data_2EYY
# 
_entry.id   2EYY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EYY         
RCSB  RCSB035265   
WWPDB D_1000035265 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2EYV . unspecified 
PDB 2EYW . unspecified 
PDB 2EYX . unspecified 
PDB 2EYZ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EYY 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kobashigawa, Y.' 1 
'Tanaka, S.'      2 
'Inagaki, F.'     3 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            14 
_citation.page_first                503 
_citation.page_last                 510 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17515907 
_citation.pdbx_database_id_DOI      10.1038/nsmb1241 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kobashigawa, Y.' 1 
primary 'Sakai, M.'       2 
primary 'Naito, M.'       3 
primary 'Yokochi, M.'     4 
primary 'Kumeta, H.'      5 
primary 'Makino, Y.'      6 
primary 'Ogura, K.'       7 
primary 'Tanaka, S.'      8 
primary 'Inagaki, F.'     9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'v-crk sarcoma virus CT10 oncogene homolog isoform a' 
_entity.formula_weight             22889.389 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'isoform I' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CT10-Regulated Kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLY n 
1 4   ASN n 
1 5   PHE n 
1 6   ASP n 
1 7   SER n 
1 8   GLU n 
1 9   GLU n 
1 10  ARG n 
1 11  SER n 
1 12  SER n 
1 13  TRP n 
1 14  TYR n 
1 15  TRP n 
1 16  GLY n 
1 17  ARG n 
1 18  LEU n 
1 19  SER n 
1 20  ARG n 
1 21  GLN n 
1 22  GLU n 
1 23  ALA n 
1 24  VAL n 
1 25  ALA n 
1 26  LEU n 
1 27  LEU n 
1 28  GLN n 
1 29  GLY n 
1 30  GLN n 
1 31  ARG n 
1 32  HIS n 
1 33  GLY n 
1 34  VAL n 
1 35  PHE n 
1 36  LEU n 
1 37  VAL n 
1 38  ARG n 
1 39  ASP n 
1 40  SER n 
1 41  SER n 
1 42  THR n 
1 43  SER n 
1 44  PRO n 
1 45  GLY n 
1 46  ASP n 
1 47  TYR n 
1 48  VAL n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  SER n 
1 53  GLU n 
1 54  ASN n 
1 55  SER n 
1 56  ARG n 
1 57  VAL n 
1 58  SER n 
1 59  HIS n 
1 60  TYR n 
1 61  ILE n 
1 62  ILE n 
1 63  ASN n 
1 64  SER n 
1 65  SER n 
1 66  GLY n 
1 67  PRO n 
1 68  ARG n 
1 69  PRO n 
1 70  PRO n 
1 71  VAL n 
1 72  PRO n 
1 73  PRO n 
1 74  SER n 
1 75  PRO n 
1 76  ALA n 
1 77  GLN n 
1 78  PRO n 
1 79  PRO n 
1 80  PRO n 
1 81  GLY n 
1 82  VAL n 
1 83  SER n 
1 84  PRO n 
1 85  SER n 
1 86  ARG n 
1 87  LEU n 
1 88  ARG n 
1 89  ILE n 
1 90  GLY n 
1 91  ASP n 
1 92  GLN n 
1 93  GLU n 
1 94  PHE n 
1 95  ASP n 
1 96  SER n 
1 97  LEU n 
1 98  PRO n 
1 99  ALA n 
1 100 LEU n 
1 101 LEU n 
1 102 GLU n 
1 103 PHE n 
1 104 TYR n 
1 105 LYS n 
1 106 ILE n 
1 107 HIS n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 THR n 
1 112 THR n 
1 113 THR n 
1 114 LEU n 
1 115 ILE n 
1 116 GLU n 
1 117 PRO n 
1 118 VAL n 
1 119 SER n 
1 120 ARG n 
1 121 SER n 
1 122 ARG n 
1 123 GLN n 
1 124 GLY n 
1 125 SER n 
1 126 GLY n 
1 127 VAL n 
1 128 ILE n 
1 129 LEU n 
1 130 ARG n 
1 131 GLN n 
1 132 GLU n 
1 133 GLU n 
1 134 ALA n 
1 135 GLU n 
1 136 TYR n 
1 137 VAL n 
1 138 ARG n 
1 139 ALA n 
1 140 LEU n 
1 141 PHE n 
1 142 ASP n 
1 143 PHE n 
1 144 ASN n 
1 145 GLY n 
1 146 ASN n 
1 147 ASP n 
1 148 GLU n 
1 149 GLU n 
1 150 ASP n 
1 151 LEU n 
1 152 PRO n 
1 153 PHE n 
1 154 LYS n 
1 155 LYS n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 LEU n 
1 160 ARG n 
1 161 ILE n 
1 162 ARG n 
1 163 ASP n 
1 164 LYS n 
1 165 PRO n 
1 166 GLU n 
1 167 GLU n 
1 168 GLN n 
1 169 TRP n 
1 170 TRP n 
1 171 ASN n 
1 172 ALA n 
1 173 GLU n 
1 174 ASP n 
1 175 SER n 
1 176 GLU n 
1 177 GLY n 
1 178 LYS n 
1 179 ARG n 
1 180 GLY n 
1 181 MET n 
1 182 ILE n 
1 183 PRO n 
1 184 VAL n 
1 185 PRO n 
1 186 TYR n 
1 187 VAL n 
1 188 GLU n 
1 189 LYS n 
1 190 TYR n 
1 191 ARG n 
1 192 PRO n 
1 193 ALA n 
1 194 SER n 
1 195 ALA n 
1 196 SER n 
1 197 VAL n 
1 198 SER n 
1 199 ALA n 
1 200 LEU n 
1 201 ILE n 
1 202 GLY n 
1 203 GLY n 
1 204 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pPRO EX-htb' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CRK_HUMAN 
_struct_ref.pdbx_db_accession          P46108 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EYY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 204 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P46108 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  204 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       204 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-SEPARATED_NOESY    1 
2 1 '3D_ 13C-SEPARATED_NOESY' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      250mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.0mM isoform I U-15N, 13C PHOSPHATE BUFFER NA; 200MM NACL;90%H2O, 10%D2O' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2EYY 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2EYY 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2EYY 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CYANA   2.0 'Guetntert P.' 1 
refinement           CNS     1.1 ?              2 
'structure solution' XEASY   ?   ?              3 
'structure solution' OLIVIA  ?   ?              4 
'structure solution' NMRPIPE ?   ?              5 
'structure solution' CYANA   2.0 'Guetntert P.' 6 
# 
_exptl.entry_id          2EYY 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EYY 
_struct.title                     'CT10-Regulated Kinase isoform I' 
_struct.pdbx_descriptor           'v-crk sarcoma virus CT10 oncogene homolog isoform a' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EYY 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SH2, SH3, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 19  ? GLN A 28  ? SER A 19  GLN A 28  1 ? 10 
HELX_P HELX_P2 2 SER A 96  ? TYR A 104 ? SER A 96  TYR A 104 1 ? 9  
HELX_P HELX_P3 3 SER A 125 ? LEU A 129 ? SER A 125 LEU A 129 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 37  ? ASP A 39  ? VAL A 37  ASP A 39  
A 2 TYR A 47  ? VAL A 51  ? TYR A 47  VAL A 51  
A 3 SER A 58  ? ASN A 63  ? SER A 58  ASN A 63  
A 4 ARG A 88  ? ILE A 89  ? ARG A 88  ILE A 89  
B 1 GLU A 135 ? ARG A 138 ? GLU A 135 ARG A 138 
B 2 ILE A 158 ? GLU A 166 ? ILE A 158 GLU A 166 
B 3 TRP A 169 ? GLU A 173 ? TRP A 169 GLU A 173 
B 4 ARG A 179 ? ILE A 182 ? ARG A 179 ILE A 182 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 38  ? N ARG A 38  O VAL A 48  ? O VAL A 48  
A 2 3 N LEU A 49  ? N LEU A 49  O TYR A 60  ? O TYR A 60  
A 3 4 N ASN A 63  ? N ASN A 63  O ARG A 88  ? O ARG A 88  
B 1 2 N VAL A 137 ? N VAL A 137 O LEU A 159 ? O LEU A 159 
B 2 3 N ASP A 163 ? N ASP A 163 O ASN A 171 ? O ASN A 171 
B 3 4 N ALA A 172 ? N ALA A 172 O GLY A 180 ? O GLY A 180 
# 
_database_PDB_matrix.entry_id          2EYY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EYY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . MET A 1 1   ? -2.008  -2.272  -3.621  1.00 0.00 ? 1   MET A N    1 
ATOM 2    C CA   . MET A 1 1   ? -0.960  -1.774  -2.692  1.00 0.00 ? 1   MET A CA   1 
ATOM 3    C C    . MET A 1 1   ? -1.259  -0.350  -2.234  1.00 0.00 ? 1   MET A C    1 
ATOM 4    O O    . MET A 1 1   ? -2.088  0.341   -2.825  1.00 0.00 ? 1   MET A O    1 
ATOM 5    C CB   . MET A 1 1   ? 0.390   -1.822  -3.409  1.00 0.00 ? 1   MET A CB   1 
ATOM 6    C CG   . MET A 1 1   ? 1.107   -3.156  -3.268  1.00 0.00 ? 1   MET A CG   1 
ATOM 7    S SD   . MET A 1 1   ? 1.806   -3.739  -4.824  1.00 0.00 ? 1   MET A SD   1 
ATOM 8    C CE   . MET A 1 1   ? 2.994   -2.444  -5.168  1.00 0.00 ? 1   MET A CE   1 
ATOM 9    H H1   . MET A 1 1   ? -2.850  -2.499  -3.056  1.00 0.00 ? 1   MET A H1   1 
ATOM 10   H H2   . MET A 1 1   ? -1.633  -3.119  -4.095  1.00 0.00 ? 1   MET A H2   1 
ATOM 11   H H3   . MET A 1 1   ? -2.210  -1.516  -4.305  1.00 0.00 ? 1   MET A H3   1 
ATOM 12   H HA   . MET A 1 1   ? -0.929  -2.422  -1.829  1.00 0.00 ? 1   MET A HA   1 
ATOM 13   H HB2  . MET A 1 1   ? 0.233   -1.630  -4.459  1.00 0.00 ? 1   MET A HB2  1 
ATOM 14   H HB3  . MET A 1 1   ? 1.027   -1.051  -3.001  1.00 0.00 ? 1   MET A HB3  1 
ATOM 15   H HG2  . MET A 1 1   ? 1.907   -3.046  -2.551  1.00 0.00 ? 1   MET A HG2  1 
ATOM 16   H HG3  . MET A 1 1   ? 0.402   -3.891  -2.908  1.00 0.00 ? 1   MET A HG3  1 
ATOM 17   H HE1  . MET A 1 1   ? 3.099   -2.325  -6.237  1.00 0.00 ? 1   MET A HE1  1 
ATOM 18   H HE2  . MET A 1 1   ? 3.950   -2.708  -4.741  1.00 0.00 ? 1   MET A HE2  1 
ATOM 19   H HE3  . MET A 1 1   ? 2.650   -1.516  -4.735  1.00 0.00 ? 1   MET A HE3  1 
ATOM 20   N N    . ALA A 1 2   ? -0.577  0.082   -1.179  1.00 0.00 ? 2   ALA A N    1 
ATOM 21   C CA   . ALA A 1 2   ? -0.770  1.423   -0.642  1.00 0.00 ? 2   ALA A CA   1 
ATOM 22   C C    . ALA A 1 2   ? 0.548   2.184   -0.575  1.00 0.00 ? 2   ALA A C    1 
ATOM 23   O O    . ALA A 1 2   ? 0.602   3.380   -0.863  1.00 0.00 ? 2   ALA A O    1 
ATOM 24   C CB   . ALA A 1 2   ? -1.415  1.355   0.734   1.00 0.00 ? 2   ALA A CB   1 
ATOM 25   H H    . ALA A 1 2   ? 0.070   -0.517  -0.751  1.00 0.00 ? 2   ALA A H    1 
ATOM 26   H HA   . ALA A 1 2   ? -1.438  1.951   -1.301  1.00 0.00 ? 2   ALA A HA   1 
ATOM 27   H HB1  . ALA A 1 2   ? -2.140  2.149   0.831   1.00 0.00 ? 2   ALA A HB1  1 
ATOM 28   H HB2  . ALA A 1 2   ? -0.656  1.466   1.493   1.00 0.00 ? 2   ALA A HB2  1 
ATOM 29   H HB3  . ALA A 1 2   ? -1.907  0.402   0.854   1.00 0.00 ? 2   ALA A HB3  1 
ATOM 30   N N    . GLY A 1 3   ? 1.608   1.485   -0.192  1.00 0.00 ? 3   GLY A N    1 
ATOM 31   C CA   . GLY A 1 3   ? 2.911   2.112   -0.094  1.00 0.00 ? 3   GLY A CA   1 
ATOM 32   C C    . GLY A 1 3   ? 3.704   1.619   1.099   1.00 0.00 ? 3   GLY A C    1 
ATOM 33   O O    . GLY A 1 3   ? 3.470   0.517   1.595   1.00 0.00 ? 3   GLY A O    1 
ATOM 34   H H    . GLY A 1 3   ? 1.505   0.536   0.025   1.00 0.00 ? 3   GLY A H    1 
ATOM 35   H HA2  . GLY A 1 3   ? 3.467   1.902   -0.996  1.00 0.00 ? 3   GLY A HA2  1 
ATOM 36   H HA3  . GLY A 1 3   ? 2.776   3.181   -0.007  1.00 0.00 ? 3   GLY A HA3  1 
ATOM 37   N N    . ASN A 1 4   ? 4.644   2.435   1.563   1.00 0.00 ? 4   ASN A N    1 
ATOM 38   C CA   . ASN A 1 4   ? 5.473   2.074   2.706   1.00 0.00 ? 4   ASN A CA   1 
ATOM 39   C C    . ASN A 1 4   ? 4.854   2.577   4.006   1.00 0.00 ? 4   ASN A C    1 
ATOM 40   O O    . ASN A 1 4   ? 4.660   3.779   4.188   1.00 0.00 ? 4   ASN A O    1 
ATOM 41   C CB   . ASN A 1 4   ? 6.882   2.645   2.545   1.00 0.00 ? 4   ASN A CB   1 
ATOM 42   C CG   . ASN A 1 4   ? 7.861   2.057   3.541   1.00 0.00 ? 4   ASN A CG   1 
ATOM 43   O OD1  . ASN A 1 4   ? 8.387   2.762   4.402   1.00 0.00 ? 4   ASN A OD1  1 
ATOM 44   N ND2  . ASN A 1 4   ? 8.111   0.758   3.427   1.00 0.00 ? 4   ASN A ND2  1 
ATOM 45   H H    . ASN A 1 4   ? 4.783   3.301   1.126   1.00 0.00 ? 4   ASN A H    1 
ATOM 46   H HA   . ASN A 1 4   ? 5.533   0.996   2.744   1.00 0.00 ? 4   ASN A HA   1 
ATOM 47   H HB2  . ASN A 1 4   ? 7.238   2.430   1.548   1.00 0.00 ? 4   ASN A HB2  1 
ATOM 48   H HB3  . ASN A 1 4   ? 6.849   3.715   2.687   1.00 0.00 ? 4   ASN A HB3  1 
ATOM 49   H HD21 . ASN A 1 4   ? 7.657   0.260   2.716   1.00 0.00 ? 4   ASN A HD21 1 
ATOM 50   H HD22 . ASN A 1 4   ? 8.741   0.351   4.058   1.00 0.00 ? 4   ASN A HD22 1 
ATOM 51   N N    . PHE A 1 5   ? 4.546   1.649   4.905   1.00 0.00 ? 5   PHE A N    1 
ATOM 52   C CA   . PHE A 1 5   ? 3.950   1.998   6.189   1.00 0.00 ? 5   PHE A CA   1 
ATOM 53   C C    . PHE A 1 5   ? 4.669   1.295   7.333   1.00 0.00 ? 5   PHE A C    1 
ATOM 54   O O    . PHE A 1 5   ? 5.144   1.938   8.269   1.00 0.00 ? 5   PHE A O    1 
ATOM 55   C CB   . PHE A 1 5   ? 2.466   1.627   6.204   1.00 0.00 ? 5   PHE A CB   1 
ATOM 56   C CG   . PHE A 1 5   ? 1.628   2.465   5.282   1.00 0.00 ? 5   PHE A CG   1 
ATOM 57   C CD1  . PHE A 1 5   ? 1.596   2.200   3.924   1.00 0.00 ? 5   PHE A CD1  1 
ATOM 58   C CD2  . PHE A 1 5   ? 0.872   3.517   5.775   1.00 0.00 ? 5   PHE A CD2  1 
ATOM 59   C CE1  . PHE A 1 5   ? 0.826   2.969   3.071   1.00 0.00 ? 5   PHE A CE1  1 
ATOM 60   C CE2  . PHE A 1 5   ? 0.101   4.289   4.928   1.00 0.00 ? 5   PHE A CE2  1 
ATOM 61   C CZ   . PHE A 1 5   ? 0.078   4.016   3.575   1.00 0.00 ? 5   PHE A CZ   1 
ATOM 62   H H    . PHE A 1 5   ? 4.725   0.707   4.702   1.00 0.00 ? 5   PHE A H    1 
ATOM 63   H HA   . PHE A 1 5   ? 4.046   3.065   6.320   1.00 0.00 ? 5   PHE A HA   1 
ATOM 64   H HB2  . PHE A 1 5   ? 2.356   0.595   5.906   1.00 0.00 ? 5   PHE A HB2  1 
ATOM 65   H HB3  . PHE A 1 5   ? 2.082   1.749   7.207   1.00 0.00 ? 5   PHE A HB3  1 
ATOM 66   H HD1  . PHE A 1 5   ? 2.181   1.382   3.530   1.00 0.00 ? 5   PHE A HD1  1 
ATOM 67   H HD2  . PHE A 1 5   ? 0.891   3.732   6.833   1.00 0.00 ? 5   PHE A HD2  1 
ATOM 68   H HE1  . PHE A 1 5   ? 0.810   2.753   2.014   1.00 0.00 ? 5   PHE A HE1  1 
ATOM 69   H HE2  . PHE A 1 5   ? -0.483  5.107   5.326   1.00 0.00 ? 5   PHE A HE2  1 
ATOM 70   H HZ   . PHE A 1 5   ? -0.525  4.618   2.912   1.00 0.00 ? 5   PHE A HZ   1 
ATOM 71   N N    . ASP A 1 6   ? 4.745   -0.030  7.253   1.00 0.00 ? 6   ASP A N    1 
ATOM 72   C CA   . ASP A 1 6   ? 5.406   -0.818  8.285   1.00 0.00 ? 6   ASP A CA   1 
ATOM 73   C C    . ASP A 1 6   ? 6.690   -1.447  7.753   1.00 0.00 ? 6   ASP A C    1 
ATOM 74   O O    . ASP A 1 6   ? 6.657   -2.287  6.855   1.00 0.00 ? 6   ASP A O    1 
ATOM 75   C CB   . ASP A 1 6   ? 4.462   -1.907  8.800   1.00 0.00 ? 6   ASP A CB   1 
ATOM 76   C CG   . ASP A 1 6   ? 3.330   -1.344  9.635   1.00 0.00 ? 6   ASP A CG   1 
ATOM 77   O OD1  . ASP A 1 6   ? 2.329   -0.883  9.046   1.00 0.00 ? 6   ASP A OD1  1 
ATOM 78   O OD2  . ASP A 1 6   ? 3.444   -1.361  10.879  1.00 0.00 ? 6   ASP A OD2  1 
ATOM 79   H H    . ASP A 1 6   ? 4.345   -0.489  6.482   1.00 0.00 ? 6   ASP A H    1 
ATOM 80   H HA   . ASP A 1 6   ? 5.654   -0.156  9.100   1.00 0.00 ? 6   ASP A HA   1 
ATOM 81   H HB2  . ASP A 1 6   ? 4.036   -2.432  7.958   1.00 0.00 ? 6   ASP A HB2  1 
ATOM 82   H HB3  . ASP A 1 6   ? 5.022   -2.602  9.407   1.00 0.00 ? 6   ASP A HB3  1 
ATOM 83   N N    . SER A 1 7   ? 7.824   -1.037  8.317   1.00 0.00 ? 7   SER A N    1 
ATOM 84   C CA   . SER A 1 7   ? 9.123   -1.562  7.903   1.00 0.00 ? 7   SER A CA   1 
ATOM 85   C C    . SER A 1 7   ? 9.128   -3.087  7.929   1.00 0.00 ? 7   SER A C    1 
ATOM 86   O O    . SER A 1 7   ? 9.880   -3.730  7.196   1.00 0.00 ? 7   SER A O    1 
