CB   . GLU A 1 81  ? 13.410  3.165   1.818   1.00 0.00 ? 81  GLU A CB   5  
ATOM   7093  C CG   . GLU A 1 81  ? 14.295  4.360   1.456   1.00 0.00 ? 81  GLU A CG   5  
ATOM   7094  C CD   . GLU A 1 81  ? 15.754  4.093   1.829   1.00 0.00 ? 81  GLU A CD   5  
ATOM   7095  O OE1  . GLU A 1 81  ? 16.116  4.420   2.980   1.00 0.00 ? 81  GLU A OE1  5  
ATOM   7096  O OE2  . GLU A 1 81  ? 16.476  3.569   0.953   1.00 0.00 ? 81  GLU A OE2  5  
ATOM   7097  H H    . GLU A 1 81  ? 11.635  1.687   2.776   1.00 0.00 ? 81  GLU A H    5  
ATOM   7098  H HA   . GLU A 1 81  ? 11.908  4.317   2.837   1.00 0.00 ? 81  GLU A HA   5  
ATOM   7099  H HB2  . GLU A 1 81  ? 13.782  2.695   2.727   1.00 0.00 ? 81  GLU A HB2  5  
ATOM   7100  H HB3  . GLU A 1 81  ? 13.463  2.416   1.026   1.00 0.00 ? 81  GLU A HB3  5  
ATOM   7101  H HG2  . GLU A 1 81  ? 14.219  4.563   0.387   1.00 0.00 ? 81  GLU A HG2  5  
ATOM   7102  H HG3  . GLU A 1 81  ? 13.940  5.251   1.974   1.00 0.00 ? 81  GLU A HG3  5  
ATOM   7103  N N    . LEU A 1 82  ? 11.539  3.504   -0.354  1.00 0.00 ? 82  LEU A N    5  
ATOM   7104  C CA   . LEU A 1 82  ? 11.050  3.978   -1.638  1.00 0.00 ? 82  LEU A CA   5  
ATOM   7105  C C    . LEU A 1 82  ? 9.522   3.923   -1.650  1.00 0.00 ? 82  LEU A C    5  
ATOM   7106  O O    . LEU A 1 82  ? 8.900   4.062   -2.702  1.00 0.00 ? 82  LEU A O    5  
ATOM   7107  C CB   . LEU A 1 82  ? 11.703  3.200   -2.781  1.00 0.00 ? 82  LEU A CB   5  
ATOM   7108  C CG   . LEU A 1 82  ? 11.883  3.961   -4.095  1.00 0.00 ? 82  LEU A CG   5  
ATOM   7109  C CD1  . LEU A 1 82  ? 10.690  4.879   -4.367  1.00 0.00 ? 82  LEU A CD1  5  
ATOM   7110  C CD2  . LEU A 1 82  ? 13.208  4.726   -4.110  1.00 0.00 ? 82  LEU A CD2  5  
ATOM   7111  H H    . LEU A 1 82  ? 11.980  2.607   -0.376  1.00 0.00 ? 82  LEU A H    5  
ATOM   7112  H HA   . LEU A 1 82  ? 11.360  5.018   -1.740  1.00 0.00 ? 82  LEU A HA   5  
ATOM   7113  H HB2  . LEU A 1 82  ? 12.681  2.853   -2.448  1.00 0.00 ? 82  LEU A HB2  5  
ATOM   7114  H HB3  . LEU A 1 82  ? 11.102  2.312   -2.977  1.00 0.00 ? 82  LEU A HB3  5  
ATOM   7115  H HG   . LEU A 1 82  ? 11.921  3.236   -4.908  1.00 0.00 ? 82  LEU A HG   5  
ATOM   7116  H HD11 . LEU A 1 82  ? 10.947  5.588   -5.152  1.00 0.00 ? 82  LEU A HD11 5  
ATOM   7117  H HD12 . LEU A 1 82  ? 9.836   4.280   -4.684  1.00 0.00 ? 82  LEU A HD12 5  
ATOM   7118  H HD13 . LEU A 1 82  ? 10.435  5.421   -3.455  1.00 0.00 ? 82  LEU A HD13 5  
ATOM   7119  H HD21 . LEU A 1 82  ? 13.496  4.973   -3.087  1.00 0.00 ? 82  LEU A HD21 5  
ATOM   7120  H HD22 . LEU A 1 82  ? 13.981  4.106   -4.564  1.00 0.00 ? 82  LEU A HD22 5  
ATOM   7121  H HD23 . LEU A 1 82  ? 13.092  5.644   -4.687  1.00 0.00 ? 82  LEU A HD23 5  
ATOM   7122  N N    . MET A 1 83  ? 8.960   3.720   -0.467  1.00 0.00 ? 83  MET A N    5  
ATOM   7123  C CA   . MET A 1 83  ? 7.515   3.646   -0.328  1.00 0.00 ? 83  MET A CA   5  
ATOM   7124  C C    . MET A 1 83  ? 6.996   4.746   0.600   1.00 0.00 ? 83  MET A C    5  
ATOM   7125  O O    . MET A 1 83  ? 5.787   4.913   0.754   1.00 0.00 ? 83  MET A O    5  
ATOM   7126  C CB   . MET A 1 83  ? 7.127   2.277   0.234   1.00 0.00 ? 83  MET A CB   5  
ATOM   7127  C CG   . MET A 1 83  ? 5.653   1.970   -0.038  1.00 0.00 ? 83  MET A CG   5  
ATOM   7128  S SD   . MET A 1 83  ? 5.327   0.238   0.244   1.00 0.00 ? 83  MET A SD   5  
ATOM   7129  C CE   . MET A 1 83  ? 4.785   0.297   1.944   1.00 0.00 ? 83  MET A CE   5  
ATOM   7130  H H    . MET A 1 83  ? 9.472   3.610   0.384   1.00 0.00 ? 83  MET A H    5  
ATOM   7131  H HA   . MET A 1 83  ? 7.117   3.789   -1.332  1.00 0.00 ? 83  MET A HA   5  
ATOM   7132  H HB2  . MET A 1 83  ? 7.751   1.504   -0.215  1.00 0.00 ? 83  MET A HB2  5  
ATOM   7133  H HB3  . MET A 1 83  ? 7.315   2.253   1.307   1.00 0.00 ? 83  MET A HB3  5  
ATOM   7134  H HG2  . MET A 1 83  ? 5.020   2.577   0.609   1.00 0.00 ? 83  MET A HG2  5  
ATOM   7135  H HG3  . MET A 1 83  ? 5.402   2.233   -1.065  1.00 0.00 ? 83  MET A HG3  5  
ATOM   7136  H HE1  . MET A 1 83  ? 3.711   0.115   1.990   1.00 0.00 ? 83  MET A HE1  5  
ATOM   7137  H HE2  . MET A 1 83  ? 5.307   -0.467  2.519   1.00 0.00 ? 83  MET A HE2  5  
ATOM   7138  H HE3  . MET A 1 83  ? 5.004   1.280   2.362   1.00 0.00 ? 83  MET A HE3  5  
ATOM   7139  N N    . THR A 1 84  ? 7.935   5.465   1.197   1.00 0.00 ? 84  THR A N    5  
ATOM   7140  C CA   . THR A 1 84  ? 7.587   6.544   2.105   1.00 0.00 ? 84  THR A CA   5  
ATOM   7141  C C    . THR A 1 84  ? 7.850   7.900   1.449   1.00 0.00 ? 84  THR A C    5  
ATOM   7142  O O    . THR A 1 84  ? 6.988   8.777   1.459   1.00 0.00 ? 84  THR A O    5  
ATOM   7143  C CB   . THR A 1 84  ? 8.367   6.336   3.405   1.00 0.00 ? 84  THR A CB   5  
ATOM   7144  O OG1  . THR A 1 84  ? 8.369   4.923   3.586   1.00 0.00 ? 84  THR A OG1  5  
ATOM   7145  C CG2  . THR A 1 84  ? 7.618   6.867   4.628   1.00 0.00 ? 84  THR A CG2  5  
ATOM   7146  H H    . THR A 1 84  ? 8.916   5.323   1.067   1.00 0.00 ? 84  THR A H    5  
ATOM   7147  H HA   . THR A 1 84  ? 6.519   6.490   2.311   1.00 0.00 ? 84  THR A HA   5  
ATOM   7148  H HB   . THR A 1 84  ? 9.362   6.775   3.337   1.00 0.00 ? 84  THR A HB   5  
ATOM   7149  H HG1  . THR A 1 84  ? 8.855   4.482   2.832   1.00 0.00 ? 84  THR A HG1  5  
ATOM   7150  H HG21 . THR A 1 84  ? 7.517   7.950   4.551   1.00 0.00 ? 84  THR A HG21 5  
ATOM   7151  H HG22 . THR A 1 84  ? 6.629   6.413   4.675   1.00 0.00 ? 84  THR A HG22 5  
ATOM   7152  H HG23 . THR A 1 84  ? 8.174   6.619   5.532   1.00 0.00 ? 84  THR A HG23 5  
ATOM   7153  N N    . ARG A 1 85  ? 9.047   8.032   0.895   1.00 0.00 ? 85  ARG A N    5  
ATOM   7154  C CA   . ARG A 1 85  ? 9.435   9.265   0.235   1.00 0.00 ? 85  ARG A CA   5  
ATOM   7155  C C    . ARG A 1 85  ? 8.552   9.515   -0.989  1.00 0.00 ? 85  ARG A C    5  
ATOM   7156  O O    . ARG A 1 85  ? 9.046   9.582   -2.114  1.00 0.00 ? 85  ARG A O    5  
ATOM   7157  C CB   . ARG A 1 85  ? 10.899  9.221   -0.204  1.00 0.00 ? 85  ARG A CB   5  
ATOM   7158  C CG   . ARG A 1 85  ? 11.827  9.656   0.933   1.00 0.00 ? 85  ARG A CG   5  
ATOM   7159  C CD   . ARG A 1 85  ? 13.245  9.119   0.719   1.00 0.00 ? 85  ARG A CD   5  
ATOM   7160  N NE   . ARG A 1 85  ? 14.205  10.243  0.659   1.00 0.00 ? 85  ARG A NE   5  
ATOM   7161  C CZ   . ARG A 1 85  ? 15.532  10.104  0.780   1.00 0.00 ? 85  ARG A CZ   5  
ATOM   7162  N NH1  . ARG A 1 85  ? 16.065  8.888   0.968   1.00 0.00 ? 85  ARG A NH1  5  
ATOM   7163  N NH2  . ARG A 1 85  ? 16.328  11.181  0.712   1.00 0.00 ? 85  ARG A NH2  5  
ATOM   7164  H H    . ARG A 1 85  ? 9.743   7.314   0.890   1.00 0.00 ? 85  ARG A H    5  
ATOM   7165  H HA   . ARG A 1 85  ? 9.290   10.041  0.988   1.00 0.00 ? 85  ARG A HA   5  
ATOM   7166  H HB2  . ARG A 1 85  ? 11.157  8.209   -0.520  1.00 0.00 ? 85  ARG A HB2  5  
ATOM   7167  H HB3  . ARG A 1 85  ? 11.046  9.870   -1.067  1.00 0.00 ? 85  ARG A HB3  5  
ATOM   7168  H HG2  . ARG A 1 85  ? 11.850  10.744  0.992   1.00 0.00 ? 85  ARG A HG2  5  
ATOM   7169  H HG3  . ARG A 1 85  ? 11.437  9.294   1.884   1.00 0.00 ? 85  ARG A HG3  5  
ATOM   7170  H HD2  . ARG A 1 85  ? 13.514  8.445   1.532   1.00 0.00 ? 85  ARG A HD2  5  
ATOM   7171  H HD3  . ARG A 1 85  ? 13.289  8.542   -0.203  1.00 0.00 ? 85  ARG A HD3  5  
ATOM   7172  H HE   . ARG A 1 85  ? 13.842  11.164  0.518   1.00 0.00 ? 85  ARG A HE   5  
ATOM   7173  H HH11 . ARG A 1 85  ? 15.471  8.085   1.019   1.00 0.00 ? 85  ARG A HH11 5  
ATOM   7174  H HH12 . ARG A 1 85  ? 17.055  8.785   1.059   1.00 0.00 ? 85  ARG A HH12 5  
ATOM   7175  H HH21 . ARG A 1 85  ? 15.932  12.087  0.570   1.00 0.00 ? 85  ARG A HH21 5  
ATOM   7176  H HH22 . ARG A 1 85  ? 17.319  11.077  0.801   1.00 0.00 ? 85  ARG A HH22 5  
ATOM   7177  N N    . THR A 1 86  ? 7.259   9.644   -0.729  1.00 0.00 ? 86  THR A N    5  
ATOM   7178  C CA   . THR A 1 86  ? 6.301   9.884   -1.796  1.00 0.00 ? 86  THR A CA   5  
ATOM   7179  C C    . THR A 1 86  ? 6.229   11.377  -2.123  1.00 0.00 ? 86  THR A C    5  
ATOM   7180  O O    . THR A 1 86  ? 6.375   11.770  -3.279  1.00 0.00 ? 86  THR A O    5  
ATOM   7181  C CB   . THR A 1 86  ? 4.957   9.290   -1.365  1.00 0.00 ? 86  THR A CB   5  
ATOM   7182  O OG1  . THR A 1 86  ? 4.800   8.146   -2.201  1.00 0.00 ? 86  THR A OG1  5  
ATOM   7183  C CG2  . THR A 1 86  ? 3.775   10.188  -1.738  1.00 0.00 ? 86  THR A CG2  5  
ATOM   7184  H H    . THR A 1 86  ? 6.864   9.587   0.189   1.00 0.00 ? 86  THR A H    5  
ATOM   7185  H HA   . THR A 1 86  ? 6.652   9.375   -2.693  1.00 0.00 ? 86  THR A HA   5  
ATOM   7186  H HB   . THR A 1 86  ? 4.954   9.066   -0.300  1.00 0.00 ? 86  THR A HB   5  
ATOM   7187  H HG1  . THR A 1 86  ? 5.673   7.672   -2.298  1.00 0.00 ? 86  THR A HG1  5  
ATOM   7188  H HG21 . THR A 1 86  ? 2.883   9.578   -1.876  1.00 0.00 ? 86  THR A HG21 5  
ATOM   7189  H HG22 . THR A 1 86  ? 3.602   10.910  -0.938  1.00 0.00 ? 86  THR A HG22 5  
ATOM   7190  H HG23 . THR A 1 86  ? 3.999   10.718  -2.665  1.00 0.00 ? 86  THR A HG23 5  
ATOM   7191  N N    . SER A 1 87  ? 6.004   12.167  -1.084  1.00 0.00 ? 87  SER A N    5  
ATOM   7192  C CA   . SER A 1 87  ? 5.912   13.608  -1.246  1.00 0.00 ? 87  SER A CA   5  
ATOM   7193  C C    . SER A 1 87  ? 5.264   13.943  -2.592  1.00 0.00 ? 87  SER A C    5  
ATOM   7194  O O    . SER A 1 87  ? 5.859   14.635  -3.415  1.00 0.00 ? 87  SER A O    5  
ATOM   7195  C CB   . SER A 1 87  ? 7.290   14.265  -1.143  1.00 0.00 ? 87  SER A CB   5  
ATOM   7196  O OG   . SER A 1 87  ? 7.617   14.611  0.200   1.00 0.00 ? 87  SER A OG   5  
ATOM   7197  H H    . SER A 1 87  ? 5.885   11.841  -0.146  1.00 0.00 ? 87  SER A H    5  
ATOM   7198  H HA   . SER A 1 87  ? 5.283   13.952  -0.425  1.00 0.00 ? 87  SER A HA   5  
ATOM   7199  H HB2  . SER A 1 87  ? 8.045   13.582  -1.536  1.00 0.00 ? 87  SER A HB2  5  
ATOM   7200  H HB3  . SER A 1 87  ? 7.314   15.160  -1.765  1.00 0.00 ? 87  SER A HB3  5  
ATOM   7201  H HG   . SER A 1 87  ? 8.457   15.151  0.218   1.00 0.00 ? 87  SER A HG   5  
ATOM   7202  N N    . SER A 1 88  ? 4.054   13.433  -2.774  1.00 0.00 ? 88  SER A N    5  
ATOM   7203  C CA   . SER A 1 88  ? 3.319   13.671  -4.003  1.00 0.00 ? 88  SER A CA   5  
ATOM   7204  C C    . SER A 1 88  ? 2.240   12.602  -4.183  1.00 0.00 ? 88  SER A C    5  
ATOM   7205  O O    . SER A 1 88  ? 1.048   12.899  -4.102  1.00 0.00 ? 88  SER A O    5  
ATOM   7206  C CB   . SER A 1 88  ? 4.259   13.682  -5.212  1.00 0.00 ? 88  SER A CB   5  
ATOM   7207  O OG   . SER A 1 88  ? 4.545   15.006  -5.654  1.00 0.00 ? 88  SER A OG   5  
ATOM   7208  H H    . SER A 1 88  ? 3.577   12.871  -2.097  1.00 0.00 ? 88  SER A H    5  
ATOM   7209  H HA   . SER A 1 88  ? 2.869   14.655  -3.886  1.00 0.00 ? 88  SER A HA   5  
ATOM   7210  H HB2  . SER A 1 88  ? 5.189   13.178  -4.953  1.00 0.00 ? 88  SER A HB2  5  
ATOM   7211  H HB3  . SER A 1 88  ? 3.807   13.117  -6.028  1.00 0.00 ? 88  SER A HB3  5  
ATOM   7212  H HG   . SER A 1 88  ? 3.698   15.476  -5.899  1.00 0.00 ? 88  SER A HG   5  
ATOM   7213  N N    . VAL A 1 89  ? 2.694   11.381  -4.420  1.00 0.00 ? 89  VAL A N    5  
ATOM   7214  C CA   . VAL A 1 89  ? 1.780   10.266  -4.611  1.00 0.00 ? 89  VAL A CA   5  
ATOM   7215  C C    . VAL A 1 89  ? 2.441   8.980   -4.110  1.00 0.00 ? 89  VAL A C    5  
ATOM   7216  O O    . VAL A 1 89  ? 3.662   8.839   -4.174  1.00 0.00 ? 89  VAL A O    5  
ATOM   7217  C CB   . VAL A 1 89  ? 1.351   10.187  -6.078  1.00 0.00 ? 89  VAL A CB   5  
ATOM   7218  C CG1  . VAL A 1 89  ? 0.974   11.569  -6.615  1.00 0.00 ? 89  VAL A CG1  5  
ATOM   7219  C CG2  . VAL A 1 89  ? 2.442   9.543   -6.935  1.00 0.00 ? 89  VAL A CG2  5  
ATOM   7220  H H    . VAL A 1 89  ? 3.662   11.147  -4.484  1.00 0.00 ? 89  VAL A H    5  
ATOM   7221  H HA   . VAL A 1 89  ? 0.892   10.462  -4.008  1.00 0.00 ? 89  VAL A HA   5  
ATOM   7222  H HB   . VAL A 1 89  ? 0.465   9.553   -6.132  1.00 0.00 ? 89  VAL A HB   5  
ATOM   7223  H HG11 . VAL A 1 89  ? 1.841   12.227  -6.564  1.00 0.00 ? 89  VAL A HG11 5  
ATOM   7224  H HG12 . VAL A 1 89  ? 0.646   11.478  -7.649  1.00 0.00 ? 89  VAL A HG12 5  
ATOM   7225  H HG13 . VAL A 1 89  ? 0.167   11.985  -6.012  1.00 0.00 ? 89  VAL A HG13 5  
ATOM   7226  H HG21 . VAL A 1 89  ? 2.655   8.541   -6.561  1.00 0.00 ? 89  VAL A HG21 5  
ATOM   7227  H HG22 . VAL A 1 89  ? 2.102   9.482   -7.969  1.00 0.00 ? 89  VAL A HG22 5  
ATOM   7228  H HG23 . VAL A 1 89  ? 3.346   10.149  -6.886  1.00 0.00 ? 89  VAL A HG23 5  
ATOM   7229  N N    . VAL A 1 90  ? 1.605   8.073   -3.625  1.00 0.00 ? 90  VAL A N    5  
ATOM   7230  C CA   . VAL A 1 90  ? 2.093   6.803   -3.114  1.00 0.00 ? 90  VAL A CA   5  
ATOM   7231  C C    . VAL A 1 90  ? 1.479   5.661   -3.929  1.00 0.00 ? 90  VAL A C    5  
ATOM   7232  O O    . VAL A 1 90  ? 0.322   5.301   -3.723  1.00 0.00 ? 90  VAL A O    5  
ATOM   7233  C CB   . VAL A 1 90  ? 1.802   6.694   -1.617  1.00 0.00 ? 90  VAL A CB   5  
ATOM   7234  C CG1  . VAL A 1 90  ? 3.090   6.801   -0.799  1.00 0.00 ? 90  VAL A CG1  5  
ATOM   7235  C CG2  . VAL A 1 90  ? 0.784   7.750   -1.179  1.00 0.00 ? 90  VAL A CG2  5  
ATOM   7236  H H    . VAL A 1 90  ? 0.614   8.195   -3.577  1.00 0.00 ? 90  VAL A H    5  
ATOM   7237  H HA   . VAL A 1 90  ? 3.174   6.788   -3.250  1.00 0.00 ? 90  VAL A HA   5  
ATOM   7238  H HB   . VAL A 1 90  ? 1.365   5.712   -1.430  1.00 0.00 ? 90  VAL A HB   5  
ATOM   7239  H HG11 . VAL A 1 90  ? 2.968   6.264   0.142   1.00 0.00 ? 90  VAL A HG11 5  
ATOM   7240  H HG12 . VAL A 1 90  ? 3.915   6.365   -1.360  1.00 0.00 ? 90  VAL A HG12 5  
ATOM   7241  H HG13 . VAL A 1 90  ? 3.304   7.850   -0.592  1.00 0.00 ? 90  VAL A HG13 5  
ATOM   7242  H HG21 . VAL A 1 90  ? 1.161   8.743   -1.426  1.00 0.00 ? 90  VAL A HG21 5  
ATOM   7243  H HG22 . VAL A 1 90  ? -0.161  7.580   -1.696  1.00 0.00 ? 90  VAL A HG22 5  
ATOM   7244  H HG23 . VAL A 1 90  ? 0.627   7.678   -0.102  1.00 0.00 ? 90  VAL A HG23 5  
ATOM   7245  N N    . THR A 1 91  ? 2.282   5.125   -4.836  1.00 0.00 ? 91  THR A N    5  
ATOM   7246  C CA   . THR A 1 91  ? 1.832   4.033   -5.681  1.00 0.00 ? 91  THR A CA   5  
ATOM   7247  C C    . THR A 1 91  ? 2.387   2.701   -5.170  1.00 0.00 ? 91  THR A C    5  
ATOM   7248  O O    . THR A 1 91  ? 3.561   2.609   -4.813  1.00 0.00 ? 91  THR A O    5  
ATOM   7249  C CB   . THR A 1 91  ? 2.242   4.349   -7.120  1.00 0.00 ? 91  THR A CB   5  
ATOM   7250  O OG1  . THR A 1 91  ? 2.987   5.559   -7.011  1.00 0.00 ? 91  THR A OG1  5  
ATOM   7251  C CG2  . THR A 1 91  ? 1.047   4.725   -8.000  1.00 0.00 ? 91  THR A CG2  5  
ATOM   7252  H H    . THR A 1 91  ? 3.222   5.425   -4.996  1.00 0.00 ? 91  THR A H    5  
ATOM   7253  H HA   . THR A 1 91  ? 0.746   3.974   -5.616  1.00 0.00 ? 91  THR A HA   5  
ATOM   7254  H HB   . THR A 1 91  ? 2.801   3.523   -7.556  1.00 0.00 ? 91  THR A HB   5  
ATOM   7255  H HG1  . THR A 1 91  ? 3.100   5.973   -7.915  1.00 0.00 ? 91  THR A HG1  5  
ATOM   7256  H HG21 . THR A 1 91  ? 0.517   3.820   -8.297  1.00 0.00 ? 91  THR A HG21 5  
ATOM   7257  H HG22 . THR A 1 91  ? 0.374   5.374   -7.439  1.00 0.00 ? 91  THR A HG22 5  
ATOM   7258  H HG23 . THR A 1 91  ? 1.402   5.247   -8.888  1.00 0.00 ? 91  THR A HG23 5  
ATOM   7259  N N    . LEU A 1 92  ? 1.516   1.702   -5.152  1.00 0.00 ? 92  LEU A N    5  
ATOM   7260  C CA   . LEU A 1 92  ? 1.903   0.380   -4.690  1.00 0.00 ? 92  LEU A CA   5  
ATOM   7261  C C    . LEU A 1 92  ? 0.874   -0.644  -5.172  1.00 0.00 ? 92  LEU A C    5  
ATOM   7262  O O    . LEU A 1 92  ? -0.282  -0.301  -5.417  1.00 0.00 ? 92  LEU A O    5  
ATOM   7263  C CB   . LEU A 1 92  ? 2.109   0.381   -3.175  1.00 0.00 ? 92  LEU A CB   5  
ATOM   7264  C CG   . LEU A 1 92  ? 1.777   1.688   -2.453  1.00 0.00 ? 92  LEU A CG   5  
ATOM   7265  C CD1  . LEU A 1 92  ? 1.135   1.415   -1.091  1.00 0.00 ? 92  LEU A CD1  5  
ATOM   7266  C CD2  . LEU A 1 92  ? 3.015   2.579   -2.335  1.00 0.00 ? 92  LEU A CD2  5  
ATOM   7267  H H    . LEU A 1 92  ? 0.563   1.787   -5.444  1.00 0.00 ? 92  LEU A H    5  
ATOM   7268  H HA   . LEU A 1 92  ? 2.865   0.143   -5.146  1.00 0.00 ? 92  LEU A HA   5  
ATOM   7269  H HB2  . LEU A 1 92  ? 1.498   -0.414  -2.747  1.00 0.00 ? 92  LEU A HB2  5  
ATOM   7270  H HB3  . LEU A 1 92  ? 3.149   0.129   -2.970  1.00 0.00 ? 92  LEU A HB3  5  
ATOM   7271  H HG   . LEU A 1 92  ? 1.045   2.231   -3.051  1.00 0.00 ? 92  LEU A HG   5  
ATOM   7272  H HD11 . LEU A 1 92  ? 0.088   1.146   -1.229  1.00 0.00 ? 92  LEU A HD11 5  
ATOM   7273  H HD12 . LEU A 1 92  ? 1.659   0.593   -0.601  1.00 0.00 ? 92  LEU A HD12 5  
ATOM   7274  H HD13 . LEU A 1 92  ? 1.203   2.309   -0.471  1.00 0.00 ? 92  LEU A HD13 5  
ATOM   7275  H HD21 . LEU A 1 92  ? 2.872   3.481   -2.930  1.00 0.00 ? 92  LEU A HD21 5  
ATOM   7276  H HD22 . LEU A 1 92  ? 3.169   2.851   -1.292  1.00 0.00 ? 92  LEU A HD22 5  
ATOM   7277  H HD23 . LEU A 1 92  ? 3.888   2.037   -2.701  1.00 0.00 ? 92  LEU A HD23 5  
ATOM   7278  N N    . GLU A 1 93  ? 1.331   -1.882  -5.295  1.00 0.00 ? 93  GLU A N    5  
ATOM   7279  C CA   . GLU A 1 93  ? 0.463   -2.959  -5.742  1.00 0.00 ? 93  GLU A CA   5  
ATOM   7280  C C    . GLU A 1 93  ? -0.112  -3.710  -4.540  1.00 0.00 ? 93  GLU A C    5  
ATOM   7281  O O    . GLU A 1 93  ? 0.608   -4.426  -3.847  1.00 0.00 ? 93  GLU A O    5  
ATOM   7282  C CB   . GLU A 1 93  ? 1.212   -3.912  -6.677  1.00 0.00 ? 93  GLU A CB   5  
ATOM   7283  C CG   . GLU A 1 93  ? 0.237   -4.829  -7.419  1.00 0.00 ? 93  GLU A CG   5  
ATOM   7284  C CD   . GLU A 1 93  ? 0.895   -5.440  -8.658  1.00 0.00 ? 93  GLU A CD   5  
ATOM   7285  O OE1  . GLU A 1 93  ? 1.400   -4.649  -9.483  1.00 0.00 ? 93  GLU A OE1  5  
ATOM   7286  O OE2  . GLU A 1 93  ? 0.880   -6.687  -8.750  1.00 0.00 ? 93  GLU A OE2  5  
ATOM   7287  H H    . GLU A 1 93  ? 2.272   -2.152  -5.094  1.00 0.00 ? 93  GLU A H    5  
ATOM   7288  H HA   . GLU A 1 93  ? -0.340  -2.473  -6.297  1.00 0.00 ? 93  GLU A HA   5  
ATOM   7289  H HB2  . GLU A 1 93  ? 1.796   -3.337  -7.397  1.00 0.00 ? 93  GLU A HB2  5  
ATOM   7290  H HB3  . GLU A 1 93  ? 1.917   -4.513  -6.103  1.00 0.00 ? 93  GLU A HB3  5  
ATOM   7291  H HG2  . GLU A 1 93  ? -0.100  -5.623  -6.753  1.00 0.00 ? 93  GLU A HG2  5  
ATOM   7292  H HG3  . GLU A 1 93  ? -0.646  -4.263  -7.713  1.00 0.00 ? 93  GLU A HG3  5  
ATOM   7293  N N    . VAL A 1 94  ? -1.407  -3.520  -4.331  1.00 0.00 ? 94  VAL A N    5  
ATOM   7294  C CA   . VAL A 1 94  ? -2.089  -4.171  -3.226  1.00 0.00 ? 94  VAL A CA   5  
ATOM   7295  C C    . VAL A 1 94  ? -3.217  -5.049  -3.773  1.00 0.00 ? 94  VAL A C    5  
ATOM   7296  O O    . VAL A 1 94  ? -3.541  -4.981  -4.957  1.00 0.00 ? 94  VAL A O    5  
ATOM   7297  C CB   . VAL A 1 94  ? -2.579  -3.124  -2.223  1.00 0.00 ? 94  VAL A CB   5  
ATOM   7298  C CG1  . VAL A 1 94  ? -1.424  -2.250  -1.736  1.00 0.00 ? 94  VAL A CG1  5  
ATOM   7299  C CG2  . VAL A 1 94  ? -3.697  -2.271  -2.826  1.00 0.00 ? 94  VAL A CG2  5  
ATOM   7300  H H    . VAL A 1 94  ? -1.985  -2.937  -4.899  1.00 0.00 ? 94  VAL A H    5  
ATOM   7301  H HA   . VAL A 1 94  ? -1.363  -4.808  -2.720  1.00 0.00 ? 94  VAL A HA   5  
ATOM   7302  H HB   . VAL A 1 94  ? -2.988  -3.651  -1.361  1.00 0.00 ? 94  VAL A HB   5  
ATOM   7303  H HG11 . VAL A 1 94  ? -1.757  -1.215  -1.661  1.00 0.00 ? 94  VAL A HG11 5  
ATOM   7304  H HG12 . VAL A 1 94  ? -1.092  -2.596  -0.757  1.00 0.00 ? 94  VAL A HG12 5  
ATOM   7305  H HG13 . VAL A 1 94  ? -0.595  -2.314  -2.442  1.00 0.00 ? 94  VAL A HG13 5  
ATOM   7306  H HG21 . VAL A 1 94  ? -4.099  -2.768  -3.708  1.00 0.00 ? 94  VAL A HG21 5  
ATOM   7307  H HG22 . VAL A 1 94  ? -4.490  -2.140  -2.090  1.00 0.00 ? 94  VAL A HG22 5  
ATOM   7308  H HG23 . VAL A 1 94  ? -3.298  -1.296  -3.108  1.00 0.00 ? 94  VAL A HG23 5  
ATOM   7309  N N    . ALA A 1 95  ? -3.782  -5.853  -2.885  1.00 0.00 ? 95  ALA A N    5  
ATOM   7310  C CA   . ALA A 1 95  ? -4.866  -6.743  -3.263  1.00 0.00 ? 95  ALA A CA   5  
ATOM   7311  C C    . ALA A 1 95  ? -5.937  -6.730  -2.170  1.00 0.00 ? 95  ALA A C    5  
ATOM   7312  O O    . ALA A 1 95  ? -5.687  -7.164  -1.048  1.00 0.00 ? 95  ALA A O    5  
ATOM   7313  C CB   . ALA A 1 95  ? -4.312  -8.144  -3.519  1.00 0.00 ? 95  ALA A CB   5  
ATOM   7314  H H    . ALA A 1 95  ? -3.512  -5.901  -1.922  1.00 0.00 ? 95  ALA A H    5  
ATOM   7315  H HA   . ALA A 1 95  ? -5.299  -6.363  -4.188  1.00 0.00 ? 95  ALA A HA   5  
ATOM   7316  H HB1  . ALA A 1 95  ? -3.224  -8.099  -3.580  1.00 0.00 ? 95  ALA A HB1  5  
ATOM   7317  H HB2  . ALA A 1 95  ? -4.601  -8.804  -2.703  1.00 0.00 ? 95  ALA A HB2  5  
ATOM   7318  H HB3  . ALA A 1 95  ? -4.712  -8.528  -4.457  1.00 0.00 ? 95  ALA A HB3  5  
ATOM   7319  N N    . LYS A 1 96  ? -7.107  -6.225  -2.538  1.00 0.00 ? 96  LYS A N    5  
ATOM   7320  C CA   . LYS A 1 96  ? -8.216  -6.151  -1.601  1.00 0.00 ? 96  LYS A CA   5  
ATOM   7321  C C    . LYS A 1 96  ? -8.743  -7.561  -1.331  1.00 0.00 ? 96  LYS A C    5  
ATOM   7322  O O    . LYS A 1 96  ? -9.363  -8.175  -2.199  1.00 0.00 ? 96  LYS A O    5  
ATOM   7323  C CB   . LYS A 1 96  ? -9.284  -5.182  -2.114  1.00 0.00 ? 96  LYS A CB   5  
ATOM   7324  C CG   . LYS A 1 96  ? -8.930  -3.737  -1.755  1.00 0.00 ? 96  LYS A CG   5  
ATOM   7325  C CD   . LYS A 1 96  ? -10.191 -2.907  -1.517  1.00 0.00 ? 96  LYS A CD   5  
ATOM   7326  C CE   . LYS A 1 96  ? -9.846  -1.433  -1.296  1.00 0.00 ? 96  LYS A CE   5  
ATOM   7327  N NZ   . LYS A 1 96  ? -10.692 -0.568  -2.147  1.00 0.00 ? 96  LYS A NZ   5  
ATOM   7328  H H    . LYS A 1 96  ? -7.302  -5.874  -3.453  1.00 0.00 ? 96  LYS A H    5  
ATOM   7329  H HA   . LYS A 1 96  ? -7.830  -5.740  -0.669  1.00 0.00 ? 96  LYS A HA   5  
ATOM   7330  H HB2  . LYS A 1 96  ? -9.381  -5.280  -3.196  1.00 0.00 ? 96  LYS A HB2  5  
ATOM   7331  H HB3  . LYS A 1 96  ? -10.250 -5.441  -1.684  1.00 0.00 ? 96  LYS A HB3  5  
ATOM   7332  H HG2  . LYS A 1 96  ? -8.306  -3.723  -0.863  1.00 0.00 ? 96  LYS A HG2  5  
ATOM   7333  H HG3  . LYS A 1 96  ? -8.345  -3.292  -2.561  1.00 0.00 ? 96  LYS A HG3  5  
ATOM   7334  H HD2  . LYS A 1 96  ? -10.862 -3.002  -2.371  1.00 0.00 ? 96  LYS A HD2  5  
ATOM   7335  H HD3  . LYS A 1 96  ? -10.727 -3.292  -0.649  1.00 0.00 ? 96  LYS A HD3  5  
ATOM   7336  H HE2  . LYS A 1 96  ? -9.988  -1.173  -0.247  1.00 0.00 ? 96  LYS A HE2  5  
ATOM   7337  H HE3  . LYS A 1 96  ? -8.794  -1.263  -1.526  1.00 0.00 ? 96  LYS A HE3  5  
ATOM   7338  H HZ1  . LYS A 1 96  ? -11.176 0.094   -1.572  1.00 0.00 ? 96  LYS A HZ1  5  
ATOM   7339  H HZ2  . LYS A 1 96  ? -10.117 -0.081  -2.804  1.00 0.00 ? 96  LYS A HZ2  5  
ATOM   7340  H HZ3  . LYS A 1 96  ? -11.357 -1.131  -2.639  1.00 0.00 ? 96  LYS A HZ3  5  
ATOM   7341  N N    . GLN A 1 97  ? -8.482  -8.033  -0.120  1.00 0.00 ? 97  GLN A N    5  
ATOM   7342  C CA   . GLN A 1 97  ? -8.924  -9.360  0.278   1.00 0.00 ? 97  GLN A CA   5  
ATOM   7343  C C    . GLN A 1 97  ? -8.482  -9.658  1.711   1.00 0.00 ? 97  GLN A C    5  
ATOM   7344  O O    . GLN A 1 97  ? -7.436  -10.268 1.928   1.00 0.00 ? 97  GLN A O    5  
ATOM   7345  C CB   . GLN A 1 97  ? -8.402  -10.424 -0.689  1.00 0.00 ? 97  GLN A CB   5  
ATOM   7346  C CG   . GLN A 1 97  ? -9.389  -11.586 -0.810  1.00 0.00 ? 97  GLN A CG   5  
ATOM   7347  C CD   . GLN A 1 97  ? -8.938  -12.581 -1.882  1.00 0.00 ? 97  GLN A CD   5  
ATOM   7348  O OE1  . GLN A 1 97  ? -7.840  -12.508 -2.408  1.00 0.00 ? 97  GLN A OE1  5  
ATOM   7349  N NE2  . GLN A 1 97  ? -9.843  -13.509 -2.174  1.00 0.00 ? 97  GLN A NE2  5  
ATOM   7350  H H    . GLN A 1 97  ? -7.978  -7.528  0.580   1.00 0.00 ? 97  GLN A H    5  
ATOM   7351  H HA   . GLN A 1 97  ? -10.012 -9.331  0.223   1.00 0.00 ? 97  GLN A HA   5  
ATOM   7352  H HB2  . GLN A 1 97  ? -8.237  -9.979  -1.672  1.00 0.00 ? 97  GLN A HB2  5  
ATOM   7353  H HB3  . GLN A 1 97  ? -7.437  -10.794 -0.344  1.00 0.00 ? 97  GLN A HB3  5  
ATOM   7354  H HG2  . GLN A 1 97  ? -9.475  -12.096 0.151   1.00 0.00 ? 97  GLN A HG2  5  
ATOM   7355  H HG3  . GLN A 1 97  ? -10.378 -11.203 -1.058  1.00 0.00 ? 97  GLN A HG3  5  
ATOM   7356  H HE21 . GLN A 1 97  ? -10.726 -13.512 -1.704  1.00 0.00 ? 97  GLN A HE21 5  
ATOM   7357  H HE22 . GLN A 1 97  ? -9.642  -14.206 -2.862  1.00 0.00 ? 97  GLN A HE22 5  
ATOM   7358  N N    . GLY A 1 98  ? -9.301  -9.216  2.654   1.00 0.00 ? 98  GLY A N    5  
ATOM   7359  C CA   . GLY A 1 98  ? -9.008  -9.429  4.061   1.00 0.00 ? 98  GLY A CA   5  
ATOM   7360  C C    . GLY A 1 98  ? -9.817  -8.472  4.940   1.00 0.00 ? 98  GLY A C    5  
ATOM   7361  O O    . GLY A 1 98  ? -10.784 -7.868  4.479   1.00 0.00 ? 98  GLY A O    5  
ATOM   7362  H H    . GLY A 1 98  ? -10.150 -8.721  2.468   1.00 0.00 ? 98  GLY A H    5  
ATOM   7363  H HA2  . GLY A 1 98  ? -9.237  -10.459 4.332   1.00 0.00 ? 98  GLY A HA2  5  
ATOM   7364  H HA3  . GLY A 1 98  ? -7.944  -9.280  4.241   1.00 0.00 ? 98  GLY A HA3  5  
ATOM   7365  N N    . ALA A 1 99  ? -9.391  -8.366  6.190   1.00 0.00 ? 99  ALA A N    5  
ATOM   7366  C CA   . ALA A 1 99  ? -10.064 -7.494  7.139   1.00 0.00 ? 99  ALA A CA   5  
ATOM   7367  C C    . ALA A 1 99  ? -9.043  -6.951  8.139   1.00 0.00 ? 99  ALA A C    5  
ATOM   7368  O O    . ALA A 1 99  ? -8.959  -5.743  8.353   1.00 0.00 ? 99  ALA A O    5  
ATOM   7369  C CB   . ALA A 1 99  ? -11.200 -8.260  7.819   1.00 0.00 ? 99  ALA A CB   5  
ATOM   7370  H H    . ALA A 1 99  ? -8.604  -8.860  6.558   1.00 0.00 ? 99  ALA A H    5  
ATOM   7371  H HA   . ALA A 1 99  ? -10.490 -6.660  6.578   1.00 0.00 ? 99  ALA A HA   5  
ATOM   7372  H HB1  . ALA A 1 99  ? -12.053 -8.325  7.143   1.00 0.00 ? 99  ALA A HB1  5  
ATOM   7373  H HB2  . ALA A 1 99  ? -10.859 -9.264  8.073   1.00 0.00 ? 99  ALA A HB2  5  
ATOM   7374  H HB3  . ALA A 1 99  ? -11.496 -7.737  8.729   1.00 0.00 ? 99  ALA A HB3  5  
ATOM   7375  N N    . ILE A 1 100 ? -8.292  -7.872  8.727   1.00 0.00 ? 100 ILE A N    5  
ATOM   7376  C CA   . ILE A 1 100 ? -7.278  -7.501  9.700   1.00 0.00 ? 100 ILE A CA   5  
ATOM   7377  C C    . ILE A 1 100 ? -6.427  -8.726  10.034  1.00 0.00 ? 100 ILE A C    5  
ATOM   7378  O O    . ILE A 1 100 ? -6.938  -9.720  10.551  1.00 0.00 ? 100 ILE A O    5  
ATOM   7379  C CB   . ILE A 1 100 ? -7.925  -6.848  10.924  1.00 0.00 ? 100 ILE A CB   5  
ATOM   7380  C CG1  . ILE A 1 100 ? -7.061  -5.703  11.457  1.00 0.00 ? 100 ILE A CG1  5  
ATOM   7381  C CG2  . ILE A 1 100 ? -8.228  -7.888  12.004  1.00 0.00 ? 100 ILE A CG2  5  
ATOM   7382  C CD1  . ILE A 1 100 ? -5.787  -6.238  12.110  1.00 0.00 ? 100 ILE A CD1  5  
ATOM   7383  H H    . ILE A 1 100 ? -8.366  -8.852  8.546   1.00 0.00 ? 100 ILE A H    5  
ATOM   7384  H HA   . ILE A 1 100 ? -6.639  -6.751  9.237   1.00 0.00 ? 100 ILE A HA   5  
ATOM   7385  H HB   . ILE A 1 100 ? -8.878  -6.416  10.616  1.00 0.00 ? 100 ILE A HB   5  
ATOM   7386  H HG12 . ILE A 1 100 ? -6.800  -5.031  10.639  1.00 0.00 ? 100 ILE A HG12 5  
ATOM   7387  H HG13 . ILE A 1 100 ? -7.629  -5.122  12.181  1.00 0.00 ? 100 ILE A HG13 5  
ATOM   7388  H HG21 . ILE A 1 100 ? -8.920  -8.632  11.610  1.00 0.00 ? 100 ILE A HG21 5  
ATOM   7389  H HG22 . ILE A 1 100 ? -7.302  -8.379  12.306  1.00 0.00 ? 100 ILE A HG22 5  
ATOM   7390  H HG23 . ILE A 1 100 ? -8.675  -7.396  12.868  1.00 0.00 ? 100 ILE A HG23 5  
ATOM   7391  H HD11 . ILE A 1 100 ? -5.112  -5.409  12.328  1.00 0.00 ? 100 ILE A HD11 5  
ATOM   7392  H HD12 . ILE A 1 100 ? -6.040  -6.752  13.037  1.00 0.00 ? 100 ILE A HD12 5  
ATOM   7393  H HD13 . ILE A 1 100 ? -5.295  -6.936  11.432  1.00 0.00 ? 100 ILE A HD13 5  
ATOM   7394  N N    . TYR A 1 101 ? -5.142  -8.617  9.728   1.00 0.00 ? 101 TYR A N    5  
ATOM   7395  C CA   . TYR A 1 101 ? -4.215  -9.704  9.991   1.00 0.00 ? 101 TYR A CA   5  
ATOM   7396  C C    . TYR A 1 101 ? -2.844  -9.166  10.406  1.00 0.00 ? 101 TYR A C    5  
ATOM   7397  O O    . TYR A 1 101 ? -2.321  -8.244  9.784   1.00 0.00 ? 101 TYR A O    5  
ATOM   7398  C CB   . TYR A 1 101 ? -4.073  -10.465 8.670   1.00 0.00 ? 101 TYR A CB   5  
ATOM   7399  C CG   . TYR A 1 101 ? -4.719  -11.851 8.681   1.00 0.00 ? 101 TYR A CG   5  
ATOM   7400  C CD1  . TYR A 1 101 ? -6.070  -11.985 8.426   1.00 0.00 ? 101 TYR A CD1  5  
ATOM   7401  C CD2  . TYR A 1 101 ? -3.953  -12.969 8.941   1.00 0.00 ? 101 TYR A CD2  5  
ATOM   7402  C CE1  . TYR A 1 101 ? -6.679  -13.291 8.433   1.00 0.00 ? 101 TYR A CE1  5  
ATOM   7403  C CE2  . TYR A 1 101 ? -4.561  -14.274 8.950   1.00 0.00 ? 101 TYR A CE2  5  
ATOM   7404  C CZ   . TYR A 1 101 ? -5.894  -14.370 8.696   1.00 0.00 ? 101 TYR A CZ   5  
ATOM   7405  O OH   . TYR A 1 101 ? -6.469  -15.602 8.703   1.00 0.00 ? 101 TYR A OH   5  
ATOM   7406  H H    . TYR A 1 101 ? -4.736  -7.805  9.310   1.00 0.00 ? 101 TYR A H    5  
ATOM   7407  H HA   . TYR A 1 101 ? -4.623  -10.305 10.803  1.00 0.00 ? 101 TYR A HA   5  
ATOM   7408  H HB2  . TYR A 1 101 ? -4.519  -9.872  7.873   1.00 0.00 ? 101 TYR A HB2  5  
ATOM   7409  H HB3  . TYR A 1 101 ? -3.015  -10.570 8.436   1.00 0.00 ? 101 TYR A HB3  5  
ATOM   7410  H HD1  . TYR A 1 101 ? -6.674  -11.102 8.219   1.00 0.00 ? 101 TYR A HD1  5  
ATOM   7411  H HD2  . TYR A 1 101 ? -2.886  -12.863 9.143   1.00 0.00 ? 101 TYR A HD2  5  
ATOM   7412  H HE1  . TYR A 1 101 ? -7.744  -13.409 8.235   1.00 0.00 ? 101 TYR A HE1  5  
ATOM   7413  H HE2  . TYR A 1 101 ? -3.967  -15.163 9.155   1.00 0.00 ? 101 TYR A HE2  5  
ATOM   7414  H HH   . TYR A 1 101 ? -6.164  -16.116 9.506   1.00 0.00 ? 101 TYR A HH   5  
ATOM   7415  N N    . GLY A 1 1   ? -12.652 -15.254 -26.128 1.00 0.00 ? 1   GLY A N    6  
ATOM   7416  C CA   . GLY A 1 1   ? -13.700 -16.259 -26.166 1.00 0.00 ? 1   GLY A CA   6  
ATOM   7417  C C    . GLY A 1 1   ? -14.553 -16.211 -24.896 1.00 0.00 ? 1   GLY A C    6  
ATOM   7418  O O    . GLY A 1 1   ? -14.489 -15.245 -24.136 1.00 0.00 ? 1   GLY A O    6  
ATOM   7419  H H1   . GLY A 1 1   ? -12.372 -14.899 -27.021 1.00 0.00 ? 1   GLY A H1   6  
ATOM   7420  H HA2  . GLY A 1 1   ? -14.332 -16.096 -27.040 1.00 0.00 ? 1   GLY A HA2  6  
ATOM   7421  H HA3  . GLY A 1 1   ? -13.257 -17.249 -26.274 1.00 0.00 ? 1   GLY A HA3  6  
ATOM   7422  N N    . PRO A 1 2   ? -15.352 -17.293 -24.700 1.00 0.00 ? 2   PRO A N    6  
ATOM   7423  C CA   . PRO A 1 2   ? -16.216 -17.384 -23.535 1.00 0.00 ? 2   PRO A CA   6  
ATOM   7424  C C    . PRO A 1 2   ? -15.408 -17.710 -22.278 1.00 0.00 ? 2   PRO A C    6  
ATOM   7425  O O    . PRO A 1 2   ? -15.696 -17.193 -21.199 1.00 0.00 ? 2   PRO A O    6  
ATOM   7426  C CB   . PRO A 1 2   ? -17.233 -18.459 -23.883 1.00 0.00 ? 2   PRO A CB   6  
ATOM   7427  C CG   . PRO A 1 2   ? -16.626 -19.252 -25.028 1.00 0.00 ? 2   PRO A CG   6  
ATOM   7428  C CD   . PRO A 1 2   ? -15.455 -18.455 -25.577 1.00 0.00 ? 2   PRO A CD   6  
ATOM   7429  H HA   . PRO A 1 2   ? -16.653 -16.503 -23.359 1.00 0.00 ? 2   PRO A HA   6  
ATOM   7430  H HB2  . PRO A 1 2   ? -17.431 -19.102 -23.025 1.00 0.00 ? 2   PRO A HB2  6  
ATOM   7431  H HB3  . PRO A 1 2   ? -18.185 -18.017 -24.176 1.00 0.00 ? 2   PRO A HB3  6  
ATOM   7432  H HG2  . PRO A 1 2   ? -16.292 -20.230 -24.680 1.00 0.00 ? 2   PRO A HG2  6  
ATOM   7433  H HG3  . PRO A 1 2   ? -17.368 -19.428 -25.808 1.00 0.00 ? 2   PRO A HG3  6  
ATOM   7434  H HD2  . PRO A 1 2   ? -14.536 -19.041 -25.567 1.00 0.00 ? 2   PRO A HD2  6  
ATOM   7435  H HD3  . PRO A 1 2   ? -15.629 -18.157 -26.613 1.00 0.00 ? 2   PRO A HD3  6  
ATOM   7436  N N    . LEU A 1 3   ? -14.412 -18.563 -22.456 1.00 0.00 ? 3   LEU A N    6  
ATOM   7437  C CA   . LEU A 1 3   ? -13.561 -18.963 -21.349 1.00 0.00 ? 3   LEU A CA   6  
ATOM   7438  C C    . LEU A 1 3   ? -12.367 -18.010 -21.259 1.00 0.00 ? 3   LEU A C    6  
ATOM   7439  O O    . LEU A 1 3   ? -11.637 -17.830 -22.232 1.00 0.00 ? 3   LEU A O    6  
ATOM   7440  C CB   . LEU A 1 3   ? -13.164 -20.436 -21.484 1.00 0.00 ? 3   LEU A CB   6  
ATOM   7441  C CG   . LEU A 1 3   ? -12.018 -20.736 -22.454 1.00 0.00 ? 3   LEU A CG   6  
ATOM   7442  C CD1  . LEU A 1 3   ? -10.669 -20.700 -21.736 1.00 0.00 ? 3   LEU A CD1  6  
ATOM   7443  C CD2  . LEU A 1 3   ? -12.248 -22.063 -23.179 1.00 0.00 ? 3   LEU A CD2  6  
ATOM   7444  H H    . LEU A 1 3   ? -14.184 -18.979 -23.337 1.00 0.00 ? 3   LEU A H    6  
ATOM   7445  H HA   . LEU A 1 3   ? -14.148 -18.870 -20.435 1.00 0.00 ? 3   LEU A HA   6  
ATOM   7446  H HB2  . LEU A 1 3   ? -12.885 -20.807 -20.497 1.00 0.00 ? 3   LEU A HB2  6  
ATOM   7447  H HB3  . LEU A 1 3   ? -14.040 -21.000 -21.801 1.00 0.00 ? 3   LEU A HB3  6  
ATOM   7448  H HG   . LEU A 1 3   ? -12.001 -19.953 -23.213 1.00 0.00 ? 3   LEU A HG   6  
ATOM   7449  H HD11 . LEU A 1 3   ? -9.878  -20.502 -22.459 1.00 0.00 ? 3   LEU A HD11 6  
ATOM   7450  H HD12 . LEU A 1 3   ? -10.678 -19.912 -20.982 1.00 0.00 ? 3   LEU A HD12 6  
ATOM   7451  H HD13 . LEU A 1 3   ? -10.488 -21.660 -21.254 1.00 0.00 ? 3   LEU A HD13 6  
ATOM   7452  H HD21 . LEU A 1 3   ? -11.459 -22.766 -22.908 1.00 0.00 ? 3   LEU A HD21 6  
ATOM   7453  H HD22 . LEU A 1 3   ? -13.216 -22.474 -22.885 1.00 0.00 ? 3   LEU A HD22 6  
ATOM   7454  H HD23 . LEU A 1 3   ? -12.235 -21.898 -24.255 1.00 0.00 ? 3   LEU A HD23 6  
ATOM   7455  N N    . GLY A 1 4   ? -12.206 -17.426 -20.082 1.00 0.00 ? 4   GLY A N    6  
ATOM   7456  C CA   . GLY A 1 4   ? -11.113 -16.495 -19.851 1.00 0.00 ? 4   GLY A CA   6  
ATOM   7457  C C    . GLY A 1 4   ? -10.403 -16.800 -18.532 1.00 0.00 ? 4   GLY A C    6  
ATOM   7458  O O    . GLY A 1 4   ? -10.941 -16.539 -17.457 1.00 0.00 ? 4   GLY A O    6  
ATOM   7459  H H    . GLY A 1 4   ? -12.804 -17.577 -19.296 1.00 0.00 ? 4   GLY A H    6  
ATOM   7460  H HA2  . GLY A 1 4   ? -10.402 -16.554 -20.676 1.00 0.00 ? 4   GLY A HA2  6  
ATOM   7461  H HA3  . GLY A 1 4   ? -11.497 -15.475 -19.835 1.00 0.00 ? 4   GLY A HA3  6  
ATOM   7462  N N    . SER A 1 5   ? -9.202  -17.346 -18.656 1.00 0.00 ? 5   SER A N    6  
ATOM   7463  C CA   . SER A 1 5   ? -8.412  -17.690 -17.487 1.00 0.00 ? 5   SER A CA   6  
ATOM   7464  C C    . SER A 1 5   ? -7.411  -16.574 -17.185 1.00 0.00 ? 5   SER A C    6  
ATOM   7465  O O    . SER A 1 5   ? -6.533  -16.284 -17.999 1.00 0.00 ? 5   SER A O    6  
ATOM   7466  C CB   . SER A 1 5   ? -7.680  -19.018 -17.687 1.00 0.00 ? 5   SER A CB   6  
ATOM   7467  O OG   . SER A 1 5   ? -8.209  -20.051 -16.860 1.00 0.00 ? 5   SER A OG   6  
ATOM   7468  H H    . SER A 1 5   ? -8.771  -17.556 -19.534 1.00 0.00 ? 5   SER A H    6  
ATOM   7469  H HA   . SER A 1 5   ? -9.129  -17.790 -16.672 1.00 0.00 ? 5   SER A HA   6  
ATOM   7470  H HB2  . SER A 1 5   ? -7.751  -19.318 -18.731 1.00 0.00 ? 5   SER A HB2  6  
ATOM   7471  H HB3  . SER A 1 5   ? -6.620  -18.886 -17.466 1.00 0.00 ? 5   SER A HB3  6  
ATOM   7472  H HG   . SER A 1 5   ? -9.165  -19.855 -16.639 1.00 0.00 ? 5   SER A HG   6  
ATOM   7473  N N    . LEU A 1 6   ? -7.575  -15.974 -16.015 1.00 0.00 ? 6   LEU A N    6  
ATOM   7474  C CA   . LEU A 1 6   ? -6.697  -14.895 -15.597 1.00 0.00 ? 6   LEU A CA   6  
ATOM   7475  C C    . LEU A 1 6   ? -7.032  -14.500 -14.157 1.00 0.00 ? 6   LEU A C    6  
ATOM   7476  O O    . LEU A 1 6   ? -6.281  -14.809 -13.233 1.00 0.00 ? 6   LEU A O    6  
ATOM   7477  C CB   . LEU A 1 6   ? -6.770  -13.730 -16.586 1.00 0.00 ? 6   LEU A CB   6  
ATOM   7478  C CG   . LEU A 1 6   ? -5.470  -12.955 -16.806 1.00 0.00 ? 6   LEU A CG   6  
ATOM   7479  C CD1  . LEU A 1 6   ? -4.362  -13.877 -17.321 1.00 0.00 ? 6   LEU A CD1  6  
ATOM   7480  C CD2  . LEU A 1 6   ? -5.696  -11.758 -17.732 1.00 0.00 ? 6   LEU A CD2  6  
ATOM   7481  H H    . LEU A 1 6   ? -8.291  -16.215 -15.360 1.00 0.00 ? 6   LEU A H    6  
ATOM   7482  H HA   . LEU A 1 6   ? -5.676  -15.275 -15.622 1.00 0.00 ? 6   LEU A HA   6  
ATOM   7483  H HB2  . LEU A 1 6   ? -7.107  -14.117 -17.547 1.00 0.00 ? 6   LEU A HB2  6  
ATOM   7484  H HB3  . LEU A 1 6   ? -7.532  -13.032 -16.240 1.00 0.00 ? 6   LEU A HB3  6  
ATOM   7485  H HG   . LEU A 1 6   ? -5.140  -12.561 -15.845 1.00 0.00 ? 6   LEU A HG   6  
ATOM   7486  H HD11 . LEU A 1 6   ? -4.763  -14.880 -17.464 1.00 0.00 ? 6   LEU A HD11 6  
ATOM   7487  H HD12 . LEU A 1 6   ? -3.985  -13.498 -18.271 1.00 0.00 ? 6   LEU A HD12 6  
ATOM   7488  H HD13 . LEU A 1 6   ? -3.549  -13.910 -16.595 1.00 0.00 ? 6   LEU A HD13 6  
ATOM   7489  H HD21 . LEU A 1 6   ? -6.742  -11.457 -17.688 1.00 0.00 ? 6   LEU A HD21 6  
ATOM   7490  H HD22 . LEU A 1 6   ? -5.064  -10.928 -17.413 1.00 0.00 ? 6   LEU A HD22 6  
ATOM   7491  H HD23 . LEU A 1 6   ? -5.440  -12.036 -18.755 1.00 0.00 ? 6   LEU A HD23 6  
ATOM   7492  N N    . ARG A 1 7   ? -8.161  -13.822 -14.010 1.00 0.00 ? 7   ARG A N    6  
ATOM   7493  C CA   . ARG A 1 7   ? -8.604  -13.382 -12.697 1.00 0.00 ? 7   ARG A CA   6  
ATOM   7494  C C    . ARG A 1 7   ? -7.445  -12.741 -11.934 1.00 0.00 ? 7   ARG A C    6  
ATOM   7495  O O    . ARG A 1 7   ? -6.657  -13.438 -11.295 1.00 0.00 ? 7   ARG A O    6  
ATOM   7496  C CB   . ARG A 1 7   ? -9.160  -14.552 -11.883 1.00 0.00 ? 7   ARG A CB   6  
ATOM   7497  C CG   . ARG A 1 7   ? -10.538 -14.973 -12.395 1.00 0.00 ? 7   ARG A CG   6  
ATOM   7498  C CD   . ARG A 1 7   ? -10.458 -16.292 -13.167 1.00 0.00 ? 7   ARG A CD   6  
ATOM   7499  N NE   . ARG A 1 7   ? -10.305 -17.422 -12.223 1.00 0.00 ? 7   ARG A NE   6  
ATOM   7500  C CZ   . ARG A 1 7   ? -10.063 -18.686 -12.598 1.00 0.00 ? 7   ARG A CZ   6  
ATOM   7501  N NH1  . ARG A 1 7   ? -9.944  -18.988 -13.898 1.00 0.00 ? 7   ARG A NH1  6  
ATOM   7502  N NH2  . ARG A 1 7   ? -9.939  -19.647 -11.672 1.00 0.00 ? 7   ARG A NH2  6  
ATOM   7503  H H    . ARG A 1 7   ? -8.767  -13.576 -14.767 1.00 0.00 ? 7   ARG A H    6  
ATOM   7504  H HA   . ARG A 1 7   ? -9.392  -12.655 -12.900 1.00 0.00 ? 7   ARG A HA   6  
ATOM   7505  H HB2  . ARG A 1 7   ? -8.472  -15.397 -11.939 1.00 0.00 ? 7   ARG A HB2  6  
ATOM   7506  H HB3  . ARG A 1 7   ? -9.228  -14.269 -10.832 1.00 0.00 ? 7   ARG A HB3  6  
ATOM   7507  H HG2  . ARG A 1 7   ? -11.225 -15.081 -11.555 1.00 0.00 ? 7   ARG A HG2  6  
ATOM   7508  H HG3  . ARG A 1 7   ? -10.943 -14.193 -13.041 1.00 0.00 ? 7   ARG A HG3  6  
ATOM   7509  H HD2  . ARG A 1 7   ? -11.357 -16.427 -13.767 1.00 0.00 ? 7   ARG A HD2  6  
ATOM   7510  H HD3  . ARG A 1 7   ? -9.614  -16.268 -13.858 1.00 0.00 ? 7   ARG A HD3  6  
ATOM   7511  H HE   . ARG A 1 7   ? -10.388 -17.231 -11.245 1.00 0.00 ? 7   ARG A HE   6  
ATOM   7512  H HH11 . ARG A 1 7   ? -10.035 -18.270 -14.588 1.00 0.00 ? 7   ARG A HH11 6  
ATOM   7513  H HH12 . ARG A 1 7   ? -9.762  -19.931 -14.177 1.00 0.00 ? 7   ARG A HH12 6  
ATOM   7514  H HH21 . ARG A 1 7   ? -10.028 -19.421 -10.701 1.00 0.00 ? 7   ARG A HH21 6  
ATOM   7515  H HH22 . ARG A 1 7   ? -9.758  -20.589 -11.951 1.00 0.00 ? 7   ARG A HH22 6  
ATOM   7516  N N    . LYS A 1 8   ? -7.378  -11.421 -12.024 1.00 0.00 ? 8   LYS A N    6  
ATOM   7517  C CA   . LYS A 1 8   ? -6.327  -10.677 -11.348 1.00 0.00 ? 8   LYS A CA   6  
ATOM   7518  C C    . LYS A 1 8   ? -6.835  -10.212 -9.982  1.00 0.00 ? 8   LYS A C    6  
ATOM   7519  O O    . LYS A 1 8   ? -7.337  -9.097  -9.848  1.00 0.00 ? 8   LYS A O    6  
ATOM   7520  C CB   . LYS A 1 8   ? -5.821  -9.539  -12.236 1.00 0.00 ? 8   LYS A CB   6  
ATOM   7521  C CG   . LYS A 1 8   ? -4.352  -9.225  -11.940 1.00 0.00 ? 8   LYS A CG   6  
ATOM   7522  C CD   . LYS A 1 8   ? -3.429  -9.939  -12.932 1.00 0.00 ? 8   LYS A CD   6  
ATOM   7523  C CE   . LYS A 1 8   ? -2.261  -10.609 -12.207 1.00 0.00 ? 8   LYS A CE   6  
ATOM   7524  N NZ   . LYS A 1 8   ? -1.026  -9.809  -12.362 1.00 0.00 ? 8   LYS A NZ   6  
ATOM   7525  H H    . LYS A 1 8   ? -8.022  -10.862 -12.544 1.00 0.00 ? 8   LYS A H    6  
ATOM   7526  H HA   . LYS A 1 8   ? -5.492  -11.361 -11.192 1.00 0.00 ? 8   LYS A HA   6  
ATOM   7527  H HB2  . LYS A 1 8   ? -5.933  -9.812  -13.285 1.00 0.00 ? 8   LYS A HB2  6  
ATOM   7528  H HB3  . LYS A 1 8   ? -6.426  -8.649  -12.072 1.00 0.00 ? 8   LYS A HB3  6  
ATOM   7529  H HG2  . LYS A 1 8   ? -4.189  -8.149  -11.995 1.00 0.00 ? 8   LYS A HG2  6  
ATOM   7530  H HG3  . LYS A 1 8   ? -4.108  -9.534  -10.924 1.00 0.00 ? 8   LYS A HG3  6  
ATOM   7531  H HD2  . LYS A 1 8   ? -3.994  -10.686 -13.486 1.00 0.00 ? 8   LYS A HD2  6  
ATOM   7532  H HD3  . LYS A 1 8   ? -3.049  -9.222  -13.658 1.00 0.00 ? 8   LYS A HD3  6  
ATOM   7533  H HE2  . LYS A 1 8   ? -2.498  -10.722 -11.148 1.00 0.00 ? 8   LYS A HE2  6  
ATOM   7534  H HE3  . LYS A 1 8   ? -2.105  -11.612 -12.606 1.00 0.00 ? 8   LYS A HE3  6  
ATOM   7535  H HZ1  . LYS A 1 8   ? -1.264  -8.842  -12.449 1.00 0.00 ? 8   LYS A HZ1  6  
ATOM   7536  H HZ2  . LYS A 1 8   ? -0.442  -9.937  -11.560 1.00 0.00 ? 8   LYS A HZ2  6  
ATOM   7537  H HZ3  . LYS A 1 8   ? -0.535  -10.107 -13.181 1.00 0.00 ? 8   LYS A HZ3  6  
ATOM   7538  N N    . GLU A 1 9   ? -6.688  -11.091 -9.001  1.00 0.00 ? 9   GLU A N    6  
ATOM   7539  C CA   . GLU A 1 9   ? -7.126  -10.785 -7.649  1.00 0.00 ? 9   GLU A CA   6  
ATOM   7540  C C    . GLU A 1 9   ? -6.517  -9.461  -7.182  1.00 0.00 ? 9   GLU A C    6  
ATOM   7541  O O    . GLU A 1 9   ? -7.232  -8.576  -6.711  1.00 0.00 ? 9   GLU A O    6  
ATOM   7542  C CB   . GLU A 1 9   ? -6.773  -11.919 -6.688  1.00 0.00 ? 9   GLU A CB   6  
ATOM   7543  C CG   . GLU A 1 9   ? -7.977  -12.300 -5.822  1.00 0.00 ? 9   GLU A CG   6  
ATOM   7544  C CD   . GLU A 1 9   ? -8.212  -11.262 -4.723  1.00 0.00 ? 9   GLU A CD   6  
ATOM   7545  O OE1  . GLU A 1 9   ? -7.553  -11.395 -3.670  1.00 0.00 ? 9   GLU A OE1  6  
ATOM   7546  O OE2  . GLU A 1 9   ? -9.046  -10.362 -4.961  1.00 0.00 ? 9   GLU A OE2  6  
ATOM   7547  H H    . GLU A 1 9   ? -6.279  -11.995 -9.117  1.00 0.00 ? 9   GLU A H    6  
ATOM   7548  H HA   . GLU A 1 9   ? -8.211  -10.692 -7.710  1.00 0.00 ? 9   GLU A HA   6  
ATOM   7549  H HB2  . GLU A 1 9   ? -6.438  -12.790 -7.254  1.00 0.00 ? 9   GLU A HB2  6  
ATOM   7550  H HB3  . GLU A 1 9   ? -5.943  -11.616 -6.050  1.00 0.00 ? 9   GLU A HB3  6  
ATOM   7551  H HG2  . GLU A 1 9   ? -8.866  -12.381 -6.448  1.00 0.00 ? 9   GLU A HG2  6  
ATOM   7552  H HG3  . GLU A 1 9   ? -7.812  -13.280 -5.375  1.00 0.00 ? 9   GLU A HG3  6  
ATOM   7553  N N    . PRO A 1 10  ? -5.168  -9.363  -7.332  1.00 0.00 ? 10  PRO A N    6  
ATOM   7554  C CA   . PRO A 1 10  ? -4.456  -8.162  -6.930  1.00 0.00 ? 10  PRO A CA   6  
ATOM   7555  C C    . PRO A 1 10  ? -4.683  -7.029  -7.931  1.00 0.00 ? 10  PRO A C    6  
ATOM   7556  O O    . PRO A 1 10  ? -5.272  -7.241  -8.992  1.00 0.00 ? 10  PRO A O    6  
ATOM   7557  C CB   . PRO A 1 10  ? -3.000  -8.585  -6.830  1.00 0.00 ? 10  PRO A CB   6  
ATOM   7558  C CG   . PRO A 1 10  ? -2.884  -9.876  -7.625  1.00 0.00 ? 10  PRO A CG   6  
ATOM   7559  C CD   . PRO A 1 10  ? -4.291  -10.390 -7.885  1.00 0.00 ? 10  PRO A CD   6  
ATOM   7560  H HA   . PRO A 1 10  ? -4.806  -7.828  -6.056  1.00 0.00 ? 10  PRO A HA   6  
ATOM   7561  H HB2  . PRO A 1 10  ? -2.342  -7.816  -7.236  1.00 0.00 ? 10  PRO A HB2  6  
ATOM   7562  H HB3  . PRO A 1 10  ? -2.708  -8.737  -5.792  1.00 0.00 ? 10  PRO A HB3  6  
ATOM   7563  H HG2  . PRO A 1 10  ? -2.363  -9.699  -8.566  1.00 0.00 ? 10  PRO A HG2  6  
ATOM   7564  H HG3  . PRO A 1 10  ? -2.304  -10.614 -7.072  1.00 0.00 ? 10  PRO A HG3  6  
ATOM   7565  H HD2  . PRO A 1 10  ? -4.471  -10.533 -8.950  1.00 0.00 ? 10  PRO A HD2  6  
ATOM   7566  H HD3  . PRO A 1 10  ? -4.456  -11.353 -7.402  1.00 0.00 ? 10  PRO A HD3  6  
ATOM   7567  N N    . GLU A 1 11  ? -4.205  -5.850  -7.562  1.00 0.00 ? 11  GLU A N    6  
ATOM   7568  C CA   . GLU A 1 11  ? -4.349  -4.683  -8.415  1.00 0.00 ? 11  GLU A CA   6  
ATOM   7569  C C    . GLU A 1 11  ? -3.414  -3.565  -7.946  1.00 0.00 ? 11  GLU A C    6  
ATOM   7570  O O    . GLU A 1 11  ? -3.000  -3.542  -6.789  1.00 0.00 ? 11  GLU A O    6  
ATOM   7571  C CB   . GLU A 1 11  ? -5.802  -4.203  -8.448  1.00 0.00 ? 11  GLU A CB   6  
ATOM   7572  C CG   . GLU A 1 11  ? -6.170  -3.477  -7.153  1.00 0.00 ? 11  GLU A CG   6  
ATOM   7573  C CD   . GLU A 1 11  ? -7.561  -2.847  -7.254  1.00 0.00 ? 11  GLU A CD   6  
ATOM   7574  O OE1  . GLU A 1 11  ? -8.507  -3.606  -7.555  1.00 0.00 ? 11  GLU A OE1  6  
ATOM   7575  O OE2  . GLU A 1 11  ? -7.645  -1.620  -7.031  1.00 0.00 ? 11  GLU A OE2  6  
ATOM   7576  H H    . GLU A 1 11  ? -3.730  -5.686  -6.698  1.00 0.00 ? 11  GLU A H    6  
ATOM   7577  H HA   . GLU A 1 11  ? -4.058  -5.015  -9.411  1.00 0.00 ? 11  GLU A HA   6  
ATOM   7578  H HB2  . GLU A 1 11  ? -5.949  -3.537  -9.299  1.00 0.00 ? 11  GLU A HB2  6  
ATOM   7579  H HB3  . GLU A 1 11  ? -6.466  -5.057  -8.593  1.00 0.00 ? 11  GLU A HB3  6  
ATOM   7580  H HG2  . GLU A 1 11  ? -6.145  -4.178  -6.319  1.00 0.00 ? 11  GLU A HG2  6  
ATOM   7581  H HG3  . GLU A 1 11  ? -5.431  -2.705  -6.943  1.00 0.00 ? 11  GLU A HG3  6  
ATOM   7582  N N    . ILE A 1 12  ? -3.110  -2.666  -8.871  1.00 0.00 ? 12  ILE A N    6  
ATOM   7583  C CA   . ILE A 1 12  ? -2.232  -1.550  -8.568  1.00 0.00 ? 12  ILE A CA   6  
ATOM   7584  C C    . ILE A 1 12  ? -3.076  -0.320  -8.226  1.00 0.00 ? 12  ILE A C    6  
ATOM   7585  O O    . ILE A 1 12  ? -3.985  0.041   -8.974  1.00 0.00 ? 12  ILE A O    6  
ATOM   7586  C CB   . ILE A 1 12  ? -1.245  -1.318  -9.714  1.00 0.00 ? 12  ILE A CB   6  
ATOM   7587  C CG1  . ILE A 1 12  ? -0.219  -0.244  -9.346  1.00 0.00 ? 12  ILE A CG1  6  
ATOM   7588  C CG2  . ILE A 1 12  ? -1.980  -0.986  -11.014 1.00 0.00 ? 12  ILE A CG2  6  
ATOM   7589  C CD1  . ILE A 1 12  ? -0.764  1.158   -9.638  1.00 0.00 ? 12  ILE A CD1  6  
ATOM   7590  H H    . ILE A 1 12  ? -3.451  -2.694  -9.811  1.00 0.00 ? 12  ILE A H    6  
ATOM   7591  H HA   . ILE A 1 12  ? -1.647  -1.823  -7.690  1.00 0.00 ? 12  ILE A HA   6  
ATOM   7592  H HB   . ILE A 1 12  ? -0.694  -2.242  -9.885  1.00 0.00 ? 12  ILE A HB   6  
ATOM   7593  H HG12 . ILE A 1 12  ? 0.035   -0.326  -8.289  1.00 0.00 ? 12  ILE A HG12 6  
ATOM   7594  H HG13 . ILE A 1 12  ? 0.701   -0.404  -9.910  1.00 0.00 ? 12  ILE A HG13 6  
ATOM   7595  H HG21 . ILE A 1 12  ? -2.351  -1.905  -11.467 1.00 0.00 ? 12  ILE A HG21 6  
ATOM   7596  H HG22 . ILE A 1 12  ? -2.821  -0.325  -10.797 1.00 0.00 ? 12  ILE A HG22 6  
ATOM   7597  H HG23 . ILE A 1 12  ? -1.298  -0.491  -11.703 1.00 0.00 ? 12  ILE A HG23 6  
ATOM   7598  H HD11 . ILE A 1 12  ? -1.839  1.099   -9.809  1.00 0.00 ? 12  ILE A HD11 6  
ATOM   7599  H HD12 . ILE A 1 12  ? -0.566  1.808   -8.786  1.00 0.00 ? 12  ILE A HD12 6  
ATOM   7600  H HD13 . ILE A 1 12  ? -0.275  1.560   -10.524 1.00 0.00 ? 12  ILE A HD13 6  
ATOM   7601  N N    . ILE A 1 13  ? -2.746  0.287   -7.097  1.00 0.00 ? 13  ILE A N    6  
ATOM   7602  C CA   . ILE A 1 13  ? -3.464  1.470   -6.646  1.00 0.00 ? 13  ILE A CA   6  
ATOM   7603  C C    . ILE A 1 13  ? -2.491  2.645   -6.548  1.00 0.00 ? 13  ILE A C    6  
ATOM   7604  O O    . ILE A 1 13  ? -1.304  2.454   -6.286  1.00 0.00 ? 13  ILE A O    6  
ATOM   7605  C CB   . ILE A 1 13  ? -4.211  1.178   -5.343  1.00 0.00 ? 13  ILE A CB   6  
ATOM   7606  C CG1  . ILE A 1 13  ? -4.704  -0.270  -5.304  1.00 0.00 ? 13  ILE A CG1  6  
ATOM   7607  C CG2  . ILE A 1 13  ? -5.351  2.177   -5.130  1.00 0.00 ? 13  ILE A CG2  6  
ATOM   7608  C CD1  . ILE A 1 13  ? -5.708  -0.479  -4.170  1.00 0.00 ? 13  ILE A CD1  6  
ATOM   7609  H H    . ILE A 1 13  ? -2.008  -0.012  -6.496  1.00 0.00 ? 13  ILE A H    6  
ATOM   7610  H HA   . ILE A 1 13  ? -4.214  1.704   -7.402  1.00 0.00 ? 13  ILE A HA   6  
ATOM   7611  H HB   . ILE A 1 13  ? -3.514  1.304   -4.515  1.00 0.00 ? 13  ILE A HB   6  
ATOM   7612  H HG12 . ILE A 1 13  ? -5.167  -0.526  -6.257  1.00 0.00 ? 13  ILE A HG12 6  
ATOM   7613  H HG13 . ILE A 1 13  ? -3.856  -0.942  -5.173  1.00 0.00 ? 13  ILE A HG13 6  
ATOM   7614  H HG21 . ILE A 1 13  ? -5.370  2.487   -4.086  1.00 0.00 ? 13  ILE A HG21 6  