ATOM 87   C CB   . SER A 1 7   ? 10.227  -1.022  8.812   1.00 0.00 ? 7   SER A CB   1 
ATOM 88   O OG   . SER A 1 7   ? 10.193  0.394   8.874   1.00 0.00 ? 7   SER A OG   1 
ATOM 89   H H    . SER A 1 7   ? 7.787   -0.365  9.031   1.00 0.00 ? 7   SER A H    1 
ATOM 90   H HA   . SER A 1 7   ? 9.307   -1.230  6.891   1.00 0.00 ? 7   SER A HA   1 
ATOM 91   H HB2  . SER A 1 7   ? 10.095  -1.416  9.809   1.00 0.00 ? 7   SER A HB2  1 
ATOM 92   H HB3  . SER A 1 7   ? 11.189  -1.329  8.428   1.00 0.00 ? 7   SER A HB3  1 
ATOM 93   H HG   . SER A 1 7   ? 9.554   0.669   9.536   1.00 0.00 ? 7   SER A HG   1 
ATOM 94   N N    . GLU A 1 8   ? 8.280   -3.659  8.778   1.00 0.00 ? 8   GLU A N    1 
ATOM 95   C CA   . GLU A 1 8   ? 8.178   -5.110  8.901   1.00 0.00 ? 8   GLU A CA   1 
ATOM 96   C C    . GLU A 1 8   ? 6.909   -5.628  8.231   1.00 0.00 ? 8   GLU A C    1 
ATOM 97   O O    . GLU A 1 8   ? 6.808   -6.810  7.902   1.00 0.00 ? 8   GLU A O    1 
ATOM 98   C CB   . GLU A 1 8   ? 8.196   -5.528  10.376  1.00 0.00 ? 8   GLU A CB   1 
ATOM 99   C CG   . GLU A 1 8   ? 7.485   -4.553  11.299  1.00 0.00 ? 8   GLU A CG   1 
ATOM 100  C CD   . GLU A 1 8   ? 8.429   -3.534  11.908  1.00 0.00 ? 8   GLU A CD   1 
ATOM 101  O OE1  . GLU A 1 8   ? 9.280   -3.930  12.732  1.00 0.00 ? 8   GLU A OE1  1 
ATOM 102  O OE2  . GLU A 1 8   ? 8.319   -2.339  11.560  1.00 0.00 ? 8   GLU A OE2  1 
ATOM 103  H H    . GLU A 1 8   ? 7.706   -3.092  9.332   1.00 0.00 ? 8   GLU A H    1 
ATOM 104  H HA   . GLU A 1 8   ? 9.032   -5.543  8.407   1.00 0.00 ? 8   GLU A HA   1 
ATOM 105  H HB2  . GLU A 1 8   ? 7.716   -6.490  10.470  1.00 0.00 ? 8   GLU A HB2  1 
ATOM 106  H HB3  . GLU A 1 8   ? 9.221   -5.615  10.704  1.00 0.00 ? 8   GLU A HB3  1 
ATOM 107  H HG2  . GLU A 1 8   ? 6.732   -4.028  10.732  1.00 0.00 ? 8   GLU A HG2  1 
ATOM 108  H HG3  . GLU A 1 8   ? 7.015   -5.108  12.095  1.00 0.00 ? 8   GLU A HG3  1 
ATOM 109  N N    . GLU A 1 9   ? 5.938   -4.737  8.037   1.00 0.00 ? 9   GLU A N    1 
ATOM 110  C CA   . GLU A 1 9   ? 4.671   -5.103  7.413   1.00 0.00 ? 9   GLU A CA   1 
ATOM 111  C C    . GLU A 1 9   ? 3.991   -6.228  8.184   1.00 0.00 ? 9   GLU A C    1 
ATOM 112  O O    . GLU A 1 9   ? 4.421   -7.380  8.132   1.00 0.00 ? 9   GLU A O    1 
ATOM 113  C CB   . GLU A 1 9   ? 4.884   -5.514  5.958   1.00 0.00 ? 9   GLU A CB   1 
ATOM 114  C CG   . GLU A 1 9   ? 3.781   -5.030  5.033   1.00 0.00 ? 9   GLU A CG   1 
ATOM 115  C CD   . GLU A 1 9   ? 4.273   -4.027  4.007   1.00 0.00 ? 9   GLU A CD   1 
ATOM 116  O OE1  . GLU A 1 9   ? 4.719   -2.934  4.412   1.00 0.00 ? 9   GLU A OE1  1 
ATOM 117  O OE2  . GLU A 1 9   ? 4.214   -4.337  2.798   1.00 0.00 ? 9   GLU A OE2  1 
ATOM 118  H H    . GLU A 1 9   ? 6.076   -3.812  8.324   1.00 0.00 ? 9   GLU A H    1 
ATOM 119  H HA   . GLU A 1 9   ? 4.030   -4.234  7.439   1.00 0.00 ? 9   GLU A HA   1 
ATOM 120  H HB2  . GLU A 1 9   ? 5.823   -5.105  5.613   1.00 0.00 ? 9   GLU A HB2  1 
ATOM 121  H HB3  . GLU A 1 9   ? 4.927   -6.592  5.902   1.00 0.00 ? 9   GLU A HB3  1 
ATOM 122  H HG2  . GLU A 1 9   ? 3.365   -5.877  4.513   1.00 0.00 ? 9   GLU A HG2  1 
ATOM 123  H HG3  . GLU A 1 9   ? 3.010   -4.564  5.629   1.00 0.00 ? 9   GLU A HG3  1 
ATOM 124  N N    . ARG A 1 10  ? 2.936   -5.881  8.910   1.00 0.00 ? 10  ARG A N    1 
ATOM 125  C CA   . ARG A 1 10  ? 2.206   -6.858  9.707   1.00 0.00 ? 10  ARG A CA   1 
ATOM 126  C C    . ARG A 1 10  ? 1.364   -7.786  8.836   1.00 0.00 ? 10  ARG A C    1 
ATOM 127  O O    . ARG A 1 10  ? 1.384   -9.004  9.008   1.00 0.00 ? 10  ARG A O    1 
ATOM 128  C CB   . ARG A 1 10  ? 1.308   -6.163  10.730  1.00 0.00 ? 10  ARG A CB   1 
ATOM 129  C CG   . ARG A 1 10  ? 0.545   -4.965  10.179  1.00 0.00 ? 10  ARG A CG   1 
ATOM 130  C CD   . ARG A 1 10  ? 0.929   -3.677  10.892  1.00 0.00 ? 10  ARG A CD   1 
ATOM 131  N NE   . ARG A 1 10  ? -0.138  -3.200  11.770  1.00 0.00 ? 10  ARG A NE   1 
ATOM 132  C CZ   . ARG A 1 10  ? -0.230  -1.948  12.213  1.00 0.00 ? 10  ARG A CZ   1 
ATOM 133  N NH1  . ARG A 1 10  ? 0.679   -1.045  11.867  1.00 0.00 ? 10  ARG A NH1  1 
ATOM 134  N NH2  . ARG A 1 10  ? -1.234  -1.598  13.006  1.00 0.00 ? 10  ARG A NH2  1 
ATOM 135  H H    . ARG A 1 10  ? 2.649   -4.944  8.918   1.00 0.00 ? 10  ARG A H    1 
ATOM 136  H HA   . ARG A 1 10  ? 2.935   -7.450  10.232  1.00 0.00 ? 10  ARG A HA   1 
ATOM 137  H HB2  . ARG A 1 10  ? 0.588   -6.879  11.095  1.00 0.00 ? 10  ARG A HB2  1 
ATOM 138  H HB3  . ARG A 1 10  ? 1.916   -5.829  11.555  1.00 0.00 ? 10  ARG A HB3  1 
ATOM 139  H HG2  . ARG A 1 10  ? 0.766   -4.860  9.129   1.00 0.00 ? 10  ARG A HG2  1 
ATOM 140  H HG3  . ARG A 1 10  ? -0.514  -5.135  10.309  1.00 0.00 ? 10  ARG A HG3  1 
ATOM 141  H HD2  . ARG A 1 10  ? 1.814   -3.856  11.484  1.00 0.00 ? 10  ARG A HD2  1 
ATOM 142  H HD3  . ARG A 1 10  ? 1.139   -2.920  10.152  1.00 0.00 ? 10  ARG A HD3  1 
ATOM 143  H HE   . ARG A 1 10  ? -0.822  -3.846  12.042  1.00 0.00 ? 10  ARG A HE   1 
ATOM 144  H HH11 . ARG A 1 10  ? 1.438   -1.302  11.269  1.00 0.00 ? 10  ARG A HH11 1 
ATOM 145  H HH12 . ARG A 1 10  ? 0.604   -0.106  12.202  1.00 0.00 ? 10  ARG A HH12 1 
ATOM 146  H HH21 . ARG A 1 10  ? -1.921  -2.275  13.270  1.00 0.00 ? 10  ARG A HH21 1 
ATOM 147  H HH22 . ARG A 1 10  ? -1.304  -0.658  13.339  1.00 0.00 ? 10  ARG A HH22 1 
ATOM 148  N N    . SER A 1 11  ? 0.621   -7.200  7.909   1.00 0.00 ? 11  SER A N    1 
ATOM 149  C CA   . SER A 1 11  ? -0.241  -7.963  7.014   1.00 0.00 ? 11  SER A CA   1 
ATOM 150  C C    . SER A 1 11  ? 0.560   -8.841  6.052   1.00 0.00 ? 11  SER A C    1 
ATOM 151  O O    . SER A 1 11  ? -0.020  -9.556  5.235   1.00 0.00 ? 11  SER A O    1 
ATOM 152  C CB   . SER A 1 11  ? -1.141  -7.017  6.217   1.00 0.00 ? 11  SER A CB   1 
ATOM 153  O OG   . SER A 1 11  ? -2.286  -7.694  5.729   1.00 0.00 ? 11  SER A OG   1 
ATOM 154  H H    . SER A 1 11  ? 0.645   -6.225  7.828   1.00 0.00 ? 11  SER A H    1 
ATOM 155  H HA   . SER A 1 11  ? -0.864  -8.601  7.623   1.00 0.00 ? 11  SER A HA   1 
ATOM 156  H HB2  . SER A 1 11  ? -1.462  -6.207  6.856   1.00 0.00 ? 11  SER A HB2  1 
ATOM 157  H HB3  . SER A 1 11  ? -0.589  -6.619  5.380   1.00 0.00 ? 11  SER A HB3  1 
ATOM 158  H HG   . SER A 1 11  ? -2.657  -8.240  6.426   1.00 0.00 ? 11  SER A HG   1 
ATOM 159  N N    . SER A 1 12  ? 1.889   -8.783  6.131   1.00 0.00 ? 12  SER A N    1 
ATOM 160  C CA   . SER A 1 12  ? 2.726   -9.575  5.240   1.00 0.00 ? 12  SER A CA   1 
ATOM 161  C C    . SER A 1 12  ? 3.242   -10.858 5.899   1.00 0.00 ? 12  SER A C    1 
ATOM 162  O O    . SER A 1 12  ? 2.947   -11.959 5.435   1.00 0.00 ? 12  SER A O    1 
ATOM 163  C CB   . SER A 1 12  ? 3.911   -8.738  4.757   1.00 0.00 ? 12  SER A CB   1 
ATOM 164  O OG   . SER A 1 12  ? 4.202   -9.002  3.396   1.00 0.00 ? 12  SER A OG   1 
ATOM 165  H H    . SER A 1 12  ? 2.311   -8.197  6.791   1.00 0.00 ? 12  SER A H    1 
ATOM 166  H HA   . SER A 1 12  ? 2.127   -9.842  4.384   1.00 0.00 ? 12  SER A HA   1 
ATOM 167  H HB2  . SER A 1 12  ? 3.676   -7.692  4.865   1.00 0.00 ? 12  SER A HB2  1 
ATOM 168  H HB3  . SER A 1 12  ? 4.781   -8.975  5.351   1.00 0.00 ? 12  SER A HB3  1 
ATOM 169  H HG   . SER A 1 12  ? 5.153   -9.038  3.273   1.00 0.00 ? 12  SER A HG   1 
ATOM 170  N N    . TRP A 1 13  ? 4.044   -10.714 6.951   1.00 0.00 ? 13  TRP A N    1 
ATOM 171  C CA   . TRP A 1 13  ? 4.632   -11.881 7.617   1.00 0.00 ? 13  TRP A CA   1 
ATOM 172  C C    . TRP A 1 13  ? 4.332   -11.931 9.121   1.00 0.00 ? 13  TRP A C    1 
ATOM 173  O O    . TRP A 1 13  ? 4.183   -13.010 9.694   1.00 0.00 ? 13  TRP A O    1 
ATOM 174  C CB   . TRP A 1 13  ? 6.148   -11.891 7.379   1.00 0.00 ? 13  TRP A CB   1 
ATOM 175  C CG   . TRP A 1 13  ? 6.907   -11.067 8.367   1.00 0.00 ? 13  TRP A CG   1 
ATOM 176  C CD1  . TRP A 1 13  ? 6.726   -9.743  8.645   1.00 0.00 ? 13  TRP A CD1  1 
ATOM 177  C CD2  . TRP A 1 13  ? 7.962   -11.513 9.218   1.00 0.00 ? 13  TRP A CD2  1 
ATOM 178  N NE1  . TRP A 1 13  ? 7.601   -9.347  9.625   1.00 0.00 ? 13  TRP A NE1  1 
ATOM 179  C CE2  . TRP A 1 13  ? 8.365   -10.413 9.993   1.00 0.00 ? 13  TRP A CE2  1 
ATOM 180  C CE3  . TRP A 1 13  ? 8.604   -12.737 9.404   1.00 0.00 ? 13  TRP A CE3  1 
ATOM 181  C CZ2  . TRP A 1 13  ? 9.374   -10.501 10.937  1.00 0.00 ? 13  TRP A CZ2  1 
ATOM 182  C CZ3  . TRP A 1 13  ? 9.610   -12.818 10.347  1.00 0.00 ? 13  TRP A CZ3  1 
ATOM 183  C CH2  . TRP A 1 13  ? 9.980   -11.711 11.099  1.00 0.00 ? 13  TRP A CH2  1 
ATOM 184  H H    . TRP A 1 13  ? 4.272   -9.806  7.250   1.00 0.00 ? 13  TRP A H    1 
ATOM 185  H HA   . TRP A 1 13  ? 4.210   -12.761 7.158   1.00 0.00 ? 13  TRP A HA   1 
ATOM 186  H HB2  . TRP A 1 13  ? 6.510   -12.907 7.445   1.00 0.00 ? 13  TRP A HB2  1 
ATOM 187  H HB3  . TRP A 1 13  ? 6.354   -11.505 6.391   1.00 0.00 ? 13  TRP A HB3  1 
ATOM 188  H HD1  . TRP A 1 13  ? 5.996   -9.113  8.159   1.00 0.00 ? 13  TRP A HD1  1 
ATOM 189  H HE1  . TRP A 1 13  ? 7.669   -8.449  10.002  1.00 0.00 ? 13  TRP A HE1  1 
ATOM 190  H HE3  . TRP A 1 13  ? 8.329   -13.608 8.828   1.00 0.00 ? 13  TRP A HE3  1 
ATOM 191  H HZ2  . TRP A 1 13  ? 9.675   -9.651  11.532  1.00 0.00 ? 13  TRP A HZ2  1 
ATOM 192  H HZ3  . TRP A 1 13  ? 10.126  -13.753 10.515  1.00 0.00 ? 13  TRP A HZ3  1 
ATOM 193  H HH2  . TRP A 1 13  ? 10.761  -11.829 11.818  1.00 0.00 ? 13  TRP A HH2  1 
ATOM 194  N N    . TYR A 1 14  ? 4.245   -10.767 9.751   1.00 0.00 ? 14  TYR A N    1 
ATOM 195  C CA   . TYR A 1 14  ? 3.961   -10.702 11.183  1.00 0.00 ? 14  TYR A CA   1 
ATOM 196  C C    . TYR A 1 14  ? 2.553   -10.164 11.430  1.00 0.00 ? 14  TYR A C    1 
ATOM 197  O O    . TYR A 1 14  ? 2.295   -8.973  11.303  1.00 0.00 ? 14  TYR A O    1 
ATOM 198  C CB   . TYR A 1 14  ? 5.029   -9.872  11.917  1.00 0.00 ? 14  TYR A CB   1 
ATOM 199  C CG   . TYR A 1 14  ? 4.776   -8.379  11.950  1.00 0.00 ? 14  TYR A CG   1 
ATOM 200  C CD1  . TYR A 1 14  ? 5.262   -7.549  10.948  1.00 0.00 ? 14  TYR A CD1  1 
ATOM 201  C CD2  . TYR A 1 14  ? 4.057   -7.802  12.990  1.00 0.00 ? 14  TYR A CD2  1 
ATOM 202  C CE1  . TYR A 1 14  ? 5.038   -6.186  10.981  1.00 0.00 ? 14  TYR A CE1  1 
ATOM 203  C CE2  . TYR A 1 14  ? 3.827   -6.440  13.028  1.00 0.00 ? 14  TYR A CE2  1 
ATOM 204  C CZ   . TYR A 1 14  ? 4.319   -5.637  12.022  1.00 0.00 ? 14  TYR A CZ   1 
ATOM 205  O OH   . TYR A 1 14  ? 4.094   -4.280  12.057  1.00 0.00 ? 14  TYR A OH   1 
ATOM 206  H H    . TYR A 1 14  ? 4.363   -9.949  9.229   1.00 0.00 ? 14  TYR A H    1 
ATOM 207  H HA   . TYR A 1 14  ? 3.999   -11.715 11.560  1.00 0.00 ? 14  TYR A HA   1 
ATOM 208  H HB2  . TYR A 1 14  ? 5.092   -10.211 12.939  1.00 0.00 ? 14  TYR A HB2  1 
ATOM 209  H HB3  . TYR A 1 14  ? 5.984   -10.033 11.436  1.00 0.00 ? 14  TYR A HB3  1 
ATOM 210  H HD1  . TYR A 1 14  ? 5.825   -7.983  10.133  1.00 0.00 ? 14  TYR A HD1  1 
ATOM 211  H HD2  . TYR A 1 14  ? 3.673   -8.433  13.776  1.00 0.00 ? 14  TYR A HD2  1 
ATOM 212  H HE1  . TYR A 1 14  ? 5.422   -5.557  10.194  1.00 0.00 ? 14  TYR A HE1  1 
ATOM 213  H HE2  . TYR A 1 14  ? 3.265   -6.011  13.844  1.00 0.00 ? 14  TYR A HE2  1 
ATOM 214  H HH   . TYR A 1 14  ? 4.901   -3.815  11.826  1.00 0.00 ? 14  TYR A HH   1 
ATOM 215  N N    . TRP A 1 15  ? 1.636   -11.061 11.767  1.00 0.00 ? 15  TRP A N    1 
ATOM 216  C CA   . TRP A 1 15  ? 0.250   -10.674 12.008  1.00 0.00 ? 15  TRP A CA   1 
ATOM 217  C C    . TRP A 1 15  ? -0.003  -10.331 13.470  1.00 0.00 ? 15  TRP A C    1 
ATOM 218  O O    . TRP A 1 15  ? -0.197  -9.166  13.819  1.00 0.00 ? 15  TRP A O    1 
ATOM 219  C CB   . TRP A 1 15  ? -0.697  -11.794 11.583  1.00 0.00 ? 15  TRP A CB   1 
ATOM 220  C CG   . TRP A 1 15  ? -0.368  -12.384 10.250  1.00 0.00 ? 15  TRP A CG   1 
ATOM 221  C CD1  . TRP A 1 15  ? 0.728   -13.134 9.916   1.00 0.00 ? 15  TRP A CD1  1 
ATOM 222  C CD2  . TRP A 1 15  ? -1.152  -12.268 9.064   1.00 0.00 ? 15  TRP A CD2  1 
ATOM 223  N NE1  . TRP A 1 15  ? 0.661   -13.494 8.596   1.00 0.00 ? 15  TRP A NE1  1 
ATOM 224  C CE2  . TRP A 1 15  ? -0.483  -12.974 8.052   1.00 0.00 ? 15  TRP A CE2  1 
ATOM 225  C CE3  . TRP A 1 15  ? -2.361  -11.635 8.761   1.00 0.00 ? 15  TRP A CE3  1 
ATOM 226  C CZ2  . TRP A 1 15  ? -0.979  -13.067 6.762   1.00 0.00 ? 15  TRP A CZ2  1 
ATOM 227  C CZ3  . TRP A 1 15  ? -2.853  -11.727 7.474   1.00 0.00 ? 15  TRP A CZ3  1 
ATOM 228  C CH2  . TRP A 1 15  ? -2.164  -12.439 6.489   1.00 0.00 ? 15  TRP A CH2  1 
ATOM 229  H H    . TRP A 1 15  ? 1.894   -12.004 11.848  1.00 0.00 ? 15  TRP A H    1 
ATOM 230  H HA   . TRP A 1 15  ? 0.044   -9.802  11.408  1.00 0.00 ? 15  TRP A HA   1 
ATOM 231  H HB2  . TRP A 1 15  ? -0.664  -12.586 12.315  1.00 0.00 ? 15  TRP A HB2  1 
ATOM 232  H HB3  . TRP A 1 15  ? -1.702  -11.402 11.535  1.00 0.00 ? 15  TRP A HB3  1 
ATOM 233  H HD1  . TRP A 1 15  ? 1.523   -13.401 10.598  1.00 0.00 ? 15  TRP A HD1  1 
ATOM 234  H HE1  . TRP A 1 15  ? 1.325   -14.035 8.120   1.00 0.00 ? 15  TRP A HE1  1 
ATOM 235  H HE3  . TRP A 1 15  ? -2.906  -11.081 9.511   1.00 0.00 ? 15  TRP A HE3  1 
ATOM 236  H HZ2  . TRP A 1 15  ? -0.461  -13.619 5.995   1.00 0.00 ? 15  TRP A HZ2  1 
ATOM 237  H HZ3  . TRP A 1 15  ? -3.785  -11.244 7.219   1.00 0.00 ? 15  TRP A HZ3  1 
ATOM 238  H HH2  . TRP A 1 15  ? -2.583  -12.485 5.495   1.00 0.00 ? 15  TRP A HH2  1 
ATOM 239  N N    . GLY A 1 16  ? -0.019  -11.352 14.316  1.00 0.00 ? 16  GLY A N    1 
ATOM 240  C CA   . GLY A 1 16  ? -0.271  -11.137 15.726  1.00 0.00 ? 16  GLY A CA   1 
ATOM 241  C C    . GLY A 1 16  ? -0.116  -12.400 16.542  1.00 0.00 ? 16  GLY A C    1 
ATOM 242  O O    . GLY A 1 16  ? -0.942  -12.695 17.406  1.00 0.00 ? 16  GLY A O    1 
ATOM 243  H H    . GLY A 1 16  ? 0.135   -12.261 13.980  1.00 0.00 ? 16  GLY A H    1 
ATOM 244  H HA2  . GLY A 1 16  ? 0.422   -10.395 16.095  1.00 0.00 ? 16  GLY A HA2  1 
ATOM 245  H HA3  . GLY A 1 16  ? -1.275  -10.765 15.846  1.00 0.00 ? 16  GLY A HA3  1 
ATOM 246  N N    . ARG A 1 17  ? 0.968   -13.122 16.286  1.00 0.00 ? 17  ARG A N    1 
ATOM 247  C CA   . ARG A 1 17  ? 1.295   -14.353 17.003  1.00 0.00 ? 17  ARG A CA   1 
ATOM 248  C C    . ARG A 1 17  ? 0.112   -15.310 17.173  1.00 0.00 ? 17  ARG A C    1 
ATOM 249  O O    . ARG A 1 17  ? -1.049  -14.957 16.967  1.00 0.00 ? 17  ARG A O    1 
ATOM 250  C CB   . ARG A 1 17  ? 1.890   -14.030 18.378  1.00 0.00 ? 17  ARG A CB   1 
ATOM 251  C CG   . ARG A 1 17  ? 1.401   -12.723 18.987  1.00 0.00 ? 17  ARG A CG   1 