ATOM   7615  H HG22 . ILE A 1 13  ? -5.194  3.048   -5.766  1.00 0.00 ? 13  ILE A HG22 6  
ATOM   7616  H HG23 . ILE A 1 13  ? -6.299  1.704   -5.385  1.00 0.00 ? 13  ILE A HG23 6  
ATOM   7617  H HD11 . ILE A 1 13  ? -5.420  0.131   -3.314  1.00 0.00 ? 13  ILE A HD11 6  
ATOM   7618  H HD12 . ILE A 1 13  ? -6.702  -0.186  -4.507  1.00 0.00 ? 13  ILE A HD12 6  
ATOM   7619  H HD13 . ILE A 1 13  ? -5.717  -1.528  -3.882  1.00 0.00 ? 13  ILE A HD13 6  
ATOM   7620  N N    . THR A 1 14  ? -3.027  3.836   -6.762  1.00 0.00 ? 14  THR A N    6  
ATOM   7621  C CA   . THR A 1 14  ? -2.221  5.044   -6.702  1.00 0.00 ? 14  THR A CA   6  
ATOM   7622  C C    . THR A 1 14  ? -2.857  6.063   -5.755  1.00 0.00 ? 14  THR A C    6  
ATOM   7623  O O    . THR A 1 14  ? -3.959  6.548   -6.008  1.00 0.00 ? 14  THR A O    6  
ATOM   7624  C CB   . THR A 1 14  ? -2.044  5.568   -8.128  1.00 0.00 ? 14  THR A CB   6  
ATOM   7625  O OG1  . THR A 1 14  ? -3.288  6.203   -8.421  1.00 0.00 ? 14  THR A OG1  6  
ATOM   7626  C CG2  . THR A 1 14  ? -1.951  4.441   -9.158  1.00 0.00 ? 14  THR A CG2  6  
ATOM   7627  H H    . THR A 1 14  ? -3.993  3.984   -6.977  1.00 0.00 ? 14  THR A H    6  
ATOM   7628  H HA   . THR A 1 14  ? -1.248  4.785   -6.287  1.00 0.00 ? 14  THR A HA   6  
ATOM   7629  H HB   . THR A 1 14  ? -1.183  6.231   -8.195  1.00 0.00 ? 14  THR A HB   6  
ATOM   7630  H HG1  . THR A 1 14  ? -4.045  5.632   -8.104  1.00 0.00 ? 14  THR A HG1  6  
ATOM   7631  H HG21 . THR A 1 14  ? -1.380  4.785   -10.022 1.00 0.00 ? 14  THR A HG21 6  
ATOM   7632  H HG22 . THR A 1 14  ? -1.453  3.581   -8.712  1.00 0.00 ? 14  THR A HG22 6  
ATOM   7633  H HG23 . THR A 1 14  ? -2.955  4.155   -9.477  1.00 0.00 ? 14  THR A HG23 6  
ATOM   7634  N N    . VAL A 1 15  ? -2.136  6.357   -4.683  1.00 0.00 ? 15  VAL A N    6  
ATOM   7635  C CA   . VAL A 1 15  ? -2.617  7.309   -3.695  1.00 0.00 ? 15  VAL A CA   6  
ATOM   7636  C C    . VAL A 1 15  ? -1.768  8.581   -3.765  1.00 0.00 ? 15  VAL A C    6  
ATOM   7637  O O    . VAL A 1 15  ? -0.619  8.588   -3.329  1.00 0.00 ? 15  VAL A O    6  
ATOM   7638  C CB   . VAL A 1 15  ? -2.620  6.667   -2.307  1.00 0.00 ? 15  VAL A CB   6  
ATOM   7639  C CG1  . VAL A 1 15  ? -3.949  6.912   -1.592  1.00 0.00 ? 15  VAL A CG1  6  
ATOM   7640  C CG2  . VAL A 1 15  ? -2.312  5.171   -2.394  1.00 0.00 ? 15  VAL A CG2  6  
ATOM   7641  H H    . VAL A 1 15  ? -1.241  5.958   -4.484  1.00 0.00 ? 15  VAL A H    6  
ATOM   7642  H HA   . VAL A 1 15  ? -3.645  7.561   -3.955  1.00 0.00 ? 15  VAL A HA   6  
ATOM   7643  H HB   . VAL A 1 15  ? -1.832  7.138   -1.718  1.00 0.00 ? 15  VAL A HB   6  
ATOM   7644  H HG11 . VAL A 1 15  ? -3.869  6.594   -0.553  1.00 0.00 ? 15  VAL A HG11 6  
ATOM   7645  H HG12 . VAL A 1 15  ? -4.192  7.975   -1.627  1.00 0.00 ? 15  VAL A HG12 6  
ATOM   7646  H HG13 . VAL A 1 15  ? -4.738  6.343   -2.087  1.00 0.00 ? 15  VAL A HG13 6  
ATOM   7647  H HG21 . VAL A 1 15  ? -1.243  5.029   -2.553  1.00 0.00 ? 15  VAL A HG21 6  
ATOM   7648  H HG22 . VAL A 1 15  ? -2.609  4.684   -1.466  1.00 0.00 ? 15  VAL A HG22 6  
ATOM   7649  H HG23 . VAL A 1 15  ? -2.864  4.735   -3.226  1.00 0.00 ? 15  VAL A HG23 6  
ATOM   7650  N N    . THR A 1 16  ? -2.369  9.626   -4.316  1.00 0.00 ? 16  THR A N    6  
ATOM   7651  C CA   . THR A 1 16  ? -1.681  10.899  -4.448  1.00 0.00 ? 16  THR A CA   6  
ATOM   7652  C C    . THR A 1 16  ? -1.858  11.734  -3.178  1.00 0.00 ? 16  THR A C    6  
ATOM   7653  O O    . THR A 1 16  ? -2.779  11.495  -2.397  1.00 0.00 ? 16  THR A O    6  
ATOM   7654  C CB   . THR A 1 16  ? -2.205  11.590  -5.708  1.00 0.00 ? 16  THR A CB   6  
ATOM   7655  O OG1  . THR A 1 16  ? -1.964  10.646  -6.748  1.00 0.00 ? 16  THR A OG1  6  
ATOM   7656  C CG2  . THR A 1 16  ? -1.362  12.804  -6.104  1.00 0.00 ? 16  THR A CG2  6  
ATOM   7657  H H    . THR A 1 16  ? -3.303  9.612   -4.668  1.00 0.00 ? 16  THR A H    6  
ATOM   7658  H HA   . THR A 1 16  ? -0.614  10.704  -4.557  1.00 0.00 ? 16  THR A HA   6  
ATOM   7659  H HB   . THR A 1 16  ? -3.254  11.865  -5.594  1.00 0.00 ? 16  THR A HB   6  
ATOM   7660  H HG1  . THR A 1 16  ? -2.714  10.669  -7.411  1.00 0.00 ? 16  THR A HG1  6  
ATOM   7661  H HG21 . THR A 1 16  ? -0.313  12.514  -6.164  1.00 0.00 ? 16  THR A HG21 6  
ATOM   7662  H HG22 . THR A 1 16  ? -1.692  13.174  -7.075  1.00 0.00 ? 16  THR A HG22 6  
ATOM   7663  H HG23 . THR A 1 16  ? -1.479  13.589  -5.356  1.00 0.00 ? 16  THR A HG23 6  
ATOM   7664  N N    . LEU A 1 17  ? -0.962  12.697  -3.011  1.00 0.00 ? 17  LEU A N    6  
ATOM   7665  C CA   . LEU A 1 17  ? -1.009  13.569  -1.850  1.00 0.00 ? 17  LEU A CA   6  
ATOM   7666  C C    . LEU A 1 17  ? -1.829  14.816  -2.186  1.00 0.00 ? 17  LEU A C    6  
ATOM   7667  O O    . LEU A 1 17  ? -1.355  15.701  -2.898  1.00 0.00 ? 17  LEU A O    6  
ATOM   7668  C CB   . LEU A 1 17  ? 0.405   13.878  -1.355  1.00 0.00 ? 17  LEU A CB   6  
ATOM   7669  C CG   . LEU A 1 17  ? 1.033   12.836  -0.425  1.00 0.00 ? 17  LEU A CG   6  
ATOM   7670  C CD1  . LEU A 1 17  ? 1.695   13.507  0.781   1.00 0.00 ? 17  LEU A CD1  6  
ATOM   7671  C CD2  . LEU A 1 17  ? 0.003   11.788  -0.002  1.00 0.00 ? 17  LEU A CD2  6  
ATOM   7672  H H    . LEU A 1 17  ? -0.219  12.883  -3.652  1.00 0.00 ? 17  LEU A H    6  
ATOM   7673  H HA   . LEU A 1 17  ? -1.518  13.025  -1.053  1.00 0.00 ? 17  LEU A HA   6  
ATOM   7674  H HB2  . LEU A 1 17  ? 1.055   13.996  -2.223  1.00 0.00 ? 17  LEU A HB2  6  
ATOM   7675  H HB3  . LEU A 1 17  ? 0.387   14.835  -0.837  1.00 0.00 ? 17  LEU A HB3  6  
ATOM   7676  H HG   . LEU A 1 17  ? 1.817   12.315  -0.973  1.00 0.00 ? 17  LEU A HG   6  
ATOM   7677  H HD11 . LEU A 1 17  ? 2.105   14.473  0.479   1.00 0.00 ? 17  LEU A HD11 6  
ATOM   7678  H HD12 . LEU A 1 17  ? 0.954   13.657  1.565   1.00 0.00 ? 17  LEU A HD12 6  
ATOM   7679  H HD13 . LEU A 1 17  ? 2.497   12.872  1.155   1.00 0.00 ? 17  LEU A HD13 6  
ATOM   7680  H HD21 . LEU A 1 17  ? -0.466  11.359  -0.890  1.00 0.00 ? 17  LEU A HD21 6  
ATOM   7681  H HD22 . LEU A 1 17  ? 0.497   10.998  0.562   1.00 0.00 ? 17  LEU A HD22 6  
ATOM   7682  H HD23 . LEU A 1 17  ? -0.760  12.256  0.621   1.00 0.00 ? 17  LEU A HD23 6  
ATOM   7683  N N    . LYS A 1 18  ? -3.043  14.846  -1.659  1.00 0.00 ? 18  LYS A N    6  
ATOM   7684  C CA   . LYS A 1 18  ? -3.934  15.971  -1.895  1.00 0.00 ? 18  LYS A CA   6  
ATOM   7685  C C    . LYS A 1 18  ? -3.662  17.058  -0.853  1.00 0.00 ? 18  LYS A C    6  
ATOM   7686  O O    . LYS A 1 18  ? -3.432  18.214  -1.201  1.00 0.00 ? 18  LYS A O    6  
ATOM   7687  C CB   . LYS A 1 18  ? -5.389  15.502  -1.931  1.00 0.00 ? 18  LYS A CB   6  
ATOM   7688  C CG   . LYS A 1 18  ? -6.307  16.605  -2.466  1.00 0.00 ? 18  LYS A CG   6  
ATOM   7689  C CD   . LYS A 1 18  ? -6.778  16.284  -3.886  1.00 0.00 ? 18  LYS A CD   6  
ATOM   7690  C CE   . LYS A 1 18  ? -7.589  17.444  -4.468  1.00 0.00 ? 18  LYS A CE   6  
ATOM   7691  N NZ   . LYS A 1 18  ? -7.379  17.539  -5.931  1.00 0.00 ? 18  LYS A NZ   6  
ATOM   7692  H H    . LYS A 1 18  ? -3.421  14.123  -1.082  1.00 0.00 ? 18  LYS A H    6  
ATOM   7693  H HA   . LYS A 1 18  ? -3.699  16.372  -2.881  1.00 0.00 ? 18  LYS A HA   6  
ATOM   7694  H HB2  . LYS A 1 18  ? -5.476  14.615  -2.558  1.00 0.00 ? 18  LYS A HB2  6  
ATOM   7695  H HB3  . LYS A 1 18  ? -5.708  15.215  -0.928  1.00 0.00 ? 18  LYS A HB3  6  
ATOM   7696  H HG2  . LYS A 1 18  ? -7.169  16.716  -1.810  1.00 0.00 ? 18  LYS A HG2  6  
ATOM   7697  H HG3  . LYS A 1 18  ? -5.777  17.557  -2.460  1.00 0.00 ? 18  LYS A HG3  6  
ATOM   7698  H HD2  . LYS A 1 18  ? -5.916  16.082  -4.522  1.00 0.00 ? 18  LYS A HD2  6  
ATOM   7699  H HD3  . LYS A 1 18  ? -7.386  15.380  -3.876  1.00 0.00 ? 18  LYS A HD3  6  
ATOM   7700  H HE2  . LYS A 1 18  ? -8.648  17.296  -4.256  1.00 0.00 ? 18  LYS A HE2  6  
ATOM   7701  H HE3  . LYS A 1 18  ? -7.295  18.377  -3.992  1.00 0.00 ? 18  LYS A HE3  6  
ATOM   7702  H HZ1  . LYS A 1 18  ? -6.507  17.113  -6.171  1.00 0.00 ? 18  LYS A HZ1  6  
ATOM   7703  H HZ2  . LYS A 1 18  ? -8.122  17.067  -6.405  1.00 0.00 ? 18  LYS A HZ2  6  
ATOM   7704  H HZ3  . LYS A 1 18  ? -7.368  18.501  -6.204  1.00 0.00 ? 18  LYS A HZ3  6  
ATOM   7705  N N    . LYS A 1 19  ? -3.698  16.646  0.407   1.00 0.00 ? 19  LYS A N    6  
ATOM   7706  C CA   . LYS A 1 19  ? -3.458  17.570  1.502   1.00 0.00 ? 19  LYS A CA   6  
ATOM   7707  C C    . LYS A 1 19  ? -1.988  17.493  1.916   1.00 0.00 ? 19  LYS A C    6  
ATOM   7708  O O    . LYS A 1 19  ? -1.546  18.235  2.793   1.00 0.00 ? 19  LYS A O    6  
ATOM   7709  C CB   . LYS A 1 19  ? -4.435  17.306  2.649   1.00 0.00 ? 19  LYS A CB   6  
ATOM   7710  C CG   . LYS A 1 19  ? -4.232  18.310  3.786   1.00 0.00 ? 19  LYS A CG   6  
ATOM   7711  C CD   . LYS A 1 19  ? -5.349  18.196  4.826   1.00 0.00 ? 19  LYS A CD   6  
ATOM   7712  C CE   . LYS A 1 19  ? -6.234  19.443  4.818   1.00 0.00 ? 19  LYS A CE   6  
ATOM   7713  N NZ   . LYS A 1 19  ? -5.947  20.289  5.999   1.00 0.00 ? 19  LYS A NZ   6  
ATOM   7714  H H    . LYS A 1 19  ? -3.885  15.704  0.683   1.00 0.00 ? 19  LYS A H    6  
ATOM   7715  H HA   . LYS A 1 19  ? -3.661  18.575  1.132   1.00 0.00 ? 19  LYS A HA   6  
ATOM   7716  H HB2  . LYS A 1 19  ? -5.460  17.370  2.282   1.00 0.00 ? 19  LYS A HB2  6  
ATOM   7717  H HB3  . LYS A 1 19  ? -4.296  16.292  3.026   1.00 0.00 ? 19  LYS A HB3  6  
ATOM   7718  H HG2  . LYS A 1 19  ? -3.267  18.134  4.262   1.00 0.00 ? 19  LYS A HG2  6  
ATOM   7719  H HG3  . LYS A 1 19  ? -4.208  19.322  3.381   1.00 0.00 ? 19  LYS A HG3  6  
ATOM   7720  H HD2  . LYS A 1 19  ? -5.956  17.315  4.618   1.00 0.00 ? 19  LYS A HD2  6  
ATOM   7721  H HD3  . LYS A 1 19  ? -4.916  18.059  5.816   1.00 0.00 ? 19  LYS A HD3  6  
ATOM   7722  H HE2  . LYS A 1 19  ? -6.061  20.014  3.906   1.00 0.00 ? 19  LYS A HE2  6  
ATOM   7723  H HE3  . LYS A 1 19  ? -7.284  19.151  4.819   1.00 0.00 ? 19  LYS A HE3  6  
ATOM   7724  H HZ1  . LYS A 1 19  ? -6.605  20.083  6.724   1.00 0.00 ? 19  LYS A HZ1  6  
ATOM   7725  H HZ2  . LYS A 1 19  ? -5.021  20.102  6.326   1.00 0.00 ? 19  LYS A HZ2  6  
ATOM   7726  H HZ3  . LYS A 1 19  ? -6.022  21.253  5.745   1.00 0.00 ? 19  LYS A HZ3  6  
ATOM   7727  N N    . GLN A 1 20  ? -1.269  16.587  1.269   1.00 0.00 ? 20  GLN A N    6  
ATOM   7728  C CA   . GLN A 1 20  ? 0.142   16.404  1.559   1.00 0.00 ? 20  GLN A CA   6  
ATOM   7729  C C    . GLN A 1 20  ? 0.353   16.201  3.061   1.00 0.00 ? 20  GLN A C    6  
ATOM   7730  O O    . GLN A 1 20  ? 1.297   16.739  3.638   1.00 0.00 ? 20  GLN A O    6  
ATOM   7731  C CB   . GLN A 1 20  ? 0.966   17.586  1.044   1.00 0.00 ? 20  GLN A CB   6  
ATOM   7732  C CG   . GLN A 1 20  ? 1.755   17.198  -0.208  1.00 0.00 ? 20  GLN A CG   6  
ATOM   7733  C CD   . GLN A 1 20  ? 2.371   18.432  -0.872  1.00 0.00 ? 20  GLN A CD   6  
ATOM   7734  O OE1  . GLN A 1 20  ? 1.819   19.017  -1.790  1.00 0.00 ? 20  GLN A OE1  6  
ATOM   7735  N NE2  . GLN A 1 20  ? 3.542   18.796  -0.358  1.00 0.00 ? 20  GLN A NE2  6  
ATOM   7736  H H    . GLN A 1 20  ? -1.638  15.988  0.558   1.00 0.00 ? 20  GLN A H    6  
ATOM   7737  H HA   . GLN A 1 20  ? 0.433   15.502  1.020   1.00 0.00 ? 20  GLN A HA   6  
ATOM   7738  H HB2  . GLN A 1 20  ? 0.306   18.423  0.818   1.00 0.00 ? 20  GLN A HB2  6  
ATOM   7739  H HB3  . GLN A 1 20  ? 1.652   17.921  1.822   1.00 0.00 ? 20  GLN A HB3  6  
ATOM   7740  H HG2  . GLN A 1 20  ? 2.544   16.493  0.058   1.00 0.00 ? 20  GLN A HG2  6  
ATOM   7741  H HG3  . GLN A 1 20  ? 1.099   16.691  -0.914  1.00 0.00 ? 20  GLN A HG3  6  
ATOM   7742  H HE21 . GLN A 1 20  ? 3.942   18.274  0.397   1.00 0.00 ? 20  GLN A HE21 6  
ATOM   7743  H HE22 . GLN A 1 20  ? 4.024   19.593  -0.725  1.00 0.00 ? 20  GLN A HE22 6  
ATOM   7744  N N    . ASN A 1 21  ? -0.543  15.426  3.652   1.00 0.00 ? 21  ASN A N    6  
ATOM   7745  C CA   . ASN A 1 21  ? -0.468  15.146  5.077   1.00 0.00 ? 21  ASN A CA   6  
ATOM   7746  C C    . ASN A 1 21  ? 0.234   13.801  5.291   1.00 0.00 ? 21  ASN A C    6  
ATOM   7747  O O    . ASN A 1 21  ? -0.318  12.904  5.926   1.00 0.00 ? 21  ASN A O    6  
ATOM   7748  C CB   . ASN A 1 21  ? -1.863  15.055  5.695   1.00 0.00 ? 21  ASN A CB   6  
ATOM   7749  C CG   . ASN A 1 21  ? -1.780  14.852  7.210   1.00 0.00 ? 21  ASN A CG   6  
ATOM   7750  O OD1  . ASN A 1 21  ? -0.773  14.423  7.750   1.00 0.00 ? 21  ASN A OD1  6  
ATOM   7751  N ND2  . ASN A 1 21  ? -2.889  15.185  7.862   1.00 0.00 ? 21  ASN A ND2  6  
ATOM   7752  H H    . ASN A 1 21  ? -1.309  14.992  3.177   1.00 0.00 ? 21  ASN A H    6  
ATOM   7753  H HA   . ASN A 1 21  ? 0.091   15.978  5.502   1.00 0.00 ? 21  ASN A HA   6  
ATOM   7754  H HB2  . ASN A 1 21  ? -2.422  15.965  5.476   1.00 0.00 ? 21  ASN A HB2  6  
ATOM   7755  H HB3  . ASN A 1 21  ? -2.412  14.228  5.244   1.00 0.00 ? 21  ASN A HB3  6  
ATOM   7756  H HD21 . ASN A 1 21  ? -3.681  15.532  7.358   1.00 0.00 ? 21  ASN A HD21 6  
ATOM   7757  H HD22 . ASN A 1 21  ? -2.934  15.089  8.856   1.00 0.00 ? 21  ASN A HD22 6  
ATOM   7758  N N    . GLY A 1 22  ? 1.440   13.705  4.750   1.00 0.00 ? 22  GLY A N    6  
ATOM   7759  C CA   . GLY A 1 22  ? 2.219   12.488  4.873   1.00 0.00 ? 22  GLY A CA   6  
ATOM   7760  C C    . GLY A 1 22  ? 1.583   11.343  4.081   1.00 0.00 ? 22  GLY A C    6  
ATOM   7761  O O    . GLY A 1 22  ? 2.093   10.949  3.034   1.00 0.00 ? 22  GLY A O    6  
ATOM   7762  H H    . GLY A 1 22  ? 1.881   14.441  4.234   1.00 0.00 ? 22  GLY A H    6  
ATOM   7763  H HA2  . GLY A 1 22  ? 3.234   12.664  4.514   1.00 0.00 ? 22  GLY A HA2  6  
ATOM   7764  H HA3  . GLY A 1 22  ? 2.298   12.208  5.924   1.00 0.00 ? 22  GLY A HA3  6  
ATOM   7765  N N    . MET A 1 23  ? 0.476   10.845  4.612   1.00 0.00 ? 23  MET A N    6  
ATOM   7766  C CA   . MET A 1 23  ? -0.238  9.756   3.968   1.00 0.00 ? 23  MET A CA   6  
ATOM   7767  C C    . MET A 1 23  ? -1.251  9.121   4.924   1.00 0.00 ? 23  MET A C    6  
ATOM   7768  O O    . MET A 1 23  ? -2.454  9.164   4.676   1.00 0.00 ? 23  MET A O    6  
ATOM   7769  C CB   . MET A 1 23  ? 0.763   8.693   3.506   1.00 0.00 ? 23  MET A CB   6  
ATOM   7770  C CG   . MET A 1 23  ? 0.772   8.575   1.980   1.00 0.00 ? 23  MET A CG   6  
ATOM   7771  S SD   . MET A 1 23  ? 2.438   8.746   1.365   1.00 0.00 ? 23  MET A SD   6  
ATOM   7772  C CE   . MET A 1 23  ? 2.967   7.041   1.422   1.00 0.00 ? 23  MET A CE   6  
ATOM   7773  H H    . MET A 1 23  ? 0.066   11.171  5.464   1.00 0.00 ? 23  MET A H    6  
ATOM   7774  H HA   . MET A 1 23  ? -0.757  10.205  3.122   1.00 0.00 ? 23  MET A HA   6  
ATOM   7775  H HB2  . MET A 1 23  ? 1.762   8.951   3.861   1.00 0.00 ? 23  MET A HB2  6  
ATOM   7776  H HB3  . MET A 1 23  ? 0.505   7.729   3.948   1.00 0.00 ? 23  MET A HB3  6  
ATOM   7777  H HG2  . MET A 1 23  ? 0.362   7.611   1.680   1.00 0.00 ? 23  MET A HG2  6  
ATOM   7778  H HG3  . MET A 1 23  ? 0.134   9.344   1.544   1.00 0.00 ? 23  MET A HG3  6  
ATOM   7779  H HE1  . MET A 1 23  ? 3.949   6.950   0.961   1.00 0.00 ? 23  MET A HE1  6  
ATOM   7780  H HE2  . MET A 1 23  ? 3.020   6.712   2.459   1.00 0.00 ? 23  MET A HE2  6  
ATOM   7781  H HE3  . MET A 1 23  ? 2.252   6.421   0.880   1.00 0.00 ? 23  MET A HE3  6  
ATOM   7782  N N    . GLY A 1 24  ? -0.726  8.547   5.997   1.00 0.00 ? 24  GLY A N    6  
ATOM   7783  C CA   . GLY A 1 24  ? -1.569  7.905   6.991   1.00 0.00 ? 24  GLY A CA   6  
ATOM   7784  C C    . GLY A 1 24  ? -1.661  6.398   6.740   1.00 0.00 ? 24  GLY A C    6  
ATOM   7785  O O    . GLY A 1 24  ? -2.109  5.649   7.605   1.00 0.00 ? 24  GLY A O    6  
ATOM   7786  H H    . GLY A 1 24  ? 0.255   8.515   6.190   1.00 0.00 ? 24  GLY A H    6  
ATOM   7787  H HA2  . GLY A 1 24  ? -1.165  8.087   7.986   1.00 0.00 ? 24  GLY A HA2  6  
ATOM   7788  H HA3  . GLY A 1 24  ? -2.565  8.344   6.963   1.00 0.00 ? 24  GLY A HA3  6  
ATOM   7789  N N    . LEU A 1 25  ? -1.231  6.000   5.551   1.00 0.00 ? 25  LEU A N    6  
ATOM   7790  C CA   . LEU A 1 25  ? -1.260  4.596   5.177   1.00 0.00 ? 25  LEU A CA   6  
ATOM   7791  C C    . LEU A 1 25  ? -0.444  3.787   6.186   1.00 0.00 ? 25  LEU A C    6  
ATOM   7792  O O    . LEU A 1 25  ? 0.486   4.308   6.799   1.00 0.00 ? 25  LEU A O    6  
ATOM   7793  C CB   . LEU A 1 25  ? -0.797  4.419   3.729   1.00 0.00 ? 25  LEU A CB   6  
ATOM   7794  C CG   . LEU A 1 25  ? -1.839  4.720   2.651   1.00 0.00 ? 25  LEU A CG   6  
ATOM   7795  C CD1  . LEU A 1 25  ? -1.724  3.734   1.485   1.00 0.00 ? 25  LEU A CD1  6  
ATOM   7796  C CD2  . LEU A 1 25  ? -3.249  4.746   3.242   1.00 0.00 ? 25  LEU A CD2  6  
ATOM   7797  H H    . LEU A 1 25  ? -0.867  6.616   4.852   1.00 0.00 ? 25  LEU A H    6  
ATOM   7798  H HA   . LEU A 1 25  ? -2.297  4.267   5.226   1.00 0.00 ? 25  LEU A HA   6  
ATOM   7799  H HB2  . LEU A 1 25  ? 0.066   5.063   3.562   1.00 0.00 ? 25  LEU A HB2  6  
ATOM   7800  H HB3  . LEU A 1 25  ? -0.457  3.392   3.600   1.00 0.00 ? 25  LEU A HB3  6  
ATOM   7801  H HG   . LEU A 1 25  ? -1.639  5.715   2.251   1.00 0.00 ? 25  LEU A HG   6  
ATOM   7802  H HD11 . LEU A 1 25  ? -0.673  3.595   1.229   1.00 0.00 ? 25  LEU A HD11 6  
ATOM   7803  H HD12 . LEU A 1 25  ? -2.157  2.777   1.777   1.00 0.00 ? 25  LEU A HD12 6  
ATOM   7804  H HD13 . LEU A 1 25  ? -2.260  4.128   0.622   1.00 0.00 ? 25  LEU A HD13 6  
ATOM   7805  H HD21 . LEU A 1 25  ? -3.472  3.781   3.696   1.00 0.00 ? 25  LEU A HD21 6  
ATOM   7806  H HD22 . LEU A 1 25  ? -3.310  5.528   4.001   1.00 0.00 ? 25  LEU A HD22 6  
ATOM   7807  H HD23 . LEU A 1 25  ? -3.972  4.950   2.452   1.00 0.00 ? 25  LEU A HD23 6  
ATOM   7808  N N    . SER A 1 26  ? -0.824  2.525   6.330   1.00 0.00 ? 26  SER A N    6  
ATOM   7809  C CA   . SER A 1 26  ? -0.140  1.638   7.255   1.00 0.00 ? 26  SER A CA   6  
ATOM   7810  C C    . SER A 1 26  ? -0.098  0.219   6.686   1.00 0.00 ? 26  SER A C    6  
ATOM   7811  O O    . SER A 1 26  ? -1.125  -0.458  6.621   1.00 0.00 ? 26  SER A O    6  
ATOM   7812  C CB   . SER A 1 26  ? -0.818  1.643   8.625   1.00 0.00 ? 26  SER A CB   6  
ATOM   7813  O OG   . SER A 1 26  ? -1.356  2.920   8.952   1.00 0.00 ? 26  SER A OG   6  
ATOM   7814  H H    . SER A 1 26  ? -1.582  2.110   5.828   1.00 0.00 ? 26  SER A H    6  
ATOM   7815  H HA   . SER A 1 26  ? 0.868   2.041   7.349   1.00 0.00 ? 26  SER A HA   6  
ATOM   7816  H HB2  . SER A 1 26  ? -1.617  0.899   8.635   1.00 0.00 ? 26  SER A HB2  6  
ATOM   7817  H HB3  . SER A 1 26  ? -0.099  1.344   9.388   1.00 0.00 ? 26  SER A HB3  6  
ATOM   7818  H HG   . SER A 1 26  ? -0.743  3.642   8.631   1.00 0.00 ? 26  SER A HG   6  
ATOM   7819  N N    . ILE A 1 27  ? 1.096   -0.192  6.286   1.00 0.00 ? 27  ILE A N    6  
ATOM   7820  C CA   . ILE A 1 27  ? 1.282   -1.518  5.724   1.00 0.00 ? 27  ILE A CA   6  
ATOM   7821  C C    . ILE A 1 27  ? 2.403   -2.233  6.480   1.00 0.00 ? 27  ILE A C    6  
ATOM   7822  O O    . ILE A 1 27  ? 3.108   -1.621  7.282   1.00 0.00 ? 27  ILE A O    6  
ATOM   7823  C CB   . ILE A 1 27  ? 1.516   -1.433  4.215   1.00 0.00 ? 27  ILE A CB   6  
ATOM   7824  C CG1  . ILE A 1 27  ? 3.011   -1.439  3.890   1.00 0.00 ? 27  ILE A CG1  6  
ATOM   7825  C CG2  . ILE A 1 27  ? 0.804   -0.217  3.618   1.00 0.00 ? 27  ILE A CG2  6  
ATOM   7826  C CD1  . ILE A 1 27  ? 3.243   -1.523  2.380   1.00 0.00 ? 27  ILE A CD1  6  
ATOM   7827  H H    . ILE A 1 27  ? 1.924   0.365   6.342   1.00 0.00 ? 27  ILE A H    6  
ATOM   7828  H HA   . ILE A 1 27  ? 0.355   -2.071  5.877   1.00 0.00 ? 27  ILE A HA   6  
ATOM   7829  H HB   . ILE A 1 27  ? 1.082   -2.319  3.751   1.00 0.00 ? 27  ILE A HB   6  
ATOM   7830  H HG12 . ILE A 1 27  ? 3.475   -0.535  4.283   1.00 0.00 ? 27  ILE A HG12 6  
ATOM   7831  H HG13 . ILE A 1 27  ? 3.490   -2.284  4.383   1.00 0.00 ? 27  ILE A HG13 6  
ATOM   7832  H HG21 . ILE A 1 27  ? -0.153  -0.073  4.119   1.00 0.00 ? 27  ILE A HG21 6  
ATOM   7833  H HG22 . ILE A 1 27  ? 1.423   0.669   3.755   1.00 0.00 ? 27  ILE A HG22 6  
ATOM   7834  H HG23 . ILE A 1 27  ? 0.636   -0.381  2.553   1.00 0.00 ? 27  ILE A HG23 6  
ATOM   7835  H HD11 . ILE A 1 27  ? 3.249   -0.520  1.957   1.00 0.00 ? 27  ILE A HD11 6  
ATOM   7836  H HD12 . ILE A 1 27  ? 4.201   -2.006  2.186   1.00 0.00 ? 27  ILE A HD12 6  
ATOM   7837  H HD13 . ILE A 1 27  ? 2.444   -2.106  1.922   1.00 0.00 ? 27  ILE A HD13 6  
ATOM   7838  N N    . VAL A 1 28  ? 2.536   -3.522  6.200   1.00 0.00 ? 28  VAL A N    6  
ATOM   7839  C CA   . VAL A 1 28  ? 3.559   -4.327  6.843   1.00 0.00 ? 28  VAL A CA   6  
ATOM   7840  C C    . VAL A 1 28  ? 3.967   -5.467  5.908   1.00 0.00 ? 28  VAL A C    6  
ATOM   7841  O O    . VAL A 1 28  ? 3.200   -5.861  5.030   1.00 0.00 ? 28  VAL A O    6  
ATOM   7842  C CB   . VAL A 1 28  ? 3.058   -4.820  8.204   1.00 0.00 ? 28  VAL A CB   6  
ATOM   7843  C CG1  . VAL A 1 28  ? 3.747   -6.128  8.599   1.00 0.00 ? 28  VAL A CG1  6  
ATOM   7844  C CG2  . VAL A 1 28  ? 3.256   -3.749  9.279   1.00 0.00 ? 28  VAL A CG2  6  
ATOM   7845  H H    . VAL A 1 28  ? 1.959   -4.013  5.548   1.00 0.00 ? 28  VAL A H    6  
ATOM   7846  H HA   . VAL A 1 28  ? 4.424   -3.686  7.013   1.00 0.00 ? 28  VAL A HA   6  
ATOM   7847  H HB   . VAL A 1 28  ? 1.991   -5.016  8.116   1.00 0.00 ? 28  VAL A HB   6  
ATOM   7848  H HG11 . VAL A 1 28  ? 3.346   -6.474  9.551   1.00 0.00 ? 28  VAL A HG11 6  
ATOM   7849  H HG12 . VAL A 1 28  ? 3.566   -6.879  7.833   1.00 0.00 ? 28  VAL A HG12 6  
ATOM   7850  H HG13 . VAL A 1 28  ? 4.819   -5.959  8.695   1.00 0.00 ? 28  VAL A HG13 6  
ATOM   7851  H HG21 . VAL A 1 28  ? 3.957   -2.996  8.919   1.00 0.00 ? 28  VAL A HG21 6  
ATOM   7852  H HG22 . VAL A 1 28  ? 2.299   -3.276  9.501   1.00 0.00 ? 28  VAL A HG22 6  
ATOM   7853  H HG23 . VAL A 1 28  ? 3.653   -4.211  10.184  1.00 0.00 ? 28  VAL A HG23 6  
ATOM   7854  N N    . ALA A 1 29  ? 5.175   -5.968  6.128   1.00 0.00 ? 29  ALA A N    6  
ATOM   7855  C CA   . ALA A 1 29  ? 5.693   -7.055  5.316   1.00 0.00 ? 29  ALA A CA   6  
ATOM   7856  C C    . ALA A 1 29  ? 6.131   -8.201  6.228   1.00 0.00 ? 29  ALA A C    6  
ATOM   7857  O O    . ALA A 1 29  ? 6.761   -7.975  7.259   1.00 0.00 ? 29  ALA A O    6  
ATOM   7858  C CB   . ALA A 1 29  ? 6.835   -6.537  4.439   1.00 0.00 ? 29  ALA A CB   6  
ATOM   7859  H H    . ALA A 1 29  ? 5.793   -5.642  6.844   1.00 0.00 ? 29  ALA A H    6  
ATOM   7860  H HA   . ALA A 1 29  ? 4.885   -7.402  4.671   1.00 0.00 ? 29  ALA A HA   6  
ATOM   7861  H HB1  . ALA A 1 29  ? 6.853   -5.448  4.472   1.00 0.00 ? 29  ALA A HB1  6  
ATOM   7862  H HB2  . ALA A 1 29  ? 7.783   -6.928  4.810   1.00 0.00 ? 29  ALA A HB2  6  
ATOM   7863  H HB3  . ALA A 1 29  ? 6.684   -6.870  3.412   1.00 0.00 ? 29  ALA A HB3  6  
ATOM   7864  N N    . ALA A 1 30  ? 5.781   -9.411  5.814   1.00 0.00 ? 30  ALA A N    6  
ATOM   7865  C CA   . ALA A 1 30  ? 6.130   -10.595 6.582   1.00 0.00 ? 30  ALA A CA   6  
ATOM   7866  C C    . ALA A 1 30  ? 7.147   -11.425 5.796   1.00 0.00 ? 30  ALA A C    6  
ATOM   7867  O O    . ALA A 1 30  ? 6.772   -12.328 5.049   1.00 0.00 ? 30  ALA A O    6  
ATOM   7868  C CB   . ALA A 1 30  ? 4.861   -11.384 6.910   1.00 0.00 ? 30  ALA A CB   6  
ATOM   7869  H H    . ALA A 1 30  ? 5.269   -9.588  4.975   1.00 0.00 ? 30  ALA A H    6  
ATOM   7870  H HA   . ALA A 1 30  ? 6.587   -10.264 7.515   1.00 0.00 ? 30  ALA A HA   6  
ATOM   7871  H HB1  . ALA A 1 30  ? 5.129   -12.409 7.170   1.00 0.00 ? 30  ALA A HB1  6  
ATOM   7872  H HB2  . ALA A 1 30  ? 4.348   -10.917 7.750   1.00 0.00 ? 30  ALA A HB2  6  
ATOM   7873  H HB3  . ALA A 1 30  ? 4.203   -11.391 6.040   1.00 0.00 ? 30  ALA A HB3  6  
ATOM   7874  N N    . LYS A 1 31  ? 8.414   -11.090 5.990   1.00 0.00 ? 31  LYS A N    6  
ATOM   7875  C CA   . LYS A 1 31  ? 9.487   -11.793 5.309   1.00 0.00 ? 31  LYS A CA   6  
ATOM   7876  C C    . LYS A 1 31  ? 10.193  -12.722 6.299   1.00 0.00 ? 31  LYS A C    6  
ATOM   7877  O O    . LYS A 1 31  ? 10.405  -12.355 7.455   1.00 0.00 ? 31  LYS A O    6  
ATOM   7878  C CB   . LYS A 1 31  ? 10.428  -10.799 4.623   1.00 0.00 ? 31  LYS A CB   6  
ATOM   7879  C CG   . LYS A 1 31  ? 11.021  -9.816  5.633   1.00 0.00 ? 31  LYS A CG   6  
ATOM   7880  C CD   . LYS A 1 31  ? 10.379  -8.433  5.497   1.00 0.00 ? 31  LYS A CD   6  
ATOM   7881  C CE   . LYS A 1 31  ? 10.306  -7.728  6.851   1.00 0.00 ? 31  LYS A CE   6  
ATOM   7882  N NZ   . LYS A 1 31  ? 11.654  -7.295  7.283   1.00 0.00 ? 31  LYS A NZ   6  
ATOM   7883  H H    . LYS A 1 31  ? 8.710   -10.353 6.599   1.00 0.00 ? 31  LYS A H    6  
ATOM   7884  H HA   . LYS A 1 31  ? 9.035   -12.402 4.527   1.00 0.00 ? 31  LYS A HA   6  
ATOM   7885  H HB2  . LYS A 1 31  ? 11.230  -11.339 4.120   1.00 0.00 ? 31  LYS A HB2  6  
ATOM   7886  H HB3  . LYS A 1 31  ? 9.884   -10.250 3.853   1.00 0.00 ? 31  LYS A HB3  6  
ATOM   7887  H HG2  . LYS A 1 31  ? 10.869  -10.193 6.646   1.00 0.00 ? 31  LYS A HG2  6  
ATOM   7888  H HG3  . LYS A 1 31  ? 12.098  -9.738  5.481   1.00 0.00 ? 31  LYS A HG3  6  
ATOM   7889  H HD2  . LYS A 1 31  ? 10.957  -7.829  4.798   1.00 0.00 ? 31  LYS A HD2  6  
ATOM   7890  H HD3  . LYS A 1 31  ? 9.378   -8.534  5.080   1.00 0.00 ? 31  LYS A HD3  6  
ATOM   7891  H HE2  . LYS A 1 31  ? 9.645   -6.863  6.782   1.00 0.00 ? 31  LYS A HE2  6  
ATOM   7892  H HE3  . LYS A 1 31  ? 9.878   -8.397  7.597   1.00 0.00 ? 31  LYS A HE3  6  
ATOM   7893  H HZ1  . LYS A 1 31  ? 11.879  -6.422  6.852   1.00 0.00 ? 31  LYS A HZ1  6  
ATOM   7894  H HZ2  . LYS A 1 31  ? 11.667  -7.186  8.279   1.00 0.00 ? 31  LYS A HZ2  6  
ATOM   7895  H HZ3  . LYS A 1 31  ? 12.327  -7.983  7.016   1.00 0.00 ? 31  LYS A HZ3  6  
ATOM   7896  N N    . GLY A 1 32  ? 10.536  -13.903 5.811   1.00 0.00 ? 32  GLY A N    6  
ATOM   7897  C CA   . GLY A 1 32  ? 11.212  -14.888 6.639   1.00 0.00 ? 32  GLY A CA   6  
ATOM   7898  C C    . GLY A 1 32  ? 10.321  -15.329 7.804   1.00 0.00 ? 32  GLY A C    6  
ATOM   7899  O O    . GLY A 1 32  ? 10.305  -14.688 8.853   1.00 0.00 ? 32  GLY A O    6  
ATOM   7900  H H    . GLY A 1 32  ? 10.358  -14.193 4.871   1.00 0.00 ? 32  GLY A H    6  
ATOM   7901  H HA2  . GLY A 1 32  ? 11.481  -15.753 6.034   1.00 0.00 ? 32  GLY A HA2  6  
ATOM   7902  H HA3  . GLY A 1 32  ? 12.140  -14.467 7.025   1.00 0.00 ? 32  GLY A HA3  6  
ATOM   7903  N N    . ALA A 1 33  ? 9.606   -16.420 7.580   1.00 0.00 ? 33  ALA A N    6  
ATOM   7904  C CA   . ALA A 1 33  ? 8.717   -16.953 8.597   1.00 0.00 ? 33  ALA A CA   6  
ATOM   7905  C C    . ALA A 1 33  ? 8.616   -18.472 8.433   1.00 0.00 ? 33  ALA A C    6  
ATOM   7906  O O    . ALA A 1 33  ? 8.161   -18.961 7.400   1.00 0.00 ? 33  ALA A O    6  
ATOM   7907  C CB   . ALA A 1 33  ? 7.354   -16.265 8.498   1.00 0.00 ? 33  ALA A CB   6  
ATOM   7908  H H    . ALA A 1 33  ? 9.626   -16.937 6.723   1.00 0.00 ? 33  ALA A H    6  
ATOM   7909  H HA   . ALA A 1 33  ? 9.154   -16.730 9.570   1.00 0.00 ? 33  ALA A HA   6  
ATOM   7910  H HB1  . ALA A 1 33  ? 6.902   -16.492 7.532   1.00 0.00 ? 33  ALA A HB1  6  
ATOM   7911  H HB2  . ALA A 1 33  ? 6.706   -16.624 9.297   1.00 0.00 ? 33  ALA A HB2  6  
ATOM   7912  H HB3  . ALA A 1 33  ? 7.485   -15.188 8.592   1.00 0.00 ? 33  ALA A HB3  6  
ATOM   7913  N N    . GLY A 1 34  ? 9.046   -19.177 9.469   1.00 0.00 ? 34  GLY A N    6  
ATOM   7914  C CA   . GLY A 1 34  ? 9.010   -20.630 9.454   1.00 0.00 ? 34  GLY A CA   6  
ATOM   7915  C C    . GLY A 1 34  ? 10.027  -21.192 8.458   1.00 0.00 ? 34  GLY A C    6  
ATOM   7916  O O    . GLY A 1 34  ? 11.112  -21.620 8.849   1.00 0.00 ? 34  GLY A O    6  
ATOM   7917  H H    . GLY A 1 34  ? 9.416   -18.773 10.306  1.00 0.00 ? 34  GLY A H    6  
ATOM   7918  H HA2  . GLY A 1 34  ? 9.223   -21.013 10.452  1.00 0.00 ? 34  GLY A HA2  6  
ATOM   7919  H HA3  . GLY A 1 34  ? 8.008   -20.968 9.189   1.00 0.00 ? 34  GLY A HA3  6  
ATOM   7920  N N    . GLN A 1 35  ? 9.639   -21.176 7.192   1.00 0.00 ? 35  GLN A N    6  
ATOM   7921  C CA   . GLN A 1 35  ? 10.503  -21.680 6.138   1.00 0.00 ? 35  GLN A CA   6  
ATOM   7922  C C    . GLN A 1 35  ? 10.636  -20.644 5.021   1.00 0.00 ? 35  GLN A C    6  
ATOM   7923  O O    . GLN A 1 35  ? 10.335  -20.930 3.863   1.00 0.00 ? 35  GLN A O    6  
ATOM   7924  C CB   . GLN A 1 35  ? 9.982   -23.011 5.591   1.00 0.00 ? 35  GLN A CB   6  
ATOM   7925  C CG   . GLN A 1 35  ? 10.792  -24.185 6.147   1.00 0.00 ? 35  GLN A CG   6  
ATOM   7926  C CD   . GLN A 1 35  ? 12.186  -24.237 5.518   1.00 0.00 ? 35  GLN A CD   6  
ATOM   7927  O OE1  . GLN A 1 35  ? 12.425  -23.734 4.433   1.00 0.00 ? 35  GLN A OE1  6  
ATOM   7928  N NE2  . GLN A 1 35  ? 13.089  -24.874 6.259   1.00 0.00 ? 35  GLN A NE2  6  
ATOM   7929  H H    . GLN A 1 35  ? 8.754   -20.826 6.883   1.00 0.00 ? 35  GLN A H    6  
ATOM   7930  H HA   . GLN A 1 35  ? 11.473  -21.842 6.610   1.00 0.00 ? 35  GLN A HA   6  
ATOM   7931  H HB2  . GLN A 1 35  ? 8.932   -23.131 5.856   1.00 0.00 ? 35  GLN A HB2  6  
ATOM   7932  H HB3  . GLN A 1 35  ? 10.039  -23.009 4.504   1.00 0.00 ? 35  GLN A HB3  6  
ATOM   7933  H HG2  . GLN A 1 35  ? 10.879  -24.091 7.229   1.00 0.00 ? 35  GLN A HG2  6  
ATOM   7934  H HG3  . GLN A 1 35  ? 10.264  -25.118 5.951   1.00 0.00 ? 35  GLN A HG3  6  
ATOM   7935  H HE21 . GLN A 1 35  ? 12.827  -25.264 7.140   1.00 0.00 ? 35  GLN A HE21 6  
ATOM   7936  H HE22 . GLN A 1 35  ? 14.030  -24.961 5.932   1.00 0.00 ? 35  GLN A HE22 6  
ATOM   7937  N N    . ASP A 1 36  ? 11.089  -19.459 5.406   1.00 0.00 ? 36  ASP A N    6  
ATOM   7938  C CA   . ASP A 1 36  ? 11.267  -18.378 4.451   1.00 0.00 ? 36  ASP A CA   6  
ATOM   7939  C C    . ASP A 1 36  ? 9.904   -17.973 3.887   1.00 0.00 ? 36  ASP A C    6  
ATOM   7940  O O    . ASP A 1 36  ? 9.259   -18.756 3.192   1.00 0.00 ? 36  ASP A O    6  
ATOM   7941  C CB   . ASP A 1 36  ? 12.151  -18.817 3.281   1.00 0.00 ? 36  ASP A CB   6  
ATOM   7942  C CG   . ASP A 1 36  ? 13.461  -19.500 3.682   1.00 0.00 ? 36  ASP A CG   6  
ATOM   7943  O OD1  . ASP A 1 36  ? 13.937  -19.205 4.799   1.00 0.00 ? 36  ASP A OD1  6  
ATOM   7944  O OD2  . ASP A 1 36  ? 13.955  -20.302 2.860   1.00 0.00 ? 36  ASP A OD2  6  
ATOM   7945  H H    . ASP A 1 36  ? 11.333  -19.234 6.350   1.00 0.00 ? 36  ASP A H    6  
ATOM   7946  H HA   . ASP A 1 36  ? 11.742  -17.574 5.014   1.00 0.00 ? 36  ASP A HA   6  
ATOM   7947  H HB2  . ASP A 1 36  ? 11.581  -19.499 2.650   1.00 0.00 ? 36  ASP A HB2  6  
ATOM   7948  H HB3  . ASP A 1 36  ? 12.385  -17.941 2.676   1.00 0.00 ? 36  ASP A HB3  6  
ATOM   7949  N N    . LYS A 1 37  ? 9.506   -16.751 4.209   1.00 0.00 ? 37  LYS A N    6  
ATOM   7950  C CA   . LYS A 1 37  ? 8.231   -16.232 3.743   1.00 0.00 ? 37  LYS A CA   6  
ATOM   7951  C C    . LYS A 1 37  ? 8.425   -14.808 3.220   1.00 0.00 ? 37  LYS A C    6  
ATOM   7952  O O    . LYS A 1 37  ? 9.542   -14.291 3.214   1.00 0.00 ? 37  LYS A O    6  
ATOM   7953  C CB   . LYS A 1 37  ? 7.173   -16.345 4.842   1.00 0.00 ? 37  LYS A CB   6  
ATOM   7954  C CG   . LYS A 1 37  ? 5.831   -16.800 4.265   1.00 0.00 ? 37  LYS A CG   6  
ATOM   7955  C CD   . LYS A 1 37  ? 5.379   -18.114 4.901   1.00 0.00 ? 37  LYS A CD   6  
ATOM   7956  C CE   . LYS A 1 37  ? 5.778   -19.310 4.034   1.00 0.00 ? 37  LYS A CE   6  
ATOM   7957  N NZ   . LYS A 1 37  ? 4.595   -19.868 3.343   1.00 0.00 ? 37  LYS A NZ   6  
ATOM   7958  H H    . LYS A 1 37  ? 10.038  -16.121 4.775   1.00 0.00 ? 37  LYS A H    6  
ATOM   7959  H HA   . LYS A 1 37  ? 7.905   -16.862 2.914   1.00 0.00 ? 37  LYS A HA   6  
ATOM   7960  H HB2  . LYS A 1 37  ? 7.505   -17.053 5.602   1.00 0.00 ? 37  LYS A HB2  6  
ATOM   7961  H HB3  . LYS A 1 37  ? 7.053   -15.381 5.336   1.00 0.00 ? 37  LYS A HB3  6  
ATOM   7962  H HG2  . LYS A 1 37  ? 5.078   -16.030 4.437   1.00 0.00 ? 37  LYS A HG2  6  
ATOM   7963  H HG3  . LYS A 1 37  ? 5.917   -16.923 3.186   1.00 0.00 ? 37  LYS A HG3  6  
ATOM   7964  H HD2  . LYS A 1 37  ? 5.822   -18.216 5.893   1.00 0.00 ? 37  LYS A HD2  6  
ATOM   7965  H HD3  . LYS A 1 37  ? 4.297   -18.105 5.035   1.00 0.00 ? 37  LYS A HD3  6  
ATOM   7966  H HE2  . LYS A 1 37  ? 6.523   -19.001 3.301   1.00 0.00 ? 37  LYS A HE2  6  
ATOM   7967  H HE3  . LYS A 1 37  ? 6.241   -20.077 4.654   1.00 0.00 ? 37  LYS A HE3  6  
ATOM   7968  H HZ1  . LYS A 1 37  ? 3.860   -20.016 4.006   1.00 0.00 ? 37  LYS A HZ1  6  
ATOM   7969  H HZ2  . LYS A 1 37  ? 4.286   -19.228 2.640   1.00 0.00 ? 37  LYS A HZ2  6  
ATOM   7970  H HZ3  . LYS A 1 37  ? 4.838   -20.741 2.917   1.00 0.00 ? 37  LYS A HZ3  6  
ATOM   7971  N N    . LEU A 1 38  ? 7.322   -14.211 2.793   1.00 0.00 ? 38  LEU A N    6  
ATOM   7972  C CA   . LEU A 1 38  ? 7.357   -12.855 2.270   1.00 0.00 ? 38  LEU A CA   6  
ATOM   7973  C C    . LEU A 1 38  ? 5.956   -12.461 1.796   1.00 0.00 ? 38  LEU A C    6  
ATOM   7974  O O    . LEU A 1 38  ? 5.574   -12.755 0.665   1.00 0.00 ? 38  LEU A O    6  
ATOM   7975  C CB   . LEU A 1 38  ? 8.431   -12.728 1.188   1.00 0.00 ? 38  LEU A CB   6  
ATOM   7976  C CG   . LEU A 1 38  ? 8.333   -11.493 0.291   1.00 0.00 ? 38  LEU A CG   6  
ATOM   7977  C CD1  . LEU A 1 38  ? 7.605   -10.351 1.003   1.00 0.00 ? 38  LEU A CD1  6  
ATOM   7978  C CD2  . LEU A 1 38  ? 9.715   -11.068 -0.210  1.00 0.00 ? 38  LEU A CD2  6  
ATOM   7979  H H    . LEU A 1 38  ? 6.418   -14.639 2.803   1.00 0.00 ? 38  LEU A H    6  
ATOM   7980  H HA   . LEU A 1 38  ? 7.644   -12.197 3.090   1.00 0.00 ? 38  LEU A HA   6  
ATOM   7981  H HB2  . LEU A 1 38  ? 9.407   -12.722 1.673   1.00 0.00 ? 38  LEU A HB2  6  
ATOM   7982  H HB3  . LEU A 1 38  ? 8.393   -13.616 0.559   1.00 0.00 ? 38  LEU A HB3  6  
ATOM   7983  H HG   . LEU A 1 38  ? 7.741   -11.755 -0.587  1.00 0.00 ? 38  LEU A HG   6  
ATOM   7984  H HD11 . LEU A 1 38  ? 8.068   -9.401  0.736   1.00 0.00 ? 38  LEU A HD11 6  
ATOM   7985  H HD12 . LEU A 1 38  ? 6.559   -10.343 0.702   1.00 0.00 ? 38  LEU A HD12 6  
ATOM   7986  H HD13 . LEU A 1 38  ? 7.672   -10.496 2.083   1.00 0.00 ? 38  LEU A HD13 6  
ATOM   7987  H HD21 . LEU A 1 38  ? 9.887   -10.021 0.040   1.00 0.00 ? 38  LEU A HD21 6  
ATOM   7988  H HD22 . LEU A 1 38  ? 10.480  -11.684 0.263   1.00 0.00 ? 38  LEU A HD22 6  
ATOM   7989  H HD23 . LEU A 1 38  ? 9.764   -11.196 -1.292  1.00 0.00 ? 38  LEU A HD23 6  
ATOM   7990  N N    . GLY A 1 39  ? 5.230   -11.799 2.686   1.00 0.00 ? 39  GLY A N    6  
ATOM   7991  C CA   . GLY A 1 39  ? 3.883   -11.361 2.372   1.00 0.00 ? 39  GLY A CA   6  
ATOM   7992  C C    . GLY A 1 39  ? 3.629   -9.947  2.901   1.00 0.00 ? 39  GLY A C    6  
ATOM   7993  O O    . GLY A 1 39  ? 3.768   -9.692  4.095   1.00 0.00 ? 39  GLY A O    6  
ATOM   7994  H H    . GLY A 1 39  ? 5.550   -11.564 3.604   1.00 0.00 ? 39  GLY A H    6  
ATOM   7995  H HA2  . GLY A 1 39  ? 3.729   -11.383 1.293   1.00 0.00 ? 39  GLY A HA2  6  
ATOM   7996  H HA3  . GLY A 1 39  ? 3.161   -12.051 2.810   1.00 0.00 ? 39  GLY A HA3  6  
ATOM   7997  N N    . ILE A 1 40  ? 3.259   -9.065  1.983   1.00 0.00 ? 40  ILE A N    6  
ATOM   7998  C CA   . ILE A 1 40  ? 2.985   -7.683  2.341   1.00 0.00 ? 40  ILE A CA   6  
ATOM   7999  C C    . ILE A 1 40  ? 1.473   -7.482  2.457   1.00 0.00 ? 40  ILE A C    6  
ATOM   8000  O O    . ILE A 1 40  ? 0.707   -8.038  1.671   1.00 0.00 ? 40  ILE A O    6  
ATOM   8001  C CB   . ILE A 1 40  ? 3.659   -6.731  1.353   1.00 0.00 ? 40  ILE A CB   6  
ATOM   8002  C CG1  . ILE A 1 40  ? 4.769   -7.442  0.573   1.00 0.00 ? 40  ILE A CG1  6  
ATOM   8003  C CG2  . ILE A 1 40  ? 4.172   -5.476  2.064   1.00 0.00 ? 40  ILE A CG2  6  
ATOM   8004  C CD1  . ILE A 1 40  ? 5.411   -6.501  -0.448  1.00 0.00 ? 40  ILE A CD1  6  
ATOM   8005  H H    . ILE A 1 40  ? 3.146   -9.280  1.013   1.00 0.00 ? 40  ILE A H    6  
ATOM   8006  H HA   . ILE A 1 40  ? 3.433   -7.505  3.318   1.00 0.00 ? 40  ILE A HA   6  
ATOM   8007  H HB   . ILE A 1 40  ? 2.914   -6.407  0.627   1.00 0.00 ? 40  ILE A HB   6  
ATOM   8008  H HG12 . ILE A 1 40  ? 5.527   -7.806  1.266   1.00 0.00 ? 40  ILE A HG12 6  
ATOM   8009  H HG13 . ILE A 1 40  ? 4.357   -8.313  0.063   1.00 0.00 ? 40  ILE A HG13 6  
ATOM   8010  H HG21 . ILE A 1 40  ? 3.327   -4.857  2.362   1.00 0.00 ? 40  ILE A HG21 6  
ATOM   8011  H HG22 . ILE A 1 40  ? 4.741   -5.766  2.947   1.00 0.00 ? 40  ILE A HG22 6  
ATOM   8012  H HG23 . ILE A 1 40  ? 4.816   -4.912  1.387   1.00 0.00 ? 40  ILE A HG23 6  
ATOM   8013  H HD11 . ILE A 1 40  ? 6.166   -5.890  0.045   1.00 0.00 ? 40  ILE A HD11 6  
ATOM   8014  H HD12 . ILE A 1 40  ? 5.880   -7.088  -1.238  1.00 0.00 ? 40  ILE A HD12 6  
ATOM   8015  H HD13 . ILE A 1 40  ? 4.646   -5.857  -0.881  1.00 0.00 ? 40  ILE A HD13 6  
ATOM   8016  N N    . TYR A 1 41  ? 1.089   -6.683  3.441   1.00 0.00 ? 41  TYR A N    6  
ATOM   8017  C CA   . TYR A 1 41  ? -0.318  -6.400  3.669   1.00 0.00 ? 41  TYR A CA   6  
ATOM   8018  C C    . TYR A 1 41  ? -0.511  -4.984  4.216   1.00 0.00 ? 41  TYR A C    6  
ATOM   8019  O O    . TYR A 1 41  ? 0.437   -4.364  4.694   1.00 0.00 ? 41  TYR A O    6  
ATOM   8020  C CB   . TYR A 1 41  ? -0.786  -7.408  4.720   1.00 0.00 ? 41  TYR A CB   6  
ATOM   8021  C CG   . TYR A 1 41  ? -0.530  -8.868  4.338   1.00 0.00 ? 41  TYR A CG   6  
ATOM   8022  C CD1  . TYR A 1 41  ? -1.196  -9.428  3.267   1.00 0.00 ? 41  TYR A CD1  6  
ATOM   8023  C CD2  . TYR A 1 41  ? 0.366   -9.625  5.066   1.00 0.00 ? 41  TYR A CD2  6  
ATOM   8024  C CE1  . TYR A 1 41  ? -0.955  -10.803 2.909   1.00 0.00 ? 41  TYR A CE1  6  
ATOM   8025  C CE2  . TYR A 1 41  ? 0.607   -10.998 4.707   1.00 0.00 ? 41  TYR A CE2  6  
ATOM   8026  C CZ   . TYR A 1 41  ? -0.065  -11.517 3.646   1.00 0.00 ? 41  TYR A CZ   6  
ATOM   8027  O OH   . TYR A 1 41  ? 0.163   -12.816 3.307   1.00 0.00 ? 41  TYR A OH   6  
ATOM   8028  H H    . TYR A 1 41  ? 1.718   -6.232  4.074   1.00 0.00 ? 41  TYR A H    6  
ATOM   8029  H HA   . TYR A 1 41  ? -0.837  -6.487  2.714   1.00 0.00 ? 41  TYR A HA   6  
ATOM   8030  H HB2  . TYR A 1 41  ? -0.282  -7.196  5.662   1.00 0.00 ? 41  TYR A HB2  6  
ATOM   8031  H HB3  . TYR A 1 41  ? -1.853  -7.270  4.891   1.00 0.00 ? 41  TYR A HB3  6  
ATOM   8032  H HD1  . TYR A 1 41  ? -1.904  -8.831  2.692   1.00 0.00 ? 41  TYR A HD1  6  
ATOM   8033  H HD2  . TYR A 1 41  ? 0.891   -9.181  5.912   1.00 0.00 ? 41  TYR A HD2  6  
ATOM   8034  H HE1  . TYR A 1 41  ? -1.473  -11.257 2.065   1.00 0.00 ? 41  TYR A HE1  6  
ATOM   8035  H HE2  . TYR A 1 41  ? 1.313   -11.606 5.274   1.00 0.00 ? 41  TYR A HE2  6  
ATOM   8036  H HH   . TYR A 1 41  ? 1.068   -13.098 3.625   1.00 0.00 ? 41  TYR A HH   6  
ATOM   8037  N N    . VAL A 1 42  ? -1.747  -4.514  4.129   1.00 0.00 ? 42  VAL A N    6  
ATOM   8038  C CA   . VAL A 1 42  ? -2.076  -3.183  4.611   1.00 0.00 ? 42  VAL A CA   6  
ATOM   8039  C C    . VAL A 1 42  ? -2.738  -3.292  5.986   1.00 0.00 ? 42  VAL A C    6  
ATOM   8040  O O    . VAL A 1 42  ? -3.752  -3.969  6.140   1.00 0.00 ? 42  VAL A O    6  
ATOM   8041  C CB   . VAL A 1 42  ? -2.949  -2.456  3.583   1.00 0.00 ? 42  VAL A CB   6  
ATOM   8042  C CG1  . VAL A 1 42  ? -3.532  -1.171  4.173   1.00 0.00 ? 42  VAL A CG1  6  
ATOM   8043  C CG2  . VAL A 1 42  ? -2.162  -2.166  2.303   1.00 0.00 ? 42  VAL A CG2  6  
ATOM   8044  H H    . VAL A 1 42  ? -2.515  -5.024  3.740   1.00 0.00 ? 42  VAL A H    6  
ATOM   8045  H HA   . VAL A 1 42  ? -1.144  -2.629  4.712   1.00 0.00 ? 42  VAL A HA   6  
ATOM   8046  H HB   . VAL A 1 42  ? -3.778  -3.114  3.325   1.00 0.00 ? 42  VAL A HB   6  
ATOM   8047  H HG11 . VAL A 1 42  ? -4.309  -0.787  3.509   1.00 0.00 ? 42  VAL A HG11 6  
ATOM   8048  H HG12 . VAL A 1 42  ? -3.963  -1.382  5.151   1.00 0.00 ? 42  VAL A HG12 6  
ATOM   8049  H HG13 . VAL A 1 42  ? -2.743  -0.427  4.276   1.00 0.00 ? 42  VAL A HG13 6  
ATOM   8050  H HG21 . VAL A 1 42  ? -2.852  -1.874  1.513   1.00 0.00 ? 42  VAL A HG21 6  
ATOM   8051  H HG22 . VAL A 1 42  ? -1.456  -1.357  2.488   1.00 0.00 ? 42  VAL A HG22 6  
ATOM   8052  H HG23 . VAL A 1 42  ? -1.619  -3.060  2.001   1.00 0.00 ? 42  VAL A HG23 6  
ATOM   8053  N N    . LYS A 1 43  ? -2.135  -2.613  6.951   1.00 0.00 ? 43  LYS A N    6  
ATOM   8054  C CA   . LYS A 1 43  ? -2.653  -2.626  8.310   1.00 0.00 ? 43  LYS A CA   6  
ATOM   8055  C C    . LYS A 1 43  ? -3.898  -1.740  8.384   1.00 0.00 ? 43  LYS A C    6  
ATOM   8056  O O    . LYS A 1 43  ? -4.926  -2.152  8.916   1.00 0.00 ? 43  LYS A O    6  
ATOM   8057  C CB   . LYS A 1 43  ? -1.558  -2.232  9.302   1.00 0.00 ? 43  LYS A CB   6  
ATOM   8058  C CG   . LYS A 1 43  ? -2.120  -2.118  10.722  1.00 0.00 ? 43  LYS A CG   6  
ATOM   8059  C CD   . LYS A 1 43  ? -1.845  -0.732  11.311  1.00 0.00 ? 43  LYS A CD   6  
ATOM   8060  C CE   . LYS A 1 43  ? -2.346  -0.641  12.754  1.00 0.00 ? 43  LYS A CE   6  
ATOM   8061  N NZ   . LYS A 1 43  ? -1.211  -0.470  13.686  1.00 0.00 ? 43  LYS A NZ   6  
ATOM   8062  H H    . LYS A 1 43  ? -1.309  -2.065  6.819   1.00 0.00 ? 43  LYS A H    6  
ATOM   8063  H HA   . LYS A 1 43  ? -2.942  -3.650  8.540   1.00 0.00 ? 43  LYS A HA   6  
ATOM   8064  H HB2  . LYS A 1 43  ? -0.759  -2.974  9.283   1.00 0.00 ? 43  LYS A HB2  6  
ATOM   8065  H HB3  . LYS A 1 43  ? -1.116  -1.282  9.005   1.00 0.00 ? 43  LYS A HB3  6  
ATOM   8066  H HG2  . LYS A 1 43  ? -3.193  -2.306  10.707  1.00 0.00 ? 43  LYS A HG2  6  
ATOM   8067  H HG3  . LYS A 1 43  ? -1.672  -2.882  11.358  1.00 0.00 ? 43  LYS A HG3  6  
ATOM   8068  H HD2  . LYS A 1 43  ? -0.777  -0.525  11.278  1.00 0.00 ? 43  LYS A HD2  6  
ATOM   8069  H HD3  . LYS A 1 43  ? -2.336  0.029   10.703  1.00 0.00 ? 43  LYS A HD3  6  
ATOM   8070  H HE2  . LYS A 1 43  ? -3.036  0.197   12.853  1.00 0.00 ? 43  LYS A HE2  6  
ATOM   8071  H HE3  . LYS A 1 43  ? -2.902  -1.543  13.009  1.00 0.00 ? 43  LYS A HE3  6  
ATOM   8072  H HZ1  . LYS A 1 43  ? -1.555  -0.399  14.623  1.00 0.00 ? 43  LYS A HZ1  6  
ATOM   8073  H HZ2  . LYS A 1 43  ? -0.597  -1.258  13.615  1.00 0.00 ? 43  LYS A HZ2  6  
ATOM   8074  H HZ3  . LYS A 1 43  ? -0.710  0.365   13.452  1.00 0.00 ? 43  LYS A HZ3  6  
ATOM   8075  N N    . SER A 1 44  ? -3.763  -0.538  7.842   1.00 0.00 ? 44  SER A N    6  
ATOM   8076  C CA   . SER A 1 44  ? -4.865  0.410   7.841   1.00 0.00 ? 44  SER A CA   6  
ATOM   8077  C C    . SER A 1 44  ? -4.329  1.833   7.672   1.00 0.00 ? 44  SER A C    6  
ATOM   8078  O O    . SER A 1 44  ? -3.121  2.040   7.588   1.00 0.00 ? 44  SER A O    6  
ATOM   8079  C CB   . SER A 1 44  ? -5.687  0.299   9.125   1.00 0.00 ? 44  SER A CB   6  
ATOM   8080  O OG   . SER A 1 44  ? -4.862  0.296   10.289  1.00 0.00 ? 44  SER A OG   6  
ATOM   8081  H H    . SER A 1 44  ? -2.923  -0.210  7.412   1.00 0.00 ? 44  SER A H    6  
ATOM   8082  H HA   . SER A 1 44  ? -5.484  0.130   6.989   1.00 0.00 ? 44  SER A HA   6  
ATOM   8083  H HB2  . SER A 1 44  ? -6.387  1.132   9.181   1.00 0.00 ? 44  SER A HB2  6  
ATOM   8084  H HB3  . SER A 1 44  ? -6.282  -0.614  9.100   1.00 0.00 ? 44  SER A HB3  6  
ATOM   8085  H HG   . SER A 1 44  ? -4.399  1.178   10.381  1.00 0.00 ? 44  SER A HG   6  
ATOM   8086  N N    . VAL A 1 45  ? -5.258  2.779   7.629   1.00 0.00 ? 45  VAL A N    6  
ATOM   8087  C CA   . VAL A 1 45  ? -4.896  4.176   7.471   1.00 0.00 ? 45  VAL A CA   6  
ATOM   8088  C C    . VAL A 1 45  ? -4.940  4.867   8.836   1.00 0.00 ? 45  VAL A C    6  
ATOM   8089  O O    . VAL A 1 45  ? -5.790  4.551   9.668   1.00 0.00 ? 45  VAL A O    6  
ATOM   8090  C CB   . VAL A 1 45  ? -5.807  4.839   6.437   1.00 0.00 ? 45  VAL A CB   6  
ATOM   8091  C CG1  . VAL A 1 45  ? -5.307  6.244   6.087   1.00 0.00 ? 45  VAL A CG1  6  
ATOM   8092  C CG2  . VAL A 1 45  ? -5.930  3.975   5.181   1.00 0.00 ? 45  VAL A CG2  6  
ATOM   8093  H H    . VAL A 1 45  ? -6.240  2.601   7.698   1.00 0.00 ? 45  VAL A H    6  
ATOM   8094  H HA   . VAL A 1 45  ? -3.873  4.210   7.094   1.00 0.00 ? 45  VAL A HA   6  
ATOM   8095  H HB   . VAL A 1 45  ? -6.798  4.937   6.877   1.00 0.00 ? 45  VAL A HB   6  
ATOM   8096  H HG11 . VAL A 1 45  ? -5.117  6.800   7.005   1.00 0.00 ? 45  VAL A HG11 6  
ATOM   8097  H HG12 . VAL A 1 45  ? -4.385  6.168   5.509   1.00 0.00 ? 45  VAL A HG12 6  
ATOM   8098  H HG13 . VAL A 1 45  ? -6.063  6.762   5.499   1.00 0.00 ? 45  VAL A HG13 6  
ATOM   8099  H HG21 . VAL A 1 45  ? -6.969  3.970   4.845   1.00 0.00 ? 45  VAL A HG21 6  
ATOM   8100  H HG22 . VAL A 1 45  ? -5.297  4.381   4.394   1.00 0.00 ? 45  VAL A HG22 6  
ATOM   8101  H HG23 . VAL A 1 45  ? -5.618  2.955   5.410   1.00 0.00 ? 45  VAL A HG23 6  
ATOM   8102  N N    . VAL A 1 46  ? -4.011  5.793   9.024   1.00 0.00 ? 46  VAL A N    6  
ATOM   8103  C CA   . VAL A 1 46  ? -3.934  6.532   10.274  1.00 0.00 ? 46  VAL A CA   6  
ATOM   8104  C C    . VAL A 1 46  ? -5.254  7.266   10.511  1.00 0.00 ? 46  VAL A C    6  
ATOM   8105  O O    . VAL A 1 46  ? -5.781  7.261   11.623  1.00 0.00 ? 46  VAL A O    6  
ATOM   8106  C CB   . VAL A 1 46  ? -2.725  7.467   10.255  1.00 0.00 ? 46  VAL A CB   6  
ATOM   8107  C CG1  . VAL A 1 46  ? -2.826  8.518   11.362  1.00 0.00 ? 46  VAL A CG1  6  
ATOM   8108  C CG2  . VAL A 1 46  ? -1.418  6.678   10.367  1.00 0.00 ? 46  VAL A CG2  6  
ATOM   8109  H H    . VAL A 1 46  ? -3.323  6.044   8.343   1.00 0.00 ? 46  VAL A H    6  
ATOM   8110  H HA   . VAL A 1 46  ? -3.787  5.806   11.075  1.00 0.00 ? 46  VAL A HA   6  
ATOM   8111  H HB   . VAL A 1 46  ? -2.719  7.990   9.298   1.00 0.00 ? 46  VAL A HB   6  
ATOM   8112  H HG11 . VAL A 1 46  ? -2.049  9.268   11.224  1.00 0.00 ? 46  VAL A HG11 6  
ATOM   8113  H HG12 . VAL A 1 46  ? -3.805  8.997   11.320  1.00 0.00 ? 46  VAL A HG12 6  
ATOM   8114  H HG13 . VAL A 1 46  ? -2.698  8.037   12.333  1.00 0.00 ? 46  VAL A HG13 6  
ATOM   8115  H HG21 . VAL A 1 46  ? -0.710  7.042   9.621   1.00 0.00 ? 46  VAL A HG21 6  
ATOM   8116  H HG22 . VAL A 1 46  ? -0.997  6.812   11.363  1.00 0.00 ? 46  VAL A HG22 6  
ATOM   8117  H HG23 . VAL A 1 46  ? -1.617  5.621   10.194  1.00 0.00 ? 46  VAL A HG23 6  
ATOM   8118  N N    . LYS A 1 47  ? -5.752  7.880   9.448   1.00 0.00 ? 47  LYS A N    6  
ATOM   8119  C CA   . LYS A 1 47  ? -7.002  8.617   9.526   1.00 0.00 ? 47  LYS A CA   6  
ATOM   8120  C C    . LYS A 1 47  ? -6.700  10.110  9.657   1.00 0.00 ? 47  LYS A C    6  
ATOM   8121  O O    . LYS A 1 47  ? -7.547  10.882  10.106  1.00 0.00 ? 47  LYS A O    6  
ATOM   8122  C CB   . LYS A 1 47  ? -7.880  8.066   10.653  1.00 0.00 ? 47  LYS A CB   6  
ATOM   8123  C CG   . LYS A 1 47  ? -9.354  8.392   10.407  1.00 0.00 ? 47  LYS A CG   6  
ATOM   8124  C CD   . LYS A 1 47  ? -10.023 7.302   9.563   1.00 0.00 ? 47  LYS A CD   6  
ATOM   8125  C CE   . LYS A 1 47  ? -11.422 7.733   9.121   1.00 0.00 ? 47  LYS A CE   6  
ATOM   8126  N NZ   . LYS A 1 47  ? -11.793 7.068   7.854   1.00 0.00 ? 47  LYS A NZ   6  
ATOM   8127  H H    . LYS A 1 47  ? -5.318  7.879   8.547   1.00 0.00 ? 47  LYS A H    6  
ATOM   8128  H HA   . LYS A 1 47  ? -7.537  8.453   8.592   1.00 0.00 ? 47  LYS A HA   6  
ATOM   8129  H HB2  . LYS A 1 47  ? -7.749  6.987   10.726  1.00 0.00 ? 47  LYS A HB2  6  
ATOM   8130  H HB3  . LYS A 1 47  ? -7.565  8.492   11.605  1.00 0.00 ? 47  LYS A HB3  6  
ATOM   8131  H HG2  . LYS A 1 47  ? -9.874  8.486   11.361  1.00 0.00 ? 47  LYS A HG2  6  
ATOM   8132  H HG3  . LYS A 1 47  ? -9.439  9.352   9.901   1.00 0.00 ? 47  LYS A HG3  6  
ATOM   8133  H HD2  . LYS A 1 47  ? -9.411  7.090   8.687   1.00 0.00 ? 47  LYS A HD2  6  
ATOM   8134  H HD3  . LYS A 1 47  ? -10.087 6.381   10.139  1.00 0.00 ? 47  LYS A HD3  6  
ATOM   8135  H HE2  . LYS A 1 47  ? -12.148 7.486   9.896   1.00 0.00 ? 47  LYS A HE2  6  
ATOM   8136  H HE3  . LYS A 1 47  ? -11.452 8.816   8.993   1.00 0.00 ? 47  LYS A HE3  6  
ATOM   8137  H HZ1  . LYS A 1 47  ? -11.130 7.306   7.143   1.00 0.00 ? 47  LYS A HZ1  6  
ATOM   8138  H HZ2  . LYS A 1 47  ? -11.798 6.076   7.988   1.00 0.00 ? 47  LYS A HZ2  6  
ATOM   8139  H HZ3  . LYS A 1 47  ? -12.705 7.370   7.572   1.00 0.00 ? 47  LYS A HZ3  6  
ATOM   8140  N N    . GLY A 1 48  ? -5.491  10.475  9.257   1.00 0.00 ? 48  GLY A N    6  
ATOM   8141  C CA   . GLY A 1 48  ? -5.066  11.862  9.324   1.00 0.00 ? 48  GLY A CA   6  
ATOM   8142  C C    . GLY A 1 48  ? -3.956  12.146  8.310   1.00 0.00 ? 48  GLY A C    6  
ATOM   8143  O O    . GLY A 1 48  ? -2.978  12.822  8.627   1.00 0.00 ? 48  GLY A O    6  
ATOM   8144  H H    . GLY A 1 48  ? -4.808  9.842   8.892   1.00 0.00 ? 48  GLY A H    6  
ATOM   8145  H HA2  . GLY A 1 48  ? -5.917  12.517  9.128   1.00 0.00 ? 48  GLY A HA2  6  
ATOM   8146  H HA3  . GLY A 1 48  ? -4.712  12.091  10.329  1.00 0.00 ? 48  GLY A HA3  6  
ATOM   8147  N N    . GLY A 1 49  ? -4.142  11.615  7.111   1.00 0.00 ? 49  GLY A N    6  
ATOM   8148  C CA   . GLY A 1 49  ? -3.167  11.802  6.050   1.00 0.00 ? 49  GLY A CA   6  
ATOM   8149  C C    . GLY A 1 49  ? -3.854  12.189  4.738   1.00 0.00 ? 49  GLY A C    6  
ATOM   8150  O O    . GLY A 1 49  ? -5.076  12.109  4.625   1.00 0.00 ? 49  GLY A O    6  
ATOM   8151  H H    . GLY A 1 49  ? -4.939  11.066  6.861   1.00 0.00 ? 49  GLY A H    6  
ATOM   8152  H HA2  . GLY A 1 49  ? -2.458  12.577  6.335   1.00 0.00 ? 49  GLY A HA2  6  
ATOM   8153  H HA3  . GLY A 1 49  ? -2.597  10.884  5.908   1.00 0.00 ? 49  GLY A HA3  6  
ATOM   8154  N N    . ALA A 1 50  ? -3.038  12.600  3.780   1.00 0.00 ? 50  ALA A N    6  
ATOM   8155  C CA   . ALA A 1 50  ? -3.550  13.001  2.480   1.00 0.00 ? 50  ALA A CA   6  
ATOM   8156  C C    . ALA A 1 50  ? -4.152  11.782  1.777   1.00 0.00 ? 50  ALA A C    6  
ATOM   8157  O O    . ALA A 1 50  ? -5.353  11.746  1.509   1.00 0.00 ? 50  ALA A O    6  
ATOM   8158  C CB   . ALA A 1 50  ? -2.429  13.649  1.666   1.00 0.00 ? 50  ALA A CB   6  
ATOM   8159  H H    . ALA A 1 50  ? -2.045  12.664  3.880   1.00 0.00 ? 50  ALA A H    6  
ATOM   8160  H HA   . ALA A 1 50  ? -4.335  13.739  2.646   1.00 0.00 ? 50  ALA A HA   6  
ATOM   8161  H HB1  . ALA A 1 50  ? -2.543  14.733  1.688   1.00 0.00 ? 50  ALA A HB1  6  
ATOM   8162  H HB2  . ALA A 1 50  ? -1.464  13.376  2.095   1.00 0.00 ? 50  ALA A HB2  6  
ATOM   8163  H HB3  . ALA A 1 50  ? -2.480  13.300  0.635   1.00 0.00 ? 50  ALA A HB3  6  
ATOM   8164  N N    . ALA A 1 51  ? -3.292  10.816  1.498   1.00 0.00 ? 51  ALA A N    6  
ATOM   8165  C CA   . ALA A 1 51  ? -3.723  9.598   0.833   1.00 0.00 ? 51  ALA A CA   6  
ATOM   8166  C C    . ALA A 1 51  ? -4.585  8.774   1.791   1.00 0.00 ? 51  ALA A C    6  
ATOM   8167  O O    . ALA A 1 51  ? -5.131  7.741   1.409   1.00 0.00 ? 51  ALA A O    6  
ATOM   8168  C CB   . ALA A 1 51  ? -2.498  8.825   0.338   1.00 0.00 ? 51  ALA A CB   6  
ATOM   8169  H H    . ALA A 1 51  ? -2.316  10.852  1.721   1.00 0.00 ? 51  ALA A H    6  
ATOM   8170  H HA   . ALA A 1 51  ? -4.326  9.888   -0.029  1.00 0.00 ? 51  ALA A HA   6  
ATOM   8171  H HB1  . ALA A 1 51  ? -2.465  7.849   0.823   1.00 0.00 ? 51  ALA A HB1  6  
ATOM   8172  H HB2  . ALA A 1 51  ? -2.563  8.692   -0.742  1.00 0.00 ? 51  ALA A HB2  6  
ATOM   8173  H HB3  . ALA A 1 51  ? -1.594  9.382   0.581   1.00 0.00 ? 51  ALA A HB3  6  
ATOM   8174  N N    . ASP A 1 52  ? -4.681  9.263   3.019   1.00 0.00 ? 52  ASP A N    6  
ATOM   8175  C CA   . ASP A 1 52  ? -5.467  8.586   4.036   1.00 0.00 ? 52  ASP A CA   6  
ATOM   8176  C C    . ASP A 1 52  ? -6.950  8.881   3.807   1.00 0.00 ? 52  ASP A C    6  
ATOM   8177  O O    . ASP A 1 52  ? -7.761  7.962   3.704   1.00 0.00 ? 52  ASP A O    6  
ATOM   8178  C CB   . ASP A 1 52  ? -5.096  9.077   5.436   1.00 0.00 ? 52  ASP A CB   6  
ATOM   8179  C CG   . ASP A 1 52  ? -6.279  9.280   6.385   1.00 0.00 ? 52  ASP A CG   6  
ATOM   8180  O OD1  . ASP A 1 52  ? -7.097  8.338   6.482   1.00 0.00 ? 52  ASP A OD1  6  
ATOM   8181  O OD2  . ASP A 1 52  ? -6.343  10.372  6.989   1.00 0.00 ? 52  ASP A OD2  6  
ATOM   8182  H H    . ASP A 1 52  ? -4.233  10.105  3.322   1.00 0.00 ? 52  ASP A H    6  
ATOM   8183  H HA   . ASP A 1 52  ? -5.230  7.528   3.922   1.00 0.00 ? 52  ASP A HA   6  
ATOM   8184  H HB2  . ASP A 1 52  ? -4.410  8.360   5.885   1.00 0.00 ? 52  ASP A HB2  6  
ATOM   8185  H HB3  . ASP A 1 52  ? -4.559  10.021  5.344   1.00 0.00 ? 52  ASP A HB3  6  
ATOM   8186  N N    . VAL A 1 53  ? -7.261  10.168  3.737   1.00 0.00 ? 53  VAL A N    6  
ATOM   8187  C CA   . VAL A 1 53  ? -8.633  10.595  3.525   1.00 0.00 ? 53  VAL A CA   6  
ATOM   8188  C C    . VAL A 1 53  ? -8.974  10.477  2.038   1.00 0.00 ? 53  VAL A C    6  
ATOM   8189  O O    . VAL A 1 53  ? -10.124 10.229  1.678   1.00 0.00 ? 53  VAL A O    6  
ATOM   8190  C CB   . VAL A 1 53  ? -8.830  12.010  4.073   1.00 0.00 ? 53  VAL A CB   6  
ATOM   8191  C CG1  . VAL A 1 53  ? -10.315 12.378  4.114   1.00 0.00 ? 53  VAL A CG1  6  
ATOM   8192  C CG2  . VAL A 1 53  ? -8.190  12.158  5.454   1.00 0.00 ? 53  VAL A CG2  6  
ATOM   8193  H H    . VAL A 1 53  ? -6.596  10.909  3.824   1.00 0.00 ? 53  VAL A H    6  
ATOM   8194  H HA   . VAL A 1 53  ? -9.279  9.922   4.086   1.00 0.00 ? 53  VAL A HA   6  
ATOM   8195  H HB   . VAL A 1 53  ? -8.331  12.704  3.397   1.00 0.00 ? 53  VAL A HB   6  
ATOM   8196  H HG11 . VAL A 1 53  ? -10.598 12.855  3.174   1.00 0.00 ? 53  VAL A HG11 6  
ATOM   8197  H HG12 . VAL A 1 53  ? -10.911 11.478  4.257   1.00 0.00 ? 53  VAL A HG12 6  
ATOM   8198  H HG13 . VAL A 1 53  ? -10.495 13.068  4.938   1.00 0.00 ? 53  VAL A HG13 6  
ATOM   8199  H HG21 . VAL A 1 53  ? -8.588  11.393  6.122   1.00 0.00 ? 53  VAL A HG21 6  
ATOM   8200  H HG22 . VAL A 1 53  ? -7.112  12.039  5.368   1.00 0.00 ? 53  VAL A HG22 6  
ATOM   8201  H HG23 . VAL A 1 53  ? -8.418  13.144  5.856   1.00 0.00 ? 53  VAL A HG23 6  
ATOM   8202  N N    . ASP A 1 54  ? -7.954  10.661  1.212   1.00 0.00 ? 54  ASP A N    6  
ATOM   8203  C CA   . ASP A 1 54  ? -8.131  10.577  -0.227  1.00 0.00 ? 54  ASP A CA   6  
ATOM   8204  C C    . ASP A 1 54  ? -8.133  9.108   -0.652  1.00 0.00 ? 54  ASP A C    6  
ATOM   8205  O O    . ASP A 1 54  ? -9.091  8.638   -1.265  1.00 0.00 ? 54  ASP A O    6  
ATOM   8206  C CB   . ASP A 1 54  ? -6.989  11.281  -0.964  1.00 0.00 ? 54  ASP A CB   6  
ATOM   8207  C CG   . ASP A 1 54  ? -7.312  11.713  -2.396  1.00 0.00 ? 54  ASP A CG   6  
ATOM   8208  O OD1  . ASP A 1 54  ? -8.145  12.635  -2.536  1.00 0.00 ? 54  ASP A OD1  6  
ATOM   8209  O OD2  . ASP A 1 54  ? -6.720  11.111  -3.318  1.00 0.00 ? 54  ASP A OD2  6  
ATOM   8210  H H    . ASP A 1 54  ? -7.022  10.861  1.512   1.00 0.00 ? 54  ASP A H    6  
ATOM   8211  H HA   . ASP A 1 54  ? -9.081  11.072  -0.429  1.00 0.00 ? 54  ASP A HA   6  
ATOM   8212  H HB2  . ASP A 1 54  ? -6.694  12.161  -0.393  1.00 0.00 ? 54  ASP A HB2  6  
ATOM   8213  H HB3  . ASP A 1 54  ? -6.126  10.613  -0.988  1.00 0.00 ? 54  ASP A HB3  6  
ATOM   8214  N N    . GLY A 1 55  ? -7.052  8.424   -0.312  1.00 0.00 ? 55  GLY A N    6  
ATOM   8215  C CA   . GLY A 1 55  ? -6.918  7.017   -0.650  1.00 0.00 ? 55  GLY A CA   6  
ATOM   8216  C C    . GLY A 1 55  ? -8.125  6.217   -0.157  1.00 0.00 ? 55  GLY A C    6  
ATOM   8217  O O    . GLY A 1 55  ? -8.831  5.595   -0.951  1.00 0.00 ? 55  GLY A O    6  
ATOM   8218  H H    . GLY A 1 55  ? -6.278  8.814   0.186   1.00 0.00 ? 55  GLY A H    6  
ATOM   8219  H HA2  . GLY A 1 55  ? -6.822  6.907   -1.731  1.00 0.00 ? 55  GLY A HA2  6  
ATOM   8220  H HA3  . GLY A 1 55  ? -6.006  6.618   -0.207  1.00 0.00 ? 55  GLY A HA3  6  
ATOM   8221  N N    . ARG A 1 56  ? -8.325  6.257   1.153   1.00 0.00 ? 56  ARG A N    6  
ATOM   8222  C CA   . ARG A 1 56  ? -9.436  5.544   1.762   1.00 0.00 ? 56  ARG A CA   6  
ATOM   8223  C C    . ARG A 1 56  ? -9.383  4.062   1.387   1.00 0.00 ? 56  ARG A C    6  
ATOM   8224  O O    . ARG A 1 56  ? -10.405 3.467   1.048   1.00 0.00 ? 56  ARG A O    6  
ATOM   8225  C CB   . ARG A 1 56  ? -10.778 6.129   1.317   1.00 0.00 ? 56  ARG A CB   6  
ATOM   8226  C CG   . ARG A 1 56  ? -11.928 5.548   2.139   1.00 0.00 ? 56  ARG A CG   6  
ATOM   8227  C CD   . ARG A 1 56  ? -12.519 6.603   3.079   1.00 0.00 ? 56  ARG A CD   6  
ATOM   8228  N NE   . ARG A 1 56  ? -13.602 6.007   3.893   1.00 0.00 ? 56  ARG A NE   6  
ATOM   8229  C CZ   . ARG A 1 56  ? -14.849 5.802   3.448   1.00 0.00 ? 56  ARG A CZ   6  
ATOM   8230  N NH1  . ARG A 1 56  ? -15.178 6.142   2.197   1.00 0.00 ? 56  ARG A NH1  6  
ATOM   8231  N NH2  . ARG A 1 56  ? -15.766 5.256   4.259   1.00 0.00 ? 56  ARG A NH2  6  
ATOM   8232  H H    . ARG A 1 56  ? -7.748  6.765   1.792   1.00 0.00 ? 56  ARG A H    6  
ATOM   8233  H HA   . ARG A 1 56  ? -9.300  5.683   2.835   1.00 0.00 ? 56  ARG A HA   6  
ATOM   8234  H HB2  . ARG A 1 56  ? -10.759 7.213   1.426   1.00 0.00 ? 56  ARG A HB2  6  
ATOM   8235  H HB3  . ARG A 1 56  ? -10.939 5.917   0.260   1.00 0.00 ? 56  ARG A HB3  6  
ATOM   8236  H HG2  . ARG A 1 56  ? -12.705 5.175   1.472   1.00 0.00 ? 56  ARG A HG2  6  
ATOM   8237  H HG3  . ARG A 1 56  ? -11.572 4.698   2.722   1.00 0.00 ? 56  ARG A HG3  6  
ATOM   8238  H HD2  . ARG A 1 56  ? -11.739 6.999   3.729   1.00 0.00 ? 56  ARG A HD2  6  
ATOM   8239  H HD3  . ARG A 1 56  ? -12.906 7.441   2.500   1.00 0.00 ? 56  ARG A HD3  6  
ATOM   8240  H HE   . ARG A 1 56  ? -13.388 5.742   4.834   1.00 0.00 ? 56  ARG A HE   6  
ATOM   8241  H HH11 . ARG A 1 56  ? -14.493 6.549   1.592   1.00 0.00 ? 56  ARG A HH11 6  
ATOM   8242  H HH12 . ARG A 1 56  ? -16.109 5.988   1.865   1.00 0.00 ? 56  ARG A HH12 6  
ATOM   8243  H HH21 . ARG A 1 56  ? -15.520 5.001   5.194   1.00 0.00 ? 56  ARG A HH21 6  
ATOM   8244  H HH22 . ARG A 1 56  ? -16.696 5.102   3.927   1.00 0.00 ? 56  ARG A HH22 6  
ATOM   8245  N N    . LEU A 1 57  ? -8.182  3.507   1.462   1.00 0.00 ? 57  LEU A N    6  
ATOM   8246  C CA   . LEU A 1 57  ? -7.984  2.106   1.134   1.00 0.00 ? 57  LEU A CA   6  
ATOM   8247  C C    . LEU A 1 57  ? -8.595  1.238   2.237   1.00 0.00 ? 57  LEU A C    6  
ATOM   8248  O O    . LEU A 1 57  ? -9.003  1.747   3.279   1.00 0.00 ? 57  LEU A O    6  
ATOM   8249  C CB   . LEU A 1 57  ? -6.503  1.820   0.878   1.00 0.00 ? 57  LEU A CB   6  
ATOM   8250  C CG   . LEU A 1 57  ? -5.842  2.645   -0.230  1.00 0.00 ? 57  LEU A CG   6  
ATOM   8251  C CD1  . LEU A 1 57  ? -4.370  2.908   0.087   1.00 0.00 ? 57  LEU A CD1  6  
ATOM   8252  C CD2  . LEU A 1 57  ? -6.024  1.976   -1.594  1.00 0.00 ? 57  LEU A CD2  6  
ATOM   8253  H H    . LEU A 1 57  ? -7.356  3.998   1.738   1.00 0.00 ? 57  LEU A H    6  
ATOM   8254  H HA   . LEU A 1 57  ? -8.515  1.909   0.205   1.00 0.00 ? 57  LEU A HA   6  
ATOM   8255  H HB2  . LEU A 1 57  ? -5.956  1.989   1.805   1.00 0.00 ? 57  LEU A HB2  6  
ATOM   8256  H HB3  . LEU A 1 57  ? -6.394  0.765   0.631   1.00 0.00 ? 57  LEU A HB3  6  
ATOM   8257  H HG   . LEU A 1 57  ? -6.341  3.614   -0.277  1.00 0.00 ? 57  LEU A HG   6  
ATOM   8258  H HD11 . LEU A 1 57  ? -4.161  2.620   1.117   1.00 0.00 ? 57  LEU A HD11 6  
ATOM   8259  H HD12 . LEU A 1 57  ? -3.742  2.323   -0.585  1.00 0.00 ? 57  LEU A HD12 6  
ATOM   8260  H HD13 . LEU A 1 57  ? -4.152  3.968   -0.044  1.00 0.00 ? 57  LEU A HD13 6  
ATOM   8261  H HD21 . LEU A 1 57  ? -5.101  1.474   -1.878  1.00 0.00 ? 57  LEU A HD21 6  
ATOM   8262  H HD22 . LEU A 1 57  ? -6.832  1.246   -1.536  1.00 0.00 ? 57  LEU A HD22 6  
ATOM   8263  H HD23 . LEU A 1 57  ? -6.272  2.732   -2.339  1.00 0.00 ? 57  LEU A HD23 6  
ATOM   8264  N N    . ALA A 1 58  ? -8.641  -0.059  1.966   1.00 0.00 ? 58  ALA A N    6  
ATOM   8265  C CA   . ALA A 1 58  ? -9.197  -1.003  2.921   1.00 0.00 ? 58  ALA A CA   6  
ATOM   8266  C C    . ALA A 1 58  ? -8.069  -1.567  3.787   1.00 0.00 ? 58  ALA A C    6  
ATOM   8267  O O    . ALA A 1 58  ? -6.935  -1.699  3.329   1.00 0.00 ? 58  ALA A O    6  
ATOM   8268  C CB   . ALA A 1 58  ? -9.960  -2.097  2.173   1.00 0.00 ? 58  ALA A CB   6  
ATOM   8269  H H    . ALA A 1 58  ? -8.308  -0.466  1.115   1.00 0.00 ? 58  ALA A H    6  
ATOM   8270  H HA   . ALA A 1 58  ? -9.895  -0.458  3.557   1.00 0.00 ? 58  ALA A HA   6  
ATOM   8271  H HB1  . ALA A 1 58  ? -9.296  -2.579  1.455   1.00 0.00 ? 58  ALA A HB1  6  
ATOM   8272  H HB2  . ALA A 1 58  ? -10.325 -2.837  2.885   1.00 0.00 ? 58  ALA A HB2  6  
ATOM   8273  H HB3  . ALA A 1 58  ? -10.806 -1.654  1.645   1.00 0.00 ? 58  ALA A HB3  6  
ATOM   8274  N N    . ALA A 1 59  ? -8.420  -1.886  5.025   1.00 0.00 ? 59  ALA A N    6  
ATOM   8275  C CA   . ALA A 1 59  ? -7.452  -2.435  5.960   1.00 0.00 ? 59  ALA A CA   6  
ATOM   8276  C C    . ALA A 1 59  ? -7.460  -3.961  5.860   1.00 0.00 ? 59  ALA A C    6  
ATOM   8277  O O    . ALA A 1 59  ? -8.479  -4.599  6.124   1.00 0.00 ? 59  ALA A O    6  
ATOM   8278  C CB   . ALA A 1 59  ? -7.770  -1.940  7.372   1.00 0.00 ? 59  ALA A CB   6  
ATOM   8279  H H    . ALA A 1 59  ? -9.344  -1.776  5.390   1.00 0.00 ? 59  ALA A H    6  
ATOM   8280  H HA   . ALA A 1 59  ? -6.468  -2.065  5.672   1.00 0.00 ? 59  ALA A HA   6  
ATOM   8281  H HB1  . ALA A 1 59  ? -8.672  -2.435  7.736   1.00 0.00 ? 59  ALA A HB1  6  
ATOM   8282  H HB2  . ALA A 1 59  ? -6.937  -2.172  8.035   1.00 0.00 ? 59  ALA A HB2  6  
ATOM   8283  H HB3  . ALA A 1 59  ? -7.930  -0.862  7.353   1.00 0.00 ? 59  ALA A HB3  6  
ATOM   8284  N N    . GLY A 1 60  ? -6.314  -4.504  5.479   1.00 0.00 ? 60  GLY A N    6  
ATOM   8285  C CA   . GLY A 1 60  ? -6.176  -5.944  5.340   1.00 0.00 ? 60  GLY A CA   6  
ATOM   8286  C C    . GLY A 1 60  ? -5.832  -6.325  3.900   1.00 0.00 ? 60  GLY A C    6  
ATOM   8287  O O    . GLY A 1 60  ? -6.006  -7.476  3.500   1.00 0.00 ? 60  GLY A O    6  
ATOM   8288  H H    . GLY A 1 60  ? -5.490  -3.978  5.266   1.00 0.00 ? 60  GLY A H    6  
ATOM   8289  H HA2  . GLY A 1 60  ? -5.397  -6.304  6.013   1.00 0.00 ? 60  GLY A HA2  6  
ATOM   8290  H HA3  . GLY A 1 60  ? -7.104  -6.432  5.637   1.00 0.00 ? 60  GLY A HA3  6  
ATOM   8291  N N    . ASP A 1 61  ? -5.349  -5.339  3.158   1.00 0.00 ? 61  ASP A N    6  
ATOM   8292  C CA   . ASP A 1 61  ? -4.978  -5.558  1.771   1.00 0.00 ? 61  ASP A CA   6  
ATOM   8293  C C    . ASP A 1 61  ? -3.660  -6.333  1.716   1.00 0.00 ? 61  ASP A C    6  
ATOM   8294  O O    . ASP A 1 61  ? -3.003  -6.522  2.738   1.00 0.00 ? 61  ASP A O    6  
ATOM   8295  C CB   . ASP A 1 61  ? -4.776  -4.229  1.038   1.00 0.00 ? 61  ASP A CB   6  
ATOM   8296  C CG   . ASP A 1 61  ? -5.953  -3.257  1.129   1.00 0.00 ? 61  ASP A CG   6  
ATOM   8297  O OD1  . ASP A 1 61  ? -7.088  -3.753  1.297   1.00 0.00 ? 61  ASP A OD1  6  
ATOM   8298  O OD2  . ASP A 1 61  ? -5.691  -2.038  1.027   1.00 0.00 ? 61  ASP A OD2  6  
ATOM   8299  H H    . ASP A 1 61  ? -5.210  -4.407  3.492   1.00 0.00 ? 61  ASP A H    6  
ATOM   8300  H HA   . ASP A 1 61  ? -5.808  -6.115  1.337   1.00 0.00 ? 61  ASP A HA   6  
ATOM   8301  H HB2  . ASP A 1 61  ? -3.888  -3.741  1.442   1.00 0.00 ? 61  ASP A HB2  6  
ATOM   8302  H HB3  . ASP A 1 61  ? -4.576  -4.439  -0.012  1.00 0.00 ? 61  ASP A HB3  6  
ATOM   8303  N N    . GLN A 1 62  ? -3.313  -6.763  0.511   1.00 0.00 ? 62  GLN A N    6  
ATOM   8304  C CA   . GLN A 1 62  ? -2.086  -7.514  0.308   1.00 0.00 ? 62  GLN A CA   6  
ATOM   8305  C C    . GLN A 1 62  ? -1.191  -6.803  -0.709  1.00 0.00 ? 62  GLN A C    6  
ATOM   8306  O O    . GLN A 1 62  ? -1.489  -6.790  -1.901  1.00 0.00 ? 62  GLN A O    6  
ATOM   8307  C CB   . GLN A 1 62  ? -2.386  -8.947  -0.131  1.00 0.00 ? 62  GLN A CB   6  
ATOM   8308  C CG   . GLN A 1 62  ? -1.123  -9.637  -0.650  1.00 0.00 ? 62  GLN A CG   6  
ATOM   8309  C CD   . GLN A 1 62  ? -1.315  -11.154 -0.717  1.00 0.00 ? 62  GLN A CD   6  
ATOM   8310  O OE1  . GLN A 1 62  ? -2.415  -11.672 -0.612  1.00 0.00 ? 62  GLN A OE1  6  
ATOM   8311  N NE2  . GLN A 1 62  ? -0.186  -11.833 -0.896  1.00 0.00 ? 62  GLN A NE2  6  
ATOM   8312  H H    . GLN A 1 62  ? -3.853  -6.605  -0.316  1.00 0.00 ? 62  GLN A H    6  
ATOM   8313  H HA   . GLN A 1 62  ? -1.596  -7.535  1.282   1.00 0.00 ? 62  GLN A HA   6  
ATOM   8314  H HB2  . GLN A 1 62  ? -2.795  -9.511  0.706   1.00 0.00 ? 62  GLN A HB2  6  
ATOM   8315  H HB3  . GLN A 1 62  ? -3.146  -8.940  -0.913  1.00 0.00 ? 62  GLN A HB3  6  
ATOM   8316  H HG2  . GLN A 1 62  ? -0.876  -9.255  -1.641  1.00 0.00 ? 62  GLN A HG2  6  
ATOM   8317  H HG3  . GLN A 1 62  ? -0.282  -9.401  0.002   1.00 0.00 ? 62  GLN A HG3  6  
ATOM   8318  H HE21 . GLN A 1 62  ? 0.684   -11.349 -0.974  1.00 0.00 ? 62  GLN A HE21 6  
ATOM   8319  H HE22 . GLN A 1 62  ? -0.209  -12.832 -0.953  1.00 0.00 ? 62  GLN A HE22 6  
ATOM   8320  N N    . LEU A 1 63  ? -0.110  -6.229  -0.199  1.00 0.00 ? 63  LEU A N    6  
ATOM   8321  C CA   . LEU A 1 63  ? 0.831   -5.519  -1.049  1.00 0.00 ? 63  LEU A CA   6  
ATOM   8322  C C    . LEU A 1 63  ? 1.845   -6.510  -1.620  1.00 0.00 ? 63  LEU A C    6  
ATOM   8323  O O    . LEU A 1 63  ? 2.105   -7.553  -1.021  1.00 0.00 ? 63  LEU A O    6  
ATOM   8324  C CB   . LEU A 1 63  ? 1.470   -4.358  -0.284  1.00 0.00 ? 63  LEU A CB   6  
ATOM   8325  C CG   . LEU A 1 63  ? 2.576   -3.599  -1.020  1.00 0.00 ? 63  LEU A CG   6  
ATOM   8326  C CD1  . LEU A 1 63  ? 2.032   -2.319  -1.660  1.00 0.00 ? 63  LEU A CD1  6  
ATOM   8327  C CD2  . LEU A 1 63  ? 3.760   -3.316  -0.092  1.00 0.00 ? 63  LEU A CD2  6  
ATOM   8328  H H    . LEU A 1 63  ? 0.126   -6.245  0.773   1.00 0.00 ? 63  LEU A H    6  
ATOM   8329  H HA   . LEU A 1 63  ? 0.265   -5.088  -1.874  1.00 0.00 ? 63  LEU A HA   6  
ATOM   8330  H HB2  . LEU A 1 63  ? 0.687   -3.648  -0.017  1.00 0.00 ? 63  LEU A HB2  6  
ATOM   8331  H HB3  . LEU A 1 63  ? 1.881   -4.745  0.648   1.00 0.00 ? 63  LEU A HB3  6  
ATOM   8332  H HG   . LEU A 1 63  ? 2.945   -4.230  -1.829  1.00 0.00 ? 63  LEU A HG   6  
ATOM   8333  H HD11 . LEU A 1 63  ? 2.820   -1.566  -1.692  1.00 0.00 ? 63  LEU A HD11 6  
ATOM   8334  H HD12 . LEU A 1 63  ? 1.695   -2.535  -2.675  1.00 0.00 ? 63  LEU A HD12 6  
ATOM   8335  H HD13 . LEU A 1 63  ? 1.195   -1.946  -1.070  1.00 0.00 ? 63  LEU A HD13 6  
ATOM   8336  H HD21 . LEU A 1 63  ? 4.062   -2.274  -0.193  1.00 0.00 ? 63  LEU A HD21 6  
ATOM   8337  H HD22 . LEU A 1 63  ? 3.465   -3.511  0.939   1.00 0.00 ? 63  LEU A HD22 6  
ATOM   8338  H HD23 . LEU A 1 63  ? 4.594   -3.965  -0.360  1.00 0.00 ? 63  LEU A HD23 6  
ATOM   8339  N N    . LEU A 1 64  ? 2.389   -6.152  -2.774  1.00 0.00 ? 64  LEU A N    6  
ATOM   8340  C CA   . LEU A 1 64  ? 3.370   -6.998  -3.433  1.00 0.00 ? 64  LEU A CA   6  
ATOM   8341  C C    . LEU A 1 64  ? 4.415   -6.118  -4.124  1.00 0.00 ? 64  LEU A C    6  
ATOM   8342  O O    . LEU A 1 64  ? 5.604   -6.429  -4.102  1.00 0.00 ? 64  LEU A O    6  
ATOM   8343  C CB   . LEU A 1 64  ? 2.677   -7.985  -4.375  1.00 0.00 ? 64  LEU A CB   6  
ATOM   8344  C CG   . LEU A 1 64  ? 1.960   -9.159  -3.707  1.00 0.00 ? 64  LEU A CG   6  
ATOM   8345  C CD1  . LEU A 1 64  ? 0.541   -9.320  -4.258  1.00 0.00 ? 64  LEU A CD1  6  
ATOM   8346  C CD2  . LEU A 1 64  ? 2.775   -10.448 -3.841  1.00 0.00 ? 64  LEU A CD2  6  
ATOM   8347  H H    . LEU A 1 64  ? 2.172   -5.303  -3.255  1.00 0.00 ? 64  LEU A H    6  
ATOM   8348  H HA   . LEU A 1 64  ? 3.868   -7.583  -2.662  1.00 0.00 ? 64  LEU A HA   6  
ATOM   8349  H HB2  . LEU A 1 64  ? 1.951   -7.436  -4.976  1.00 0.00 ? 64  LEU A HB2  6  
ATOM   8350  H HB3  . LEU A 1 64  ? 3.423   -8.385  -5.063  1.00 0.00 ? 64  LEU A HB3  6  
ATOM   8351  H HG   . LEU A 1 64  ? 1.869   -8.944  -2.643  1.00 0.00 ? 64  LEU A HG   6  
ATOM   8352  H HD11 . LEU A 1 64  ? 0.521   -9.015  -5.303  1.00 0.00 ? 64  LEU A HD11 6  
ATOM   8353  H HD12 . LEU A 1 64  ? 0.235   -10.362 -4.175  1.00 0.00 ? 64  LEU A HD12 6  
ATOM   8354  H HD13 . LEU A 1 64  ? -0.144  -8.692  -3.684  1.00 0.00 ? 64  LEU A HD13 6  
ATOM   8355  H HD21 . LEU A 1 64  ? 3.828   -10.199 -3.965  1.00 0.00 ? 64  LEU A HD21 6  
ATOM   8356  H HD22 . LEU A 1 64  ? 2.647   -11.052 -2.942  1.00 0.00 ? 64  LEU A HD22 6  
ATOM   8357  H HD23 . LEU A 1 64  ? 2.428   -11.009 -4.708  1.00 0.00 ? 64  LEU A HD23 6  
ATOM   8358  N N    . SER A 1 65  ? 3.932   -5.038  -4.719  1.00 0.00 ? 65  SER A N    6  
ATOM   8359  C CA   . SER A 1 65  ? 4.808   -4.112  -5.414  1.00 0.00 ? 65  SER A CA   6  
ATOM   8360  C C    . SER A 1 65  ? 4.748   -2.736  -4.749  1.00 0.00 ? 65  SER A C    6  
ATOM   8361  O O    . SER A 1 65  ? 3.850   -2.464  -3.954  1.00 0.00 ? 65  SER A O    6  
ATOM   8362  C CB   . SER A 1 65  ? 4.433   -4.002  -6.893  1.00 0.00 ? 65  SER A CB   6  
ATOM   8363  O OG   . SER A 1 65  ? 4.158   -2.657  -7.277  1.00 0.00 ? 65  SER A OG   6  
ATOM   8364  H H    . SER A 1 65  ? 2.962   -4.792  -4.731  1.00 0.00 ? 65  SER A H    6  
ATOM   8365  H HA   . SER A 1 65  ? 5.808   -4.537  -5.324  1.00 0.00 ? 65  SER A HA   6  
ATOM   8366  H HB2  . SER A 1 65  ? 5.248   -4.393  -7.503  1.00 0.00 ? 65  SER A HB2  6  
ATOM   8367  H HB3  . SER A 1 65  ? 3.559   -4.622  -7.092  1.00 0.00 ? 65  SER A HB3  6  
ATOM   8368  H HG   . SER A 1 65  ? 4.986   -2.104  -7.200  1.00 0.00 ? 65  SER A HG   6  
ATOM   8369  N N    . VAL A 1 66  ? 5.717   -1.901  -5.099  1.00 0.00 ? 66  VAL A N    6  
ATOM   8370  C CA   . VAL A 1 66  ? 5.785   -0.560  -4.545  1.00 0.00 ? 66  VAL A CA   6  
ATOM   8371  C C    . VAL A 1 66  ? 5.936   0.451   -5.685  1.00 0.00 ? 66  VAL A C    6  
ATOM   8372  O O    . VAL A 1 66  ? 6.229   0.073   -6.818  1.00 0.00 ? 66  VAL A O    6  
ATOM   8373  C CB   . VAL A 1 66  ? 6.916   -0.474  -3.518  1.00 0.00 ? 66  VAL A CB   6  
ATOM   8374  C CG1  . VAL A 1 66  ? 8.282   -0.569  -4.198  1.00 0.00 ? 66  VAL A CG1  6  
ATOM   8375  C CG2  . VAL A 1 66  ? 6.806   0.805   -2.685  1.00 0.00 ? 66  VAL A CG2  6  
ATOM   8376  H H    . VAL A 1 66  ? 6.444   -2.129  -5.747  1.00 0.00 ? 66  VAL A H    6  
ATOM   8377  H HA   . VAL A 1 66  ? 4.844   -0.367  -4.029  1.00 0.00 ? 66  VAL A HA   6  
ATOM   8378  H HB   . VAL A 1 66  ? 6.817   -1.323  -2.842  1.00 0.00 ? 66  VAL A HB   6  
ATOM   8379  H HG11 . VAL A 1 66  ? 8.995   0.070   -3.675  1.00 0.00 ? 66  VAL A HG11 6  
ATOM   8380  H HG12 . VAL A 1 66  ? 8.633   -1.601  -4.169  1.00 0.00 ? 66  VAL A HG12 6  
ATOM   8381  H HG13 . VAL A 1 66  ? 8.196   -0.244  -5.236  1.00 0.00 ? 66  VAL A HG13 6  
ATOM   8382  H HG21 . VAL A 1 66  ? 7.257   1.633   -3.231  1.00 0.00 ? 66  VAL A HG21 6  
ATOM   8383  H HG22 . VAL A 1 66  ? 5.754   1.025   -2.495  1.00 0.00 ? 66  VAL A HG22 6  
ATOM   8384  H HG23 . VAL A 1 66  ? 7.327   0.667   -1.737  1.00 0.00 ? 66  VAL A HG23 6  
ATOM   8385  N N    . ASP A 1 67  ? 5.728   1.715   -5.345  1.00 0.00 ? 67  ASP A N    6  
ATOM   8386  C CA   . ASP A 1 67  ? 5.839   2.781   -6.324  1.00 0.00 ? 67  ASP A CA   6  
ATOM   8387  C C    . ASP A 1 67  ? 7.308   2.977   -6.697  1.00 0.00 ? 67  ASP A C    6  
ATOM   8388  O O    . ASP A 1 67  ? 8.161   3.116   -5.820  1.00 0.00 ? 67  ASP A O    6  
ATOM   8389  C CB   . ASP A 1 67  ? 5.311   4.102   -5.761  1.00 0.00 ? 67  ASP A CB   6  
ATOM   8390  C CG   . ASP A 1 67  ? 6.315   4.889   -4.915  1.00 0.00 ? 67  ASP A CG   6  
ATOM   8391  O OD1  . ASP A 1 67  ? 6.535   4.471   -3.758  1.00 0.00 ? 67  ASP A OD1  6  
ATOM   8392  O OD2  . ASP A 1 67  ? 6.840   5.892   -5.445  1.00 0.00 ? 67  ASP A OD2  6  
ATOM   8393  H H    . ASP A 1 67  ? 5.491   2.013   -4.420  1.00 0.00 ? 67  ASP A H    6  
ATOM   8394  H HA   . ASP A 1 67  ? 5.234   2.456   -7.169  1.00 0.00 ? 67  ASP A HA   6  
ATOM   8395  H HB2  . ASP A 1 67  ? 4.987   4.730   -6.590  1.00 0.00 ? 67  ASP A HB2  6  
ATOM   8396  H HB3  . ASP A 1 67  ? 4.432   3.897   -5.154  1.00 0.00 ? 67  ASP A HB3  6  
ATOM   8397  N N    . GLY A 1 68  ? 7.560   2.982   -7.997  1.00 0.00 ? 68  GLY A N    6  
ATOM   8398  C CA   . GLY A 1 68  ? 8.914   3.159   -8.496  1.00 0.00 ? 68  GLY A CA   6  
ATOM   8399  C C    . GLY A 1 68  ? 9.657   1.823   -8.552  1.00 0.00 ? 68  GLY A C    6  
ATOM   8400  O O    . GLY A 1 68  ? 10.727  1.729   -9.152  1.00 0.00 ? 68  GLY A O    6  
ATOM   8401  H H    . GLY A 1 68  ? 6.863   2.870   -8.703  1.00 0.00 ? 68  GLY A H    6  
ATOM   8402  H HA2  . GLY A 1 68  ? 8.884   3.605   -9.491  1.00 0.00 ? 68  GLY A HA2  6  
ATOM   8403  H HA3  . GLY A 1 68  ? 9.455   3.854   -7.853  1.00 0.00 ? 68  GLY A HA3  6  
ATOM   8404  N N    . ARG A 1 69  ? 9.060   0.824   -7.918  1.00 0.00 ? 69  ARG A N    6  
ATOM   8405  C CA   . ARG A 1 69  ? 9.653   -0.502  -7.888  1.00 0.00 ? 69  ARG A CA   6  
ATOM   8406  C C    . ARG A 1 69  ? 8.560   -1.570  -7.819  1.00 0.00 ? 69  ARG A C    6  
ATOM   8407  O O    . ARG A 1 69  ? 7.846   -1.669  -6.822  1.00 0.00 ? 69  ARG A O    6  
ATOM   8408  C CB   . ARG A 1 69  ? 10.588  -0.660  -6.687  1.00 0.00 ? 69  ARG A CB   6  
ATOM   8409  C CG   . ARG A 1 69  ? 11.451  0.588   -6.495  1.00 0.00 ? 69  ARG A CG   6  
ATOM   8410  C CD   . ARG A 1 69  ? 12.575  0.330   -5.492  1.00 0.00 ? 69  ARG A CD   6  
ATOM   8411  N NE   . ARG A 1 69  ? 13.807  -0.082  -6.203  1.00 0.00 ? 69  ARG A NE   6  
ATOM   8412  C CZ   . ARG A 1 69  ? 15.025  -0.102  -5.648  1.00 0.00 ? 69  ARG A CZ   6  
ATOM   8413  N NH1  . ARG A 1 69  ? 15.184  0.268   -4.369  1.00 0.00 ? 69  ARG A NH1  6  
ATOM   8414  N NH2  . ARG A 1 69  ? 16.085  -0.489  -6.370  1.00 0.00 ? 69  ARG A NH2  6  
ATOM   8415  H H    . ARG A 1 69  ? 8.191   0.910   -7.432  1.00 0.00 ? 69  ARG A H    6  
ATOM   8416  H HA   . ARG A 1 69  ? 10.217  -0.577  -8.817  1.00 0.00 ? 69  ARG A HA   6  
ATOM   8417  H HB2  . ARG A 1 69  ? 10.001  -0.844  -5.787  1.00 0.00 ? 69  ARG A HB2  6  
ATOM   8418  H HB3  . ARG A 1 69  ? 11.228  -1.531  -6.831  1.00 0.00 ? 69  ARG A HB3  6  
ATOM   8419  H HG2  . ARG A 1 69  ? 11.876  0.891   -7.451  1.00 0.00 ? 69  ARG A HG2  6  
ATOM   8420  H HG3  . ARG A 1 69  ? 10.830  1.414   -6.146  1.00 0.00 ? 69  ARG A HG3  6  
ATOM   8421  H HD2  . ARG A 1 69  ? 12.768  1.229   -4.906  1.00 0.00 ? 69  ARG A HD2  6  
ATOM   8422  H HD3  . ARG A 1 69  ? 12.276  -0.450  -4.790  1.00 0.00 ? 69  ARG A HD3  6  
ATOM   8423  H HE   . ARG A 1 69  ? 13.722  -0.365  -7.160  1.00 0.00 ? 69  ARG A HE   6  
ATOM   8424  H HH11 . ARG A 1 69  ? 14.394  0.557   -3.830  1.00 0.00 ? 69  ARG A HH11 6  
ATOM   8425  H HH12 . ARG A 1 69  ? 16.095  0.254   -3.955  1.00 0.00 ? 69  ARG A HH12 6  
ATOM   8426  H HH21 . ARG A 1 69  ? 15.966  -0.764  -7.325  1.00 0.00 ? 69  ARG A HH21 6  
ATOM   8427  H HH22 . ARG A 1 69  ? 16.994  -0.502  -5.956  1.00 0.00 ? 69  ARG A HH22 6  
ATOM   8428  N N    . SER A 1 70  ? 8.462   -2.342  -8.891  1.00 0.00 ? 70  SER A N    6  
ATOM   8429  C CA   . SER A 1 70  ? 7.467   -3.399  -8.964  1.00 0.00 ? 70  SER A CA   6  
ATOM   8430  C C    . SER A 1 70  ? 7.973   -4.645  -8.234  1.00 0.00 ? 70  SER A C    6  
ATOM   8431  O O    . SER A 1 70  ? 8.422   -5.599  -8.868  1.00 0.00 ? 70  SER A O    6  
ATOM   8432  C CB   . SER A 1 70  ? 7.128   -3.734  -10.417 1.00 0.00 ? 70  SER A CB   6  
ATOM   8433  O OG   . SER A 1 70  ? 6.286   -2.749  -11.011 1.00 0.00 ? 70  SER A OG   6  
ATOM   8434  H H    . SER A 1 70  ? 9.046   -2.255  -9.698  1.00 0.00 ? 70  SER A H    6  
ATOM   8435  H HA   . SER A 1 70  ? 6.583   -2.998  -8.468  1.00 0.00 ? 70  SER A HA   6  
ATOM   8436  H HB2  . SER A 1 70  ? 8.048   -3.820  -10.995 1.00 0.00 ? 70  SER A HB2  6  
ATOM   8437  H HB3  . SER A 1 70  ? 6.635   -4.706  -10.458 1.00 0.00 ? 70  SER A HB3  6  
ATOM   8438  H HG   . SER A 1 70  ? 6.055   -3.017  -11.946 1.00 0.00 ? 70  SER A HG   6  
ATOM   8439  N N    . LEU A 1 71  ? 7.885   -4.595  -6.915  1.00 0.00 ? 71  LEU A N    6  
ATOM   8440  C CA   . LEU A 1 71  ? 8.328   -5.709  -6.093  1.00 0.00 ? 71  LEU A CA   6  
ATOM   8441  C C    . LEU A 1 71  ? 7.667   -6.998  -6.588  1.00 0.00 ? 71  LEU A C    6  
ATOM   8442  O O    . LEU A 1 71  ? 8.355   -7.952  -6.950  1.00 0.00 ? 71  LEU A O    6  
ATOM   8443  C CB   . LEU A 1 71  ? 8.072   -5.418  -4.612  1.00 0.00 ? 71  LEU A CB   6  
ATOM   8444  C CG   . LEU A 1 71  ? 8.595   -4.078  -4.094  1.00 0.00 ? 71  LEU A CG   6  
ATOM   8445  C CD1  . LEU A 1 71  ? 7.683   -3.517  -3.001  1.00 0.00 ? 71  LEU A CD1  6  
ATOM   8446  C CD2  . LEU A 1 71  ? 10.046  -4.202  -3.619  1.00 0.00 ? 71  LEU A CD2  6  
ATOM   8447  H H    . LEU A 1 71  ? 7.517   -3.817  -6.408  1.00 0.00 ? 71  LEU A H    6  
ATOM   8448  H HA   . LEU A 1 71  ? 9.406   -5.802  -6.222  1.00 0.00 ? 71  LEU A HA   6  
ATOM   8449  H HB2  . LEU A 1 71  ? 6.998   -5.459  -4.434  1.00 0.00 ? 71  LEU A HB2  6  
ATOM   8450  H HB3  . LEU A 1 71  ? 8.524   -6.216  -4.022  1.00 0.00 ? 71  LEU A HB3  6  
ATOM   8451  H HG   . LEU A 1 71  ? 8.587   -3.364  -4.917  1.00 0.00 ? 71  LEU A HG   6  
ATOM   8452  H HD11 . LEU A 1 71  ? 6.756   -3.158  -3.451  1.00 0.00 ? 71  LEU A HD11 6  
ATOM   8453  H HD12 . LEU A 1 71  ? 7.456   -4.303  -2.279  1.00 0.00 ? 71  LEU A HD12 6  
ATOM   8454  H HD13 . LEU A 1 71  ? 8.184   -2.693  -2.495  1.00 0.00 ? 71  LEU A HD13 6  
ATOM   8455  H HD21 . LEU A 1 71  ? 10.547  -4.985  -4.188  1.00 0.00 ? 71  LEU A HD21 6  
ATOM   8456  H HD22 . LEU A 1 71  ? 10.560  -3.255  -3.772  1.00 0.00 ? 71  LEU A HD22 6  
ATOM   8457  H HD23 . LEU A 1 71  ? 10.061  -4.456  -2.559  1.00 0.00 ? 71  LEU A HD23 6  
ATOM   8458  N N    . VAL A 1 72  ? 6.343   -6.983  -6.588  1.00 0.00 ? 72  VAL A N    6  
ATOM   8459  C CA   . VAL A 1 72  ? 5.583   -8.140  -7.033  1.00 0.00 ? 72  VAL A CA   6  
ATOM   8460  C C    . VAL A 1 72  ? 5.434   -9.125  -5.872  1.00 0.00 ? 72  VAL A C    6  
ATOM   8461  O O    . VAL A 1 72  ? 4.681   -10.094 -5.967  1.00 0.00 ? 72  VAL A O    6  
ATOM   8462  C CB   . VAL A 1 72  ? 6.247   -8.761  -8.263  1.00 0.00 ? 72  VAL A CB   6  
ATOM   8463  C CG1  . VAL A 1 72  ? 5.289   -9.715  -8.981  1.00 0.00 ? 72  VAL A CG1  6  
ATOM   8464  C CG2  . VAL A 1 72  ? 6.758   -7.678  -9.215  1.00 0.00 ? 72  VAL A CG2  6  
ATOM   8465  H H    . VAL A 1 72  ? 5.791   -6.204  -6.292  1.00 0.00 ? 72  VAL A H    6  
ATOM   8466  H HA   . VAL A 1 72  ? 4.592   -7.790  -7.324  1.00 0.00 ? 72  VAL A HA   6  
ATOM   8467  H HB   . VAL A 1 72  ? 7.106   -9.342  -7.924  1.00 0.00 ? 72  VAL A HB   6  
ATOM   8468  H HG11 . VAL A 1 72  ? 4.486   -9.143  -9.446  1.00 0.00 ? 72  VAL A HG11 6  
ATOM   8469  H HG12 . VAL A 1 72  ? 5.833   -10.267 -9.747  1.00 0.00 ? 72  VAL A HG12 6  
ATOM   8470  H HG13 . VAL A 1 72  ? 4.867   -10.415 -8.261  1.00 0.00 ? 72  VAL A HG13 6  
ATOM   8471  H HG21 . VAL A 1 72  ? 6.359   -7.855  -10.214 1.00 0.00 ? 72  VAL A HG21 6  
ATOM   8472  H HG22 . VAL A 1 72  ? 6.432   -6.699  -8.862  1.00 0.00 ? 72  VAL A HG22 6  
ATOM   8473  H HG23 . VAL A 1 72  ? 7.847   -7.708  -9.249  1.00 0.00 ? 72  VAL A HG23 6  
ATOM   8474  N N    . GLY A 1 73  ? 6.165   -8.845  -4.803  1.00 0.00 ? 73  GLY A N    6  
ATOM   8475  C CA   . GLY A 1 73  ? 6.124   -9.695  -3.626  1.00 0.00 ? 73  GLY A CA   6  
ATOM   8476  C C    . GLY A 1 73  ? 7.460   -9.665  -2.880  1.00 0.00 ? 73  GLY A C    6  
ATOM   8477  O O    . GLY A 1 73  ? 7.986   -10.708 -2.500  1.00 0.00 ? 73  GLY A O    6  
ATOM   8478  H H    . GLY A 1 73  ? 6.774   -8.056  -4.733  1.00 0.00 ? 73  GLY A H    6  
ATOM   8479  H HA2  . GLY A 1 73  ? 5.326   -9.364  -2.961  1.00 0.00 ? 73  GLY A HA2  6  
ATOM   8480  H HA3  . GLY A 1 73  ? 5.890   -10.719 -3.919  1.00 0.00 ? 73  GLY A HA3  6  
ATOM   8481  N N    . LEU A 1 74  ? 7.971   -8.454  -2.696  1.00 0.00 ? 74  LEU A N    6  
ATOM   8482  C CA   . LEU A 1 74  ? 9.235   -8.275  -2.002  1.00 0.00 ? 74  LEU A CA   6  
ATOM   8483  C C    . LEU A 1 74  ? 8.973   -7.683  -0.617  1.00 0.00 ? 74  LEU A C    6  
ATOM   8484  O O    . LEU A 1 74  ? 7.845   -7.302  -0.303  1.00 0.00 ? 74  LEU A O    6  
ATOM   8485  C CB   . LEU A 1 74  ? 10.198  -7.444  -2.854  1.00 0.00 ? 74  LEU A CB   6  
ATOM   8486  C CG   . LEU A 1 74  ? 10.395  -7.916  -4.297  1.00 0.00 ? 74  LEU A CG   6  
ATOM   8487  C CD1  . LEU A 1 74  ? 11.659  -7.306  -4.905  1.00 0.00 ? 74  LEU A CD1  6  
ATOM   8488  C CD2  . LEU A 1 74  ? 10.398  -9.444  -4.378  1.00 0.00 ? 74  LEU A CD2  6  
ATOM   8489  H H    . LEU A 1 74  ? 7.535   -7.610  -3.009  1.00 0.00 ? 74  LEU A H    6  
ATOM   8490  H HA   . LEU A 1 74  ? 9.682   -9.260  -1.879  1.00 0.00 ? 74  LEU A HA   6  
ATOM   8491  H HB2  . LEU A 1 74  ? 9.838   -6.415  -2.875  1.00 0.00 ? 74  LEU A HB2  6  
ATOM   8492  H HB3  . LEU A 1 74  ? 11.170  -7.434  -2.361  1.00 0.00 ? 74  LEU A HB3  6  
ATOM   8493  H HG   . LEU A 1 74  ? 9.551   -7.563  -4.888  1.00 0.00 ? 74  LEU A HG   6  
ATOM   8494  H HD11 . LEU A 1 74  ? 12.372  -8.099  -5.132  1.00 0.00 ? 74  LEU A HD11 6  
ATOM   8495  H HD12 . LEU A 1 74  ? 11.402  -6.775  -5.820  1.00 0.00 ? 74  LEU A HD12 6  
ATOM   8496  H HD13 . LEU A 1 74  ? 12.105  -6.611  -4.193  1.00 0.00 ? 74  LEU A HD13 6  
ATOM   8497  H HD21 . LEU A 1 74  ? 9.372   -9.811  -4.366  1.00 0.00 ? 74  LEU A HD21 6  
ATOM   8498  H HD22 . LEU A 1 74  ? 10.885  -9.756  -5.303  1.00 0.00 ? 74  LEU A HD22 6  
ATOM   8499  H HD23 . LEU A 1 74  ? 10.941  -9.852  -3.526  1.00 0.00 ? 74  LEU A HD23 6  
ATOM   8500  N N    . SER A 1 75  ? 10.031  -7.622  0.176   1.00 0.00 ? 75  SER A N    6  
ATOM   8501  C CA   . SER A 1 75  ? 9.931   -7.083  1.522   1.00 0.00 ? 75  SER A CA   6  
ATOM   8502  C C    . SER A 1 75  ? 9.784   -5.561  1.465   1.00 0.00 ? 75  SER A C    6  
ATOM   8503  O O    . SER A 1 75  ? 10.332  -4.912  0.574   1.00 0.00 ? 75  SER A O    6  
ATOM   8504  C CB   . SER A 1 75  ? 11.149  -7.467  2.362   1.00 0.00 ? 75  SER A CB   6  
ATOM   8505  O OG   . SER A 1 75  ? 12.323  -7.608  1.568   1.00 0.00 ? 75  SER A OG   6  
ATOM   8506  H H    . SER A 1 75  ? 10.945  -7.933  -0.088  1.00 0.00 ? 75  SER A H    6  
ATOM   8507  H HA   . SER A 1 75  ? 9.037   -7.537  1.948   1.00 0.00 ? 75  SER A HA   6  
ATOM   8508  H HB2  . SER A 1 75  ? 11.318  -6.707  3.127   1.00 0.00 ? 75  SER A HB2  6  
ATOM   8509  H HB3  . SER A 1 75  ? 10.950  -8.404  2.882   1.00 0.00 ? 75  SER A HB3  6  
ATOM   8510  H HG   . SER A 1 75  ? 12.505  -6.758  1.073   1.00 0.00 ? 75  SER A HG   6  
ATOM   8511  N N    . GLN A 1 76  ? 9.040   -5.034  2.427   1.00 0.00 ? 76  GLN A N    6  
ATOM   8512  C CA   . GLN A 1 76  ? 8.815   -3.599  2.497   1.00 0.00 ? 76  GLN A CA   6  
ATOM   8513  C C    . GLN A 1 76  ? 10.132  -2.867  2.753   1.00 0.00 ? 76  GLN A C    6  
ATOM   8514  O O    . GLN A 1 76  ? 10.194  -1.642  2.660   1.00 0.00 ? 76  GLN A O    6  
ATOM   8515  C CB   . GLN A 1 76  ? 7.780   -3.260  3.573   1.00 0.00 ? 76  GLN A CB   6  
ATOM   8516  C CG   . GLN A 1 76  ? 8.299   -3.623  4.966   1.00 0.00 ? 76  GLN A CG   6  
ATOM   8517  C CD   . GLN A 1 76  ? 9.194   -2.515  5.525   1.00 0.00 ? 76  GLN A CD   6  
ATOM   8518  O OE1  . GLN A 1 76  ? 10.409  -2.550  5.418   1.00 0.00 ? 76  GLN A OE1  6  
ATOM   8519  N NE2  . GLN A 1 76  ? 8.529   -1.533  6.124   1.00 0.00 ? 76  GLN A NE2  6  
ATOM   8520  H H    . GLN A 1 76  ? 8.597   -5.568  3.147   1.00 0.00 ? 76  GLN A H    6  
ATOM   8521  H HA   . GLN A 1 76  ? 8.419   -3.319  1.522   1.00 0.00 ? 76  GLN A HA   6  
ATOM   8522  H HB2  . GLN A 1 76  ? 7.547   -2.197  3.535   1.00 0.00 ? 76  GLN A HB2  6  
ATOM   8523  H HB3  . GLN A 1 76  ? 6.853   -3.798  3.374   1.00 0.00 ? 76  GLN A HB3  6  
ATOM   8524  H HG2  . GLN A 1 76  ? 7.457   -3.790  5.639   1.00 0.00 ? 76  GLN A HG2  6  
ATOM   8525  H HG3  . GLN A 1 76  ? 8.857   -4.558  4.918   1.00 0.00 ? 76  GLN A HG3  6  
ATOM   8526  H HE21 . GLN A 1 76  ? 7.530   -1.564  6.176   1.00 0.00 ? 76  GLN A HE21 6  
ATOM   8527  H HE22 . GLN A 1 76  ? 9.026   -0.762  6.521   1.00 0.00 ? 76  GLN A HE22 6  
ATOM   8528  N N    . GLU A 1 77  ? 11.156  -3.648  3.071   1.00 0.00 ? 77  GLU A N    6  
ATOM   8529  C CA   . GLU A 1 77  ? 12.469  -3.088  3.341   1.00 0.00 ? 77  GLU A CA   6  
ATOM   8530  C C    . GLU A 1 77  ? 12.800  -1.995  2.322   1.00 0.00 ? 77  GLU A C    6  
ATOM   8531  O O    . GLU A 1 77  ? 12.699  -0.809  2.625   1.00 0.00 ? 77  GLU A O    6  
ATOM   8532  C CB   . GLU A 1 77  ? 13.540  -4.180  3.343   1.00 0.00 ? 77  GLU A CB   6  
ATOM   8533  C CG   . GLU A 1 77  ? 13.191  -5.289  4.337   1.00 0.00 ? 77  GLU A CG   6  
ATOM   8534  C CD   . GLU A 1 77  ? 14.168  -5.298  5.514   1.00 0.00 ? 77  GLU A CD   6  
ATOM   8535  O OE1  . GLU A 1 77  ? 15.372  -5.092  5.254   1.00 0.00 ? 77  GLU A OE1  6  
ATOM   8536  O OE2  . GLU A 1 77  ? 13.687  -5.510  6.649   1.00 0.00 ? 77  GLU A OE2  6  
ATOM   8537  H H    . GLU A 1 77  ? 11.097  -4.642  3.144   1.00 0.00 ? 77  GLU A H    6  
ATOM   8538  H HA   . GLU A 1 77  ? 12.400  -2.655  4.339   1.00 0.00 ? 77  GLU A HA   6  
ATOM   8539  H HB2  . GLU A 1 77  ? 13.637  -4.600  2.342   1.00 0.00 ? 77  GLU A HB2  6  
ATOM   8540  H HB3  . GLU A 1 77  ? 14.507  -3.747  3.601   1.00 0.00 ? 77  GLU A HB3  6  
ATOM   8541  H HG2  . GLU A 1 77  ? 12.174  -5.148  4.703   1.00 0.00 ? 77  GLU A HG2  6  
ATOM   8542  H HG3  . GLU A 1 77  ? 13.217  -6.255  3.832   1.00 0.00 ? 77  GLU A HG3  6  
ATOM   8543  N N    . ARG A 1 78  ? 13.189  -2.437  1.135   1.00 0.00 ? 78  ARG A N    6  
ATOM   8544  C CA   . ARG A 1 78  ? 13.535  -1.512  0.070   1.00 0.00 ? 78  ARG A CA   6  
ATOM   8545  C C    . ARG A 1 78  ? 12.437  -0.461  -0.100  1.00 0.00 ? 78  ARG A C    6  
ATOM   8546  O O    . ARG A 1 78  ? 12.672  0.726   0.117   1.00 0.00 ? 78  ARG A O    6  
ATOM   8547  C CB   . ARG A 1 78  ? 13.736  -2.249  -1.257  1.00 0.00 ? 78  ARG A CB   6  
ATOM   8548  C CG   . ARG A 1 78  ? 14.707  -3.418  -1.092  1.00 0.00 ? 78  ARG A CG   6  
ATOM   8549  C CD   . ARG A 1 78  ? 13.988  -4.757  -1.277  1.00 0.00 ? 78  ARG A CD   6  
ATOM   8550  N NE   . ARG A 1 78  ? 14.813  -5.664  -2.107  1.00 0.00 ? 78  ARG A NE   6  
ATOM   8551  C CZ   . ARG A 1 78  ? 14.841  -5.639  -3.446  1.00 0.00 ? 78  ARG A CZ   6  
ATOM   8552  N NH1  . ARG A 1 78  ? 14.088  -4.754  -4.115  1.00 0.00 ? 78  ARG A NH1  6  
ATOM   8553  N NH2  . ARG A 1 78  ? 15.617  -6.500  -4.117  1.00 0.00 ? 78  ARG A NH2  6  
ATOM   8554  H H    . ARG A 1 78  ? 13.269  -3.405  0.897   1.00 0.00 ? 78  ARG A H    6  
ATOM   8555  H HA   . ARG A 1 78  ? 14.471  -1.053  0.391   1.00 0.00 ? 78  ARG A HA   6  
ATOM   8556  H HB2  . ARG A 1 78  ? 12.777  -2.616  -1.621  1.00 0.00 ? 78  ARG A HB2  6  
ATOM   8557  H HB3  . ARG A 1 78  ? 14.118  -1.557  -2.007  1.00 0.00 ? 78  ARG A HB3  6  
ATOM   8558  H HG2  . ARG A 1 78  ? 15.514  -3.332  -1.820  1.00 0.00 ? 78  ARG A HG2  6  
ATOM   8559  H HG3  . ARG A 1 78  ? 15.163  -3.382  -0.103  1.00 0.00 ? 78  ARG A HG3  6  
ATOM   8560  H HD2  . ARG A 1 78  ? 13.797  -5.213  -0.305  1.00 0.00 ? 78  ARG A HD2  6  
ATOM   8561  H HD3  . ARG A 1 78  ? 13.019  -4.598  -1.751  1.00 0.00 ? 78  ARG A HD3  6  
ATOM   8562  H HE   . ARG A 1 78  ? 15.386  -6.337  -1.640  1.00 0.00 ? 78  ARG A HE   6  
ATOM   8563  H HH11 . ARG A 1 78  ? 13.508  -4.112  -3.616  1.00 0.00 ? 78  ARG A HH11 6  
ATOM   8564  H HH12 . ARG A 1 78  ? 14.110  -4.736  -5.115  1.00 0.00 ? 78  ARG A HH12 6  
ATOM   8565  H HH21 . ARG A 1 78  ? 16.179  -7.160  -3.618  1.00 0.00 ? 78  ARG A HH21 6  
ATOM   8566  H HH22 . ARG A 1 78  ? 15.638  -6.482  -5.116  1.00 0.00 ? 78  ARG A HH22 6  
ATOM   8567  N N    . ALA A 1 79  ? 11.261  -0.937  -0.484  1.00 0.00 ? 79  ALA A N    6  
ATOM   8568  C CA   . ALA A 1 79  ? 10.125  -0.052  -0.684  1.00 0.00 ? 79  ALA A CA   6  
ATOM   8569  C C    . ALA A 1 79  ? 10.028  0.920   0.492   1.00 0.00 ? 79  ALA A C    6  
ATOM   8570  O O    . ALA A 1 79  ? 10.542  2.036   0.424   1.00 0.00 ? 79  ALA A O    6  
ATOM   8571  C CB   . ALA A 1 79  ? 8.853   -0.886  -0.860  1.00 0.00 ? 79  ALA A CB   6  
ATOM   8572  H H    . ALA A 1 79  ? 11.080  -1.904  -0.658  1.00 0.00 ? 79  ALA A H    6  
ATOM   8573  H HA   . ALA A 1 79  ? 10.303  0.514   -1.599  1.00 0.00 ? 79  ALA A HA   6  
ATOM   8574  H HB1  . ALA A 1 79  ? 9.046   -1.912  -0.544  1.00 0.00 ? 79  ALA A HB1  6  
ATOM   8575  H HB2  . ALA A 1 79  ? 8.056   -0.462  -0.251  1.00 0.00 ? 79  ALA A HB2  6  
ATOM   8576  H HB3  . ALA A 1 79  ? 8.556   -0.878  -1.908  1.00 0.00 ? 79  ALA A HB3  6  
ATOM   8577  N N    . ALA A 1 80  ? 9.365   0.461   1.544   1.00 0.00 ? 80  ALA A N    6  
ATOM   8578  C CA   . ALA A 1 80  ? 9.193   1.278   2.735   1.00 0.00 ? 80  ALA A CA   6  
ATOM   8579  C C    . ALA A 1 80  ? 9.862   2.635   2.517   1.00 0.00 ? 80  ALA A C    6  
ATOM   8580  O O    . ALA A 1 80  ? 9.213   3.594   2.106   1.00 0.00 ? 80  ALA A O    6  
ATOM   8581  C CB   . ALA A 1 80  ? 9.756   0.535   3.947   1.00 0.00 ? 80  ALA A CB   6  
ATOM   8582  H H    . ALA A 1 80  ? 8.951   -0.447  1.590   1.00 0.00 ? 80  ALA A H    6  
ATOM   8583  H HA   . ALA A 1 80  ? 8.123   1.428   2.881   1.00 0.00 ? 80  ALA A HA   6  
ATOM   8584  H HB1  . ALA A 1 80  ? 10.773  0.205   3.731   1.00 0.00 ? 80  ALA A HB1  6  
ATOM   8585  H HB2  . ALA A 1 80  ? 9.766   1.201   4.809   1.00 0.00 ? 80  ALA A HB2  6  
ATOM   8586  H HB3  . ALA A 1 80  ? 9.133   -0.333  4.166   1.00 0.00 ? 80  ALA A HB3  6  
ATOM   8587  N N    . GLU A 1 81  ? 11.156  2.673   2.805   1.00 0.00 ? 81  GLU A N    6  
ATOM   8588  C CA   . GLU A 1 81  ? 11.922  3.898   2.647   1.00 0.00 ? 81  GLU A CA   6  
ATOM   8589  C C    . GLU A 1 81  ? 11.569  4.578   1.322   1.00 0.00 ? 81  GLU A C    6  
ATOM   8590  O O    . GLU A 1 81  ? 11.003  5.670   1.313   1.00 0.00 ? 81  GLU A O    6  
ATOM   8591  C CB   . GLU A 1 81  ? 13.425  3.620   2.737   1.00 0.00 ? 81  GLU A CB   6  
ATOM   8592  C CG   . GLU A 1 81  ? 14.232  4.898   2.506   1.00 0.00 ? 81  GLU A CG   6  
ATOM   8593  C CD   . GLU A 1 81  ? 15.589  4.825   3.209   1.00 0.00 ? 81  GLU A CD   6  
ATOM   8594  O OE1  . GLU A 1 81  ? 15.613  5.113   4.427   1.00 0.00 ? 81  GLU A OE1  6  
ATOM   8595  O OE2  . GLU A 1 81  ? 16.571  4.482   2.516   1.00 0.00 ? 81  GLU A OE2  6  
ATOM   8596  H H    . GLU A 1 81  ? 11.679  1.889   3.139   1.00 0.00 ? 81  GLU A H    6  
ATOM   8597  H HA   . GLU A 1 81  ? 11.626  4.535   3.480   1.00 0.00 ? 81  GLU A HA   6  
ATOM   8598  H HB2  . GLU A 1 81  ? 13.663  3.206   3.717   1.00 0.00 ? 81  GLU A HB2  6  
ATOM   8599  H HB3  . GLU A 1 81  ? 13.704  2.870   1.997   1.00 0.00 ? 81  GLU A HB3  6  
ATOM   8600  H HG2  . GLU A 1 81  ? 14.383  5.051   1.437   1.00 0.00 ? 81  GLU A HG2  6  
ATOM   8601  H HG3  . GLU A 1 81  ? 13.674  5.759   2.875   1.00 0.00 ? 81  GLU A HG3  6  
ATOM   8602  N N    . LEU A 1 82  ? 11.918  3.905   0.236   1.00 0.00 ? 82  LEU A N    6  
ATOM   8603  C CA   . LEU A 1 82  ? 11.645  4.429   -1.090  1.00 0.00 ? 82  LEU A CA   6  
ATOM   8604  C C    . LEU A 1 82  ? 10.144  4.334   -1.372  1.00 0.00 ? 82  LEU A C    6  
ATOM   8605  O O    . LEU A 1 82  ? 9.711   4.500   -2.513  1.00 0.00 ? 82  LEU A O    6  
ATOM   8606  C CB   . LEU A 1 82  ? 12.513  3.727   -2.135  1.00 0.00 ? 82  LEU A CB   6  
ATOM   8607  C CG   . LEU A 1 82  ? 12.885  4.555   -3.366  1.00 0.00 ? 82  LEU A CG   6  
ATOM   8608  C CD1  . LEU A 1 82  ? 11.722  5.449   -3.798  1.00 0.00 ? 82  LEU A CD1  6  
ATOM   8609  C CD2  . LEU A 1 82  ? 14.165  5.357   -3.120  1.00 0.00 ? 82  LEU A CD2  6  
ATOM   8610  H H    . LEU A 1 82  ? 12.378  3.017   0.252   1.00 0.00 ? 82  LEU A H    6  
ATOM   8611  H HA   . LEU A 1 82  ? 11.929  5.482   -1.090  1.00 0.00 ? 82  LEU A HA   6  
ATOM   8612  H HB2  . LEU A 1 82  ? 13.432  3.395   -1.652  1.00 0.00 ? 82  LEU A HB2  6  
ATOM   8613  H HB3  . LEU A 1 82  ? 11.990  2.830   -2.469  1.00 0.00 ? 82  LEU A HB3  6  
ATOM   8614  H HG   . LEU A 1 82  ? 13.087  3.871   -4.191  1.00 0.00 ? 82  LEU A HG   6  
ATOM   8615  H HD11 . LEU A 1 82  ? 12.081  6.198   -4.503  1.00 0.00 ? 82  LEU A HD11 6  
ATOM   8616  H HD12 . LEU A 1 82  ? 10.953  4.841   -4.275  1.00 0.00 ? 82  LEU A HD12 6  
ATOM   8617  H HD13 . LEU A 1 82  ? 11.300  5.946   -2.922  1.00 0.00 ? 82  LEU A HD13 6  
ATOM   8618  H HD21 . LEU A 1 82  ? 14.111  6.301   -3.662  1.00 0.00 ? 82  LEU A HD21 6  
ATOM   8619  H HD22 . LEU A 1 82  ? 14.269  5.555   -2.053  1.00 0.00 ? 82  LEU A HD22 6  
ATOM   8620  H HD23 . LEU A 1 82  ? 15.024  4.786   -3.468  1.00 0.00 ? 82  LEU A HD23 6  
ATOM   8621  N N    . MET A 1 83  ? 9.390   4.067   -0.315  1.00 0.00 ? 83  MET A N    6  
ATOM   8622  C CA   . MET A 1 83  ? 7.946   3.946   -0.437  1.00 0.00 ? 83  MET A CA   6  
ATOM   8623  C C    . MET A 1 83  ? 7.237   4.985   0.434   1.00 0.00 ? 83  MET A C    6  
ATOM   8624  O O    . MET A 1 83  ? 6.055   5.265   0.235   1.00 0.00 ? 83  MET A O    6  
ATOM   8625  C CB   . MET A 1 83  ? 7.514   2.541   -0.012  1.00 0.00 ? 83  MET A CB   6  
ATOM   8626  C CG   . MET A 1 83  ? 6.034   2.308   -0.320  1.00 0.00 ? 83  MET A CG   6  
ATOM   8627  S SD   . MET A 1 83  ? 5.603   0.608   0.013   1.00 0.00 ? 83  MET A SD   6  
ATOM   8628  C CE   . MET A 1 83  ? 5.276   0.709   1.766   1.00 0.00 ? 83  MET A CE   6  
ATOM   8629  H H    . MET A 1 83  ? 9.751   3.933   0.608   1.00 0.00 ? 83  MET A H    6  
ATOM   8630  H HA   . MET A 1 83  ? 7.725   4.131   -1.487  1.00 0.00 ? 83  MET A HA   6  
ATOM   8631  H HB2  . MET A 1 83  ? 8.120   1.798   -0.531  1.00 0.00 ? 83  MET A HB2  6  
ATOM   8632  H HB3  . MET A 1 83  ? 7.694   2.409   1.055   1.00 0.00 ? 83  MET A HB3  6  
ATOM   8633  H HG2  . MET A 1 83  ? 5.419   2.973   0.286   1.00 0.00 ? 83  MET A HG2  6  
ATOM   8634  H HG3  . MET A 1 83  ? 5.829   2.546   -1.363  1.00 0.00 ? 83  MET A HG3  6  
ATOM   8635  H HE1  . MET A 1 83  ? 6.052   1.305   2.247   1.00 0.00 ? 83  MET A HE1  6  
ATOM   8636  H HE2  . MET A 1 83  ? 4.305   1.179   1.929   1.00 0.00 ? 83  MET A HE2  6  
ATOM   8637  H HE3  . MET A 1 83  ? 5.271   -0.294  2.194   1.00 0.00 ? 83  MET A HE3  6  
ATOM   8638  N N    . THR A 1 84  ? 7.987   5.528   1.383   1.00 0.00 ? 84  THR A N    6  
ATOM   8639  C CA   . THR A 1 84  ? 7.443   6.528   2.285   1.00 0.00 ? 84  THR A CA   6  
ATOM   8640  C C    . THR A 1 84  ? 7.630   7.931   1.701   1.00 0.00 ? 84  THR A C    6  
ATOM   8641  O O    . THR A 1 84  ? 6.666   8.678   1.547   1.00 0.00 ? 84  THR A O    6  
ATOM   8642  C CB   . THR A 1 84  ? 8.108   6.346   3.650   1.00 0.00 ? 84  THR A CB   6  
ATOM   8643  O OG1  . THR A 1 84  ? 8.285   4.936   3.763   1.00 0.00 ? 84  THR A OG1  6  
ATOM   8644  C CG2  . THR A 1 84  ? 7.173   6.700   4.809   1.00 0.00 ? 84  THR A CG2  6  
ATOM   8645  H H    . THR A 1 84  ? 8.947   5.296   1.539   1.00 0.00 ? 84  THR A H    6  
ATOM   8646  H HA   . THR A 1 84  ? 6.371   6.362   2.376   1.00 0.00 ? 84  THR A HA   6  
ATOM   8647  H HB   . THR A 1 84  ? 9.036   6.915   3.712   1.00 0.00 ? 84  THR A HB   6  
ATOM   8648  H HG1  . THR A 1 84  ? 9.159   4.669   3.361   1.00 0.00 ? 84  THR A HG1  6  
ATOM   8649  H HG21 . THR A 1 84  ? 6.942   7.764   4.779   1.00 0.00 ? 84  THR A HG21 6  
ATOM   8650  H HG22 . THR A 1 84  ? 6.251   6.124   4.720   1.00 0.00 ? 84  THR A HG22 6  
ATOM   8651  H HG23 . THR A 1 84  ? 7.660   6.461   5.754   1.00 0.00 ? 84  THR A HG23 6  
ATOM   8652  N N    . ARG A 1 85  ? 8.880   8.245   1.390   1.00 0.00 ? 85  ARG A N    6  
ATOM   8653  C CA   . ARG A 1 85  ? 9.207   9.544   0.828   1.00 0.00 ? 85  ARG A CA   6  
ATOM   8654  C C    . ARG A 1 85  ? 8.584   9.692   -0.563  1.00 0.00 ? 85  ARG A C    6  
ATOM   8655  O O    . ARG A 1 85  ? 9.295   9.880   -1.549  1.00 0.00 ? 85  ARG A O    6  
ATOM   8656  C CB   . ARG A 1 85  ? 10.721  9.734   0.723   1.00 0.00 ? 85  ARG A CB   6  
ATOM   8657  C CG   . ARG A 1 85  ? 11.099  11.212  0.855   1.00 0.00 ? 85  ARG A CG   6  
ATOM   8658  C CD   . ARG A 1 85  ? 12.347  11.534  0.031   1.00 0.00 ? 85  ARG A CD   6  