ATOM 252  C CD   . ARG A 1 17  ? 2.139   -12.395 20.275  1.00 0.00 ? 17  ARG A CD   1 
ATOM 253  N NE   . ARG A 1 17  ? 1.643   -11.168 20.892  1.00 0.00 ? 17  ARG A NE   1 
ATOM 254  C CZ   . ARG A 1 17  ? 1.872   -9.949  20.404  1.00 0.00 ? 17  ARG A CZ   1 
ATOM 255  N NH1  . ARG A 1 17  ? 2.586   -9.794  19.297  1.00 0.00 ? 17  ARG A NH1  1 
ATOM 256  N NH2  . ARG A 1 17  ? 1.384   -8.885  21.026  1.00 0.00 ? 17  ARG A NH2  1 
ATOM 257  H H    . ARG A 1 17  ? 1.599   -12.802 15.609  1.00 0.00 ? 17  ARG A H    1 
ATOM 258  H HA   . ARG A 1 17  ? 2.052   -14.861 16.426  1.00 0.00 ? 17  ARG A HA   1 
ATOM 259  H HB2  . ARG A 1 17  ? 1.638   -14.829 19.059  1.00 0.00 ? 17  ARG A HB2  1 
ATOM 260  H HB3  . ARG A 1 17  ? 2.962   -13.977 18.284  1.00 0.00 ? 17  ARG A HB3  1 
ATOM 261  H HG2  . ARG A 1 17  ? 1.565   -11.924 18.279  1.00 0.00 ? 17  ARG A HG2  1 
ATOM 262  H HG3  . ARG A 1 17  ? 0.345   -12.808 19.199  1.00 0.00 ? 17  ARG A HG3  1 
ATOM 263  H HD2  . ARG A 1 17  ? 2.008   -13.213 20.968  1.00 0.00 ? 17  ARG A HD2  1 
ATOM 264  H HD3  . ARG A 1 17  ? 3.188   -12.276 20.054  1.00 0.00 ? 17  ARG A HD3  1 
ATOM 265  H HE   . ARG A 1 17  ? 1.113   -11.255 21.712  1.00 0.00 ? 17  ARG A HE   1 
ATOM 266  H HH11 . ARG A 1 17  ? 2.955   -10.592 18.822  1.00 0.00 ? 17  ARG A HH11 1 
ATOM 267  H HH12 . ARG A 1 17  ? 2.754   -8.877  18.936  1.00 0.00 ? 17  ARG A HH12 1 
ATOM 268  H HH21 . ARG A 1 17  ? 0.846   -8.997  21.861  1.00 0.00 ? 17  ARG A HH21 1 
ATOM 269  H HH22 . ARG A 1 17  ? 1.557   -7.970  20.661  1.00 0.00 ? 17  ARG A HH22 1 
ATOM 270  N N    . LEU A 1 18  ? 0.455   -16.530 17.579  1.00 0.00 ? 18  LEU A N    1 
ATOM 271  C CA   . LEU A 1 18  ? -0.500  -17.601 17.836  1.00 0.00 ? 18  LEU A CA   1 
ATOM 272  C C    . LEU A 1 18  ? 0.258   -18.904 18.095  1.00 0.00 ? 18  LEU A C    1 
ATOM 273  O O    . LEU A 1 18  ? 1.425   -18.872 18.487  1.00 0.00 ? 18  LEU A O    1 
ATOM 274  C CB   . LEU A 1 18  ? -1.535  -17.752 16.703  1.00 0.00 ? 18  LEU A CB   1 
ATOM 275  C CG   . LEU A 1 18  ? -1.029  -17.971 15.277  1.00 0.00 ? 18  LEU A CG   1 
ATOM 276  C CD1  . LEU A 1 18  ? -0.879  -16.648 14.566  1.00 0.00 ? 18  LEU A CD1  1 
ATOM 277  C CD2  . LEU A 1 18  ? 0.262   -18.774 15.238  1.00 0.00 ? 18  LEU A CD2  1 
ATOM 278  H H    . LEU A 1 18  ? 1.401   -16.714 17.733  1.00 0.00 ? 18  LEU A H    1 
ATOM 279  H HA   . LEU A 1 18  ? -1.025  -17.338 18.743  1.00 0.00 ? 18  LEU A HA   1 
ATOM 280  H HB2  . LEU A 1 18  ? -2.172  -18.580 16.945  1.00 0.00 ? 18  LEU A HB2  1 
ATOM 281  H HB3  . LEU A 1 18  ? -2.133  -16.858 16.698  1.00 0.00 ? 18  LEU A HB3  1 
ATOM 282  H HG   . LEU A 1 18  ? -1.775  -18.529 14.738  1.00 0.00 ? 18  LEU A HG   1 
ATOM 283  H HD11 . LEU A 1 18  ? -0.816  -16.824 13.503  1.00 0.00 ? 18  LEU A HD11 1 
ATOM 284  H HD12 . LEU A 1 18  ? 0.016   -16.155 14.907  1.00 0.00 ? 18  LEU A HD12 1 
ATOM 285  H HD13 . LEU A 1 18  ? -1.736  -16.029 14.778  1.00 0.00 ? 18  LEU A HD13 1 
ATOM 286  H HD21 . LEU A 1 18  ? 0.616   -18.833 14.219  1.00 0.00 ? 18  LEU A HD21 1 
ATOM 287  H HD22 . LEU A 1 18  ? 0.071   -19.773 15.607  1.00 0.00 ? 18  LEU A HD22 1 
ATOM 288  H HD23 . LEU A 1 18  ? 1.008   -18.295 15.853  1.00 0.00 ? 18  LEU A HD23 1 
ATOM 289  N N    . SER A 1 19  ? -0.385  -20.046 17.884  1.00 0.00 ? 19  SER A N    1 
ATOM 290  C CA   . SER A 1 19  ? 0.273   -21.327 18.111  1.00 0.00 ? 19  SER A CA   1 
ATOM 291  C C    . SER A 1 19  ? 0.733   -21.941 16.795  1.00 0.00 ? 19  SER A C    1 
ATOM 292  O O    . SER A 1 19  ? -0.026  -21.985 15.834  1.00 0.00 ? 19  SER A O    1 
ATOM 293  C CB   . SER A 1 19  ? -0.669  -22.291 18.834  1.00 0.00 ? 19  SER A CB   1 
ATOM 294  O OG   . SER A 1 19  ? -0.603  -22.112 20.238  1.00 0.00 ? 19  SER A OG   1 
ATOM 295  H H    . SER A 1 19  ? -1.312  -20.031 17.570  1.00 0.00 ? 19  SER A H    1 
ATOM 296  H HA   . SER A 1 19  ? 1.138   -21.150 18.733  1.00 0.00 ? 19  SER A HA   1 
ATOM 297  H HB2  . SER A 1 19  ? -1.683  -22.113 18.507  1.00 0.00 ? 19  SER A HB2  1 
ATOM 298  H HB3  . SER A 1 19  ? -0.386  -23.307 18.599  1.00 0.00 ? 19  SER A HB3  1 
ATOM 299  H HG   . SER A 1 19  ? 0.081   -22.679 20.602  1.00 0.00 ? 19  SER A HG   1 
ATOM 300  N N    . ARG A 1 20  ? 1.995   -22.372 16.750  1.00 0.00 ? 20  ARG A N    1 
ATOM 301  C CA   . ARG A 1 20  ? 2.590   -22.954 15.544  1.00 0.00 ? 20  ARG A CA   1 
ATOM 302  C C    . ARG A 1 20  ? 1.568   -23.696 14.687  1.00 0.00 ? 20  ARG A C    1 
ATOM 303  O O    . ARG A 1 20  ? 1.630   -23.651 13.458  1.00 0.00 ? 20  ARG A O    1 
ATOM 304  C CB   . ARG A 1 20  ? 3.713   -23.913 15.937  1.00 0.00 ? 20  ARG A CB   1 
ATOM 305  C CG   . ARG A 1 20  ? 3.222   -25.148 16.677  1.00 0.00 ? 20  ARG A CG   1 
ATOM 306  C CD   . ARG A 1 20  ? 3.388   -26.402 15.837  1.00 0.00 ? 20  ARG A CD   1 
ATOM 307  N NE   . ARG A 1 20  ? 4.727   -26.506 15.261  1.00 0.00 ? 20  ARG A NE   1 
ATOM 308  C CZ   . ARG A 1 20  ? 5.791   -26.943 15.930  1.00 0.00 ? 20  ARG A CZ   1 
ATOM 309  N NH1  . ARG A 1 20  ? 5.682   -27.314 17.199  1.00 0.00 ? 20  ARG A NH1  1 
ATOM 310  N NH2  . ARG A 1 20  ? 6.971   -27.008 15.327  1.00 0.00 ? 20  ARG A NH2  1 
ATOM 311  H H    . ARG A 1 20  ? 2.567   -22.252 17.535  1.00 0.00 ? 20  ARG A H    1 
ATOM 312  H HA   . ARG A 1 20  ? 3.010   -22.148 14.962  1.00 0.00 ? 20  ARG A HA   1 
ATOM 313  H HB2  . ARG A 1 20  ? 4.224   -24.235 15.042  1.00 0.00 ? 20  ARG A HB2  1 
ATOM 314  H HB3  . ARG A 1 20  ? 4.412   -23.392 16.574  1.00 0.00 ? 20  ARG A HB3  1 
ATOM 315  H HG2  . ARG A 1 20  ? 3.786   -25.260 17.589  1.00 0.00 ? 20  ARG A HG2  1 
ATOM 316  H HG3  . ARG A 1 20  ? 2.174   -25.022 16.911  1.00 0.00 ? 20  ARG A HG3  1 
ATOM 317  H HD2  . ARG A 1 20  ? 3.206   -27.262 16.462  1.00 0.00 ? 20  ARG A HD2  1 
ATOM 318  H HD3  . ARG A 1 20  ? 2.663   -26.377 15.039  1.00 0.00 ? 20  ARG A HD3  1 
ATOM 319  H HE   . ARG A 1 20  ? 4.838   -26.238 14.325  1.00 0.00 ? 20  ARG A HE   1 
ATOM 320  H HH11 . ARG A 1 20  ? 4.796   -27.267 17.660  1.00 0.00 ? 20  ARG A HH11 1 
ATOM 321  H HH12 . ARG A 1 20  ? 6.486   -27.641 17.695  1.00 0.00 ? 20  ARG A HH12 1 
ATOM 322  H HH21 . ARG A 1 20  ? 7.059   -26.729 14.370  1.00 0.00 ? 20  ARG A HH21 1 
ATOM 323  H HH22 . ARG A 1 20  ? 7.771   -27.336 15.829  1.00 0.00 ? 20  ARG A HH22 1 
ATOM 324  N N    . GLN A 1 21  ? 0.628   -24.375 15.333  1.00 0.00 ? 21  GLN A N    1 
ATOM 325  C CA   . GLN A 1 21  ? -0.395  -25.114 14.613  1.00 0.00 ? 21  GLN A CA   1 
ATOM 326  C C    . GLN A 1 21  ? -1.231  -24.160 13.769  1.00 0.00 ? 21  GLN A C    1 
ATOM 327  O O    . GLN A 1 21  ? -1.557  -24.447 12.619  1.00 0.00 ? 21  GLN A O    1 
ATOM 328  C CB   . GLN A 1 21  ? -1.283  -25.888 15.593  1.00 0.00 ? 21  GLN A CB   1 
ATOM 329  C CG   . GLN A 1 21  ? -2.494  -25.106 16.076  1.00 0.00 ? 21  GLN A CG   1 
ATOM 330  C CD   . GLN A 1 21  ? -3.246  -25.815 17.184  1.00 0.00 ? 21  GLN A CD   1 
ATOM 331  O OE1  . GLN A 1 21  ? -2.800  -25.848 18.331  1.00 0.00 ? 21  GLN A OE1  1 
ATOM 332  N NE2  . GLN A 1 21  ? -4.395  -26.387 16.846  1.00 0.00 ? 21  GLN A NE2  1 
ATOM 333  H H    . GLN A 1 21  ? 0.620   -24.378 16.309  1.00 0.00 ? 21  GLN A H    1 
ATOM 334  H HA   . GLN A 1 21  ? 0.105   -25.813 13.961  1.00 0.00 ? 21  GLN A HA   1 
ATOM 335  H HB2  . GLN A 1 21  ? -1.633  -26.788 15.109  1.00 0.00 ? 21  GLN A HB2  1 
ATOM 336  H HB3  . GLN A 1 21  ? -0.692  -26.162 16.455  1.00 0.00 ? 21  GLN A HB3  1 
ATOM 337  H HG2  . GLN A 1 21  ? -2.166  -24.145 16.438  1.00 0.00 ? 21  GLN A HG2  1 
ATOM 338  H HG3  . GLN A 1 21  ? -3.162  -24.963 15.242  1.00 0.00 ? 21  GLN A HG3  1 
ATOM 339  H HE21 . GLN A 1 21  ? -4.688  -26.320 15.912  1.00 0.00 ? 21  GLN A HE21 1 
ATOM 340  H HE22 . GLN A 1 21  ? -4.904  -26.853 17.541  1.00 0.00 ? 21  GLN A HE22 1 
ATOM 341  N N    . GLU A 1 22  ? -1.554  -23.012 14.354  1.00 0.00 ? 22  GLU A N    1 
ATOM 342  C CA   . GLU A 1 22  ? -2.329  -21.991 13.677  1.00 0.00 ? 22  GLU A CA   1 
ATOM 343  C C    . GLU A 1 22  ? -1.574  -21.490 12.459  1.00 0.00 ? 22  GLU A C    1 
ATOM 344  O O    . GLU A 1 22  ? -2.049  -21.608 11.330  1.00 0.00 ? 22  GLU A O    1 
ATOM 345  C CB   . GLU A 1 22  ? -2.624  -20.843 14.636  1.00 0.00 ? 22  GLU A CB   1 
ATOM 346  C CG   . GLU A 1 22  ? -3.737  -19.928 14.158  1.00 0.00 ? 22  GLU A CG   1 
ATOM 347  C CD   . GLU A 1 22  ? -4.870  -19.811 15.160  1.00 0.00 ? 22  GLU A CD   1 
ATOM 348  O OE1  . GLU A 1 22  ? -4.624  -19.318 16.280  1.00 0.00 ? 22  GLU A OE1  1 
ATOM 349  O OE2  . GLU A 1 22  ? -6.003  -20.216 14.823  1.00 0.00 ? 22  GLU A OE2  1 
ATOM 350  H H    . GLU A 1 22  ? -1.247  -22.839 15.265  1.00 0.00 ? 22  GLU A H    1 
ATOM 351  H HA   . GLU A 1 22  ? -3.253  -22.428 13.358  1.00 0.00 ? 22  GLU A HA   1 
ATOM 352  H HB2  . GLU A 1 22  ? -2.909  -21.254 15.593  1.00 0.00 ? 22  GLU A HB2  1 
ATOM 353  H HB3  . GLU A 1 22  ? -1.728  -20.258 14.758  1.00 0.00 ? 22  GLU A HB3  1 
ATOM 354  H HG2  . GLU A 1 22  ? -3.328  -18.946 13.985  1.00 0.00 ? 22  GLU A HG2  1 
ATOM 355  H HG3  . GLU A 1 22  ? -4.132  -20.320 13.233  1.00 0.00 ? 22  GLU A HG3  1 
ATOM 356  N N    . ALA A 1 23  ? -0.378  -20.963 12.693  1.00 0.00 ? 23  ALA A N    1 
ATOM 357  C CA   . ALA A 1 23  ? 0.464   -20.479 11.609  1.00 0.00 ? 23  ALA A CA   1 
ATOM 358  C C    . ALA A 1 23  ? 0.593   -21.562 10.549  1.00 0.00 ? 23  ALA A C    1 
ATOM 359  O O    . ALA A 1 23  ? 0.377   -21.330 9.366   1.00 0.00 ? 23  ALA A O    1 
ATOM 360  C CB   . ALA A 1 23  ? 1.830   -20.101 12.142  1.00 0.00 ? 23  ALA A CB   1 
ATOM 361  H H    . ALA A 1 23  ? -0.044  -20.924 13.613  1.00 0.00 ? 23  ALA A H    1 
ATOM 362  H HA   . ALA A 1 23  ? 0.005   -19.599 11.180  1.00 0.00 ? 23  ALA A HA   1 
ATOM 363  H HB1  . ALA A 1 23  ? 1.882   -19.030 12.259  1.00 0.00 ? 23  ALA A HB1  1 
ATOM 364  H HB2  . ALA A 1 23  ? 2.593   -20.429 11.443  1.00 0.00 ? 23  ALA A HB2  1 
ATOM 365  H HB3  . ALA A 1 23  ? 1.984   -20.579 13.099  1.00 0.00 ? 23  ALA A HB3  1 
ATOM 366  N N    . VAL A 1 24  ? 0.937   -22.756 11.009  1.00 0.00 ? 24  VAL A N    1 
ATOM 367  C CA   . VAL A 1 24  ? 1.086   -23.907 10.136  1.00 0.00 ? 24  VAL A CA   1 
ATOM 368  C C    . VAL A 1 24  ? -0.190  -24.136 9.352   1.00 0.00 ? 24  VAL A C    1 
ATOM 369  O O    . VAL A 1 24  ? -0.178  -24.330 8.136   1.00 0.00 ? 24  VAL A O    1 
ATOM 370  C CB   . VAL A 1 24  ? 1.376   -25.178 10.947  1.00 0.00 ? 24  VAL A CB   1 
ATOM 371  C CG1  . VAL A 1 24  ? 1.117   -26.421 10.106  1.00 0.00 ? 24  VAL A CG1  1 
ATOM 372  C CG2  . VAL A 1 24  ? 2.793   -25.149 11.485  1.00 0.00 ? 24  VAL A CG2  1 
ATOM 373  H H    . VAL A 1 24  ? 1.087   -22.856 11.972  1.00 0.00 ? 24  VAL A H    1 
ATOM 374  H HA   . VAL A 1 24  ? 1.904   -23.728 9.458   1.00 0.00 ? 24  VAL A HA   1 
ATOM 375  H HB   . VAL A 1 24  ? 0.698   -25.201 11.789  1.00 0.00 ? 24  VAL A HB   1 
ATOM 376  H HG11 . VAL A 1 24  ? 1.609   -27.271 10.551  1.00 0.00 ? 24  VAL A HG11 1 
ATOM 377  H HG12 . VAL A 1 24  ? 1.497   -26.263 9.105   1.00 0.00 ? 24  VAL A HG12 1 
ATOM 378  H HG13 . VAL A 1 24  ? 0.049   -26.600 10.060  1.00 0.00 ? 24  VAL A HG13 1 
ATOM 379  H HG21 . VAL A 1 24  ? 2.788   -25.429 12.527  1.00 0.00 ? 24  VAL A HG21 1 
ATOM 380  H HG22 . VAL A 1 24  ? 3.188   -24.149 11.382  1.00 0.00 ? 24  VAL A HG22 1 
ATOM 381  H HG23 . VAL A 1 24  ? 3.407   -25.839 10.927  1.00 0.00 ? 24  VAL A HG23 1 
ATOM 382  N N    . ALA A 1 25  ? -1.287  -24.115 10.082  1.00 0.00 ? 25  ALA A N    1 
ATOM 383  C CA   . ALA A 1 25  ? -2.602  -24.323 9.514   1.00 0.00 ? 25  ALA A CA   1 
ATOM 384  C C    . ALA A 1 25  ? -2.810  -23.447 8.285   1.00 0.00 ? 25  ALA A C    1 
ATOM 385  O O    . ALA A 1 25  ? -3.268  -23.921 7.245   1.00 0.00 ? 25  ALA A O    1 
ATOM 386  C CB   . ALA A 1 25  ? -3.653  -24.044 10.569  1.00 0.00 ? 25  ALA A CB   1 
ATOM 387  H H    . ALA A 1 25  ? -1.204  -23.953 11.045  1.00 0.00 ? 25  ALA A H    1 
ATOM 388  H HA   . ALA A 1 25  ? -2.678  -25.362 9.226   1.00 0.00 ? 25  ALA A HA   1 
ATOM 389  H HB1  . ALA A 1 25  ? -3.398  -24.581 11.473  1.00 0.00 ? 25  ALA A HB1  1 
ATOM 390  H HB2  . ALA A 1 25  ? -4.617  -24.369 10.214  1.00 0.00 ? 25  ALA A HB2  1 
ATOM 391  H HB3  . ALA A 1 25  ? -3.678  -22.985 10.777  1.00 0.00 ? 25  ALA A HB3  1 
ATOM 392  N N    . LEU A 1 26  ? -2.456  -22.170 8.401   1.00 0.00 ? 26  LEU A N    1 
ATOM 393  C CA   . LEU A 1 26  ? -2.595  -21.256 7.282   1.00 0.00 ? 26  LEU A CA   1 
ATOM 394  C C    . LEU A 1 26  ? -1.408  -21.410 6.333   1.00 0.00 ? 26  LEU A C    1 
ATOM 395  O O    . LEU A 1 26  ? -1.588  -21.479 5.118   1.00 0.00 ? 26  LEU A O    1 
ATOM 396  C CB   . LEU A 1 26  ? -2.751  -19.803 7.764   1.00 0.00 ? 26  LEU A CB   1 
ATOM 397  C CG   . LEU A 1 26  ? -1.534  -19.190 8.461   1.00 0.00 ? 26  LEU A CG   1 
ATOM 398  C CD1  . LEU A 1 26  ? -1.006  -18.001 7.673   1.00 0.00 ? 26  LEU A CD1  1 
ATOM 399  C CD2  . LEU A 1 26  ? -1.875  -18.772 9.885   1.00 0.00 ? 26  LEU A CD2  1 
ATOM 400  H H    . LEU A 1 26  ? -2.085  -21.851 9.251   1.00 0.00 ? 26  LEU A H    1 
ATOM 401  H HA   . LEU A 1 26  ? -3.491  -21.541 6.748   1.00 0.00 ? 26  LEU A HA   1 
ATOM 402  H HB2  . LEU A 1 26  ? -2.994  -19.192 6.908   1.00 0.00 ? 26  LEU A HB2  1 
ATOM 403  H HB3  . LEU A 1 26  ? -3.585  -19.770 8.451   1.00 0.00 ? 26  LEU A HB3  1 
ATOM 404  H HG   . LEU A 1 26  ? -0.753  -19.925 8.511   1.00 0.00 ? 26  LEU A HG   1 
ATOM 405  H HD11 . LEU A 1 26  ? -1.389  -17.085 8.098   1.00 0.00 ? 26  LEU A HD11 1 
ATOM 406  H HD12 . LEU A 1 26  ? -1.328  -18.079 6.644   1.00 0.00 ? 26  LEU A HD12 1 
ATOM 407  H HD13 . LEU A 1 26  ? 0.070   -17.994 7.713   1.00 0.00 ? 26  LEU A HD13 1 
ATOM 408  H HD21 . LEU A 1 26  ? -1.817  -19.631 10.537  1.00 0.00 ? 26  LEU A HD21 1 
ATOM 409  H HD22 . LEU A 1 26  ? -2.876  -18.366 9.913   1.00 0.00 ? 26  LEU A HD22 1 
ATOM 410  H HD23 . LEU A 1 26  ? -1.172  -18.021 10.219  1.00 0.00 ? 26  LEU A HD23 1 
ATOM 411  N N    . LEU A 1 27  ? -0.191  -21.448 6.889   1.00 0.00 ? 27  LEU A N    1 
ATOM 412  C CA   . LEU A 1 27  ? 1.024   -21.572 6.081   1.00 0.00 ? 27  LEU A CA   1 
ATOM 413  C C    . LEU A 1 27  ? 0.852   -22.600 4.964   1.00 0.00 ? 27  LEU A C    1 
ATOM 414  O O    . LEU A 1 27  ? 0.896   -22.251 3.785   1.00 0.00 ? 27  LEU A O    1 
ATOM 415  C CB   . LEU A 1 27  ? 2.226   -21.955 6.965   1.00 0.00 ? 27  LEU A CB   1 
ATOM 416  C CG   . LEU A 1 27  ? 3.385   -20.942 6.977   1.00 0.00 ? 27  LEU A CG   1 