ATOM   8659  N NE   . ARG A 1 85  ? 12.915  12.831  0.459   1.00 0.00 ? 85  ARG A NE   6  
ATOM   8660  C CZ   . ARG A 1 85  ? 14.192  13.192  0.270   1.00 0.00 ? 85  ARG A CZ   6  
ATOM   8661  N NH1  . ARG A 1 85  ? 15.041  12.355  -0.340  1.00 0.00 ? 85  ARG A NH1  6  
ATOM   8662  N NH2  . ARG A 1 85  ? 14.619  14.390  0.692   1.00 0.00 ? 85  ARG A NH2  6  
ATOM   8663  H H    . ARG A 1 85  ? 9.659   7.632   1.519   1.00 0.00 ? 85  ARG A H    6  
ATOM   8664  H HA   . ARG A 1 85  ? 8.783   10.266  1.526   1.00 0.00 ? 85  ARG A HA   6  
ATOM   8665  H HB2  . ARG A 1 85  ? 11.218  9.158   1.503   1.00 0.00 ? 85  ARG A HB2  6  
ATOM   8666  H HB3  . ARG A 1 85  ? 11.075  9.349   -0.233  1.00 0.00 ? 85  ARG A HB3  6  
ATOM   8667  H HG2  . ARG A 1 85  ? 10.268  11.834  0.521   1.00 0.00 ? 85  ARG A HG2  6  
ATOM   8668  H HG3  . ARG A 1 85  ? 11.278  11.453  1.902   1.00 0.00 ? 85  ARG A HG3  6  
ATOM   8669  H HD2  . ARG A 1 85  ? 13.089  10.744  0.155   1.00 0.00 ? 85  ARG A HD2  6  
ATOM   8670  H HD3  . ARG A 1 85  ? 12.096  11.570  -1.028  1.00 0.00 ? 85  ARG A HD3  6  
ATOM   8671  H HE   . ARG A 1 85  ? 12.307  13.481  0.918   1.00 0.00 ? 85  ARG A HE   6  
ATOM   8672  H HH11 . ARG A 1 85  ? 14.722  11.460  -0.653  1.00 0.00 ? 85  ARG A HH11 6  
ATOM   8673  H HH12 . ARG A 1 85  ? 15.994  12.622  -0.480  1.00 0.00 ? 85  ARG A HH12 6  
ATOM   8674  H HH21 . ARG A 1 85  ? 13.986  15.015  1.146   1.00 0.00 ? 85  ARG A HH21 6  
ATOM   8675  H HH22 . ARG A 1 85  ? 15.571  14.659  0.550   1.00 0.00 ? 85  ARG A HH22 6  
ATOM   8676  N N    . THR A 1 86  ? 7.263   9.600   -0.596  1.00 0.00 ? 86  THR A N    6  
ATOM   8677  C CA   . THR A 1 86  ? 6.537   9.722   -1.850  1.00 0.00 ? 86  THR A CA   6  
ATOM   8678  C C    . THR A 1 86  ? 6.282   11.193  -2.179  1.00 0.00 ? 86  THR A C    6  
ATOM   8679  O O    . THR A 1 86  ? 6.686   11.676  -3.235  1.00 0.00 ? 86  THR A O    6  
ATOM   8680  C CB   . THR A 1 86  ? 5.255   8.895   -1.735  1.00 0.00 ? 86  THR A CB   6  
ATOM   8681  O OG1  . THR A 1 86  ? 5.513   7.741   -2.529  1.00 0.00 ? 86  THR A OG1  6  
ATOM   8682  C CG2  . THR A 1 86  ? 4.062   9.562   -2.425  1.00 0.00 ? 86  THR A CG2  6  
ATOM   8683  H H    . THR A 1 86  ? 6.692   9.447   0.210   1.00 0.00 ? 86  THR A H    6  
ATOM   8684  H HA   . THR A 1 86  ? 7.160   9.318   -2.649  1.00 0.00 ? 86  THR A HA   6  
ATOM   8685  H HB   . THR A 1 86  ? 5.027   8.672   -0.691  1.00 0.00 ? 86  THR A HB   6  
ATOM   8686  H HG1  . THR A 1 86  ? 6.426   7.385   -2.328  1.00 0.00 ? 86  THR A HG1  6  
ATOM   8687  H HG21 . THR A 1 86  ? 3.769   10.449  -1.864  1.00 0.00 ? 86  THR A HG21 6  
ATOM   8688  H HG22 . THR A 1 86  ? 4.343   9.850   -3.437  1.00 0.00 ? 86  THR A HG22 6  
ATOM   8689  H HG23 . THR A 1 86  ? 3.227   8.863   -2.464  1.00 0.00 ? 86  THR A HG23 6  
ATOM   8690  N N    . SER A 1 87  ? 5.614   11.866  -1.254  1.00 0.00 ? 87  SER A N    6  
ATOM   8691  C CA   . SER A 1 87  ? 5.302   13.274  -1.433  1.00 0.00 ? 87  SER A CA   6  
ATOM   8692  C C    . SER A 1 87  ? 4.326   13.450  -2.598  1.00 0.00 ? 87  SER A C    6  
ATOM   8693  O O    . SER A 1 87  ? 3.233   13.986  -2.421  1.00 0.00 ? 87  SER A O    6  
ATOM   8694  C CB   . SER A 1 87  ? 6.571   14.095  -1.676  1.00 0.00 ? 87  SER A CB   6  
ATOM   8695  O OG   . SER A 1 87  ? 6.477   15.402  -1.117  1.00 0.00 ? 87  SER A OG   6  
ATOM   8696  H H    . SER A 1 87  ? 5.290   11.468  -0.397  1.00 0.00 ? 87  SER A H    6  
ATOM   8697  H HA   . SER A 1 87  ? 4.840   13.589  -0.496  1.00 0.00 ? 87  SER A HA   6  
ATOM   8698  H HB2  . SER A 1 87  ? 7.425   13.576  -1.241  1.00 0.00 ? 87  SER A HB2  6  
ATOM   8699  H HB3  . SER A 1 87  ? 6.753   14.171  -2.747  1.00 0.00 ? 87  SER A HB3  6  
ATOM   8700  H HG   . SER A 1 87  ? 6.663   15.368  -0.134  1.00 0.00 ? 87  SER A HG   6  
ATOM   8701  N N    . SER A 1 88  ? 4.756   12.989  -3.763  1.00 0.00 ? 88  SER A N    6  
ATOM   8702  C CA   . SER A 1 88  ? 3.934   13.087  -4.957  1.00 0.00 ? 88  SER A CA   6  
ATOM   8703  C C    . SER A 1 88  ? 2.754   12.118  -4.862  1.00 0.00 ? 88  SER A C    6  
ATOM   8704  O O    . SER A 1 88  ? 1.642   12.520  -4.524  1.00 0.00 ? 88  SER A O    6  
ATOM   8705  C CB   . SER A 1 88  ? 4.755   12.803  -6.217  1.00 0.00 ? 88  SER A CB   6  
ATOM   8706  O OG   . SER A 1 88  ? 5.513   13.938  -6.626  1.00 0.00 ? 88  SER A OG   6  
ATOM   8707  H H    . SER A 1 88  ? 5.647   12.553  -3.899  1.00 0.00 ? 88  SER A H    6  
ATOM   8708  H HA   . SER A 1 88  ? 3.580   14.119  -4.979  1.00 0.00 ? 88  SER A HA   6  
ATOM   8709  H HB2  . SER A 1 88  ? 5.429   11.967  -6.028  1.00 0.00 ? 88  SER A HB2  6  
ATOM   8710  H HB3  . SER A 1 88  ? 4.087   12.502  -7.023  1.00 0.00 ? 88  SER A HB3  6  
ATOM   8711  H HG   . SER A 1 88  ? 5.424   14.070  -7.614  1.00 0.00 ? 88  SER A HG   6  
ATOM   8712  N N    . VAL A 1 89  ? 3.038   10.859  -5.166  1.00 0.00 ? 89  VAL A N    6  
ATOM   8713  C CA   . VAL A 1 89  ? 2.015   9.830   -5.120  1.00 0.00 ? 89  VAL A CA   6  
ATOM   8714  C C    . VAL A 1 89  ? 2.649   8.505   -4.689  1.00 0.00 ? 89  VAL A C    6  
ATOM   8715  O O    . VAL A 1 89  ? 3.837   8.280   -4.915  1.00 0.00 ? 89  VAL A O    6  
ATOM   8716  C CB   . VAL A 1 89  ? 1.301   9.740   -6.469  1.00 0.00 ? 89  VAL A CB   6  
ATOM   8717  C CG1  . VAL A 1 89  ? 2.302   9.526   -7.606  1.00 0.00 ? 89  VAL A CG1  6  
ATOM   8718  C CG2  . VAL A 1 89  ? 0.241   8.636   -6.457  1.00 0.00 ? 89  VAL A CG2  6  
ATOM   8719  H H    . VAL A 1 89  ? 3.946   10.542  -5.439  1.00 0.00 ? 89  VAL A H    6  
ATOM   8720  H HA   . VAL A 1 89  ? 1.283   10.128  -4.369  1.00 0.00 ? 89  VAL A HA   6  
ATOM   8721  H HB   . VAL A 1 89  ? 0.794   10.689  -6.644  1.00 0.00 ? 89  VAL A HB   6  
ATOM   8722  H HG11 . VAL A 1 89  ? 2.719   8.521   -7.537  1.00 0.00 ? 89  VAL A HG11 6  
ATOM   8723  H HG12 . VAL A 1 89  ? 1.795   9.644   -8.564  1.00 0.00 ? 89  VAL A HG12 6  
ATOM   8724  H HG13 . VAL A 1 89  ? 3.104   10.259  -7.527  1.00 0.00 ? 89  VAL A HG13 6  
ATOM   8725  H HG21 . VAL A 1 89  ? 0.672   7.714   -6.844  1.00 0.00 ? 89  VAL A HG21 6  
ATOM   8726  H HG22 . VAL A 1 89  ? -0.103  8.475   -5.434  1.00 0.00 ? 89  VAL A HG22 6  
ATOM   8727  H HG23 . VAL A 1 89  ? -0.602  8.934   -7.080  1.00 0.00 ? 89  VAL A HG23 6  
ATOM   8728  N N    . VAL A 1 90  ? 1.830   7.664   -4.077  1.00 0.00 ? 90  VAL A N    6  
ATOM   8729  C CA   . VAL A 1 90  ? 2.295   6.368   -3.613  1.00 0.00 ? 90  VAL A CA   6  
ATOM   8730  C C    . VAL A 1 90  ? 1.568   5.265   -4.382  1.00 0.00 ? 90  VAL A C    6  
ATOM   8731  O O    . VAL A 1 90  ? 0.471   4.857   -4.005  1.00 0.00 ? 90  VAL A O    6  
ATOM   8732  C CB   . VAL A 1 90  ? 2.114   6.259   -2.098  1.00 0.00 ? 90  VAL A CB   6  
ATOM   8733  C CG1  . VAL A 1 90  ? 3.459   6.377   -1.376  1.00 0.00 ? 90  VAL A CG1  6  
ATOM   8734  C CG2  . VAL A 1 90  ? 1.123   7.306   -1.587  1.00 0.00 ? 90  VAL A CG2  6  
ATOM   8735  H H    . VAL A 1 90  ? 0.865   7.855   -3.896  1.00 0.00 ? 90  VAL A H    6  
ATOM   8736  H HA   . VAL A 1 90  ? 3.361   6.306   -3.832  1.00 0.00 ? 90  VAL A HA   6  
ATOM   8737  H HB   . VAL A 1 90  ? 1.703   5.274   -1.880  1.00 0.00 ? 90  VAL A HB   6  
ATOM   8738  H HG11 . VAL A 1 90  ? 3.473   5.698   -0.523  1.00 0.00 ? 90  VAL A HG11 6  
ATOM   8739  H HG12 . VAL A 1 90  ? 4.264   6.114   -2.061  1.00 0.00 ? 90  VAL A HG12 6  
ATOM   8740  H HG13 . VAL A 1 90  ? 3.595   7.400   -1.027  1.00 0.00 ? 90  VAL A HG13 6  
ATOM   8741  H HG21 . VAL A 1 90  ? 1.425   8.292   -1.938  1.00 0.00 ? 90  VAL A HG21 6  
ATOM   8742  H HG22 . VAL A 1 90  ? 0.127   7.075   -1.962  1.00 0.00 ? 90  VAL A HG22 6  
ATOM   8743  H HG23 . VAL A 1 90  ? 1.114   7.295   -0.497  1.00 0.00 ? 90  VAL A HG23 6  
ATOM   8744  N N    . THR A 1 91  ? 2.210   4.811   -5.451  1.00 0.00 ? 91  THR A N    6  
ATOM   8745  C CA   . THR A 1 91  ? 1.639   3.761   -6.277  1.00 0.00 ? 91  THR A CA   6  
ATOM   8746  C C    . THR A 1 91  ? 2.222   2.400   -5.891  1.00 0.00 ? 91  THR A C    6  
ATOM   8747  O O    . THR A 1 91  ? 3.391   2.127   -6.152  1.00 0.00 ? 91  THR A O    6  
ATOM   8748  C CB   . THR A 1 91  ? 1.877   4.130   -7.743  1.00 0.00 ? 91  THR A CB   6  
ATOM   8749  O OG1  . THR A 1 91  ? 3.221   4.606   -7.766  1.00 0.00 ? 91  THR A OG1  6  
ATOM   8750  C CG2  . THR A 1 91  ? 1.048   5.338   -8.184  1.00 0.00 ? 91  THR A CG2  6  
ATOM   8751  H H    . THR A 1 91  ? 3.103   5.148   -5.751  1.00 0.00 ? 91  THR A H    6  
ATOM   8752  H HA   . THR A 1 91  ? 0.566   3.716   -6.084  1.00 0.00 ? 91  THR A HA   6  
ATOM   8753  H HB   . THR A 1 91  ? 1.698   3.275   -8.394  1.00 0.00 ? 91  THR A HB   6  
ATOM   8754  H HG1  . THR A 1 91  ? 3.399   5.084   -8.626  1.00 0.00 ? 91  THR A HG1  6  
ATOM   8755  H HG21 . THR A 1 91  ? 0.333   5.028   -8.948  1.00 0.00 ? 91  THR A HG21 6  
ATOM   8756  H HG22 . THR A 1 91  ? 0.511   5.745   -7.327  1.00 0.00 ? 91  THR A HG22 6  
ATOM   8757  H HG23 . THR A 1 91  ? 1.707   6.102   -8.595  1.00 0.00 ? 91  THR A HG23 6  
ATOM   8758  N N    . LEU A 1 92  ? 1.378   1.585   -5.276  1.00 0.00 ? 92  LEU A N    6  
ATOM   8759  C CA   . LEU A 1 92  ? 1.795   0.259   -4.852  1.00 0.00 ? 92  LEU A CA   6  
ATOM   8760  C C    . LEU A 1 92  ? 0.774   -0.771  -5.334  1.00 0.00 ? 92  LEU A C    6  
ATOM   8761  O O    . LEU A 1 92  ? -0.370  -0.426  -5.629  1.00 0.00 ? 92  LEU A O    6  
ATOM   8762  C CB   . LEU A 1 92  ? 2.031   0.230   -3.339  1.00 0.00 ? 92  LEU A CB   6  
ATOM   8763  C CG   . LEU A 1 92  ? 1.904   1.571   -2.614  1.00 0.00 ? 92  LEU A CG   6  
ATOM   8764  C CD1  . LEU A 1 92  ? 1.777   1.369   -1.103  1.00 0.00 ? 92  LEU A CD1  6  
ATOM   8765  C CD2  . LEU A 1 92  ? 3.065   2.501   -2.973  1.00 0.00 ? 92  LEU A CD2  6  
ATOM   8766  H H    . LEU A 1 92  ? 0.428   1.816   -5.066  1.00 0.00 ? 92  LEU A H    6  
ATOM   8767  H HA   . LEU A 1 92  ? 2.751   0.048   -5.330  1.00 0.00 ? 92  LEU A HA   6  
ATOM   8768  H HB2  . LEU A 1 92  ? 1.324   -0.470  -2.895  1.00 0.00 ? 92  LEU A HB2  6  
ATOM   8769  H HB3  . LEU A 1 92  ? 3.030   -0.166  -3.156  1.00 0.00 ? 92  LEU A HB3  6  
ATOM   8770  H HG   . LEU A 1 92  ? 0.988   2.056   -2.952  1.00 0.00 ? 92  LEU A HG   6  
ATOM   8771  H HD11 . LEU A 1 92  ? 1.836   0.306   -0.874  1.00 0.00 ? 92  LEU A HD11 6  
ATOM   8772  H HD12 . LEU A 1 92  ? 2.585   1.895   -0.597  1.00 0.00 ? 92  LEU A HD12 6  
ATOM   8773  H HD13 . LEU A 1 92  ? 0.820   1.761   -0.763  1.00 0.00 ? 92  LEU A HD13 6  
ATOM   8774  H HD21 . LEU A 1 92  ? 3.580   2.117   -3.853  1.00 0.00 ? 92  LEU A HD21 6  
ATOM   8775  H HD22 . LEU A 1 92  ? 2.679   3.499   -3.184  1.00 0.00 ? 92  LEU A HD22 6  
ATOM   8776  H HD23 . LEU A 1 92  ? 3.762   2.550   -2.136  1.00 0.00 ? 92  LEU A HD23 6  
ATOM   8777  N N    . GLU A 1 93  ? 1.222   -2.017  -5.398  1.00 0.00 ? 93  GLU A N    6  
ATOM   8778  C CA   . GLU A 1 93  ? 0.359   -3.101  -5.839  1.00 0.00 ? 93  GLU A CA   6  
ATOM   8779  C C    . GLU A 1 93  ? -0.228  -3.837  -4.632  1.00 0.00 ? 93  GLU A C    6  
ATOM   8780  O O    . GLU A 1 93  ? 0.484   -4.552  -3.931  1.00 0.00 ? 93  GLU A O    6  
ATOM   8781  C CB   . GLU A 1 93  ? 1.115   -4.064  -6.755  1.00 0.00 ? 93  GLU A CB   6  
ATOM   8782  C CG   . GLU A 1 93  ? 0.173   -4.703  -7.778  1.00 0.00 ? 93  GLU A CG   6  
ATOM   8783  C CD   . GLU A 1 93  ? -0.188  -6.132  -7.371  1.00 0.00 ? 93  GLU A CD   6  
ATOM   8784  O OE1  . GLU A 1 93  ? -0.409  -6.340  -6.157  1.00 0.00 ? 93  GLU A OE1  6  
ATOM   8785  O OE2  . GLU A 1 93  ? -0.238  -6.987  -8.282  1.00 0.00 ? 93  GLU A OE2  6  
ATOM   8786  H H    . GLU A 1 93  ? 2.152   -2.290  -5.155  1.00 0.00 ? 93  GLU A H    6  
ATOM   8787  H HA   . GLU A 1 93  ? -0.441  -2.623  -6.406  1.00 0.00 ? 93  GLU A HA   6  
ATOM   8788  H HB2  . GLU A 1 93  ? 1.913   -3.531  -7.272  1.00 0.00 ? 93  GLU A HB2  6  
ATOM   8789  H HB3  . GLU A 1 93  ? 1.592   -4.843  -6.157  1.00 0.00 ? 93  GLU A HB3  6  
ATOM   8790  H HG2  . GLU A 1 93  ? -0.733  -4.105  -7.865  1.00 0.00 ? 93  GLU A HG2  6  
ATOM   8791  H HG3  . GLU A 1 93  ? 0.648   -4.710  -8.759  1.00 0.00 ? 93  GLU A HG3  6  
ATOM   8792  N N    . VAL A 1 94  ? -1.522  -3.636  -4.431  1.00 0.00 ? 94  VAL A N    6  
ATOM   8793  C CA   . VAL A 1 94  ? -2.214  -4.273  -3.322  1.00 0.00 ? 94  VAL A CA   6  
ATOM   8794  C C    . VAL A 1 94  ? -3.295  -5.205  -3.868  1.00 0.00 ? 94  VAL A C    6  
ATOM   8795  O O    . VAL A 1 94  ? -3.735  -5.052  -5.007  1.00 0.00 ? 94  VAL A O    6  
ATOM   8796  C CB   . VAL A 1 94  ? -2.766  -3.209  -2.372  1.00 0.00 ? 94  VAL A CB   6  
ATOM   8797  C CG1  . VAL A 1 94  ? -1.648  -2.587  -1.531  1.00 0.00 ? 94  VAL A CG1  6  
ATOM   8798  C CG2  . VAL A 1 94  ? -3.536  -2.133  -3.140  1.00 0.00 ? 94  VAL A CG2  6  
ATOM   8799  H H    . VAL A 1 94  ? -2.094  -3.053  -5.006  1.00 0.00 ? 94  VAL A H    6  
ATOM   8800  H HA   . VAL A 1 94  ? -1.481  -4.866  -2.775  1.00 0.00 ? 94  VAL A HA   6  
ATOM   8801  H HB   . VAL A 1 94  ? -3.464  -3.697  -1.691  1.00 0.00 ? 94  VAL A HB   6  
ATOM   8802  H HG11 . VAL A 1 94  ? -0.682  -2.836  -1.974  1.00 0.00 ? 94  VAL A HG11 6  
ATOM   8803  H HG12 . VAL A 1 94  ? -1.770  -1.505  -1.509  1.00 0.00 ? 94  VAL A HG12 6  
ATOM   8804  H HG13 . VAL A 1 94  ? -1.694  -2.981  -0.516  1.00 0.00 ? 94  VAL A HG13 6  
ATOM   8805  H HG21 . VAL A 1 94  ? -2.845  -1.358  -3.470  1.00 0.00 ? 94  VAL A HG21 6  
ATOM   8806  H HG22 . VAL A 1 94  ? -4.021  -2.582  -4.007  1.00 0.00 ? 94  VAL A HG22 6  
ATOM   8807  H HG23 . VAL A 1 94  ? -4.292  -1.692  -2.489  1.00 0.00 ? 94  VAL A HG23 6  
ATOM   8808  N N    . ALA A 1 95  ? -3.693  -6.152  -3.032  1.00 0.00 ? 95  ALA A N    6  
ATOM   8809  C CA   . ALA A 1 95  ? -4.715  -7.111  -3.418  1.00 0.00 ? 95  ALA A CA   6  
ATOM   8810  C C    . ALA A 1 95  ? -5.814  -7.133  -2.352  1.00 0.00 ? 95  ALA A C    6  
ATOM   8811  O O    . ALA A 1 95  ? -5.541  -7.388  -1.180  1.00 0.00 ? 95  ALA A O    6  
ATOM   8812  C CB   . ALA A 1 95  ? -4.075  -8.484  -3.625  1.00 0.00 ? 95  ALA A CB   6  
ATOM   8813  H H    . ALA A 1 95  ? -3.331  -6.271  -2.107  1.00 0.00 ? 95  ALA A H    6  
ATOM   8814  H HA   . ALA A 1 95  ? -5.144  -6.777  -4.362  1.00 0.00 ? 95  ALA A HA   6  
ATOM   8815  H HB1  . ALA A 1 95  ? -3.015  -8.361  -3.853  1.00 0.00 ? 95  ALA A HB1  6  
ATOM   8816  H HB2  . ALA A 1 95  ? -4.184  -9.076  -2.717  1.00 0.00 ? 95  ALA A HB2  6  
ATOM   8817  H HB3  . ALA A 1 95  ? -4.568  -8.994  -4.454  1.00 0.00 ? 95  ALA A HB3  6  
ATOM   8818  N N    . LYS A 1 96  ? -7.032  -6.866  -2.800  1.00 0.00 ? 96  LYS A N    6  
ATOM   8819  C CA   . LYS A 1 96  ? -8.173  -6.853  -1.900  1.00 0.00 ? 96  LYS A CA   6  
ATOM   8820  C C    . LYS A 1 96  ? -8.299  -8.220  -1.222  1.00 0.00 ? 96  LYS A C    6  
ATOM   8821  O O    . LYS A 1 96  ? -7.966  -9.244  -1.817  1.00 0.00 ? 96  LYS A O    6  
ATOM   8822  C CB   . LYS A 1 96  ? -9.437  -6.418  -2.644  1.00 0.00 ? 96  LYS A CB   6  
ATOM   8823  C CG   . LYS A 1 96  ? -9.923  -7.518  -3.589  1.00 0.00 ? 96  LYS A CG   6  
ATOM   8824  C CD   . LYS A 1 96  ? -11.441 -7.448  -3.778  1.00 0.00 ? 96  LYS A CD   6  
ATOM   8825  C CE   . LYS A 1 96  ? -11.797 -7.091  -5.221  1.00 0.00 ? 96  LYS A CE   6  
ATOM   8826  N NZ   . LYS A 1 96  ? -13.136 -6.462  -5.285  1.00 0.00 ? 96  LYS A NZ   6  
ATOM   8827  H H    . LYS A 1 96  ? -7.245  -6.660  -3.756  1.00 0.00 ? 96  LYS A H    6  
ATOM   8828  H HA   . LYS A 1 96  ? -7.976  -6.104  -1.133  1.00 0.00 ? 96  LYS A HA   6  
ATOM   8829  H HB2  . LYS A 1 96  ? -10.220 -6.178  -1.926  1.00 0.00 ? 96  LYS A HB2  6  
ATOM   8830  H HB3  . LYS A 1 96  ? -9.235  -5.509  -3.211  1.00 0.00 ? 96  LYS A HB3  6  
ATOM   8831  H HG2  . LYS A 1 96  ? -9.428  -7.417  -4.556  1.00 0.00 ? 96  LYS A HG2  6  
ATOM   8832  H HG3  . LYS A 1 96  ? -9.648  -8.494  -3.190  1.00 0.00 ? 96  LYS A HG3  6  
ATOM   8833  H HD2  . LYS A 1 96  ? -11.887 -8.406  -3.515  1.00 0.00 ? 96  LYS A HD2  6  
ATOM   8834  H HD3  . LYS A 1 96  ? -11.860 -6.704  -3.099  1.00 0.00 ? 96  LYS A HD3  6  
ATOM   8835  H HE2  . LYS A 1 96  ? -11.050 -6.409  -5.630  1.00 0.00 ? 96  LYS A HE2  6  
ATOM   8836  H HE3  . LYS A 1 96  ? -11.780 -7.987  -5.839  1.00 0.00 ? 96  LYS A HE3  6  
ATOM   8837  H HZ1  . LYS A 1 96  ? -13.102 -5.562  -4.850  1.00 0.00 ? 96  LYS A HZ1  6  
ATOM   8838  H HZ2  . LYS A 1 96  ? -13.412 -6.361  -6.240  1.00 0.00 ? 96  LYS A HZ2  6  
ATOM   8839  H HZ3  . LYS A 1 96  ? -13.797 -7.039  -4.805  1.00 0.00 ? 96  LYS A HZ3  6  
ATOM   8840  N N    . GLN A 1 97  ? -8.776  -8.190  0.012   1.00 0.00 ? 97  GLN A N    6  
ATOM   8841  C CA   . GLN A 1 97  ? -8.950  -9.413  0.777   1.00 0.00 ? 97  GLN A CA   6  
ATOM   8842  C C    . GLN A 1 97  ? -9.818  -9.152  2.009   1.00 0.00 ? 97  GLN A C    6  
ATOM   8843  O O    . GLN A 1 97  ? -10.934 -9.659  2.106   1.00 0.00 ? 97  GLN A O    6  
ATOM   8844  C CB   . GLN A 1 97  ? -7.597  -10.006 1.177   1.00 0.00 ? 97  GLN A CB   6  
ATOM   8845  C CG   . GLN A 1 97  ? -7.777  -11.310 1.957   1.00 0.00 ? 97  GLN A CG   6  
ATOM   8846  C CD   . GLN A 1 97  ? -7.658  -12.523 1.034   1.00 0.00 ? 97  GLN A CD   6  
ATOM   8847  O OE1  . GLN A 1 97  ? -6.579  -12.918 0.623   1.00 0.00 ? 97  GLN A OE1  6  
ATOM   8848  N NE2  . GLN A 1 97  ? -8.822  -13.090 0.731   1.00 0.00 ? 97  GLN A NE2  6  
ATOM   8849  H H    . GLN A 1 97  ? -9.045  -7.353  0.489   1.00 0.00 ? 97  GLN A H    6  
ATOM   8850  H HA   . GLN A 1 97  ? -9.459  -10.105 0.106   1.00 0.00 ? 97  GLN A HA   6  
ATOM   8851  H HB2  . GLN A 1 97  ? -7.000  -10.193 0.284   1.00 0.00 ? 97  GLN A HB2  6  
ATOM   8852  H HB3  . GLN A 1 97  ? -7.046  -9.288  1.784   1.00 0.00 ? 97  GLN A HB3  6  
ATOM   8853  H HG2  . GLN A 1 97  ? -7.029  -11.373 2.746   1.00 0.00 ? 97  GLN A HG2  6  
ATOM   8854  H HG3  . GLN A 1 97  ? -8.753  -11.313 2.443   1.00 0.00 ? 97  GLN A HG3  6  
ATOM   8855  H HE21 . GLN A 1 97  ? -9.672  -12.715 1.101   1.00 0.00 ? 97  GLN A HE21 6  
ATOM   8856  H HE22 . GLN A 1 97  ? -8.847  -13.891 0.132   1.00 0.00 ? 97  GLN A HE22 6  
ATOM   8857  N N    . GLY A 1 98  ? -9.273  -8.359  2.922   1.00 0.00 ? 98  GLY A N    6  
ATOM   8858  C CA   . GLY A 1 98  ? -9.985  -8.023  4.143   1.00 0.00 ? 98  GLY A CA   6  
ATOM   8859  C C    . GLY A 1 98  ? -9.438  -8.817  5.330   1.00 0.00 ? 98  GLY A C    6  
ATOM   8860  O O    . GLY A 1 98  ? -9.483  -10.046 5.334   1.00 0.00 ? 98  GLY A O    6  
ATOM   8861  H H    . GLY A 1 98  ? -8.364  -7.950  2.834   1.00 0.00 ? 98  GLY A H    6  
ATOM   8862  H HA2  . GLY A 1 98  ? -9.891  -6.955  4.340   1.00 0.00 ? 98  GLY A HA2  6  
ATOM   8863  H HA3  . GLY A 1 98  ? -11.046 -8.233  4.017   1.00 0.00 ? 98  GLY A HA3  6  
ATOM   8864  N N    . ALA A 1 99  ? -8.933  -8.083  6.311   1.00 0.00 ? 99  ALA A N    6  
ATOM   8865  C CA   . ALA A 1 99  ? -8.380  -8.702  7.503   1.00 0.00 ? 99  ALA A CA   6  
ATOM   8866  C C    . ALA A 1 99  ? -8.055  -7.618  8.532   1.00 0.00 ? 99  ALA A C    6  
ATOM   8867  O O    . ALA A 1 99  ? -8.313  -6.438  8.299   1.00 0.00 ? 99  ALA A O    6  
ATOM   8868  C CB   . ALA A 1 99  ? -7.151  -9.532  7.122   1.00 0.00 ? 99  ALA A CB   6  
ATOM   8869  H H    . ALA A 1 99  ? -8.902  -7.082  6.300   1.00 0.00 ? 99  ALA A H    6  
ATOM   8870  H HA   . ALA A 1 99  ? -9.139  -9.367  7.913   1.00 0.00 ? 99  ALA A HA   6  
ATOM   8871  H HB1  . ALA A 1 99  ? -6.391  -8.879  6.696   1.00 0.00 ? 99  ALA A HB1  6  
ATOM   8872  H HB2  . ALA A 1 99  ? -6.754  -10.021 8.012   1.00 0.00 ? 99  ALA A HB2  6  
ATOM   8873  H HB3  . ALA A 1 99  ? -7.435  -10.286 6.389   1.00 0.00 ? 99  ALA A HB3  6  
ATOM   8874  N N    . ILE A 1 100 ? -7.494  -8.056  9.649   1.00 0.00 ? 100 ILE A N    6  
ATOM   8875  C CA   . ILE A 1 100 ? -7.132  -7.139  10.715  1.00 0.00 ? 100 ILE A CA   6  
ATOM   8876  C C    . ILE A 1 100 ? -5.792  -7.568  11.320  1.00 0.00 ? 100 ILE A C    6  
ATOM   8877  O O    . ILE A 1 100 ? -5.208  -8.564  10.898  1.00 0.00 ? 100 ILE A O    6  
ATOM   8878  C CB   . ILE A 1 100 ? -8.263  -7.033  11.739  1.00 0.00 ? 100 ILE A CB   6  
ATOM   8879  C CG1  . ILE A 1 100 ? -8.586  -8.402  12.343  1.00 0.00 ? 100 ILE A CG1  6  
ATOM   8880  C CG2  . ILE A 1 100 ? -9.498  -6.371  11.126  1.00 0.00 ? 100 ILE A CG2  6  
ATOM   8881  C CD1  . ILE A 1 100 ? -8.039  -8.515  13.768  1.00 0.00 ? 100 ILE A CD1  6  
ATOM   8882  H H    . ILE A 1 100 ? -7.288  -9.018  9.831   1.00 0.00 ? 100 ILE A H    6  
ATOM   8883  H HA   . ILE A 1 100 ? -7.007  -6.152  10.269  1.00 0.00 ? 100 ILE A HA   6  
ATOM   8884  H HB   . ILE A 1 100 ? -7.927  -6.393  12.555  1.00 0.00 ? 100 ILE A HB   6  
ATOM   8885  H HG12 . ILE A 1 100 ? -9.665  -8.553  12.351  1.00 0.00 ? 100 ILE A HG12 6  
ATOM   8886  H HG13 . ILE A 1 100 ? -8.158  -9.187  11.720  1.00 0.00 ? 100 ILE A HG13 6  
ATOM   8887  H HG21 . ILE A 1 100 ? -9.192  -5.717  10.310  1.00 0.00 ? 100 ILE A HG21 6  
ATOM   8888  H HG22 . ILE A 1 100 ? -10.169 -7.139  10.742  1.00 0.00 ? 100 ILE A HG22 6  
ATOM   8889  H HG23 . ILE A 1 100 ? -10.013 -5.786  11.887  1.00 0.00 ? 100 ILE A HG23 6  
ATOM   8890  H HD11 . ILE A 1 100 ? -6.989  -8.808  13.731  1.00 0.00 ? 100 ILE A HD11 6  
ATOM   8891  H HD12 . ILE A 1 100 ? -8.130  -7.552  14.270  1.00 0.00 ? 100 ILE A HD12 6  
ATOM   8892  H HD13 . ILE A 1 100 ? -8.608  -9.267  14.316  1.00 0.00 ? 100 ILE A HD13 6  
ATOM   8893  N N    . TYR A 1 101 ? -5.347  -6.797  12.300  1.00 0.00 ? 101 TYR A N    6  
ATOM   8894  C CA   . TYR A 1 101 ? -4.090  -7.085  12.966  1.00 0.00 ? 101 TYR A CA   6  
ATOM   8895  C C    . TYR A 1 101 ? -4.240  -6.986  14.486  1.00 0.00 ? 101 TYR A C    6  
ATOM   8896  O O    . TYR A 1 101 ? -4.967  -7.770  15.095  1.00 0.00 ? 101 TYR A O    6  
ATOM   8897  C CB   . TYR A 1 101 ? -3.105  -6.013  12.493  1.00 0.00 ? 101 TYR A CB   6  
ATOM   8898  C CG   . TYR A 1 101 ? -1.641  -6.457  12.522  1.00 0.00 ? 101 TYR A CG   6  
ATOM   8899  C CD1  . TYR A 1 101 ? -1.275  -7.669  11.973  1.00 0.00 ? 101 TYR A CD1  6  
ATOM   8900  C CD2  . TYR A 1 101 ? -0.685  -5.643  13.098  1.00 0.00 ? 101 TYR A CD2  6  
ATOM   8901  C CE1  . TYR A 1 101 ? 0.103   -8.085  12.002  1.00 0.00 ? 101 TYR A CE1  6  
ATOM   8902  C CE2  . TYR A 1 101 ? 0.692   -6.060  13.125  1.00 0.00 ? 101 TYR A CE2  6  
ATOM   8903  C CZ   . TYR A 1 101 ? 1.018   -7.261  12.577  1.00 0.00 ? 101 TYR A CZ   6  
ATOM   8904  O OH   . TYR A 1 101 ? 2.319   -7.654  12.602  1.00 0.00 ? 101 TYR A OH   6  
ATOM   8905  H H    . TYR A 1 101 ? -5.829  -5.988  12.638  1.00 0.00 ? 101 TYR A H    6  
ATOM   8906  H HA   . TYR A 1 101 ? -3.794  -8.101  12.703  1.00 0.00 ? 101 TYR A HA   6  
ATOM   8907  H HB2  . TYR A 1 101 ? -3.365  -5.720  11.475  1.00 0.00 ? 101 TYR A HB2  6  
ATOM   8908  H HB3  . TYR A 1 101 ? -3.219  -5.127  13.118  1.00 0.00 ? 101 TYR A HB3  6  
ATOM   8909  H HD1  . TYR A 1 101 ? -2.030  -8.311  11.519  1.00 0.00 ? 101 TYR A HD1  6  
ATOM   8910  H HD2  . TYR A 1 101 ? -0.974  -4.685  13.531  1.00 0.00 ? 101 TYR A HD2  6  
ATOM   8911  H HE1  . TYR A 1 101 ? 0.405   -9.040  11.572  1.00 0.00 ? 101 TYR A HE1  6  
ATOM   8912  H HE2  . TYR A 1 101 ? 1.457   -5.427  13.576  1.00 0.00 ? 101 TYR A HE2  6  
ATOM   8913  H HH   . TYR A 1 101 ? 2.425   -8.448  13.200  1.00 0.00 ? 101 TYR A HH   6  
ATOM   8914  N N    . GLY A 1 1   ? -9.557  -14.387 -17.078 1.00 0.00 ? 1   GLY A N    7  
ATOM   8915  C CA   . GLY A 1 1   ? -10.362 -13.851 -18.163 1.00 0.00 ? 1   GLY A CA   7  
ATOM   8916  C C    . GLY A 1 1   ? -10.323 -12.322 -18.172 1.00 0.00 ? 1   GLY A C    7  
ATOM   8917  O O    . GLY A 1 1   ? -10.024 -11.700 -17.154 1.00 0.00 ? 1   GLY A O    7  
ATOM   8918  H H1   . GLY A 1 1   ? -8.994  -13.715 -16.599 1.00 0.00 ? 1   GLY A H1   7  
ATOM   8919  H HA2  . GLY A 1 1   ? -9.994  -14.232 -19.116 1.00 0.00 ? 1   GLY A HA2  7  
ATOM   8920  H HA3  . GLY A 1 1   ? -11.392 -14.192 -18.060 1.00 0.00 ? 1   GLY A HA3  7  
ATOM   8921  N N    . PRO A 1 2   ? -10.639 -11.745 -19.362 1.00 0.00 ? 2   PRO A N    7  
ATOM   8922  C CA   . PRO A 1 2   ? -10.643 -10.300 -19.516 1.00 0.00 ? 2   PRO A CA   7  
ATOM   8923  C C    . PRO A 1 2   ? -11.874 -9.681  -18.851 1.00 0.00 ? 2   PRO A C    7  
ATOM   8924  O O    . PRO A 1 2   ? -12.818 -9.284  -19.532 1.00 0.00 ? 2   PRO A O    7  
ATOM   8925  C CB   . PRO A 1 2   ? -10.599 -10.065 -21.017 1.00 0.00 ? 2   PRO A CB   7  
ATOM   8926  C CG   . PRO A 1 2   ? -11.040 -11.372 -21.658 1.00 0.00 ? 2   PRO A CG   7  
ATOM   8927  C CD   . PRO A 1 2   ? -11.000 -12.450 -20.588 1.00 0.00 ? 2   PRO A CD   7  
ATOM   8928  H HA   . PRO A 1 2   ? -9.852  -9.900  -19.054 1.00 0.00 ? 2   PRO A HA   7  
ATOM   8929  H HB2  . PRO A 1 2   ? -11.259 -9.246  -21.304 1.00 0.00 ? 2   PRO A HB2  7  
ATOM   8930  H HB3  . PRO A 1 2   ? -9.595  -9.790  -21.339 1.00 0.00 ? 2   PRO A HB3  7  
ATOM   8931  H HG2  . PRO A 1 2   ? -12.045 -11.275 -22.067 1.00 0.00 ? 2   PRO A HG2  7  
ATOM   8932  H HG3  . PRO A 1 2   ? -10.380 -11.630 -22.487 1.00 0.00 ? 2   PRO A HG3  7  
ATOM   8933  H HD2  . PRO A 1 2   ? -11.966 -12.946 -20.491 1.00 0.00 ? 2   PRO A HD2  7  
ATOM   8934  H HD3  . PRO A 1 2   ? -10.269 -13.221 -20.831 1.00 0.00 ? 2   PRO A HD3  7  
ATOM   8935  N N    . LEU A 1 3   ? -11.823 -9.620  -17.527 1.00 0.00 ? 3   LEU A N    7  
ATOM   8936  C CA   . LEU A 1 3   ? -12.923 -9.055  -16.763 1.00 0.00 ? 3   LEU A CA   7  
ATOM   8937  C C    . LEU A 1 3   ? -12.651 -7.572  -16.504 1.00 0.00 ? 3   LEU A C    7  
ATOM   8938  O O    . LEU A 1 3   ? -11.497 -7.153  -16.431 1.00 0.00 ? 3   LEU A O    7  
ATOM   8939  C CB   . LEU A 1 3   ? -13.159 -9.868  -15.487 1.00 0.00 ? 3   LEU A CB   7  
ATOM   8940  C CG   . LEU A 1 3   ? -14.319 -10.863 -15.533 1.00 0.00 ? 3   LEU A CG   7  
ATOM   8941  C CD1  . LEU A 1 3   ? -14.060 -12.051 -14.604 1.00 0.00 ? 3   LEU A CD1  7  
ATOM   8942  C CD2  . LEU A 1 3   ? -15.648 -10.171 -15.219 1.00 0.00 ? 3   LEU A CD2  7  
ATOM   8943  H H    . LEU A 1 3   ? -11.052 -9.944  -16.982 1.00 0.00 ? 3   LEU A H    7  
ATOM   8944  H HA   . LEU A 1 3   ? -13.822 -9.141  -17.371 1.00 0.00 ? 3   LEU A HA   7  
ATOM   8945  H HB2  . LEU A 1 3   ? -12.246 -10.416 -15.254 1.00 0.00 ? 3   LEU A HB2  7  
ATOM   8946  H HB3  . LEU A 1 3   ? -13.333 -9.174  -14.664 1.00 0.00 ? 3   LEU A HB3  7  
ATOM   8947  H HG   . LEU A 1 3   ? -14.394 -11.257 -16.547 1.00 0.00 ? 3   LEU A HG   7  
ATOM   8948  H HD11 . LEU A 1 3   ? -13.119 -12.530 -14.879 1.00 0.00 ? 3   LEU A HD11 7  
ATOM   8949  H HD12 . LEU A 1 3   ? -14.002 -11.700 -13.573 1.00 0.00 ? 3   LEU A HD12 7  
ATOM   8950  H HD13 . LEU A 1 3   ? -14.874 -12.771 -14.698 1.00 0.00 ? 3   LEU A HD13 7  
ATOM   8951  H HD21 . LEU A 1 3   ? -15.630 -9.155  -15.614 1.00 0.00 ? 3   LEU A HD21 7  
ATOM   8952  H HD22 . LEU A 1 3   ? -16.466 -10.727 -15.683 1.00 0.00 ? 3   LEU A HD22 7  
ATOM   8953  H HD23 . LEU A 1 3   ? -15.797 -10.140 -14.140 1.00 0.00 ? 3   LEU A HD23 7  
ATOM   8954  N N    . GLY A 1 4   ? -13.732 -6.819  -16.375 1.00 0.00 ? 4   GLY A N    7  
ATOM   8955  C CA   . GLY A 1 4   ? -13.627 -5.391  -16.127 1.00 0.00 ? 4   GLY A CA   7  
ATOM   8956  C C    . GLY A 1 4   ? -14.776 -4.901  -15.245 1.00 0.00 ? 4   GLY A C    7  
ATOM   8957  O O    . GLY A 1 4   ? -15.859 -4.601  -15.743 1.00 0.00 ? 4   GLY A O    7  
ATOM   8958  H H    . GLY A 1 4   ? -14.668 -7.168  -16.437 1.00 0.00 ? 4   GLY A H    7  
ATOM   8959  H HA2  . GLY A 1 4   ? -12.674 -5.173  -15.645 1.00 0.00 ? 4   GLY A HA2  7  
ATOM   8960  H HA3  . GLY A 1 4   ? -13.635 -4.853  -17.076 1.00 0.00 ? 4   GLY A HA3  7  
ATOM   8961  N N    . SER A 1 5   ? -14.499 -4.831  -13.951 1.00 0.00 ? 5   SER A N    7  
ATOM   8962  C CA   . SER A 1 5   ? -15.495 -4.382  -12.997 1.00 0.00 ? 5   SER A CA   7  
ATOM   8963  C C    . SER A 1 5   ? -14.945 -3.216  -12.173 1.00 0.00 ? 5   SER A C    7  
ATOM   8964  O O    . SER A 1 5   ? -13.756 -2.905  -12.250 1.00 0.00 ? 5   SER A O    7  
ATOM   8965  C CB   . SER A 1 5   ? -15.930 -5.523  -12.076 1.00 0.00 ? 5   SER A CB   7  
ATOM   8966  O OG   . SER A 1 5   ? -16.792 -6.445  -12.737 1.00 0.00 ? 5   SER A OG   7  
ATOM   8967  H H    . SER A 1 5   ? -13.613 -5.076  -13.556 1.00 0.00 ? 5   SER A H    7  
ATOM   8968  H HA   . SER A 1 5   ? -16.345 -4.057  -13.597 1.00 0.00 ? 5   SER A HA   7  
ATOM   8969  H HB2  . SER A 1 5   ? -15.048 -6.049  -11.709 1.00 0.00 ? 5   SER A HB2  7  
ATOM   8970  H HB3  . SER A 1 5   ? -16.441 -5.112  -11.204 1.00 0.00 ? 5   SER A HB3  7  
ATOM   8971  H HG   . SER A 1 5   ? -17.730 -6.099  -12.739 1.00 0.00 ? 5   SER A HG   7  
ATOM   8972  N N    . LEU A 1 6   ? -15.832 -2.603  -11.403 1.00 0.00 ? 6   LEU A N    7  
ATOM   8973  C CA   . LEU A 1 6   ? -15.449 -1.480  -10.566 1.00 0.00 ? 6   LEU A CA   7  
ATOM   8974  C C    . LEU A 1 6   ? -15.799 -1.792  -9.109  1.00 0.00 ? 6   LEU A C    7  
ATOM   8975  O O    . LEU A 1 6   ? -16.954 -1.664  -8.704  1.00 0.00 ? 6   LEU A O    7  
ATOM   8976  C CB   . LEU A 1 6   ? -16.076 -0.186  -11.086 1.00 0.00 ? 6   LEU A CB   7  
ATOM   8977  C CG   . LEU A 1 6   ? -15.285 1.098   -10.823 1.00 0.00 ? 6   LEU A CG   7  
ATOM   8978  C CD1  . LEU A 1 6   ? -14.351 1.416   -11.992 1.00 0.00 ? 6   LEU A CD1  7  
ATOM   8979  C CD2  . LEU A 1 6   ? -16.222 2.263   -10.502 1.00 0.00 ? 6   LEU A CD2  7  
ATOM   8980  H H    . LEU A 1 6   ? -16.795 -2.864  -11.345 1.00 0.00 ? 6   LEU A H    7  
ATOM   8981  H HA   . LEU A 1 6   ? -14.367 -1.368  -10.645 1.00 0.00 ? 6   LEU A HA   7  
ATOM   8982  H HB2  . LEU A 1 6   ? -16.222 -0.283  -12.163 1.00 0.00 ? 6   LEU A HB2  7  
ATOM   8983  H HB3  . LEU A 1 6   ? -17.064 -0.078  -10.638 1.00 0.00 ? 6   LEU A HB3  7  
ATOM   8984  H HG   . LEU A 1 6   ? -14.659 0.939   -9.945  1.00 0.00 ? 6   LEU A HG   7  
ATOM   8985  H HD11 . LEU A 1 6   ? -13.587 2.121   -11.664 1.00 0.00 ? 6   LEU A HD11 7  
ATOM   8986  H HD12 . LEU A 1 6   ? -13.877 0.499   -12.340 1.00 0.00 ? 6   LEU A HD12 7  
ATOM   8987  H HD13 . LEU A 1 6   ? -14.928 1.859   -12.806 1.00 0.00 ? 6   LEU A HD13 7  
ATOM   8988  H HD21 . LEU A 1 6   ? -16.059 3.068   -11.219 1.00 0.00 ? 6   LEU A HD21 7  
ATOM   8989  H HD22 . LEU A 1 6   ? -17.256 1.925   -10.564 1.00 0.00 ? 6   LEU A HD22 7  
ATOM   8990  H HD23 . LEU A 1 6   ? -16.019 2.627   -9.494  1.00 0.00 ? 6   LEU A HD23 7  
ATOM   8991  N N    . ARG A 1 7   ? -14.781 -2.193  -8.363  1.00 0.00 ? 7   ARG A N    7  
ATOM   8992  C CA   . ARG A 1 7   ? -14.966 -2.522  -6.960  1.00 0.00 ? 7   ARG A CA   7  
ATOM   8993  C C    . ARG A 1 7   ? -13.680 -3.111  -6.378  1.00 0.00 ? 7   ARG A C    7  
ATOM   8994  O O    . ARG A 1 7   ? -12.765 -3.464  -7.118  1.00 0.00 ? 7   ARG A O    7  
ATOM   8995  C CB   . ARG A 1 7   ? -16.108 -3.525  -6.776  1.00 0.00 ? 7   ARG A CB   7  
ATOM   8996  C CG   . ARG A 1 7   ? -17.285 -2.886  -6.037  1.00 0.00 ? 7   ARG A CG   7  
ATOM   8997  C CD   . ARG A 1 7   ? -18.614 -3.490  -6.496  1.00 0.00 ? 7   ARG A CD   7  
ATOM   8998  N NE   . ARG A 1 7   ? -19.534 -2.415  -6.931  1.00 0.00 ? 7   ARG A NE   7  
ATOM   8999  C CZ   . ARG A 1 7   ? -20.818 -2.614  -7.261  1.00 0.00 ? 7   ARG A CZ   7  
ATOM   9000  N NH1  . ARG A 1 7   ? -21.340 -3.846  -7.210  1.00 0.00 ? 7   ARG A NH1  7  
ATOM   9001  N NH2  . ARG A 1 7   ? -21.578 -1.579  -7.643  1.00 0.00 ? 7   ARG A NH2  7  
ATOM   9002  H H    . ARG A 1 7   ? -13.845 -2.291  -8.699  1.00 0.00 ? 7   ARG A H    7  
ATOM   9003  H HA   . ARG A 1 7   ? -15.216 -1.575  -6.482  1.00 0.00 ? 7   ARG A HA   7  
ATOM   9004  H HB2  . ARG A 1 7   ? -16.438 -3.886  -7.749  1.00 0.00 ? 7   ARG A HB2  7  
ATOM   9005  H HB3  . ARG A 1 7   ? -15.750 -4.389  -6.219  1.00 0.00 ? 7   ARG A HB3  7  
ATOM   9006  H HG2  . ARG A 1 7   ? -17.168 -3.033  -4.963  1.00 0.00 ? 7   ARG A HG2  7  
ATOM   9007  H HG3  . ARG A 1 7   ? -17.290 -1.810  -6.212  1.00 0.00 ? 7   ARG A HG3  7  
ATOM   9008  H HD2  . ARG A 1 7   ? -18.441 -4.187  -7.317  1.00 0.00 ? 7   ARG A HD2  7  
ATOM   9009  H HD3  . ARG A 1 7   ? -19.065 -4.060  -5.684  1.00 0.00 ? 7   ARG A HD3  7  
ATOM   9010  H HE   . ARG A 1 7   ? -19.176 -1.482  -6.980  1.00 0.00 ? 7   ARG A HE   7  
ATOM   9011  H HH11 . ARG A 1 7   ? -20.771 -4.619  -6.925  1.00 0.00 ? 7   ARG A HH11 7  
ATOM   9012  H HH12 . ARG A 1 7   ? -22.297 -3.994  -7.458  1.00 0.00 ? 7   ARG A HH12 7  
ATOM   9013  H HH21 . ARG A 1 7   ? -21.189 -0.659  -7.682  1.00 0.00 ? 7   ARG A HH21 7  
ATOM   9014  H HH22 . ARG A 1 7   ? -22.536 -1.727  -7.890  1.00 0.00 ? 7   ARG A HH22 7  
ATOM   9015  N N    . LYS A 1 8   ? -13.652 -3.201  -5.055  1.00 0.00 ? 8   LYS A N    7  
ATOM   9016  C CA   . LYS A 1 8   ? -12.494 -3.741  -4.366  1.00 0.00 ? 8   LYS A CA   7  
ATOM   9017  C C    . LYS A 1 8   ? -12.034 -5.016  -5.075  1.00 0.00 ? 8   LYS A C    7  
ATOM   9018  O O    . LYS A 1 8   ? -12.829 -5.927  -5.300  1.00 0.00 ? 8   LYS A O    7  
ATOM   9019  C CB   . LYS A 1 8   ? -12.799 -3.939  -2.881  1.00 0.00 ? 8   LYS A CB   7  
ATOM   9020  C CG   . LYS A 1 8   ? -12.500 -2.665  -2.085  1.00 0.00 ? 8   LYS A CG   7  
ATOM   9021  C CD   . LYS A 1 8   ? -13.772 -1.844  -1.868  1.00 0.00 ? 8   LYS A CD   7  
ATOM   9022  C CE   . LYS A 1 8   ? -13.464 -0.542  -1.126  1.00 0.00 ? 8   LYS A CE   7  
ATOM   9023  N NZ   . LYS A 1 8   ? -13.212 0.554   -2.088  1.00 0.00 ? 8   LYS A NZ   7  
ATOM   9024  H H    . LYS A 1 8   ? -14.402 -2.911  -4.461  1.00 0.00 ? 8   LYS A H    7  
ATOM   9025  H HA   . LYS A 1 8   ? -11.696 -3.000  -4.437  1.00 0.00 ? 8   LYS A HA   7  
ATOM   9026  H HB2  . LYS A 1 8   ? -13.846 -4.214  -2.753  1.00 0.00 ? 8   LYS A HB2  7  
ATOM   9027  H HB3  . LYS A 1 8   ? -12.205 -4.764  -2.489  1.00 0.00 ? 8   LYS A HB3  7  
ATOM   9028  H HG2  . LYS A 1 8   ? -12.064 -2.928  -1.121  1.00 0.00 ? 8   LYS A HG2  7  
ATOM   9029  H HG3  . LYS A 1 8   ? -11.762 -2.066  -2.618  1.00 0.00 ? 8   LYS A HG3  7  
ATOM   9030  H HD2  . LYS A 1 8   ? -14.233 -1.619  -2.829  1.00 0.00 ? 8   LYS A HD2  7  
ATOM   9031  H HD3  . LYS A 1 8   ? -14.495 -2.428  -1.298  1.00 0.00 ? 8   LYS A HD3  7  
ATOM   9032  H HE2  . LYS A 1 8   ? -14.299 -0.279  -0.476  1.00 0.00 ? 8   LYS A HE2  7  
ATOM   9033  H HE3  . LYS A 1 8   ? -12.593 -0.678  -0.486  1.00 0.00 ? 8   LYS A HE3  7  
ATOM   9034  H HZ1  . LYS A 1 8   ? -12.812 1.336   -1.608  1.00 0.00 ? 8   LYS A HZ1  7  
ATOM   9035  H HZ2  . LYS A 1 8   ? -12.579 0.239   -2.796  1.00 0.00 ? 8   LYS A HZ2  7  
ATOM   9036  H HZ3  . LYS A 1 8   ? -14.075 0.831   -2.512  1.00 0.00 ? 8   LYS A HZ3  7  
ATOM   9037  N N    . GLU A 1 9   ? -10.751 -5.040  -5.407  1.00 0.00 ? 9   GLU A N    7  
ATOM   9038  C CA   . GLU A 1 9   ? -10.175 -6.189  -6.084  1.00 0.00 ? 9   GLU A CA   7  
ATOM   9039  C C    . GLU A 1 9   ? -8.653  -6.053  -6.162  1.00 0.00 ? 9   GLU A C    7  
ATOM   9040  O O    . GLU A 1 9   ? -8.103  -5.007  -5.822  1.00 0.00 ? 9   GLU A O    7  
ATOM   9041  C CB   . GLU A 1 9   ? -10.782 -6.364  -7.479  1.00 0.00 ? 9   GLU A CB   7  
ATOM   9042  C CG   . GLU A 1 9   ? -11.692 -7.592  -7.531  1.00 0.00 ? 9   GLU A CG   7  
ATOM   9043  C CD   . GLU A 1 9   ? -11.918 -8.044  -8.975  1.00 0.00 ? 9   GLU A CD   7  
ATOM   9044  O OE1  . GLU A 1 9   ? -11.041 -8.772  -9.486  1.00 0.00 ? 9   GLU A OE1  7  
ATOM   9045  O OE2  . GLU A 1 9   ? -12.966 -7.653  -9.534  1.00 0.00 ? 9   GLU A OE2  7  
ATOM   9046  H H    . GLU A 1 9   ? -10.111 -4.297  -5.220  1.00 0.00 ? 9   GLU A H    7  
ATOM   9047  H HA   . GLU A 1 9   ? -10.438 -7.051  -5.471  1.00 0.00 ? 9   GLU A HA   7  
ATOM   9048  H HB2  . GLU A 1 9   ? -11.350 -5.473  -7.745  1.00 0.00 ? 9   GLU A HB2  7  
ATOM   9049  H HB3  . GLU A 1 9   ? -9.985  -6.465  -8.216  1.00 0.00 ? 9   GLU A HB3  7  
ATOM   9050  H HG2  . GLU A 1 9   ? -11.246 -8.405  -6.958  1.00 0.00 ? 9   GLU A HG2  7  
ATOM   9051  H HG3  . GLU A 1 9   ? -12.649 -7.360  -7.064  1.00 0.00 ? 9   GLU A HG3  7  
ATOM   9052  N N    . PRO A 1 10  ? -8.000  -7.154  -6.620  1.00 0.00 ? 10  PRO A N    7  
ATOM   9053  C CA   . PRO A 1 10  ? -6.553  -7.166  -6.746  1.00 0.00 ? 10  PRO A CA   7  
ATOM   9054  C C    . PRO A 1 10  ? -6.100  -6.349  -7.957  1.00 0.00 ? 10  PRO A C    7  
ATOM   9055  O O    . PRO A 1 10  ? -6.619  -6.525  -9.059  1.00 0.00 ? 10  PRO A O    7  
ATOM   9056  C CB   . PRO A 1 10  ? -6.180  -8.637  -6.849  1.00 0.00 ? 10  PRO A CB   7  
ATOM   9057  C CG   . PRO A 1 10  ? -7.454  -9.364  -7.243  1.00 0.00 ? 10  PRO A CG   7  
ATOM   9058  C CD   . PRO A 1 10  ? -8.618  -8.410  -7.032  1.00 0.00 ? 10  PRO A CD   7  
ATOM   9059  H HA   . PRO A 1 10  ? -6.131  -6.732  -5.950  1.00 0.00 ? 10  PRO A HA   7  
ATOM   9060  H HB2  . PRO A 1 10  ? -5.397  -8.790  -7.591  1.00 0.00 ? 10  PRO A HB2  7  
ATOM   9061  H HB3  . PRO A 1 10  ? -5.796  -9.010  -5.899  1.00 0.00 ? 10  PRO A HB3  7  
ATOM   9062  H HG2  . PRO A 1 10  ? -7.407  -9.681  -8.286  1.00 0.00 ? 10  PRO A HG2  7  
ATOM   9063  H HG3  . PRO A 1 10  ? -7.584  -10.264 -6.642  1.00 0.00 ? 10  PRO A HG3  7  
ATOM   9064  H HD2  . PRO A 1 10  ? -9.200  -8.285  -7.946  1.00 0.00 ? 10  PRO A HD2  7  
ATOM   9065  H HD3  . PRO A 1 10  ? -9.303  -8.783  -6.268  1.00 0.00 ? 10  PRO A HD3  7  
ATOM   9066  N N    . GLU A 1 11  ? -5.137  -5.471  -7.713  1.00 0.00 ? 11  GLU A N    7  
ATOM   9067  C CA   . GLU A 1 11  ? -4.609  -4.628  -8.771  1.00 0.00 ? 11  GLU A CA   7  
ATOM   9068  C C    . GLU A 1 11  ? -3.639  -3.595  -8.190  1.00 0.00 ? 11  GLU A C    7  
ATOM   9069  O O    . GLU A 1 11  ? -3.348  -3.614  -6.995  1.00 0.00 ? 11  GLU A O    7  
ATOM   9070  C CB   . GLU A 1 11  ? -5.740  -3.945  -9.544  1.00 0.00 ? 11  GLU A CB   7  
ATOM   9071  C CG   . GLU A 1 11  ? -5.688  -4.313  -11.029 1.00 0.00 ? 11  GLU A CG   7  
ATOM   9072  C CD   . GLU A 1 11  ? -7.072  -4.197  -11.668 1.00 0.00 ? 11  GLU A CD   7  
ATOM   9073  O OE1  . GLU A 1 11  ? -7.491  -3.044  -11.911 1.00 0.00 ? 11  GLU A OE1  7  
ATOM   9074  O OE2  . GLU A 1 11  ? -7.679  -5.263  -11.903 1.00 0.00 ? 11  GLU A OE2  7  
ATOM   9075  H H    . GLU A 1 11  ? -4.721  -5.336  -6.815  1.00 0.00 ? 11  GLU A H    7  
ATOM   9076  H HA   . GLU A 1 11  ? -4.074  -5.300  -9.440  1.00 0.00 ? 11  GLU A HA   7  
ATOM   9077  H HB2  . GLU A 1 11  ? -6.701  -4.241  -9.125  1.00 0.00 ? 11  GLU A HB2  7  
ATOM   9078  H HB3  . GLU A 1 11  ? -5.662  -2.864  -9.430  1.00 0.00 ? 11  GLU A HB3  7  
ATOM   9079  H HG2  . GLU A 1 11  ? -4.988  -3.658  -11.545 1.00 0.00 ? 11  GLU A HG2  7  
ATOM   9080  H HG3  . GLU A 1 11  ? -5.314  -5.331  -11.141 1.00 0.00 ? 11  GLU A HG3  7  
ATOM   9081  N N    . ILE A 1 12  ? -3.168  -2.716  -9.063  1.00 0.00 ? 12  ILE A N    7  
ATOM   9082  C CA   . ILE A 1 12  ? -2.239  -1.678  -8.652  1.00 0.00 ? 12  ILE A CA   7  
ATOM   9083  C C    . ILE A 1 12  ? -3.002  -0.368  -8.448  1.00 0.00 ? 12  ILE A C    7  
ATOM   9084  O O    . ILE A 1 12  ? -3.629  0.140   -9.376  1.00 0.00 ? 12  ILE A O    7  
ATOM   9085  C CB   . ILE A 1 12  ? -1.084  -1.568  -9.651  1.00 0.00 ? 12  ILE A CB   7  
ATOM   9086  C CG1  . ILE A 1 12  ? 0.090   -0.795  -9.045  1.00 0.00 ? 12  ILE A CG1  7  
ATOM   9087  C CG2  . ILE A 1 12  ? -1.557  -0.954  -10.970 1.00 0.00 ? 12  ILE A CG2  7  
ATOM   9088  C CD1  . ILE A 1 12  ? -0.346  0.601   -8.595  1.00 0.00 ? 12  ILE A CD1  7  
ATOM   9089  H H    . ILE A 1 12  ? -3.410  -2.706  -10.033 1.00 0.00 ? 12  ILE A H    7  
ATOM   9090  H HA   . ILE A 1 12  ? -1.811  -1.981  -7.698  1.00 0.00 ? 12  ILE A HA   7  
ATOM   9091  H HB   . ILE A 1 12  ? -0.728  -2.573  -9.873  1.00 0.00 ? 12  ILE A HB   7  
ATOM   9092  H HG12 . ILE A 1 12  ? 0.494   -1.346  -8.198  1.00 0.00 ? 12  ILE A HG12 7  
ATOM   9093  H HG13 . ILE A 1 12  ? 0.891   -0.709  -9.782  1.00 0.00 ? 12  ILE A HG13 7  
ATOM   9094  H HG21 . ILE A 1 12  ? -2.341  -1.576  -11.400 1.00 0.00 ? 12  ILE A HG21 7  
ATOM   9095  H HG22 . ILE A 1 12  ? -1.947  0.047   -10.785 1.00 0.00 ? 12  ILE A HG22 7  
ATOM   9096  H HG23 . ILE A 1 12  ? -0.718  -0.893  -11.663 1.00 0.00 ? 12  ILE A HG23 7  
ATOM   9097  H HD11 . ILE A 1 12  ? 0.500   1.286   -8.662  1.00 0.00 ? 12  ILE A HD11 7  
ATOM   9098  H HD12 . ILE A 1 12  ? -1.151  0.955   -9.236  1.00 0.00 ? 12  ILE A HD12 7  
ATOM   9099  H HD13 . ILE A 1 12  ? -0.697  0.555   -7.564  1.00 0.00 ? 12  ILE A HD13 7  
ATOM   9100  N N    . ILE A 1 13  ? -2.924  0.140   -7.226  1.00 0.00 ? 13  ILE A N    7  
ATOM   9101  C CA   . ILE A 1 13  ? -3.600  1.381   -6.888  1.00 0.00 ? 13  ILE A CA   7  
ATOM   9102  C C    . ILE A 1 13  ? -2.564  2.496   -6.737  1.00 0.00 ? 13  ILE A C    7  
ATOM   9103  O O    . ILE A 1 13  ? -1.430  2.244   -6.332  1.00 0.00 ? 13  ILE A O    7  
ATOM   9104  C CB   . ILE A 1 13  ? -4.484  1.191   -5.653  1.00 0.00 ? 13  ILE A CB   7  
ATOM   9105  C CG1  . ILE A 1 13  ? -4.944  -0.263  -5.528  1.00 0.00 ? 13  ILE A CG1  7  
ATOM   9106  C CG2  . ILE A 1 13  ? -5.662  2.167   -5.666  1.00 0.00 ? 13  ILE A CG2  7  
ATOM   9107  C CD1  . ILE A 1 13  ? -6.099  -0.387  -4.533  1.00 0.00 ? 13  ILE A CD1  7  
ATOM   9108  H H    . ILE A 1 13  ? -2.413  -0.279  -6.477  1.00 0.00 ? 13  ILE A H    7  
ATOM   9109  H HA   . ILE A 1 13  ? -4.259  1.632   -7.720  1.00 0.00 ? 13  ILE A HA   7  
ATOM   9110  H HB   . ILE A 1 13  ? -3.888  1.418   -4.769  1.00 0.00 ? 13  ILE A HB   7  
ATOM   9111  H HG12 . ILE A 1 13  ? -5.259  -0.634  -6.504  1.00 0.00 ? 13  ILE A HG12 7  
ATOM   9112  H HG13 . ILE A 1 13  ? -4.111  -0.885  -5.203  1.00 0.00 ? 13  ILE A HG13 7  
ATOM   9113  H HG21 . ILE A 1 13  ? -5.931  2.425   -4.643  1.00 0.00 ? 13  ILE A HG21 7  
ATOM   9114  H HG22 . ILE A 1 13  ? -5.381  3.070   -6.208  1.00 0.00 ? 13  ILE A HG22 7  
ATOM   9115  H HG23 . ILE A 1 13  ? -6.515  1.700   -6.160  1.00 0.00 ? 13  ILE A HG23 7  
ATOM   9116  H HD11 . ILE A 1 13  ? -6.933  0.234   -4.863  1.00 0.00 ? 13  ILE A HD11 7  
ATOM   9117  H HD12 . ILE A 1 13  ? -6.422  -1.427  -4.478  1.00 0.00 ? 13  ILE A HD12 7  
ATOM   9118  H HD13 . ILE A 1 13  ? -5.768  -0.058  -3.549  1.00 0.00 ? 13  ILE A HD13 7  
ATOM   9119  N N    . THR A 1 14  ? -2.991  3.707   -7.069  1.00 0.00 ? 14  THR A N    7  
ATOM   9120  C CA   . THR A 1 14  ? -2.114  4.862   -6.976  1.00 0.00 ? 14  THR A CA   7  
ATOM   9121  C C    . THR A 1 14  ? -2.826  6.015   -6.269  1.00 0.00 ? 14  THR A C    7  
ATOM   9122  O O    . THR A 1 14  ? -3.804  6.555   -6.783  1.00 0.00 ? 14  THR A O    7  
ATOM   9123  C CB   . THR A 1 14  ? -1.642  5.213   -8.388  1.00 0.00 ? 14  THR A CB   7  
ATOM   9124  O OG1  . THR A 1 14  ? -2.849  5.465   -9.104  1.00 0.00 ? 14  THR A OG1  7  
ATOM   9125  C CG2  . THR A 1 14  ? -1.021  4.017   -9.113  1.00 0.00 ? 14  THR A CG2  7  
ATOM   9126  H H    . THR A 1 14  ? -3.914  3.903   -7.398  1.00 0.00 ? 14  THR A H    7  
ATOM   9127  H HA   . THR A 1 14  ? -1.255  4.591   -6.362  1.00 0.00 ? 14  THR A HA   7  
ATOM   9128  H HB   . THR A 1 14  ? -0.953  6.056   -8.369  1.00 0.00 ? 14  THR A HB   7  
ATOM   9129  H HG1  . THR A 1 14  ? -2.647  5.616   -10.071 1.00 0.00 ? 14  THR A HG1  7  
ATOM   9130  H HG21 . THR A 1 14  ? -0.018  4.279   -9.454  1.00 0.00 ? 14  THR A HG21 7  
ATOM   9131  H HG22 . THR A 1 14  ? -0.963  3.169   -8.431  1.00 0.00 ? 14  THR A HG22 7  
ATOM   9132  H HG23 . THR A 1 14  ? -1.637  3.753   -9.972  1.00 0.00 ? 14  THR A HG23 7  
ATOM   9133  N N    . VAL A 1 15  ? -2.309  6.359   -5.098  1.00 0.00 ? 15  VAL A N    7  
ATOM   9134  C CA   . VAL A 1 15  ? -2.882  7.439   -4.314  1.00 0.00 ? 15  VAL A CA   7  
ATOM   9135  C C    . VAL A 1 15  ? -1.888  8.602   -4.250  1.00 0.00 ? 15  VAL A C    7  
ATOM   9136  O O    . VAL A 1 15  ? -0.741  8.421   -3.846  1.00 0.00 ? 15  VAL A O    7  
ATOM   9137  C CB   . VAL A 1 15  ? -3.289  6.924   -2.932  1.00 0.00 ? 15  VAL A CB   7  
ATOM   9138  C CG1  . VAL A 1 15  ? -4.251  7.894   -2.247  1.00 0.00 ? 15  VAL A CG1  7  
ATOM   9139  C CG2  . VAL A 1 15  ? -3.895  5.524   -3.025  1.00 0.00 ? 15  VAL A CG2  7  
ATOM   9140  H H    . VAL A 1 15  ? -1.513  5.915   -4.686  1.00 0.00 ? 15  VAL A H    7  
ATOM   9141  H HA   . VAL A 1 15  ? -3.783  7.776   -4.828  1.00 0.00 ? 15  VAL A HA   7  
ATOM   9142  H HB   . VAL A 1 15  ? -2.389  6.859   -2.321  1.00 0.00 ? 15  VAL A HB   7  
ATOM   9143  H HG11 . VAL A 1 15  ? -3.754  8.852   -2.092  1.00 0.00 ? 15  VAL A HG11 7  
ATOM   9144  H HG12 . VAL A 1 15  ? -5.130  8.040   -2.876  1.00 0.00 ? 15  VAL A HG12 7  
ATOM   9145  H HG13 . VAL A 1 15  ? -4.558  7.485   -1.285  1.00 0.00 ? 15  VAL A HG13 7  
ATOM   9146  H HG21 . VAL A 1 15  ? -3.199  4.859   -3.538  1.00 0.00 ? 15  VAL A HG21 7  
ATOM   9147  H HG22 . VAL A 1 15  ? -4.088  5.144   -2.022  1.00 0.00 ? 15  VAL A HG22 7  
ATOM   9148  H HG23 . VAL A 1 15  ? -4.831  5.568   -3.582  1.00 0.00 ? 15  VAL A HG23 7  
ATOM   9149  N N    . THR A 1 16  ? -2.366  9.769   -4.656  1.00 0.00 ? 16  THR A N    7  
ATOM   9150  C CA   . THR A 1 16  ? -1.534  10.960  -4.651  1.00 0.00 ? 16  THR A CA   7  
ATOM   9151  C C    . THR A 1 16  ? -1.876  11.845  -3.449  1.00 0.00 ? 16  THR A C    7  
ATOM   9152  O O    . THR A 1 16  ? -3.047  12.018  -3.115  1.00 0.00 ? 16  THR A O    7  
ATOM   9153  C CB   . THR A 1 16  ? -1.713  11.668  -5.995  1.00 0.00 ? 16  THR A CB   7  
ATOM   9154  O OG1  . THR A 1 16  ? -1.309  10.696  -6.956  1.00 0.00 ? 16  THR A OG1  7  
ATOM   9155  C CG2  . THR A 1 16  ? -0.721  12.817  -6.190  1.00 0.00 ? 16  THR A CG2  7  
ATOM   9156  H H    . THR A 1 16  ? -3.301  9.908   -4.984  1.00 0.00 ? 16  THR A H    7  
ATOM   9157  H HA   . THR A 1 16  ? -0.496  10.652  -4.537  1.00 0.00 ? 16  THR A HA   7  
ATOM   9158  H HB   . THR A 1 16  ? -2.740  12.015  -6.120  1.00 0.00 ? 16  THR A HB   7  
ATOM   9159  H HG1  . THR A 1 16  ? -2.113  10.318  -7.417  1.00 0.00 ? 16  THR A HG1  7  
ATOM   9160  H HG21 . THR A 1 16  ? -0.949  13.342  -7.117  1.00 0.00 ? 16  THR A HG21 7  
ATOM   9161  H HG22 . THR A 1 16  ? -0.799  13.508  -5.351  1.00 0.00 ? 16  THR A HG22 7  
ATOM   9162  H HG23 . THR A 1 16  ? 0.292   12.417  -6.239  1.00 0.00 ? 16  THR A HG23 7  
ATOM   9163  N N    . LEU A 1 17  ? -0.833  12.380  -2.834  1.00 0.00 ? 17  LEU A N    7  
ATOM   9164  C CA   . LEU A 1 17  ? -1.008  13.240  -1.677  1.00 0.00 ? 17  LEU A CA   7  
ATOM   9165  C C    . LEU A 1 17  ? -1.791  14.490  -2.088  1.00 0.00 ? 17  LEU A C    7  
ATOM   9166  O O    . LEU A 1 17  ? -1.254  15.369  -2.762  1.00 0.00 ? 17  LEU A O    7  
ATOM   9167  C CB   . LEU A 1 17  ? 0.344   13.549  -1.029  1.00 0.00 ? 17  LEU A CB   7  
ATOM   9168  C CG   . LEU A 1 17  ? 0.888   12.485  -0.072  1.00 0.00 ? 17  LEU A CG   7  
ATOM   9169  C CD1  . LEU A 1 17  ? 1.432   13.125  1.207   1.00 0.00 ? 17  LEU A CD1  7  
ATOM   9170  C CD2  . LEU A 1 17  ? -0.173  11.422  0.225   1.00 0.00 ? 17  LEU A CD2  7  
ATOM   9171  H H    . LEU A 1 17  ? 0.117   12.233  -3.111  1.00 0.00 ? 17  LEU A H    7  
ATOM   9172  H HA   . LEU A 1 17  ? -1.598  12.689  -0.945  1.00 0.00 ? 17  LEU A HA   7  
ATOM   9173  H HB2  . LEU A 1 17  ? 1.076   13.706  -1.820  1.00 0.00 ? 17  LEU A HB2  7  
ATOM   9174  H HB3  . LEU A 1 17  ? 0.258   14.489  -0.484  1.00 0.00 ? 17  LEU A HB3  7  
ATOM   9175  H HG   . LEU A 1 17  ? 1.721   11.980  -0.560  1.00 0.00 ? 17  LEU A HG   7  
ATOM   9176  H HD11 . LEU A 1 17  ? 0.638   13.182  1.951   1.00 0.00 ? 17  LEU A HD11 7  
ATOM   9177  H HD12 . LEU A 1 17  ? 2.251   12.521  1.596   1.00 0.00 ? 17  LEU A HD12 7  
ATOM   9178  H HD13 . LEU A 1 17  ? 1.795   14.130  0.984   1.00 0.00 ? 17  LEU A HD13 7  
ATOM   9179  H HD21 . LEU A 1 17  ? 0.274   10.617  0.806   1.00 0.00 ? 17  LEU A HD21 7  
ATOM   9180  H HD22 . LEU A 1 17  ? -0.989  11.871  0.794   1.00 0.00 ? 17  LEU A HD22 7  
ATOM   9181  H HD23 . LEU A 1 17  ? -0.561  11.024  -0.712  1.00 0.00 ? 17  LEU A HD23 7  
ATOM   9182  N N    . LYS A 1 18  ? -3.047  14.526  -1.668  1.00 0.00 ? 18  LYS A N    7  
ATOM   9183  C CA   . LYS A 1 18  ? -3.908  15.653  -1.986  1.00 0.00 ? 18  LYS A CA   7  
ATOM   9184  C C    . LYS A 1 18  ? -3.809  16.696  -0.871  1.00 0.00 ? 18  LYS A C    7  
ATOM   9185  O O    . LYS A 1 18  ? -3.587  17.876  -1.137  1.00 0.00 ? 18  LYS A O    7  
ATOM   9186  C CB   . LYS A 1 18  ? -5.338  15.175  -2.256  1.00 0.00 ? 18  LYS A CB   7  
ATOM   9187  C CG   . LYS A 1 18  ? -6.257  16.353  -2.585  1.00 0.00 ? 18  LYS A CG   7  
ATOM   9188  C CD   . LYS A 1 18  ? -7.191  16.010  -3.746  1.00 0.00 ? 18  LYS A CD   7  
ATOM   9189  C CE   . LYS A 1 18  ? -8.201  17.132  -3.987  1.00 0.00 ? 18  LYS A CE   7  
ATOM   9190  N NZ   . LYS A 1 18  ? -8.445  17.309  -5.436  1.00 0.00 ? 18  LYS A NZ   7  
ATOM   9191  H H    . LYS A 1 18  ? -3.475  13.808  -1.122  1.00 0.00 ? 18  LYS A H    7  
ATOM   9192  H HA   . LYS A 1 18  ? -3.537  16.098  -2.909  1.00 0.00 ? 18  LYS A HA   7  
ATOM   9193  H HB2  . LYS A 1 18  ? -5.336  14.465  -3.084  1.00 0.00 ? 18  LYS A HB2  7  
ATOM   9194  H HB3  . LYS A 1 18  ? -5.717  14.645  -1.382  1.00 0.00 ? 18  LYS A HB3  7  
ATOM   9195  H HG2  . LYS A 1 18  ? -6.843  16.616  -1.706  1.00 0.00 ? 18  LYS A HG2  7  
ATOM   9196  H HG3  . LYS A 1 18  ? -5.656  17.226  -2.842  1.00 0.00 ? 18  LYS A HG3  7  
ATOM   9197  H HD2  . LYS A 1 18  ? -6.607  15.840  -4.651  1.00 0.00 ? 18  LYS A HD2  7  
ATOM   9198  H HD3  . LYS A 1 18  ? -7.719  15.081  -3.530  1.00 0.00 ? 18  LYS A HD3  7  
ATOM   9199  H HE2  . LYS A 1 18  ? -9.138  16.904  -3.479  1.00 0.00 ? 18  LYS A HE2  7  
ATOM   9200  H HE3  . LYS A 1 18  ? -7.828  18.064  -3.560  1.00 0.00 ? 18  LYS A HE3  7  
ATOM   9201  H HZ1  . LYS A 1 18  ? -9.202  16.719  -5.720  1.00 0.00 ? 18  LYS A HZ1  7  
ATOM   9202  H HZ2  . LYS A 1 18  ? -8.679  18.263  -5.621  1.00 0.00 ? 18  LYS A HZ2  7  
ATOM   9203  H HZ3  . LYS A 1 18  ? -7.621  17.063  -5.946  1.00 0.00 ? 18  LYS A HZ3  7  
ATOM   9204  N N    . LYS A 1 19  ? -3.979  16.222  0.354   1.00 0.00 ? 19  LYS A N    7  
ATOM   9205  C CA   . LYS A 1 19  ? -3.911  17.100  1.512   1.00 0.00 ? 19  LYS A CA   7  
ATOM   9206  C C    . LYS A 1 19  ? -2.454  17.235  1.958   1.00 0.00 ? 19  LYS A C    7  
ATOM   9207  O O    . LYS A 1 19  ? -2.144  18.034  2.841   1.00 0.00 ? 19  LYS A O    7  
ATOM   9208  C CB   . LYS A 1 19  ? -4.850  16.605  2.614   1.00 0.00 ? 19  LYS A CB   7  
ATOM   9209  C CG   . LYS A 1 19  ? -4.888  17.590  3.784   1.00 0.00 ? 19  LYS A CG   7  
ATOM   9210  C CD   . LYS A 1 19  ? -6.271  17.612  4.437   1.00 0.00 ? 19  LYS A CD   7  
ATOM   9211  C CE   . LYS A 1 19  ? -6.173  17.352  5.941   1.00 0.00 ? 19  LYS A CE   7  
ATOM   9212  N NZ   . LYS A 1 19  ? -7.320  17.964  6.650   1.00 0.00 ? 19  LYS A NZ   7  
ATOM   9213  H H    . LYS A 1 19  ? -4.160  15.261  0.563   1.00 0.00 ? 19  LYS A H    7  
ATOM   9214  H HA   . LYS A 1 19  ? -4.269  18.080  1.198   1.00 0.00 ? 19  LYS A HA   7  
ATOM   9215  H HB2  . LYS A 1 19  ? -5.854  16.473  2.211   1.00 0.00 ? 19  LYS A HB2  7  
ATOM   9216  H HB3  . LYS A 1 19  ? -4.519  15.629  2.968   1.00 0.00 ? 19  LYS A HB3  7  
ATOM   9217  H HG2  . LYS A 1 19  ? -4.138  17.314  4.524   1.00 0.00 ? 19  LYS A HG2  7  
ATOM   9218  H HG3  . LYS A 1 19  ? -4.635  18.591  3.431   1.00 0.00 ? 19  LYS A HG3  7  
ATOM   9219  H HD2  . LYS A 1 19  ? -6.746  18.577  4.261   1.00 0.00 ? 19  LYS A HD2  7  
ATOM   9220  H HD3  . LYS A 1 19  ? -6.908  16.857  3.975   1.00 0.00 ? 19  LYS A HD3  7  
ATOM   9221  H HE2  . LYS A 1 19  ? -6.150  16.279  6.130   1.00 0.00 ? 19  LYS A HE2  7  
ATOM   9222  H HE3  . LYS A 1 19  ? -5.238  17.763  6.326   1.00 0.00 ? 19  LYS A HE3  7  
ATOM   9223  H HZ1  . LYS A 1 19  ? -7.886  18.465  5.998   1.00 0.00 ? 19  LYS A HZ1  7  
ATOM   9224  H HZ2  . LYS A 1 19  ? -7.863  17.246  7.084   1.00 0.00 ? 19  LYS A HZ2  7  
ATOM   9225  H HZ3  . LYS A 1 19  ? -6.981  18.594  7.351   1.00 0.00 ? 19  LYS A HZ3  7  
ATOM   9226  N N    . GLN A 1 20  ? -1.600  16.441  1.330   1.00 0.00 ? 20  GLN A N    7  
ATOM   9227  C CA   . GLN A 1 20  ? -0.182  16.462  1.653   1.00 0.00 ? 20  GLN A CA   7  
ATOM   9228  C C    . GLN A 1 20  ? 0.021   16.291  3.159   1.00 0.00 ? 20  GLN A C    7  
ATOM   9229  O O    . GLN A 1 20  ? 0.873   16.951  3.752   1.00 0.00 ? 20  GLN A O    7  
ATOM   9230  C CB   . GLN A 1 20  ? 0.474   17.752  1.153   1.00 0.00 ? 20  GLN A CB   7  
ATOM   9231  C CG   . GLN A 1 20  ? 1.248   17.505  -0.143  1.00 0.00 ? 20  GLN A CG   7  
ATOM   9232  C CD   . GLN A 1 20  ? 1.766   18.821  -0.730  1.00 0.00 ? 20  GLN A CD   7  
ATOM   9233  O OE1  . GLN A 1 20  ? 1.090   19.502  -1.483  1.00 0.00 ? 20  GLN A OE1  7  
ATOM   9234  N NE2  . GLN A 1 20  ? 2.998   19.136  -0.344  1.00 0.00 ? 20  GLN A NE2  7  
ATOM   9235  H H    . GLN A 1 20  ? -1.860  15.794  0.614   1.00 0.00 ? 20  GLN A H    7  
ATOM   9236  H HA   . GLN A 1 20  ? 0.248   15.613  1.122   1.00 0.00 ? 20  GLN A HA   7  
ATOM   9237  H HB2  . GLN A 1 20  ? -0.288  18.511  0.988   1.00 0.00 ? 20  GLN A HB2  7  
ATOM   9238  H HB3  . GLN A 1 20  ? 1.149   18.138  1.917   1.00 0.00 ? 20  GLN A HB3  7  
ATOM   9239  H HG2  . GLN A 1 20  ? 2.085   16.834  0.051   1.00 0.00 ? 20  GLN A HG2  7  
ATOM   9240  H HG3  . GLN A 1 20  ? 0.603   17.010  -0.868  1.00 0.00 ? 20  GLN A HG3  7  
ATOM   9241  H HE21 . GLN A 1 20  ? 3.498   18.532  0.277   1.00 0.00 ? 20  GLN A HE21 7  
ATOM   9242  H HE22 . GLN A 1 20  ? 3.425   19.979  -0.674  1.00 0.00 ? 20  GLN A HE22 7  
ATOM   9243  N N    . ASN A 1 21  ? -0.775  15.402  3.734   1.00 0.00 ? 21  ASN A N    7  
ATOM   9244  C CA   . ASN A 1 21  ? -0.693  15.135  5.160   1.00 0.00 ? 21  ASN A CA   7  
ATOM   9245  C C    . ASN A 1 21  ? 0.251   13.954  5.400   1.00 0.00 ? 21  ASN A C    7  
ATOM   9246  O O    . ASN A 1 21  ? -0.116  12.986  6.064   1.00 0.00 ? 21  ASN A O    7  
ATOM   9247  C CB   . ASN A 1 21  ? -2.063  14.768  5.732   1.00 0.00 ? 21  ASN A CB   7  
ATOM   9248  C CG   . ASN A 1 21  ? -2.226  15.309  7.153   1.00 0.00 ? 21  ASN A CG   7  
ATOM   9249  O OD1  . ASN A 1 21  ? -1.489  16.168  7.607   1.00 0.00 ? 21  ASN A OD1  7  
ATOM   9250  N ND2  . ASN A 1 21  ? -3.230  14.759  7.830   1.00 0.00 ? 21  ASN A ND2  7  
ATOM   9251  H H    . ASN A 1 21  ? -1.464  14.870  3.244   1.00 0.00 ? 21  ASN A H    7  
ATOM   9252  H HA   . ASN A 1 21  ? -0.324  16.059  5.604   1.00 0.00 ? 21  ASN A HA   7  
ATOM   9253  H HB2  . ASN A 1 21  ? -2.848  15.172  5.093   1.00 0.00 ? 21  ASN A HB2  7  
ATOM   9254  H HB3  . ASN A 1 21  ? -2.181  13.685  5.735   1.00 0.00 ? 21  ASN A HB3  7  
ATOM   9255  H HD21 . ASN A 1 21  ? -3.799  14.059  7.399   1.00 0.00 ? 21  ASN A HD21 7  
ATOM   9256  H HD22 . ASN A 1 21  ? -3.418  15.048  8.769   1.00 0.00 ? 21  ASN A HD22 7  
ATOM   9257  N N    . GLY A 1 22  ? 1.448   14.074  4.846   1.00 0.00 ? 22  GLY A N    7  
ATOM   9258  C CA   . GLY A 1 22  ? 2.447   13.028  4.992   1.00 0.00 ? 22  GLY A CA   7  
ATOM   9259  C C    . GLY A 1 22  ? 2.026   11.759  4.248   1.00 0.00 ? 22  GLY A C    7  
ATOM   9260  O O    . GLY A 1 22  ? 2.735   11.292  3.358   1.00 0.00 ? 22  GLY A O    7  
ATOM   9261  H H    . GLY A 1 22  ? 1.741   14.863  4.308   1.00 0.00 ? 22  GLY A H    7  
ATOM   9262  H HA2  . GLY A 1 22  ? 3.405   13.379  4.606   1.00 0.00 ? 22  GLY A HA2  7  
ATOM   9263  H HA3  . GLY A 1 22  ? 2.593   12.803  6.048   1.00 0.00 ? 22  GLY A HA3  7  
ATOM   9264  N N    . MET A 1 23  ? 0.873   11.236  4.641   1.00 0.00 ? 23  MET A N    7  
ATOM   9265  C CA   . MET A 1 23  ? 0.349   10.031  4.024   1.00 0.00 ? 23  MET A CA   7  
ATOM   9266  C C    . MET A 1 23  ? -0.835  9.477   4.819   1.00 0.00 ? 23  MET A C    7  
ATOM   9267  O O    . MET A 1 23  ? -1.986  9.643   4.423   1.00 0.00 ? 23  MET A O    7  
ATOM   9268  C CB   . MET A 1 23  ? 1.452   8.975   3.947   1.00 0.00 ? 23  MET A CB   7  
ATOM   9269  C CG   . MET A 1 23  ? 1.721   8.568   2.496   1.00 0.00 ? 23  MET A CG   7  
ATOM   9270  S SD   . MET A 1 23  ? 3.404   8.961   2.053   1.00 0.00 ? 23  MET A SD   7  
ATOM   9271  C CE   . MET A 1 23  ? 4.193   7.400   2.409   1.00 0.00 ? 23  MET A CE   7  
ATOM   9272  H H    . MET A 1 23  ? 0.303   11.623  5.366   1.00 0.00 ? 23  MET A H    7  
ATOM   9273  H HA   . MET A 1 23  ? 0.018   10.333  3.030   1.00 0.00 ? 23  MET A HA   7  
ATOM   9274  H HB2  . MET A 1 23  ? 2.367   9.366   4.393   1.00 0.00 ? 23  MET A HB2  7  
ATOM   9275  H HB3  . MET A 1 23  ? 1.165   8.098   4.528   1.00 0.00 ? 23  MET A HB3  7  
ATOM   9276  H HG2  . MET A 1 23  ? 1.545   7.498   2.373   1.00 0.00 ? 23  MET A HG2  7  
ATOM   9277  H HG3  . MET A 1 23  ? 1.030   9.083   1.830   1.00 0.00 ? 23  MET A HG3  7  
ATOM   9278  H HE1  . MET A 1 23  ? 4.220   6.792   1.505   1.00 0.00 ? 23  MET A HE1  7  
ATOM   9279  H HE2  . MET A 1 23  ? 5.211   7.578   2.758   1.00 0.00 ? 23  MET A HE2  7  
ATOM   9280  H HE3  . MET A 1 23  ? 3.630   6.877   3.182   1.00 0.00 ? 23  MET A HE3  7  
ATOM   9281  N N    . GLY A 1 24  ? -0.509  8.831   5.929   1.00 0.00 ? 24  GLY A N    7  
ATOM   9282  C CA   . GLY A 1 24  ? -1.530  8.250   6.785   1.00 0.00 ? 24  GLY A CA   7  
ATOM   9283  C C    . GLY A 1 24  ? -1.845  6.814   6.366   1.00 0.00 ? 24  GLY A C    7  
ATOM   9284  O O    . GLY A 1 24  ? -2.979  6.358   6.501   1.00 0.00 ? 24  GLY A O    7  
ATOM   9285  H H    . GLY A 1 24  ? 0.432   8.700   6.246   1.00 0.00 ? 24  GLY A H    7  
ATOM   9286  H HA2  . GLY A 1 24  ? -1.193  8.266   7.821   1.00 0.00 ? 24  GLY A HA2  7  
ATOM   9287  H HA3  . GLY A 1 24  ? -2.437  8.855   6.736   1.00 0.00 ? 24  GLY A HA3  7  
ATOM   9288  N N    . LEU A 1 25  ? -0.820  6.137   5.868   1.00 0.00 ? 25  LEU A N    7  
ATOM   9289  C CA   . LEU A 1 25  ? -0.973  4.761   5.429   1.00 0.00 ? 25  LEU A CA   7  
ATOM   9290  C C    . LEU A 1 25  ? -0.254  3.834   6.413   1.00 0.00 ? 25  LEU A C    7  
ATOM   9291  O O    . LEU A 1 25  ? 0.711   4.237   7.060   1.00 0.00 ? 25  LEU A O    7  
ATOM   9292  C CB   . LEU A 1 25  ? -0.502  4.604   3.983   1.00 0.00 ? 25  LEU A CB   7  
ATOM   9293  C CG   . LEU A 1 25  ? -1.576  4.782   2.905   1.00 0.00 ? 25  LEU A CG   7  
ATOM   9294  C CD1  . LEU A 1 25  ? -1.233  3.977   1.651   1.00 0.00 ? 25  LEU A CD1  7  
ATOM   9295  C CD2  . LEU A 1 25  ? -2.962  4.432   3.451   1.00 0.00 ? 25  LEU A CD2  7  
ATOM   9296  H H    . LEU A 1 25  ? 0.100   6.515   5.762   1.00 0.00 ? 25  LEU A H    7  
ATOM   9297  H HA   . LEU A 1 25  ? -2.037  4.528   5.451   1.00 0.00 ? 25  LEU A HA   7  
ATOM   9298  H HB2  . LEU A 1 25  ? 0.291   5.328   3.798   1.00 0.00 ? 25  LEU A HB2  7  
ATOM   9299  H HB3  . LEU A 1 25  ? -0.064  3.614   3.869   1.00 0.00 ? 25  LEU A HB3  7  
ATOM   9300  H HG   . LEU A 1 25  ? -1.599  5.834   2.616   1.00 0.00 ? 25  LEU A HG   7  
ATOM   9301  H HD11 . LEU A 1 25  ? -0.323  4.374   1.203   1.00 0.00 ? 25  LEU A HD11 7  
ATOM   9302  H HD12 . LEU A 1 25  ? -1.079  2.932   1.920   1.00 0.00 ? 25  LEU A HD12 7  
ATOM   9303  H HD13 . LEU A 1 25  ? -2.052  4.050   0.936   1.00 0.00 ? 25  LEU A HD13 7  
ATOM   9304  H HD21 . LEU A 1 25  ? -2.908  3.497   4.009   1.00 0.00 ? 25  LEU A HD21 7  
ATOM   9305  H HD22 . LEU A 1 25  ? -3.305  5.230   4.110   1.00 0.00 ? 25  LEU A HD22 7  
ATOM   9306  H HD23 . LEU A 1 25  ? -3.661  4.319   2.621   1.00 0.00 ? 25  LEU A HD23 7  
ATOM   9307  N N    . SER A 1 26  ? -0.754  2.610   6.494   1.00 0.00 ? 26  SER A N    7  
ATOM   9308  C CA   . SER A 1 26  ? -0.173  1.622   7.387   1.00 0.00 ? 26  SER A CA   7  
ATOM   9309  C C    . SER A 1 26  ? -0.099  0.263   6.689   1.00 0.00 ? 26  SER A C    7  
ATOM   9310  O O    . SER A 1 26  ? -1.121  -0.386  6.475   1.00 0.00 ? 26  SER A O    7  
ATOM   9311  C CB   . SER A 1 26  ? -0.977  1.508   8.683   1.00 0.00 ? 26  SER A CB   7  
ATOM   9312  O OG   . SER A 1 26  ? -0.137  1.349   9.823   1.00 0.00 ? 26  SER A OG   7  
ATOM   9313  H H    . SER A 1 26  ? -1.540  2.289   5.965   1.00 0.00 ? 26  SER A H    7  
ATOM   9314  H HA   . SER A 1 26  ? 0.828   1.991   7.613   1.00 0.00 ? 26  SER A HA   7  
ATOM   9315  H HB2  . SER A 1 26  ? -1.592  2.401   8.807   1.00 0.00 ? 26  SER A HB2  7  
ATOM   9316  H HB3  . SER A 1 26  ? -1.658  0.660   8.613   1.00 0.00 ? 26  SER A HB3  7  
ATOM   9317  H HG   . SER A 1 26  ? -0.459  1.929   10.570  1.00 0.00 ? 26  SER A HG   7  
ATOM   9318  N N    . ILE A 1 27  ? 1.123   -0.127  6.350   1.00 0.00 ? 27  ILE A N    7  
ATOM   9319  C CA   . ILE A 1 27  ? 1.344   -1.396  5.678   1.00 0.00 ? 27  ILE A CA   7  
ATOM   9320  C C    . ILE A 1 27  ? 2.422   -2.182  6.428   1.00 0.00 ? 27  ILE A C    7  
ATOM   9321  O O    . ILE A 1 27  ? 3.074   -1.649  7.325   1.00 0.00 ? 27  ILE A O    7  
ATOM   9322  C CB   . ILE A 1 27  ? 1.663   -1.172  4.200   1.00 0.00 ? 27  ILE A CB   7  
ATOM   9323  C CG1  . ILE A 1 27  ? 3.168   -1.003  3.982   1.00 0.00 ? 27  ILE A CG1  7  
ATOM   9324  C CG2  . ILE A 1 27  ? 0.867   0.009   3.640   1.00 0.00 ? 27  ILE A CG2  7  
ATOM   9325  C CD1  . ILE A 1 27  ? 3.457   -0.362  2.623   1.00 0.00 ? 27  ILE A CD1  7  
ATOM   9326  H H    . ILE A 1 27  ? 1.950   0.407   6.528   1.00 0.00 ? 27  ILE A H    7  
ATOM   9327  H HA   . ILE A 1 27  ? 0.411   -1.958  5.727   1.00 0.00 ? 27  ILE A HA   7  
ATOM   9328  H HB   . ILE A 1 27  ? 1.355   -2.059  3.646   1.00 0.00 ? 27  ILE A HB   7  
ATOM   9329  H HG12 . ILE A 1 27  ? 3.587   -0.384  4.777   1.00 0.00 ? 27  ILE A HG12 7  
ATOM   9330  H HG13 . ILE A 1 27  ? 3.659   -1.974  4.043   1.00 0.00 ? 27  ILE A HG13 7  
ATOM   9331  H HG21 . ILE A 1 27  ? 1.333   0.943   3.955   1.00 0.00 ? 27  ILE A HG21 7  
ATOM   9332  H HG22 . ILE A 1 27  ? 0.857   -0.043  2.552   1.00 0.00 ? 27  ILE A HG22 7  
ATOM   9333  H HG23 . ILE A 1 27  ? -0.156  -0.032  4.016   1.00 0.00 ? 27  ILE A HG23 7  
ATOM   9334  H HD11 . ILE A 1 27  ? 4.485   -0.576  2.333   1.00 0.00 ? 27  ILE A HD11 7  
ATOM   9335  H HD12 . ILE A 1 27  ? 2.776   -0.771  1.877   1.00 0.00 ? 27  ILE A HD12 7  
ATOM   9336  H HD13 . ILE A 1 27  ? 3.316   0.716   2.693   1.00 0.00 ? 27  ILE A HD13 7  
ATOM   9337  N N    . VAL A 1 28  ? 2.575   -3.438  6.033   1.00 0.00 ? 28  VAL A N    7  
ATOM   9338  C CA   . VAL A 1 28  ? 3.563   -4.303  6.655   1.00 0.00 ? 28  VAL A CA   7  
ATOM   9339  C C    . VAL A 1 28  ? 4.030   -5.350  5.640   1.00 0.00 ? 28  VAL A C    7  
ATOM   9340  O O    . VAL A 1 28  ? 3.328   -5.639  4.673   1.00 0.00 ? 28  VAL A O    7  
ATOM   9341  C CB   . VAL A 1 28  ? 2.987   -4.923  7.929   1.00 0.00 ? 28  VAL A CB   7  
ATOM   9342  C CG1  . VAL A 1 28  ? 3.845   -6.095  8.406   1.00 0.00 ? 28  VAL A CG1  7  
ATOM   9343  C CG2  . VAL A 1 28  ? 2.837   -3.870  9.031   1.00 0.00 ? 28  VAL A CG2  7  
ATOM   9344  H H    . VAL A 1 28  ? 2.041   -3.863  5.302   1.00 0.00 ? 28  VAL A H    7  
ATOM   9345  H HA   . VAL A 1 28  ? 4.413   -3.681  6.937   1.00 0.00 ? 28  VAL A HA   7  
ATOM   9346  H HB   . VAL A 1 28  ? 1.995   -5.306  7.696   1.00 0.00 ? 28  VAL A HB   7  
ATOM   9347  H HG11 . VAL A 1 28  ? 4.853   -5.743  8.627   1.00 0.00 ? 28  VAL A HG11 7  
ATOM   9348  H HG12 . VAL A 1 28  ? 3.406   -6.526  9.307   1.00 0.00 ? 28  VAL A HG12 7  
ATOM   9349  H HG13 . VAL A 1 28  ? 3.890   -6.854  7.624   1.00 0.00 ? 28  VAL A HG13 7  
ATOM   9350  H HG21 . VAL A 1 28  ? 2.691   -4.366  9.990   1.00 0.00 ? 28  VAL A HG21 7  
ATOM   9351  H HG22 . VAL A 1 28  ? 3.737   -3.258  9.072   1.00 0.00 ? 28  VAL A HG22 7  
ATOM   9352  H HG23 . VAL A 1 28  ? 1.976   -3.238  8.814   1.00 0.00 ? 28  VAL A HG23 7  
ATOM   9353  N N    . ALA A 1 29  ? 5.213   -5.888  5.896   1.00 0.00 ? 29  ALA A N    7  
ATOM   9354  C CA   . ALA A 1 29  ? 5.784   -6.895  5.018   1.00 0.00 ? 29  ALA A CA   7  
ATOM   9355  C C    . ALA A 1 29  ? 6.451   -7.981  5.862   1.00 0.00 ? 29  ALA A C    7  
ATOM   9356  O O    . ALA A 1 29  ? 7.191   -7.680  6.797   1.00 0.00 ? 29  ALA A O    7  
ATOM   9357  C CB   . ALA A 1 29  ? 6.758   -6.230  4.044   1.00 0.00 ? 29  ALA A CB   7  
ATOM   9358  H H    . ALA A 1 29  ? 5.779   -5.647  6.685   1.00 0.00 ? 29  ALA A H    7  
ATOM   9359  H HA   . ALA A 1 29  ? 4.966   -7.338  4.448   1.00 0.00 ? 29  ALA A HA   7  
ATOM   9360  H HB1  . ALA A 1 29  ? 7.172   -5.333  4.500   1.00 0.00 ? 29  ALA A HB1  7  
ATOM   9361  H HB2  . ALA A 1 29  ? 7.566   -6.924  3.810   1.00 0.00 ? 29  ALA A HB2  7  
ATOM   9362  H HB3  . ALA A 1 29  ? 6.232   -5.964  3.128   1.00 0.00 ? 29  ALA A HB3  7  
ATOM   9363  N N    . ALA A 1 30  ? 6.166   -9.225  5.501   1.00 0.00 ? 30  ALA A N    7  
ATOM   9364  C CA   . ALA A 1 30  ? 6.729   -10.359 6.212   1.00 0.00 ? 30  ALA A CA   7  
ATOM   9365  C C    . ALA A 1 30  ? 7.784   -11.035 5.334   1.00 0.00 ? 30  ALA A C    7  
ATOM   9366  O O    . ALA A 1 30  ? 7.748   -10.910 4.110   1.00 0.00 ? 30  ALA A O    7  
ATOM   9367  C CB   . ALA A 1 30  ? 5.607   -11.317 6.618   1.00 0.00 ? 30  ALA A CB   7  
ATOM   9368  H H    . ALA A 1 30  ? 5.563   -9.462  4.737   1.00 0.00 ? 30  ALA A H    7  
ATOM   9369  H HA   . ALA A 1 30  ? 7.210   -9.980  7.113   1.00 0.00 ? 30  ALA A HA   7  
ATOM   9370  H HB1  . ALA A 1 30  ? 5.971   -11.996 7.389   1.00 0.00 ? 30  ALA A HB1  7  
ATOM   9371  H HB2  . ALA A 1 30  ? 4.764   -10.744 7.006   1.00 0.00 ? 30  ALA A HB2  7  
ATOM   9372  H HB3  . ALA A 1 30  ? 5.287   -11.891 5.749   1.00 0.00 ? 30  ALA A HB3  7  
ATOM   9373  N N    . LYS A 1 31  ? 8.695   -11.737 5.990   1.00 0.00 ? 31  LYS A N    7  
ATOM   9374  C CA   . LYS A 1 31  ? 9.757   -12.432 5.284   1.00 0.00 ? 31  LYS A CA   7  
ATOM   9375  C C    . LYS A 1 31  ? 9.799   -13.891 5.744   1.00 0.00 ? 31  LYS A C    7  
ATOM   9376  O O    . LYS A 1 31  ? 9.200   -14.243 6.761   1.00 0.00 ? 31  LYS A O    7  
ATOM   9377  C CB   . LYS A 1 31  ? 11.086  -11.696 5.454   1.00 0.00 ? 31  LYS A CB   7  
ATOM   9378  C CG   . LYS A 1 31  ? 11.576  -11.774 6.901   1.00 0.00 ? 31  LYS A CG   7  
ATOM   9379  C CD   . LYS A 1 31  ? 11.055  -10.593 7.723   1.00 0.00 ? 31  LYS A CD   7  
ATOM   9380  C CE   . LYS A 1 31  ? 10.822  -11.000 9.180   1.00 0.00 ? 31  LYS A CE   7  
ATOM   9381  N NZ   . LYS A 1 31  ? 11.001  -9.835  10.076  1.00 0.00 ? 31  LYS A NZ   7  
ATOM   9382  H H    . LYS A 1 31  ? 8.715   -11.834 6.986   1.00 0.00 ? 31  LYS A H    7  
ATOM   9383  H HA   . LYS A 1 31  ? 9.511   -12.413 4.222   1.00 0.00 ? 31  LYS A HA   7  
ATOM   9384  H HB2  . LYS A 1 31  ? 11.834  -12.126 4.790   1.00 0.00 ? 31  LYS A HB2  7  
ATOM   9385  H HB3  . LYS A 1 31  ? 10.967  -10.652 5.165   1.00 0.00 ? 31  LYS A HB3  7  
ATOM   9386  H HG2  . LYS A 1 31  ? 11.243  -12.711 7.350   1.00 0.00 ? 31  LYS A HG2  7  
ATOM   9387  H HG3  . LYS A 1 31  ? 12.667  -11.783 6.921   1.00 0.00 ? 31  LYS A HG3  7  
ATOM   9388  H HD2  . LYS A 1 31  ? 11.769  -9.774  7.680   1.00 0.00 ? 31  LYS A HD2  7  
ATOM   9389  H HD3  . LYS A 1 31  ? 10.123  -10.229 7.290   1.00 0.00 ? 31  LYS A HD3  7  
ATOM   9390  H HE2  . LYS A 1 31  ? 9.817   -11.405 9.295   1.00 0.00 ? 31  LYS A HE2  7  
ATOM   9391  H HE3  . LYS A 1 31  ? 11.519  -11.789 9.460   1.00 0.00 ? 31  LYS A HE3  7  
ATOM   9392  H HZ1  . LYS A 1 31  ? 10.142  -9.324  10.133  1.00 0.00 ? 31  LYS A HZ1  7  
ATOM   9393  H HZ2  . LYS A 1 31  ? 11.260  -10.153 10.989  1.00 0.00 ? 31  LYS A HZ2  7  
ATOM   9394  H HZ3  . LYS A 1 31  ? 11.718  -9.241  9.715   1.00 0.00 ? 31  LYS A HZ3  7  
ATOM   9395  N N    . GLY A 1 32  ? 10.514  -14.700 4.975   1.00 0.00 ? 32  GLY A N    7  
ATOM   9396  C CA   . GLY A 1 32  ? 10.641  -16.113 5.292   1.00 0.00 ? 32  GLY A CA   7  
ATOM   9397  C C    . GLY A 1 32  ? 11.758  -16.759 4.471   1.00 0.00 ? 32  GLY A C    7  
ATOM   9398  O O    . GLY A 1 32  ? 12.705  -16.085 4.065   1.00 0.00 ? 32  GLY A O    7  
ATOM   9399  H H    . GLY A 1 32  ? 10.998  -14.406 4.151   1.00 0.00 ? 32  GLY A H    7  
ATOM   9400  H HA2  . GLY A 1 32  ? 10.850  -16.234 6.355   1.00 0.00 ? 32  GLY A HA2  7  
ATOM   9401  H HA3  . GLY A 1 32  ? 9.698   -16.620 5.092   1.00 0.00 ? 32  GLY A HA3  7  
ATOM   9402  N N    . ALA A 1 33  ? 11.612  -18.057 4.250   1.00 0.00 ? 33  ALA A N    7  
ATOM   9403  C CA   . ALA A 1 33  ? 12.596  -18.803 3.484   1.00 0.00 ? 33  ALA A CA   7  
ATOM   9404  C C    . ALA A 1 33  ? 11.879  -19.779 2.550   1.00 0.00 ? 33  ALA A C    7  
ATOM   9405  O O    . ALA A 1 33  ? 11.140  -20.650 3.006   1.00 0.00 ? 33  ALA A O    7  
ATOM   9406  C CB   . ALA A 1 33  ? 13.558  -19.510 4.441   1.00 0.00 ? 33  ALA A CB   7  
ATOM   9407  H H    . ALA A 1 33  ? 10.839  -18.597 4.584   1.00 0.00 ? 33  ALA A H    7  
ATOM   9408  H HA   . ALA A 1 33  ? 13.161  -18.088 2.884   1.00 0.00 ? 33  ALA A HA   7  
ATOM   9409  H HB1  . ALA A 1 33  ? 14.576  -19.426 4.060   1.00 0.00 ? 33  ALA A HB1  7  
ATOM   9410  H HB2  . ALA A 1 33  ? 13.498  -19.047 5.425   1.00 0.00 ? 33  ALA A HB2  7  
ATOM   9411  H HB3  . ALA A 1 33  ? 13.285  -20.562 4.517   1.00 0.00 ? 33  ALA A HB3  7  
ATOM   9412  N N    . GLY A 1 34  ? 12.120  -19.599 1.259   1.00 0.00 ? 34  GLY A N    7  
ATOM   9413  C CA   . GLY A 1 34  ? 11.505  -20.454 0.257   1.00 0.00 ? 34  GLY A CA   7  
ATOM   9414  C C    . GLY A 1 34  ? 10.012  -20.151 0.120   1.00 0.00 ? 34  GLY A C    7  
ATOM   9415  O O    . GLY A 1 34  ? 9.595   -19.486 -0.826  1.00 0.00 ? 34  GLY A O    7  
ATOM   9416  H H    . GLY A 1 34  ? 12.721  -18.889 0.898   1.00 0.00 ? 34  GLY A H    7  
ATOM   9417  H HA2  . GLY A 1 34  ? 12.000  -20.308 -0.702  1.00 0.00 ? 34  GLY A HA2  7  
ATOM   9418  H HA3  . GLY A 1 34  ? 11.645  -21.501 0.533   1.00 0.00 ? 34  GLY A HA3  7  
ATOM   9419  N N    . GLN A 1 35  ? 9.248   -20.653 1.079   1.00 0.00 ? 35  GLN A N    7  
ATOM   9420  C CA   . GLN A 1 35  ? 7.810   -20.445 1.077   1.00 0.00 ? 35  GLN A CA   7  
ATOM   9421  C C    . GLN A 1 35  ? 7.230   -20.729 2.464   1.00 0.00 ? 35  GLN A C    7  
ATOM   9422  O O    . GLN A 1 35  ? 6.838   -21.859 2.756   1.00 0.00 ? 35  GLN A O    7  
ATOM   9423  C CB   . GLN A 1 35  ? 7.132   -21.309 0.012   1.00 0.00 ? 35  GLN A CB   7  
ATOM   9424  C CG   . GLN A 1 35  ? 6.542   -20.442 -1.103  1.00 0.00 ? 35  GLN A CG   7  
ATOM   9425  C CD   . GLN A 1 35  ? 5.223   -19.805 -0.662  1.00 0.00 ? 35  GLN A CD   7  
ATOM   9426  O OE1  . GLN A 1 35  ? 5.004   -19.510 0.502   1.00 0.00 ? 35  GLN A OE1  7  
ATOM   9427  N NE2  . GLN A 1 35  ? 4.358   -19.608 -1.655  1.00 0.00 ? 35  GLN A NE2  7  
ATOM   9428  H H    . GLN A 1 35  ? 9.595   -21.193 1.846   1.00 0.00 ? 35  GLN A H    7  
ATOM   9429  H HA   . GLN A 1 35  ? 7.671   -19.394 0.826   1.00 0.00 ? 35  GLN A HA   7  
ATOM   9430  H HB2  . GLN A 1 35  ? 7.856   -22.007 -0.411  1.00 0.00 ? 35  GLN A HB2  7  
ATOM   9431  H HB3  . GLN A 1 35  ? 6.344   -21.905 0.469   1.00 0.00 ? 35  GLN A HB3  7  
ATOM   9432  H HG2  . GLN A 1 35  ? 7.253   -19.662 -1.377  1.00 0.00 ? 35  GLN A HG2  7  
ATOM   9433  H HG3  . GLN A 1 35  ? 6.379   -21.049 -1.993  1.00 0.00 ? 35  GLN A HG3  7  
ATOM   9434  H HE21 . GLN A 1 35  ? 4.602   -19.873 -2.589  1.00 0.00 ? 35  GLN A HE21 7  
ATOM   9435  H HE22 . GLN A 1 35  ? 3.468   -19.198 -1.466  1.00 0.00 ? 35  GLN A HE22 7  
ATOM   9436  N N    . ASP A 1 36  ? 7.194   -19.688 3.281   1.00 0.00 ? 36  ASP A N    7  
ATOM   9437  C CA   . ASP A 1 36  ? 6.668   -19.812 4.630   1.00 0.00 ? 36  ASP A CA   7  
ATOM   9438  C C    . ASP A 1 36  ? 5.786   -18.603 4.943   1.00 0.00 ? 36  ASP A C    7  
ATOM   9439  O O    . ASP A 1 36  ? 4.613   -18.757 5.281   1.00 0.00 ? 36  ASP A O    7  
ATOM   9440  C CB   . ASP A 1 36  ? 7.799   -19.850 5.660   1.00 0.00 ? 36  ASP A CB   7  
ATOM   9441  C CG   . ASP A 1 36  ? 8.248   -21.252 6.077   1.00 0.00 ? 36  ASP A CG   7  
ATOM   9442  O OD1  . ASP A 1 36  ? 8.738   -21.979 5.188   1.00 0.00 ? 36  ASP A OD1  7  
ATOM   9443  O OD2  . ASP A 1 36  ? 8.091   -21.564 7.278   1.00 0.00 ? 36  ASP A OD2  7  
ATOM   9444  H H    . ASP A 1 36  ? 7.516   -18.774 3.035   1.00 0.00 ? 36  ASP A H    7  
ATOM   9445  H HA   . ASP A 1 36  ? 6.112   -20.749 4.635   1.00 0.00 ? 36  ASP A HA   7  
ATOM   9446  H HB2  . ASP A 1 36  ? 8.659   -19.315 5.255   1.00 0.00 ? 36  ASP A HB2  7  
ATOM   9447  H HB3  . ASP A 1 36  ? 7.478   -19.307 6.551   1.00 0.00 ? 36  ASP A HB3  7  
ATOM   9448  N N    . LYS A 1 37  ? 6.381   -17.426 4.816   1.00 0.00 ? 37  LYS A N    7  
ATOM   9449  C CA   . LYS A 1 37  ? 5.663   -16.191 5.083   1.00 0.00 ? 37  LYS A CA   7  
ATOM   9450  C C    . LYS A 1 37  ? 6.456   -15.013 4.512   1.00 0.00 ? 37  LYS A C    7  
ATOM   9451  O O    . LYS A 1 37  ? 7.330   -14.466 5.184   1.00 0.00 ? 37  LYS A O    7  
ATOM   9452  C CB   . LYS A 1 37  ? 5.353   -16.060 6.574   1.00 0.00 ? 37  LYS A CB   7  
ATOM   9453  C CG   . LYS A 1 37  ? 3.982   -16.654 6.904   1.00 0.00 ? 37  LYS A CG   7  
ATOM   9454  C CD   . LYS A 1 37  ? 3.128   -15.660 7.693   1.00 0.00 ? 37  LYS A CD   7  
ATOM   9455  C CE   . LYS A 1 37  ? 2.071   -15.014 6.796   1.00 0.00 ? 37  LYS A CE   7  
ATOM   9456  N NZ   . LYS A 1 37  ? 1.929   -13.575 7.114   1.00 0.00 ? 37  LYS A NZ   7  
ATOM   9457  H H    . LYS A 1 37  ? 7.337   -17.309 4.541   1.00 0.00 ? 37  LYS A H    7  
ATOM   9458  H HA   . LYS A 1 37  ? 4.708   -16.250 4.559   1.00 0.00 ? 37  LYS A HA   7  
ATOM   9459  H HB2  . LYS A 1 37  ? 6.122   -16.569 7.155   1.00 0.00 ? 37  LYS A HB2  7  
ATOM   9460  H HB3  . LYS A 1 37  ? 5.378   -15.010 6.864   1.00 0.00 ? 37  LYS A HB3  7  
ATOM   9461  H HG2  . LYS A 1 37  ? 3.469   -16.927 5.982   1.00 0.00 ? 37  LYS A HG2  7  
ATOM   9462  H HG3  . LYS A 1 37  ? 4.108   -17.569 7.482   1.00 0.00 ? 37  LYS A HG3  7  
ATOM   9463  H HD2  . LYS A 1 37  ? 2.644   -16.170 8.525   1.00 0.00 ? 37  LYS A HD2  7  
ATOM   9464  H HD3  . LYS A 1 37  ? 3.769   -14.887 8.121   1.00 0.00 ? 37  LYS A HD3  7  
ATOM   9465  H HE2  . LYS A 1 37  ? 2.347   -15.137 5.750   1.00 0.00 ? 37  LYS A HE2  7  
ATOM   9466  H HE3  . LYS A 1 37  ? 1.113   -15.517 6.935   1.00 0.00 ? 37  LYS A HE3  7  
ATOM   9467  H HZ1  . LYS A 1 37  ? 2.568   -13.330 7.843   1.00 0.00 ? 37  LYS A HZ1  7  
ATOM   9468  H HZ2  . LYS A 1 37  ? 2.131   -13.033 6.298   1.00 0.00 ? 37  LYS A HZ2  7  
ATOM   9469  H HZ3  . LYS A 1 37  ? 0.994   -13.390 7.415   1.00 0.00 ? 37  LYS A HZ3  7  
ATOM   9470  N N    . LEU A 1 38  ? 6.123   -14.656 3.280   1.00 0.00 ? 38  LEU A N    7  
ATOM   9471  C CA   . LEU A 1 38  ? 6.794   -13.552 2.613   1.00 0.00 ? 38  LEU A CA   7  
ATOM   9472  C C    . LEU A 1 38  ? 5.787   -12.802 1.741   1.00 0.00 ? 38  LEU A C    7  
ATOM   9473  O O    . LEU A 1 38  ? 5.167   -13.389 0.855   1.00 0.00 ? 38  LEU A O    7  
ATOM   9474  C CB   . LEU A 1 38  ? 8.018   -14.055 1.846   1.00 0.00 ? 38  LEU A CB   7  
ATOM   9475  C CG   . LEU A 1 38  ? 9.007   -12.982 1.386   1.00 0.00 ? 38  LEU A CG   7  
ATOM   9476  C CD1  . LEU A 1 38  ? 10.018  -13.559 0.392   1.00 0.00 ? 38  LEU A CD1  7  
ATOM   9477  C CD2  . LEU A 1 38  ? 8.274   -11.767 0.817   1.00 0.00 ? 38  LEU A CD2  7  
ATOM   9478  H H    . LEU A 1 38  ? 5.411   -15.106 2.741   1.00 0.00 ? 38  LEU A H    7  
ATOM   9479  H HA   . LEU A 1 38  ? 7.155   -12.874 3.388   1.00 0.00 ? 38  LEU A HA   7  
ATOM   9480  H HB2  . LEU A 1 38  ? 8.551   -14.767 2.477   1.00 0.00 ? 38  LEU A HB2  7  
ATOM   9481  H HB3  . LEU A 1 38  ? 7.673   -14.603 0.969   1.00 0.00 ? 38  LEU A HB3  7  
ATOM   9482  H HG   . LEU A 1 38  ? 9.569   -12.641 2.256   1.00 0.00 ? 38  LEU A HG   7  
ATOM   9483  H HD11 . LEU A 1 38  ? 10.625  -12.752 -0.018  1.00 0.00 ? 38  LEU A HD11 7  
ATOM   9484  H HD12 . LEU A 1 38  ? 10.663  -14.275 0.903   1.00 0.00 ? 38  LEU A HD12 7  
ATOM   9485  H HD13 . LEU A 1 38  ? 9.487   -14.062 -0.415  1.00 0.00 ? 38  LEU A HD13 7  
ATOM   9486  H HD21 . LEU A 1 38  ? 8.967   -11.165 0.231   1.00 0.00 ? 38  LEU A HD21 7  
ATOM   9487  H HD22 . LEU A 1 38  ? 7.456   -12.102 0.178   1.00 0.00 ? 38  LEU A HD22 7  
ATOM   9488  H HD23 . LEU A 1 38  ? 7.873   -11.168 1.634   1.00 0.00 ? 38  LEU A HD23 7  
ATOM   9489  N N    . GLY A 1 39  ? 5.650   -11.514 2.024   1.00 0.00 ? 39  GLY A N    7  
ATOM   9490  C CA   . GLY A 1 39  ? 4.728   -10.677 1.275   1.00 0.00 ? 39  GLY A CA   7  
ATOM   9491  C C    . GLY A 1 39  ? 4.412   -9.391  2.041   1.00 0.00 ? 39  GLY A C    7  
ATOM   9492  O O    . GLY A 1 39  ? 4.819   -9.232  3.191   1.00 0.00 ? 39  GLY A O    7  
ATOM   9493  H H    . GLY A 1 39  ? 6.157   -11.044 2.745   1.00 0.00 ? 39  GLY A H    7  
ATOM   9494  H HA2  . GLY A 1 39  ? 5.160   -10.429 0.306   1.00 0.00 ? 39  GLY A HA2  7  
ATOM   9495  H HA3  . GLY A 1 39  ? 3.807   -11.226 1.084   1.00 0.00 ? 39  GLY A HA3  7  
ATOM   9496  N N    . ILE A 1 40  ? 3.687   -8.506  1.373   1.00 0.00 ? 40  ILE A N    7  
ATOM   9497  C CA   . ILE A 1 40  ? 3.311   -7.238  1.976   1.00 0.00 ? 40  ILE A CA   7  
ATOM   9498  C C    . ILE A 1 40  ? 1.807   -7.241  2.260   1.00 0.00 ? 40  ILE A C    7  
ATOM   9499  O O    . ILE A 1 40  ? 1.079   -8.097  1.762   1.00 0.00 ? 40  ILE A O    7  
ATOM   9500  C CB   . ILE A 1 40  ? 3.769   -6.071  1.101   1.00 0.00 ? 40  ILE A CB   7  
ATOM   9501  C CG1  . ILE A 1 40  ? 5.126   -6.368  0.458   1.00 0.00 ? 40  ILE A CG1  7  
ATOM   9502  C CG2  . ILE A 1 40  ? 3.786   -4.763  1.895   1.00 0.00 ? 40  ILE A CG2  7  
ATOM   9503  C CD1  . ILE A 1 40  ? 5.496   -5.294  -0.566  1.00 0.00 ? 40  ILE A CD1  7  
ATOM   9504  H H    . ILE A 1 40  ? 3.359   -8.642  0.439   1.00 0.00 ? 40  ILE A H    7  
ATOM   9505  H HA   . ILE A 1 40  ? 3.841   -7.158  2.926   1.00 0.00 ? 40  ILE A HA   7  
ATOM   9506  H HB   . ILE A 1 40  ? 3.051   -5.948  0.291   1.00 0.00 ? 40  ILE A HB   7  
ATOM   9507  H HG12 . ILE A 1 40  ? 5.895   -6.419  1.230   1.00 0.00 ? 40  ILE A HG12 7  
ATOM   9508  H HG13 . ILE A 1 40  ? 5.097   -7.343  -0.027  1.00 0.00 ? 40  ILE A HG13 7  
ATOM   9509  H HG21 . ILE A 1 40  ? 4.299   -3.994  1.318   1.00 0.00 ? 40  ILE A HG21 7  
ATOM   9510  H HG22 . ILE A 1 40  ? 2.762   -4.446  2.092   1.00 0.00 ? 40  ILE A HG22 7  
ATOM   9511  H HG23 . ILE A 1 40  ? 4.307   -4.918  2.840   1.00 0.00 ? 40  ILE A HG23 7  
ATOM   9512  H HD11 . ILE A 1 40  ? 4.663   -5.147  -1.255  1.00 0.00 ? 40  ILE A HD11 7  
ATOM   9513  H HD12 . ILE A 1 40  ? 5.708   -4.357  -0.050  1.00 0.00 ? 40  ILE A HD12 7  
ATOM   9514  H HD13 . ILE A 1 40  ? 6.378   -5.611  -1.123  1.00 0.00 ? 40  ILE A HD13 7  
ATOM   9515  N N    . TYR A 1 41  ? 1.387   -6.270  3.058   1.00 0.00 ? 41  TYR A N    7  
ATOM   9516  C CA   . TYR A 1 41  ? -0.018  -6.148  3.413   1.00 0.00 ? 41  TYR A CA   7  
ATOM   9517  C C    . TYR A 1 41  ? -0.333  -4.743  3.927   1.00 0.00 ? 41  TYR A C    7  
ATOM   9518  O O    . TYR A 1 41  ? 0.571   -3.995  4.296   1.00 0.00 ? 41  TYR A O    7  
ATOM   9519  C CB   . TYR A 1 41  ? -0.256  -7.156  4.539   1.00 0.00 ? 41  TYR A CB   7  
ATOM   9520  C CG   . TYR A 1 41  ? 0.164   -8.586  4.195   1.00 0.00 ? 41  TYR A CG   7  
ATOM   9521  C CD1  . TYR A 1 41  ? -0.641  -9.368  3.391   1.00 0.00 ? 41  TYR A CD1  7  
ATOM   9522  C CD2  . TYR A 1 41  ? 1.350   -9.094  4.687   1.00 0.00 ? 41  TYR A CD2  7  
ATOM   9523  C CE1  . TYR A 1 41  ? -0.245  -10.714 3.066   1.00 0.00 ? 41  TYR A CE1  7  
ATOM   9524  C CE2  . TYR A 1 41  ? 1.745   -10.441 4.361   1.00 0.00 ? 41  TYR A CE2  7  
ATOM   9525  C CZ   . TYR A 1 41  ? 0.928   -11.184 3.567   1.00 0.00 ? 41  TYR A CZ   7  
ATOM   9526  O OH   . TYR A 1 41  ? 1.302   -12.455 3.260   1.00 0.00 ? 41  TYR A OH   7  
ATOM   9527  H H    . TYR A 1 41  ? 1.986   -5.577  3.459   1.00 0.00 ? 41  TYR A H    7  
ATOM   9528  H HA   . TYR A 1 41  ? -0.609  -6.342  2.518   1.00 0.00 ? 41  TYR A HA   7  
ATOM   9529  H HB2  . TYR A 1 41  ? 0.290   -6.833  5.425   1.00 0.00 ? 41  TYR A HB2  7  
ATOM   9530  H HB3  . TYR A 1 41  ? -1.315  -7.152  4.799   1.00 0.00 ? 41  TYR A HB3  7  
ATOM   9531  H HD1  . TYR A 1 41  ? -1.577  -8.965  3.003   1.00 0.00 ? 41  TYR A HD1  7  
ATOM   9532  H HD2  . TYR A 1 41  ? 1.985   -8.478  5.322   1.00 0.00 ? 41  TYR A HD2  7  
ATOM   9533  H HE1  . TYR A 1 41  ? -0.873  -11.341 2.433   1.00 0.00 ? 41  TYR A HE1  7  
ATOM   9534  H HE2  . TYR A 1 41  ? 2.678   -10.855 4.744   1.00 0.00 ? 41  TYR A HE2  7  
ATOM   9535  H HH   . TYR A 1 41  ? 1.284   -13.023 4.083   1.00 0.00 ? 41  TYR A HH   7  
ATOM   9536  N N    . VAL A 1 42  ? -1.620  -4.425  3.936   1.00 0.00 ? 42  VAL A N    7  
ATOM   9537  C CA   . VAL A 1 42  ? -2.066  -3.123  4.399   1.00 0.00 ? 42  VAL A CA   7  
ATOM   9538  C C    . VAL A 1 42  ? -2.729  -3.274  5.770   1.00 0.00 ? 42  VAL A C    7  
ATOM   9539  O O    . VAL A 1 42  ? -3.741  -3.958  5.901   1.00 0.00 ? 42  VAL A O    7  
ATOM   9540  C CB   . VAL A 1 42  ? -2.987  -2.485  3.358   1.00 0.00 ? 42  VAL A CB   7  
ATOM   9541  C CG1  . VAL A 1 42  ? -3.607  -1.192  3.892   1.00 0.00 ? 42  VAL A CG1  7  
ATOM   9542  C CG2  . VAL A 1 42  ? -2.239  -2.232  2.045   1.00 0.00 ? 42  VAL A CG2  7  
ATOM   9543  H H    . VAL A 1 42  ? -2.349  -5.039  3.636   1.00 0.00 ? 42  VAL A H    7  
ATOM   9544  H HA   . VAL A 1 42  ? -1.184  -2.490  4.502   1.00 0.00 ? 42  VAL A HA   7  
ATOM   9545  H HB   . VAL A 1 42  ? -3.796  -3.184  3.151   1.00 0.00 ? 42  VAL A HB   7  
ATOM   9546  H HG11 . VAL A 1 42  ? -4.026  -1.373  4.881   1.00 0.00 ? 42  VAL A HG11 7  
ATOM   9547  H HG12 . VAL A 1 42  ? -2.841  -0.421  3.957   1.00 0.00 ? 42  VAL A HG12 7  
ATOM   9548  H HG13 . VAL A 1 42  ? -4.398  -0.863  3.218   1.00 0.00 ? 42  VAL A HG13 7  
ATOM   9549  H HG21 . VAL A 1 42  ? -2.658  -2.862  1.262   1.00 0.00 ? 42  VAL A HG21 7  
ATOM   9550  H HG22 . VAL A 1 42  ? -2.343  -1.184  1.764   1.00 0.00 ? 42  VAL A HG22 7  
ATOM   9551  H HG23 . VAL A 1 42  ? -1.183  -2.470  2.178   1.00 0.00 ? 42  VAL A HG23 7  
ATOM   9552  N N    . LYS A 1 43  ? -2.129  -2.620  6.755   1.00 0.00 ? 43  LYS A N    7  
ATOM   9553  C CA   . LYS A 1 43  ? -2.650  -2.672  8.111   1.00 0.00 ? 43  LYS A CA   7  
ATOM   9554  C C    . LYS A 1 43  ? -3.914  -1.816  8.202   1.00 0.00 ? 43  LYS A C    7  
ATOM   9555  O O    . LYS A 1 43  ? -4.957  -2.288  8.651   1.00 0.00 ? 43  LYS A O    7  
ATOM   9556  C CB   . LYS A 1 43  ? -1.566  -2.275  9.116   1.00 0.00 ? 43  LYS A CB   7  
ATOM   9557  C CG   . LYS A 1 43  ? -2.143  -2.161  10.528  1.00 0.00 ? 43  LYS A CG   7  
ATOM   9558  C CD   . LYS A 1 43  ? -2.306  -3.540  11.168  1.00 0.00 ? 43  LYS A CD   7  
ATOM   9559  C CE   . LYS A 1 43  ? -1.170  -3.823  12.155  1.00 0.00 ? 43  LYS A CE   7  
ATOM   9560  N NZ   . LYS A 1 43  ? -1.701  -4.456  13.385  1.00 0.00 ? 43  LYS A NZ   7  
ATOM   9561  H H    . LYS A 1 43  ? -1.306  -2.064  6.639   1.00 0.00 ? 43  LYS A H    7  
ATOM   9562  H HA   . LYS A 1 43  ? -2.918  -3.709  8.319   1.00 0.00 ? 43  LYS A HA   7  
ATOM   9563  H HB2  . LYS A 1 43  ? -0.767  -3.017  9.106   1.00 0.00 ? 43  LYS A HB2  7  
ATOM   9564  H HB3  . LYS A 1 43  ? -1.122  -1.325  8.823   1.00 0.00 ? 43  LYS A HB3  7  
ATOM   9565  H HG2  . LYS A 1 43  ? -1.486  -1.545  11.143  1.00 0.00 ? 43  LYS A HG2  7  
ATOM   9566  H HG3  . LYS A 1 43  ? -3.109  -1.657  10.491  1.00 0.00 ? 43  LYS A HG3  7  
ATOM   9567  H HD2  . LYS A 1 43  ? -3.263  -3.595  11.686  1.00 0.00 ? 43  LYS A HD2  7  
ATOM   9568  H HD3  . LYS A 1 43  ? -2.317  -4.307  10.394  1.00 0.00 ? 43  LYS A HD3  7  
ATOM   9569  H HE2  . LYS A 1 43  ? -0.430  -4.475  11.693  1.00 0.00 ? 43  LYS A HE2  7  
ATOM   9570  H HE3  . LYS A 1 43  ? -0.661  -2.894  12.409  1.00 0.00 ? 43  LYS A HE3  7  
ATOM   9571  H HZ1  . LYS A 1 43  ? -1.845  -3.757  14.085  1.00 0.00 ? 43  LYS A HZ1  7  
ATOM   9572  H HZ2  . LYS A 1 43  ? -2.567  -4.908  13.180  1.00 0.00 ? 43  LYS A HZ2  7  
ATOM   9573  H HZ3  . LYS A 1 43  ? -1.043  -5.133  13.720  1.00 0.00 ? 43  LYS A HZ3  7  
ATOM   9574  N N    . SER A 1 44  ? -3.780  -0.571  7.768   1.00 0.00 ? 44  SER A N    7  
ATOM   9575  C CA   . SER A 1 44  ? -4.899  0.354   7.795   1.00 0.00 ? 44  SER A CA   7  
ATOM   9576  C C    . SER A 1 44  ? -4.410  1.775   7.501   1.00 0.00 ? 44  SER A C    7  
ATOM   9577  O O    . SER A 1 44  ? -3.208  2.013   7.407   1.00 0.00 ? 44  SER A O    7  
ATOM   9578  C CB   . SER A 1 44  ? -5.619  0.310   9.143   1.00 0.00 ? 44  SER A CB   7  
ATOM   9579  O OG   . SER A 1 44  ? -5.582  1.567   9.811   1.00 0.00 ? 44  SER A OG   7  
ATOM   9580  H H    . SER A 1 44  ? -2.928  -0.195  7.404   1.00 0.00 ? 44  SER A H    7  
ATOM   9581  H HA   . SER A 1 44  ? -5.576  0.014   7.011   1.00 0.00 ? 44  SER A HA   7  
ATOM   9582  H HB2  . SER A 1 44  ? -6.657  0.012   8.992   1.00 0.00 ? 44  SER A HB2  7  
ATOM   9583  H HB3  . SER A 1 44  ? -5.160  -0.450  9.775   1.00 0.00 ? 44  SER A HB3  7  
ATOM   9584  H HG   . SER A 1 44  ? -4.634  1.831   9.993   1.00 0.00 ? 44  SER A HG   7  
ATOM   9585  N N    . VAL A 1 45  ? -5.368  2.680   7.366   1.00 0.00 ? 45  VAL A N    7  
ATOM   9586  C CA   . VAL A 1 45  ? -5.050  4.070   7.086   1.00 0.00 ? 45  VAL A CA   7  
ATOM   9587  C C    . VAL A 1 45  ? -5.163  4.885   8.376   1.00 0.00 ? 45  VAL A C    7  
ATOM   9588  O O    . VAL A 1 45  ? -6.124  4.730   9.129   1.00 0.00 ? 45  VAL A O    7  
ATOM   9589  C CB   . VAL A 1 45  ? -5.949  4.596   5.965   1.00 0.00 ? 45  VAL A CB   7  
ATOM   9590  C CG1  . VAL A 1 45  ? -5.846  3.711   4.721   1.00 0.00 ? 45  VAL A CG1  7  
ATOM   9591  C CG2  . VAL A 1 45  ? -7.399  4.717   6.435   1.00 0.00 ? 45  VAL A CG2  7  
ATOM   9592  H H    . VAL A 1 45  ? -6.345  2.478   7.446   1.00 0.00 ? 45  VAL A H    7  
ATOM   9593  H HA   . VAL A 1 45  ? -4.018  4.107   6.737   1.00 0.00 ? 45  VAL A HA   7  
ATOM   9594  H HB   . VAL A 1 45  ? -5.599  5.594   5.697   1.00 0.00 ? 45  VAL A HB   7  
ATOM   9595  H HG11 . VAL A 1 45  ? -6.206  4.265   3.852   1.00 0.00 ? 45  VAL A HG11 7  
ATOM   9596  H HG12 . VAL A 1 45  ? -4.808  3.423   4.563   1.00 0.00 ? 45  VAL A HG12 7  
ATOM   9597  H HG13 . VAL A 1 45  ? -6.455  2.819   4.859   1.00 0.00 ? 45  VAL A HG13 7  
ATOM   9598  H HG21 . VAL A 1 45  ? -7.980  5.254   5.686   1.00 0.00 ? 45  VAL A HG21 7  
ATOM   9599  H HG22 . VAL A 1 45  ? -7.819  3.721   6.576   1.00 0.00 ? 45  VAL A HG22 7  
ATOM   9600  H HG23 . VAL A 1 45  ? -7.431  5.261   7.380   1.00 0.00 ? 45  VAL A HG23 7  
ATOM   9601  N N    . VAL A 1 46  ? -4.170  5.736   8.590   1.00 0.00 ? 46  VAL A N    7  
ATOM   9602  C CA   . VAL A 1 46  ? -4.147  6.575   9.776   1.00 0.00 ? 46  VAL A CA   7  
ATOM   9603  C C    . VAL A 1 46  ? -5.560  7.089   10.060  1.00 0.00 ? 46  VAL A C    7  
ATOM   9604  O O    . VAL A 1 46  ? -5.932  7.286   11.215  1.00 0.00 ? 46  VAL A O    7  
ATOM   9605  C CB   . VAL A 1 46  ? -3.125  7.701   9.600   1.00 0.00 ? 46  VAL A CB   7  
ATOM   9606  C CG1  . VAL A 1 46  ? -3.482  8.906   10.472  1.00 0.00 ? 46  VAL A CG1  7  
ATOM   9607  C CG2  . VAL A 1 46  ? -1.708  7.207   9.899   1.00 0.00 ? 46  VAL A CG2  7  
ATOM   9608  H H    . VAL A 1 46  ? -3.393  5.856   7.972   1.00 0.00 ? 46  VAL A H    7  
ATOM   9609  H HA   . VAL A 1 46  ? -3.824  5.955   10.611  1.00 0.00 ? 46  VAL A HA   7  
ATOM   9610  H HB   . VAL A 1 46  ? -3.155  8.019   8.558   1.00 0.00 ? 46  VAL A HB   7  
ATOM   9611  H HG11 . VAL A 1 46  ? -2.820  9.737   10.231  1.00 0.00 ? 46  VAL A HG11 7  
ATOM   9612  H HG12 . VAL A 1 46  ? -4.515  9.197   10.284  1.00 0.00 ? 46  VAL A HG12 7  
ATOM   9613  H HG13 . VAL A 1 46  ? -3.364  8.641   11.523  1.00 0.00 ? 46  VAL A HG13 7  
ATOM   9614  H HG21 . VAL A 1 46  ? -1.667  6.817   10.916  1.00 0.00 ? 46  VAL A HG21 7  
ATOM   9615  H HG22 . VAL A 1 46  ? -1.443  6.417   9.197   1.00 0.00 ? 46  VAL A HG22 7  
ATOM   9616  H HG23 . VAL A 1 46  ? -1.006  8.034   9.798   1.00 0.00 ? 46  VAL A HG23 7  
ATOM   9617  N N    . LYS A 1 47  ? -6.308  7.292   8.986   1.00 0.00 ? 47  LYS A N    7  
ATOM   9618  C CA   . LYS A 1 47  ? -7.672  7.779   9.104   1.00 0.00 ? 47  LYS A CA   7  
ATOM   9619  C C    . LYS A 1 47  ? -7.660  9.308   9.144   1.00 0.00 ? 47  LYS A C    7  
ATOM   9620  O O    . LYS A 1 47  ? -8.693  9.934   9.377   1.00 0.00 ? 47  LYS A O    7  
ATOM   9621  C CB   . LYS A 1 47  ? -8.367  7.138   10.307  1.00 0.00 ? 47  LYS A CB   7  
ATOM   9622  C CG   . LYS A 1 47  ? -9.888  7.170   10.144  1.00 0.00 ? 47  LYS A CG   7  
ATOM   9623  C CD   . LYS A 1 47  ? -10.418 5.816   9.671   1.00 0.00 ? 47  LYS A CD   7  
ATOM   9624  C CE   . LYS A 1 47  ? -11.213 5.960   8.371   1.00 0.00 ? 47  LYS A CE   7  
ATOM   9625  N NZ   . LYS A 1 47  ? -11.508 4.630   7.793   1.00 0.00 ? 47  LYS A NZ   7  
ATOM   9626  H H    . LYS A 1 47  ? -5.998  7.128   8.049   1.00 0.00 ? 47  LYS A H    7  
ATOM   9627  H HA   . LYS A 1 47  ? -8.211  7.460   8.212   1.00 0.00 ? 47  LYS A HA   7  
ATOM   9628  H HB2  . LYS A 1 47  ? -8.031  6.107   10.419  1.00 0.00 ? 47  LYS A HB2  7  
ATOM   9629  H HB3  . LYS A 1 47  ? -8.083  7.665   11.218  1.00 0.00 ? 47  LYS A HB3  7  
ATOM   9630  H HG2  . LYS A 1 47  ? -10.354 7.435   11.092  1.00 0.00 ? 47  LYS A HG2  7  
ATOM   9631  H HG3  . LYS A 1 47  ? -10.162 7.943   9.425   1.00 0.00 ? 47  LYS A HG3  7  
ATOM   9632  H HD2  . LYS A 1 47  ? -9.585  5.128   9.517   1.00 0.00 ? 47  LYS A HD2  7  
ATOM   9633  H HD3  . LYS A 1 47  ? -11.051 5.379   10.442  1.00 0.00 ? 47  LYS A HD3  7  
ATOM   9634  H HE2  . LYS A 1 47  ? -12.143 6.494   8.566   1.00 0.00 ? 47  LYS A HE2  7  
ATOM   9635  H HE3  . LYS A 1 47  ? -10.646 6.556   7.655   1.00 0.00 ? 47  LYS A HE3  7  
ATOM   9636  H HZ1  . LYS A 1 47  ? -11.752 3.996   8.526   1.00 0.00 ? 47  LYS A HZ1  7  
ATOM   9637  H HZ2  . LYS A 1 47  ? -12.270 4.708   7.152   1.00 0.00 ? 47  LYS A HZ2  7  
ATOM   9638  H HZ3  . LYS A 1 47  ? -10.700 4.289   7.312   1.00 0.00 ? 47  LYS A HZ3  7  
ATOM   9639  N N    . GLY A 1 48  ? -6.482  9.866   8.913   1.00 0.00 ? 48  GLY A N    7  
ATOM   9640  C CA   . GLY A 1 48  ? -6.321  11.310  8.919   1.00 0.00 ? 48  GLY A CA   7  
ATOM   9641  C C    . GLY A 1 48  ? -5.151  11.737  8.033   1.00 0.00 ? 48  GLY A C    7  
ATOM   9642  O O    . GLY A 1 48  ? -4.420  12.669  8.366   1.00 0.00 ? 48  GLY A O    7  
ATOM   9643  H H    . GLY A 1 48  ? -5.647  9.349   8.725   1.00 0.00 ? 48  GLY A H    7  
ATOM   9644  H HA2  . GLY A 1 48  ? -7.240  11.782  8.566   1.00 0.00 ? 48  GLY A HA2  7  
ATOM   9645  H HA3  . GLY A 1 48  ? -6.157  11.657  9.938   1.00 0.00 ? 48  GLY A HA3  7  
ATOM   9646  N N    . GLY A 1 49  ? -5.004  11.032  6.919   1.00 0.00 ? 49  GLY A N    7  
ATOM   9647  C CA   . GLY A 1 49  ? -3.933  11.326  5.982   1.00 0.00 ? 49  GLY A CA   7  
ATOM   9648  C C    . GLY A 1 49  ? -4.493  11.689  4.605   1.00 0.00 ? 49  GLY A C    7  
ATOM   9649  O O    . GLY A 1 49  ? -5.702  11.624  4.387   1.00 0.00 ? 49  GLY A O    7  
ATOM   9650  H H    . GLY A 1 49  ? -5.600  10.275  6.656   1.00 0.00 ? 49  GLY A H    7  
ATOM   9651  H HA2  . GLY A 1 49  ? -3.329  12.149  6.362   1.00 0.00 ? 49  GLY A HA2  7  
ATOM   9652  H HA3  . GLY A 1 49  ? -3.274  10.461  5.895   1.00 0.00 ? 49  GLY A HA3  7  
ATOM   9653  N N    . ALA A 1 50  ? -3.587  12.062  3.713   1.00 0.00 ? 50  ALA A N    7  
ATOM   9654  C CA   . ALA A 1 50  ? -3.975  12.434  2.364   1.00 0.00 ? 50  ALA A CA   7  
ATOM   9655  C C    . ALA A 1 50  ? -4.425  11.185  1.603   1.00 0.00 ? 50  ALA A C    7  
ATOM   9656  O O    . ALA A 1 50  ? -5.587  11.074  1.218   1.00 0.00 ? 50  ALA A O    7  
ATOM   9657  C CB   . ALA A 1 50  ? -2.811  13.148  1.676   1.00 0.00 ? 50  ALA A CB   7  
ATOM   9658  H H    . ALA A 1 50  ? -2.607  12.110  3.900   1.00 0.00 ? 50  ALA A H    7  
ATOM   9659  H HA   . ALA A 1 50  ? -4.815  13.126  2.440   1.00 0.00 ? 50  ALA A HA   7  
ATOM   9660  H HB1  . ALA A 1 50  ? -2.981  14.225  1.693   1.00 0.00 ? 50  ALA A HB1  7  
ATOM   9661  H HB2  . ALA A 1 50  ? -1.883  12.919  2.202   1.00 0.00 ? 50  ALA A HB2  7  
ATOM   9662  H HB3  . ALA A 1 50  ? -2.736  12.809  0.643   1.00 0.00 ? 50  ALA A HB3  7  
ATOM   9663  N N    . ALA A 1 51  ? -3.479  10.277  1.410   1.00 0.00 ? 51  ALA A N    7  
ATOM   9664  C CA   . ALA A 1 51  ? -3.763  9.040   0.703   1.00 0.00 ? 51  ALA A CA   7  
ATOM   9665  C C    . ALA A 1 51  ? -4.712  8.183   1.544   1.00 0.00 ? 51  ALA A C    7  
ATOM   9666  O O    . ALA A 1 51  ? -5.383  7.295   1.019   1.00 0.00 ? 51  ALA A O    7  
ATOM   9667  C CB   . ALA A 1 51  ? -2.451  8.319   0.389   1.00 0.00 ? 51  ALA A CB   7  
ATOM   9668  H H    . ALA A 1 51  ? -2.536  10.375  1.728   1.00 0.00 ? 51  ALA A H    7  
ATOM   9669  H HA   . ALA A 1 51  ? -4.255  9.300   -0.235  1.00 0.00 ? 51  ALA A HA   7  
ATOM   9670  H HB1  . ALA A 1 51  ? -1.618  9.009   0.519   1.00 0.00 ? 51  ALA A HB1  7  
ATOM   9671  H HB2  . ALA A 1 51  ? -2.332  7.471   1.063   1.00 0.00 ? 51  ALA A HB2  7  
ATOM   9672  H HB3  . ALA A 1 51  ? -2.470  7.962   -0.641  1.00 0.00 ? 51  ALA A HB3  7  
ATOM   9673  N N    . ASP A 1 52  ? -4.739  8.480   2.835   1.00 0.00 ? 52  ASP A N    7  
ATOM   9674  C CA   . ASP A 1 52  ? -5.594  7.746   3.753   1.00 0.00 ? 52  ASP A CA   7  
ATOM   9675  C C    . ASP A 1 52  ? -7.060  8.034   3.418   1.00 0.00 ? 52  ASP A C    7  
ATOM   9676  O O    . ASP A 1 52  ? -7.850  7.110   3.227   1.00 0.00 ? 52  ASP A O    7  
ATOM   9677  C CB   . ASP A 1 52  ? -5.347  8.180   5.200   1.00 0.00 ? 52  ASP A CB   7  
ATOM   9678  C CG   . ASP A 1 52  ? -6.607  8.310   6.059   1.00 0.00 ? 52  ASP A CG   7  
ATOM   9679  O OD1  . ASP A 1 52  ? -7.258  7.266   6.274   1.00 0.00 ? 52  ASP A OD1  7  
ATOM   9680  O OD2  . ASP A 1 52  ? -6.889  9.452   6.482   1.00 0.00 ? 52  ASP A OD2  7  
ATOM   9681  H H    . ASP A 1 52  ? -4.190  9.203   3.253   1.00 0.00 ? 52  ASP A H    7  
ATOM   9682  H HA   . ASP A 1 52  ? -5.332  6.698   3.614   1.00 0.00 ? 52  ASP A HA   7  
ATOM   9683  H HB2  . ASP A 1 52  ? -4.679  7.459   5.669   1.00 0.00 ? 52  ASP A HB2  7  
ATOM   9684  H HB3  . ASP A 1 52  ? -4.829  9.138   5.193   1.00 0.00 ? 52  ASP A HB3  7  
ATOM   9685  N N    . VAL A 1 53  ? -7.378  9.319   3.355   1.00 0.00 ? 53  VAL A N    7  
ATOM   9686  C CA   . VAL A 1 53  ? -8.733  9.738   3.045   1.00 0.00 ? 53  VAL A CA   7  
ATOM   9687  C C    . VAL A 1 53  ? -8.968  9.621   1.537   1.00 0.00 ? 53  VAL A C    7  
ATOM   9688  O O    . VAL A 1 53  ? -9.873  8.911   1.101   1.00 0.00 ? 53  VAL A O    7  
ATOM   9689  C CB   . VAL A 1 53  ? -8.980  11.151  3.579   1.00 0.00 ? 53  VAL A CB   7  
ATOM   9690  C CG1  . VAL A 1 53  ? -10.280 11.730  3.019   1.00 0.00 ? 53  VAL A CG1  7  
ATOM   9691  C CG2  . VAL A 1 53  ? -8.987  11.165  5.108   1.00 0.00 ? 53  VAL A CG2  7  
ATOM   9692  H H    . VAL A 1 53  ? -6.730  10.064  3.510   1.00 0.00 ? 53  VAL A H    7  
ATOM   9693  H HA   . VAL A 1 53  ? -9.414  9.059   3.560   1.00 0.00 ? 53  VAL A HA   7  
ATOM   9694  H HB   . VAL A 1 53  ? -8.157  11.784  3.242   1.00 0.00 ? 53  VAL A HB   7  
ATOM   9695  H HG11 . VAL A 1 53  ? -10.232 11.745  1.929   1.00 0.00 ? 53  VAL A HG11 7  
ATOM   9696  H HG12 . VAL A 1 53  ? -11.120 11.112  3.336   1.00 0.00 ? 53  VAL A HG12 7  
ATOM   9697  H HG13 . VAL A 1 53  ? -10.414 12.747  3.390   1.00 0.00 ? 53  VAL A HG13 7  
ATOM   9698  H HG21 . VAL A 1 53  ? -9.978  11.446  5.464   1.00 0.00 ? 53  VAL A HG21 7  
ATOM   9699  H HG22 . VAL A 1 53  ? -8.734  10.173  5.483   1.00 0.00 ? 53  VAL A HG22 7  
ATOM   9700  H HG23 . VAL A 1 53  ? -8.252  11.887  5.468   1.00 0.00 ? 53  VAL A HG23 7  
ATOM   9701  N N    . ASP A 1 54  ? -8.137  10.326  0.785   1.00 0.00 ? 54  ASP A N    7  
ATOM   9702  C CA   . ASP A 1 54  ? -8.242  10.309  -0.665  1.00 0.00 ? 54  ASP A CA   7  
ATOM   9703  C C    . ASP A 1 54  ? -8.233  8.859   -1.155  1.00 0.00 ? 54  ASP A C    7  