ATOM 417  C CD1  . LEU A 1 27  ? 2.866   -19.513 7.021   1.00 0.00 ? 27  LEU A CD1  1 
ATOM 418  C CD2  . LEU A 1 27  ? 4.320   -21.202 8.152   1.00 0.00 ? 27  LEU A CD2  1 
ATOM 419  H H    . LEU A 1 27  ? -0.103  -21.346 7.859   1.00 0.00 ? 27  LEU A H    1 
ATOM 420  H HA   . LEU A 1 27  ? 1.214   -20.609 5.631   1.00 0.00 ? 27  LEU A HA   1 
ATOM 421  H HB2  . LEU A 1 27  ? 1.879   -22.089 7.980   1.00 0.00 ? 27  LEU A HB2  1 
ATOM 422  H HB3  . LEU A 1 27  ? 2.615   -22.898 6.612   1.00 0.00 ? 27  LEU A HB3  1 
ATOM 423  H HG   . LEU A 1 27  ? 3.957   -21.056 6.067   1.00 0.00 ? 27  LEU A HG   1 
ATOM 424  H HD11 . LEU A 1 27  ? 2.538   -19.219 6.034   1.00 0.00 ? 27  LEU A HD11 1 
ATOM 425  H HD12 . LEU A 1 27  ? 3.656   -18.853 7.348   1.00 0.00 ? 27  LEU A HD12 1 
ATOM 426  H HD13 . LEU A 1 27  ? 2.036   -19.451 7.710   1.00 0.00 ? 27  LEU A HD13 1 
ATOM 427  H HD21 . LEU A 1 27  ? 4.820   -22.148 8.011   1.00 0.00 ? 27  LEU A HD21 1 
ATOM 428  H HD22 . LEU A 1 27  ? 3.750   -21.225 9.075   1.00 0.00 ? 27  LEU A HD22 1 
ATOM 429  H HD23 . LEU A 1 27  ? 5.059   -20.413 8.204   1.00 0.00 ? 27  LEU A HD23 1 
ATOM 430  N N    . GLN A 1 28  ? 0.659   -23.865 5.327   1.00 0.00 ? 28  GLN A N    1 
ATOM 431  C CA   . GLN A 1 28  ? 0.485   -24.926 4.339   1.00 0.00 ? 28  GLN A CA   1 
ATOM 432  C C    . GLN A 1 28  ? -0.554  -24.549 3.283   1.00 0.00 ? 28  GLN A C    1 
ATOM 433  O O    . GLN A 1 28  ? -0.497  -25.020 2.148   1.00 0.00 ? 28  GLN A O    1 
ATOM 434  C CB   . GLN A 1 28  ? 0.064   -26.221 5.040   1.00 0.00 ? 28  GLN A CB   1 
ATOM 435  C CG   . GLN A 1 28  ? 1.190   -27.224 5.198   1.00 0.00 ? 28  GLN A CG   1 
ATOM 436  C CD   . GLN A 1 28  ? 0.763   -28.633 4.839   1.00 0.00 ? 28  GLN A CD   1 
ATOM 437  O OE1  . GLN A 1 28  ? 0.481   -28.934 3.680   1.00 0.00 ? 28  GLN A OE1  1 
ATOM 438  N NE2  . GLN A 1 28  ? 0.713   -29.504 5.838   1.00 0.00 ? 28  GLN A NE2  1 
ATOM 439  H H    . GLN A 1 28  ? 0.635   -24.112 6.275   1.00 0.00 ? 28  GLN A H    1 
ATOM 440  H HA   . GLN A 1 28  ? 1.434   -25.086 3.852   1.00 0.00 ? 28  GLN A HA   1 
ATOM 441  H HB2  . GLN A 1 28  ? -0.308  -25.979 6.024   1.00 0.00 ? 28  GLN A HB2  1 
ATOM 442  H HB3  . GLN A 1 28  ? -0.726  -26.688 4.472   1.00 0.00 ? 28  GLN A HB3  1 
ATOM 443  H HG2  . GLN A 1 28  ? 2.007   -26.936 4.553   1.00 0.00 ? 28  GLN A HG2  1 
ATOM 444  H HG3  . GLN A 1 28  ? 1.522   -27.214 6.228   1.00 0.00 ? 28  GLN A HG3  1 
ATOM 445  H HE21 . GLN A 1 28  ? 0.950   -29.189 6.736   1.00 0.00 ? 28  GLN A HE21 1 
ATOM 446  H HE22 . GLN A 1 28  ? 0.450   -30.425 5.638   1.00 0.00 ? 28  GLN A HE22 1 
ATOM 447  N N    . GLY A 1 29  ? -1.506  -23.705 3.667   1.00 0.00 ? 29  GLY A N    1 
ATOM 448  C CA   . GLY A 1 29  ? -2.547  -23.291 2.744   1.00 0.00 ? 29  GLY A CA   1 
ATOM 449  C C    . GLY A 1 29  ? -2.032  -22.416 1.615   1.00 0.00 ? 29  GLY A C    1 
ATOM 450  O O    . GLY A 1 29  ? -2.712  -22.240 0.605   1.00 0.00 ? 29  GLY A O    1 
ATOM 451  H H    . GLY A 1 29  ? -1.506  -23.368 4.586   1.00 0.00 ? 29  GLY A H    1 
ATOM 452  H HA2  . GLY A 1 29  ? -3.003  -24.173 2.318   1.00 0.00 ? 29  GLY A HA2  1 
ATOM 453  H HA3  . GLY A 1 29  ? -3.299  -22.744 3.293   1.00 0.00 ? 29  GLY A HA3  1 
ATOM 454  N N    . GLN A 1 30  ? -0.837  -21.859 1.786   1.00 0.00 ? 30  GLN A N    1 
ATOM 455  C CA   . GLN A 1 30  ? -0.253  -20.992 0.769   1.00 0.00 ? 30  GLN A CA   1 
ATOM 456  C C    . GLN A 1 30  ? 0.799   -21.723 -0.059  1.00 0.00 ? 30  GLN A C    1 
ATOM 457  O O    . GLN A 1 30  ? 0.961   -22.938 0.049   1.00 0.00 ? 30  GLN A O    1 
ATOM 458  C CB   . GLN A 1 30  ? 0.364   -19.757 1.421   1.00 0.00 ? 30  GLN A CB   1 
ATOM 459  C CG   . GLN A 1 30  ? -0.609  -18.600 1.559   1.00 0.00 ? 30  GLN A CG   1 
ATOM 460  C CD   . GLN A 1 30  ? -1.614  -18.802 2.676   1.00 0.00 ? 30  GLN A CD   1 
ATOM 461  O OE1  . GLN A 1 30  ? -2.777  -18.415 2.555   1.00 0.00 ? 30  GLN A OE1  1 
ATOM 462  N NE2  . GLN A 1 30  ? -1.174  -19.409 3.770   1.00 0.00 ? 30  GLN A NE2  1 
ATOM 463  H H    . GLN A 1 30  ? -0.341  -22.025 2.613   1.00 0.00 ? 30  GLN A H    1 
ATOM 464  H HA   . GLN A 1 30  ? -1.049  -20.675 0.111   1.00 0.00 ? 30  GLN A HA   1 
ATOM 465  H HB2  . GLN A 1 30  ? 0.722   -20.024 2.402   1.00 0.00 ? 30  GLN A HB2  1 
ATOM 466  H HB3  . GLN A 1 30  ? 1.198   -19.425 0.824   1.00 0.00 ? 30  GLN A HB3  1 
ATOM 467  H HG2  . GLN A 1 30  ? -0.048  -17.703 1.759   1.00 0.00 ? 30  GLN A HG2  1 
ATOM 468  H HG3  . GLN A 1 30  ? -1.145  -18.488 0.629   1.00 0.00 ? 30  GLN A HG3  1 
ATOM 469  H HE21 . GLN A 1 30  ? -0.237  -19.691 3.799   1.00 0.00 ? 30  GLN A HE21 1 
ATOM 470  H HE22 . GLN A 1 30  ? -1.804  -19.549 4.506   1.00 0.00 ? 30  GLN A HE22 1 
ATOM 471  N N    . ARG A 1 31  ? 1.505   -20.965 -0.893  1.00 0.00 ? 31  ARG A N    1 
ATOM 472  C CA   . ARG A 1 31  ? 2.542   -21.521 -1.758  1.00 0.00 ? 31  ARG A CA   1 
ATOM 473  C C    . ARG A 1 31  ? 3.586   -22.294 -0.958  1.00 0.00 ? 31  ARG A C    1 
ATOM 474  O O    . ARG A 1 31  ? 3.992   -21.878 0.127   1.00 0.00 ? 31  ARG A O    1 
ATOM 475  C CB   . ARG A 1 31  ? 3.220   -20.407 -2.555  1.00 0.00 ? 31  ARG A CB   1 
ATOM 476  C CG   . ARG A 1 31  ? 4.226   -20.918 -3.575  1.00 0.00 ? 31  ARG A CG   1 
ATOM 477  C CD   . ARG A 1 31  ? 5.623   -20.387 -3.298  1.00 0.00 ? 31  ARG A CD   1 
ATOM 478  N NE   . ARG A 1 31  ? 5.876   -19.125 -3.989  1.00 0.00 ? 31  ARG A NE   1 
ATOM 479  C CZ   . ARG A 1 31  ? 6.178   -19.035 -5.282  1.00 0.00 ? 31  ARG A CZ   1 
ATOM 480  N NH1  . ARG A 1 31  ? 6.265   -20.130 -6.028  1.00 0.00 ? 31  ARG A NH1  1 
ATOM 481  N NH2  . ARG A 1 31  ? 6.394   -17.848 -5.833  1.00 0.00 ? 31  ARG A NH2  1 
ATOM 482  H H    . ARG A 1 31  ? 1.317   -20.004 -0.933  1.00 0.00 ? 31  ARG A H    1 
ATOM 483  H HA   . ARG A 1 31  ? 2.064   -22.199 -2.447  1.00 0.00 ? 31  ARG A HA   1 
ATOM 484  H HB2  . ARG A 1 31  ? 2.463   -19.842 -3.079  1.00 0.00 ? 31  ARG A HB2  1 
ATOM 485  H HB3  . ARG A 1 31  ? 3.736   -19.751 -1.869  1.00 0.00 ? 31  ARG A HB3  1 
ATOM 486  H HG2  . ARG A 1 31  ? 4.247   -21.997 -3.533  1.00 0.00 ? 31  ARG A HG2  1 
ATOM 487  H HG3  . ARG A 1 31  ? 3.918   -20.599 -4.560  1.00 0.00 ? 31  ARG A HG3  1 
ATOM 488  H HD2  . ARG A 1 31  ? 5.732   -20.231 -2.235  1.00 0.00 ? 31  ARG A HD2  1 
ATOM 489  H HD3  . ARG A 1 31  ? 6.345   -21.119 -3.629  1.00 0.00 ? 31  ARG A HD3  1 
ATOM 490  H HE   . ARG A 1 31  ? 5.818   -18.300 -3.462  1.00 0.00 ? 31  ARG A HE   1 
ATOM 491  H HH11 . ARG A 1 31  ? 6.103   -21.028 -5.619  1.00 0.00 ? 31  ARG A HH11 1 
ATOM 492  H HH12 . ARG A 1 31  ? 6.492   -20.056 -6.999  1.00 0.00 ? 31  ARG A HH12 1 
ATOM 493  H HH21 . ARG A 1 31  ? 6.330   -17.019 -5.276  1.00 0.00 ? 31  ARG A HH21 1 
ATOM 494  H HH22 . ARG A 1 31  ? 6.622   -17.781 -6.804  1.00 0.00 ? 31  ARG A HH22 1 
ATOM 495  N N    . HIS A 1 32  ? 3.998   -23.434 -1.502  1.00 0.00 ? 32  HIS A N    1 
ATOM 496  C CA   . HIS A 1 32  ? 4.981   -24.304 -0.859  1.00 0.00 ? 32  HIS A CA   1 
ATOM 497  C C    . HIS A 1 32  ? 6.132   -23.528 -0.216  1.00 0.00 ? 32  HIS A C    1 
ATOM 498  O O    . HIS A 1 32  ? 6.584   -23.878 0.874   1.00 0.00 ? 32  HIS A O    1 
ATOM 499  C CB   . HIS A 1 32  ? 5.541   -25.300 -1.876  1.00 0.00 ? 32  HIS A CB   1 
ATOM 500  C CG   . HIS A 1 32  ? 5.913   -24.674 -3.185  1.00 0.00 ? 32  HIS A CG   1 
ATOM 501  N ND1  . HIS A 1 32  ? 7.137   -24.083 -3.416  1.00 0.00 ? 32  HIS A ND1  1 
ATOM 502  C CD2  . HIS A 1 32  ? 5.213   -24.546 -4.337  1.00 0.00 ? 32  HIS A CD2  1 
ATOM 503  C CE1  . HIS A 1 32  ? 7.174   -23.619 -4.651  1.00 0.00 ? 32  HIS A CE1  1 
ATOM 504  N NE2  . HIS A 1 32  ? 6.020   -23.887 -5.232  1.00 0.00 ? 32  HIS A NE2  1 
ATOM 505  H H    . HIS A 1 32  ? 3.615   -23.714 -2.359  1.00 0.00 ? 32  HIS A H    1 
ATOM 506  H HA   . HIS A 1 32  ? 4.469   -24.856 -0.086  1.00 0.00 ? 32  HIS A HA   1 
ATOM 507  H HB2  . HIS A 1 32  ? 6.426   -25.764 -1.467  1.00 0.00 ? 32  HIS A HB2  1 
ATOM 508  H HB3  . HIS A 1 32  ? 4.799   -26.062 -2.070  1.00 0.00 ? 32  HIS A HB3  1 
ATOM 509  H HD1  . HIS A 1 32  ? 7.871   -24.015 -2.769  1.00 0.00 ? 32  HIS A HD1  1 
ATOM 510  H HD2  . HIS A 1 32  ? 4.207   -24.898 -4.518  1.00 0.00 ? 32  HIS A HD2  1 
ATOM 511  H HE1  . HIS A 1 32  ? 8.007   -23.107 -5.110  1.00 0.00 ? 32  HIS A HE1  1 
ATOM 512  H HE2  . HIS A 1 32  ? 5.744   -23.569 -6.117  1.00 0.00 ? 32  HIS A HE2  1 
ATOM 513  N N    . GLY A 1 33  ? 6.621   -22.489 -0.892  1.00 0.00 ? 33  GLY A N    1 
ATOM 514  C CA   . GLY A 1 33  ? 7.728   -21.718 -0.350  1.00 0.00 ? 33  GLY A CA   1 
ATOM 515  C C    . GLY A 1 33  ? 7.274   -20.505 0.432   1.00 0.00 ? 33  GLY A C    1 
ATOM 516  O O    . GLY A 1 33  ? 7.894   -19.447 0.363   1.00 0.00 ? 33  GLY A O    1 
ATOM 517  H H    . GLY A 1 33  ? 6.247   -22.244 -1.764  1.00 0.00 ? 33  GLY A H    1 
ATOM 518  H HA2  . GLY A 1 33  ? 8.309   -22.355 0.301   1.00 0.00 ? 33  GLY A HA2  1 
ATOM 519  H HA3  . GLY A 1 33  ? 8.356   -21.391 -1.166  1.00 0.00 ? 33  GLY A HA3  1 
ATOM 520  N N    . VAL A 1 34  ? 6.184   -20.652 1.166   1.00 0.00 ? 34  VAL A N    1 
ATOM 521  C CA   . VAL A 1 34  ? 5.645   -19.558 1.952   1.00 0.00 ? 34  VAL A CA   1 
ATOM 522  C C    . VAL A 1 34  ? 6.005   -19.709 3.429   1.00 0.00 ? 34  VAL A C    1 
ATOM 523  O O    . VAL A 1 34  ? 6.054   -20.822 3.955   1.00 0.00 ? 34  VAL A O    1 
ATOM 524  C CB   . VAL A 1 34  ? 4.123   -19.482 1.784   1.00 0.00 ? 34  VAL A CB   1 
ATOM 525  C CG1  . VAL A 1 34  ? 3.507   -18.700 2.918   1.00 0.00 ? 34  VAL A CG1  1 
ATOM 526  C CG2  . VAL A 1 34  ? 3.779   -18.855 0.444   1.00 0.00 ? 34  VAL A CG2  1 
ATOM 527  H H    . VAL A 1 34  ? 5.721   -21.511 1.166   1.00 0.00 ? 34  VAL A H    1 
ATOM 528  H HA   . VAL A 1 34  ? 6.073   -18.637 1.581   1.00 0.00 ? 34  VAL A HA   1 
ATOM 529  H HB   . VAL A 1 34  ? 3.724   -20.484 1.805   1.00 0.00 ? 34  VAL A HB   1 
ATOM 530  H HG11 . VAL A 1 34  ? 2.461   -18.539 2.713   1.00 0.00 ? 34  VAL A HG11 1 
ATOM 531  H HG12 . VAL A 1 34  ? 4.016   -17.750 3.007   1.00 0.00 ? 34  VAL A HG12 1 
ATOM 532  H HG13 . VAL A 1 34  ? 3.616   -19.258 3.835   1.00 0.00 ? 34  VAL A HG13 1 
ATOM 533  H HG21 . VAL A 1 34  ? 4.608   -18.988 -0.238  1.00 0.00 ? 34  VAL A HG21 1 
ATOM 534  H HG22 . VAL A 1 34  ? 3.588   -17.800 0.580   1.00 0.00 ? 34  VAL A HG22 1 
ATOM 535  H HG23 . VAL A 1 34  ? 2.901   -19.331 0.038   1.00 0.00 ? 34  VAL A HG23 1 
ATOM 536  N N    . PHE A 1 35  ? 6.290   -18.584 4.083   1.00 0.00 ? 35  PHE A N    1 
ATOM 537  C CA   . PHE A 1 35  ? 6.687   -18.609 5.490   1.00 0.00 ? 35  PHE A CA   1 
ATOM 538  C C    . PHE A 1 35  ? 6.304   -17.326 6.241   1.00 0.00 ? 35  PHE A C    1 
ATOM 539  O O    . PHE A 1 35  ? 6.541   -16.218 5.762   1.00 0.00 ? 35  PHE A O    1 
ATOM 540  C CB   . PHE A 1 35  ? 8.199   -18.832 5.566   1.00 0.00 ? 35  PHE A CB   1 
ATOM 541  C CG   . PHE A 1 35  ? 8.742   -19.628 4.404   1.00 0.00 ? 35  PHE A CG   1 
ATOM 542  C CD1  . PHE A 1 35  ? 8.729   -21.012 4.426   1.00 0.00 ? 35  PHE A CD1  1 
ATOM 543  C CD2  . PHE A 1 35  ? 9.258   -18.991 3.292   1.00 0.00 ? 35  PHE A CD2  1 
ATOM 544  C CE1  . PHE A 1 35  ? 9.221   -21.745 3.366   1.00 0.00 ? 35  PHE A CE1  1 
ATOM 545  C CE2  . PHE A 1 35  ? 9.752   -19.719 2.228   1.00 0.00 ? 35  PHE A CE2  1 
ATOM 546  C CZ   . PHE A 1 35  ? 9.735   -21.097 2.266   1.00 0.00 ? 35  PHE A CZ   1 
ATOM 547  H H    . PHE A 1 35  ? 6.265   -17.736 3.594   1.00 0.00 ? 35  PHE A H    1 
ATOM 548  H HA   . PHE A 1 35  ? 6.192   -19.445 5.957   1.00 0.00 ? 35  PHE A HA   1 
ATOM 549  H HB2  . PHE A 1 35  ? 8.697   -17.873 5.573   1.00 0.00 ? 35  PHE A HB2  1 
ATOM 550  H HB3  . PHE A 1 35  ? 8.435   -19.361 6.473   1.00 0.00 ? 35  PHE A HB3  1 
ATOM 551  H HD1  . PHE A 1 35  ? 8.329   -21.520 5.280   1.00 0.00 ? 35  PHE A HD1  1 
ATOM 552  H HD2  . PHE A 1 35  ? 9.274   -17.911 3.257   1.00 0.00 ? 35  PHE A HD2  1 
ATOM 553  H HE1  . PHE A 1 35  ? 9.204   -22.825 3.400   1.00 0.00 ? 35  PHE A HE1  1 
ATOM 554  H HE2  . PHE A 1 35  ? 10.154  -19.212 1.368   1.00 0.00 ? 35  PHE A HE2  1 
ATOM 555  H HZ   . PHE A 1 35  ? 10.124  -21.665 1.436   1.00 0.00 ? 35  PHE A HZ   1 
ATOM 556  N N    . LEU A 1 36  ? 5.728   -17.496 7.440   1.00 0.00 ? 36  LEU A N    1 
ATOM 557  C CA   . LEU A 1 36  ? 5.329   -16.366 8.286   1.00 0.00 ? 36  LEU A CA   1 
ATOM 558  C C    . LEU A 1 36  ? 5.990   -16.462 9.665   1.00 0.00 ? 36  LEU A C    1 
ATOM 559  O O    . LEU A 1 36  ? 6.606   -17.471 9.999   1.00 0.00 ? 36  LEU A O    1 
ATOM 560  C CB   . LEU A 1 36  ? 3.802   -16.304 8.428   1.00 0.00 ? 36  LEU A CB   1 
ATOM 561  C CG   . LEU A 1 36  ? 3.242   -16.784 9.768   1.00 0.00 ? 36  LEU A CG   1 
ATOM 562  C CD1  . LEU A 1 36  ? 1.729   -16.787 9.730   1.00 0.00 ? 36  LEU A CD1  1 
ATOM 563  C CD2  . LEU A 1 36  ? 3.775   -18.165 10.111  1.00 0.00 ? 36  LEU A CD2  1 
ATOM 564  H H    . LEU A 1 36  ? 5.580   -18.405 7.769   1.00 0.00 ? 36  LEU A H    1 
ATOM 565  H HA   . LEU A 1 36  ? 5.667   -15.459 7.808   1.00 0.00 ? 36  LEU A HA   1 
ATOM 566  H HB2  . LEU A 1 36  ? 3.493   -15.278 8.286   1.00 0.00 ? 36  LEU A HB2  1 
ATOM 567  H HB3  . LEU A 1 36  ? 3.364   -16.905 7.646   1.00 0.00 ? 36  LEU A HB3  1 
ATOM 568  H HG   . LEU A 1 36  ? 3.554   -16.101 10.545  1.00 0.00 ? 36  LEU A HG   1 
ATOM 569  H HD11 . LEU A 1 36  ? 1.351   -17.326 10.585  1.00 0.00 ? 36  LEU A HD11 1 
ATOM 570  H HD12 . LEU A 1 36  ? 1.395   -17.268 8.825   1.00 0.00 ? 36  LEU A HD12 1 
ATOM 571  H HD13 . LEU A 1 36  ? 1.369   -15.771 9.755   1.00 0.00 ? 36  LEU A HD13 1 
ATOM 572  H HD21 . LEU A 1 36  ? 4.192   -18.620 9.225   1.00 0.00 ? 36  LEU A HD21 1 
ATOM 573  H HD22 . LEU A 1 36  ? 2.971   -18.778 10.485  1.00 0.00 ? 36  LEU A HD22 1 
ATOM 574  H HD23 . LEU A 1 36  ? 4.546   -18.074 10.866  1.00 0.00 ? 36  LEU A HD23 1 
ATOM 575  N N    . VAL A 1 37  ? 5.890   -15.385 10.436  1.00 0.00 ? 37  VAL A N    1 
ATOM 576  C CA   . VAL A 1 37  ? 6.515   -15.314 11.755  1.00 0.00 ? 37  VAL A CA   1 
ATOM 577  C C    . VAL A 1 37  ? 5.507   -15.304 12.902  1.00 0.00 ? 37  VAL A C    1 
ATOM 578  O O    . VAL A 1 37  ? 4.374   -14.852 12.747  1.00 0.00 ? 37  VAL A O    1 
ATOM 579  C CB   . VAL A 1 37  ? 7.380   -14.049 11.832  1.00 0.00 ? 37  VAL A CB   1 
ATOM 580  C CG1  . VAL A 1 37  ? 6.524   -12.812 11.641  1.00 0.00 ? 37  VAL A CG1  1 
ATOM 581  C CG2  . VAL A 1 37  ? 8.171   -13.960 13.126  1.00 0.00 ? 37  VAL A CG2  1 