ATOM   9704  O O    . ASP A 1 54  ? -9.118  8.448   -1.904  1.00 0.00 ? 54  ASP A O    7  
ATOM   9705  C CB   . ASP A 1 54  ? -7.062  11.036  -1.311  1.00 0.00 ? 54  ASP A CB   7  
ATOM   9706  C CG   . ASP A 1 54  ? -7.090  12.560  -1.180  1.00 0.00 ? 54  ASP A CG   7  
ATOM   9707  O OD1  . ASP A 1 54  ? -6.614  13.049  -0.134  1.00 0.00 ? 54  ASP A OD1  7  
ATOM   9708  O OD2  . ASP A 1 54  ? -7.588  13.202  -2.130  1.00 0.00 ? 54  ASP A OD2  7  
ATOM   9709  H H    . ASP A 1 54  ? -7.404  10.900  1.148   1.00 0.00 ? 54  ASP A H    7  
ATOM   9710  H HA   . ASP A 1 54  ? -9.180  10.819  -0.890  1.00 0.00 ? 54  ASP A HA   7  
ATOM   9711  H HB2  . ASP A 1 54  ? -6.139  10.664  -0.865  1.00 0.00 ? 54  ASP A HB2  7  
ATOM   9712  H HB3  . ASP A 1 54  ? -7.031  10.777  -2.370  1.00 0.00 ? 54  ASP A HB3  7  
ATOM   9713  N N    . GLY A 1 55  ? -7.222  8.127   -0.714  1.00 0.00 ? 55  GLY A N    7  
ATOM   9714  C CA   . GLY A 1 55  ? -7.085  6.732   -1.098  1.00 0.00 ? 55  GLY A CA   7  
ATOM   9715  C C    . GLY A 1 55  ? -8.223  5.890   -0.522  1.00 0.00 ? 55  GLY A C    7  
ATOM   9716  O O    . GLY A 1 55  ? -8.909  5.180   -1.255  1.00 0.00 ? 55  GLY A O    7  
ATOM   9717  H H    . GLY A 1 55  ? -6.506  8.469   -0.105  1.00 0.00 ? 55  GLY A H    7  
ATOM   9718  H HA2  . GLY A 1 55  ? -7.081  6.649   -2.187  1.00 0.00 ? 55  GLY A HA2  7  
ATOM   9719  H HA3  . GLY A 1 55  ? -6.128  6.346   -0.749  1.00 0.00 ? 55  GLY A HA3  7  
ATOM   9720  N N    . ARG A 1 56  ? -8.390  5.995   0.789   1.00 0.00 ? 56  ARG A N    7  
ATOM   9721  C CA   . ARG A 1 56  ? -9.433  5.252   1.473   1.00 0.00 ? 56  ARG A CA   7  
ATOM   9722  C C    . ARG A 1 56  ? -9.297  3.756   1.181   1.00 0.00 ? 56  ARG A C    7  
ATOM   9723  O O    . ARG A 1 56  ? -10.287 3.083   0.900   1.00 0.00 ? 56  ARG A O    7  
ATOM   9724  C CB   . ARG A 1 56  ? -10.822 5.726   1.039   1.00 0.00 ? 56  ARG A CB   7  
ATOM   9725  C CG   . ARG A 1 56  ? -11.900 5.213   1.997   1.00 0.00 ? 56  ARG A CG   7  
ATOM   9726  C CD   . ARG A 1 56  ? -13.289 5.311   1.362   1.00 0.00 ? 56  ARG A CD   7  
ATOM   9727  N NE   . ARG A 1 56  ? -14.186 6.111   2.228   1.00 0.00 ? 56  ARG A NE   7  
ATOM   9728  C CZ   . ARG A 1 56  ? -14.653 5.694   3.412   1.00 0.00 ? 56  ARG A CZ   7  
ATOM   9729  N NH1  . ARG A 1 56  ? -14.314 4.485   3.880   1.00 0.00 ? 56  ARG A NH1  7  
ATOM   9730  N NH2  . ARG A 1 56  ? -15.462 6.487   4.128   1.00 0.00 ? 56  ARG A NH2  7  
ATOM   9731  H H    . ARG A 1 56  ? -7.828  6.574   1.379   1.00 0.00 ? 56  ARG A H    7  
ATOM   9732  H HA   . ARG A 1 56  ? -9.276  5.461   2.531   1.00 0.00 ? 56  ARG A HA   7  
ATOM   9733  H HB2  . ARG A 1 56  ? -10.847 6.814   1.010   1.00 0.00 ? 56  ARG A HB2  7  
ATOM   9734  H HB3  . ARG A 1 56  ? -11.030 5.374   0.029   1.00 0.00 ? 56  ARG A HB3  7  
ATOM   9735  H HG2  . ARG A 1 56  ? -11.691 4.177   2.264   1.00 0.00 ? 56  ARG A HG2  7  
ATOM   9736  H HG3  . ARG A 1 56  ? -11.877 5.792   2.921   1.00 0.00 ? 56  ARG A HG3  7  
ATOM   9737  H HD2  . ARG A 1 56  ? -13.216 5.772   0.376   1.00 0.00 ? 56  ARG A HD2  7  
ATOM   9738  H HD3  . ARG A 1 56  ? -13.704 4.314   1.218   1.00 0.00 ? 56  ARG A HD3  7  
ATOM   9739  H HE   . ARG A 1 56  ? -14.457 7.018   1.908   1.00 0.00 ? 56  ARG A HE   7  
ATOM   9740  H HH11 . ARG A 1 56  ? -13.710 3.893   3.344   1.00 0.00 ? 56  ARG A HH11 7  
ATOM   9741  H HH12 . ARG A 1 56  ? -14.663 4.175   4.763   1.00 0.00 ? 56  ARG A HH12 7  
ATOM   9742  H HH21 . ARG A 1 56  ? -15.715 7.389   3.781   1.00 0.00 ? 56  ARG A HH21 7  
ATOM   9743  H HH22 . ARG A 1 56  ? -15.811 6.175   5.012   1.00 0.00 ? 56  ARG A HH22 7  
ATOM   9744  N N    . LEU A 1 57  ? -8.064  3.279   1.260   1.00 0.00 ? 57  LEU A N    7  
ATOM   9745  C CA   . LEU A 1 57  ? -7.786  1.876   1.008   1.00 0.00 ? 57  LEU A CA   7  
ATOM   9746  C C    . LEU A 1 57  ? -8.347  1.035   2.158   1.00 0.00 ? 57  LEU A C    7  
ATOM   9747  O O    . LEU A 1 57  ? -8.521  1.534   3.268   1.00 0.00 ? 57  LEU A O    7  
ATOM   9748  C CB   . LEU A 1 57  ? -6.291  1.661   0.762   1.00 0.00 ? 57  LEU A CB   7  
ATOM   9749  C CG   . LEU A 1 57  ? -5.708  2.355   -0.471  1.00 0.00 ? 57  LEU A CG   7  
ATOM   9750  C CD1  . LEU A 1 57  ? -4.221  2.657   -0.279  1.00 0.00 ? 57  LEU A CD1  7  
ATOM   9751  C CD2  . LEU A 1 57  ? -5.970  1.539   -1.737  1.00 0.00 ? 57  LEU A CD2  7  
ATOM   9752  H H    . LEU A 1 57  ? -7.265  3.834   1.491   1.00 0.00 ? 57  LEU A H    7  
ATOM   9753  H HA   . LEU A 1 57  ? -8.306  1.598   0.091   1.00 0.00 ? 57  LEU A HA   7  
ATOM   9754  H HB2  . LEU A 1 57  ? -5.746  2.005   1.640   1.00 0.00 ? 57  LEU A HB2  7  
ATOM   9755  H HB3  . LEU A 1 57  ? -6.109  0.590   0.671   1.00 0.00 ? 57  LEU A HB3  7  
ATOM   9756  H HG   . LEU A 1 57  ? -6.216  3.313   -0.595  1.00 0.00 ? 57  LEU A HG   7  
ATOM   9757  H HD11 . LEU A 1 57  ? -3.628  1.862   -0.731  1.00 0.00 ? 57  LEU A HD11 7  
ATOM   9758  H HD12 . LEU A 1 57  ? -3.977  3.608   -0.753  1.00 0.00 ? 57  LEU A HD12 7  
ATOM   9759  H HD13 . LEU A 1 57  ? -3.997  2.714   0.787   1.00 0.00 ? 57  LEU A HD13 7  
ATOM   9760  H HD21 . LEU A 1 57  ? -7.027  1.592   -1.993  1.00 0.00 ? 57  LEU A HD21 7  
ATOM   9761  H HD22 . LEU A 1 57  ? -5.375  1.940   -2.558  1.00 0.00 ? 57  LEU A HD22 7  
ATOM   9762  H HD23 . LEU A 1 57  ? -5.690  0.500   -1.561  1.00 0.00 ? 57  LEU A HD23 7  
ATOM   9763  N N    . ALA A 1 58  ? -8.614  -0.226  1.850   1.00 0.00 ? 58  ALA A N    7  
ATOM   9764  C CA   . ALA A 1 58  ? -9.151  -1.140  2.843   1.00 0.00 ? 58  ALA A CA   7  
ATOM   9765  C C    . ALA A 1 58  ? -8.020  -1.619  3.755   1.00 0.00 ? 58  ALA A C    7  
ATOM   9766  O O    . ALA A 1 58  ? -6.864  -1.676  3.337   1.00 0.00 ? 58  ALA A O    7  
ATOM   9767  C CB   . ALA A 1 58  ? -9.862  -2.298  2.140   1.00 0.00 ? 58  ALA A CB   7  
ATOM   9768  H H    . ALA A 1 58  ? -8.470  -0.623  0.944   1.00 0.00 ? 58  ALA A H    7  
ATOM   9769  H HA   . ALA A 1 58  ? -9.880  -0.591  3.441   1.00 0.00 ? 58  ALA A HA   7  
ATOM   9770  H HB1  . ALA A 1 58  ? -10.835 -1.963  1.784   1.00 0.00 ? 58  ALA A HB1  7  
ATOM   9771  H HB2  . ALA A 1 58  ? -9.260  -2.633  1.294   1.00 0.00 ? 58  ALA A HB2  7  
ATOM   9772  H HB3  . ALA A 1 58  ? -9.995  -3.122  2.840   1.00 0.00 ? 58  ALA A HB3  7  
ATOM   9773  N N    . ALA A 1 59  ? -8.391  -1.947  4.984   1.00 0.00 ? 59  ALA A N    7  
ATOM   9774  C CA   . ALA A 1 59  ? -7.422  -2.417  5.959   1.00 0.00 ? 59  ALA A CA   7  
ATOM   9775  C C    . ALA A 1 59  ? -7.420  -3.947  5.972   1.00 0.00 ? 59  ALA A C    7  
ATOM   9776  O O    . ALA A 1 59  ? -8.411  -4.568  6.353   1.00 0.00 ? 59  ALA A O    7  
ATOM   9777  C CB   . ALA A 1 59  ? -7.746  -1.822  7.330   1.00 0.00 ? 59  ALA A CB   7  
ATOM   9778  H H    . ALA A 1 59  ? -9.333  -1.896  5.315   1.00 0.00 ? 59  ALA A H    7  
ATOM   9779  H HA   . ALA A 1 59  ? -6.439  -2.065  5.646   1.00 0.00 ? 59  ALA A HA   7  
ATOM   9780  H HB1  . ALA A 1 59  ? -7.482  -0.765  7.339   1.00 0.00 ? 59  ALA A HB1  7  
ATOM   9781  H HB2  . ALA A 1 59  ? -8.812  -1.931  7.531   1.00 0.00 ? 59  ALA A HB2  7  
ATOM   9782  H HB3  . ALA A 1 59  ? -7.176  -2.346  8.097   1.00 0.00 ? 59  ALA A HB3  7  
ATOM   9783  N N    . GLY A 1 60  ? -6.298  -4.511  5.551   1.00 0.00 ? 60  GLY A N    7  
ATOM   9784  C CA   . GLY A 1 60  ? -6.155  -5.956  5.510   1.00 0.00 ? 60  GLY A CA   7  
ATOM   9785  C C    . GLY A 1 60  ? -5.932  -6.444  4.077   1.00 0.00 ? 60  GLY A C    7  
ATOM   9786  O O    . GLY A 1 60  ? -6.294  -7.570  3.739   1.00 0.00 ? 60  GLY A O    7  
ATOM   9787  H H    . GLY A 1 60  ? -5.496  -3.998  5.242   1.00 0.00 ? 60  GLY A H    7  
ATOM   9788  H HA2  . GLY A 1 60  ? -5.316  -6.260  6.136   1.00 0.00 ? 60  GLY A HA2  7  
ATOM   9789  H HA3  . GLY A 1 60  ? -7.047  -6.424  5.923   1.00 0.00 ? 60  GLY A HA3  7  
ATOM   9790  N N    . ASP A 1 61  ? -5.340  -5.573  3.274   1.00 0.00 ? 61  ASP A N    7  
ATOM   9791  C CA   . ASP A 1 61  ? -5.066  -5.902  1.885   1.00 0.00 ? 61  ASP A CA   7  
ATOM   9792  C C    . ASP A 1 61  ? -3.654  -6.481  1.770   1.00 0.00 ? 61  ASP A C    7  
ATOM   9793  O O    . ASP A 1 61  ? -2.807  -6.232  2.629   1.00 0.00 ? 61  ASP A O    7  
ATOM   9794  C CB   . ASP A 1 61  ? -5.139  -4.656  0.999   1.00 0.00 ? 61  ASP A CB   7  
ATOM   9795  C CG   . ASP A 1 61  ? -6.289  -3.700  1.324   1.00 0.00 ? 61  ASP A CG   7  
ATOM   9796  O OD1  . ASP A 1 61  ? -7.274  -4.179  1.929   1.00 0.00 ? 61  ASP A OD1  7  
ATOM   9797  O OD2  . ASP A 1 61  ? -6.158  -2.513  0.959   1.00 0.00 ? 61  ASP A OD2  7  
ATOM   9798  H H    . ASP A 1 61  ? -5.051  -4.660  3.557   1.00 0.00 ? 61  ASP A H    7  
ATOM   9799  H HA   . ASP A 1 61  ? -5.835  -6.622  1.604   1.00 0.00 ? 61  ASP A HA   7  
ATOM   9800  H HB2  . ASP A 1 61  ? -4.199  -4.113  1.084   1.00 0.00 ? 61  ASP A HB2  7  
ATOM   9801  H HB3  . ASP A 1 61  ? -5.233  -4.974  -0.039  1.00 0.00 ? 61  ASP A HB3  7  
ATOM   9802  N N    . GLN A 1 62  ? -3.443  -7.240  0.707   1.00 0.00 ? 62  GLN A N    7  
ATOM   9803  C CA   . GLN A 1 62  ? -2.149  -7.855  0.471   1.00 0.00 ? 62  GLN A CA   7  
ATOM   9804  C C    . GLN A 1 62  ? -1.375  -7.070  -0.590  1.00 0.00 ? 62  GLN A C    7  
ATOM   9805  O O    . GLN A 1 62  ? -1.804  -6.983  -1.740  1.00 0.00 ? 62  GLN A O    7  
ATOM   9806  C CB   . GLN A 1 62  ? -2.305  -9.321  0.062   1.00 0.00 ? 62  GLN A CB   7  
ATOM   9807  C CG   . GLN A 1 62  ? -0.946  -9.952  -0.249  1.00 0.00 ? 62  GLN A CG   7  
ATOM   9808  C CD   . GLN A 1 62  ? -1.063  -10.978 -1.379  1.00 0.00 ? 62  GLN A CD   7  
ATOM   9809  O OE1  . GLN A 1 62  ? -1.072  -10.648 -2.553  1.00 0.00 ? 62  GLN A OE1  7  
ATOM   9810  N NE2  . GLN A 1 62  ? -1.151  -12.236 -0.958  1.00 0.00 ? 62  GLN A NE2  7  
ATOM   9811  H H    . GLN A 1 62  ? -4.139  -7.439  0.016   1.00 0.00 ? 62  GLN A H    7  
ATOM   9812  H HA   . GLN A 1 62  ? -1.624  -7.803  1.424   1.00 0.00 ? 62  GLN A HA   7  
ATOM   9813  H HB2  . GLN A 1 62  ? -2.790  -9.876  0.865   1.00 0.00 ? 62  GLN A HB2  7  
ATOM   9814  H HB3  . GLN A 1 62  ? -2.952  -9.393  -0.811  1.00 0.00 ? 62  GLN A HB3  7  
ATOM   9815  H HG2  . GLN A 1 62  ? -0.237  -9.173  -0.532  1.00 0.00 ? 62  GLN A HG2  7  
ATOM   9816  H HG3  . GLN A 1 62  ? -0.550  -10.433 0.645   1.00 0.00 ? 62  GLN A HG3  7  
ATOM   9817  H HE21 . GLN A 1 62  ? -1.138  -12.439 0.021   1.00 0.00 ? 62  GLN A HE21 7  
ATOM   9818  H HE22 . GLN A 1 62  ? -1.232  -12.980 -1.622  1.00 0.00 ? 62  GLN A HE22 7  
ATOM   9819  N N    . LEU A 1 63  ? -0.247  -6.518  -0.167  1.00 0.00 ? 63  LEU A N    7  
ATOM   9820  C CA   . LEU A 1 63  ? 0.591   -5.744  -1.066  1.00 0.00 ? 63  LEU A CA   7  
ATOM   9821  C C    . LEU A 1 63  ? 1.779   -6.600  -1.515  1.00 0.00 ? 63  LEU A C    7  
ATOM   9822  O O    . LEU A 1 63  ? 2.139   -7.566  -0.845  1.00 0.00 ? 63  LEU A O    7  
ATOM   9823  C CB   . LEU A 1 63  ? 0.998   -4.422  -0.413  1.00 0.00 ? 63  LEU A CB   7  
ATOM   9824  C CG   . LEU A 1 63  ? 1.532   -3.344  -1.359  1.00 0.00 ? 63  LEU A CG   7  
ATOM   9825  C CD1  . LEU A 1 63  ? 0.446   -2.318  -1.689  1.00 0.00 ? 63  LEU A CD1  7  
ATOM   9826  C CD2  . LEU A 1 63  ? 2.788   -2.684  -0.785  1.00 0.00 ? 63  LEU A CD2  7  
ATOM   9827  H H    . LEU A 1 63  ? 0.095   -6.594  0.769   1.00 0.00 ? 63  LEU A H    7  
ATOM   9828  H HA   . LEU A 1 63  ? -0.008  -5.500  -1.943  1.00 0.00 ? 63  LEU A HA   7  
ATOM   9829  H HB2  . LEU A 1 63  ? 0.134   -4.019  0.113   1.00 0.00 ? 63  LEU A HB2  7  
ATOM   9830  H HB3  . LEU A 1 63  ? 1.761   -4.629  0.336   1.00 0.00 ? 63  LEU A HB3  7  
ATOM   9831  H HG   . LEU A 1 63  ? 1.819   -3.821  -2.295  1.00 0.00 ? 63  LEU A HG   7  
ATOM   9832  H HD11 . LEU A 1 63  ? 0.653   -1.387  -1.161  1.00 0.00 ? 63  LEU A HD11 7  
ATOM   9833  H HD12 . LEU A 1 63  ? 0.437   -2.131  -2.764  1.00 0.00 ? 63  LEU A HD12 7  
ATOM   9834  H HD13 . LEU A 1 63  ? -0.525  -2.704  -1.379  1.00 0.00 ? 63  LEU A HD13 7  
ATOM   9835  H HD21 . LEU A 1 63  ? 2.829   -1.644  -1.106  1.00 0.00 ? 63  LEU A HD21 7  
ATOM   9836  H HD22 . LEU A 1 63  ? 2.756   -2.728  0.304   1.00 0.00 ? 63  LEU A HD22 7  
ATOM   9837  H HD23 . LEU A 1 63  ? 3.671   -3.211  -1.145  1.00 0.00 ? 63  LEU A HD23 7  
ATOM   9838  N N    . LEU A 1 64  ? 2.352   -6.212  -2.644  1.00 0.00 ? 64  LEU A N    7  
ATOM   9839  C CA   . LEU A 1 64  ? 3.491   -6.932  -3.189  1.00 0.00 ? 64  LEU A CA   7  
ATOM   9840  C C    . LEU A 1 64  ? 4.410   -5.949  -3.917  1.00 0.00 ? 64  LEU A C    7  
ATOM   9841  O O    . LEU A 1 64  ? 5.627   -6.127  -3.936  1.00 0.00 ? 64  LEU A O    7  
ATOM   9842  C CB   . LEU A 1 64  ? 3.021   -8.096  -4.063  1.00 0.00 ? 64  LEU A CB   7  
ATOM   9843  C CG   . LEU A 1 64  ? 1.740   -8.801  -3.609  1.00 0.00 ? 64  LEU A CG   7  
ATOM   9844  C CD1  . LEU A 1 64  ? 0.509   -7.941  -3.900  1.00 0.00 ? 64  LEU A CD1  7  
ATOM   9845  C CD2  . LEU A 1 64  ? 1.629   -10.192 -4.237  1.00 0.00 ? 64  LEU A CD2  7  
ATOM   9846  H H    . LEU A 1 64  ? 2.052   -5.425  -3.183  1.00 0.00 ? 64  LEU A H    7  
ATOM   9847  H HA   . LEU A 1 64  ? 4.040   -7.361  -2.350  1.00 0.00 ? 64  LEU A HA   7  
ATOM   9848  H HB2  . LEU A 1 64  ? 2.868   -7.725  -5.077  1.00 0.00 ? 64  LEU A HB2  7  
ATOM   9849  H HB3  . LEU A 1 64  ? 3.821   -8.835  -4.111  1.00 0.00 ? 64  LEU A HB3  7  
ATOM   9850  H HG   . LEU A 1 64  ? 1.789   -8.937  -2.530  1.00 0.00 ? 64  LEU A HG   7  
ATOM   9851  H HD11 . LEU A 1 64  ? -0.169  -8.486  -4.557  1.00 0.00 ? 64  LEU A HD11 7  
ATOM   9852  H HD12 . LEU A 1 64  ? 0.000   -7.708  -2.966  1.00 0.00 ? 64  LEU A HD12 7  
ATOM   9853  H HD13 . LEU A 1 64  ? 0.819   -7.015  -4.385  1.00 0.00 ? 64  LEU A HD13 7  
ATOM   9854  H HD21 . LEU A 1 64  ? 2.589   -10.701 -4.166  1.00 0.00 ? 64  LEU A HD21 7  
ATOM   9855  H HD22 . LEU A 1 64  ? 0.871   -10.769 -3.707  1.00 0.00 ? 64  LEU A HD22 7  
ATOM   9856  H HD23 . LEU A 1 64  ? 1.345   -10.096 -5.286  1.00 0.00 ? 64  LEU A HD23 7  
ATOM   9857  N N    . SER A 1 65  ? 3.791   -4.931  -4.499  1.00 0.00 ? 65  SER A N    7  
ATOM   9858  C CA   . SER A 1 65  ? 4.537   -3.918  -5.226  1.00 0.00 ? 65  SER A CA   7  
ATOM   9859  C C    . SER A 1 65  ? 4.480   -2.585  -4.476  1.00 0.00 ? 65  SER A C    7  
ATOM   9860  O O    . SER A 1 65  ? 3.522   -2.319  -3.750  1.00 0.00 ? 65  SER A O    7  
ATOM   9861  C CB   . SER A 1 65  ? 3.999   -3.752  -6.648  1.00 0.00 ? 65  SER A CB   7  
ATOM   9862  O OG   . SER A 1 65  ? 4.978   -4.077  -7.630  1.00 0.00 ? 65  SER A OG   7  
ATOM   9863  H H    . SER A 1 65  ? 2.801   -4.792  -4.478  1.00 0.00 ? 65  SER A H    7  
ATOM   9864  H HA   . SER A 1 65  ? 5.563   -4.290  -5.267  1.00 0.00 ? 65  SER A HA   7  
ATOM   9865  H HB2  . SER A 1 65  ? 3.125   -4.390  -6.781  1.00 0.00 ? 65  SER A HB2  7  
ATOM   9866  H HB3  . SER A 1 65  ? 3.667   -2.724  -6.792  1.00 0.00 ? 65  SER A HB3  7  
ATOM   9867  H HG   . SER A 1 65  ? 4.859   -5.024  -7.931  1.00 0.00 ? 65  SER A HG   7  
ATOM   9868  N N    . VAL A 1 66  ? 5.516   -1.785  -4.678  1.00 0.00 ? 66  VAL A N    7  
ATOM   9869  C CA   . VAL A 1 66  ? 5.593   -0.486  -4.030  1.00 0.00 ? 66  VAL A CA   7  
ATOM   9870  C C    . VAL A 1 66  ? 5.821   0.594   -5.089  1.00 0.00 ? 66  VAL A C    7  
ATOM   9871  O O    . VAL A 1 66  ? 6.199   0.291   -6.220  1.00 0.00 ? 66  VAL A O    7  
ATOM   9872  C CB   . VAL A 1 66  ? 6.679   -0.503  -2.951  1.00 0.00 ? 66  VAL A CB   7  
ATOM   9873  C CG1  . VAL A 1 66  ? 7.928   0.246   -3.418  1.00 0.00 ? 66  VAL A CG1  7  
ATOM   9874  C CG2  . VAL A 1 66  ? 6.153   0.073   -1.636  1.00 0.00 ? 66  VAL A CG2  7  
ATOM   9875  H H    . VAL A 1 66  ? 6.290   -2.009  -5.270  1.00 0.00 ? 66  VAL A H    7  
ATOM   9876  H HA   . VAL A 1 66  ? 4.637   -0.303  -3.542  1.00 0.00 ? 66  VAL A HA   7  
ATOM   9877  H HB   . VAL A 1 66  ? 6.958   -1.543  -2.773  1.00 0.00 ? 66  VAL A HB   7  
ATOM   9878  H HG11 . VAL A 1 66  ? 7.759   1.319   -3.340  1.00 0.00 ? 66  VAL A HG11 7  
ATOM   9879  H HG12 . VAL A 1 66  ? 8.776   -0.036  -2.793  1.00 0.00 ? 66  VAL A HG12 7  
ATOM   9880  H HG13 . VAL A 1 66  ? 8.141   -0.014  -4.456  1.00 0.00 ? 66  VAL A HG13 7  
ATOM   9881  H HG21 . VAL A 1 66  ? 5.237   0.633   -1.825  1.00 0.00 ? 66  VAL A HG21 7  
ATOM   9882  H HG22 . VAL A 1 66  ? 5.946   -0.740  -0.939  1.00 0.00 ? 66  VAL A HG22 7  
ATOM   9883  H HG23 . VAL A 1 66  ? 6.903   0.737   -1.204  1.00 0.00 ? 66  VAL A HG23 7  
ATOM   9884  N N    . ASP A 1 67  ? 5.581   1.834   -4.686  1.00 0.00 ? 67  ASP A N    7  
ATOM   9885  C CA   . ASP A 1 67  ? 5.754   2.960   -5.586  1.00 0.00 ? 67  ASP A CA   7  
ATOM   9886  C C    . ASP A 1 67  ? 7.245   3.150   -5.877  1.00 0.00 ? 67  ASP A C    7  
ATOM   9887  O O    . ASP A 1 67  ? 8.047   3.293   -4.956  1.00 0.00 ? 67  ASP A O    7  
ATOM   9888  C CB   . ASP A 1 67  ? 5.227   4.254   -4.959  1.00 0.00 ? 67  ASP A CB   7  
ATOM   9889  C CG   . ASP A 1 67  ? 6.265   5.365   -4.800  1.00 0.00 ? 67  ASP A CG   7  
ATOM   9890  O OD1  . ASP A 1 67  ? 6.868   5.730   -5.832  1.00 0.00 ? 67  ASP A OD1  7  
ATOM   9891  O OD2  . ASP A 1 67  ? 6.432   5.825   -3.649  1.00 0.00 ? 67  ASP A OD2  7  
ATOM   9892  H H    . ASP A 1 67  ? 5.273   2.073   -3.764  1.00 0.00 ? 67  ASP A H    7  
ATOM   9893  H HA   . ASP A 1 67  ? 5.185   2.704   -6.480  1.00 0.00 ? 67  ASP A HA   7  
ATOM   9894  H HB2  . ASP A 1 67  ? 4.406   4.627   -5.572  1.00 0.00 ? 67  ASP A HB2  7  
ATOM   9895  H HB3  . ASP A 1 67  ? 4.811   4.020   -3.980  1.00 0.00 ? 67  ASP A HB3  7  
ATOM   9896  N N    . GLY A 1 68  ? 7.569   3.145   -7.161  1.00 0.00 ? 68  GLY A N    7  
ATOM   9897  C CA   . GLY A 1 68  ? 8.949   3.315   -7.585  1.00 0.00 ? 68  GLY A CA   7  
ATOM   9898  C C    . GLY A 1 68  ? 9.648   1.962   -7.729  1.00 0.00 ? 68  GLY A C    7  
ATOM   9899  O O    . GLY A 1 68  ? 10.724  1.874   -8.323  1.00 0.00 ? 68  GLY A O    7  
ATOM   9900  H H    . GLY A 1 68  ? 6.911   3.027   -7.905  1.00 0.00 ? 68  GLY A H    7  
ATOM   9901  H HA2  . GLY A 1 68  ? 8.979   3.847   -8.536  1.00 0.00 ? 68  GLY A HA2  7  
ATOM   9902  H HA3  . GLY A 1 68  ? 9.483   3.928   -6.859  1.00 0.00 ? 68  GLY A HA3  7  
ATOM   9903  N N    . ARG A 1 69  ? 9.012   0.939   -7.180  1.00 0.00 ? 69  ARG A N    7  
ATOM   9904  C CA   . ARG A 1 69  ? 9.558   -0.405  -7.241  1.00 0.00 ? 69  ARG A CA   7  
ATOM   9905  C C    . ARG A 1 69  ? 8.429   -1.436  -7.306  1.00 0.00 ? 69  ARG A C    7  
ATOM   9906  O O    . ARG A 1 69  ? 7.777   -1.712  -6.300  1.00 0.00 ? 69  ARG A O    7  
ATOM   9907  C CB   . ARG A 1 69  ? 10.436  -0.698  -6.024  1.00 0.00 ? 69  ARG A CB   7  
ATOM   9908  C CG   . ARG A 1 69  ? 11.510  0.379   -5.850  1.00 0.00 ? 69  ARG A CG   7  
ATOM   9909  C CD   . ARG A 1 69  ? 12.592  -0.077  -4.870  1.00 0.00 ? 69  ARG A CD   7  
ATOM   9910  N NE   . ARG A 1 69  ? 13.933  0.158   -5.450  1.00 0.00 ? 69  ARG A NE   7  
ATOM   9911  C CZ   . ARG A 1 69  ? 15.075  0.098   -4.751  1.00 0.00 ? 69  ARG A CZ   7  
ATOM   9912  N NH1  . ARG A 1 69  ? 15.046  -0.194  -3.443  1.00 0.00 ? 69  ARG A NH1  7  
ATOM   9913  N NH2  . ARG A 1 69  ? 16.245  0.328   -5.361  1.00 0.00 ? 69  ARG A NH2  7  
ATOM   9914  H H    . ARG A 1 69  ? 8.137   1.019   -6.701  1.00 0.00 ? 69  ARG A H    7  
ATOM   9915  H HA   . ARG A 1 69  ? 10.155  -0.421  -8.152  1.00 0.00 ? 69  ARG A HA   7  
ATOM   9916  H HB2  . ARG A 1 69  ? 9.818   -0.748  -5.128  1.00 0.00 ? 69  ARG A HB2  7  
ATOM   9917  H HB3  . ARG A 1 69  ? 10.910  -1.673  -6.137  1.00 0.00 ? 69  ARG A HB3  7  
ATOM   9918  H HG2  . ARG A 1 69  ? 11.960  0.607   -6.815  1.00 0.00 ? 69  ARG A HG2  7  
ATOM   9919  H HG3  . ARG A 1 69  ? 11.050  1.299   -5.487  1.00 0.00 ? 69  ARG A HG3  7  
ATOM   9920  H HD2  . ARG A 1 69  ? 12.493  0.463   -3.928  1.00 0.00 ? 69  ARG A HD2  7  
ATOM   9921  H HD3  . ARG A 1 69  ? 12.465  -1.136  -4.643  1.00 0.00 ? 69  ARG A HD3  7  
ATOM   9922  H HE   . ARG A 1 69  ? 13.989  0.378   -6.423  1.00 0.00 ? 69  ARG A HE   7  
ATOM   9923  H HH11 . ARG A 1 69  ? 14.172  -0.365  -2.989  1.00 0.00 ? 69  ARG A HH11 7  
ATOM   9924  H HH12 . ARG A 1 69  ? 15.898  -0.239  -2.923  1.00 0.00 ? 69  ARG A HH12 7  
ATOM   9925  H HH21 . ARG A 1 69  ? 16.266  0.544   -6.337  1.00 0.00 ? 69  ARG A HH21 7  
ATOM   9926  H HH22 . ARG A 1 69  ? 17.097  0.281   -4.839  1.00 0.00 ? 69  ARG A HH22 7  
ATOM   9927  N N    . SER A 1 70  ? 8.231   -1.975  -8.499  1.00 0.00 ? 70  SER A N    7  
ATOM   9928  C CA   . SER A 1 70  ? 7.193   -2.969  -8.710  1.00 0.00 ? 70  SER A CA   7  
ATOM   9929  C C    . SER A 1 70  ? 7.608   -4.302  -8.081  1.00 0.00 ? 70  SER A C    7  
ATOM   9930  O O    . SER A 1 70  ? 7.738   -5.306  -8.779  1.00 0.00 ? 70  SER A O    7  
ATOM   9931  C CB   . SER A 1 70  ? 6.897   -3.153  -10.199 1.00 0.00 ? 70  SER A CB   7  
ATOM   9932  O OG   . SER A 1 70  ? 6.622   -1.914  -10.845 1.00 0.00 ? 70  SER A OG   7  
ATOM   9933  H H    . SER A 1 70  ? 8.765   -1.746  -9.313  1.00 0.00 ? 70  SER A H    7  
ATOM   9934  H HA   . SER A 1 70  ? 6.308   -2.572  -8.212  1.00 0.00 ? 70  SER A HA   7  
ATOM   9935  H HB2  . SER A 1 70  ? 7.750   -3.632  -10.681 1.00 0.00 ? 70  SER A HB2  7  
ATOM   9936  H HB3  . SER A 1 70  ? 6.046   -3.824  -10.320 1.00 0.00 ? 70  SER A HB3  7  
ATOM   9937  H HG   . SER A 1 70  ? 7.476   -1.487  -11.147 1.00 0.00 ? 70  SER A HG   7  
ATOM   9938  N N    . LEU A 1 71  ? 7.804   -4.265  -6.771  1.00 0.00 ? 71  LEU A N    7  
ATOM   9939  C CA   . LEU A 1 71  ? 8.203   -5.458  -6.042  1.00 0.00 ? 71  LEU A CA   7  
ATOM   9940  C C    . LEU A 1 71  ? 7.478   -6.673  -6.624  1.00 0.00 ? 71  LEU A C    7  
ATOM   9941  O O    . LEU A 1 71  ? 8.110   -7.567  -7.186  1.00 0.00 ? 71  LEU A O    7  
ATOM   9942  C CB   . LEU A 1 71  ? 7.978   -5.268  -4.541  1.00 0.00 ? 71  LEU A CB   7  
ATOM   9943  C CG   . LEU A 1 71  ? 9.087   -4.535  -3.784  1.00 0.00 ? 71  LEU A CG   7  
ATOM   9944  C CD1  . LEU A 1 71  ? 9.158   -3.065  -4.203  1.00 0.00 ? 71  LEU A CD1  7  
ATOM   9945  C CD2  . LEU A 1 71  ? 8.914   -4.691  -2.272  1.00 0.00 ? 71  LEU A CD2  7  
ATOM   9946  H H    . LEU A 1 71  ? 7.696   -3.444  -6.212  1.00 0.00 ? 71  LEU A H    7  
ATOM   9947  H HA   . LEU A 1 71  ? 9.275   -5.591  -6.194  1.00 0.00 ? 71  LEU A HA   7  
ATOM   9948  H HB2  . LEU A 1 71  ? 7.046   -4.720  -4.401  1.00 0.00 ? 71  LEU A HB2  7  
ATOM   9949  H HB3  . LEU A 1 71  ? 7.842   -6.248  -4.087  1.00 0.00 ? 71  LEU A HB3  7  
ATOM   9950  H HG   . LEU A 1 71  ? 10.041  -4.991  -4.047  1.00 0.00 ? 71  LEU A HG   7  
ATOM   9951  H HD11 . LEU A 1 71  ? 9.983   -2.578  -3.683  1.00 0.00 ? 71  LEU A HD11 7  
ATOM   9952  H HD12 . LEU A 1 71  ? 9.320   -3.002  -5.280  1.00 0.00 ? 71  LEU A HD12 7  
ATOM   9953  H HD13 . LEU A 1 71  ? 8.222   -2.568  -3.947  1.00 0.00 ? 71  LEU A HD13 7  
ATOM   9954  H HD21 . LEU A 1 71  ? 8.363   -3.837  -1.878  1.00 0.00 ? 71  LEU A HD21 7  
ATOM   9955  H HD22 . LEU A 1 71  ? 8.361   -5.607  -2.062  1.00 0.00 ? 71  LEU A HD22 7  
ATOM   9956  H HD23 . LEU A 1 71  ? 9.894   -4.741  -1.797  1.00 0.00 ? 71  LEU A HD23 7  
ATOM   9957  N N    . VAL A 1 72  ? 6.162   -6.666  -6.469  1.00 0.00 ? 72  VAL A N    7  
ATOM   9958  C CA   . VAL A 1 72  ? 5.344   -7.757  -6.973  1.00 0.00 ? 72  VAL A CA   7  
ATOM   9959  C C    . VAL A 1 72  ? 5.247   -8.850  -5.905  1.00 0.00 ? 72  VAL A C    7  
ATOM   9960  O O    . VAL A 1 72  ? 4.451   -9.779  -6.036  1.00 0.00 ? 72  VAL A O    7  
ATOM   9961  C CB   . VAL A 1 72  ? 5.909   -8.265  -8.300  1.00 0.00 ? 72  VAL A CB   7  
ATOM   9962  C CG1  . VAL A 1 72  ? 6.758   -9.522  -8.091  1.00 0.00 ? 72  VAL A CG1  7  
ATOM   9963  C CG2  . VAL A 1 72  ? 4.789   -8.523  -9.311  1.00 0.00 ? 72  VAL A CG2  7  
ATOM   9964  H H    . VAL A 1 72  ? 5.657   -5.935  -6.012  1.00 0.00 ? 72  VAL A H    7  
ATOM   9965  H HA   . VAL A 1 72  ? 4.346   -7.360  -7.160  1.00 0.00 ? 72  VAL A HA   7  
ATOM   9966  H HB   . VAL A 1 72  ? 6.556   -7.489  -8.710  1.00 0.00 ? 72  VAL A HB   7  
ATOM   9967  H HG11 . VAL A 1 72  ? 7.193   -9.502  -7.090  1.00 0.00 ? 72  VAL A HG11 7  
ATOM   9968  H HG12 . VAL A 1 72  ? 6.130   -10.405 -8.198  1.00 0.00 ? 72  VAL A HG12 7  
ATOM   9969  H HG13 . VAL A 1 72  ? 7.556   -9.549  -8.832  1.00 0.00 ? 72  VAL A HG13 7  
ATOM   9970  H HG21 . VAL A 1 72  ? 4.597   -7.614  -9.879  1.00 0.00 ? 72  VAL A HG21 7  
ATOM   9971  H HG22 . VAL A 1 72  ? 5.088   -9.321  -9.991  1.00 0.00 ? 72  VAL A HG22 7  
ATOM   9972  H HG23 . VAL A 1 72  ? 3.884   -8.820  -8.781  1.00 0.00 ? 72  VAL A HG23 7  
ATOM   9973  N N    . GLY A 1 73  ? 6.069   -8.702  -4.877  1.00 0.00 ? 73  GLY A N    7  
ATOM   9974  C CA   . GLY A 1 73  ? 6.085   -9.666  -3.790  1.00 0.00 ? 73  GLY A CA   7  
ATOM   9975  C C    . GLY A 1 73  ? 7.423   -9.632  -3.047  1.00 0.00 ? 73  GLY A C    7  
ATOM   9976  O O    . GLY A 1 73  ? 8.052   -10.669 -2.849  1.00 0.00 ? 73  GLY A O    7  
ATOM   9977  H H    . GLY A 1 73  ? 6.713   -7.943  -4.780  1.00 0.00 ? 73  GLY A H    7  
ATOM   9978  H HA2  . GLY A 1 73  ? 5.274   -9.448  -3.095  1.00 0.00 ? 73  GLY A HA2  7  
ATOM   9979  H HA3  . GLY A 1 73  ? 5.909   -10.667 -4.183  1.00 0.00 ? 73  GLY A HA3  7  
ATOM   9980  N N    . LEU A 1 74  ? 7.817   -8.428  -2.660  1.00 0.00 ? 74  LEU A N    7  
ATOM   9981  C CA   . LEU A 1 74  ? 9.068   -8.246  -1.944  1.00 0.00 ? 74  LEU A CA   7  
ATOM   9982  C C    . LEU A 1 74  ? 8.786   -7.605  -0.584  1.00 0.00 ? 74  LEU A C    7  
ATOM   9983  O O    . LEU A 1 74  ? 7.656   -7.199  -0.308  1.00 0.00 ? 74  LEU A O    7  
ATOM   9984  C CB   . LEU A 1 74  ? 10.065  -7.460  -2.799  1.00 0.00 ? 74  LEU A CB   7  
ATOM   9985  C CG   . LEU A 1 74  ? 10.920  -8.285  -3.761  1.00 0.00 ? 74  LEU A CG   7  
ATOM   9986  C CD1  . LEU A 1 74  ? 11.972  -7.410  -4.449  1.00 0.00 ? 74  LEU A CD1  7  
ATOM   9987  C CD2  . LEU A 1 74  ? 11.549  -9.484  -3.048  1.00 0.00 ? 74  LEU A CD2  7  
ATOM   9988  H H    . LEU A 1 74  ? 7.299   -7.590  -2.825  1.00 0.00 ? 74  LEU A H    7  
ATOM   9989  H HA   . LEU A 1 74  ? 9.498   -9.234  -1.778  1.00 0.00 ? 74  LEU A HA   7  
ATOM   9990  H HB2  . LEU A 1 74  ? 9.511   -6.719  -3.378  1.00 0.00 ? 74  LEU A HB2  7  
ATOM   9991  H HB3  . LEU A 1 74  ? 10.731  -6.910  -2.133  1.00 0.00 ? 74  LEU A HB3  7  
ATOM   9992  H HG   . LEU A 1 74  ? 10.270  -8.680  -4.544  1.00 0.00 ? 74  LEU A HG   7  
ATOM   9993  H HD11 . LEU A 1 74  ? 12.088  -6.479  -3.894  1.00 0.00 ? 74  LEU A HD11 7  
ATOM   9994  H HD12 . LEU A 1 74  ? 12.925  -7.941  -4.474  1.00 0.00 ? 74  LEU A HD12 7  
ATOM   9995  H HD13 . LEU A 1 74  ? 11.653  -7.190  -5.466  1.00 0.00 ? 74  LEU A HD13 7  
ATOM   9996  H HD21 . LEU A 1 74  ? 11.477  -9.341  -1.970  1.00 0.00 ? 74  LEU A HD21 7  
ATOM   9997  H HD22 . LEU A 1 74  ? 11.021  -10.394 -3.332  1.00 0.00 ? 74  LEU A HD22 7  
ATOM   9998  H HD23 . LEU A 1 74  ? 12.597  -9.569  -3.334  1.00 0.00 ? 74  LEU A HD23 7  
ATOM   9999  N N    . SER A 1 75  ? 9.829   -7.532  0.229   1.00 0.00 ? 75  SER A N    7  
ATOM   10000 C CA   . SER A 1 75  ? 9.706   -6.947  1.553   1.00 0.00 ? 75  SER A CA   7  
ATOM   10001 C C    . SER A 1 75  ? 9.572   -5.426  1.444   1.00 0.00 ? 75  SER A C    7  
ATOM   10002 O O    . SER A 1 75  ? 9.971   -4.837  0.441   1.00 0.00 ? 75  SER A O    7  
ATOM   10003 C CB   . SER A 1 75  ? 10.905  -7.313  2.432   1.00 0.00 ? 75  SER A CB   7  
ATOM   10004 O OG   . SER A 1 75  ? 10.502  -7.815  3.702   1.00 0.00 ? 75  SER A OG   7  
ATOM   10005 H H    . SER A 1 75  ? 10.743  -7.863  -0.003  1.00 0.00 ? 75  SER A H    7  
ATOM   10006 H HA   . SER A 1 75  ? 8.801   -7.381  1.979   1.00 0.00 ? 75  SER A HA   7  
ATOM   10007 H HB2  . SER A 1 75  ? 11.512  -8.061  1.920   1.00 0.00 ? 75  SER A HB2  7  
ATOM   10008 H HB3  . SER A 1 75  ? 11.534  -6.434  2.571   1.00 0.00 ? 75  SER A HB3  7  
ATOM   10009 H HG   . SER A 1 75  ? 9.612   -8.264  3.627   1.00 0.00 ? 75  SER A HG   7  
ATOM   10010 N N    . GLN A 1 76  ? 9.012   -4.836  2.489   1.00 0.00 ? 76  GLN A N    7  
ATOM   10011 C CA   . GLN A 1 76  ? 8.821   -3.397  2.523   1.00 0.00 ? 76  GLN A CA   7  
ATOM   10012 C C    . GLN A 1 76  ? 10.110  -2.702  2.967   1.00 0.00 ? 76  GLN A C    7  
ATOM   10013 O O    . GLN A 1 76  ? 10.255  -1.491  2.798   1.00 0.00 ? 76  GLN A O    7  
ATOM   10014 C CB   . GLN A 1 76  ? 7.651   -3.019  3.434   1.00 0.00 ? 76  GLN A CB   7  
ATOM   10015 C CG   . GLN A 1 76  ? 8.095   -2.957  4.898   1.00 0.00 ? 76  GLN A CG   7  
ATOM   10016 C CD   . GLN A 1 76  ? 6.969   -2.429  5.789   1.00 0.00 ? 76  GLN A CD   7  
ATOM   10017 O OE1  . GLN A 1 76  ? 6.126   -1.652  5.373   1.00 0.00 ? 76  GLN A OE1  7  
ATOM   10018 N NE2  . GLN A 1 76  ? 7.005   -2.891  7.036   1.00 0.00 ? 76  GLN A NE2  7  
ATOM   10019 H H    . GLN A 1 76  ? 8.690   -5.325  3.301   1.00 0.00 ? 76  GLN A H    7  
ATOM   10020 H HA   . GLN A 1 76  ? 8.582   -3.112  1.498   1.00 0.00 ? 76  GLN A HA   7  
ATOM   10021 H HB2  . GLN A 1 76  ? 7.246   -2.054  3.132   1.00 0.00 ? 76  GLN A HB2  7  
ATOM   10022 H HB3  . GLN A 1 76  ? 6.850   -3.751  3.325   1.00 0.00 ? 76  GLN A HB3  7  
ATOM   10023 H HG2  . GLN A 1 76  ? 8.394   -3.951  5.232   1.00 0.00 ? 76  GLN A HG2  7  
ATOM   10024 H HG3  . GLN A 1 76  ? 8.970   -2.313  4.988   1.00 0.00 ? 76  GLN A HG3  7  
ATOM   10025 H HE21 . GLN A 1 76  ? 7.725   -3.527  7.313   1.00 0.00 ? 76  GLN A HE21 7  
ATOM   10026 H HE22 . GLN A 1 76  ? 6.311   -2.605  7.696   1.00 0.00 ? 76  GLN A HE22 7  
ATOM   10027 N N    . GLU A 1 77  ? 11.011  -3.496  3.525   1.00 0.00 ? 77  GLU A N    7  
ATOM   10028 C CA   . GLU A 1 77  ? 12.282  -2.971  3.994   1.00 0.00 ? 77  GLU A CA   7  
ATOM   10029 C C    . GLU A 1 77  ? 12.826  -1.936  3.008   1.00 0.00 ? 77  GLU A C    7  
ATOM   10030 O O    . GLU A 1 77  ? 13.110  -0.800  3.387   1.00 0.00 ? 77  GLU A O    7  
ATOM   10031 C CB   . GLU A 1 77  ? 13.291  -4.099  4.218   1.00 0.00 ? 77  GLU A CB   7  
ATOM   10032 C CG   . GLU A 1 77  ? 14.724  -3.593  4.046   1.00 0.00 ? 77  GLU A CG   7  
ATOM   10033 C CD   . GLU A 1 77  ? 15.627  -4.111  5.168   1.00 0.00 ? 77  GLU A CD   7  
ATOM   10034 O OE1  . GLU A 1 77  ? 15.579  -5.336  5.416   1.00 0.00 ? 77  GLU A OE1  7  
ATOM   10035 O OE2  . GLU A 1 77  ? 16.343  -3.270  5.754   1.00 0.00 ? 77  GLU A OE2  7  
ATOM   10036 H H    . GLU A 1 77  ? 10.883  -4.478  3.658   1.00 0.00 ? 77  GLU A H    7  
ATOM   10037 H HA   . GLU A 1 77  ? 12.062  -2.494  4.949   1.00 0.00 ? 77  GLU A HA   7  
ATOM   10038 H HB2  . GLU A 1 77  ? 13.165  -4.512  5.219   1.00 0.00 ? 77  GLU A HB2  7  
ATOM   10039 H HB3  . GLU A 1 77  ? 13.100  -4.908  3.514   1.00 0.00 ? 77  GLU A HB3  7  
ATOM   10040 H HG2  . GLU A 1 77  ? 15.116  -3.919  3.083   1.00 0.00 ? 77  GLU A HG2  7  
ATOM   10041 H HG3  . GLU A 1 77  ? 14.733  -2.504  4.043   1.00 0.00 ? 77  GLU A HG3  7  
ATOM   10042 N N    . ARG A 1 78  ? 12.957  -2.366  1.761   1.00 0.00 ? 78  ARG A N    7  
ATOM   10043 C CA   . ARG A 1 78  ? 13.461  -1.489  0.718   1.00 0.00 ? 78  ARG A CA   7  
ATOM   10044 C C    . ARG A 1 78  ? 12.324  -0.647  0.136   1.00 0.00 ? 78  ARG A C    7  
ATOM   10045 O O    . ARG A 1 78  ? 12.399  0.582   0.127   1.00 0.00 ? 78  ARG A O    7  
ATOM   10046 C CB   . ARG A 1 78  ? 14.117  -2.295  -0.407  1.00 0.00 ? 78  ARG A CB   7  
ATOM   10047 C CG   . ARG A 1 78  ? 14.811  -3.542  0.145   1.00 0.00 ? 78  ARG A CG   7  
ATOM   10048 C CD   . ARG A 1 78  ? 14.014  -4.804  -0.189  1.00 0.00 ? 78  ARG A CD   7  
ATOM   10049 N NE   . ARG A 1 78  ? 14.915  -5.979  -0.219  1.00 0.00 ? 78  ARG A NE   7  
ATOM   10050 C CZ   . ARG A 1 78  ? 14.640  -7.119  -0.864  1.00 0.00 ? 78  ARG A CZ   7  
ATOM   10051 N NH1  . ARG A 1 78  ? 13.489  -7.248  -1.537  1.00 0.00 ? 78  ARG A NH1  7  
ATOM   10052 N NH2  . ARG A 1 78  ? 15.517  -8.133  -0.836  1.00 0.00 ? 78  ARG A NH2  7  
ATOM   10053 H H    . ARG A 1 78  ? 12.723  -3.290  1.460   1.00 0.00 ? 78  ARG A H    7  
ATOM   10054 H HA   . ARG A 1 78  ? 14.200  -0.862  1.215   1.00 0.00 ? 78  ARG A HA   7  
ATOM   10055 H HB2  . ARG A 1 78  ? 13.364  -2.585  -1.138  1.00 0.00 ? 78  ARG A HB2  7  
ATOM   10056 H HB3  . ARG A 1 78  ? 14.844  -1.671  -0.929  1.00 0.00 ? 78  ARG A HB3  7  
ATOM   10057 H HG2  . ARG A 1 78  ? 15.814  -3.619  -0.274  1.00 0.00 ? 78  ARG A HG2  7  
ATOM   10058 H HG3  . ARG A 1 78  ? 14.922  -3.452  1.226   1.00 0.00 ? 78  ARG A HG3  7  
ATOM   10059 H HD2  . ARG A 1 78  ? 13.231  -4.955  0.554   1.00 0.00 ? 78  ARG A HD2  7  
ATOM   10060 H HD3  . ARG A 1 78  ? 13.521  -4.688  -1.154  1.00 0.00 ? 78  ARG A HD3  7  
ATOM   10061 H HE   . ARG A 1 78  ? 15.782  -5.915  0.274   1.00 0.00 ? 78  ARG A HE   7  
ATOM   10062 H HH11 . ARG A 1 78  ? 12.835  -6.492  -1.559  1.00 0.00 ? 78  ARG A HH11 7  
ATOM   10063 H HH12 . ARG A 1 78  ? 13.283  -8.099  -2.019  1.00 0.00 ? 78  ARG A HH12 7  
ATOM   10064 H HH21 . ARG A 1 78  ? 16.377  -8.036  -0.334  1.00 0.00 ? 78  ARG A HH21 7  
ATOM   10065 H HH22 . ARG A 1 78  ? 15.312  -8.985  -1.319  1.00 0.00 ? 78  ARG A HH22 7  
ATOM   10066 N N    . ALA A 1 79  ? 11.299  -1.341  -0.338  1.00 0.00 ? 79  ALA A N    7  
ATOM   10067 C CA   . ALA A 1 79  ? 10.148  -0.671  -0.920  1.00 0.00 ? 79  ALA A CA   7  
ATOM   10068 C C    . ALA A 1 79  ? 9.721   0.485   -0.012  1.00 0.00 ? 79  ALA A C    7  
ATOM   10069 O O    . ALA A 1 79  ? 9.808   1.648   -0.402  1.00 0.00 ? 79  ALA A O    7  
ATOM   10070 C CB   . ALA A 1 79  ? 9.024   -1.685  -1.140  1.00 0.00 ? 79  ALA A CB   7  
ATOM   10071 H H    . ALA A 1 79  ? 11.248  -2.339  -0.327  1.00 0.00 ? 79  ALA A H    7  
ATOM   10072 H HA   . ALA A 1 79  ? 10.452  -0.269  -1.887  1.00 0.00 ? 79  ALA A HA   7  
ATOM   10073 H HB1  . ALA A 1 79  ? 8.917   -1.883  -2.206  1.00 0.00 ? 79  ALA A HB1  7  
ATOM   10074 H HB2  . ALA A 1 79  ? 9.265   -2.613  -0.621  1.00 0.00 ? 79  ALA A HB2  7  
ATOM   10075 H HB3  . ALA A 1 79  ? 8.090   -1.283  -0.749  1.00 0.00 ? 79  ALA A HB3  7  
ATOM   10076 N N    . ALA A 1 80  ? 9.270   0.122   1.180   1.00 0.00 ? 80  ALA A N    7  
ATOM   10077 C CA   . ALA A 1 80  ? 8.831   1.114   2.146   1.00 0.00 ? 80  ALA A CA   7  
ATOM   10078 C C    . ALA A 1 80  ? 9.657   2.391   1.972   1.00 0.00 ? 80  ALA A C    7  
ATOM   10079 O O    . ALA A 1 80  ? 9.171   3.381   1.430   1.00 0.00 ? 80  ALA A O    7  
ATOM   10080 C CB   . ALA A 1 80  ? 8.940   0.535   3.558   1.00 0.00 ? 80  ALA A CB   7  
ATOM   10081 H H    . ALA A 1 80  ? 9.203   -0.826  1.489   1.00 0.00 ? 80  ALA A H    7  
ATOM   10082 H HA   . ALA A 1 80  ? 7.785   1.338   1.938   1.00 0.00 ? 80  ALA A HA   7  
ATOM   10083 H HB1  . ALA A 1 80  ? 9.991   0.433   3.828   1.00 0.00 ? 80  ALA A HB1  7  
ATOM   10084 H HB2  . ALA A 1 80  ? 8.448   1.205   4.265   1.00 0.00 ? 80  ALA A HB2  7  
ATOM   10085 H HB3  . ALA A 1 80  ? 8.460   -0.443  3.588   1.00 0.00 ? 80  ALA A HB3  7  
ATOM   10086 N N    . GLU A 1 81  ? 10.894  2.325   2.445   1.00 0.00 ? 81  GLU A N    7  
ATOM   10087 C CA   . GLU A 1 81  ? 11.793  3.463   2.351   1.00 0.00 ? 81  GLU A CA   7  
ATOM   10088 C C    . GLU A 1 81  ? 11.564  4.211   1.035   1.00 0.00 ? 81  GLU A C    7  
ATOM   10089 O O    . GLU A 1 81  ? 11.014  5.310   1.030   1.00 0.00 ? 81  GLU A O    7  
ATOM   10090 C CB   . GLU A 1 81  ? 13.251  3.022   2.484   1.00 0.00 ? 81  GLU A CB   7  
ATOM   10091 C CG   . GLU A 1 81  ? 14.194  4.225   2.424   1.00 0.00 ? 81  GLU A CG   7  
ATOM   10092 C CD   . GLU A 1 81  ? 15.512  3.924   3.143   1.00 0.00 ? 81  GLU A CD   7  
ATOM   10093 O OE1  . GLU A 1 81  ? 16.088  2.856   2.847   1.00 0.00 ? 81  GLU A OE1  7  
ATOM   10094 O OE2  . GLU A 1 81  ? 15.911  4.770   3.972   1.00 0.00 ? 81  GLU A OE2  7  
ATOM   10095 H H    . GLU A 1 81  ? 11.282  1.516   2.886   1.00 0.00 ? 81  GLU A H    7  
ATOM   10096 H HA   . GLU A 1 81  ? 11.535  4.107   3.191   1.00 0.00 ? 81  GLU A HA   7  
ATOM   10097 H HB2  . GLU A 1 81  ? 13.390  2.493   3.427   1.00 0.00 ? 81  GLU A HB2  7  
ATOM   10098 H HB3  . GLU A 1 81  ? 13.499  2.321   1.686   1.00 0.00 ? 81  GLU A HB3  7  
ATOM   10099 H HG2  . GLU A 1 81  ? 14.395  4.483   1.384   1.00 0.00 ? 81  GLU A HG2  7  
ATOM   10100 H HG3  . GLU A 1 81  ? 13.715  5.089   2.882   1.00 0.00 ? 81  GLU A HG3  7  
ATOM   10101 N N    . LEU A 1 82  ? 11.999  3.584   -0.049  1.00 0.00 ? 82  LEU A N    7  
ATOM   10102 C CA   . LEU A 1 82  ? 11.848  4.176   -1.367  1.00 0.00 ? 82  LEU A CA   7  
ATOM   10103 C C    . LEU A 1 82  ? 10.434  4.743   -1.508  1.00 0.00 ? 82  LEU A C    7  
ATOM   10104 O O    . LEU A 1 82  ? 10.214  5.695   -2.257  1.00 0.00 ? 82  LEU A O    7  
ATOM   10105 C CB   . LEU A 1 82  ? 12.216  3.165   -2.455  1.00 0.00 ? 82  LEU A CB   7  
ATOM   10106 C CG   . LEU A 1 82  ? 11.981  3.615   -3.897  1.00 0.00 ? 82  LEU A CG   7  
ATOM   10107 C CD1  . LEU A 1 82  ? 10.490  3.823   -4.171  1.00 0.00 ? 82  LEU A CD1  7  
ATOM   10108 C CD2  . LEU A 1 82  ? 12.803  4.864   -4.223  1.00 0.00 ? 82  LEU A CD2  7  
ATOM   10109 H H    . LEU A 1 82  ? 12.444  2.688   -0.035  1.00 0.00 ? 82  LEU A H    7  
ATOM   10110 H HA   . LEU A 1 82  ? 12.558  4.999   -1.438  1.00 0.00 ? 82  LEU A HA   7  
ATOM   10111 H HB2  . LEU A 1 82  ? 13.271  2.908   -2.342  1.00 0.00 ? 82  LEU A HB2  7  
ATOM   10112 H HB3  . LEU A 1 82  ? 11.646  2.252   -2.281  1.00 0.00 ? 82  LEU A HB3  7  
ATOM   10113 H HG   . LEU A 1 82  ? 12.323  2.823   -4.562  1.00 0.00 ? 82  LEU A HG   7  
ATOM   10114 H HD11 . LEU A 1 82  ? 10.223  3.346   -5.113  1.00 0.00 ? 82  LEU A HD11 7  
ATOM   10115 H HD12 . LEU A 1 82  ? 9.908   3.381   -3.362  1.00 0.00 ? 82  LEU A HD12 7  
ATOM   10116 H HD13 . LEU A 1 82  ? 10.278  4.890   -4.230  1.00 0.00 ? 82  LEU A HD13 7  
ATOM   10117 H HD21 . LEU A 1 82  ? 13.175  5.305   -3.298  1.00 0.00 ? 82  LEU A HD21 7  
ATOM   10118 H HD22 . LEU A 1 82  ? 13.646  4.588   -4.858  1.00 0.00 ? 82  LEU A HD22 7  
ATOM   10119 H HD23 . LEU A 1 82  ? 12.176  5.586   -4.746  1.00 0.00 ? 82  LEU A HD23 7  
ATOM   10120 N N    . MET A 1 83  ? 9.511   4.136   -0.777  1.00 0.00 ? 83  MET A N    7  
ATOM   10121 C CA   . MET A 1 83  ? 8.125   4.568   -0.813  1.00 0.00 ? 83  MET A CA   7  
ATOM   10122 C C    . MET A 1 83  ? 7.873   5.686   0.201   1.00 0.00 ? 83  MET A C    7  
ATOM   10123 O O    . MET A 1 83  ? 7.018   6.543   -0.016  1.00 0.00 ? 83  MET A O    7  
ATOM   10124 C CB   . MET A 1 83  ? 7.211   3.379   -0.499  1.00 0.00 ? 83  MET A CB   7  
ATOM   10125 C CG   . MET A 1 83  ? 6.190   3.164   -1.618  1.00 0.00 ? 83  MET A CG   7  
ATOM   10126 S SD   . MET A 1 83  ? 4.587   2.810   -0.920  1.00 0.00 ? 83  MET A SD   7  
ATOM   10127 C CE   . MET A 1 83  ? 5.078   1.991   0.588   1.00 0.00 ? 83  MET A CE   7  
ATOM   10128 H H    . MET A 1 83  ? 9.698   3.362   -0.172  1.00 0.00 ? 83  MET A H    7  
ATOM   10129 H HA   . MET A 1 83  ? 7.958   4.939   -1.824  1.00 0.00 ? 83  MET A HA   7  
ATOM   10130 H HB2  . MET A 1 83  ? 7.812   2.479   -0.371  1.00 0.00 ? 83  MET A HB2  7  
ATOM   10131 H HB3  . MET A 1 83  ? 6.692   3.555   0.443   1.00 0.00 ? 83  MET A HB3  7  
ATOM   10132 H HG2  . MET A 1 83  ? 6.134   4.052   -2.248  1.00 0.00 ? 83  MET A HG2  7  
ATOM   10133 H HG3  . MET A 1 83  ? 6.507   2.340   -2.257  1.00 0.00 ? 83  MET A HG3  7  
ATOM   10134 H HE1  . MET A 1 83  ? 5.204   2.732   1.379   1.00 0.00 ? 83  MET A HE1  7  
ATOM   10135 H HE2  . MET A 1 83  ? 4.310   1.276   0.881   1.00 0.00 ? 83  MET A HE2  7  
ATOM   10136 H HE3  . MET A 1 83  ? 6.021   1.468   0.427   1.00 0.00 ? 83  MET A HE3  7  
ATOM   10137 N N    . THR A 1 84  ? 8.635   5.641   1.284   1.00 0.00 ? 84  THR A N    7  
ATOM   10138 C CA   . THR A 1 84  ? 8.506   6.640   2.330   1.00 0.00 ? 84  THR A CA   7  
ATOM   10139 C C    . THR A 1 84  ? 8.601   8.048   1.740   1.00 0.00 ? 84  THR A C    7  
ATOM   10140 O O    . THR A 1 84  ? 7.730   8.885   1.974   1.00 0.00 ? 84  THR A O    7  
ATOM   10141 C CB   . THR A 1 84  ? 9.570   6.353   3.392   1.00 0.00 ? 84  THR A CB   7  
ATOM   10142 O OG1  . THR A 1 84  ? 9.215   5.070   3.901   1.00 0.00 ? 84  THR A OG1  7  
ATOM   10143 C CG2  . THR A 1 84  ? 9.450   7.279   4.605   1.00 0.00 ? 84  THR A CG2  7  
ATOM   10144 H H    . THR A 1 84  ? 9.328   4.940   1.452   1.00 0.00 ? 84  THR A H    7  
ATOM   10145 H HA   . THR A 1 84  ? 7.514   6.546   2.775   1.00 0.00 ? 84  THR A HA   7  
ATOM   10146 H HB   . THR A 1 84  ? 10.570  6.400   2.963   1.00 0.00 ? 84  THR A HB   7  
ATOM   10147 H HG1  . THR A 1 84  ? 9.580   4.354   3.304   1.00 0.00 ? 84  THR A HG1  7  
ATOM   10148 H HG21 . THR A 1 84  ? 8.818   6.810   5.359   1.00 0.00 ? 84  THR A HG21 7  
ATOM   10149 H HG22 . THR A 1 84  ? 10.441  7.457   5.023   1.00 0.00 ? 84  THR A HG22 7  
ATOM   10150 H HG23 . THR A 1 84  ? 9.008   8.226   4.298   1.00 0.00 ? 84  THR A HG23 7  
ATOM   10151 N N    . ARG A 1 85  ? 9.668   8.266   0.985   1.00 0.00 ? 85  ARG A N    7  
ATOM   10152 C CA   . ARG A 1 85  ? 9.890   9.559   0.359   1.00 0.00 ? 85  ARG A CA   7  
ATOM   10153 C C    . ARG A 1 85  ? 8.879   9.784   -0.766  1.00 0.00 ? 85  ARG A C    7  
ATOM   10154 O O    . ARG A 1 85  ? 9.259   10.003  -1.915  1.00 0.00 ? 85  ARG A O    7  
ATOM   10155 C CB   . ARG A 1 85  ? 11.306  9.658   -0.212  1.00 0.00 ? 85  ARG A CB   7  
ATOM   10156 C CG   . ARG A 1 85  ? 12.269  10.256  0.815   1.00 0.00 ? 85  ARG A CG   7  
ATOM   10157 C CD   . ARG A 1 85  ? 12.180  11.785  0.827   1.00 0.00 ? 85  ARG A CD   7  
ATOM   10158 N NE   . ARG A 1 85  ? 13.275  12.362  0.015   1.00 0.00 ? 85  ARG A NE   7  
ATOM   10159 C CZ   . ARG A 1 85  ? 13.283  13.618  -0.449  1.00 0.00 ? 85  ARG A CZ   7  
ATOM   10160 N NH1  . ARG A 1 85  ? 12.256  14.437  -0.186  1.00 0.00 ? 85  ARG A NH1  7  
ATOM   10161 N NH2  . ARG A 1 85  ? 14.319  14.057  -1.177  1.00 0.00 ? 85  ARG A NH2  7  
ATOM   10162 H H    . ARG A 1 85  ? 10.373  7.581   0.800   1.00 0.00 ? 85  ARG A H    7  
ATOM   10163 H HA   . ARG A 1 85  ? 9.752   10.285  1.159   1.00 0.00 ? 85  ARG A HA   7  
ATOM   10164 H HB2  . ARG A 1 85  ? 11.654  8.668   -0.509  1.00 0.00 ? 85  ARG A HB2  7  
ATOM   10165 H HB3  . ARG A 1 85  ? 11.297  10.276  -1.110  1.00 0.00 ? 85  ARG A HB3  7  
ATOM   10166 H HG2  . ARG A 1 85  ? 12.038  9.868   1.807   1.00 0.00 ? 85  ARG A HG2  7  
ATOM   10167 H HG3  . ARG A 1 85  ? 13.290  9.951   0.583   1.00 0.00 ? 85  ARG A HG3  7  
ATOM   10168 H HD2  . ARG A 1 85  ? 11.216  12.102  0.430   1.00 0.00 ? 85  ARG A HD2  7  
ATOM   10169 H HD3  . ARG A 1 85  ? 12.241  12.153  1.850   1.00 0.00 ? 85  ARG A HD3  7  
ATOM   10170 H HE   . ARG A 1 85  ? 14.057  11.777  -0.198  1.00 0.00 ? 85  ARG A HE   7  
ATOM   10171 H HH11 . ARG A 1 85  ? 11.481  14.109  0.357   1.00 0.00 ? 85  ARG A HH11 7  
ATOM   10172 H HH12 . ARG A 1 85  ? 12.261  15.375  -0.533  1.00 0.00 ? 85  ARG A HH12 7  
ATOM   10173 H HH21 . ARG A 1 85  ? 15.087  13.446  -1.372  1.00 0.00 ? 85  ARG A HH21 7  
ATOM   10174 H HH22 . ARG A 1 85  ? 14.325  14.995  -1.524  1.00 0.00 ? 85  ARG A HH22 7  
ATOM   10175 N N    . THR A 1 86  ? 7.607   9.721   -0.397  1.00 0.00 ? 86  THR A N    7  
ATOM   10176 C CA   . THR A 1 86  ? 6.537   9.915   -1.360  1.00 0.00 ? 86  THR A CA   7  
ATOM   10177 C C    . THR A 1 86  ? 6.285   11.408  -1.585  1.00 0.00 ? 86  THR A C    7  
ATOM   10178 O O    . THR A 1 86  ? 6.270   11.875  -2.723  1.00 0.00 ? 86  THR A O    7  
ATOM   10179 C CB   . THR A 1 86  ? 5.304   9.160   -0.858  1.00 0.00 ? 86  THR A CB   7  
ATOM   10180 O OG1  . THR A 1 86  ? 5.219   8.026   -1.717  1.00 0.00 ? 86  THR A OG1  7  
ATOM   10181 C CG2  . THR A 1 86  ? 4.005   9.923   -1.117  1.00 0.00 ? 86  THR A CG2  7  
ATOM   10182 H H    . THR A 1 86  ? 7.305   9.543   0.539   1.00 0.00 ? 86  THR A H    7  
ATOM   10183 H HA   . THR A 1 86  ? 6.855   9.498   -2.316  1.00 0.00 ? 86  THR A HA   7  
ATOM   10184 H HB   . THR A 1 86  ? 5.406   8.909   0.198   1.00 0.00 ? 86  THR A HB   7  
ATOM   10185 H HG1  . THR A 1 86  ? 6.125   7.630   -1.852  1.00 0.00 ? 86  THR A HG1  7  
ATOM   10186 H HG21 . THR A 1 86  ? 3.206   9.500   -0.505  1.00 0.00 ? 86  THR A HG21 7  
ATOM   10187 H HG22 . THR A 1 86  ? 4.142   10.974  -0.857  1.00 0.00 ? 86  THR A HG22 7  
ATOM   10188 H HG23 . THR A 1 86  ? 3.737   9.842   -2.170  1.00 0.00 ? 86  THR A HG23 7  
ATOM   10189 N N    . SER A 1 87  ? 6.093   12.116  -0.481  1.00 0.00 ? 87  SER A N    7  
ATOM   10190 C CA   . SER A 1 87  ? 5.844   13.545  -0.542  1.00 0.00 ? 87  SER A CA   7  
ATOM   10191 C C    . SER A 1 87  ? 5.725   13.993  -2.001  1.00 0.00 ? 87  SER A C    7  
ATOM   10192 O O    . SER A 1 87  ? 6.635   14.626  -2.537  1.00 0.00 ? 87  SER A O    7  
ATOM   10193 C CB   . SER A 1 87  ? 6.951   14.329  0.165   1.00 0.00 ? 87  SER A CB   7  
ATOM   10194 O OG   . SER A 1 87  ? 6.579   14.701  1.489   1.00 0.00 ? 87  SER A OG   7  
ATOM   10195 H H    . SER A 1 87  ? 6.107   11.728  0.441   1.00 0.00 ? 87  SER A H    7  
ATOM   10196 H HA   . SER A 1 87  ? 4.901   13.696  -0.018  1.00 0.00 ? 87  SER A HA   7  
ATOM   10197 H HB2  . SER A 1 87  ? 7.859   13.725  0.199   1.00 0.00 ? 87  SER A HB2  7  
ATOM   10198 H HB3  . SER A 1 87  ? 7.186   15.225  -0.410  1.00 0.00 ? 87  SER A HB3  7  
ATOM   10199 H HG   . SER A 1 87  ? 6.992   14.075  2.150   1.00 0.00 ? 87  SER A HG   7  
ATOM   10200 N N    . SER A 1 88  ? 4.595   13.649  -2.603  1.00 0.00 ? 88  SER A N    7  
ATOM   10201 C CA   . SER A 1 88  ? 4.345   14.008  -3.988  1.00 0.00 ? 88  SER A CA   7  
ATOM   10202 C C    . SER A 1 88  ? 3.322   13.050  -4.600  1.00 0.00 ? 88  SER A C    7  
ATOM   10203 O O    . SER A 1 88  ? 2.365   13.484  -5.239  1.00 0.00 ? 88  SER A O    7  
ATOM   10204 C CB   . SER A 1 88  ? 5.641   13.992  -4.803  1.00 0.00 ? 88  SER A CB   7  
ATOM   10205 O OG   . SER A 1 88  ? 6.267   15.272  -4.835  1.00 0.00 ? 88  SER A OG   7  
ATOM   10206 H H    . SER A 1 88  ? 3.861   13.135  -2.160  1.00 0.00 ? 88  SER A H    7  
ATOM   10207 H HA   . SER A 1 88  ? 3.950   15.023  -3.957  1.00 0.00 ? 88  SER A HA   7  
ATOM   10208 H HB2  . SER A 1 88  ? 6.330   13.262  -4.375  1.00 0.00 ? 88  SER A HB2  7  
ATOM   10209 H HB3  . SER A 1 88  ? 5.425   13.668  -5.821  1.00 0.00 ? 88  SER A HB3  7  
ATOM   10210 H HG   . SER A 1 88  ? 6.072   15.769  -3.990  1.00 0.00 ? 88  SER A HG   7  
ATOM   10211 N N    . VAL A 1 89  ? 3.558   11.765  -4.384  1.00 0.00 ? 89  VAL A N    7  
ATOM   10212 C CA   . VAL A 1 89  ? 2.668   10.742  -4.906  1.00 0.00 ? 89  VAL A CA   7  
ATOM   10213 C C    . VAL A 1 89  ? 3.144   9.367   -4.433  1.00 0.00 ? 89  VAL A C    7  
ATOM   10214 O O    . VAL A 1 89  ? 4.344   9.097   -4.406  1.00 0.00 ? 89  VAL A O    7  
ATOM   10215 C CB   . VAL A 1 89  ? 2.581   10.853  -6.429  1.00 0.00 ? 89  VAL A CB   7  
ATOM   10216 C CG1  . VAL A 1 89  ? 3.766   10.151  -7.099  1.00 0.00 ? 89  VAL A CG1  7  
ATOM   10217 C CG2  . VAL A 1 89  ? 1.251   10.296  -6.946  1.00 0.00 ? 89  VAL A CG2  7  
ATOM   10218 H H    . VAL A 1 89  ? 4.339   11.419  -3.864  1.00 0.00 ? 89  VAL A H    7  
ATOM   10219 H HA   . VAL A 1 89  ? 1.675   10.929  -4.497  1.00 0.00 ? 89  VAL A HA   7  
ATOM   10220 H HB   . VAL A 1 89  ? 2.627   11.909  -6.692  1.00 0.00 ? 89  VAL A HB   7  
ATOM   10221 H HG11 . VAL A 1 89  ? 3.767   10.378  -8.166  1.00 0.00 ? 89  VAL A HG11 7  
ATOM   10222 H HG12 . VAL A 1 89  ? 4.695   10.500  -6.650  1.00 0.00 ? 89  VAL A HG12 7  
ATOM   10223 H HG13 . VAL A 1 89  ? 3.676   9.073   -6.958  1.00 0.00 ? 89  VAL A HG13 7  
ATOM   10224 H HG21 . VAL A 1 89  ? 0.769   11.041  -7.578  1.00 0.00 ? 89  VAL A HG21 7  
ATOM   10225 H HG22 . VAL A 1 89  ? 1.436   9.392   -7.525  1.00 0.00 ? 89  VAL A HG22 7  
ATOM   10226 H HG23 . VAL A 1 89  ? 0.605   10.062  -6.101  1.00 0.00 ? 89  VAL A HG23 7  
ATOM   10227 N N    . VAL A 1 90  ? 2.179   8.535   -4.071  1.00 0.00 ? 90  VAL A N    7  
ATOM   10228 C CA   . VAL A 1 90  ? 2.485   7.194   -3.600  1.00 0.00 ? 90  VAL A CA   7  
ATOM   10229 C C    . VAL A 1 90  ? 1.601   6.186   -4.335  1.00 0.00 ? 90  VAL A C    7  
ATOM   10230 O O    . VAL A 1 90  ? 0.457   6.488   -4.674  1.00 0.00 ? 90  VAL A O    7  
ATOM   10231 C CB   . VAL A 1 90  ? 2.331   7.127   -2.079  1.00 0.00 ? 90  VAL A CB   7  
ATOM   10232 C CG1  . VAL A 1 90  ? 0.875   6.866   -1.685  1.00 0.00 ? 90  VAL A CG1  7  
ATOM   10233 C CG2  . VAL A 1 90  ? 3.260   6.067   -1.481  1.00 0.00 ? 90  VAL A CG2  7  
ATOM   10234 H H    . VAL A 1 90  ? 1.207   8.762   -4.096  1.00 0.00 ? 90  VAL A H    7  
ATOM   10235 H HA   . VAL A 1 90  ? 3.527   6.989   -3.843  1.00 0.00 ? 90  VAL A HA   7  
ATOM   10236 H HB   . VAL A 1 90  ? 2.621   8.094   -1.669  1.00 0.00 ? 90  VAL A HB   7  
ATOM   10237 H HG11 . VAL A 1 90  ? 0.253   7.692   -2.032  1.00 0.00 ? 90  VAL A HG11 7  
ATOM   10238 H HG12 . VAL A 1 90  ? 0.536   5.938   -2.145  1.00 0.00 ? 90  VAL A HG12 7  
ATOM   10239 H HG13 . VAL A 1 90  ? 0.801   6.784   -0.603  1.00 0.00 ? 90  VAL A HG13 7  
ATOM   10240 H HG21 . VAL A 1 90  ? 3.608   6.400   -0.503  1.00 0.00 ? 90  VAL A HG21 7  
ATOM   10241 H HG22 . VAL A 1 90  ? 2.716   5.127   -1.373  1.00 0.00 ? 90  VAL A HG22 7  
ATOM   10242 H HG23 . VAL A 1 90  ? 4.113   5.918   -2.141  1.00 0.00 ? 90  VAL A HG23 7  
ATOM   10243 N N    . THR A 1 91  ? 2.164   5.007   -4.561  1.00 0.00 ? 91  THR A N    7  
ATOM   10244 C CA   . THR A 1 91  ? 1.440   3.952   -5.250  1.00 0.00 ? 91  THR A CA   7  
ATOM   10245 C C    . THR A 1 91  ? 1.960   2.579   -4.820  1.00 0.00 ? 91  THR A C    7  
ATOM   10246 O O    . THR A 1 91  ? 3.150   2.420   -4.551  1.00 0.00 ? 91  THR A O    7  
ATOM   10247 C CB   . THR A 1 91  ? 1.559   4.202   -6.755  1.00 0.00 ? 91  THR A CB   7  
ATOM   10248 O OG1  . THR A 1 91  ? 2.960   4.124   -7.010  1.00 0.00 ? 91  THR A OG1  7  
ATOM   10249 C CG2  . THR A 1 91  ? 1.191   5.636   -7.141  1.00 0.00 ? 91  THR A CG2  7  
ATOM   10250 H H    . THR A 1 91  ? 3.093   4.769   -4.283  1.00 0.00 ? 91  THR A H    7  
ATOM   10251 H HA   . THR A 1 91  ? 0.392   4.005   -4.955  1.00 0.00 ? 91  THR A HA   7  
ATOM   10252 H HB   . THR A 1 91  ? 0.966   3.482   -7.319  1.00 0.00 ? 91  THR A HB   7  
ATOM   10253 H HG1  . THR A 1 91  ? 3.328   5.037   -7.181  1.00 0.00 ? 91  THR A HG1  7  
ATOM   10254 H HG21 . THR A 1 91  ? 1.199   5.733   -8.227  1.00 0.00 ? 91  THR A HG21 7  
ATOM   10255 H HG22 . THR A 1 91  ? 0.197   5.870   -6.763  1.00 0.00 ? 91  THR A HG22 7  
ATOM   10256 H HG23 . THR A 1 91  ? 1.916   6.327   -6.709  1.00 0.00 ? 91  THR A HG23 7  
ATOM   10257 N N    . LEU A 1 92  ? 1.043   1.626   -4.767  1.00 0.00 ? 92  LEU A N    7  
ATOM   10258 C CA   . LEU A 1 92  ? 1.395   0.270   -4.373  1.00 0.00 ? 92  LEU A CA   7  
ATOM   10259 C C    . LEU A 1 92  ? 0.435   -0.715  -5.043  1.00 0.00 ? 92  LEU A C    7  
ATOM   10260 O O    . LEU A 1 92  ? -0.613  -0.320  -5.550  1.00 0.00 ? 92  LEU A O    7  
ATOM   10261 C CB   . LEU A 1 92  ? 1.436   0.149   -2.848  1.00 0.00 ? 92  LEU A CB   7  
ATOM   10262 C CG   . LEU A 1 92  ? 2.225   1.232   -2.111  1.00 0.00 ? 92  LEU A CG   7  
ATOM   10263 C CD1  . LEU A 1 92  ? 1.463   2.559   -2.102  1.00 0.00 ? 92  LEU A CD1  7  
ATOM   10264 C CD2  . LEU A 1 92  ? 2.596   0.774   -0.699  1.00 0.00 ? 92  LEU A CD2  7  
ATOM   10265 H H    . LEU A 1 92  ? 0.078   1.764   -4.988  1.00 0.00 ? 92  LEU A H    7  
ATOM   10266 H HA   . LEU A 1 92  ? 2.401   0.075   -4.739  1.00 0.00 ? 92  LEU A HA   7  
ATOM   10267 H HB2  . LEU A 1 92  ? 0.410   0.158   -2.476  1.00 0.00 ? 92  LEU A HB2  7  
ATOM   10268 H HB3  . LEU A 1 92  ? 1.861   -0.820  -2.592  1.00 0.00 ? 92  LEU A HB3  7  
ATOM   10269 H HG   . LEU A 1 92  ? 3.158   1.402   -2.649  1.00 0.00 ? 92  LEU A HG   7  
ATOM   10270 H HD11 . LEU A 1 92  ? 2.092   3.343   -2.521  1.00 0.00 ? 92  LEU A HD11 7  
ATOM   10271 H HD12 . LEU A 1 92  ? 0.557   2.461   -2.702  1.00 0.00 ? 92  LEU A HD12 7  
ATOM   10272 H HD13 . LEU A 1 92  ? 1.193   2.815   -1.077  1.00 0.00 ? 92  LEU A HD13 7  
ATOM   10273 H HD21 . LEU A 1 92  ? 2.506   1.615   -0.010  1.00 0.00 ? 92  LEU A HD21 7  
ATOM   10274 H HD22 . LEU A 1 92  ? 1.924   -0.024  -0.388  1.00 0.00 ? 92  LEU A HD22 7  
ATOM   10275 H HD23 . LEU A 1 92  ? 3.622   0.408   -0.693  1.00 0.00 ? 92  LEU A HD23 7  
ATOM   10276 N N    . GLU A 1 93  ? 0.828   -1.981  -5.022  1.00 0.00 ? 93  GLU A N    7  
ATOM   10277 C CA   . GLU A 1 93  ? 0.017   -3.027  -5.621  1.00 0.00 ? 93  GLU A CA   7  
ATOM   10278 C C    . GLU A 1 93  ? -0.583  -3.921  -4.535  1.00 0.00 ? 93  GLU A C    7  
ATOM   10279 O O    . GLU A 1 93  ? 0.144   -4.632  -3.841  1.00 0.00 ? 93  GLU A O    7  
ATOM   10280 C CB   . GLU A 1 93  ? 0.833   -3.849  -6.622  1.00 0.00 ? 93  GLU A CB   7  
ATOM   10281 C CG   . GLU A 1 93  ? -0.068  -4.446  -7.704  1.00 0.00 ? 93  GLU A CG   7  
ATOM   10282 C CD   . GLU A 1 93  ? 0.763   -5.048  -8.837  1.00 0.00 ? 93  GLU A CD   7  
ATOM   10283 O OE1  . GLU A 1 93  ? 1.393   -6.097  -8.583  1.00 0.00 ? 93  GLU A OE1  7  
ATOM   10284 O OE2  . GLU A 1 93  ? 0.750   -4.445  -9.933  1.00 0.00 ? 93  GLU A OE2  7  
ATOM   10285 H H    . GLU A 1 93  ? 1.682   -2.294  -4.608  1.00 0.00 ? 93  GLU A H    7  
ATOM   10286 H HA   . GLU A 1 93  ? -0.780  -2.506  -6.153  1.00 0.00 ? 93  GLU A HA   7  
ATOM   10287 H HB2  . GLU A 1 93  ? 1.593   -3.218  -7.082  1.00 0.00 ? 93  GLU A HB2  7  
ATOM   10288 H HB3  . GLU A 1 93  ? 1.358   -4.649  -6.097  1.00 0.00 ? 93  GLU A HB3  7  
ATOM   10289 H HG2  . GLU A 1 93  ? -0.705  -5.216  -7.267  1.00 0.00 ? 93  GLU A HG2  7  
ATOM   10290 H HG3  . GLU A 1 93  ? -0.727  -3.673  -8.101  1.00 0.00 ? 93  GLU A HG3  7  
ATOM   10291 N N    . VAL A 1 94  ? -1.901  -3.857  -4.421  1.00 0.00 ? 94  VAL A N    7  
ATOM   10292 C CA   . VAL A 1 94  ? -2.605  -4.653  -3.429  1.00 0.00 ? 94  VAL A CA   7  
ATOM   10293 C C    . VAL A 1 94  ? -3.294  -5.829  -4.125  1.00 0.00 ? 94  VAL A C    7  
ATOM   10294 O O    . VAL A 1 94  ? -3.479  -5.816  -5.341  1.00 0.00 ? 94  VAL A O    7  
ATOM   10295 C CB   . VAL A 1 94  ? -3.576  -3.770  -2.644  1.00 0.00 ? 94  VAL A CB   7  
ATOM   10296 C CG1  . VAL A 1 94  ? -2.868  -2.527  -2.098  1.00 0.00 ? 94  VAL A CG1  7  
ATOM   10297 C CG2  . VAL A 1 94  ? -4.782  -3.380  -3.502  1.00 0.00 ? 94  VAL A CG2  7  
ATOM   10298 H H    . VAL A 1 94  ? -2.483  -3.276  -4.989  1.00 0.00 ? 94  VAL A H    7  
ATOM   10299 H HA   . VAL A 1 94  ? -1.863  -5.042  -2.732  1.00 0.00 ? 94  VAL A HA   7  
ATOM   10300 H HB   . VAL A 1 94  ? -3.942  -4.347  -1.795  1.00 0.00 ? 94  VAL A HB   7  
ATOM   10301 H HG11 . VAL A 1 94  ? -1.983  -2.321  -2.698  1.00 0.00 ? 94  VAL A HG11 7  
ATOM   10302 H HG12 . VAL A 1 94  ? -3.545  -1.674  -2.141  1.00 0.00 ? 94  VAL A HG12 7  
ATOM   10303 H HG13 . VAL A 1 94  ? -2.572  -2.704  -1.063  1.00 0.00 ? 94  VAL A HG13 7  
ATOM   10304 H HG21 . VAL A 1 94  ? -5.695  -3.733  -3.025  1.00 0.00 ? 94  VAL A HG21 7  
ATOM   10305 H HG22 . VAL A 1 94  ? -4.820  -2.295  -3.604  1.00 0.00 ? 94  VAL A HG22 7  
ATOM   10306 H HG23 . VAL A 1 94  ? -4.687  -3.835  -4.487  1.00 0.00 ? 94  VAL A HG23 7  
ATOM   10307 N N    . ALA A 1 95  ? -3.658  -6.818  -3.321  1.00 0.00 ? 95  ALA A N    7  
ATOM   10308 C CA   . ALA A 1 95  ? -4.322  -8.001  -3.843  1.00 0.00 ? 95  ALA A CA   7  
ATOM   10309 C C    . ALA A 1 95  ? -5.238  -8.583  -2.762  1.00 0.00 ? 95  ALA A C    7  
ATOM   10310 O O    . ALA A 1 95  ? -4.912  -8.541  -1.578  1.00 0.00 ? 95  ALA A O    7  
ATOM   10311 C CB   . ALA A 1 95  ? -3.275  -9.005  -4.324  1.00 0.00 ? 95  ALA A CB   7  
ATOM   10312 H H    . ALA A 1 95  ? -3.504  -6.822  -2.332  1.00 0.00 ? 95  ALA A H    7  
ATOM   10313 H HA   . ALA A 1 95  ? -4.931  -7.691  -4.693  1.00 0.00 ? 95  ALA A HA   7  
ATOM   10314 H HB1  . ALA A 1 95  ? -2.409  -8.469  -4.712  1.00 0.00 ? 95  ALA A HB1  7  
ATOM   10315 H HB2  . ALA A 1 95  ? -2.969  -9.638  -3.492  1.00 0.00 ? 95  ALA A HB2  7  
ATOM   10316 H HB3  . ALA A 1 95  ? -3.703  -9.625  -5.113  1.00 0.00 ? 95  ALA A HB3  7  
ATOM   10317 N N    . LYS A 1 96  ? -6.367  -9.113  -3.212  1.00 0.00 ? 96  LYS A N    7  
ATOM   10318 C CA   . LYS A 1 96  ? -7.330  -9.704  -2.299  1.00 0.00 ? 96  LYS A CA   7  
ATOM   10319 C C    . LYS A 1 96  ? -7.221  -11.228 -2.366  1.00 0.00 ? 96  LYS A C    7  
ATOM   10320 O O    . LYS A 1 96  ? -7.050  -11.798 -3.442  1.00 0.00 ? 96  LYS A O    7  
ATOM   10321 C CB   . LYS A 1 96  ? -8.737  -9.175  -2.589  1.00 0.00 ? 96  LYS A CB   7  
ATOM   10322 C CG   . LYS A 1 96  ? -9.582  -9.137  -1.314  1.00 0.00 ? 96  LYS A CG   7  
ATOM   10323 C CD   . LYS A 1 96  ? -9.847  -7.694  -0.876  1.00 0.00 ? 96  LYS A CD   7  
ATOM   10324 C CE   . LYS A 1 96  ? -9.031  -7.341  0.368   1.00 0.00 ? 96  LYS A CE   7  
ATOM   10325 N NZ   . LYS A 1 96  ? -9.529  -6.087  0.975   1.00 0.00 ? 96  LYS A NZ   7  
ATOM   10326 H H    . LYS A 1 96  ? -6.625  -9.144  -4.177  1.00 0.00 ? 96  LYS A H    7  
ATOM   10327 H HA   . LYS A 1 96  ? -7.067  -9.382  -1.291  1.00 0.00 ? 96  LYS A HA   7  
ATOM   10328 H HB2  . LYS A 1 96  ? -8.673  -8.176  -3.017  1.00 0.00 ? 96  LYS A HB2  7  
ATOM   10329 H HB3  . LYS A 1 96  ? -9.222  -9.809  -3.331  1.00 0.00 ? 96  LYS A HB3  7  
ATOM   10330 H HG2  . LYS A 1 96  ? -10.528 -9.649  -1.485  1.00 0.00 ? 96  LYS A HG2  7  
ATOM   10331 H HG3  . LYS A 1 96  ? -9.068  -9.674  -0.517  1.00 0.00 ? 96  LYS A HG3  7  
ATOM   10332 H HD2  . LYS A 1 96  ? -9.594  -7.012  -1.687  1.00 0.00 ? 96  LYS A HD2  7  
ATOM   10333 H HD3  . LYS A 1 96  ? -10.910 -7.564  -0.669  1.00 0.00 ? 96  LYS A HD3  7  
ATOM   10334 H HE2  . LYS A 1 96  ? -9.094  -8.151  1.095   1.00 0.00 ? 96  LYS A HE2  7  
ATOM   10335 H HE3  . LYS A 1 96  ? -7.979  -7.231  0.104   1.00 0.00 ? 96  LYS A HE3  7  
ATOM   10336 H HZ1  . LYS A 1 96  ? -10.083 -5.589  0.306   1.00 0.00 ? 96  LYS A HZ1  7  
ATOM   10337 H HZ2  . LYS A 1 96  ? -10.087 -6.300  1.776   1.00 0.00 ? 96  LYS A HZ2  7  
ATOM   10338 H HZ3  . LYS A 1 96  ? -8.753  -5.518  1.251   1.00 0.00 ? 96  LYS A HZ3  7  
ATOM   10339 N N    . GLN A 1 97  ? -7.323  -11.849 -1.199  1.00 0.00 ? 97  GLN A N    7  
ATOM   10340 C CA   . GLN A 1 97  ? -7.237  -13.296 -1.112  1.00 0.00 ? 97  GLN A CA   7  
ATOM   10341 C C    . GLN A 1 97  ? -7.250  -13.741 0.353   1.00 0.00 ? 97  GLN A C    7  
ATOM   10342 O O    . GLN A 1 97  ? -6.240  -13.641 1.044   1.00 0.00 ? 97  GLN A O    7  
ATOM   10343 C CB   . GLN A 1 97  ? -5.992  -13.817 -1.830  1.00 0.00 ? 97  GLN A CB   7  
ATOM   10344 C CG   . GLN A 1 97  ? -4.775  -12.942 -1.524  1.00 0.00 ? 97  GLN A CG   7  
ATOM   10345 C CD   . GLN A 1 97  ? -4.203  -12.330 -2.803  1.00 0.00 ? 97  GLN A CD   7  
ATOM   10346 O OE1  . GLN A 1 97  ? -4.610  -11.270 -3.253  1.00 0.00 ? 97  GLN A OE1  7  
ATOM   10347 N NE2  . GLN A 1 97  ? -3.239  -13.054 -3.365  1.00 0.00 ? 97  GLN A NE2  7  
ATOM   10348 H H    . GLN A 1 97  ? -7.461  -11.379 -0.327  1.00 0.00 ? 97  GLN A H    7  
ATOM   10349 H HA   . GLN A 1 97  ? -8.126  -13.671 -1.619  1.00 0.00 ? 97  GLN A HA   7  
ATOM   10350 H HB2  . GLN A 1 97  ? -5.792  -14.843 -1.523  1.00 0.00 ? 97  GLN A HB2  7  
ATOM   10351 H HB3  . GLN A 1 97  ? -6.169  -13.836 -2.905  1.00 0.00 ? 97  GLN A HB3  7  
ATOM   10352 H HG2  . GLN A 1 97  ? -5.059  -12.148 -0.832  1.00 0.00 ? 97  GLN A HG2  7  
ATOM   10353 H HG3  . GLN A 1 97  ? -4.010  -13.538 -1.027  1.00 0.00 ? 97  GLN A HG3  7  
ATOM   10354 H HE21 . GLN A 1 97  ? -2.952  -13.916 -2.947  1.00 0.00 ? 97  GLN A HE21 7  
ATOM   10355 H HE22 . GLN A 1 97  ? -2.801  -12.737 -4.207  1.00 0.00 ? 97  GLN A HE22 7  
ATOM   10356 N N    . GLY A 1 98  ? -8.409  -14.222 0.781   1.00 0.00 ? 98  GLY A N    7  
ATOM   10357 C CA   . GLY A 1 98  ? -8.567  -14.682 2.151   1.00 0.00 ? 98  GLY A CA   7  
ATOM   10358 C C    . GLY A 1 98  ? -8.544  -13.507 3.130   1.00 0.00 ? 98  GLY A C    7  
ATOM   10359 O O    . GLY A 1 98  ? -9.564  -12.861 3.357   1.00 0.00 ? 98  GLY A O    7  
ATOM   10360 H H    . GLY A 1 98  ? -9.227  -14.300 0.212   1.00 0.00 ? 98  GLY A H    7  
ATOM   10361 H HA2  . GLY A 1 98  ? -9.508  -15.223 2.250   1.00 0.00 ? 98  GLY A HA2  7  
ATOM   10362 H HA3  . GLY A 1 98  ? -7.769  -15.383 2.398   1.00 0.00 ? 98  GLY A HA3  7  
ATOM   10363 N N    . ALA A 1 99  ? -7.364  -13.266 3.686   1.00 0.00 ? 99  ALA A N    7  
ATOM   10364 C CA   . ALA A 1 99  ? -7.194  -12.179 4.636   1.00 0.00 ? 99  ALA A CA   7  
ATOM   10365 C C    . ALA A 1 99  ? -8.016  -12.473 5.893   1.00 0.00 ? 99  ALA A C    7  
ATOM   10366 O O    . ALA A 1 99  ? -9.243  -12.397 5.868   1.00 0.00 ? 99  ALA A O    7  
ATOM   10367 C CB   . ALA A 1 99  ? -7.589  -10.857 3.976   1.00 0.00 ? 99  ALA A CB   7  
ATOM   10368 H H    . ALA A 1 99  ? -6.537  -13.796 3.497   1.00 0.00 ? 99  ALA A H    7  
ATOM   10369 H HA   . ALA A 1 99  ? -6.138  -12.135 4.905   1.00 0.00 ? 99  ALA A HA   7  
ATOM   10370 H HB1  . ALA A 1 99  ? -7.092  -10.769 3.010   1.00 0.00 ? 99  ALA A HB1  7  
ATOM   10371 H HB2  . ALA A 1 99  ? -8.669  -10.831 3.834   1.00 0.00 ? 99  ALA A HB2  7  
ATOM   10372 H HB3  . ALA A 1 99  ? -7.286  -10.027 4.616   1.00 0.00 ? 99  ALA A HB3  7  
ATOM   10373 N N    . ILE A 1 100 ? -7.305  -12.801 6.962   1.00 0.00 ? 100 ILE A N    7  
ATOM   10374 C CA   . ILE A 1 100 ? -7.954  -13.107 8.227   1.00 0.00 ? 100 ILE A CA   7  
ATOM   10375 C C    . ILE A 1 100 ? -6.892  -13.261 9.317   1.00 0.00 ? 100 ILE A C    7  
ATOM   10376 O O    . ILE A 1 100 ? -5.706  -13.396 9.018   1.00 0.00 ? 100 ILE A O    7  
ATOM   10377 C CB   . ILE A 1 100 ? -8.866  -14.326 8.080   1.00 0.00 ? 100 ILE A CB   7  
ATOM   10378 C CG1  . ILE A 1 100 ? -9.790  -14.469 9.292   1.00 0.00 ? 100 ILE A CG1  7  
ATOM   10379 C CG2  . ILE A 1 100 ? -8.050  -15.594 7.828   1.00 0.00 ? 100 ILE A CG2  7  
ATOM   10380 C CD1  . ILE A 1 100 ? -11.091 -15.176 8.909   1.00 0.00 ? 100 ILE A CD1  7  
ATOM   10381 H H    . ILE A 1 100 ? -6.308  -12.861 6.975   1.00 0.00 ? 100 ILE A H    7  
ATOM   10382 H HA   . ILE A 1 100 ? -8.590  -12.258 8.481   1.00 0.00 ? 100 ILE A HA   7  
ATOM   10383 H HB   . ILE A 1 100 ? -9.503  -14.173 7.207   1.00 0.00 ? 100 ILE A HB   7  
ATOM   10384 H HG12 . ILE A 1 100 ? -9.281  -15.032 10.075  1.00 0.00 ? 100 ILE A HG12 7  
ATOM   10385 H HG13 . ILE A 1 100 ? -10.012 -13.484 9.702   1.00 0.00 ? 100 ILE A HG13 7  
ATOM   10386 H HG21 . ILE A 1 100 ? -7.534  -15.883 8.745   1.00 0.00 ? 100 ILE A HG21 7  
ATOM   10387 H HG22 . ILE A 1 100 ? -8.716  -16.399 7.517   1.00 0.00 ? 100 ILE A HG22 7  
ATOM   10388 H HG23 . ILE A 1 100 ? -7.317  -15.405 7.044   1.00 0.00 ? 100 ILE A HG23 7  
ATOM   10389 H HD11 . ILE A 1 100 ? -11.061 -16.207 9.260   1.00 0.00 ? 100 ILE A HD11 7  
ATOM   10390 H HD12 . ILE A 1 100 ? -11.934 -14.660 9.371   1.00 0.00 ? 100 ILE A HD12 7  
ATOM   10391 H HD13 . ILE A 1 100 ? -11.206 -15.163 7.825   1.00 0.00 ? 100 ILE A HD13 7  
ATOM   10392 N N    . TYR A 1 101 ? -7.355  -13.236 10.558  1.00 0.00 ? 101 TYR A N    7  
ATOM   10393 C CA   . TYR A 1 101 ? -6.459  -13.371 11.694  1.00 0.00 ? 101 TYR A CA   7  
ATOM   10394 C C    . TYR A 1 101 ? -7.237  -13.689 12.970  1.00 0.00 ? 101 TYR A C    7  
ATOM   10395 O O    . TYR A 1 101 ? -8.465  -13.755 12.954  1.00 0.00 ? 101 TYR A O    7  
ATOM   10396 C CB   . TYR A 1 101 ? -5.773  -12.013 11.852  1.00 0.00 ? 101 TYR A CB   7  
ATOM   10397 C CG   . TYR A 1 101 ? -6.622  -10.968 12.579  1.00 0.00 ? 101 TYR A CG   7  
ATOM   10398 C CD1  . TYR A 1 101 ? -7.672  -10.357 11.926  1.00 0.00 ? 101 TYR A CD1  7  
ATOM   10399 C CD2  . TYR A 1 101 ? -6.337  -10.637 13.890  1.00 0.00 ? 101 TYR A CD2  7  
ATOM   10400 C CE1  . TYR A 1 101 ? -8.473  -9.374  12.611  1.00 0.00 ? 101 TYR A CE1  7  
ATOM   10401 C CE2  . TYR A 1 101 ? -7.136  -9.653  14.573  1.00 0.00 ? 101 TYR A CE2  7  
ATOM   10402 C CZ   . TYR A 1 101 ? -8.165  -9.071  13.900  1.00 0.00 ? 101 TYR A CZ   7  
ATOM   10403 O OH   . TYR A 1 101 ? -8.919  -8.141  14.545  1.00 0.00 ? 101 TYR A OH   7  
ATOM   10404 H H    . TYR A 1 101 ? -8.320  -13.126 10.792  1.00 0.00 ? 101 TYR A H    7  
ATOM   10405 H HA   . TYR A 1 101 ? -5.769  -14.189 11.483  1.00 0.00 ? 101 TYR A HA   7  
ATOM   10406 H HB2  . TYR A 1 101 ? -4.840  -12.151 12.399  1.00 0.00 ? 101 TYR A HB2  7  
ATOM   10407 H HB3  . TYR A 1 101 ? -5.510  -11.630 10.866  1.00 0.00 ? 101 TYR A HB3  7  
ATOM   10408 H HD1  . TYR A 1 101 ? -7.897  -10.620 10.892  1.00 0.00 ? 101 TYR A HD1  7  
ATOM   10409 H HD2  . TYR A 1 101 ? -5.506  -11.119 14.404  1.00 0.00 ? 101 TYR A HD2  7  
ATOM   10410 H HE1  . TYR A 1 101 ? -9.304  -8.884  12.105  1.00 0.00 ? 101 TYR A HE1  7  
ATOM   10411 H HE2  . TYR A 1 101 ? -6.922  -9.383  15.607  1.00 0.00 ? 101 TYR A HE2  7  
ATOM   10412 H HH   . TYR A 1 101 ? -9.552  -7.709  13.904  1.00 0.00 ? 101 TYR A HH   7  
ATOM   10413 N N    . GLY A 1 1   ? 6.186   -15.002 -22.841 1.00 0.00 ? 1   GLY A N    8  
ATOM   10414 C CA   . GLY A 1 1   ? 5.006   -14.390 -23.428 1.00 0.00 ? 1   GLY A CA   8  
ATOM   10415 C C    . GLY A 1 1   ? 4.136   -13.736 -22.352 1.00 0.00 ? 1   GLY A C    8  
ATOM   10416 O O    . GLY A 1 1   ? 3.233   -14.371 -21.807 1.00 0.00 ? 1   GLY A O    8  
ATOM   10417 H H1   . GLY A 1 1   ? 6.627   -14.466 -22.122 1.00 0.00 ? 1   GLY A H1   8  
ATOM   10418 H HA2  . GLY A 1 1   ? 5.306   -13.641 -24.162 1.00 0.00 ? 1   GLY A HA2  8  
ATOM   10419 H HA3  . GLY A 1 1   ? 4.427   -15.145 -23.959 1.00 0.00 ? 1   GLY A HA3  8  
ATOM   10420 N N    . PRO A 1 2   ? 4.445   -12.442 -22.070 1.00 0.00 ? 2   PRO A N    8  
ATOM   10421 C CA   . PRO A 1 2   ? 3.703   -11.694 -21.070 1.00 0.00 ? 2   PRO A CA   8  
ATOM   10422 C C    . PRO A 1 2   ? 2.326   -11.287 -21.600 1.00 0.00 ? 2   PRO A C    8  
ATOM   10423 O O    . PRO A 1 2   ? 2.145   -11.130 -22.806 1.00 0.00 ? 2   PRO A O    8  
ATOM   10424 C CB   . PRO A 1 2   ? 4.586   -10.504 -20.731 1.00 0.00 ? 2   PRO A CB   8  
ATOM   10425 C CG   . PRO A 1 2   ? 5.570   -10.376 -21.882 1.00 0.00 ? 2   PRO A CG   8  
ATOM   10426 C CD   . PRO A 1 2   ? 5.507   -11.658 -22.696 1.00 0.00 ? 2   PRO A CD   8  
ATOM   10427 H HA   . PRO A 1 2   ? 3.528   -12.267 -20.269 1.00 0.00 ? 2   PRO A HA   8  
ATOM   10428 H HB2  . PRO A 1 2   ? 3.992   -9.597  -20.621 1.00 0.00 ? 2   PRO A HB2  8  
ATOM   10429 H HB3  . PRO A 1 2   ? 5.107   -10.661 -19.788 1.00 0.00 ? 2   PRO A HB3  8  
ATOM   10430 H HG2  . PRO A 1 2   ? 5.322   -9.517  -22.504 1.00 0.00 ? 2   PRO A HG2  8  
ATOM   10431 H HG3  . PRO A 1 2   ? 6.580   -10.214 -21.503 1.00 0.00 ? 2   PRO A HG3  8  
ATOM   10432 H HD2  . PRO A 1 2   ? 5.283   -11.453 -23.742 1.00 0.00 ? 2   PRO A HD2  8  
ATOM   10433 H HD3  . PRO A 1 2   ? 6.460   -12.190 -22.671 1.00 0.00 ? 2   PRO A HD3  8  
ATOM   10434 N N    . LEU A 1 3   ? 1.394   -11.125 -20.673 1.00 0.00 ? 3   LEU A N    8  
ATOM   10435 C CA   . LEU A 1 3   ? 0.041   -10.739 -21.031 1.00 0.00 ? 3   LEU A CA   8  
ATOM   10436 C C    . LEU A 1 3   ? -0.666  -10.167 -19.800 1.00 0.00 ? 3   LEU A C    8  
ATOM   10437 O O    . LEU A 1 3   ? -0.284  -10.464 -18.668 1.00 0.00 ? 3   LEU A O    8  
ATOM   10438 C CB   . LEU A 1 3   ? -0.699  -11.913 -21.675 1.00 0.00 ? 3   LEU A CB   8  
ATOM   10439 C CG   . LEU A 1 3   ? -1.286  -12.945 -20.711 1.00 0.00 ? 3   LEU A CG   8  
ATOM   10440 C CD1  . LEU A 1 3   ? -2.778  -12.698 -20.483 1.00 0.00 ? 3   LEU A CD1  8  
ATOM   10441 C CD2  . LEU A 1 3   ? -1.009  -14.369 -21.197 1.00 0.00 ? 3   LEU A CD2  8  
ATOM   10442 H H    . LEU A 1 3   ? 1.552   -11.254 -19.693 1.00 0.00 ? 3   LEU A H    8  
ATOM   10443 H HA   . LEU A 1 3   ? 0.115   -9.952  -21.783 1.00 0.00 ? 3   LEU A HA   8  
ATOM   10444 H HB2  . LEU A 1 3   ? -1.509  -11.515 -22.286 1.00 0.00 ? 3   LEU A HB2  8  
ATOM   10445 H HB3  . LEU A 1 3   ? -0.012  -12.424 -22.350 1.00 0.00 ? 3   LEU A HB3  8  
ATOM   10446 H HG   . LEU A 1 3   ? -0.790  -12.832 -19.747 1.00 0.00 ? 3   LEU A HG   8  
ATOM   10447 H HD11 . LEU A 1 3   ? -3.210  -12.236 -21.371 1.00 0.00 ? 3   LEU A HD11 8  
ATOM   10448 H HD12 . LEU A 1 3   ? -3.278  -13.647 -20.289 1.00 0.00 ? 3   LEU A HD12 8  
ATOM   10449 H HD13 . LEU A 1 3   ? -2.911  -12.035 -19.628 1.00 0.00 ? 3   LEU A HD13 8  
ATOM   10450 H HD21 . LEU A 1 3   ? -1.925  -14.956 -21.145 1.00 0.00 ? 3   LEU A HD21 8  
ATOM   10451 H HD22 . LEU A 1 3   ? -0.656  -14.338 -22.229 1.00 0.00 ? 3   LEU A HD22 8  
ATOM   10452 H HD23 . LEU A 1 3   ? -0.246  -14.828 -20.567 1.00 0.00 ? 3   LEU A HD23 8  
ATOM   10453 N N    . GLY A 1 4   ? -1.681  -9.357  -20.061 1.00 0.00 ? 4   GLY A N    8  
ATOM   10454 C CA   . GLY A 1 4   ? -2.444  -8.743  -18.988 1.00 0.00 ? 4   GLY A CA   8  
ATOM   10455 C C    . GLY A 1 4   ? -3.530  -7.822  -19.547 1.00 0.00 ? 4   GLY A C    8  
ATOM   10456 O O    . GLY A 1 4   ? -3.415  -7.329  -20.669 1.00 0.00 ? 4   GLY A O    8  
ATOM   10457 H H    . GLY A 1 4   ? -1.984  -9.122  -20.986 1.00 0.00 ? 4   GLY A H    8  
ATOM   10458 H HA2  . GLY A 1 4   ? -2.900  -9.517  -18.372 1.00 0.00 ? 4   GLY A HA2  8  
ATOM   10459 H HA3  . GLY A 1 4   ? -1.774  -8.174  -18.342 1.00 0.00 ? 4   GLY A HA3  8  
ATOM   10460 N N    . SER A 1 5   ? -4.559  -7.615  -18.738 1.00 0.00 ? 5   SER A N    8  
ATOM   10461 C CA   . SER A 1 5   ? -5.664  -6.761  -19.136 1.00 0.00 ? 5   SER A CA   8  
ATOM   10462 C C    . SER A 1 5   ? -6.686  -6.661  -18.002 1.00 0.00 ? 5   SER A C    8  
ATOM   10463 O O    . SER A 1 5   ? -6.477  -7.220  -16.924 1.00 0.00 ? 5   SER A O    8  
ATOM   10464 C CB   . SER A 1 5   ? -6.334  -7.285  -20.408 1.00 0.00 ? 5   SER A CB   8  
ATOM   10465 O OG   . SER A 1 5   ? -5.776  -6.704  -21.584 1.00 0.00 ? 5   SER A OG   8  
ATOM   10466 H H    . SER A 1 5   ? -4.644  -8.018  -17.825 1.00 0.00 ? 5   SER A H    8  
ATOM   10467 H HA   . SER A 1 5   ? -5.219  -5.785  -19.336 1.00 0.00 ? 5   SER A HA   8  
ATOM   10468 H HB2  . SER A 1 5   ? -6.227  -8.369  -20.454 1.00 0.00 ? 5   SER A HB2  8  
ATOM   10469 H HB3  . SER A 1 5   ? -7.402  -7.071  -20.370 1.00 0.00 ? 5   SER A HB3  8  
ATOM   10470 H HG   . SER A 1 5   ? -6.042  -7.237  -22.387 1.00 0.00 ? 5   SER A HG   8  
ATOM   10471 N N    . LEU A 1 6   ? -7.767  -5.948  -18.281 1.00 0.00 ? 6   LEU A N    8  
ATOM   10472 C CA   . LEU A 1 6   ? -8.820  -5.769  -17.297 1.00 0.00 ? 6   LEU A CA   8  
ATOM   10473 C C    . LEU A 1 6   ? -8.232  -5.122  -16.040 1.00 0.00 ? 6   LEU A C    8  
ATOM   10474 O O    . LEU A 1 6   ? -7.016  -5.008  -15.906 1.00 0.00 ? 6   LEU A O    8  
ATOM   10475 C CB   . LEU A 1 6   ? -9.534  -7.095  -17.027 1.00 0.00 ? 6   LEU A CB   8  
ATOM   10476 C CG   . LEU A 1 6   ? -10.348 -7.665  -18.192 1.00 0.00 ? 6   LEU A CG   8  
ATOM   10477 C CD1  . LEU A 1 6   ? -10.386 -9.194  -18.138 1.00 0.00 ? 6   LEU A CD1  8  
ATOM   10478 C CD2  . LEU A 1 6   ? -11.752 -7.058  -18.226 1.00 0.00 ? 6   LEU A CD2  8  
ATOM   10479 H H    . LEU A 1 6   ? -7.927  -5.498  -19.157 1.00 0.00 ? 6   LEU A H    8  
ATOM   10480 H HA   . LEU A 1 6   ? -9.555  -5.088  -17.724 1.00 0.00 ? 6   LEU A HA   8  
ATOM   10481 H HB2  . LEU A 1 6   ? -8.788  -7.835  -16.735 1.00 0.00 ? 6   LEU A HB2  8  
ATOM   10482 H HB3  . LEU A 1 6   ? -10.200 -6.961  -16.174 1.00 0.00 ? 6   LEU A HB3  8  
ATOM   10483 H HG   . LEU A 1 6   ? -9.855  -7.389  -19.122 1.00 0.00 ? 6   LEU A HG   8  
ATOM   10484 H HD11 . LEU A 1 6   ? -11.370 -9.520  -17.800 1.00 0.00 ? 6   LEU A HD11 8  
ATOM   10485 H HD12 . LEU A 1 6   ? -10.189 -9.598  -19.130 1.00 0.00 ? 6   LEU A HD12 8  
ATOM   10486 H HD13 . LEU A 1 6   ? -9.626  -9.552  -17.442 1.00 0.00 ? 6   LEU A HD13 8  
ATOM   10487 H HD21 . LEU A 1 6   ? -12.395 -7.587  -17.523 1.00 0.00 ? 6   LEU A HD21 8  
ATOM   10488 H HD22 . LEU A 1 6   ? -11.700 -6.005  -17.951 1.00 0.00 ? 6   LEU A HD22 8  
ATOM   10489 H HD23 . LEU A 1 6   ? -12.162 -7.150  -19.233 1.00 0.00 ? 6   LEU A HD23 8  
ATOM   10490 N N    . ARG A 1 7   ? -9.127  -4.716  -15.149 1.00 0.00 ? 7   ARG A N    8  
ATOM   10491 C CA   . ARG A 1 7   ? -8.712  -4.084  -13.909 1.00 0.00 ? 7   ARG A CA   8  
ATOM   10492 C C    . ARG A 1 7   ? -9.717  -4.393  -12.795 1.00 0.00 ? 7   ARG A C    8  
ATOM   10493 O O    . ARG A 1 7   ? -10.893 -4.054  -12.902 1.00 0.00 ? 7   ARG A O    8  
ATOM   10494 C CB   . ARG A 1 7   ? -8.597  -2.568  -14.073 1.00 0.00 ? 7   ARG A CB   8  
ATOM   10495 C CG   . ARG A 1 7   ? -9.899  -1.975  -14.616 1.00 0.00 ? 7   ARG A CG   8  
ATOM   10496 C CD   . ARG A 1 7   ? -9.618  -0.927  -15.696 1.00 0.00 ? 7   ARG A CD   8  
ATOM   10497 N NE   . ARG A 1 7   ? -10.880 -0.271  -16.105 1.00 0.00 ? 7   ARG A NE   8  
ATOM   10498 C CZ   . ARG A 1 7   ? -10.942 0.894   -16.765 1.00 0.00 ? 7   ARG A CZ   8  
ATOM   10499 N NH1  . ARG A 1 7   ? -9.812  1.538   -17.093 1.00 0.00 ? 7   ARG A NH1  8  
ATOM   10500 N NH2  . ARG A 1 7   ? -12.130 1.414   -17.096 1.00 0.00 ? 7   ARG A NH2  8  
ATOM   10501 H H    . ARG A 1 7   ? -10.116 -4.814  -15.265 1.00 0.00 ? 7   ARG A H    8  
ATOM   10502 H HA   . ARG A 1 7   ? -7.737  -4.515  -13.687 1.00 0.00 ? 7   ARG A HA   8  
ATOM   10503 H HB2  . ARG A 1 7   ? -8.358  -2.111  -13.114 1.00 0.00 ? 7   ARG A HB2  8  
ATOM   10504 H HB3  . ARG A 1 7   ? -7.777  -2.334  -14.753 1.00 0.00 ? 7   ARG A HB3  8  
ATOM   10505 H HG2  . ARG A 1 7   ? -10.521 -2.771  -15.031 1.00 0.00 ? 7   ARG A HG2  8  
ATOM   10506 H HG3  . ARG A 1 7   ? -10.465 -1.521  -13.802 1.00 0.00 ? 7   ARG A HG3  8  
ATOM   10507 H HD2  . ARG A 1 7   ? -8.918  -0.183  -15.316 1.00 0.00 ? 7   ARG A HD2  8  
ATOM   10508 H HD3  . ARG A 1 7   ? -9.147  -1.399  -16.557 1.00 0.00 ? 7   ARG A HD3  8  
ATOM   10509 H HE   . ARG A 1 7   ? -11.741 -0.724  -15.875 1.00 0.00 ? 7   ARG A HE   8  
ATOM   10510 H HH11 . ARG A 1 7   ? -8.925  1.150   -16.846 1.00 0.00 ? 7   ARG A HH11 8  
ATOM   10511 H HH12 . ARG A 1 7   ? -9.858  2.407   -17.585 1.00 0.00 ? 7   ARG A HH12 8  
ATOM   10512 H HH21 . ARG A 1 7   ? -12.972 0.934   -16.851 1.00 0.00 ? 7   ARG A HH21 8  
ATOM   10513 H HH22 . ARG A 1 7   ? -12.176 2.284   -17.589 1.00 0.00 ? 7   ARG A HH22 8  
ATOM   10514 N N    . LYS A 1 8   ? -9.213  -5.034  -11.749 1.00 0.00 ? 8   LYS A N    8  
ATOM   10515 C CA   . LYS A 1 8   ? -10.049 -5.393  -10.619 1.00 0.00 ? 8   LYS A CA   8  
ATOM   10516 C C    . LYS A 1 8   ? -9.442  -4.817  -9.338  1.00 0.00 ? 8   LYS A C    8  
ATOM   10517 O O    . LYS A 1 8   ? -8.386  -4.187  -9.375  1.00 0.00 ? 8   LYS A O    8  
ATOM   10518 C CB   . LYS A 1 8   ? -10.263 -6.908  -10.569 1.00 0.00 ? 8   LYS A CB   8  
ATOM   10519 C CG   . LYS A 1 8   ? -10.918 -7.411  -11.857 1.00 0.00 ? 8   LYS A CG   8  
ATOM   10520 C CD   . LYS A 1 8   ? -10.535 -8.866  -12.135 1.00 0.00 ? 8   LYS A CD   8  
ATOM   10521 C CE   . LYS A 1 8   ? -10.265 -9.086  -13.624 1.00 0.00 ? 8   LYS A CE   8  
ATOM   10522 N NZ   . LYS A 1 8   ? -10.008 -10.519 -13.898 1.00 0.00 ? 8   LYS A NZ   8  
ATOM   10523 H H    . LYS A 1 8   ? -8.253  -5.308  -11.669 1.00 0.00 ? 8   LYS A H    8  
ATOM   10524 H HA   . LYS A 1 8   ? -11.026 -4.936  -10.775 1.00 0.00 ? 8   LYS A HA   8  
ATOM   10525 H HB2  . LYS A 1 8   ? -9.307  -7.410  -10.422 1.00 0.00 ? 8   LYS A HB2  8  
ATOM   10526 H HB3  . LYS A 1 8   ? -10.891 -7.162  -9.715  1.00 0.00 ? 8   LYS A HB3  8  
ATOM   10527 H HG2  . LYS A 1 8   ? -12.002 -7.325  -11.775 1.00 0.00 ? 8   LYS A HG2  8  
ATOM   10528 H HG3  . LYS A 1 8   ? -10.612 -6.784  -12.694 1.00 0.00 ? 8   LYS A HG3  8  
ATOM   10529 H HD2  . LYS A 1 8   ? -9.649  -9.129  -11.558 1.00 0.00 ? 8   LYS A HD2  8  
ATOM   10530 H HD3  . LYS A 1 8   ? -11.338 -9.526  -11.805 1.00 0.00 ? 8   LYS A HD3  8  
ATOM   10531 H HE2  . LYS A 1 8   ? -11.119 -8.746  -14.209 1.00 0.00 ? 8   LYS A HE2  8  
ATOM   10532 H HE3  . LYS A 1 8   ? -9.407  -8.492  -13.936 1.00 0.00 ? 8   LYS A HE3  8  
ATOM   10533 H HZ1  . LYS A 1 8   ? -10.875 -11.018 -13.903 1.00 0.00 ? 8   LYS A HZ1  8  
ATOM   10534 H HZ2  . LYS A 1 8   ? -9.562  -10.613 -14.789 1.00 0.00 ? 8   LYS A HZ2  8  
ATOM   10535 H HZ3  . LYS A 1 8   ? -9.413  -10.892 -13.187 1.00 0.00 ? 8   LYS A HZ3  8  
ATOM   10536 N N    . GLU A 1 9   ? -10.136 -5.051  -8.233  1.00 0.00 ? 9   GLU A N    8  
ATOM   10537 C CA   . GLU A 1 9   ? -9.679  -4.563  -6.943  1.00 0.00 ? 9   GLU A CA   8  
ATOM   10538 C C    . GLU A 1 9   ? -8.177  -4.804  -6.786  1.00 0.00 ? 9   GLU A C    8  
ATOM   10539 O O    . GLU A 1 9   ? -7.420  -3.875  -6.510  1.00 0.00 ? 9   GLU A O    8  
ATOM   10540 C CB   . GLU A 1 9   ? -10.463 -5.214  -5.803  1.00 0.00 ? 9   GLU A CB   8  
ATOM   10541 C CG   . GLU A 1 9   ? -11.370 -4.196  -5.110  1.00 0.00 ? 9   GLU A CG   8  
ATOM   10542 C CD   . GLU A 1 9   ? -10.622 -3.460  -3.998  1.00 0.00 ? 9   GLU A CD   8  
ATOM   10543 O OE1  . GLU A 1 9   ? -10.004 -2.422  -4.321  1.00 0.00 ? 9   GLU A OE1  8  
ATOM   10544 O OE2  . GLU A 1 9   ? -10.684 -3.950  -2.849  1.00 0.00 ? 9   GLU A OE2  8  
ATOM   10545 H H    . GLU A 1 9   ? -10.995 -5.564  -8.211  1.00 0.00 ? 9   GLU A H    8  
ATOM   10546 H HA   . GLU A 1 9   ? -9.883  -3.492  -6.951  1.00 0.00 ? 9   GLU A HA   8  
ATOM   10547 H HB2  . GLU A 1 9   ? -11.062 -6.038  -6.190  1.00 0.00 ? 9   GLU A HB2  8  
ATOM   10548 H HB3  . GLU A 1 9   ? -9.768  -5.640  -5.077  1.00 0.00 ? 9   GLU A HB3  8  
ATOM   10549 H HG2  . GLU A 1 9   ? -11.742 -3.479  -5.841  1.00 0.00 ? 9   GLU A HG2  8  
ATOM   10550 H HG3  . GLU A 1 9   ? -12.241 -4.704  -4.692  1.00 0.00 ? 9   GLU A HG3  8  
ATOM   10551 N N    . PRO A 1 10  ? -7.780  -6.092  -6.974  1.00 0.00 ? 10  PRO A N    8  
ATOM   10552 C CA   . PRO A 1 10  ? -6.381  -6.468  -6.857  1.00 0.00 ? 10  PRO A CA   8  
ATOM   10553 C C    . PRO A 1 10  ? -5.583  -6.008  -8.079  1.00 0.00 ? 10  PRO A C    8  
ATOM   10554 O O    . PRO A 1 10  ? -5.847  -6.447  -9.197  1.00 0.00 ? 10  PRO A O    8  
ATOM   10555 C CB   . PRO A 1 10  ? -6.393  -7.978  -6.689  1.00 0.00 ? 10  PRO A CB   8  
ATOM   10556 C CG   . PRO A 1 10  ? -7.754  -8.443  -7.183  1.00 0.00 ? 10  PRO A CG   8  
ATOM   10557 C CD   . PRO A 1 10  ? -8.648  -7.219  -7.302  1.00 0.00 ? 10  PRO A CD   8  
ATOM   10558 H HA   . PRO A 1 10  ? -5.964  -6.011  -6.070  1.00 0.00 ? 10  PRO A HA   8  
ATOM   10559 H HB2  . PRO A 1 10  ? -5.590  -8.442  -7.264  1.00 0.00 ? 10  PRO A HB2  8  
ATOM   10560 H HB3  . PRO A 1 10  ? -6.240  -8.258  -5.647  1.00 0.00 ? 10  PRO A HB3  8  
ATOM   10561 H HG2  . PRO A 1 10  ? -7.659  -8.941  -8.149  1.00 0.00 ? 10  PRO A HG2  8  
ATOM   10562 H HG3  . PRO A 1 10  ? -8.185  -9.165  -6.491  1.00 0.00 ? 10  PRO A HG3  8  
ATOM   10563 H HD2  . PRO A 1 10  ? -9.058  -7.124  -8.309  1.00 0.00 ? 10  PRO A HD2  8  
ATOM   10564 H HD3  . PRO A 1 10  ? -9.494  -7.280  -6.619  1.00 0.00 ? 10  PRO A HD3  8  
ATOM   10565 N N    . GLU A 1 11  ? -4.627  -5.129  -7.824  1.00 0.00 ? 11  GLU A N    8  
ATOM   10566 C CA   . GLU A 1 11  ? -3.789  -4.604  -8.890  1.00 0.00 ? 11  GLU A CA   8  
ATOM   10567 C C    . GLU A 1 11  ? -2.923  -3.457  -8.368  1.00 0.00 ? 11  GLU A C    8  
ATOM   10568 O O    . GLU A 1 11  ? -2.760  -3.297  -7.159  1.00 0.00 ? 11  GLU A O    8  
ATOM   10569 C CB   . GLU A 1 11  ? -4.638  -4.152  -10.080 1.00 0.00 ? 11  GLU A CB   8  
ATOM   10570 C CG   . GLU A 1 11  ? -4.361  -5.020  -11.310 1.00 0.00 ? 11  GLU A CG   8  
ATOM   10571 C CD   . GLU A 1 11  ? -5.472  -4.864  -12.351 1.00 0.00 ? 11  GLU A CD   8  
ATOM   10572 O OE1  . GLU A 1 11  ? -5.758  -3.700  -12.706 1.00 0.00 ? 11  GLU A OE1  8  
ATOM   10573 O OE2  . GLU A 1 11  ? -6.010  -5.912  -12.768 1.00 0.00 ? 11  GLU A OE2  8  
ATOM   10574 H H    . GLU A 1 11  ? -4.419  -4.777  -6.911  1.00 0.00 ? 11  GLU A H    8  
ATOM   10575 H HA   . GLU A 1 11  ? -3.157  -5.436  -9.197  1.00 0.00 ? 11  GLU A HA   8  
ATOM   10576 H HB2  . GLU A 1 11  ? -5.695  -4.209  -9.821  1.00 0.00 ? 11  GLU A HB2  8  
ATOM   10577 H HB3  . GLU A 1 11  ? -4.420  -3.109  -10.311 1.00 0.00 ? 11  GLU A HB3  8  
ATOM   10578 H HG2  . GLU A 1 11  ? -3.405  -4.740  -11.750 1.00 0.00 ? 11  GLU A HG2  8  
ATOM   10579 H HG3  . GLU A 1 11  ? -4.281  -6.066  -11.012 1.00 0.00 ? 11  GLU A HG3  8  
ATOM   10580 N N    . ILE A 1 12  ? -2.389  -2.687  -9.304  1.00 0.00 ? 12  ILE A N    8  
ATOM   10581 C CA   . ILE A 1 12  ? -1.541  -1.560  -8.954  1.00 0.00 ? 12  ILE A CA   8  
ATOM   10582 C C    . ILE A 1 12  ? -2.419  -0.339  -8.667  1.00 0.00 ? 12  ILE A C    8  
ATOM   10583 O O    . ILE A 1 12  ? -3.043  0.208   -9.573  1.00 0.00 ? 12  ILE A O    8  
ATOM   10584 C CB   . ILE A 1 12  ? -0.492  -1.320  -10.040 1.00 0.00 ? 12  ILE A CB   8  
ATOM   10585 C CG1  . ILE A 1 12  ? 0.445   -0.174  -9.654  1.00 0.00 ? 12  ILE A CG1  8  
ATOM   10586 C CG2  . ILE A 1 12  ? -1.153  -1.085  -11.399 1.00 0.00 ? 12  ILE A CG2  8  
ATOM   10587 C CD1  . ILE A 1 12  ? 1.687   -0.157  -10.547 1.00 0.00 ? 12  ILE A CD1  8  
ATOM   10588 H H    . ILE A 1 12  ? -2.525  -2.824  -10.285 1.00 0.00 ? 12  ILE A H    8  
ATOM   10589 H HA   . ILE A 1 12  ? -1.008  -1.824  -8.042  1.00 0.00 ? 12  ILE A HA   8  
ATOM   10590 H HB   . ILE A 1 12  ? 0.120   -2.218  -10.130 1.00 0.00 ? 12  ILE A HB   8  
ATOM   10591 H HG12 . ILE A 1 12  ? -0.081  0.777   -9.740  1.00 0.00 ? 12  ILE A HG12 8  
ATOM   10592 H HG13 . ILE A 1 12  ? 0.744   -0.280  -8.610  1.00 0.00 ? 12  ILE A HG13 8  
ATOM   10593 H HG21 . ILE A 1 12  ? -0.929  -0.076  -11.745 1.00 0.00 ? 12  ILE A HG21 8  
ATOM   10594 H HG22 . ILE A 1 12  ? -0.769  -1.809  -12.120 1.00 0.00 ? 12  ILE A HG22 8  
ATOM   10595 H HG23 . ILE A 1 12  ? -2.231  -1.206  -11.305 1.00 0.00 ? 12  ILE A HG23 8  
ATOM   10596 H HD11 . ILE A 1 12  ? 1.714   0.774   -11.115 1.00 0.00 ? 12  ILE A HD11 8  
ATOM   10597 H HD12 . ILE A 1 12  ? 2.582   -0.229  -9.927  1.00 0.00 ? 12  ILE A HD12 8  
ATOM   10598 H HD13 . ILE A 1 12  ? 1.653   -1.002  -11.235 1.00 0.00 ? 12  ILE A HD13 8  
ATOM   10599 N N    . ILE A 1 13  ? -2.437  0.052   -7.401  1.00 0.00 ? 13  ILE A N    8  
ATOM   10600 C CA   . ILE A 1 13  ? -3.227  1.198   -6.982  1.00 0.00 ? 13  ILE A CA   8  
ATOM   10601 C C    . ILE A 1 13  ? -2.316  2.419   -6.851  1.00 0.00 ? 13  ILE A C    8  
ATOM   10602 O O    . ILE A 1 13  ? -1.176  2.303   -6.403  1.00 0.00 ? 13  ILE A O    8  
ATOM   10603 C CB   . ILE A 1 13  ? -4.009  0.873   -5.708  1.00 0.00 ? 13  ILE A CB   8  
ATOM   10604 C CG1  . ILE A 1 13  ? -4.207  -0.636  -5.557  1.00 0.00 ? 13  ILE A CG1  8  
ATOM   10605 C CG2  . ILE A 1 13  ? -5.337  1.633   -5.670  1.00 0.00 ? 13  ILE A CG2  8  
ATOM   10606 C CD1  . ILE A 1 13  ? -4.943  -1.217  -6.767  1.00 0.00 ? 13  ILE A CD1  8  
ATOM   10607 H H    . ILE A 1 13  ? -1.926  -0.399  -6.669  1.00 0.00 ? 13  ILE A H    8  
ATOM   10608 H HA   . ILE A 1 13  ? -3.957  1.394   -7.768  1.00 0.00 ? 13  ILE A HA   8  
ATOM   10609 H HB   . ILE A 1 13  ? -3.421  1.207   -4.853  1.00 0.00 ? 13  ILE A HB   8  
ATOM   10610 H HG12 . ILE A 1 13  ? -3.241  -1.126  -5.446  1.00 0.00 ? 13  ILE A HG12 8  
ATOM   10611 H HG13 . ILE A 1 13  ? -4.776  -0.842  -4.649  1.00 0.00 ? 13  ILE A HG13 8  
ATOM   10612 H HG21 . ILE A 1 13  ? -5.598  1.854   -4.635  1.00 0.00 ? 13  ILE A HG21 8  
ATOM   10613 H HG22 . ILE A 1 13  ? -5.237  2.566   -6.226  1.00 0.00 ? 13  ILE A HG22 8  
ATOM   10614 H HG23 . ILE A 1 13  ? -6.118  1.022   -6.121  1.00 0.00 ? 13  ILE A HG23 8  
ATOM   10615 H HD11 . ILE A 1 13  ? -6.016  -1.063  -6.650  1.00 0.00 ? 13  ILE A HD11 8  
ATOM   10616 H HD12 . ILE A 1 13  ? -4.600  -0.717  -7.674  1.00 0.00 ? 13  ILE A HD12 8  
ATOM   10617 H HD13 . ILE A 1 13  ? -4.736  -2.284  -6.842  1.00 0.00 ? 13  ILE A HD13 8  
ATOM   10618 N N    . THR A 1 14  ? -2.852  3.563   -7.249  1.00 0.00 ? 14  THR A N    8  
ATOM   10619 C CA   . THR A 1 14  ? -2.101  4.805   -7.182  1.00 0.00 ? 14  THR A CA   8  
ATOM   10620 C C    . THR A 1 14  ? -2.808  5.806   -6.263  1.00 0.00 ? 14  THR A C    8  
ATOM   10621 O O    . THR A 1 14  ? -3.880  6.309   -6.597  1.00 0.00 ? 14  THR A O    8  
ATOM   10622 C CB   . THR A 1 14  ? -1.910  5.321   -8.609  1.00 0.00 ? 14  THR A CB   8  
ATOM   10623 O OG1  . THR A 1 14  ? -1.558  6.691   -8.438  1.00 0.00 ? 14  THR A OG1  8  
ATOM   10624 C CG2  . THR A 1 14  ? -3.221  5.367   -9.396  1.00 0.00 ? 14  THR A CG2  8  
ATOM   10625 H H    . THR A 1 14  ? -3.779  3.649   -7.611  1.00 0.00 ? 14  THR A H    8  
ATOM   10626 H HA   . THR A 1 14  ? -1.128  4.595   -6.736  1.00 0.00 ? 14  THR A HA   8  
ATOM   10627 H HB   . THR A 1 14  ? -1.158  4.733   -9.136  1.00 0.00 ? 14  THR A HB   8  
ATOM   10628 H HG1  . THR A 1 14  ? -0.666  6.870   -8.857  1.00 0.00 ? 14  THR A HG1  8  
ATOM   10629 H HG21 . THR A 1 14  ? -3.089  5.985   -10.285 1.00 0.00 ? 14  THR A HG21 8  
ATOM   10630 H HG22 . THR A 1 14  ? -3.501  4.356   -9.693  1.00 0.00 ? 14  THR A HG22 8  
ATOM   10631 H HG23 . THR A 1 14  ? -4.006  5.793   -8.770  1.00 0.00 ? 14  THR A HG23 8  
ATOM   10632 N N    . VAL A 1 15  ? -2.178  6.065   -5.127  1.00 0.00 ? 15  VAL A N    8  
ATOM   10633 C CA   . VAL A 1 15  ? -2.731  6.997   -4.160  1.00 0.00 ? 15  VAL A CA   8  
ATOM   10634 C C    . VAL A 1 15  ? -1.921  8.294   -4.185  1.00 0.00 ? 15  VAL A C    8  
ATOM   10635 O O    . VAL A 1 15  ? -0.738  8.297   -3.851  1.00 0.00 ? 15  VAL A O    8  
ATOM   10636 C CB   . VAL A 1 15  ? -2.778  6.347   -2.775  1.00 0.00 ? 15  VAL A CB   8  
ATOM   10637 C CG1  . VAL A 1 15  ? -1.540  6.715   -1.955  1.00 0.00 ? 15  VAL A CG1  8  
ATOM   10638 C CG2  . VAL A 1 15  ? -4.061  6.728   -2.032  1.00 0.00 ? 15  VAL A CG2  8  
ATOM   10639 H H    . VAL A 1 15  ? -1.305  5.651   -4.864  1.00 0.00 ? 15  VAL A H    8  
ATOM   10640 H HA   . VAL A 1 15  ? -3.756  7.216   -4.463  1.00 0.00 ? 15  VAL A HA   8  
ATOM   10641 H HB   . VAL A 1 15  ? -2.779  5.266   -2.912  1.00 0.00 ? 15  VAL A HB   8  
ATOM   10642 H HG11 . VAL A 1 15  ? -1.618  6.275   -0.960  1.00 0.00 ? 15  VAL A HG11 8  
ATOM   10643 H HG12 . VAL A 1 15  ? -0.647  6.334   -2.452  1.00 0.00 ? 15  VAL A HG12 8  
ATOM   10644 H HG13 . VAL A 1 15  ? -1.471  7.799   -1.868  1.00 0.00 ? 15  VAL A HG13 8  
ATOM   10645 H HG21 . VAL A 1 15  ? -4.116  7.812   -1.936  1.00 0.00 ? 15  VAL A HG21 8  
ATOM   10646 H HG22 . VAL A 1 15  ? -4.924  6.368   -2.591  1.00 0.00 ? 15  VAL A HG22 8  
ATOM   10647 H HG23 . VAL A 1 15  ? -4.054  6.275   -1.041  1.00 0.00 ? 15  VAL A HG23 8  
ATOM   10648 N N    . THR A 1 16  ? -2.593  9.365   -4.584  1.00 0.00 ? 16  THR A N    8  
ATOM   10649 C CA   . THR A 1 16  ? -1.951  10.666  -4.658  1.00 0.00 ? 16  THR A CA   8  
ATOM   10650 C C    . THR A 1 16  ? -2.320  11.513  -3.438  1.00 0.00 ? 16  THR A C    8  
ATOM   10651 O O    . THR A 1 16  ? -3.397  11.347  -2.867  1.00 0.00 ? 16  THR A O    8  
ATOM   10652 C CB   . THR A 1 16  ? -2.341  11.312  -5.987  1.00 0.00 ? 16  THR A CB   8  
ATOM   10653 O OG1  . THR A 1 16  ? -2.143  10.278  -6.948  1.00 0.00 ? 16  THR A OG1  8  
ATOM   10654 C CG2  . THR A 1 16  ? -1.365  12.410  -6.415  1.00 0.00 ? 16  THR A CG2  8  
ATOM   10655 H H    . THR A 1 16  ? -3.555  9.353   -4.853  1.00 0.00 ? 16  THR A H    8  
ATOM   10656 H HA   . THR A 1 16  ? -0.871  10.519  -4.627  1.00 0.00 ? 16  THR A HA   8  
ATOM   10657 H HB   . THR A 1 16  ? -3.362  11.692  -5.950  1.00 0.00 ? 16  THR A HB   8  
ATOM   10658 H HG1  . THR A 1 16  ? -3.025  9.957   -7.290  1.00 0.00 ? 16  THR A HG1  8  
ATOM   10659 H HG21 . THR A 1 16  ? -1.653  12.791  -7.394  1.00 0.00 ? 16  THR A HG21 8  
ATOM   10660 H HG22 . THR A 1 16  ? -1.387  13.220  -5.686  1.00 0.00 ? 16  THR A HG22 8  
ATOM   10661 H HG23 . THR A 1 16  ? -0.357  11.999  -6.469  1.00 0.00 ? 16  THR A HG23 8  
ATOM   10662 N N    . LEU A 1 17  ? -1.409  12.404  -3.077  1.00 0.00 ? 17  LEU A N    8  
ATOM   10663 C CA   . LEU A 1 17  ? -1.626  13.277  -1.936  1.00 0.00 ? 17  LEU A CA   8  
ATOM   10664 C C    . LEU A 1 17  ? -2.573  14.410  -2.340  1.00 0.00 ? 17  LEU A C    8  
ATOM   10665 O O    . LEU A 1 17  ? -2.267  15.188  -3.242  1.00 0.00 ? 17  LEU A O    8  
ATOM   10666 C CB   . LEU A 1 17  ? -0.290  13.764  -1.372  1.00 0.00 ? 17  LEU A CB   8  
ATOM   10667 C CG   . LEU A 1 17  ? 0.434   12.799  -0.433  1.00 0.00 ? 17  LEU A CG   8  
ATOM   10668 C CD1  . LEU A 1 17  ? 1.053   13.545  0.751   1.00 0.00 ? 17  LEU A CD1  8  
ATOM   10669 C CD2  . LEU A 1 17  ? -0.499  11.675  0.023   1.00 0.00 ? 17  LEU A CD2  8  
ATOM   10670 H H    . LEU A 1 17  ? -0.536  12.532  -3.547  1.00 0.00 ? 17  LEU A H    8  
ATOM   10671 H HA   . LEU A 1 17  ? -2.106  12.685  -1.159  1.00 0.00 ? 17  LEU A HA   8  
ATOM   10672 H HB2  . LEU A 1 17  ? 0.372   13.993  -2.207  1.00 0.00 ? 17  LEU A HB2  8  
ATOM   10673 H HB3  . LEU A 1 17  ? -0.463  14.699  -0.839  1.00 0.00 ? 17  LEU A HB3  8  
ATOM   10674 H HG   . LEU A 1 17  ? 1.252   12.335  -0.984  1.00 0.00 ? 17  LEU A HG   8  
ATOM   10675 H HD11 . LEU A 1 17  ? 1.865   12.950  1.172   1.00 0.00 ? 17  LEU A HD11 8  
ATOM   10676 H HD12 . LEU A 1 17  ? 1.442   14.505  0.412   1.00 0.00 ? 17  LEU A HD12 8  
ATOM   10677 H HD13 . LEU A 1 17  ? 0.292   13.712  1.513   1.00 0.00 ? 17  LEU A HD13 8  
ATOM   10678 H HD21 . LEU A 1 17  ? -1.315  12.095  0.609   1.00 0.00 ? 17  LEU A HD21 8  
ATOM   10679 H HD22 . LEU A 1 17  ? -0.904  11.163  -0.850  1.00 0.00 ? 17  LEU A HD22 8  
ATOM   10680 H HD23 . LEU A 1 17  ? 0.061   10.966  0.634   1.00 0.00 ? 17  LEU A HD23 8  
ATOM   10681 N N    . LYS A 1 18  ? -3.704  14.466  -1.651  1.00 0.00 ? 18  LYS A N    8  
ATOM   10682 C CA   . LYS A 1 18  ? -4.697  15.489  -1.927  1.00 0.00 ? 18  LYS A CA   8  
ATOM   10683 C C    . LYS A 1 18  ? -4.555  16.620  -0.906  1.00 0.00 ? 18  LYS A C    8  
ATOM   10684 O O    . LYS A 1 18  ? -4.493  17.791  -1.275  1.00 0.00 ? 18  LYS A O    8  
ATOM   10685 C CB   . LYS A 1 18  ? -6.098  14.876  -1.976  1.00 0.00 ? 18  LYS A CB   8  
ATOM   10686 C CG   . LYS A 1 18  ? -7.092  15.829  -2.644  1.00 0.00 ? 18  LYS A CG   8  
ATOM   10687 C CD   . LYS A 1 18  ? -8.504  15.628  -2.091  1.00 0.00 ? 18  LYS A CD   8  
ATOM   10688 C CE   . LYS A 1 18  ? -9.261  16.955  -2.025  1.00 0.00 ? 18  LYS A CE   8  
ATOM   10689 N NZ   . LYS A 1 18  ? -10.286 17.022  -3.090  1.00 0.00 ? 18  LYS A NZ   8  
ATOM   10690 H H    . LYS A 1 18  ? -3.946  13.828  -0.919  1.00 0.00 ? 18  LYS A H    8  
ATOM   10691 H HA   . LYS A 1 18  ? -4.489  15.890  -2.918  1.00 0.00 ? 18  LYS A HA   8  
ATOM   10692 H HB2  . LYS A 1 18  ? -6.069  13.934  -2.521  1.00 0.00 ? 18  LYS A HB2  8  
ATOM   10693 H HB3  . LYS A 1 18  ? -6.434  14.647  -0.963  1.00 0.00 ? 18  LYS A HB3  8  
ATOM   10694 H HG2  . LYS A 1 18  ? -6.777  16.859  -2.483  1.00 0.00 ? 18  LYS A HG2  8  
ATOM   10695 H HG3  . LYS A 1 18  ? -7.091  15.661  -3.722  1.00 0.00 ? 18  LYS A HG3  8  
ATOM   10696 H HD2  . LYS A 1 18  ? -9.047  14.926  -2.722  1.00 0.00 ? 18  LYS A HD2  8  
ATOM   10697 H HD3  . LYS A 1 18  ? -8.449  15.185  -1.096  1.00 0.00 ? 18  LYS A HD3  8  
ATOM   10698 H HE2  . LYS A 1 18  ? -9.735  17.062  -1.049  1.00 0.00 ? 18  LYS A HE2  8  
ATOM   10699 H HE3  . LYS A 1 18  ? -8.563  17.784  -2.129  1.00 0.00 ? 18  LYS A HE3  8  
ATOM   10700 H HZ1  . LYS A 1 18  ? -11.078 17.532  -2.759  1.00 0.00 ? 18  LYS A HZ1  8  
ATOM   10701 H HZ2  . LYS A 1 18  ? -9.902  17.484  -3.891  1.00 0.00 ? 18  LYS A HZ2  8  
ATOM   10702 H HZ3  . LYS A 1 18  ? -10.565 16.095  -3.343  1.00 0.00 ? 18  LYS A HZ3  8  
ATOM   10703 N N    . LYS A 1 19  ? -4.509  16.228  0.359   1.00 0.00 ? 19  LYS A N    8  
ATOM   10704 C CA   . LYS A 1 19  ? -4.376  17.194  1.436   1.00 0.00 ? 19  LYS A CA   8  
ATOM   10705 C C    . LYS A 1 19  ? -2.896  17.356  1.790   1.00 0.00 ? 19  LYS A C    8  
ATOM   10706 O O    . LYS A 1 19  ? -2.542  18.183  2.630   1.00 0.00 ? 19  LYS A O    8  
ATOM   10707 C CB   . LYS A 1 19  ? -5.251  16.795  2.627   1.00 0.00 ? 19  LYS A CB   8  
ATOM   10708 C CG   . LYS A 1 19  ? -5.140  17.819  3.757   1.00 0.00 ? 19  LYS A CG   8  
ATOM   10709 C CD   . LYS A 1 19  ? -6.232  17.599  4.806   1.00 0.00 ? 19  LYS A CD   8  
ATOM   10710 C CE   . LYS A 1 19  ? -5.623  17.367  6.191   1.00 0.00 ? 19  LYS A CE   8  
ATOM   10711 N NZ   . LYS A 1 19  ? -5.730  18.591  7.015   1.00 0.00 ? 19  LYS A NZ   8  
ATOM   10712 H H    . LYS A 1 19  ? -4.561  15.274  0.652   1.00 0.00 ? 19  LYS A H    8  
ATOM   10713 H HA   . LYS A 1 19  ? -4.749  18.149  1.067   1.00 0.00 ? 19  LYS A HA   8  
ATOM   10714 H HB2  . LYS A 1 19  ? -6.290  16.712  2.306   1.00 0.00 ? 19  LYS A HB2  8  
ATOM   10715 H HB3  . LYS A 1 19  ? -4.950  15.813  2.990   1.00 0.00 ? 19  LYS A HB3  8  
ATOM   10716 H HG2  . LYS A 1 19  ? -4.160  17.743  4.227   1.00 0.00 ? 19  LYS A HG2  8  
ATOM   10717 H HG3  . LYS A 1 19  ? -5.221  18.827  3.349   1.00 0.00 ? 19  LYS A HG3  8  
ATOM   10718 H HD2  . LYS A 1 19  ? -6.892  18.464  4.836   1.00 0.00 ? 19  LYS A HD2  8  
ATOM   10719 H HD3  . LYS A 1 19  ? -6.842  16.741  4.524   1.00 0.00 ? 19  LYS A HD3  8  
ATOM   10720 H HE2  . LYS A 1 19  ? -6.136  16.542  6.685   1.00 0.00 ? 19  LYS A HE2  8  
ATOM   10721 H HE3  . LYS A 1 19  ? -4.577  17.079  6.091   1.00 0.00 ? 19  LYS A HE3  8  
ATOM   10722 H HZ1  . LYS A 1 19  ? -4.814  18.944  7.207   1.00 0.00 ? 19  LYS A HZ1  8  
ATOM   10723 H HZ2  . LYS A 1 19  ? -6.257  19.282  6.520   1.00 0.00 ? 19  LYS A HZ2  8  
ATOM   10724 H HZ3  . LYS A 1 19  ? -6.191  18.374  7.876   1.00 0.00 ? 19  LYS A HZ3  8  
ATOM   10725 N N    . GLN A 1 20  ? -2.071  16.556  1.129   1.00 0.00 ? 20  GLN A N    8  
ATOM   10726 C CA   . GLN A 1 20  ? -0.638  16.600  1.364   1.00 0.00 ? 20  GLN A CA   8  
ATOM   10727 C C    . GLN A 1 20  ? -0.336  16.401  2.850   1.00 0.00 ? 20  GLN A C    8  
ATOM   10728 O O    . GLN A 1 20  ? 0.537   17.067  3.404   1.00 0.00 ? 20  GLN A O    8  
ATOM   10729 C CB   . GLN A 1 20  ? -0.041  17.914  0.854   1.00 0.00 ? 20  GLN A CB   8  
ATOM   10730 C CG   . GLN A 1 20  ? 0.684   17.706  -0.478  1.00 0.00 ? 20  GLN A CG   8  
ATOM   10731 C CD   . GLN A 1 20  ? 1.067   19.046  -1.109  1.00 0.00 ? 20  GLN A CD   8  
ATOM   10732 O OE1  . GLN A 1 20  ? 0.299   19.669  -1.823  1.00 0.00 ? 20  GLN A OE1  8  
ATOM   10733 N NE2  . GLN A 1 20  ? 2.296   19.454  -0.804  1.00 0.00 ? 20  GLN A NE2  8  
ATOM   10734 H H    . GLN A 1 20  ? -2.368  15.887  0.450   1.00 0.00 ? 20  GLN A H    8  
ATOM   10735 H HA   . GLN A 1 20  ? -0.225  15.773  0.788   1.00 0.00 ? 20  GLN A HA   8  
ATOM   10736 H HB2  . GLN A 1 20  ? -0.831  18.654  0.732   1.00 0.00 ? 20  GLN A HB2  8  
ATOM   10737 H HB3  . GLN A 1 20  ? 0.658   18.311  1.592   1.00 0.00 ? 20  GLN A HB3  8  
ATOM   10738 H HG2  . GLN A 1 20  ? 1.578   17.105  -0.321  1.00 0.00 ? 20  GLN A HG2  8  
ATOM   10739 H HG3  . GLN A 1 20  ? 0.041   17.150  -1.162  1.00 0.00 ? 20  GLN A HG3  8  
ATOM   10740 H HE21 . GLN A 1 20  ? 2.876   18.895  -0.211  1.00 0.00 ? 20  GLN A HE21 8  
ATOM   10741 H HE22 . GLN A 1 20  ? 2.639   20.320  -1.168  1.00 0.00 ? 20  GLN A HE22 8  
ATOM   10742 N N    . ASN A 1 21  ? -1.076  15.482  3.454   1.00 0.00 ? 21  ASN A N    8  
ATOM   10743 C CA   . ASN A 1 21  ? -0.897  15.187  4.864   1.00 0.00 ? 21  ASN A CA   8  
ATOM   10744 C C    . ASN A 1 21  ? 0.141   14.075  5.023   1.00 0.00 ? 21  ASN A C    8  
ATOM   10745 O O    . ASN A 1 21  ? -0.047  13.153  5.815   1.00 0.00 ? 21  ASN A O    8  
ATOM   10746 C CB   . ASN A 1 21  ? -2.206  14.707  5.496   1.00 0.00 ? 21  ASN A CB   8  
ATOM   10747 C CG   . ASN A 1 21  ? -2.129  14.761  7.023   1.00 0.00 ? 21  ASN A CG   8  
ATOM   10748 O OD1  . ASN A 1 21  ? -1.100  14.513  7.629   1.00 0.00 ? 21  ASN A OD1  8  