ATOM 582  H H    . VAL A 1 37  ? 5.429   -14.605 10.075  1.00 0.00 ? 37  VAL A H    1 
ATOM 583  H HA   . VAL A 1 37  ? 7.158   -16.173 11.863  1.00 0.00 ? 37  VAL A HA   1 
ATOM 584  H HB   . VAL A 1 37  ? 8.075   -14.096 11.019  1.00 0.00 ? 37  VAL A HB   1 
ATOM 585  H HG11 . VAL A 1 37  ? 7.079   -11.941 11.952  1.00 0.00 ? 37  VAL A HG11 1 
ATOM 586  H HG12 . VAL A 1 37  ? 5.626   -12.901 12.234  1.00 0.00 ? 37  VAL A HG12 1 
ATOM 587  H HG13 . VAL A 1 37  ? 6.261   -12.719 10.598  1.00 0.00 ? 37  VAL A HG13 1 
ATOM 588  H HG21 . VAL A 1 37  ? 9.043   -14.596 13.052  1.00 0.00 ? 37  VAL A HG21 1 
ATOM 589  H HG22 . VAL A 1 37  ? 7.555   -14.274 13.957  1.00 0.00 ? 37  VAL A HG22 1 
ATOM 590  H HG23 . VAL A 1 37  ? 8.487   -12.939 13.281  1.00 0.00 ? 37  VAL A HG23 1 
ATOM 591  N N    . ARG A 1 38  ? 5.947   -15.801 14.060  1.00 0.00 ? 38  ARG A N    1 
ATOM 592  C CA   . ARG A 1 38  ? 5.114   -15.850 15.250  1.00 0.00 ? 38  ARG A CA   1 
ATOM 593  C C    . ARG A 1 38  ? 5.905   -15.435 16.488  1.00 0.00 ? 38  ARG A C    1 
ATOM 594  O O    . ARG A 1 38  ? 7.066   -15.037 16.388  1.00 0.00 ? 38  ARG A O    1 
ATOM 595  C CB   . ARG A 1 38  ? 4.517   -17.250 15.418  1.00 0.00 ? 38  ARG A CB   1 
ATOM 596  C CG   . ARG A 1 38  ? 3.419   -17.558 14.409  1.00 0.00 ? 38  ARG A CG   1 
ATOM 597  C CD   . ARG A 1 38  ? 2.394   -16.437 14.355  1.00 0.00 ? 38  ARG A CD   1 
ATOM 598  N NE   . ARG A 1 38  ? 1.481   -16.555 13.221  1.00 0.00 ? 38  ARG A NE   1 
ATOM 599  C CZ   . ARG A 1 38  ? 0.947   -15.509 12.593  1.00 0.00 ? 38  ARG A CZ   1 
ATOM 600  N NH1  . ARG A 1 38  ? 1.309   -14.273 12.916  1.00 0.00 ? 38  ARG A NH1  1 
ATOM 601  N NH2  . ARG A 1 38  ? 0.043   -15.697 11.640  1.00 0.00 ? 38  ARG A NH2  1 
ATOM 602  H H    . ARG A 1 38  ? 6.866   -16.142 14.119  1.00 0.00 ? 38  ARG A H    1 
ATOM 603  H HA   . ARG A 1 38  ? 4.313   -15.143 15.112  1.00 0.00 ? 38  ARG A HA   1 
ATOM 604  H HB2  . ARG A 1 38  ? 5.303   -17.981 15.301  1.00 0.00 ? 38  ARG A HB2  1 
ATOM 605  H HB3  . ARG A 1 38  ? 4.100   -17.335 16.411  1.00 0.00 ? 38  ARG A HB3  1 
ATOM 606  H HG2  . ARG A 1 38  ? 3.862   -17.676 13.432  1.00 0.00 ? 38  ARG A HG2  1 
ATOM 607  H HG3  . ARG A 1 38  ? 2.925   -18.474 14.697  1.00 0.00 ? 38  ARG A HG3  1 
ATOM 608  H HD2  . ARG A 1 38  ? 1.819   -16.454 15.267  1.00 0.00 ? 38  ARG A HD2  1 
ATOM 609  H HD3  . ARG A 1 38  ? 2.914   -15.497 14.282  1.00 0.00 ? 38  ARG A HD3  1 
ATOM 610  H HE   . ARG A 1 38  ? 1.222   -17.455 12.940  1.00 0.00 ? 38  ARG A HE   1 
ATOM 611  H HH11 . ARG A 1 38  ? 1.985   -14.120 13.633  1.00 0.00 ? 38  ARG A HH11 1 
ATOM 612  H HH12 . ARG A 1 38  ? 0.904   -13.498 12.440  1.00 0.00 ? 38  ARG A HH12 1 
ATOM 613  H HH21 . ARG A 1 38  ? -0.238  -16.624 11.395  1.00 0.00 ? 38  ARG A HH21 1 
ATOM 614  H HH22 . ARG A 1 38  ? -0.362  -14.913 11.173  1.00 0.00 ? 38  ARG A HH22 1 
ATOM 615  N N    . ASP A 1 39  ? 5.261   -15.495 17.650  1.00 0.00 ? 39  ASP A N    1 
ATOM 616  C CA   . ASP A 1 39  ? 5.894   -15.088 18.899  1.00 0.00 ? 39  ASP A CA   1 
ATOM 617  C C    . ASP A 1 39  ? 6.575   -16.250 19.618  1.00 0.00 ? 39  ASP A C    1 
ATOM 618  O O    . ASP A 1 39  ? 6.097   -17.384 19.592  1.00 0.00 ? 39  ASP A O    1 
ATOM 619  C CB   . ASP A 1 39  ? 4.852   -14.468 19.825  1.00 0.00 ? 39  ASP A CB   1 
ATOM 620  C CG   . ASP A 1 39  ? 3.742   -15.438 20.174  1.00 0.00 ? 39  ASP A CG   1 
ATOM 621  O OD1  . ASP A 1 39  ? 3.493   -16.366 19.376  1.00 0.00 ? 39  ASP A OD1  1 
ATOM 622  O OD2  . ASP A 1 39  ? 3.123   -15.272 21.245  1.00 0.00 ? 39  ASP A OD2  1 
ATOM 623  H H    . ASP A 1 39  ? 4.332   -15.795 17.665  1.00 0.00 ? 39  ASP A H    1 
ATOM 624  H HA   . ASP A 1 39  ? 6.637   -14.342 18.659  1.00 0.00 ? 39  ASP A HA   1 
ATOM 625  H HB2  . ASP A 1 39  ? 5.330   -14.163 20.737  1.00 0.00 ? 39  ASP A HB2  1 
ATOM 626  H HB3  . ASP A 1 39  ? 4.418   -13.605 19.345  1.00 0.00 ? 39  ASP A HB3  1 
ATOM 627  N N    . SER A 1 40  ? 7.702   -15.945 20.260  1.00 0.00 ? 40  SER A N    1 
ATOM 628  C CA   . SER A 1 40  ? 8.480   -16.940 20.999  1.00 0.00 ? 40  SER A CA   1 
ATOM 629  C C    . SER A 1 40  ? 7.649   -17.652 22.060  1.00 0.00 ? 40  SER A C    1 
ATOM 630  O O    . SER A 1 40  ? 7.663   -17.279 23.231  1.00 0.00 ? 40  SER A O    1 
ATOM 631  C CB   . SER A 1 40  ? 9.697   -16.285 21.654  1.00 0.00 ? 40  SER A CB   1 
ATOM 632  O OG   . SER A 1 40  ? 10.850  -16.423 20.843  1.00 0.00 ? 40  SER A OG   1 
ATOM 633  H H    . SER A 1 40  ? 8.025   -15.019 20.229  1.00 0.00 ? 40  SER A H    1 
ATOM 634  H HA   . SER A 1 40  ? 8.827   -17.675 20.297  1.00 0.00 ? 40  SER A HA   1 
ATOM 635  H HB2  . SER A 1 40  ? 9.503   -15.236 21.805  1.00 0.00 ? 40  SER A HB2  1 
ATOM 636  H HB3  . SER A 1 40  ? 9.885   -16.754 22.608  1.00 0.00 ? 40  SER A HB3  1 
ATOM 637  H HG   . SER A 1 40  ? 10.735  -15.919 20.034  1.00 0.00 ? 40  SER A HG   1 
ATOM 638  N N    . SER A 1 41  ? 6.941   -18.694 21.640  1.00 0.00 ? 41  SER A N    1 
ATOM 639  C CA   . SER A 1 41  ? 6.120   -19.480 22.557  1.00 0.00 ? 41  SER A CA   1 
ATOM 640  C C    . SER A 1 41  ? 6.969   -20.023 23.710  1.00 0.00 ? 41  SER A C    1 
ATOM 641  O O    . SER A 1 41  ? 6.442   -20.412 24.753  1.00 0.00 ? 41  SER A O    1 
ATOM 642  C CB   . SER A 1 41  ? 5.449   -20.635 21.811  1.00 0.00 ? 41  SER A CB   1 
ATOM 643  O OG   . SER A 1 41  ? 4.362   -21.158 22.553  1.00 0.00 ? 41  SER A OG   1 
ATOM 644  H H    . SER A 1 41  ? 6.980   -18.940 20.692  1.00 0.00 ? 41  SER A H    1 
ATOM 645  H HA   . SER A 1 41  ? 5.358   -18.830 22.960  1.00 0.00 ? 41  SER A HA   1 
ATOM 646  H HB2  . SER A 1 41  ? 5.080   -20.280 20.859  1.00 0.00 ? 41  SER A HB2  1 
ATOM 647  H HB3  . SER A 1 41  ? 6.171   -21.422 21.647  1.00 0.00 ? 41  SER A HB3  1 
ATOM 648  H HG   . SER A 1 41  ? 4.648   -21.345 23.450  1.00 0.00 ? 41  SER A HG   1 
ATOM 649  N N    . THR A 1 42  ? 8.288   -20.040 23.510  1.00 0.00 ? 42  THR A N    1 
ATOM 650  C CA   . THR A 1 42  ? 9.216   -20.526 24.525  1.00 0.00 ? 42  THR A CA   1 
ATOM 651  C C    . THR A 1 42  ? 9.837   -19.367 25.302  1.00 0.00 ? 42  THR A C    1 
ATOM 652  O O    . THR A 1 42  ? 9.850   -19.370 26.533  1.00 0.00 ? 42  THR A O    1 
ATOM 653  C CB   . THR A 1 42  ? 10.319  -21.364 23.876  1.00 0.00 ? 42  THR A CB   1 
ATOM 654  O OG1  . THR A 1 42  ? 11.271  -20.533 23.237  1.00 0.00 ? 42  THR A OG1  1 
ATOM 655  C CG2  . THR A 1 42  ? 9.799   -22.346 22.848  1.00 0.00 ? 42  THR A CG2  1 
ATOM 656  H H    . THR A 1 42  ? 8.639   -19.713 22.659  1.00 0.00 ? 42  THR A H    1 
ATOM 657  H HA   . THR A 1 42  ? 8.661   -21.148 25.211  1.00 0.00 ? 42  THR A HA   1 
ATOM 658  H HB   . THR A 1 42  ? 10.824  -21.929 24.645  1.00 0.00 ? 42  THR A HB   1 
ATOM 659  H HG1  . THR A 1 42  ? 10.888  -20.158 22.441  1.00 0.00 ? 42  THR A HG1  1 
ATOM 660  H HG21 . THR A 1 42  ? 9.380   -21.805 22.013  1.00 0.00 ? 42  THR A HG21 1 
ATOM 661  H HG22 . THR A 1 42  ? 9.037   -22.965 23.296  1.00 0.00 ? 42  THR A HG22 1 
ATOM 662  H HG23 . THR A 1 42  ? 10.612  -22.968 22.502  1.00 0.00 ? 42  THR A HG23 1 
ATOM 663  N N    . SER A 1 43  ? 10.355  -18.378 24.576  1.00 0.00 ? 43  SER A N    1 
ATOM 664  C CA   . SER A 1 43  ? 10.981  -17.217 25.202  1.00 0.00 ? 43  SER A CA   1 
ATOM 665  C C    . SER A 1 43  ? 9.941   -16.141 25.529  1.00 0.00 ? 43  SER A C    1 
ATOM 666  O O    . SER A 1 43  ? 9.007   -15.921 24.760  1.00 0.00 ? 43  SER A O    1 
ATOM 667  C CB   . SER A 1 43  ? 12.063  -16.640 24.286  1.00 0.00 ? 43  SER A CB   1 
ATOM 668  O OG   . SER A 1 43  ? 13.209  -17.473 24.261  1.00 0.00 ? 43  SER A OG   1 
ATOM 669  H H    . SER A 1 43  ? 10.317  -18.434 23.599  1.00 0.00 ? 43  SER A H    1 
ATOM 670  H HA   . SER A 1 43  ? 11.440  -17.549 26.119  1.00 0.00 ? 43  SER A HA   1 
ATOM 671  H HB2  . SER A 1 43  ? 11.675  -16.554 23.283  1.00 0.00 ? 43  SER A HB2  1 
ATOM 672  H HB3  . SER A 1 43  ? 12.351  -15.664 24.645  1.00 0.00 ? 43  SER A HB3  1 
ATOM 673  H HG   . SER A 1 43  ? 13.333  -17.821 23.375  1.00 0.00 ? 43  SER A HG   1 
ATOM 674  N N    . PRO A 1 44  ? 10.084  -15.462 26.683  1.00 0.00 ? 44  PRO A N    1 
ATOM 675  C CA   . PRO A 1 44  ? 9.144   -14.417 27.110  1.00 0.00 ? 44  PRO A CA   1 
ATOM 676  C C    . PRO A 1 44  ? 9.193   -13.170 26.228  1.00 0.00 ? 44  PRO A C    1 
ATOM 677  O O    . PRO A 1 44  ? 8.169   -12.526 25.998  1.00 0.00 ? 44  PRO A O    1 
ATOM 678  C CB   . PRO A 1 44  ? 9.599   -14.067 28.536  1.00 0.00 ? 44  PRO A CB   1 
ATOM 679  C CG   . PRO A 1 44  ? 10.532  -15.160 28.939  1.00 0.00 ? 44  PRO A CG   1 
ATOM 680  C CD   . PRO A 1 44  ? 11.154  -15.663 27.671  1.00 0.00 ? 44  PRO A CD   1 
ATOM 681  H HA   . PRO A 1 44  ? 8.131   -14.789 27.139  1.00 0.00 ? 44  PRO A HA   1 
ATOM 682  H HB2  . PRO A 1 44  ? 10.097  -13.109 28.532  1.00 0.00 ? 44  PRO A HB2  1 
ATOM 683  H HB3  . PRO A 1 44  ? 8.739   -14.026 29.188  1.00 0.00 ? 44  PRO A HB3  1 
ATOM 684  H HG2  . PRO A 1 44  ? 11.291  -14.769 29.600  1.00 0.00 ? 44  PRO A HG2  1 
ATOM 685  H HG3  . PRO A 1 44  ? 9.981   -15.951 29.426  1.00 0.00 ? 44  PRO A HG3  1 
ATOM 686  H HD2  . PRO A 1 44  ? 12.028  -15.080 27.420  1.00 0.00 ? 44  PRO A HD2  1 
ATOM 687  H HD3  . PRO A 1 44  ? 11.406  -16.708 27.764  1.00 0.00 ? 44  PRO A HD3  1 
ATOM 688  N N    . GLY A 1 45  ? 10.383  -12.825 25.747  1.00 0.00 ? 45  GLY A N    1 
ATOM 689  C CA   . GLY A 1 45  ? 10.528  -11.647 24.910  1.00 0.00 ? 45  GLY A CA   1 
ATOM 690  C C    . GLY A 1 45  ? 11.388  -11.897 23.688  1.00 0.00 ? 45  GLY A C    1 
ATOM 691  O O    . GLY A 1 45  ? 12.523  -11.429 23.613  1.00 0.00 ? 45  GLY A O    1 
ATOM 692  H H    . GLY A 1 45  ? 11.167  -13.368 25.966  1.00 0.00 ? 45  GLY A H    1 
ATOM 693  H HA2  . GLY A 1 45  ? 9.548   -11.327 24.586  1.00 0.00 ? 45  GLY A HA2  1 
ATOM 694  H HA3  . GLY A 1 45  ? 10.975  -10.857 25.495  1.00 0.00 ? 45  GLY A HA3  1 
ATOM 695  N N    . ASP A 1 46  ? 10.844  -12.637 22.729  1.00 0.00 ? 46  ASP A N    1 
ATOM 696  C CA   . ASP A 1 46  ? 11.566  -12.952 21.502  1.00 0.00 ? 46  ASP A CA   1 
ATOM 697  C C    . ASP A 1 46  ? 10.596  -13.276 20.369  1.00 0.00 ? 46  ASP A C    1 
ATOM 698  O O    . ASP A 1 46  ? 9.399   -13.448 20.598  1.00 0.00 ? 46  ASP A O    1 
ATOM 699  C CB   . ASP A 1 46  ? 12.511  -14.126 21.739  1.00 0.00 ? 46  ASP A CB   1 
ATOM 700  C CG   . ASP A 1 46  ? 13.612  -13.789 22.727  1.00 0.00 ? 46  ASP A CG   1 
ATOM 701  O OD1  . ASP A 1 46  ? 13.343  -13.805 23.947  1.00 0.00 ? 46  ASP A OD1  1 
ATOM 702  O OD2  . ASP A 1 46  ? 14.744  -13.508 22.281  1.00 0.00 ? 46  ASP A OD2  1 
ATOM 703  H H    . ASP A 1 46  ? 9.935   -12.981 22.852  1.00 0.00 ? 46  ASP A H    1 
ATOM 704  H HA   . ASP A 1 46  ? 12.146  -12.084 21.225  1.00 0.00 ? 46  ASP A HA   1 
ATOM 705  H HB2  . ASP A 1 46  ? 11.948  -14.961 22.129  1.00 0.00 ? 46  ASP A HB2  1 
ATOM 706  H HB3  . ASP A 1 46  ? 12.964  -14.408 20.804  1.00 0.00 ? 46  ASP A HB3  1 
ATOM 707  N N    . TYR A 1 47  ? 11.110  -13.344 19.144  1.00 0.00 ? 47  TYR A N    1 
ATOM 708  C CA   . TYR A 1 47  ? 10.278  -13.635 17.981  1.00 0.00 ? 47  TYR A CA   1 
ATOM 709  C C    . TYR A 1 47  ? 10.532  -15.043 17.460  1.00 0.00 ? 47  TYR A C    1 
ATOM 710  O O    . TYR A 1 47  ? 11.487  -15.704 17.864  1.00 0.00 ? 47  TYR A O    1 
ATOM 711  C CB   . TYR A 1 47  ? 10.559  -12.619 16.869  1.00 0.00 ? 47  TYR A CB   1 
ATOM 712  C CG   . TYR A 1 47  ? 9.988   -11.248 17.142  1.00 0.00 ? 47  TYR A CG   1 
ATOM 713  C CD1  . TYR A 1 47  ? 8.677   -10.937 16.806  1.00 0.00 ? 47  TYR A CD1  1 
ATOM 714  C CD2  . TYR A 1 47  ? 10.764  -10.266 17.738  1.00 0.00 ? 47  TYR A CD2  1 
ATOM 715  C CE1  . TYR A 1 47  ? 8.156   -9.683  17.056  1.00 0.00 ? 47  TYR A CE1  1 
ATOM 716  C CE2  . TYR A 1 47  ? 10.251  -9.008  17.993  1.00 0.00 ? 47  TYR A CE2  1 
ATOM 717  C CZ   . TYR A 1 47  ? 8.947   -8.722  17.650  1.00 0.00 ? 47  TYR A CZ   1 
ATOM 718  O OH   . TYR A 1 47  ? 8.432   -7.471  17.902  1.00 0.00 ? 47  TYR A OH   1 
ATOM 719  H H    . TYR A 1 47  ? 12.068  -13.184 19.008  1.00 0.00 ? 47  TYR A H    1 
ATOM 720  H HA   . TYR A 1 47  ? 9.245   -13.551 18.280  1.00 0.00 ? 47  TYR A HA   1 
ATOM 721  H HB2  . TYR A 1 47  ? 11.627  -12.511 16.756  1.00 0.00 ? 47  TYR A HB2  1 
ATOM 722  H HB3  . TYR A 1 47  ? 10.140  -12.978 15.939  1.00 0.00 ? 47  TYR A HB3  1 
ATOM 723  H HD1  . TYR A 1 47  ? 8.060   -11.693 16.341  1.00 0.00 ? 47  TYR A HD1  1 
ATOM 724  H HD2  . TYR A 1 47  ? 11.786  -10.497 18.005  1.00 0.00 ? 47  TYR A HD2  1 
ATOM 725  H HE1  . TYR A 1 47  ? 7.134   -9.459  16.788  1.00 0.00 ? 47  TYR A HE1  1 
ATOM 726  H HE2  . TYR A 1 47  ? 10.872  -8.257  18.459  1.00 0.00 ? 47  TYR A HE2  1 
ATOM 727  H HH   . TYR A 1 47  ? 9.051   -6.802  17.597  1.00 0.00 ? 47  TYR A HH   1 
ATOM 728  N N    . VAL A 1 48  ? 9.672   -15.491 16.552  1.00 0.00 ? 48  VAL A N    1 
ATOM 729  C CA   . VAL A 1 48  ? 9.782   -16.785 15.959  1.00 0.00 ? 48  VAL A CA   1 
ATOM 730  C C    . VAL A 1 48  ? 9.426   -16.735 14.494  1.00 0.00 ? 48  VAL A C    1 
ATOM 731  O O    . VAL A 1 48  ? 8.372   -16.239 14.127  1.00 0.00 ? 48  VAL A O    1 
ATOM 732  C CB   . VAL A 1 48  ? 8.832   -17.768 16.607  1.00 0.00 ? 48  VAL A CB   1 
ATOM 733  C CG1  . VAL A 1 48  ? 9.324   -19.145 16.331  1.00 0.00 ? 48  VAL A CG1  1 
ATOM 734  C CG2  . VAL A 1 48  ? 8.715   -17.499 18.081  1.00 0.00 ? 48  VAL A CG2  1 
ATOM 735  H H    . VAL A 1 48  ? 8.947   -14.936 16.268  1.00 0.00 ? 48  VAL A H    1 
ATOM 736  H HA   . VAL A 1 48  ? 10.794  -17.143 16.083  1.00 0.00 ? 48  VAL A HA   1 
ATOM 737  H HB   . VAL A 1 48  ? 7.856   -17.655 16.157  1.00 0.00 ? 48  VAL A HB   1 
ATOM 738  H HG11 . VAL A 1 48  ? 9.038   -19.415 15.330  1.00 0.00 ? 48  VAL A HG11 1 
ATOM 739  H HG12 . VAL A 1 48  ? 8.896   -19.829 17.040  1.00 0.00 ? 48  VAL A HG12 1 
ATOM 740  H HG13 . VAL A 1 48  ? 10.398  -19.146 16.411  1.00 0.00 ? 48  VAL A HG13 1 
ATOM 741  H HG21 . VAL A 1 48  ? 7.902   -18.080 18.490  1.00 0.00 ? 48  VAL A HG21 1 
ATOM 742  H HG22 . VAL A 1 48  ? 8.519   -16.449 18.229  1.00 0.00 ? 48  VAL A HG22 1 
ATOM 743  H HG23 . VAL A 1 48  ? 9.639   -17.768 18.570  1.00 0.00 ? 48  VAL A HG23 1 
ATOM 744  N N    . LEU A 1 49  ? 10.269  -17.304 13.669  1.00 0.00 ? 49  LEU A N    1 
ATOM 745  C CA   . LEU A 1 49  ? 9.993   -17.356 12.252  1.00 0.00 ? 49  LEU A CA   1 
ATOM 746  C C    . LEU A 1 49  ? 9.458   -18.743 11.906  1.00 0.00 ? 49  LEU A C    1 
ATOM 747  O O    . LEU A 1 49  ? 10.044  -19.749 12.289  1.00 0.00 ? 49  LEU A O    1 
ATOM 748  C CB   . LEU A 1 49  ? 11.253  -17.015 11.457  1.00 0.00 ? 49  LEU A CB   1 
ATOM 749  C CG   . LEU A 1 49  ? 11.153  -17.232 9.952   1.00 0.00 ? 49  LEU A CG   1 
ATOM 750  C CD1  . LEU A 1 49  ? 11.257  -18.712 9.634   1.00 0.00 ? 49  LEU A CD1  1 
ATOM 751  C CD2  . LEU A 1 49  ? 9.855   -16.653 9.403   1.00 0.00 ? 49  LEU A CD2  1 
ATOM 752  H H    . LEU A 1 49  ? 11.064  -17.743 14.035  1.00 0.00 ? 49  LEU A H    1 
ATOM 753  H HA   . LEU A 1 49  ? 9.227   -16.623 12.037  1.00 0.00 ? 49  LEU A HA   1 
ATOM 754  H HB2  . LEU A 1 49  ? 11.491  -15.973 11.632  1.00 0.00 ? 49  LEU A HB2  1 
ATOM 755  H HB3  . LEU A 1 49  ? 12.065  -17.619 11.835  1.00 0.00 ? 49  LEU A HB3  1 
ATOM 756  H HG   . LEU A 1 49  ? 11.975  -16.727 9.469   1.00 0.00 ? 49  LEU A HG   1 
ATOM 757  H HD11 . LEU A 1 49  ? 10.280  -19.095 9.385   1.00 0.00 ? 49  LEU A HD11 1 
ATOM 758  H HD12 . LEU A 1 49  ? 11.636  -19.235 10.499  1.00 0.00 ? 49  LEU A HD12 1 
ATOM 759  H HD13 . LEU A 1 49  ? 11.928  -18.857 8.801   1.00 0.00 ? 49  LEU A HD13 1 
ATOM 760  H HD21 . LEU A 1 49  ? 9.401   -16.013 10.149  1.00 0.00 ? 49  LEU A HD21 1 
ATOM 761  H HD22 . LEU A 1 49  ? 9.177   -17.457 9.155   1.00 0.00 ? 49  LEU A HD22 1 
ATOM 762  H HD23 . LEU A 1 49  ? 10.067  -16.075 8.514   1.00 0.00 ? 49  LEU A HD23 1 
ATOM 763  N N    . SER A 1 50  ? 8.343   -18.793 11.189  1.00 0.00 ? 50  SER A N    1 
ATOM 764  C CA   . SER A 1 50  ? 7.736   -20.068 10.811  1.00 0.00 ? 50  SER A CA   1 
ATOM 765  C C    . SER A 1 50  ? 7.904   -20.318 9.322   1.00 0.00 ? 50  SER A C    1 
ATOM 766  O O    . SER A 1 50  ? 7.748   -19.401 8.518   1.00 0.00 ? 50  SER A O    1 
ATOM 767  C CB   . SER A 1 50  ? 6.250   -20.075 11.171  1.00 0.00 ? 50  SER A CB   1 
ATOM 768  O OG   . SER A 1 50  ? 5.778   -21.395 11.369  1.00 0.00 ? 50  SER A OG   1 
ATOM 769  H H    . SER A 1 50  ? 7.922   -17.956 10.896  1.00 0.00 ? 50  SER A H    1 
ATOM 770  H HA   . SER A 1 50  ? 8.237   -20.852 11.359  1.00 0.00 ? 50  SER A HA   1 
ATOM 771  H HB2  . SER A 1 50  ? 6.096   -19.510 12.078  1.00 0.00 ? 50  SER A HB2  1 
ATOM 772  H HB3  . SER A 1 50  ? 5.689   -19.624 10.366  1.00 0.00 ? 50  SER A HB3  1 
ATOM 773  H HG   . SER A 1 50  ? 4.829   -21.377 11.507  1.00 0.00 ? 50  SER A HG   1 
ATOM 774  N N    . VAL A 1 51  ? 8.235   -21.555 8.948   1.00 0.00 ? 51  VAL A N    1 
ATOM 775  C CA   . VAL A 1 51  ? 8.432   -21.871 7.541   1.00 0.00 ? 51  VAL A CA   1 
ATOM 776  C C    . VAL A 1 51  ? 7.887   -23.234 7.125   1.00 0.00 ? 51  VAL A C    1 
ATOM 777  O O    . VAL A 1 51  ? 8.307   -24.271 7.635   1.00 0.00 ? 51  VAL A O    1 
ATOM 778  C CB   . VAL A 1 51  ? 9.918   -21.829 7.159   1.00 0.00 ? 51  VAL A CB   1 
ATOM 779  C CG1  . VAL A 1 51  ? 10.487  -20.437 7.335   1.00 0.00 ? 51  VAL A CG1  1 
ATOM 780  C CG2  . VAL A 1 51  ? 10.710  -22.850 7.957   1.00 0.00 ? 51  VAL A CG2  1 
ATOM 781  H H    . VAL A 1 51  ? 8.359   -22.249 9.625   1.00 0.00 ? 51  VAL A H    1 
ATOM 782  H HA   . VAL A 1 51  ? 7.928   -21.114 6.969   1.00 0.00 ? 51  VAL A HA   1 
ATOM 783  H HB   . VAL A 1 51  ? 9.998   -22.083 6.120   1.00 0.00 ? 51  VAL A HB   1 
ATOM 784  H HG11 . VAL A 1 51  ? 10.717  -20.027 6.367   1.00 0.00 ? 51  VAL A HG11 1 
ATOM 785  H HG12 . VAL A 1 51  ? 11.385  -20.487 7.930   1.00 0.00 ? 51  VAL A HG12 1 
ATOM 786  H HG13 . VAL A 1 51  ? 9.761   -19.812 7.825   1.00 0.00 ? 51  VAL A HG13 1 
ATOM 787  H HG21 . VAL A 1 51  ? 10.262  -23.825 7.839   1.00 0.00 ? 51  VAL A HG21 1 
ATOM 788  H HG22 . VAL A 1 51  ? 10.706  -22.575 9.001   1.00 0.00 ? 51  VAL A HG22 1 
ATOM 789  H HG23 . VAL A 1 51  ? 11.727  -22.877 7.594   1.00 0.00 ? 51  VAL A HG23 1 
ATOM 790  N N    . SER A 1 52  ? 6.968   -23.214 6.166   1.00 0.00 ? 52  SER A N    1 
ATOM 791  C CA   . SER A 1 52  ? 6.379   -24.441 5.636   1.00 0.00 ? 52  SER A CA   1 
ATOM 792  C C    . SER A 1 52  ? 7.447   -25.269 4.930   1.00 0.00 ? 52  SER A C    1 
ATOM 793  O O    . SER A 1 52  ? 7.693   -25.097 3.736   1.00 0.00 ? 52  SER A O    1 
ATOM 794  C CB   . SER A 1 52  ? 5.246   -24.111 4.665   1.00 0.00 ? 52  SER A CB   1 
ATOM 795  O OG   . SER A 1 52  ? 4.942   -25.222 3.839   1.00 0.00 ? 52  SER A OG   1 
ATOM 796  H H    . SER A 1 52  ? 6.689   -22.348 5.806   1.00 0.00 ? 52  SER A H    1 
ATOM 797  H HA   . SER A 1 52  ? 5.985   -25.012 6.458   1.00 0.00 ? 52  SER A HA   1 
ATOM 798  H HB2  . SER A 1 52  ? 4.363   -23.844 5.225   1.00 0.00 ? 52  SER A HB2  1 
ATOM 799  H HB3  . SER A 1 52  ? 5.541   -23.282 4.040   1.00 0.00 ? 52  SER A HB3  1 
ATOM 800  H HG   . SER A 1 52  ? 5.346   -25.100 2.977   1.00 0.00 ? 52  SER A HG   1 
ATOM 801  N N    . GLU A 1 53  ? 8.091   -26.154 5.682   1.00 0.00 ? 53  GLU A N    1 
ATOM 802  C CA   . GLU A 1 53  ? 9.148   -26.999 5.139   1.00 0.00 ? 53  GLU A CA   1 
ATOM 803  C C    . GLU A 1 53  ? 8.642   -28.402 4.803   1.00 0.00 ? 53  GLU A C    1 
ATOM 804  O O    . GLU A 1 53  ? 8.188   -29.139 5.678   1.00 0.00 ? 53  GLU A O    1 
ATOM 805  C CB   . GLU A 1 53  ? 10.306  -27.089 6.133   1.00 0.00 ? 53  GLU A CB   1 
ATOM 806  C CG   . GLU A 1 53  ? 11.521  -27.822 5.591   1.00 0.00 ? 53  GLU A CG   1 
ATOM 807  C CD   . GLU A 1 53  ? 12.183  -28.703 6.633   1.00 0.00 ? 53  GLU A CD   1 
ATOM 808  O OE1  . GLU A 1 53  ? 12.652  -28.162 7.656   1.00 0.00 ? 53  GLU A OE1  1 
ATOM 809  O OE2  . GLU A 1 53  ? 12.233  -29.933 6.424   1.00 0.00 ? 53  GLU A OE2  1 
ATOM 810  H H    . GLU A 1 53  ? 7.859   -26.233 6.629   1.00 0.00 ? 53  GLU A H    1 
ATOM 811  H HA   . GLU A 1 53  ? 9.505   -26.535 4.232   1.00 0.00 ? 53  GLU A HA   1 
ATOM 812  H HB2  . GLU A 1 53  ? 10.608  -26.090 6.407   1.00 0.00 ? 53  GLU A HB2  1 
ATOM 813  H HB3  . GLU A 1 53  ? 9.965   -27.607 7.017   1.00 0.00 ? 53  GLU A HB3  1 
ATOM 814  H HG2  . GLU A 1 53  ? 11.214  -28.440 4.761   1.00 0.00 ? 53  GLU A HG2  1 
ATOM 815  H HG3  . GLU A 1 53  ? 12.241  -27.092 5.247   1.00 0.00 ? 53  GLU A HG3  1 
ATOM 816  N N    . ASN A 1 54  ? 8.737   -28.755 3.523   1.00 0.00 ? 54  ASN A N    1 
ATOM 817  C CA   . ASN A 1 54  ? 8.311   -30.062 3.027   1.00 0.00 ? 54  ASN A CA   1 
ATOM 818  C C    . ASN A 1 54  ? 6.792   -30.208 3.072   1.00 0.00 ? 54  ASN A C    1 
ATOM 819  O O    . ASN A 1 54  ? 6.099   -29.827 2.129   1.00 0.00 ? 54  ASN A O    1 
ATOM 820  C CB   . ASN A 1 54  ? 8.989   -31.189 3.816   1.00 0.00 ? 54  ASN A CB   1 
ATOM 821  C CG   . ASN A 1 54  ? 10.431  -31.402 3.394   1.00 0.00 ? 54  ASN A CG   1 
ATOM 822  O OD1  . ASN A 1 54  ? 10.702  -32.026 2.368   1.00 0.00 ? 54  ASN A OD1  1 
ATOM 823  N ND2  . ASN A 1 54  ? 11.363  -30.885 4.186   1.00 0.00 ? 54  ASN A ND2  1 
ATOM 824  H H    . ASN A 1 54  ? 9.106   -28.116 2.890   1.00 0.00 ? 54  ASN A H    1 
ATOM 825  H HA   . ASN A 1 54  ? 8.625   -30.130 1.996   1.00 0.00 ? 54  ASN A HA   1 
ATOM 826  H HB2  . ASN A 1 54  ? 8.975   -30.948 4.867   1.00 0.00 ? 54  ASN A HB2  1 
ATOM 827  H HB3  . ASN A 1 54  ? 8.447   -32.109 3.656   1.00 0.00 ? 54  ASN A HB3  1 
ATOM 828  H HD21 . ASN A 1 54  ? 11.075  -30.402 4.987   1.00 0.00 ? 54  ASN A HD21 1 
ATOM 829  H HD22 . ASN A 1 54  ? 12.303  -31.007 3.935   1.00 0.00 ? 54  ASN A HD22 1 
ATOM 830  N N    . SER A 1 55  ? 6.277   -30.757 4.166   1.00 0.00 ? 55  SER A N    1 
ATOM 831  C CA   . SER A 1 55  ? 4.841   -30.943 4.316   1.00 0.00 ? 55  SER A CA   1 
ATOM 832  C C    . SER A 1 55  ? 4.298   -30.071 5.436   1.00 0.00 ? 55  SER A C    1 
ATOM 833  O O    . SER A 1 55  ? 3.160   -29.619 5.385   1.00 0.00 ? 55  SER A O    1 
ATOM 834  C CB   . SER A 1 55  ? 4.514   -32.410 4.597   1.00 0.00 ? 55  SER A CB   1 
ATOM 835  O OG   . SER A 1 55  ? 5.457   -32.982 5.486   1.00 0.00 ? 55  SER A OG   1 
ATOM 836  H H    . SER A 1 55  ? 6.878   -31.038 4.886   1.00 0.00 ? 55  SER A H    1 
ATOM 837  H HA   . SER A 1 55  ? 4.371   -30.650 3.389   1.00 0.00 ? 55  SER A HA   1 
ATOM 838  H HB2  . SER A 1 55  ? 3.532   -32.477 5.043   1.00 0.00 ? 55  SER A HB2  1 
ATOM 839  H HB3  . SER A 1 55  ? 4.527   -32.964 3.670   1.00 0.00 ? 55  SER A HB3  1 
ATOM 840  H HG   . SER A 1 55  ? 5.280   -33.920 5.581   1.00 0.00 ? 55  SER A HG   1 
ATOM 841  N N    . ARG A 1 56  ? 5.117   -29.844 6.452   1.00 0.00 ? 56  ARG A N    1 
ATOM 842  C CA   . ARG A 1 56  ? 4.711   -29.031 7.592   1.00 0.00 ? 56  ARG A CA   1 
ATOM 843  C C    . ARG A 1 56  ? 5.428   -27.689 7.578   1.00 0.00 ? 56  ARG A C    1 
ATOM 844  O O    . ARG A 1 56  ? 5.967   -27.278 6.551   1.00 0.00 ? 56  ARG A O    1 
ATOM 845  C CB   . ARG A 1 56  ? 4.997   -29.778 8.896   1.00 0.00 ? 56  ARG A CB   1 
ATOM 846  C CG   . ARG A 1 56  ? 6.479   -29.973 9.162   1.00 0.00 ? 56  ARG A CG   1 
ATOM 847  C CD   . ARG A 1 56  ? 6.979   -29.059 10.271  1.00 0.00 ? 56  ARG A CD   1 
ATOM 848  N NE   . ARG A 1 56  ? 7.779   -29.783 11.256  1.00 0.00 ? 56  ARG A NE   1 
ATOM 849  C CZ   . ARG A 1 56  ? 7.260   -30.521 12.236  1.00 0.00 ? 56  ARG A CZ   1 
ATOM 850  N NH1  . ARG A 1 56  ? 5.943   -30.637 12.364  1.00 0.00 ? 56  ARG A NH1  1 
ATOM 851  N NH2  . ARG A 1 56  ? 8.059   -31.145 13.090  1.00 0.00 ? 56  ARG A NH2  1 
ATOM 852  H H    . ARG A 1 56  ? 6.016   -30.237 6.441   1.00 0.00 ? 56  ARG A H    1 
ATOM 853  H HA   . ARG A 1 56  ? 3.651   -28.860 7.513   1.00 0.00 ? 56  ARG A HA   1 
ATOM 854  H HB2  . ARG A 1 56  ? 4.573   -29.222 9.719   1.00 0.00 ? 56  ARG A HB2  1 
ATOM 855  H HB3  . ARG A 1 56  ? 4.531   -30.751 8.851   1.00 0.00 ? 56  ARG A HB3  1 
ATOM 856  H HG2  . ARG A 1 56  ? 6.651   -30.999 9.450   1.00 0.00 ? 56  ARG A HG2  1 
ATOM 857  H HG3  . ARG A 1 56  ? 7.023   -29.756 8.256   1.00 0.00 ? 56  ARG A HG3  1 
ATOM 858  H HD2  . ARG A 1 56  ? 7.586   -28.282 9.832   1.00 0.00 ? 56  ARG A HD2  1 
ATOM 859  H HD3  . ARG A 1 56  ? 6.129   -28.614 10.767  1.00 0.00 ? 56  ARG A HD3  1 
ATOM 860  H HE   . ARG A 1 56  ? 8.754   -29.715 11.186  1.00 0.00 ? 56  ARG A HE   1 
ATOM 861  H HH11 . ARG A 1 56  ? 5.335   -30.170 11.722  1.00 0.00 ? 56  ARG A HH11 1 
ATOM 862  H HH12 . ARG A 1 56  ? 5.561   -31.193 13.101  1.00 0.00 ? 56  ARG A HH12 1 
ATOM 863  H HH21 . ARG A 1 56  ? 9.052   -31.062 12.998  1.00 0.00 ? 56  ARG A HH21 1 
ATOM 864  H HH22 . ARG A 1 56  ? 7.669   -31.699 13.825  1.00 0.00 ? 56  ARG A HH22 1 
ATOM 865  N N    . VAL A 1 57  ? 5.443   -27.007 8.719   1.00 0.00 ? 57  VAL A N    1 
ATOM 866  C CA   . VAL A 1 57  ? 6.109   -25.717 8.813   1.00 0.00 ? 57  VAL A CA   1 
ATOM 867  C C    . VAL A 1 57  ? 6.900   -25.601 10.111  1.00 0.00 ? 57  VAL A C    1 
ATOM 868  O O    . VAL A 1 57  ? 6.339   -25.654 11.206  1.00 0.00 ? 57  VAL A O    1 
ATOM 869  C CB   . VAL A 1 57  ? 5.113   -24.527 8.664   1.00 0.00 ? 57  VAL A CB   1 
ATOM 870  C CG1  . VAL A 1 57  ? 3.722   -25.014 8.282   1.00 0.00 ? 57  VAL A CG1  1 
ATOM 871  C CG2  . VAL A 1 57  ? 5.053   -23.667 9.920   1.00 0.00 ? 57  VAL A CG2  1 
ATOM 872  H H    . VAL A 1 57  ? 5.005   -27.380 9.510   1.00 0.00 ? 57  VAL A H    1 
ATOM 873  H HA   . VAL A 1 57  ? 6.806   -25.663 7.996   1.00 0.00 ? 57  VAL A HA   1 
ATOM 874  H HB   . VAL A 1 57  ? 5.470   -23.904 7.859   1.00 0.00 ? 57  VAL A HB   1 
ATOM 875  H HG11 . VAL A 1 57  ? 3.294   -25.562 9.105   1.00 0.00 ? 57  VAL A HG11 1 
ATOM 876  H HG12 . VAL A 1 57  ? 3.792   -25.657 7.419   1.00 0.00 ? 57  VAL A HG12 1 
ATOM 877  H HG13 . VAL A 1 57  ? 3.096   -24.166 8.049   1.00 0.00 ? 57  VAL A HG13 1 
ATOM 878  H HG21 . VAL A 1 57  ? 4.943   -24.298 10.785  1.00 0.00 ? 57  VAL A HG21 1 
ATOM 879  H HG22 . VAL A 1 57  ? 4.209   -22.993 9.857   1.00 0.00 ? 57  VAL A HG22 1 
ATOM 880  H HG23 . VAL A 1 57  ? 5.966   -23.097 10.005  1.00 0.00 ? 57  VAL A HG23 1 
ATOM 881  N N    . SER A 1 58  ? 8.217   -25.490 9.984   1.00 0.00 ? 58  SER A N    1 
ATOM 882  C CA   . SER A 1 58  ? 9.085   -25.410 11.149  1.00 0.00 ? 58  SER A CA   1 
ATOM 883  C C    . SER A 1 58  ? 9.195   -23.978 11.644  1.00 0.00 ? 58  SER A C    1 
ATOM 884  O O    . SER A 1 58  ? 8.779   -23.041 10.966  1.00 0.00 ? 58  SER A O    1 
ATOM 885  C CB   . SER A 1 58  ? 10.479  -25.936 10.799  1.00 0.00 ? 58  SER A CB   1 
ATOM 886  O OG   . SER A 1 58  ? 10.403  -27.191 10.147  1.00 0.00 ? 58  SER A OG   1 
ATOM 887  H H    . SER A 1 58  ? 8.625   -25.519 9.094   1.00 0.00 ? 58  SER A H    1 
ATOM 888  H HA   . SER A 1 58  ? 8.659   -26.021 11.927  1.00 0.00 ? 58  SER A HA   1 
ATOM 889  H HB2  . SER A 1 58  ? 10.973  -25.231 10.141  1.00 0.00 ? 58  SER A HB2  1 
ATOM 890  H HB3  . SER A 1 58  ? 11.057  -26.047 11.705  1.00 0.00 ? 58  SER A HB3  1 
ATOM 891  H HG   . SER A 1 58  ? 10.279  -27.056 9.204   1.00 0.00 ? 58  SER A HG   1 
ATOM 892  N N    . HIS A 1 59  ? 9.745   -23.817 12.841  1.00 0.00 ? 59  HIS A N    1 
ATOM 893  C CA   . HIS A 1 59  ? 9.892   -22.502 13.433  1.00 0.00 ? 59  HIS A CA   1 
ATOM 894  C C    . HIS A 1 59  ? 11.345  -22.207 13.775  1.00 0.00 ? 59  HIS A C    1 
ATOM 895  O O    . HIS A 1 59  ? 12.119  -23.104 14.110  1.00 0.00 ? 59  HIS A O    1 
ATOM 896  C CB   . HIS A 1 59  ? 9.034   -22.389 14.693  1.00 0.00 ? 59  HIS A CB   1 
ATOM 897  C CG   . HIS A 1 59  ? 7.570   -22.260 14.408  1.00 0.00 ? 59  HIS A CG   1 
ATOM 898  N ND1  . HIS A 1 59  ? 6.851   -23.214 13.721  1.00 0.00 ? 59  HIS A ND1  1 
ATOM 899  C CD2  . HIS A 1 59  ? 6.688   -21.282 14.724  1.00 0.00 ? 59  HIS A CD2  1 
ATOM 900  C CE1  . HIS A 1 59  ? 5.591   -22.829 13.625  1.00 0.00 ? 59  HIS A CE1  1 
ATOM 901  N NE2  . HIS A 1 59  ? 5.465   -21.661 14.227  1.00 0.00 ? 59  HIS A NE2  1 
ATOM 902  H H    . HIS A 1 59  ? 10.048  -24.601 13.339  1.00 0.00 ? 59  HIS A H    1 
ATOM 903  H HA   . HIS A 1 59  ? 9.550   -21.777 12.712  1.00 0.00 ? 59  HIS A HA   1 
ATOM 904  H HB2  . HIS A 1 59  ? 9.178   -23.270 15.299  1.00 0.00 ? 59  HIS A HB2  1 
ATOM 905  H HB3  . HIS A 1 59  ? 9.342   -21.517 15.253  1.00 0.00 ? 59  HIS A HB3  1 
ATOM 906  H HD1  . HIS A 1 59  ? 7.212   -24.050 13.356  1.00 0.00 ? 59  HIS A HD1  1 
ATOM 907  H HD2  . HIS A 1 59  ? 6.905   -20.374 15.269  1.00 0.00 ? 59  HIS A HD2  1 
ATOM 908  H HE1  . HIS A 1 59  ? 4.799   -23.378 13.137  1.00 0.00 ? 59  HIS A HE1  1 
ATOM 909  H HE2  . HIS A 1 59  ? 4.656   -21.110 14.225  1.00 0.00 ? 59  HIS A HE2  1 
ATOM 910  N N    . TYR A 1 60  ? 11.690  -20.933 13.710  1.00 0.00 ? 60  TYR A N    1 