ATOM   10749 N ND2  . ASN A 1 21  ? -3.275  15.095  7.611   1.00 0.00 ? 21  ASN A ND2  8  
ATOM   10750 H H    . ASN A 1 21  ? -1.784  14.946  2.996   1.00 0.00 ? 21  ASN A H    8  
ATOM   10751 H HA   . ASN A 1 21  ? -0.574  16.125  5.315   1.00 0.00 ? 21  ASN A HA   8  
ATOM   10752 H HB2  . ASN A 1 21  ? -3.032  15.325  5.148   1.00 0.00 ? 21  ASN A HB2  8  
ATOM   10753 H HB3  . ASN A 1 21  ? -2.416  13.686  5.175   1.00 0.00 ? 21  ASN A HB3  8  
ATOM   10754 H HD21 . ASN A 1 21  ? -4.084  15.286  7.055   1.00 0.00 ? 21  ASN A HD21 8  
ATOM   10755 H HD22 . ASN A 1 21  ? -3.327  15.158  8.606   1.00 0.00 ? 21  ASN A HD22 8  
ATOM   10756 N N    . GLY A 1 22  ? 1.213   14.197  4.254   1.00 0.00 ? 22  GLY A N    8  
ATOM   10757 C CA   . GLY A 1 22  ? 2.281   13.213  4.299   1.00 0.00 ? 22  GLY A CA   8  
ATOM   10758 C C    . GLY A 1 22  ? 1.843   11.900  3.647   1.00 0.00 ? 22  GLY A C    8  
ATOM   10759 O O    . GLY A 1 22  ? 2.488   11.417  2.717   1.00 0.00 ? 22  GLY A O    8  
ATOM   10760 H H    . GLY A 1 22  ? 1.359   14.949  3.611   1.00 0.00 ? 22  GLY A H    8  
ATOM   10761 H HA2  . GLY A 1 22  ? 3.161   13.601  3.785   1.00 0.00 ? 22  GLY A HA2  8  
ATOM   10762 H HA3  . GLY A 1 22  ? 2.571   13.031  5.333   1.00 0.00 ? 22  GLY A HA3  8  
ATOM   10763 N N    . MET A 1 23  ? 0.749   11.356  4.162   1.00 0.00 ? 23  MET A N    8  
ATOM   10764 C CA   . MET A 1 23  ? 0.218   10.107  3.642   1.00 0.00 ? 23  MET A CA   8  
ATOM   10765 C C    . MET A 1 23  ? -0.800  9.501   4.610   1.00 0.00 ? 23  MET A C    8  
ATOM   10766 O O    . MET A 1 23  ? -2.002  9.529   4.351   1.00 0.00 ? 23  MET A O    8  
ATOM   10767 C CB   . MET A 1 23  ? 1.364   9.118   3.419   1.00 0.00 ? 23  MET A CB   8  
ATOM   10768 C CG   . MET A 1 23  ? 1.480   8.740   1.943   1.00 0.00 ? 23  MET A CG   8  
ATOM   10769 S SD   . MET A 1 23  ? 3.107   9.152   1.333   1.00 0.00 ? 23  MET A SD   8  
ATOM   10770 C CE   . MET A 1 23  ? 3.916   7.572   1.515   1.00 0.00 ? 23  MET A CE   8  
ATOM   10771 H H    . MET A 1 23  ? 0.231   11.754  4.919   1.00 0.00 ? 23  MET A H    8  
ATOM   10772 H HA   . MET A 1 23  ? -0.272  10.365  2.704   1.00 0.00 ? 23  MET A HA   8  
ATOM   10773 H HB2  . MET A 1 23  ? 2.300   9.558   3.761   1.00 0.00 ? 23  MET A HB2  8  
ATOM   10774 H HB3  . MET A 1 23  ? 1.196   8.223   4.017   1.00 0.00 ? 23  MET A HB3  8  
ATOM   10775 H HG2  . MET A 1 23  ? 1.296   7.671   1.818   1.00 0.00 ? 23  MET A HG2  8  
ATOM   10776 H HG3  . MET A 1 23  ? 0.722   9.264   1.364   1.00 0.00 ? 23  MET A HG3  8  
ATOM   10777 H HE1  . MET A 1 23  ? 3.236   6.777   1.205   1.00 0.00 ? 23  MET A HE1  8  
ATOM   10778 H HE2  . MET A 1 23  ? 4.811   7.546   0.892   1.00 0.00 ? 23  MET A HE2  8  
ATOM   10779 H HE3  . MET A 1 23  ? 4.194   7.424   2.558   1.00 0.00 ? 23  MET A HE3  8  
ATOM   10780 N N    . GLY A 1 24  ? -0.281  8.966   5.707   1.00 0.00 ? 24  GLY A N    8  
ATOM   10781 C CA   . GLY A 1 24  ? -1.131  8.353   6.715   1.00 0.00 ? 24  GLY A CA   8  
ATOM   10782 C C    . GLY A 1 24  ? -1.540  6.939   6.299   1.00 0.00 ? 24  GLY A C    8  
ATOM   10783 O O    . GLY A 1 24  ? -2.727  6.642   6.182   1.00 0.00 ? 24  GLY A O    8  
ATOM   10784 H H    . GLY A 1 24  ? 0.698   8.946   5.910   1.00 0.00 ? 24  GLY A H    8  
ATOM   10785 H HA2  . GLY A 1 24  ? -0.601  8.318   7.667   1.00 0.00 ? 24  GLY A HA2  8  
ATOM   10786 H HA3  . GLY A 1 24  ? -2.020  8.964   6.866   1.00 0.00 ? 24  GLY A HA3  8  
ATOM   10787 N N    . LEU A 1 25  ? -0.533  6.103   6.089   1.00 0.00 ? 25  LEU A N    8  
ATOM   10788 C CA   . LEU A 1 25  ? -0.775  4.727   5.690   1.00 0.00 ? 25  LEU A CA   8  
ATOM   10789 C C    . LEU A 1 25  ? -0.089  3.785   6.683   1.00 0.00 ? 25  LEU A C    8  
ATOM   10790 O O    . LEU A 1 25  ? 0.826   4.190   7.397   1.00 0.00 ? 25  LEU A O    8  
ATOM   10791 C CB   . LEU A 1 25  ? -0.345  4.507   4.237   1.00 0.00 ? 25  LEU A CB   8  
ATOM   10792 C CG   . LEU A 1 25  ? -1.425  4.738   3.179   1.00 0.00 ? 25  LEU A CG   8  
ATOM   10793 C CD1  . LEU A 1 25  ? -1.184  3.858   1.950   1.00 0.00 ? 25  LEU A CD1  8  
ATOM   10794 C CD2  . LEU A 1 25  ? -2.823  4.533   3.766   1.00 0.00 ? 25  LEU A CD2  8  
ATOM   10795 H H    . LEU A 1 25  ? 0.430   6.351   6.188   1.00 0.00 ? 25  LEU A H    8  
ATOM   10796 H HA   . LEU A 1 25  ? -1.849  4.556   5.738   1.00 0.00 ? 25  LEU A HA   8  
ATOM   10797 H HB2  . LEU A 1 25  ? 0.494   5.170   4.024   1.00 0.00 ? 25  LEU A HB2  8  
ATOM   10798 H HB3  . LEU A 1 25  ? 0.021   3.487   4.138   1.00 0.00 ? 25  LEU A HB3  8  
ATOM   10799 H HG   . LEU A 1 25  ? -1.364  5.776   2.848   1.00 0.00 ? 25  LEU A HG   8  
ATOM   10800 H HD11 . LEU A 1 25  ? -2.064  3.885   1.306   1.00 0.00 ? 25  LEU A HD11 8  
ATOM   10801 H HD12 . LEU A 1 25  ? -0.319  4.229   1.401   1.00 0.00 ? 25  LEU A HD12 8  
ATOM   10802 H HD13 . LEU A 1 25  ? -0.999  2.832   2.268   1.00 0.00 ? 25  LEU A HD13 8  
ATOM   10803 H HD21 . LEU A 1 25  ? -3.064  5.364   4.430   1.00 0.00 ? 25  LEU A HD21 8  
ATOM   10804 H HD22 . LEU A 1 25  ? -3.553  4.491   2.958   1.00 0.00 ? 25  LEU A HD22 8  
ATOM   10805 H HD23 . LEU A 1 25  ? -2.847  3.599   4.326   1.00 0.00 ? 25  LEU A HD23 8  
ATOM   10806 N N    . SER A 1 26  ? -0.558  2.547   6.694   1.00 0.00 ? 26  SER A N    8  
ATOM   10807 C CA   . SER A 1 26  ? -0.002  1.543   7.587   1.00 0.00 ? 26  SER A CA   8  
ATOM   10808 C C    . SER A 1 26  ? -0.001  0.176   6.902   1.00 0.00 ? 26  SER A C    8  
ATOM   10809 O O    . SER A 1 26  ? -1.055  -0.422  6.700   1.00 0.00 ? 26  SER A O    8  
ATOM   10810 C CB   . SER A 1 26  ? -0.786  1.480   8.899   1.00 0.00 ? 26  SER A CB   8  
ATOM   10811 O OG   . SER A 1 26  ? 0.063   1.230   10.016  1.00 0.00 ? 26  SER A OG   8  
ATOM   10812 H H    . SER A 1 26  ? -1.303  2.224   6.109   1.00 0.00 ? 26  SER A H    8  
ATOM   10813 H HA   . SER A 1 26  ? 1.018   1.872   7.789   1.00 0.00 ? 26  SER A HA   8  
ATOM   10814 H HB2  . SER A 1 26  ? -1.318  2.418   9.051   1.00 0.00 ? 26  SER A HB2  8  
ATOM   10815 H HB3  . SER A 1 26  ? -1.538  0.694   8.832   1.00 0.00 ? 26  SER A HB3  8  
ATOM   10816 H HG   . SER A 1 26  ? 0.387   2.095   10.399  1.00 0.00 ? 26  SER A HG   8  
ATOM   10817 N N    . ILE A 1 27  ? 1.197   -0.279  6.561   1.00 0.00 ? 27  ILE A N    8  
ATOM   10818 C CA   . ILE A 1 27  ? 1.350   -1.565  5.903   1.00 0.00 ? 27  ILE A CA   8  
ATOM   10819 C C    . ILE A 1 27  ? 2.441   -2.369  6.613   1.00 0.00 ? 27  ILE A C    8  
ATOM   10820 O O    . ILE A 1 27  ? 3.136   -1.846  7.481   1.00 0.00 ? 27  ILE A O    8  
ATOM   10821 C CB   . ILE A 1 27  ? 1.601   -1.374  4.405   1.00 0.00 ? 27  ILE A CB   8  
ATOM   10822 C CG1  . ILE A 1 27  ? 3.094   -1.454  4.086   1.00 0.00 ? 27  ILE A CG1  8  
ATOM   10823 C CG2  . ILE A 1 27  ? 0.977   -0.069  3.906   1.00 0.00 ? 27  ILE A CG2  8  
ATOM   10824 C CD1  . ILE A 1 27  ? 3.333   -1.442  2.574   1.00 0.00 ? 27  ILE A CD1  8  
ATOM   10825 H H    . ILE A 1 27  ? 2.051   0.215   6.729   1.00 0.00 ? 27  ILE A H    8  
ATOM   10826 H HA   . ILE A 1 27  ? 0.405   -2.098  6.005   1.00 0.00 ? 27  ILE A HA   8  
ATOM   10827 H HB   . ILE A 1 27  ? 1.114   -2.188  3.871   1.00 0.00 ? 27  ILE A HB   8  
ATOM   10828 H HG12 . ILE A 1 27  ? 3.614   -0.613  4.545   1.00 0.00 ? 27  ILE A HG12 8  
ATOM   10829 H HG13 . ILE A 1 27  ? 3.515   -2.361  4.517   1.00 0.00 ? 27  ILE A HG13 8  
ATOM   10830 H HG21 . ILE A 1 27  ? -0.109  -0.129  3.994   1.00 0.00 ? 27  ILE A HG21 8  
ATOM   10831 H HG22 . ILE A 1 27  ? 1.343   0.762   4.509   1.00 0.00 ? 27  ILE A HG22 8  
ATOM   10832 H HG23 . ILE A 1 27  ? 1.250   0.090   2.864   1.00 0.00 ? 27  ILE A HG23 8  
ATOM   10833 H HD11 . ILE A 1 27  ? 4.289   -1.918  2.354   1.00 0.00 ? 27  ILE A HD11 8  
ATOM   10834 H HD12 . ILE A 1 27  ? 2.532   -1.989  2.077   1.00 0.00 ? 27  ILE A HD12 8  
ATOM   10835 H HD13 . ILE A 1 27  ? 3.349   -0.413  2.217   1.00 0.00 ? 27  ILE A HD13 8  
ATOM   10836 N N    . VAL A 1 28  ? 2.557   -3.627  6.213   1.00 0.00 ? 28  VAL A N    8  
ATOM   10837 C CA   . VAL A 1 28  ? 3.552   -4.510  6.799   1.00 0.00 ? 28  VAL A CA   8  
ATOM   10838 C C    . VAL A 1 28  ? 3.962   -5.564  5.769   1.00 0.00 ? 28  VAL A C    8  
ATOM   10839 O O    . VAL A 1 28  ? 3.237   -5.814  4.809   1.00 0.00 ? 28  VAL A O    8  
ATOM   10840 C CB   . VAL A 1 28  ? 3.014   -5.118  8.095   1.00 0.00 ? 28  VAL A CB   8  
ATOM   10841 C CG1  . VAL A 1 28  ? 1.756   -5.948  7.830   1.00 0.00 ? 28  VAL A CG1  8  
ATOM   10842 C CG2  . VAL A 1 28  ? 4.086   -5.956  8.794   1.00 0.00 ? 28  VAL A CG2  8  
ATOM   10843 H H    . VAL A 1 28  ? 1.989   -4.044  5.504   1.00 0.00 ? 28  VAL A H    8  
ATOM   10844 H HA   . VAL A 1 28  ? 4.423   -3.903  7.046   1.00 0.00 ? 28  VAL A HA   8  
ATOM   10845 H HB   . VAL A 1 28  ? 2.741   -4.298  8.761   1.00 0.00 ? 28  VAL A HB   8  
ATOM   10846 H HG11 . VAL A 1 28  ? 1.417   -6.403  8.761   1.00 0.00 ? 28  VAL A HG11 8  
ATOM   10847 H HG12 . VAL A 1 28  ? 0.971   -5.302  7.434   1.00 0.00 ? 28  VAL A HG12 8  
ATOM   10848 H HG13 . VAL A 1 28  ? 1.982   -6.729  7.105   1.00 0.00 ? 28  VAL A HG13 8  
ATOM   10849 H HG21 . VAL A 1 28  ? 4.085   -6.964  8.382   1.00 0.00 ? 28  VAL A HG21 8  
ATOM   10850 H HG22 . VAL A 1 28  ? 5.063   -5.499  8.637   1.00 0.00 ? 28  VAL A HG22 8  
ATOM   10851 H HG23 . VAL A 1 28  ? 3.874   -6.000  9.864   1.00 0.00 ? 28  VAL A HG23 8  
ATOM   10852 N N    . ALA A 1 29  ? 5.125   -6.154  6.005   1.00 0.00 ? 29  ALA A N    8  
ATOM   10853 C CA   . ALA A 1 29  ? 5.641   -7.177  5.110   1.00 0.00 ? 29  ALA A CA   8  
ATOM   10854 C C    . ALA A 1 29  ? 6.267   -8.302  5.936   1.00 0.00 ? 29  ALA A C    8  
ATOM   10855 O O    . ALA A 1 29  ? 7.109   -8.053  6.796   1.00 0.00 ? 29  ALA A O    8  
ATOM   10856 C CB   . ALA A 1 29  ? 6.636   -6.545  4.134   1.00 0.00 ? 29  ALA A CB   8  
ATOM   10857 H H    . ALA A 1 29  ? 5.709   -5.945  6.789   1.00 0.00 ? 29  ALA A H    8  
ATOM   10858 H HA   . ALA A 1 29  ? 4.798   -7.577  4.544   1.00 0.00 ? 29  ALA A HA   8  
ATOM   10859 H HB1  . ALA A 1 29  ? 7.633   -6.557  4.575   1.00 0.00 ? 29  ALA A HB1  8  
ATOM   10860 H HB2  . ALA A 1 29  ? 6.645   -7.115  3.205   1.00 0.00 ? 29  ALA A HB2  8  
ATOM   10861 H HB3  . ALA A 1 29  ? 6.340   -5.518  3.927   1.00 0.00 ? 29  ALA A HB3  8  
ATOM   10862 N N    . ALA A 1 30  ? 5.830   -9.519  5.645   1.00 0.00 ? 30  ALA A N    8  
ATOM   10863 C CA   . ALA A 1 30  ? 6.337   -10.685 6.350   1.00 0.00 ? 30  ALA A CA   8  
ATOM   10864 C C    . ALA A 1 30  ? 7.356   -11.407 5.465   1.00 0.00 ? 30  ALA A C    8  
ATOM   10865 O O    . ALA A 1 30  ? 7.300   -11.309 4.240   1.00 0.00 ? 30  ALA A O    8  
ATOM   10866 C CB   . ALA A 1 30  ? 5.169   -11.588 6.749   1.00 0.00 ? 30  ALA A CB   8  
ATOM   10867 H H    . ALA A 1 30  ? 5.144   -9.714  4.943   1.00 0.00 ? 30  ALA A H    8  
ATOM   10868 H HA   . ALA A 1 30  ? 6.836   -10.335 7.253   1.00 0.00 ? 30  ALA A HA   8  
ATOM   10869 H HB1  . ALA A 1 30  ? 4.538   -11.775 5.878   1.00 0.00 ? 30  ALA A HB1  8  
ATOM   10870 H HB2  . ALA A 1 30  ? 5.555   -12.535 7.128   1.00 0.00 ? 30  ALA A HB2  8  
ATOM   10871 H HB3  . ALA A 1 30  ? 4.581   -11.099 7.525   1.00 0.00 ? 30  ALA A HB3  8  
ATOM   10872 N N    . LYS A 1 31  ? 8.264   -12.115 6.120   1.00 0.00 ? 31  LYS A N    8  
ATOM   10873 C CA   . LYS A 1 31  ? 9.294   -12.853 5.410   1.00 0.00 ? 31  LYS A CA   8  
ATOM   10874 C C    . LYS A 1 31  ? 9.385   -14.270 5.979   1.00 0.00 ? 31  LYS A C    8  
ATOM   10875 O O    . LYS A 1 31  ? 8.803   -14.561 7.022   1.00 0.00 ? 31  LYS A O    8  
ATOM   10876 C CB   . LYS A 1 31  ? 10.620  -12.090 5.443   1.00 0.00 ? 31  LYS A CB   8  
ATOM   10877 C CG   . LYS A 1 31  ? 11.157  -11.987 6.872   1.00 0.00 ? 31  LYS A CG   8  
ATOM   10878 C CD   . LYS A 1 31  ? 10.951  -10.581 7.437   1.00 0.00 ? 31  LYS A CD   8  
ATOM   10879 C CE   . LYS A 1 31  ? 10.209  -10.631 8.773   1.00 0.00 ? 31  LYS A CE   8  
ATOM   10880 N NZ   . LYS A 1 31  ? 9.212   -9.540  8.853   1.00 0.00 ? 31  LYS A NZ   8  
ATOM   10881 H H    . LYS A 1 31  ? 8.303   -12.189 7.117   1.00 0.00 ? 31  LYS A H    8  
ATOM   10882 H HA   . LYS A 1 31  ? 8.987   -12.920 4.365   1.00 0.00 ? 31  LYS A HA   8  
ATOM   10883 H HB2  . LYS A 1 31  ? 11.350  -12.592 4.809   1.00 0.00 ? 31  LYS A HB2  8  
ATOM   10884 H HB3  . LYS A 1 31  ? 10.478  -11.090 5.032   1.00 0.00 ? 31  LYS A HB3  8  
ATOM   10885 H HG2  . LYS A 1 31  ? 10.654  -12.716 7.507   1.00 0.00 ? 31  LYS A HG2  8  
ATOM   10886 H HG3  . LYS A 1 31  ? 12.220  -12.235 6.883   1.00 0.00 ? 31  LYS A HG3  8  
ATOM   10887 H HD2  . LYS A 1 31  ? 11.918  -10.094 7.571   1.00 0.00 ? 31  LYS A HD2  8  
ATOM   10888 H HD3  . LYS A 1 31  ? 10.387  -9.978  6.724   1.00 0.00 ? 31  LYS A HD3  8  
ATOM   10889 H HE2  . LYS A 1 31  ? 9.711   -11.596 8.884   1.00 0.00 ? 31  LYS A HE2  8  
ATOM   10890 H HE3  . LYS A 1 31  ? 10.920  -10.542 9.595   1.00 0.00 ? 31  LYS A HE3  8  
ATOM   10891 H HZ1  . LYS A 1 31  ? 9.224   -9.144  9.771   1.00 0.00 ? 31  LYS A HZ1  8  
ATOM   10892 H HZ2  . LYS A 1 31  ? 9.434   -8.834  8.181   1.00 0.00 ? 31  LYS A HZ2  8  
ATOM   10893 H HZ3  . LYS A 1 31  ? 8.300   -9.907  8.663   1.00 0.00 ? 31  LYS A HZ3  8  
ATOM   10894 N N    . GLY A 1 32  ? 10.122  -15.111 5.270   1.00 0.00 ? 32  GLY A N    8  
ATOM   10895 C CA   . GLY A 1 32  ? 10.298  -16.490 5.692   1.00 0.00 ? 32  GLY A CA   8  
ATOM   10896 C C    . GLY A 1 32  ? 10.428  -16.586 7.213   1.00 0.00 ? 32  GLY A C    8  
ATOM   10897 O O    . GLY A 1 32  ? 11.359  -16.032 7.795   1.00 0.00 ? 32  GLY A O    8  
ATOM   10898 H H    . GLY A 1 32  ? 10.592  -14.865 4.422   1.00 0.00 ? 32  GLY A H    8  
ATOM   10899 H HA2  . GLY A 1 32  ? 9.448   -17.088 5.358   1.00 0.00 ? 32  GLY A HA2  8  
ATOM   10900 H HA3  . GLY A 1 32  ? 11.186  -16.909 5.220   1.00 0.00 ? 32  GLY A HA3  8  
ATOM   10901 N N    . ALA A 1 33  ? 9.481   -17.294 7.812   1.00 0.00 ? 33  ALA A N    8  
ATOM   10902 C CA   . ALA A 1 33  ? 9.478   -17.469 9.255   1.00 0.00 ? 33  ALA A CA   8  
ATOM   10903 C C    . ALA A 1 33  ? 9.056   -18.902 9.590   1.00 0.00 ? 33  ALA A C    8  
ATOM   10904 O O    . ALA A 1 33  ? 7.966   -19.332 9.220   1.00 0.00 ? 33  ALA A O    8  
ATOM   10905 C CB   . ALA A 1 33  ? 8.561   -16.426 9.894   1.00 0.00 ? 33  ALA A CB   8  
ATOM   10906 H H    . ALA A 1 33  ? 8.728   -17.742 7.331   1.00 0.00 ? 33  ALA A H    8  
ATOM   10907 H HA   . ALA A 1 33  ? 10.497  -17.306 9.612   1.00 0.00 ? 33  ALA A HA   8  
ATOM   10908 H HB1  . ALA A 1 33  ? 7.636   -16.356 9.322   1.00 0.00 ? 33  ALA A HB1  8  
ATOM   10909 H HB2  . ALA A 1 33  ? 8.332   -16.721 10.919  1.00 0.00 ? 33  ALA A HB2  8  
ATOM   10910 H HB3  . ALA A 1 33  ? 9.059   -15.456 9.900   1.00 0.00 ? 33  ALA A HB3  8  
ATOM   10911 N N    . GLY A 1 34  ? 9.944   -19.599 10.284  1.00 0.00 ? 34  GLY A N    8  
ATOM   10912 C CA   . GLY A 1 34  ? 9.676   -20.973 10.673  1.00 0.00 ? 34  GLY A CA   8  
ATOM   10913 C C    . GLY A 1 34  ? 9.712   -21.903 9.458   1.00 0.00 ? 34  GLY A C    8  
ATOM   10914 O O    . GLY A 1 34  ? 10.708  -22.584 9.221   1.00 0.00 ? 34  GLY A O    8  
ATOM   10915 H H    . GLY A 1 34  ? 10.830  -19.239 10.580  1.00 0.00 ? 34  GLY A H    8  
ATOM   10916 H HA2  . GLY A 1 34  ? 10.415  -21.298 11.406  1.00 0.00 ? 34  GLY A HA2  8  
ATOM   10917 H HA3  . GLY A 1 34  ? 8.702   -21.035 11.154  1.00 0.00 ? 34  GLY A HA3  8  
ATOM   10918 N N    . GLN A 1 35  ? 8.612   -21.899 8.719   1.00 0.00 ? 35  GLN A N    8  
ATOM   10919 C CA   . GLN A 1 35  ? 8.504   -22.734 7.535   1.00 0.00 ? 35  GLN A CA   8  
ATOM   10920 C C    . GLN A 1 35  ? 8.402   -21.865 6.279   1.00 0.00 ? 35  GLN A C    8  
ATOM   10921 O O    . GLN A 1 35  ? 8.918   -22.227 5.223   1.00 0.00 ? 35  GLN A O    8  
ATOM   10922 C CB   . GLN A 1 35  ? 7.310   -23.684 7.640   1.00 0.00 ? 35  GLN A CB   8  
ATOM   10923 C CG   . GLN A 1 35  ? 7.429   -24.830 6.633   1.00 0.00 ? 35  GLN A CG   8  
ATOM   10924 C CD   . GLN A 1 35  ? 6.052   -25.266 6.132   1.00 0.00 ? 35  GLN A CD   8  
ATOM   10925 O OE1  . GLN A 1 35  ? 5.422   -24.612 5.318   1.00 0.00 ? 35  GLN A OE1  8  
ATOM   10926 N NE2  . GLN A 1 35  ? 5.619   -26.408 6.662   1.00 0.00 ? 35  GLN A NE2  8  
ATOM   10927 H H    . GLN A 1 35  ? 7.806   -21.341 8.917   1.00 0.00 ? 35  GLN A H    8  
ATOM   10928 H HA   . GLN A 1 35  ? 9.423   -23.317 7.507   1.00 0.00 ? 35  GLN A HA   8  
ATOM   10929 H HB2  . GLN A 1 35  ? 7.249   -24.087 8.651   1.00 0.00 ? 35  GLN A HB2  8  
ATOM   10930 H HB3  . GLN A 1 35  ? 6.385   -23.134 7.463   1.00 0.00 ? 35  GLN A HB3  8  
ATOM   10931 H HG2  . GLN A 1 35  ? 8.044   -24.516 5.790   1.00 0.00 ? 35  GLN A HG2  8  
ATOM   10932 H HG3  . GLN A 1 35  ? 7.935   -25.676 7.099   1.00 0.00 ? 35  GLN A HG3  8  
ATOM   10933 H HE21 . GLN A 1 35  ? 6.187   -26.897 7.325   1.00 0.00 ? 35  GLN A HE21 8  
ATOM   10934 H HE22 . GLN A 1 35  ? 4.728   -26.776 6.397   1.00 0.00 ? 35  GLN A HE22 8  
ATOM   10935 N N    . ASP A 1 36  ? 7.734   -20.730 6.435   1.00 0.00 ? 36  ASP A N    8  
ATOM   10936 C CA   . ASP A 1 36  ? 7.558   -19.806 5.328   1.00 0.00 ? 36  ASP A CA   8  
ATOM   10937 C C    . ASP A 1 36  ? 6.308   -18.958 5.571   1.00 0.00 ? 36  ASP A C    8  
ATOM   10938 O O    . ASP A 1 36  ? 5.240   -19.492 5.867   1.00 0.00 ? 36  ASP A O    8  
ATOM   10939 C CB   . ASP A 1 36  ? 7.372   -20.557 4.008   1.00 0.00 ? 36  ASP A CB   8  
ATOM   10940 C CG   . ASP A 1 36  ? 8.622   -20.635 3.128   1.00 0.00 ? 36  ASP A CG   8  
ATOM   10941 O OD1  . ASP A 1 36  ? 9.353   -19.624 3.091   1.00 0.00 ? 36  ASP A OD1  8  
ATOM   10942 O OD2  . ASP A 1 36  ? 8.814   -21.705 2.512   1.00 0.00 ? 36  ASP A OD2  8  
ATOM   10943 H H    . ASP A 1 36  ? 7.317   -20.442 7.298   1.00 0.00 ? 36  ASP A H    8  
ATOM   10944 H HA   . ASP A 1 36  ? 8.470   -19.209 5.308   1.00 0.00 ? 36  ASP A HA   8  
ATOM   10945 H HB2  . ASP A 1 36  ? 7.036   -21.570 4.229   1.00 0.00 ? 36  ASP A HB2  8  
ATOM   10946 H HB3  . ASP A 1 36  ? 6.576   -20.075 3.442   1.00 0.00 ? 36  ASP A HB3  8  
ATOM   10947 N N    . LYS A 1 37  ? 6.483   -17.653 5.436   1.00 0.00 ? 37  LYS A N    8  
ATOM   10948 C CA   . LYS A 1 37  ? 5.381   -16.725 5.637   1.00 0.00 ? 37  LYS A CA   8  
ATOM   10949 C C    . LYS A 1 37  ? 5.785   -15.342 5.125   1.00 0.00 ? 37  LYS A C    8  
ATOM   10950 O O    . LYS A 1 37  ? 5.998   -14.421 5.912   1.00 0.00 ? 37  LYS A O    8  
ATOM   10951 C CB   . LYS A 1 37  ? 4.935   -16.733 7.100   1.00 0.00 ? 37  LYS A CB   8  
ATOM   10952 C CG   . LYS A 1 37  ? 3.409   -16.687 7.208   1.00 0.00 ? 37  LYS A CG   8  
ATOM   10953 C CD   . LYS A 1 37  ? 2.944   -15.366 7.824   1.00 0.00 ? 37  LYS A CD   8  
ATOM   10954 C CE   . LYS A 1 37  ? 2.449   -14.402 6.745   1.00 0.00 ? 37  LYS A CE   8  
ATOM   10955 N NZ   . LYS A 1 37  ? 1.035   -14.034 6.985   1.00 0.00 ? 37  LYS A NZ   8  
ATOM   10956 H H    . LYS A 1 37  ? 7.355   -17.227 5.195   1.00 0.00 ? 37  LYS A H    8  
ATOM   10957 H HA   . LYS A 1 37  ? 4.541   -17.083 5.043   1.00 0.00 ? 37  LYS A HA   8  
ATOM   10958 H HB2  . LYS A 1 37  ? 5.311   -17.629 7.595   1.00 0.00 ? 37  LYS A HB2  8  
ATOM   10959 H HB3  . LYS A 1 37  ? 5.366   -15.878 7.620   1.00 0.00 ? 37  LYS A HB3  8  
ATOM   10960 H HG2  . LYS A 1 37  ? 2.968   -16.808 6.220   1.00 0.00 ? 37  LYS A HG2  8  
ATOM   10961 H HG3  . LYS A 1 37  ? 3.059   -17.520 7.817   1.00 0.00 ? 37  LYS A HG3  8  
ATOM   10962 H HD2  . LYS A 1 37  ? 2.144   -15.557 8.540   1.00 0.00 ? 37  LYS A HD2  8  
ATOM   10963 H HD3  . LYS A 1 37  ? 3.763   -14.908 8.377   1.00 0.00 ? 37  LYS A HD3  8  
ATOM   10964 H HE2  . LYS A 1 37  ? 3.067   -13.505 6.739   1.00 0.00 ? 37  LYS A HE2  8  
ATOM   10965 H HE3  . LYS A 1 37  ? 2.549   -14.865 5.762   1.00 0.00 ? 37  LYS A HE3  8  
ATOM   10966 H HZ1  . LYS A 1 37  ? 0.446   -14.554 6.364   1.00 0.00 ? 37  LYS A HZ1  8  
ATOM   10967 H HZ2  . LYS A 1 37  ? 0.791   -14.248 7.931   1.00 0.00 ? 37  LYS A HZ2  8  
ATOM   10968 H HZ3  . LYS A 1 37  ? 0.912   -13.056 6.821   1.00 0.00 ? 37  LYS A HZ3  8  
ATOM   10969 N N    . LEU A 1 38  ? 5.881   -15.239 3.807   1.00 0.00 ? 38  LEU A N    8  
ATOM   10970 C CA   . LEU A 1 38  ? 6.255   -13.982 3.179   1.00 0.00 ? 38  LEU A CA   8  
ATOM   10971 C C    . LEU A 1 38  ? 5.036   -13.388 2.471   1.00 0.00 ? 38  LEU A C    8  
ATOM   10972 O O    . LEU A 1 38  ? 4.312   -14.097 1.774   1.00 0.00 ? 38  LEU A O    8  
ATOM   10973 C CB   . LEU A 1 38  ? 7.464   -14.181 2.263   1.00 0.00 ? 38  LEU A CB   8  
ATOM   10974 C CG   . LEU A 1 38  ? 7.570   -13.221 1.075   1.00 0.00 ? 38  LEU A CG   8  
ATOM   10975 C CD1  . LEU A 1 38  ? 7.911   -11.806 1.543   1.00 0.00 ? 38  LEU A CD1  8  
ATOM   10976 C CD2  . LEU A 1 38  ? 8.569   -13.740 0.040   1.00 0.00 ? 38  LEU A CD2  8  
ATOM   10977 H H    . LEU A 1 38  ? 5.706   -15.992 3.173   1.00 0.00 ? 38  LEU A H    8  
ATOM   10978 H HA   . LEU A 1 38  ? 6.560   -13.300 3.972   1.00 0.00 ? 38  LEU A HA   8  
ATOM   10979 H HB2  . LEU A 1 38  ? 8.369   -14.086 2.862   1.00 0.00 ? 38  LEU A HB2  8  
ATOM   10980 H HB3  . LEU A 1 38  ? 7.440   -15.201 1.879   1.00 0.00 ? 38  LEU A HB3  8  
ATOM   10981 H HG   . LEU A 1 38  ? 6.596   -13.173 0.587   1.00 0.00 ? 38  LEU A HG   8  
ATOM   10982 H HD11 . LEU A 1 38  ? 8.152   -11.187 0.679   1.00 0.00 ? 38  LEU A HD11 8  
ATOM   10983 H HD12 . LEU A 1 38  ? 7.056   -11.381 2.069   1.00 0.00 ? 38  LEU A HD12 8  
ATOM   10984 H HD13 . LEU A 1 38  ? 8.768   -11.841 2.215   1.00 0.00 ? 38  LEU A HD13 8  
ATOM   10985 H HD21 . LEU A 1 38  ? 9.114   -12.900 -0.391  1.00 0.00 ? 38  LEU A HD21 8  
ATOM   10986 H HD22 . LEU A 1 38  ? 9.272   -14.420 0.522   1.00 0.00 ? 38  LEU A HD22 8  
ATOM   10987 H HD23 . LEU A 1 38  ? 8.034   -14.268 -0.750  1.00 0.00 ? 38  LEU A HD23 8  
ATOM   10988 N N    . GLY A 1 39  ? 4.846   -12.092 2.673   1.00 0.00 ? 39  GLY A N    8  
ATOM   10989 C CA   . GLY A 1 39  ? 3.728   -11.395 2.060   1.00 0.00 ? 39  GLY A CA   8  
ATOM   10990 C C    . GLY A 1 39  ? 3.538   -10.012 2.686   1.00 0.00 ? 39  GLY A C    8  
ATOM   10991 O O    . GLY A 1 39  ? 3.824   -9.815  3.866   1.00 0.00 ? 39  GLY A O    8  
ATOM   10992 H H    . GLY A 1 39  ? 5.440   -11.523 3.241   1.00 0.00 ? 39  GLY A H    8  
ATOM   10993 H HA2  . GLY A 1 39  ? 3.900   -11.292 0.990   1.00 0.00 ? 39  GLY A HA2  8  
ATOM   10994 H HA3  . GLY A 1 39  ? 2.818   -11.982 2.185   1.00 0.00 ? 39  GLY A HA3  8  
ATOM   10995 N N    . ILE A 1 40  ? 3.056   -9.089  1.867   1.00 0.00 ? 40  ILE A N    8  
ATOM   10996 C CA   . ILE A 1 40  ? 2.824   -7.729  2.324   1.00 0.00 ? 40  ILE A CA   8  
ATOM   10997 C C    . ILE A 1 40  ? 1.319   -7.496  2.478   1.00 0.00 ? 40  ILE A C    8  
ATOM   10998 O O    . ILE A 1 40  ? 0.524   -8.031  1.707   1.00 0.00 ? 40  ILE A O    8  
ATOM   10999 C CB   . ILE A 1 40  ? 3.510   -6.726  1.394   1.00 0.00 ? 40  ILE A CB   8  
ATOM   11000 C CG1  . ILE A 1 40  ? 4.590   -7.409  0.553   1.00 0.00 ? 40  ILE A CG1  8  
ATOM   11001 C CG2  . ILE A 1 40  ? 4.064   -5.536  2.183   1.00 0.00 ? 40  ILE A CG2  8  
ATOM   11002 C CD1  . ILE A 1 40  ? 5.179   -6.439  -0.474  1.00 0.00 ? 40  ILE A CD1  8  
ATOM   11003 H H    . ILE A 1 40  ? 2.827   -9.255  0.909   1.00 0.00 ? 40  ILE A H    8  
ATOM   11004 H HA   . ILE A 1 40  ? 3.290   -7.631  3.305   1.00 0.00 ? 40  ILE A HA   8  
ATOM   11005 H HB   . ILE A 1 40  ? 2.763   -6.335  0.705   1.00 0.00 ? 40  ILE A HB   8  
ATOM   11006 H HG12 . ILE A 1 40  ? 5.382   -7.780  1.204   1.00 0.00 ? 40  ILE A HG12 8  
ATOM   11007 H HG13 . ILE A 1 40  ? 4.165   -8.272  0.042   1.00 0.00 ? 40  ILE A HG13 8  
ATOM   11008 H HG21 . ILE A 1 40  ? 3.240   -4.901  2.509   1.00 0.00 ? 40  ILE A HG21 8  
ATOM   11009 H HG22 . ILE A 1 40  ? 4.608   -5.901  3.053   1.00 0.00 ? 40  ILE A HG22 8  
ATOM   11010 H HG23 . ILE A 1 40  ? 4.738   -4.962  1.549   1.00 0.00 ? 40  ILE A HG23 8  
ATOM   11011 H HD11 . ILE A 1 40  ? 5.731   -6.999  -1.228  1.00 0.00 ? 40  ILE A HD11 8  
ATOM   11012 H HD12 . ILE A 1 40  ? 4.374   -5.883  -0.953  1.00 0.00 ? 40  ILE A HD12 8  
ATOM   11013 H HD13 . ILE A 1 40  ? 5.852   -5.744  0.027   1.00 0.00 ? 40  ILE A HD13 8  
ATOM   11014 N N    . TYR A 1 41  ? 0.974   -6.698  3.476   1.00 0.00 ? 41  TYR A N    8  
ATOM   11015 C CA   . TYR A 1 41  ? -0.421  -6.389  3.740   1.00 0.00 ? 41  TYR A CA   8  
ATOM   11016 C C    . TYR A 1 41  ? -0.570  -4.978  4.313   1.00 0.00 ? 41  TYR A C    8  
ATOM   11017 O O    . TYR A 1 41  ? 0.394   -4.404  4.817   1.00 0.00 ? 41  TYR A O    8  
ATOM   11018 C CB   . TYR A 1 41  ? -0.888  -7.404  4.784   1.00 0.00 ? 41  TYR A CB   8  
ATOM   11019 C CG   . TYR A 1 41  ? -0.658  -8.862  4.382   1.00 0.00 ? 41  TYR A CG   8  
ATOM   11020 C CD1  . TYR A 1 41  ? -1.359  -9.405  3.324   1.00 0.00 ? 41  TYR A CD1  8  
ATOM   11021 C CD2  . TYR A 1 41  ? 0.252   -9.634  5.075   1.00 0.00 ? 41  TYR A CD2  8  
ATOM   11022 C CE1  . TYR A 1 41  ? -1.143  -10.776 2.946   1.00 0.00 ? 41  TYR A CE1  8  
ATOM   11023 C CE2  . TYR A 1 41  ? 0.469   -11.005 4.696   1.00 0.00 ? 41  TYR A CE2  8  
ATOM   11024 C CZ   . TYR A 1 41  ? -0.240  -11.509 3.651   1.00 0.00 ? 41  TYR A CZ   8  
ATOM   11025 O OH   . TYR A 1 41  ? -0.034  -12.805 3.291   1.00 0.00 ? 41  TYR A OH   8  
ATOM   11026 H H    . TYR A 1 41  ? 1.628   -6.267  4.099   1.00 0.00 ? 41  TYR A H    8  
ATOM   11027 H HA   . TYR A 1 41  ? -0.962  -6.447  2.796   1.00 0.00 ? 41  TYR A HA   8  
ATOM   11028 H HB2  . TYR A 1 41  ? -0.368  -7.210  5.722   1.00 0.00 ? 41  TYR A HB2  8  
ATOM   11029 H HB3  . TYR A 1 41  ? -1.950  -7.253  4.972   1.00 0.00 ? 41  TYR A HB3  8  
ATOM   11030 H HD1  . TYR A 1 41  ? -2.078  -8.795  2.776   1.00 0.00 ? 41  TYR A HD1  8  
ATOM   11031 H HD2  . TYR A 1 41  ? 0.805   -9.205  5.910   1.00 0.00 ? 41  TYR A HD2  8  
ATOM   11032 H HE1  . TYR A 1 41  ? -1.691  -11.219 2.113   1.00 0.00 ? 41  TYR A HE1  8  
ATOM   11033 H HE2  . TYR A 1 41  ? 1.184   -11.626 5.235   1.00 0.00 ? 41  TYR A HE2  8  
ATOM   11034 H HH   . TYR A 1 41  ? 0.326   -13.322 4.068   1.00 0.00 ? 41  TYR A HH   8  
ATOM   11035 N N    . VAL A 1 42  ? -1.786  -4.460  4.218   1.00 0.00 ? 42  VAL A N    8  
ATOM   11036 C CA   . VAL A 1 42  ? -2.074  -3.129  4.722   1.00 0.00 ? 42  VAL A CA   8  
ATOM   11037 C C    . VAL A 1 42  ? -2.730  -3.240  6.099   1.00 0.00 ? 42  VAL A C    8  
ATOM   11038 O O    . VAL A 1 42  ? -3.761  -3.893  6.249   1.00 0.00 ? 42  VAL A O    8  
ATOM   11039 C CB   . VAL A 1 42  ? -2.932  -2.361  3.713   1.00 0.00 ? 42  VAL A CB   8  
ATOM   11040 C CG1  . VAL A 1 42  ? -3.571  -1.132  4.359   1.00 0.00 ? 42  VAL A CG1  8  
ATOM   11041 C CG2  . VAL A 1 42  ? -2.111  -1.971  2.482   1.00 0.00 ? 42  VAL A CG2  8  
ATOM   11042 H H    . VAL A 1 42  ? -2.564  -4.934  3.807   1.00 0.00 ? 42  VAL A H    8  
ATOM   11043 H HA   . VAL A 1 42  ? -1.125  -2.603  4.826   1.00 0.00 ? 42  VAL A HA   8  
ATOM   11044 H HB   . VAL A 1 42  ? -3.734  -3.022  3.385   1.00 0.00 ? 42  VAL A HB   8  
ATOM   11045 H HG11 . VAL A 1 42  ? -2.805  -0.381  4.548   1.00 0.00 ? 42  VAL A HG11 8  
ATOM   11046 H HG12 . VAL A 1 42  ? -4.327  -0.720  3.691   1.00 0.00 ? 42  VAL A HG12 8  
ATOM   11047 H HG13 . VAL A 1 42  ? -4.039  -1.418  5.303   1.00 0.00 ? 42  VAL A HG13 8  
ATOM   11048 H HG21 . VAL A 1 42  ? -1.741  -2.870  1.992   1.00 0.00 ? 42  VAL A HG21 8  
ATOM   11049 H HG22 . VAL A 1 42  ? -2.741  -1.412  1.789   1.00 0.00 ? 42  VAL A HG22 8  
ATOM   11050 H HG23 . VAL A 1 42  ? -1.269  -1.351  2.789   1.00 0.00 ? 42  VAL A HG23 8  
ATOM   11051 N N    . LYS A 1 43  ? -2.103  -2.592  7.072   1.00 0.00 ? 43  LYS A N    8  
ATOM   11052 C CA   . LYS A 1 43  ? -2.611  -2.611  8.432   1.00 0.00 ? 43  LYS A CA   8  
ATOM   11053 C C    . LYS A 1 43  ? -3.844  -1.708  8.524   1.00 0.00 ? 43  LYS A C    8  
ATOM   11054 O O    . LYS A 1 43  ? -4.891  -2.128  9.014   1.00 0.00 ? 43  LYS A O    8  
ATOM   11055 C CB   . LYS A 1 43  ? -1.506  -2.243  9.424   1.00 0.00 ? 43  LYS A CB   8  
ATOM   11056 C CG   . LYS A 1 43  ? -2.062  -2.107  10.842  1.00 0.00 ? 43  LYS A CG   8  
ATOM   11057 C CD   . LYS A 1 43  ? -2.330  -3.481  11.460  1.00 0.00 ? 43  LYS A CD   8  
ATOM   11058 C CE   . LYS A 1 43  ? -2.181  -3.435  12.982  1.00 0.00 ? 43  LYS A CE   8  
ATOM   11059 N NZ   . LYS A 1 43  ? -1.869  -4.782  13.513  1.00 0.00 ? 43  LYS A NZ   8  
ATOM   11060 H H    . LYS A 1 43  ? -1.263  -2.064  6.940   1.00 0.00 ? 43  LYS A H    8  
ATOM   11061 H HA   . LYS A 1 43  ? -2.916  -3.634  8.654   1.00 0.00 ? 43  LYS A HA   8  
ATOM   11062 H HB2  . LYS A 1 43  ? -0.726  -3.007  9.406   1.00 0.00 ? 43  LYS A HB2  8  
ATOM   11063 H HB3  . LYS A 1 43  ? -1.037  -1.306  9.121   1.00 0.00 ? 43  LYS A HB3  8  
ATOM   11064 H HG2  . LYS A 1 43  ? -1.354  -1.557  11.463  1.00 0.00 ? 43  LYS A HG2  8  
ATOM   11065 H HG3  . LYS A 1 43  ? -2.985  -1.527  10.820  1.00 0.00 ? 43  LYS A HG3  8  
ATOM   11066 H HD2  . LYS A 1 43  ? -3.335  -3.811  11.198  1.00 0.00 ? 43  LYS A HD2  8  
ATOM   11067 H HD3  . LYS A 1 43  ? -1.636  -4.211  11.045  1.00 0.00 ? 43  LYS A HD3  8  
ATOM   11068 H HE2  . LYS A 1 43  ? -1.390  -2.738  13.256  1.00 0.00 ? 43  LYS A HE2  8  
ATOM   11069 H HE3  . LYS A 1 43  ? -3.102  -3.065  13.432  1.00 0.00 ? 43  LYS A HE3  8  
ATOM   11070 H HZ1  . LYS A 1 43  ? -2.122  -5.473  12.836  1.00 0.00 ? 43  LYS A HZ1  8  
ATOM   11071 H HZ2  . LYS A 1 43  ? -0.889  -4.846  13.706  1.00 0.00 ? 43  LYS A HZ2  8  
ATOM   11072 H HZ3  . LYS A 1 43  ? -2.387  -4.936  14.355  1.00 0.00 ? 43  LYS A HZ3  8  
ATOM   11073 N N    . SER A 1 44  ? -3.678  -0.485  8.044   1.00 0.00 ? 44  SER A N    8  
ATOM   11074 C CA   . SER A 1 44  ? -4.765  0.481   8.065   1.00 0.00 ? 44  SER A CA   8  
ATOM   11075 C C    . SER A 1 44  ? -4.231  1.875   7.733   1.00 0.00 ? 44  SER A C    8  
ATOM   11076 O O    . SER A 1 44  ? -3.022  2.070   7.611   1.00 0.00 ? 44  SER A O    8  
ATOM   11077 C CB   . SER A 1 44  ? -5.465  0.490   9.424   1.00 0.00 ? 44  SER A CB   8  
ATOM   11078 O OG   . SER A 1 44  ? -5.464  1.788   10.015  1.00 0.00 ? 44  SER A OG   8  
ATOM   11079 H H    . SER A 1 44  ? -2.824  -0.150  7.646   1.00 0.00 ? 44  SER A H    8  
ATOM   11080 H HA   . SER A 1 44  ? -5.464  0.145   7.299   1.00 0.00 ? 44  SER A HA   8  
ATOM   11081 H HB2  . SER A 1 44  ? -6.494  0.148   9.305   1.00 0.00 ? 44  SER A HB2  8  
ATOM   11082 H HB3  . SER A 1 44  ? -4.970  -0.213  10.093  1.00 0.00 ? 44  SER A HB3  8  
ATOM   11083 H HG   . SER A 1 44  ? -5.396  1.710   11.011  1.00 0.00 ? 44  SER A HG   8  
ATOM   11084 N N    . VAL A 1 45  ? -5.158  2.812   7.594   1.00 0.00 ? 45  VAL A N    8  
ATOM   11085 C CA   . VAL A 1 45  ? -4.796  4.183   7.279   1.00 0.00 ? 45  VAL A CA   8  
ATOM   11086 C C    . VAL A 1 45  ? -4.753  5.005   8.566   1.00 0.00 ? 45  VAL A C    8  
ATOM   11087 O O    . VAL A 1 45  ? -5.642  4.892   9.411   1.00 0.00 ? 45  VAL A O    8  
ATOM   11088 C CB   . VAL A 1 45  ? -5.763  4.753   6.238   1.00 0.00 ? 45  VAL A CB   8  
ATOM   11089 C CG1  . VAL A 1 45  ? -5.818  3.862   4.995   1.00 0.00 ? 45  VAL A CG1  8  
ATOM   11090 C CG2  . VAL A 1 45  ? -7.158  4.947   6.835   1.00 0.00 ? 45  VAL A CG2  8  
ATOM   11091 H H    . VAL A 1 45  ? -6.139  2.646   7.695   1.00 0.00 ? 45  VAL A H    8  
ATOM   11092 H HA   . VAL A 1 45  ? -3.799  4.167   6.839   1.00 0.00 ? 45  VAL A HA   8  
ATOM   11093 H HB   . VAL A 1 45  ? -5.390  5.731   5.934   1.00 0.00 ? 45  VAL A HB   8  
ATOM   11094 H HG11 . VAL A 1 45  ? -5.512  2.850   5.259   1.00 0.00 ? 45  VAL A HG11 8  
ATOM   11095 H HG12 . VAL A 1 45  ? -6.836  3.845   4.605   1.00 0.00 ? 45  VAL A HG12 8  
ATOM   11096 H HG13 . VAL A 1 45  ? -5.145  4.259   4.235   1.00 0.00 ? 45  VAL A HG13 8  
ATOM   11097 H HG21 . VAL A 1 45  ? -7.081  5.520   7.759   1.00 0.00 ? 45  VAL A HG21 8  
ATOM   11098 H HG22 . VAL A 1 45  ? -7.784  5.487   6.125   1.00 0.00 ? 45  VAL A HG22 8  
ATOM   11099 H HG23 . VAL A 1 45  ? -7.601  3.975   7.046   1.00 0.00 ? 45  VAL A HG23 8  
ATOM   11100 N N    . VAL A 1 46  ? -3.710  5.814   8.682   1.00 0.00 ? 46  VAL A N    8  
ATOM   11101 C CA   . VAL A 1 46  ? -3.539  6.654   9.855   1.00 0.00 ? 46  VAL A CA   8  
ATOM   11102 C C    . VAL A 1 46  ? -4.899  7.216   10.277  1.00 0.00 ? 46  VAL A C    8  
ATOM   11103 O O    . VAL A 1 46  ? -5.150  7.415   11.464  1.00 0.00 ? 46  VAL A O    8  
ATOM   11104 C CB   . VAL A 1 46  ? -2.503  7.745   9.570   1.00 0.00 ? 46  VAL A CB   8  
ATOM   11105 C CG1  . VAL A 1 46  ? -2.707  8.946   10.494  1.00 0.00 ? 46  VAL A CG1  8  
ATOM   11106 C CG2  . VAL A 1 46  ? -1.081  7.195   9.689   1.00 0.00 ? 46  VAL A CG2  8  
ATOM   11107 H H    . VAL A 1 46  ? -2.991  5.900   7.991   1.00 0.00 ? 46  VAL A H    8  
ATOM   11108 H HA   . VAL A 1 46  ? -3.155  6.024   10.657  1.00 0.00 ? 46  VAL A HA   8  
ATOM   11109 H HB   . VAL A 1 46  ? -2.647  8.083   8.544   1.00 0.00 ? 46  VAL A HB   8  
ATOM   11110 H HG11 . VAL A 1 46  ? -2.051  9.761   10.183  1.00 0.00 ? 46  VAL A HG11 8  
ATOM   11111 H HG12 . VAL A 1 46  ? -3.744  9.275   10.442  1.00 0.00 ? 46  VAL A HG12 8  
ATOM   11112 H HG13 . VAL A 1 46  ? -2.469  8.661   11.519  1.00 0.00 ? 46  VAL A HG13 8  
ATOM   11113 H HG21 . VAL A 1 46  ? -0.372  8.023   9.704   1.00 0.00 ? 46  VAL A HG21 8  
ATOM   11114 H HG22 . VAL A 1 46  ? -0.991  6.621   10.611  1.00 0.00 ? 46  VAL A HG22 8  
ATOM   11115 H HG23 . VAL A 1 46  ? -0.869  6.550   8.837   1.00 0.00 ? 46  VAL A HG23 8  
ATOM   11116 N N    . LYS A 1 47  ? -5.740  7.455   9.281   1.00 0.00 ? 47  LYS A N    8  
ATOM   11117 C CA   . LYS A 1 47  ? -7.067  7.990   9.534   1.00 0.00 ? 47  LYS A CA   8  
ATOM   11118 C C    . LYS A 1 47  ? -6.995  9.517   9.585   1.00 0.00 ? 47  LYS A C    8  
ATOM   11119 O O    . LYS A 1 47  ? -7.986  10.179  9.896   1.00 0.00 ? 47  LYS A O    8  
ATOM   11120 C CB   . LYS A 1 47  ? -7.667  7.359   10.793  1.00 0.00 ? 47  LYS A CB   8  
ATOM   11121 C CG   . LYS A 1 47  ? -9.192  7.476   10.790  1.00 0.00 ? 47  LYS A CG   8  
ATOM   11122 C CD   . LYS A 1 47  ? -9.838  6.215   10.211  1.00 0.00 ? 47  LYS A CD   8  
ATOM   11123 C CE   . LYS A 1 47  ? -11.323 6.444   9.922   1.00 0.00 ? 47  LYS A CE   8  
ATOM   11124 N NZ   . LYS A 1 47  ? -11.829 5.423   8.977   1.00 0.00 ? 47  LYS A NZ   8  
ATOM   11125 H H    . LYS A 1 47  ? -5.526  7.290   8.318   1.00 0.00 ? 47  LYS A H    8  
ATOM   11126 H HA   . LYS A 1 47  ? -7.701  7.701   8.695   1.00 0.00 ? 47  LYS A HA   8  
ATOM   11127 H HB2  . LYS A 1 47  ? -7.380  6.310   10.852  1.00 0.00 ? 47  LYS A HB2  8  
ATOM   11128 H HB3  . LYS A 1 47  ? -7.262  7.849   11.678  1.00 0.00 ? 47  LYS A HB3  8  
ATOM   11129 H HG2  . LYS A 1 47  ? -9.549  7.638   11.807  1.00 0.00 ? 47  LYS A HG2  8  
ATOM   11130 H HG3  . LYS A 1 47  ? -9.493  8.345   10.205  1.00 0.00 ? 47  LYS A HG3  8  
ATOM   11131 H HD2  . LYS A 1 47  ? -9.325  5.928   9.295   1.00 0.00 ? 47  LYS A HD2  8  
ATOM   11132 H HD3  . LYS A 1 47  ? -9.723  5.389   10.913  1.00 0.00 ? 47  LYS A HD3  8  
ATOM   11133 H HE2  . LYS A 1 47  ? -11.891 6.403   10.851  1.00 0.00 ? 47  LYS A HE2  8  
ATOM   11134 H HE3  . LYS A 1 47  ? -11.469 7.440   9.503   1.00 0.00 ? 47  LYS A HE3  8  
ATOM   11135 H HZ1  . LYS A 1 47  ? -12.700 5.728   8.591   1.00 0.00 ? 47  LYS A HZ1  8  
ATOM   11136 H HZ2  . LYS A 1 47  ? -11.166 5.292   8.241   1.00 0.00 ? 47  LYS A HZ2  8  
ATOM   11137 H HZ3  . LYS A 1 47  ? -11.965 4.558   9.463   1.00 0.00 ? 47  LYS A HZ3  8  
ATOM   11138 N N    . GLY A 1 48  ? -5.815  10.033  9.276   1.00 0.00 ? 48  GLY A N    8  
ATOM   11139 C CA   . GLY A 1 48  ? -5.602  11.470  9.283   1.00 0.00 ? 48  GLY A CA   8  
ATOM   11140 C C    . GLY A 1 48  ? -4.538  11.873  8.258   1.00 0.00 ? 48  GLY A C    8  
ATOM   11141 O O    . GLY A 1 48  ? -3.753  12.787  8.501   1.00 0.00 ? 48  GLY A O    8  
ATOM   11142 H H    . GLY A 1 48  ? -5.016  9.488   9.023   1.00 0.00 ? 48  GLY A H    8  
ATOM   11143 H HA2  . GLY A 1 48  ? -6.538  11.981  9.059   1.00 0.00 ? 48  GLY A HA2  8  
ATOM   11144 H HA3  . GLY A 1 48  ? -5.293  11.792  10.277  1.00 0.00 ? 48  GLY A HA3  8  
ATOM   11145 N N    . GLY A 1 49  ? -4.547  11.168  7.137   1.00 0.00 ? 49  GLY A N    8  
ATOM   11146 C CA   . GLY A 1 49  ? -3.593  11.439  6.075   1.00 0.00 ? 49  GLY A CA   8  
ATOM   11147 C C    . GLY A 1 49  ? -4.309  11.836  4.782   1.00 0.00 ? 49  GLY A C    8  
ATOM   11148 O O    . GLY A 1 49  ? -5.537  11.794  4.710   1.00 0.00 ? 49  GLY A O    8  
ATOM   11149 H H    . GLY A 1 49  ? -5.190  10.425  6.947   1.00 0.00 ? 49  GLY A H    8  
ATOM   11150 H HA2  . GLY A 1 49  ? -2.920  12.239  6.382   1.00 0.00 ? 49  GLY A HA2  8  
ATOM   11151 H HA3  . GLY A 1 49  ? -2.980  10.556  5.898   1.00 0.00 ? 49  GLY A HA3  8  
ATOM   11152 N N    . ALA A 1 50  ? -3.512  12.212  3.794   1.00 0.00 ? 50  ALA A N    8  
ATOM   11153 C CA   . ALA A 1 50  ? -4.054  12.616  2.507   1.00 0.00 ? 50  ALA A CA   8  
ATOM   11154 C C    . ALA A 1 50  ? -4.546  11.379  1.754   1.00 0.00 ? 50  ALA A C    8  
ATOM   11155 O O    . ALA A 1 50  ? -5.703  11.318  1.342   1.00 0.00 ? 50  ALA A O    8  
ATOM   11156 C CB   . ALA A 1 50  ? -2.991  13.391  1.725   1.00 0.00 ? 50  ALA A CB   8  
ATOM   11157 H H    . ALA A 1 50  ? -2.514  12.244  3.860   1.00 0.00 ? 50  ALA A H    8  
ATOM   11158 H HA   . ALA A 1 50  ? -4.901  13.276  2.697   1.00 0.00 ? 50  ALA A HA   8  
ATOM   11159 H HB1  . ALA A 1 50  ? -3.193  14.460  1.799   1.00 0.00 ? 50  ALA A HB1  8  
ATOM   11160 H HB2  . ALA A 1 50  ? -2.007  13.177  2.141   1.00 0.00 ? 50  ALA A HB2  8  
ATOM   11161 H HB3  . ALA A 1 50  ? -3.019  13.088  0.679   1.00 0.00 ? 50  ALA A HB3  8  
ATOM   11162 N N    . ALA A 1 51  ? -3.643  10.423  1.599   1.00 0.00 ? 51  ALA A N    8  
ATOM   11163 C CA   . ALA A 1 51  ? -3.969  9.190   0.901   1.00 0.00 ? 51  ALA A CA   8  
ATOM   11164 C C    . ALA A 1 51  ? -4.854  8.322   1.799   1.00 0.00 ? 51  ALA A C    8  
ATOM   11165 O O    . ALA A 1 51  ? -5.422  7.330   1.344   1.00 0.00 ? 51  ALA A O    8  
ATOM   11166 C CB   . ALA A 1 51  ? -2.679  8.478   0.491   1.00 0.00 ? 51  ALA A CB   8  
ATOM   11167 H H    . ALA A 1 51  ? -2.703  10.480  1.937   1.00 0.00 ? 51  ALA A H    8  
ATOM   11168 H HA   . ALA A 1 51  ? -4.526  9.454   0.003   1.00 0.00 ? 51  ALA A HA   8  
ATOM   11169 H HB1  . ALA A 1 51  ? -1.885  9.212   0.360   1.00 0.00 ? 51  ALA A HB1  8  
ATOM   11170 H HB2  . ALA A 1 51  ? -2.394  7.766   1.265   1.00 0.00 ? 51  ALA A HB2  8  
ATOM   11171 H HB3  . ALA A 1 51  ? -2.841  7.948   -0.447  1.00 0.00 ? 51  ALA A HB3  8  
ATOM   11172 N N    . ASP A 1 52  ? -4.944  8.726   3.057   1.00 0.00 ? 52  ASP A N    8  
ATOM   11173 C CA   . ASP A 1 52  ? -5.750  7.999   4.023   1.00 0.00 ? 52  ASP A CA   8  
ATOM   11174 C C    . ASP A 1 52  ? -7.224  8.361   3.826   1.00 0.00 ? 52  ASP A C    8  
ATOM   11175 O O    . ASP A 1 52  ? -8.068  7.478   3.678   1.00 0.00 ? 52  ASP A O    8  
ATOM   11176 C CB   . ASP A 1 52  ? -5.359  8.366   5.455   1.00 0.00 ? 52  ASP A CB   8  
ATOM   11177 C CG   . ASP A 1 52  ? -6.532  8.530   6.424   1.00 0.00 ? 52  ASP A CG   8  
ATOM   11178 O OD1  . ASP A 1 52  ? -7.306  7.557   6.548   1.00 0.00 ? 52  ASP A OD1  8  
ATOM   11179 O OD2  . ASP A 1 52  ? -6.631  9.627   7.016   1.00 0.00 ? 52  ASP A OD2  8  
ATOM   11180 H H    . ASP A 1 52  ? -4.479  9.536   3.419   1.00 0.00 ? 52  ASP A H    8  
ATOM   11181 H HA   . ASP A 1 52  ? -5.549  6.946   3.826   1.00 0.00 ? 52  ASP A HA   8  
ATOM   11182 H HB2  . ASP A 1 52  ? -4.693  7.595   5.843   1.00 0.00 ? 52  ASP A HB2  8  
ATOM   11183 H HB3  . ASP A 1 52  ? -4.792  9.297   5.433   1.00 0.00 ? 52  ASP A HB3  8  
ATOM   11184 N N    . VAL A 1 53  ? -7.488  9.659   3.833   1.00 0.00 ? 53  VAL A N    8  
ATOM   11185 C CA   . VAL A 1 53  ? -8.844  10.148  3.657   1.00 0.00 ? 53  VAL A CA   8  
ATOM   11186 C C    . VAL A 1 53  ? -9.197  10.139  2.168   1.00 0.00 ? 53  VAL A C    8  
ATOM   11187 O O    . VAL A 1 53  ? -10.349 9.921   1.801   1.00 0.00 ? 53  VAL A O    8  
ATOM   11188 C CB   . VAL A 1 53  ? -8.988  11.530  4.297   1.00 0.00 ? 53  VAL A CB   8  
ATOM   11189 C CG1  . VAL A 1 53  ? -10.448 11.989  4.286   1.00 0.00 ? 53  VAL A CG1  8  
ATOM   11190 C CG2  . VAL A 1 53  ? -8.422  11.539  5.719   1.00 0.00 ? 53  VAL A CG2  8  
ATOM   11191 H H    . VAL A 1 53  ? -6.794  10.369  3.954   1.00 0.00 ? 53  VAL A H    8  
ATOM   11192 H HA   . VAL A 1 53  ? -9.511  9.463   4.179   1.00 0.00 ? 53  VAL A HA   8  
ATOM   11193 H HB   . VAL A 1 53  ? -8.410  12.237  3.701   1.00 0.00 ? 53  VAL A HB   8  
ATOM   11194 H HG11 . VAL A 1 53  ? -10.486 13.076  4.223   1.00 0.00 ? 53  VAL A HG11 8  
ATOM   11195 H HG12 . VAL A 1 53  ? -10.959 11.558  3.424   1.00 0.00 ? 53  VAL A HG12 8  
ATOM   11196 H HG13 . VAL A 1 53  ? -10.940 11.661  5.202   1.00 0.00 ? 53  VAL A HG13 8  
ATOM   11197 H HG21 . VAL A 1 53  ? -7.385  11.202  5.696   1.00 0.00 ? 53  VAL A HG21 8  
ATOM   11198 H HG22 . VAL A 1 53  ? -8.468  12.550  6.121   1.00 0.00 ? 53  VAL A HG22 8  
ATOM   11199 H HG23 . VAL A 1 53  ? -9.008  10.868  6.346   1.00 0.00 ? 53  VAL A HG23 8  
ATOM   11200 N N    . ASP A 1 54  ? -8.182  10.379  1.350   1.00 0.00 ? 54  ASP A N    8  
ATOM   11201 C CA   . ASP A 1 54  ? -8.369  10.400  -0.090  1.00 0.00 ? 54  ASP A CA   8  
ATOM   11202 C C    . ASP A 1 54  ? -8.391  8.964   -0.619  1.00 0.00 ? 54  ASP A C    8  
ATOM   11203 O O    . ASP A 1 54  ? -9.344  8.557   -1.280  1.00 0.00 ? 54  ASP A O    8  
ATOM   11204 C CB   . ASP A 1 54  ? -7.227  11.144  -0.783  1.00 0.00 ? 54  ASP A CB   8  
ATOM   11205 C CG   . ASP A 1 54  ? -7.471  11.478  -2.256  1.00 0.00 ? 54  ASP A CG   8  
ATOM   11206 O OD1  . ASP A 1 54  ? -8.428  12.240  -2.514  1.00 0.00 ? 54  ASP A OD1  8  
ATOM   11207 O OD2  . ASP A 1 54  ? -6.697  10.964  -3.091  1.00 0.00 ? 54  ASP A OD2  8  
ATOM   11208 H H    . ASP A 1 54  ? -7.246  10.555  1.658   1.00 0.00 ? 54  ASP A H    8  
ATOM   11209 H HA   . ASP A 1 54  ? -9.316  10.917  -0.247  1.00 0.00 ? 54  ASP A HA   8  
ATOM   11210 H HB2  . ASP A 1 54  ? -7.035  12.071  -0.243  1.00 0.00 ? 54  ASP A HB2  8  
ATOM   11211 H HB3  . ASP A 1 54  ? -6.323  10.539  -0.710  1.00 0.00 ? 54  ASP A HB3  8  
ATOM   11212 N N    . GLY A 1 55  ? -7.328  8.237   -0.308  1.00 0.00 ? 55  GLY A N    8  
ATOM   11213 C CA   . GLY A 1 55  ? -7.213  6.857   -0.745  1.00 0.00 ? 55  GLY A CA   8  
ATOM   11214 C C    . GLY A 1 55  ? -8.329  5.999   -0.148  1.00 0.00 ? 55  GLY A C    8  
ATOM   11215 O O    . GLY A 1 55  ? -9.012  5.273   -0.868  1.00 0.00 ? 55  GLY A O    8  
ATOM   11216 H H    . GLY A 1 55  ? -6.556  8.577   0.230   1.00 0.00 ? 55  GLY A H    8  
ATOM   11217 H HA2  . GLY A 1 55  ? -7.255  6.811   -1.833  1.00 0.00 ? 55  GLY A HA2  8  
ATOM   11218 H HA3  . GLY A 1 55  ? -6.242  6.457   -0.446  1.00 0.00 ? 55  GLY A HA3  8  
ATOM   11219 N N    . ARG A 1 56  ? -8.480  6.108   1.164   1.00 0.00 ? 56  ARG A N    8  
ATOM   11220 C CA   . ARG A 1 56  ? -9.502  5.351   1.866   1.00 0.00 ? 56  ARG A CA   8  
ATOM   11221 C C    . ARG A 1 56  ? -9.345  3.856   1.581   1.00 0.00 ? 56  ARG A C    8  
ATOM   11222 O O    . ARG A 1 56  ? -10.322 3.169   1.293   1.00 0.00 ? 56  ARG A O    8  
ATOM   11223 C CB   . ARG A 1 56  ? -10.904 5.797   1.446   1.00 0.00 ? 56  ARG A CB   8  
ATOM   11224 C CG   . ARG A 1 56  ? -11.216 7.198   1.980   1.00 0.00 ? 56  ARG A CG   8  
ATOM   11225 C CD   . ARG A 1 56  ? -12.067 7.124   3.250   1.00 0.00 ? 56  ARG A CD   8  
ATOM   11226 N NE   . ARG A 1 56  ? -12.867 8.361   3.396   1.00 0.00 ? 56  ARG A NE   8  
ATOM   11227 C CZ   . ARG A 1 56  ? -13.671 8.617   4.436   1.00 0.00 ? 56  ARG A CZ   8  
ATOM   11228 N NH1  . ARG A 1 56  ? -13.785 7.725   5.430   1.00 0.00 ? 56  ARG A NH1  8  
ATOM   11229 N NH2  . ARG A 1 56  ? -14.358 9.765   4.485   1.00 0.00 ? 56  ARG A NH2  8  
ATOM   11230 H H    . ARG A 1 56  ? -7.920  6.701   1.743   1.00 0.00 ? 56  ARG A H    8  
ATOM   11231 H HA   . ARG A 1 56  ? -9.337  5.570   2.921   1.00 0.00 ? 56  ARG A HA   8  
ATOM   11232 H HB2  . ARG A 1 56  ? -10.981 5.792   0.359   1.00 0.00 ? 56  ARG A HB2  8  
ATOM   11233 H HB3  . ARG A 1 56  ? -11.643 5.090   1.822   1.00 0.00 ? 56  ARG A HB3  8  
ATOM   11234 H HG2  . ARG A 1 56  ? -10.286 7.727   2.190   1.00 0.00 ? 56  ARG A HG2  8  
ATOM   11235 H HG3  . ARG A 1 56  ? -11.742 7.772   1.218   1.00 0.00 ? 56  ARG A HG3  8  
ATOM   11236 H HD2  . ARG A 1 56  ? -12.725 6.256   3.206   1.00 0.00 ? 56  ARG A HD2  8  
ATOM   11237 H HD3  . ARG A 1 56  ? -11.423 6.993   4.120   1.00 0.00 ? 56  ARG A HD3  8  
ATOM   11238 H HE   . ARG A 1 56  ? -12.804 9.048   2.671   1.00 0.00 ? 56  ARG A HE   8  
ATOM   11239 H HH11 . ARG A 1 56  ? -13.271 6.869   5.394   1.00 0.00 ? 56  ARG A HH11 8  
ATOM   11240 H HH12 . ARG A 1 56  ? -14.386 7.916   6.206   1.00 0.00 ? 56  ARG A HH12 8  
ATOM   11241 H HH21 . ARG A 1 56  ? -14.273 10.430  3.743   1.00 0.00 ? 56  ARG A HH21 8  
ATOM   11242 H HH22 . ARG A 1 56  ? -14.959 9.958   5.261   1.00 0.00 ? 56  ARG A HH22 8  
ATOM   11243 N N    . LEU A 1 57  ? -8.105  3.396   1.672   1.00 0.00 ? 57  LEU A N    8  
ATOM   11244 C CA   . LEU A 1 57  ? -7.807  1.996   1.429   1.00 0.00 ? 57  LEU A CA   8  
ATOM   11245 C C    . LEU A 1 57  ? -8.403  1.148   2.553   1.00 0.00 ? 57  LEU A C    8  
ATOM   11246 O O    . LEU A 1 57  ? -8.621  1.642   3.659   1.00 0.00 ? 57  LEU A O    8  
ATOM   11247 C CB   . LEU A 1 57  ? -6.302  1.794   1.237   1.00 0.00 ? 57  LEU A CB   8  
ATOM   11248 C CG   . LEU A 1 57  ? -5.702  2.381   -0.041  1.00 0.00 ? 57  LEU A CG   8  
ATOM   11249 C CD1  . LEU A 1 57  ? -4.188  2.554   0.091   1.00 0.00 ? 57  LEU A CD1  8  
ATOM   11250 C CD2  . LEU A 1 57  ? -6.079  1.536   -1.262  1.00 0.00 ? 57  LEU A CD2  8  
ATOM   11251 H H    . LEU A 1 57  ? -7.314  3.962   1.908   1.00 0.00 ? 57  LEU A H    8  
ATOM   11252 H HA   . LEU A 1 57  ? -8.289  1.717   0.493   1.00 0.00 ? 57  LEU A HA   8  
ATOM   11253 H HB2  . LEU A 1 57  ? -5.786  2.233   2.092   1.00 0.00 ? 57  LEU A HB2  8  
ATOM   11254 H HB3  . LEU A 1 57  ? -6.095  0.724   1.255   1.00 0.00 ? 57  LEU A HB3  8  
ATOM   11255 H HG   . LEU A 1 57  ? -6.128  3.373   -0.194  1.00 0.00 ? 57  LEU A HG   8  
ATOM   11256 H HD11 . LEU A 1 57  ? -3.684  1.709   -0.379  1.00 0.00 ? 57  LEU A HD11 8  
ATOM   11257 H HD12 . LEU A 1 57  ? -3.884  3.478   -0.399  1.00 0.00 ? 57  LEU A HD12 8  
ATOM   11258 H HD13 . LEU A 1 57  ? -3.918  2.596   1.146   1.00 0.00 ? 57  LEU A HD13 8  
ATOM   11259 H HD21 . LEU A 1 57  ? -5.561  1.918   -2.141  1.00 0.00 ? 57  LEU A HD21 8  
ATOM   11260 H HD22 . LEU A 1 57  ? -5.787  0.500   -1.089  1.00 0.00 ? 57  LEU A HD22 8  
ATOM   11261 H HD23 . LEU A 1 57  ? -7.156  1.589   -1.422  1.00 0.00 ? 57  LEU A HD23 8  
ATOM   11262 N N    . ALA A 1 58  ? -8.652  -0.114  2.233   1.00 0.00 ? 58  ALA A N    8  
ATOM   11263 C CA   . ALA A 1 58  ? -9.218  -1.034  3.203   1.00 0.00 ? 58  ALA A CA   8  
ATOM   11264 C C    . ALA A 1 58  ? -8.092  -1.650  4.034   1.00 0.00 ? 58  ALA A C    8  
ATOM   11265 O O    . ALA A 1 58  ? -7.009  -1.918  3.517   1.00 0.00 ? 58  ALA A O    8  
ATOM   11266 C CB   . ALA A 1 58  ? -10.053 -2.093  2.476   1.00 0.00 ? 58  ALA A CB   8  
ATOM   11267 H H    . ALA A 1 58  ? -8.471  -0.507  1.331   1.00 0.00 ? 58  ALA A H    8  
ATOM   11268 H HA   . ALA A 1 58  ? -9.873  -0.462  3.860   1.00 0.00 ? 58  ALA A HA   8  
ATOM   11269 H HB1  . ALA A 1 58  ? -9.511  -2.441  1.597   1.00 0.00 ? 58  ALA A HB1  8  
ATOM   11270 H HB2  . ALA A 1 58  ? -10.237 -2.932  3.146   1.00 0.00 ? 58  ALA A HB2  8  
ATOM