ATOM 911  C CA   . TYR A 1 60  ? 13.030  -20.475 14.034  1.00 0.00 ? 60  TYR A CA   1 
ATOM 912  C C    . TYR A 1 60  ? 12.946  -19.327 15.027  1.00 0.00 ? 60  TYR A C    1 
ATOM 913  O O    . TYR A 1 60  ? 12.393  -18.269 14.727  1.00 0.00 ? 60  TYR A O    1 
ATOM 914  C CB   . TYR A 1 60  ? 13.773  -20.045 12.769  1.00 0.00 ? 60  TYR A CB   1 
ATOM 915  C CG   . TYR A 1 60  ? 14.059  -21.193 11.828  1.00 0.00 ? 60  TYR A CG   1 
ATOM 916  C CD1  . TYR A 1 60  ? 15.096  -22.082 12.079  1.00 0.00 ? 60  TYR A CD1  1 
ATOM 917  C CD2  . TYR A 1 60  ? 13.288  -21.391 10.692  1.00 0.00 ? 60  TYR A CD2  1 
ATOM 918  C CE1  . TYR A 1 60  ? 15.356  -23.134 11.221  1.00 0.00 ? 60  TYR A CE1  1 
ATOM 919  C CE2  . TYR A 1 60  ? 13.539  -22.439 9.831   1.00 0.00 ? 60  TYR A CE2  1 
ATOM 920  C CZ   . TYR A 1 60  ? 14.573  -23.307 10.099  1.00 0.00 ? 60  TYR A CZ   1 
ATOM 921  O OH   . TYR A 1 60  ? 14.825  -24.353 9.243   1.00 0.00 ? 60  TYR A OH   1 
ATOM 922  H H    . TYR A 1 60  ? 11.009  -20.276 13.458  1.00 0.00 ? 60  TYR A H    1 
ATOM 923  H HA   . TYR A 1 60  ? 13.558  -21.296 14.494  1.00 0.00 ? 60  TYR A HA   1 
ATOM 924  H HB2  . TYR A 1 60  ? 13.177  -19.319 12.237  1.00 0.00 ? 60  TYR A HB2  1 
ATOM 925  H HB3  . TYR A 1 60  ? 14.715  -19.598 13.047  1.00 0.00 ? 60  TYR A HB3  1 
ATOM 926  H HD1  . TYR A 1 60  ? 15.706  -21.943 12.959  1.00 0.00 ? 60  TYR A HD1  1 
ATOM 927  H HD2  . TYR A 1 60  ? 12.479  -20.712 10.482  1.00 0.00 ? 60  TYR A HD2  1 
ATOM 928  H HE1  . TYR A 1 60  ? 16.167  -23.814 11.434  1.00 0.00 ? 60  TYR A HE1  1 
ATOM 929  H HE2  . TYR A 1 60  ? 12.927  -22.573 8.953   1.00 0.00 ? 60  TYR A HE2  1 
ATOM 930  H HH   . TYR A 1 60  ? 15.118  -24.011 8.395   1.00 0.00 ? 60  TYR A HH   1 
ATOM 931  N N    . ILE A 1 61  ? 13.485  -19.547 16.214  1.00 0.00 ? 61  ILE A N    1 
ATOM 932  C CA   . ILE A 1 61  ? 13.454  -18.532 17.253  1.00 0.00 ? 61  ILE A CA   1 
ATOM 933  C C    . ILE A 1 61  ? 14.409  -17.386 16.953  1.00 0.00 ? 61  ILE A C    1 
ATOM 934  O O    . ILE A 1 61  ? 15.601  -17.589 16.720  1.00 0.00 ? 61  ILE A O    1 
ATOM 935  C CB   . ILE A 1 61  ? 13.782  -19.113 18.647  1.00 0.00 ? 61  ILE A CB   1 
ATOM 936  C CG1  . ILE A 1 61  ? 12.588  -19.906 19.182  1.00 0.00 ? 61  ILE A CG1  1 
ATOM 937  C CG2  . ILE A 1 61  ? 14.158  -17.998 19.620  1.00 0.00 ? 61  ILE A CG2  1 
ATOM 938  C CD1  . ILE A 1 61  ? 11.513  -19.034 19.794  1.00 0.00 ? 61  ILE A CD1  1 
ATOM 939  H H    . ILE A 1 61  ? 13.908  -20.411 16.382  1.00 0.00 ? 61  ILE A H    1 
ATOM 940  H HA   . ILE A 1 61  ? 12.449  -18.136 17.286  1.00 0.00 ? 61  ILE A HA   1 
ATOM 941  H HB   . ILE A 1 61  ? 14.627  -19.774 18.549  1.00 0.00 ? 61  ILE A HB   1 
ATOM 942  H HG12 . ILE A 1 61  ? 12.142  -20.461 18.372  1.00 0.00 ? 61  ILE A HG12 1 
ATOM 943  H HG13 . ILE A 1 61  ? 12.931  -20.594 19.940  1.00 0.00 ? 61  ILE A HG13 1 
ATOM 944  H HG21 . ILE A 1 61  ? 14.064  -18.359 20.633  1.00 0.00 ? 61  ILE A HG21 1 
ATOM 945  H HG22 . ILE A 1 61  ? 13.495  -17.156 19.472  1.00 0.00 ? 61  ILE A HG22 1 
ATOM 946  H HG23 . ILE A 1 61  ? 15.177  -17.690 19.438  1.00 0.00 ? 61  ILE A HG23 1 
ATOM 947  H HD11 . ILE A 1 61  ? 11.691  -18.003 19.521  1.00 0.00 ? 61  ILE A HD11 1 
ATOM 948  H HD12 . ILE A 1 61  ? 11.543  -19.130 20.869  1.00 0.00 ? 61  ILE A HD12 1 
ATOM 949  H HD13 . ILE A 1 61  ? 10.545  -19.343 19.429  1.00 0.00 ? 61  ILE A HD13 1 
ATOM 950  N N    . ILE A 1 62  ? 13.868  -16.180 17.003  1.00 0.00 ? 62  ILE A N    1 
ATOM 951  C CA   . ILE A 1 62  ? 14.644  -14.975 16.785  1.00 0.00 ? 62  ILE A CA   1 
ATOM 952  C C    . ILE A 1 62  ? 14.847  -14.277 18.121  1.00 0.00 ? 62  ILE A C    1 
ATOM 953  O O    . ILE A 1 62  ? 14.003  -14.382 19.007  1.00 0.00 ? 62  ILE A O    1 
ATOM 954  C CB   . ILE A 1 62  ? 13.939  -14.016 15.810  1.00 0.00 ? 62  ILE A CB   1 
ATOM 955  C CG1  . ILE A 1 62  ? 13.749  -14.682 14.446  1.00 0.00 ? 62  ILE A CG1  1 
ATOM 956  C CG2  . ILE A 1 62  ? 14.728  -12.725 15.675  1.00 0.00 ? 62  ILE A CG2  1 
ATOM 957  C CD1  . ILE A 1 62  ? 12.299  -14.934 14.100  1.00 0.00 ? 62  ILE A CD1  1 
ATOM 958  H H    . ILE A 1 62  ? 12.918  -16.097 17.225  1.00 0.00 ? 62  ILE A H    1 
ATOM 959  H HA   . ILE A 1 62  ? 15.605  -15.253 16.372  1.00 0.00 ? 62  ILE A HA   1 
ATOM 960  H HB   . ILE A 1 62  ? 12.971  -13.773 16.220  1.00 0.00 ? 62  ILE A HB   1 
ATOM 961  H HG12 . ILE A 1 62  ? 14.167  -14.049 13.679  1.00 0.00 ? 62  ILE A HG12 1 
ATOM 962  H HG13 . ILE A 1 62  ? 14.262  -15.633 14.441  1.00 0.00 ? 62  ILE A HG13 1 
ATOM 963  H HG21 . ILE A 1 62  ? 15.666  -12.927 15.180  1.00 0.00 ? 62  ILE A HG21 1 
ATOM 964  H HG22 . ILE A 1 62  ? 14.920  -12.319 16.657  1.00 0.00 ? 62  ILE A HG22 1 
ATOM 965  H HG23 . ILE A 1 62  ? 14.160  -12.014 15.095  1.00 0.00 ? 62  ILE A HG23 1 
ATOM 966  H HD11 . ILE A 1 62  ? 11.954  -14.168 13.421  1.00 0.00 ? 62  ILE A HD11 1 
ATOM 967  H HD12 . ILE A 1 62  ? 11.703  -14.913 15.002  1.00 0.00 ? 62  ILE A HD12 1 
ATOM 968  H HD13 . ILE A 1 62  ? 12.205  -15.901 13.628  1.00 0.00 ? 62  ILE A HD13 1 
ATOM 969  N N    . ASN A 1 63  ? 15.961  -13.578 18.280  1.00 0.00 ? 63  ASN A N    1 
ATOM 970  C CA   . ASN A 1 63  ? 16.234  -12.891 19.539  1.00 0.00 ? 63  ASN A CA   1 
ATOM 971  C C    . ASN A 1 63  ? 16.306  -11.387 19.347  1.00 0.00 ? 63  ASN A C    1 
ATOM 972  O O    . ASN A 1 63  ? 17.249  -10.865 18.756  1.00 0.00 ? 63  ASN A O    1 
ATOM 973  C CB   . ASN A 1 63  ? 17.524  -13.420 20.167  1.00 0.00 ? 63  ASN A CB   1 
ATOM 974  C CG   . ASN A 1 63  ? 17.284  -14.605 21.092  1.00 0.00 ? 63  ASN A CG   1 
ATOM 975  O OD1  . ASN A 1 63  ? 18.137  -14.941 21.914  1.00 0.00 ? 63  ASN A OD1  1 
ATOM 976  N ND2  . ASN A 1 63  ? 16.122  -15.247 20.967  1.00 0.00 ? 63  ASN A ND2  1 
ATOM 977  H H    . ASN A 1 63  ? 16.611  -13.526 17.546  1.00 0.00 ? 63  ASN A H    1 
ATOM 978  H HA   . ASN A 1 63  ? 15.415  -13.104 20.209  1.00 0.00 ? 63  ASN A HA   1 
ATOM 979  H HB2  . ASN A 1 63  ? 18.195  -13.733 19.381  1.00 0.00 ? 63  ASN A HB2  1 
ATOM 980  H HB3  . ASN A 1 63  ? 17.986  -12.629 20.736  1.00 0.00 ? 63  ASN A HB3  1 
ATOM 981  H HD21 . ASN A 1 63  ? 15.485  -14.931 20.294  1.00 0.00 ? 63  ASN A HD21 1 
ATOM 982  H HD22 . ASN A 1 63  ? 15.951  -16.014 21.554  1.00 0.00 ? 63  ASN A HD22 1 
ATOM 983  N N    . SER A 1 64  ? 15.286  -10.702 19.850  1.00 0.00 ? 64  SER A N    1 
ATOM 984  C CA   . SER A 1 64  ? 15.201  -9.250  19.738  1.00 0.00 ? 64  SER A CA   1 
ATOM 985  C C    . SER A 1 64  ? 15.556  -8.559  21.047  1.00 0.00 ? 64  SER A C    1 
ATOM 986  O O    . SER A 1 64  ? 15.284  -9.073  22.132  1.00 0.00 ? 64  SER A O    1 
ATOM 987  C CB   . SER A 1 64  ? 13.791  -8.839  19.307  1.00 0.00 ? 64  SER A CB   1 
ATOM 988  O OG   . SER A 1 64  ? 13.777  -7.514  18.807  1.00 0.00 ? 64  SER A OG   1 
ATOM 989  H H    . SER A 1 64  ? 14.568  -11.191 20.305  1.00 0.00 ? 64  SER A H    1 
ATOM 990  H HA   . SER A 1 64  ? 15.902  -8.937  18.981  1.00 0.00 ? 64  SER A HA   1 
ATOM 991  H HB2  . SER A 1 64  ? 13.444  -9.506  18.532  1.00 0.00 ? 64  SER A HB2  1 
ATOM 992  H HB3  . SER A 1 64  ? 13.126  -8.898  20.156  1.00 0.00 ? 64  SER A HB3  1 
ATOM 993  H HG   . SER A 1 64  ? 13.470  -7.517  17.898  1.00 0.00 ? 64  SER A HG   1 
ATOM 994  N N    . SER A 1 65  ? 16.159  -7.381  20.931  1.00 0.00 ? 65  SER A N    1 
ATOM 995  C CA   . SER A 1 65  ? 16.551  -6.598  22.098  1.00 0.00 ? 65  SER A CA   1 
ATOM 996  C C    . SER A 1 65  ? 15.601  -5.418  22.306  1.00 0.00 ? 65  SER A C    1 
ATOM 997  O O    . SER A 1 65  ? 14.973  -5.294  23.358  1.00 0.00 ? 65  SER A O    1 
ATOM 998  C CB   . SER A 1 65  ? 17.986  -6.093  21.941  1.00 0.00 ? 65  SER A CB   1 
ATOM 999  O OG   . SER A 1 65  ? 18.039  -4.952  21.103  1.00 0.00 ? 65  SER A OG   1 
ATOM 1000 H H    . SER A 1 65  ? 16.342  -7.028  20.034  1.00 0.00 ? 65  SER A H    1 
ATOM 1001 H HA   . SER A 1 65  ? 16.498  -7.242  22.961  1.00 0.00 ? 65  SER A HA   1 
ATOM 1002 H HB2  . SER A 1 65  ? 18.380  -5.829  22.911  1.00 0.00 ? 65  SER A HB2  1 
ATOM 1003 H HB3  . SER A 1 65  ? 18.594  -6.873  21.507  1.00 0.00 ? 65  SER A HB3  1 
ATOM 1004 H HG   . SER A 1 65  ? 17.804  -4.171  21.609  1.00 0.00 ? 65  SER A HG   1 
ATOM 1005 N N    . GLY A 1 66  ? 15.501  -4.554  21.298  1.00 0.00 ? 66  GLY A N    1 
ATOM 1006 C CA   . GLY A 1 66  ? 14.625  -3.399  21.390  1.00 0.00 ? 66  GLY A CA   1 
ATOM 1007 C C    . GLY A 1 66  ? 15.326  -2.178  21.963  1.00 0.00 ? 66  GLY A C    1 
ATOM 1008 O O    . GLY A 1 66  ? 15.154  -1.859  23.139  1.00 0.00 ? 66  GLY A O    1 
ATOM 1009 H H    . GLY A 1 66  ? 16.025  -4.706  20.483  1.00 0.00 ? 66  GLY A H    1 
ATOM 1010 H HA2  . GLY A 1 66  ? 14.258  -3.158  20.404  1.00 0.00 ? 66  GLY A HA2  1 
ATOM 1011 H HA3  . GLY A 1 66  ? 13.785  -3.647  22.023  1.00 0.00 ? 66  GLY A HA3  1 
ATOM 1012 N N    . PRO A 1 67  ? 16.139  -1.479  21.152  1.00 0.00 ? 67  PRO A N    1 
ATOM 1013 C CA   . PRO A 1 67  ? 16.881  -0.295  21.587  1.00 0.00 ? 67  PRO A CA   1 
ATOM 1014 C C    . PRO A 1 67  ? 16.024  0.969   21.629  1.00 0.00 ? 67  PRO A C    1 
ATOM 1015 O O    . PRO A 1 67  ? 16.220  1.832   22.484  1.00 0.00 ? 67  PRO A O    1 
ATOM 1016 C CB   . PRO A 1 67  ? 17.988  -0.145  20.527  1.00 0.00 ? 67  PRO A CB   1 
ATOM 1017 C CG   . PRO A 1 67  ? 17.833  -1.309  19.597  1.00 0.00 ? 67  PRO A CG   1 
ATOM 1018 C CD   . PRO A 1 67  ? 16.420  -1.792  19.751  1.00 0.00 ? 67  PRO A CD   1 
ATOM 1019 H HA   . PRO A 1 67  ? 17.332  -0.449  22.557  1.00 0.00 ? 67  PRO A HA   1 
ATOM 1020 H HB2  . PRO A 1 67  ? 17.861  0.791   20.004  1.00 0.00 ? 67  PRO A HB2  1 
ATOM 1021 H HB3  . PRO A 1 67  ? 18.953  -0.160  21.013  1.00 0.00 ? 67  PRO A HB3  1 
ATOM 1022 H HG2  . PRO A 1 67  ? 18.010  -0.991  18.581  1.00 0.00 ? 67  PRO A HG2  1 
ATOM 1023 H HG3  . PRO A 1 67  ? 18.526  -2.090  19.872  1.00 0.00 ? 67  PRO A HG3  1 
ATOM 1024 H HD2  . PRO A 1 67  ? 15.759  -1.251  19.090  1.00 0.00 ? 67  PRO A HD2  1 
ATOM 1025 H HD3  . PRO A 1 67  ? 16.358  -2.854  19.571  1.00 0.00 ? 67  PRO A HD3  1 
ATOM 1026 N N    . ARG A 1 68  ? 15.082  1.083   20.696  1.00 0.00 ? 68  ARG A N    1 
ATOM 1027 C CA   . ARG A 1 68  ? 14.212  2.255   20.633  1.00 0.00 ? 68  ARG A CA   1 
ATOM 1028 C C    . ARG A 1 68  ? 12.740  1.865   20.735  1.00 0.00 ? 68  ARG A C    1 
ATOM 1029 O O    . ARG A 1 68  ? 12.372  0.719   20.479  1.00 0.00 ? 68  ARG A O    1 
ATOM 1030 C CB   . ARG A 1 68  ? 14.459  3.038   19.338  1.00 0.00 ? 68  ARG A CB   1 
ATOM 1031 C CG   . ARG A 1 68  ? 14.612  2.164   18.101  1.00 0.00 ? 68  ARG A CG   1 
ATOM 1032 C CD   . ARG A 1 68  ? 15.583  2.777   17.104  1.00 0.00 ? 68  ARG A CD   1 
ATOM 1033 N NE   . ARG A 1 68  ? 15.198  4.135   16.727  1.00 0.00 ? 68  ARG A NE   1 
ATOM 1034 C CZ   . ARG A 1 68  ? 15.973  4.957   16.023  1.00 0.00 ? 68  ARG A CZ   1 
ATOM 1035 N NH1  . ARG A 1 68  ? 17.175  4.564   15.621  1.00 0.00 ? 68  ARG A NH1  1 
ATOM 1036 N NH2  . ARG A 1 68  ? 15.546  6.176   15.722  1.00 0.00 ? 68  ARG A NH2  1 
ATOM 1037 H H    . ARG A 1 68  ? 14.974  0.368   20.036  1.00 0.00 ? 68  ARG A H    1 
ATOM 1038 H HA   . ARG A 1 68  ? 14.457  2.889   21.472  1.00 0.00 ? 68  ARG A HA   1 
ATOM 1039 H HB2  . ARG A 1 68  ? 13.628  3.708   19.173  1.00 0.00 ? 68  ARG A HB2  1 
ATOM 1040 H HB3  . ARG A 1 68  ? 15.360  3.622   19.451  1.00 0.00 ? 68  ARG A HB3  1 
ATOM 1041 H HG2  . ARG A 1 68  ? 14.984  1.196   18.396  1.00 0.00 ? 68  ARG A HG2  1 
ATOM 1042 H HG3  . ARG A 1 68  ? 13.647  2.054   17.630  1.00 0.00 ? 68  ARG A HG3  1 
ATOM 1043 H HD2  . ARG A 1 68  ? 16.567  2.804   17.549  1.00 0.00 ? 68  ARG A HD2  1 
ATOM 1044 H HD3  . ARG A 1 68  ? 15.605  2.160   16.218  1.00 0.00 ? 68  ARG A HD3  1 
ATOM 1045 H HE   . ARG A 1 68  ? 14.315  4.451   17.012  1.00 0.00 ? 68  ARG A HE   1 
ATOM 1046 H HH11 . ARG A 1 68  ? 17.503  3.646   15.844  1.00 0.00 ? 68  ARG A HH11 1 
ATOM 1047 H HH12 . ARG A 1 68  ? 17.753  5.187   15.093  1.00 0.00 ? 68  ARG A HH12 1 
ATOM 1048 H HH21 . ARG A 1 68  ? 14.641  6.477   16.022  1.00 0.00 ? 68  ARG A HH21 1 
ATOM 1049 H HH22 . ARG A 1 68  ? 16.128  6.794   15.194  1.00 0.00 ? 68  ARG A HH22 1 
ATOM 1050 N N    . PRO A 1 69  ? 11.873  2.825   21.113  1.00 0.00 ? 69  PRO A N    1 
ATOM 1051 C CA   . PRO A 1 69  ? 10.433  2.587   21.252  1.00 0.00 ? 69  PRO A CA   1 
ATOM 1052 C C    . PRO A 1 69  ? 9.833   1.928   20.011  1.00 0.00 ? 69  PRO A C    1 
ATOM 1053 O O    . PRO A 1 69  ? 10.272  2.183   18.890  1.00 0.00 ? 69  PRO A O    1 
ATOM 1054 C CB   . PRO A 1 69  ? 9.841   3.992   21.455  1.00 0.00 ? 69  PRO A CB   1 
ATOM 1055 C CG   . PRO A 1 69  ? 10.947  4.946   21.143  1.00 0.00 ? 69  PRO A CG   1 
ATOM 1056 C CD   . PRO A 1 69  ? 12.223  4.214   21.435  1.00 0.00 ? 69  PRO A CD   1 
ATOM 1057 H HA   . PRO A 1 69  ? 10.221  1.977   22.117  1.00 0.00 ? 69  PRO A HA   1 
ATOM 1058 H HB2  . PRO A 1 69  ? 9.003   4.130   20.789  1.00 0.00 ? 69  PRO A HB2  1 
ATOM 1059 H HB3  . PRO A 1 69  ? 9.510   4.097   22.478  1.00 0.00 ? 69  PRO A HB3  1 
ATOM 1060 H HG2  . PRO A 1 69  ? 10.907  5.226   20.100  1.00 0.00 ? 69  PRO A HG2  1 
ATOM 1061 H HG3  . PRO A 1 69  ? 10.865  5.821   21.771  1.00 0.00 ? 69  PRO A HG3  1 
ATOM 1062 H HD2  . PRO A 1 69  ? 13.020  4.572   20.801  1.00 0.00 ? 69  PRO A HD2  1 
ATOM 1063 H HD3  . PRO A 1 69  ? 12.489  4.314   22.477  1.00 0.00 ? 69  PRO A HD3  1 
ATOM 1064 N N    . PRO A 1 70  ? 8.824   1.061   20.198  1.00 0.00 ? 70  PRO A N    1 
ATOM 1065 C CA   . PRO A 1 70  ? 8.172   0.357   19.097  1.00 0.00 ? 70  PRO A CA   1 
ATOM 1066 C C    . PRO A 1 70  ? 7.054   1.169   18.449  1.00 0.00 ? 70  PRO A C    1 
ATOM 1067 O O    . PRO A 1 70  ? 6.936   1.210   17.224  1.00 0.00 ? 70  PRO A O    1 
ATOM 1068 C CB   . PRO A 1 70  ? 7.600   -0.876  19.787  1.00 0.00 ? 70  PRO A CB   1 
ATOM 1069 C CG   . PRO A 1 70  ? 7.262   -0.411  21.163  1.00 0.00 ? 70  PRO A CG   1 
ATOM 1070 C CD   . PRO A 1 70  ? 8.243   0.686   21.503  1.00 0.00 ? 70  PRO A CD   1 
ATOM 1071 H HA   . PRO A 1 70  ? 8.882   0.054   18.342  1.00 0.00 ? 70  PRO A HA   1 
ATOM 1072 H HB2  . PRO A 1 70  ? 6.723   -1.216  19.256  1.00 0.00 ? 70  PRO A HB2  1 
ATOM 1073 H HB3  . PRO A 1 70  ? 8.344   -1.659  19.806  1.00 0.00 ? 70  PRO A HB3  1 
ATOM 1074 H HG2  . PRO A 1 70  ? 6.253   -0.028  21.181  1.00 0.00 ? 70  PRO A HG2  1 
ATOM 1075 H HG3  . PRO A 1 70  ? 7.362   -1.230  21.860  1.00 0.00 ? 70  PRO A HG3  1 
ATOM 1076 H HD2  . PRO A 1 70  ? 7.730   1.524   21.950  1.00 0.00 ? 70  PRO A HD2  1 
ATOM 1077 H HD3  . PRO A 1 70  ? 9.006   0.313   22.170  1.00 0.00 ? 70  PRO A HD3  1 
ATOM 1078 N N    . VAL A 1 71  ? 6.226   1.803   19.273  1.00 0.00 ? 71  VAL A N    1 
ATOM 1079 C CA   . VAL A 1 71  ? 5.111   2.598   18.766  1.00 0.00 ? 71  VAL A CA   1 
ATOM 1080 C C    . VAL A 1 71  ? 5.099   4.007   19.360  1.00 0.00 ? 71  VAL A C    1 
ATOM 1081 O O    . VAL A 1 71  ? 5.557   4.226   20.481  1.00 0.00 ? 71  VAL A O    1 
ATOM 1082 C CB   . VAL A 1 71  ? 3.765   1.914   19.064  1.00 0.00 ? 71  VAL A CB   1 
ATOM 1083 C CG1  . VAL A 1 71  ? 3.649   0.606   18.297  1.00 0.00 ? 71  VAL A CG1  1 
ATOM 1084 C CG2  . VAL A 1 71  ? 3.609   1.681   20.557  1.00 0.00 ? 71  VAL A CG2  1 
ATOM 1085 H H    . VAL A 1 71  ? 6.360   1.728   20.241  1.00 0.00 ? 71  VAL A H    1 
ATOM 1086 H HA   . VAL A 1 71  ? 5.219   2.672   17.697  1.00 0.00 ? 71  VAL A HA   1 
ATOM 1087 H HB   . VAL A 1 71  ? 2.971   2.568   18.737  1.00 0.00 ? 71  VAL A HB   1 
ATOM 1088 H HG11 . VAL A 1 71  ? 4.624   0.151   18.212  1.00 0.00 ? 71  VAL A HG11 1 
ATOM 1089 H HG12 . VAL A 1 71  ? 3.256   0.800   17.311  1.00 0.00 ? 71  VAL A HG12 1 
ATOM 1090 H HG13 . VAL A 1 71  ? 2.985   -0.063  18.825  1.00 0.00 ? 71  VAL A HG13 1 
ATOM 1091 H HG21 . VAL A 1 71  ? 2.603   1.353   20.767  1.00 0.00 ? 71  VAL A HG21 1 
ATOM 1092 H HG22 . VAL A 1 71  ? 3.806   2.603   21.085  1.00 0.00 ? 71  VAL A HG22 1 
ATOM 1093 H HG23 . VAL A 1 71  ? 4.310   0.926   20.876  1.00 0.00 ? 71  VAL A HG23 1 
ATOM 1094 N N    . PRO A 1 72  ? 4.568   4.985   18.600  1.00 0.00 ? 72  PRO A N    1 
ATOM 1095 C CA   . PRO A 1 72  ? 4.488   6.386   19.028  1.00 0.00 ? 72  PRO A CA   1 
ATOM 1096 C C    . PRO A 1 72  ? 3.904   6.570   20.433  1.00 0.00 ? 72  PRO A C    1 
ATOM 1097 O O    . PRO A 1 72  ? 4.458   7.317   21.239  1.00 0.00 ? 72  PRO A O    1 
ATOM 1098 C CB   . PRO A 1 72  ? 3.576   7.048   17.980  1.00 0.00 ? 72  PRO A CB   1 
ATOM 1099 C CG   . PRO A 1 72  ? 3.040   5.938   17.133  1.00 0.00 ? 72  PRO A CG   1 
ATOM 1100 C CD   . PRO A 1 72  ? 4.011   4.801   17.254  1.00 0.00 ? 72  PRO A CD   1 
ATOM 1101 H HA   . PRO A 1 72  ? 5.461   6.855   18.993  1.00 0.00 ? 72  PRO A HA   1 
ATOM 1102 H HB2  . PRO A 1 72  ? 2.778   7.576   18.481  1.00 0.00 ? 72  PRO A HB2  1 
ATOM 1103 H HB3  . PRO A 1 72  ? 4.155   7.744   17.391  1.00 0.00 ? 72  PRO A HB3  1 
ATOM 1104 H HG2  . PRO A 1 72  ? 2.068   5.638   17.493  1.00 0.00 ? 72  PRO A HG2  1 
ATOM 1105 H HG3  . PRO A 1 72  ? 2.973   6.264   16.106  1.00 0.00 ? 72  PRO A HG3  1 
ATOM 1106 H HD2  . PRO A 1 72  ? 3.498   3.854   17.173  1.00 0.00 ? 72  PRO A HD2  1 
ATOM 1107 H HD3  . PRO A 1 72  ? 4.783   4.881   16.503  1.00 0.00 ? 72  PRO A HD3  1 
ATOM 1108 N N    . PRO A 1 73  ? 2.777   5.903   20.757  1.00 0.00 ? 73  PRO A N    1 
ATOM 1109 C CA   . PRO A 1 73  ? 2.142   6.022   22.081  1.00 0.00 ? 73  PRO A CA   1 
ATOM 1110 C C    . PRO A 1 73  ? 3.075   5.584   23.203  1.00 0.00 ? 73  PRO A C    1 
ATOM 1111 O O    . PRO A 1 73  ? 4.296   5.595   23.043  1.00 0.00 ? 73  PRO A O    1 
ATOM 1112 C CB   . PRO A 1 73  ? 0.935   5.079   21.981  1.00 0.00 ? 73  PRO A CB   1 
ATOM 1113 C CG   . PRO A 1 73  ? 1.294   4.141   20.890  1.00 0.00 ? 73  PRO A CG   1 
ATOM 1114 C CD   . PRO A 1 73  ? 2.026   4.982   19.889  1.00 0.00 ? 73  PRO A CD   1 
ATOM 1115 H HA   . PRO A 1 73  ? 1.804   7.030   22.268  1.00 0.00 ? 73  PRO A HA   1 
ATOM 1116 H HB2  . PRO A 1 73  ? 0.792   4.561   22.917  1.00 0.00 ? 73  PRO A HB2  1 
ATOM 1117 H HB3  . PRO A 1 73  ? 0.049   5.646   21.737  1.00 0.00 ? 73  PRO A HB3  1 
ATOM 1118 H HG2  . PRO A 1 73  ? 1.942   3.362   21.278  1.00 0.00 ? 73  PRO A HG2  1 
ATOM 1119 H HG3  . PRO A 1 73  ? 0.404   3.716   20.452  1.00 0.00 ? 73  PRO A HG3  1 
ATOM 1120 H HD2  . PRO A 1 73  ? 2.683   4.373   19.294  1.00 0.00 ? 73  PRO A HD2  1 
ATOM 1121 H HD3  . PRO A 1 73  ? 1.330   5.521   19.264  1.00 0.00 ? 73  PRO A HD3  1 
ATOM 1122 N N    . SER A 1 74  ? 2.496   5.198   24.340  1.00 0.00 ? 74  SER A N    1 
ATOM 1123 C CA   . SER A 1 74  ? 3.275   4.754   25.489  1.00 0.00 ? 74  SER A CA   1 
ATOM 1124 C C    . SER A 1 74  ? 3.846   5.955   26.248  1.00 0.00 ? 74  SER A C    1 
ATOM 1125 O O    . SER A 1 74  ? 4.753   6.631   25.764  1.00 0.00 ? 74  SER A O    1 
ATOM 1126 C CB   . SER A 1 74  ? 4.395   3.809   25.035  1.00 0.00 ? 74  SER A CB   1 
ATOM 1127 O OG   . SER A 1 74  ? 5.629   4.494   24.896  1.00 0.00 ? 74  SER A OG   1 
ATOM 1128 H H    . SER A 1 74  ? 1.519   5.214   24.407  1.00 0.00 ? 74  SER A H    1 
ATOM 1129 H HA   . SER A 1 74  ? 2.609   4.213   26.144  1.00 0.00 ? 74  SER A HA   1 
ATOM 1130 H HB2  . SER A 1 74  ? 4.516   3.020   25.762  1.00 0.00 ? 74  SER A HB2  1 
ATOM 1131 H HB3  . SER A 1 74  ? 4.126   3.378   24.076  1.00 0.00 ? 74  SER A HB3  1 
ATOM 1132 H HG   . SER A 1 74  ? 5.483   5.328   24.443  1.00 0.00 ? 74  SER A HG   1 
ATOM 1133 N N    . PRO A 1 75  ? 3.306   6.245   27.448  1.00 0.00 ? 75  PRO A N    1 
ATOM 1134 C CA   . PRO A 1 75  ? 3.750   7.378   28.267  1.00 0.00 ? 75  PRO A CA   1 
ATOM 1135 C C    . PRO A 1 75  ? 5.268   7.484   28.381  1.00 0.00 ? 75  PRO A C    1 
ATOM 1136 O O    . PRO A 1 75  ? 5.863   8.463   27.934  1.00 0.00 ? 75  PRO A O    1 
ATOM 1137 C CB   . PRO A 1 75  ? 3.127   7.087   29.631  1.00 0.00 ? 75  PRO A CB   1 
ATOM 1138 C CG   . PRO A 1 75  ? 1.892   6.316   29.320  1.00 0.00 ? 75  PRO A CG   1 
ATOM 1139 C CD   . PRO A 1 75  ? 2.205   5.500   28.094  1.00 0.00 ? 75  PRO A CD   1 
ATOM 1140 H HA   . PRO A 1 75  ? 3.359   8.311   27.888  1.00 0.00 ? 75  PRO A HA   1 
ATOM 1141 H HB2  . PRO A 1 75  ? 3.816   6.508   30.229  1.00 0.00 ? 75  PRO A HB2  1 
ATOM 1142 H HB3  . PRO A 1 75  ? 2.897   8.015   30.132  1.00 0.00 ? 75  PRO A HB3  1 
ATOM 1143 H HG2  . PRO A 1 75  ? 1.646   5.668   30.149  1.00 0.00 ? 75  PRO A HG2  1 
ATOM 1144 H HG3  . PRO A 1 75  ? 1.077   6.995   29.119  1.00 0.00 ? 75  PRO A HG3  1 
ATOM 1145 H HD2  . PRO A 1 75  ? 2.526   4.508   28.375  1.00 0.00 ? 75  PRO A HD2  1 
ATOM 1146 H HD3  . PRO A 1 75  ? 1.343   5.449   27.446  1.00 0.00 ? 75  PRO A HD3  1 
ATOM 1147 N N    . ALA A 1 76  ? 5.891   6.480   28.992  1.00 0.00 ? 76  ALA A N    1 
ATOM 1148 C CA   . ALA A 1 76  ? 7.336   6.484   29.170  1.00 0.00 ? 76  ALA A CA   1 
ATOM 1149 C C    . ALA A 1 76  ? 7.856   5.093   29.491  1.00 0.00 ? 76  ALA A C    1 
ATOM 1150 O O    . ALA A 1 76  ? 7.386   4.445   30.426  1.00 0.00 ? 76  ALA A O    1 
ATOM 1151 C CB   . ALA A 1 76  ? 7.718   7.441   30.279  1.00 0.00 ? 76  ALA A CB   1 
ATOM 1152 H H    . ALA A 1 76  ? 5.370   5.727   29.337  1.00 0.00 ? 76  ALA A H    1 
ATOM 1153 H HA   . ALA A 1 76  ? 7.789   6.828   28.252  1.00 0.00 ? 76  ALA A HA   1 
ATOM 1154 H HB1  . ALA A 1 76  ? 7.587   8.457   29.939  1.00 0.00 ? 76  ALA A HB1  1 
ATOM 1155 H HB2  . ALA A 1 76  ? 8.750   7.280   30.550  1.00 0.00 ? 76  ALA A HB2  1 
ATOM 1156 H HB3  . ALA A 1 76  ? 7.087   7.260   31.135  1.00 0.00 ? 76  ALA A HB3  1 
ATOM 1157 N N    . GLN A 1 77  ? 8.829   4.640   28.714  1.00 0.00 ? 77  GLN A N    1 
ATOM 1158 C CA   . GLN A 1 77  ? 9.415   3.325   28.915  1.00 0.00 ? 77  GLN A CA   1 
ATOM 1159 C C    . GLN A 1 77  ? 10.871  3.303   28.454  1.00 0.00 ? 77  GLN A C    1 
ATOM 1160 O O    . GLN A 1 77  ? 11.167  2.938   27.316  1.00 0.00 ? 77  GLN A O    1 
ATOM 1161 C CB   . GLN A 1 77  ? 8.600   2.274   28.161  1.00 0.00 ? 77  GLN A CB   1 
ATOM 1162 C CG   . GLN A 1 77  ? 7.230   2.020   28.770  1.00 0.00 ? 77  GLN A CG   1 
ATOM 1163 C CD   . GLN A 1 77  ? 7.297   1.172   30.025  1.00 0.00 ? 77  GLN A CD   1 
ATOM 1164 O OE1  . GLN A 1 77  ? 7.421   -0.050  29.956  1.00 0.00 ? 77  GLN A OE1  1 
ATOM 1165 N NE2  . GLN A 1 77  ? 7.215   1.819   31.182  1.00 0.00 ? 77  GLN A NE2  1 
ATOM 1166 H H    . GLN A 1 77  ? 9.163   5.208   27.987  1.00 0.00 ? 77  GLN A H    1 
ATOM 1167 H HA   . GLN A 1 77  ? 9.380   3.104   29.972  1.00 0.00 ? 77  GLN A HA   1 
ATOM 1168 H HB2  . GLN A 1 77  ? 8.459   2.609   27.145  1.00 0.00 ? 77  GLN A HB2  1 
ATOM 1169 H HB3  . GLN A 1 77  ? 9.146   1.343   28.155  1.00 0.00 ? 77  GLN A HB3  1 
ATOM 1170 H HG2  . GLN A 1 77  ? 6.779   2.971   29.019  1.00 0.00 ? 77  GLN A HG2  1 
ATOM 1171 H HG3  . GLN A 1 77  ? 6.615   1.513   28.041  1.00 0.00 ? 77  GLN A HG3  1 
ATOM 1172 H HE21 . GLN A 1 77  ? 7.116   2.794   31.161  1.00 0.00 ? 77  GLN A HE21 1 
ATOM 1173 H HE22 . GLN A 1 77  ? 7.255   1.295   32.009  1.00 0.00 ? 77  GLN A HE22 1 
ATOM 1174 N N    . PRO A 1 78  ? 11.802  3.702   29.339  1.00 0.00 ? 78  PRO A N    1 
ATOM 1175 C CA   . PRO A 1 78  ? 13.234  3.737   29.025  1.00 0.00 ? 78  PRO A CA   1 
ATOM 1176 C C    . PRO A 1 78  ? 13.734  2.429   28.411  1.00 0.00 ? 78  PRO A C    1 
ATOM 1177 O O    . PRO A 1 78  ? 13.556  1.356   28.989  1.00 0.00 ? 78  PRO A O    1 
ATOM 1178 C CB   . PRO A 1 78  ? 13.887  3.968   30.388  1.00 0.00 ? 78  PRO A CB   1 
ATOM 1179 C CG   . PRO A 1 78  ? 12.854  4.689   31.183  1.00 0.00 ? 78  PRO A CG   1 
ATOM 1180 C CD   . PRO A 1 78  ? 11.527  4.158   30.716  1.00 0.00 ? 78  PRO A CD   1 
ATOM 1181 H HA   . PRO A 1 78  ? 13.471  4.559   28.368  1.00 0.00 ? 78  PRO A HA   1 
ATOM 1182 H HB2  . PRO A 1 78  ? 14.140  3.017   30.836  1.00 0.00 ? 78  PRO A HB2  1 
ATOM 1183 H HB3  . PRO A 1 78  ? 14.779  4.565   30.267  1.00 0.00 ? 78  PRO A HB3  1 
ATOM 1184 H HG2  . PRO A 1 78  ? 12.992  4.484   32.234  1.00 0.00 ? 78  PRO A HG2  1 
ATOM 1185 H HG3  . PRO A 1 78  ? 12.921  5.750   30.994  1.00 0.00 ? 78  PRO A HG3  1 
ATOM 1186 H HD2  . PRO A 1 78  ? 11.210  3.335   31.339  1.00 0.00 ? 78  PRO A HD2  1 
ATOM 1187 H HD3  . PRO A 1 78  ? 10.785  4.943   30.721  1.00 0.00 ? 78  PRO A HD3  1 
ATOM 1188 N N    . PRO A 1 79  ? 14.371  2.499   27.227  1.00 0.00 ? 79  PRO A N    1 
ATOM 1189 C CA   . PRO A 1 79  ? 14.896  1.319   26.540  1.00 0.00 ? 79  PRO A CA   1 
ATOM 1190 C C    . PRO A 1 79  ? 16.254  0.880   27.088  1.00 0.00 ? 79  PRO A C    1 
ATOM 1191 O O    . PRO A 1 79  ? 16.864  1.584   27.892  1.00 0.00 ? 79  PRO A O    1 
ATOM 1192 C CB   . PRO A 1 79  ? 15.034  1.803   25.099  1.00 0.00 ? 79  PRO A CB   1 
ATOM 1193 C CG   . PRO A 1 79  ? 15.339  3.256   25.221  1.00 0.00 ? 79  PRO A CG   1 
ATOM 1194 C CD   . PRO A 1 79  ? 14.628  3.737   26.462  1.00 0.00 ? 79  PRO A CD   1 
ATOM 1195 H HA   . PRO A 1 79  ? 14.204  0.492   26.582  1.00 0.00 ? 79  PRO A HA   1 
ATOM 1196 H HB2  . PRO A 1 79  ? 15.838  1.270   24.612  1.00 0.00 ? 79  PRO A HB2  1 
ATOM 1197 H HB3  . PRO A 1 79  ? 14.109  1.636   24.568  1.00 0.00 ? 79  PRO A HB3  1 
ATOM 1198 H HG2  . PRO A 1 79  ? 16.404  3.400   25.322  1.00 0.00 ? 79  PRO A HG2  1 
ATOM 1199 H HG3  . PRO A 1 79  ? 14.970  3.782   24.353  1.00 0.00 ? 79  PRO A HG3  1 
ATOM 1200 H HD2  . PRO A 1 79  ? 15.262  4.409   27.021  1.00 0.00 ? 79  PRO A HD2  1 
ATOM 1201 H HD3  . PRO A 1 79  ? 13.701  4.226   26.198  1.00 0.00 ? 79  PRO A HD3  1 
ATOM 1202 N N    . PRO A 1 80  ? 16.746  -0.295  26.655  1.00 0.00 ? 80  PRO A N    1 
ATOM 1203 C CA   . PRO A 1 80  ? 18.039  -0.826  27.101  1.00 0.00 ? 80  PRO A CA   1 
ATOM 1204 C C    . PRO A 1 80  ? 19.184  0.154   26.858  1.00 0.00 ? 80  PRO A C    1 
ATOM 1205 O O    . PRO A 1 80  ? 19.701  0.763   27.794  1.00 0.00 ? 80  PRO A O    1 
ATOM 1206 C CB   . PRO A 1 80  ? 18.229  -2.097  26.257  1.00 0.00 ? 80  PRO A CB   1 
ATOM 1207 C CG   . PRO A 1 80  ? 17.239  -1.985  25.146  1.00 0.00 ? 80  PRO A CG   1 
ATOM 1208 C CD   . PRO A 1 80  ? 16.090  -1.195  25.697  1.00 0.00 ? 80  PRO A CD   1 
ATOM 1209 H HA   . PRO A 1 80  ? 18.015  -1.089  28.148  1.00 0.00 ? 80  PRO A HA   1 
ATOM 1210 H HB2  . PRO A 1 80  ? 19.242  -2.135  25.879  1.00 0.00 ? 80  PRO A HB2  1 
ATOM 1211 H HB3  . PRO A 1 80  ? 18.036  -2.968  26.867  1.00 0.00 ? 80  PRO A HB3  1 
ATOM 1212 H HG2  . PRO A 1 80  ? 17.684  -1.468  24.308  1.00 0.00 ? 80  PRO A HG2  1 
ATOM 1213 H HG3  . PRO A 1 80  ? 16.908  -2.969  24.847  1.00 0.00 ? 80  PRO A HG3  1 
ATOM 1214 H HD2  . PRO A 1 80  ? 15.602  -0.636  24.912  1.00 0.00 ? 80  PRO A HD2  1 
ATOM 1215 H HD3  . PRO A 1 80  ? 15.387  -1.844  26.197  1.00 0.00 ? 80  PRO A HD3  1 
ATOM 1216 N N    . GLY A 1 81  ? 19.573  0.302   25.596  1.00 0.00 ? 81  GLY A N    1 
ATOM 1217 C CA   . GLY A 1 81  ? 20.652  1.209   25.254  1.00 0.00 ? 81  GLY A CA   1 
ATOM 1218 C C    . GLY A 1 81  ? 22.011  0.536   25.288  1.00 0.00 ? 81  GLY A C    1 
ATOM 1219 O O    . GLY A 1 81  ? 23.003  1.145   25.685  1.00 0.00 ? 81  GLY A O    1 
ATOM 1220 H H    . GLY A 1 81  ? 19.123  -0.210  24.892  1.00 0.00 ? 81  GLY A H    1 
ATOM 1221 H HA2  . GLY A 1 81  ? 20.479  1.598   24.261  1.00 0.00 ? 81  GLY A HA2  1 
ATOM 1222 H HA3  . GLY A 1 81  ? 20.653  2.031   25.955  1.00 0.00 ? 81  GLY A HA3  1 
ATOM 1223 N N    . VAL A 1 82  ? 22.054  -0.725  24.870  1.00 0.00 ? 82  VAL A N    1 
ATOM 1224 C CA   . VAL A 1 82  ? 23.300  -1.484  24.853  1.00 0.00 ? 82  VAL A CA   1 
ATOM 1225 C C    . VAL A 1 82  ? 23.305  -2.507  23.729  1.00 0.00 ? 82  VAL A C    1 
ATOM 1226 O O    . VAL A 1 82  ? 24.282  -2.627  22.992  1.00 0.00 ? 82  VAL A O    1 
ATOM 1227 C CB   . VAL A 1 82  ? 23.538  -2.203  26.192  1.00 0.00 ? 82  VAL A CB   1 
ATOM 1228 C CG1  . VAL A 1 82  ? 23.780  -1.194  27.304  1.00 0.00 ? 82  VAL A CG1  1 
ATOM 1229 C CG2  . VAL A 1 82  ? 22.362  -3.103  26.528  1.00 0.00 ? 82  VAL A CG2  1 
ATOM 1230 H H    . VAL A 1 82  ? 21.229  -1.156  24.565  1.00 0.00 ? 82  VAL A H    1 
ATOM 1231 H HA   . VAL A 1 82  ? 24.108  -0.796  24.690  1.00 0.00 ? 82  VAL A HA   1 
ATOM 1232 H HB   . VAL A 1 82  ? 24.420  -2.819  26.096  1.00 0.00 ? 82  VAL A HB   1 
ATOM 1233 H HG11 . VAL A 1 82  ? 23.856  -1.712  28.250  1.00 0.00 ? 82  VAL A HG11 1 
ATOM 1234 H HG12 . VAL A 1 82  ? 22.958  -0.496  27.342  1.00 0.00 ? 82  VAL A HG12 1 
ATOM 1235 H HG13 . VAL A 1 82  ? 24.699  -0.659  27.112  1.00 0.00 ? 82  VAL A HG13 1 
ATOM 1236 H HG21 . VAL A 1 82  ? 22.400  -3.371  27.573  1.00 0.00 ? 82  VAL A HG21 1 
ATOM 1237 H HG22 . VAL A 1 82  ? 22.410  -3.997  25.924  1.00 0.00 ? 82  VAL A HG22 1 
ATOM 1238 H HG23 . VAL A 1 82  ? 21.440  -2.580  26.324  1.00 0.00 ? 82  VAL A HG23 1 
ATOM 1239 N N    . SER A 1 83  ? 22.208  -3.241  23.604  1.00 0.00 ? 83  SER A N    1 
ATOM 1240 C CA   . SER A 1 83  ? 22.080  -4.259  22.569  1.00 0.00 ? 83  SER A CA   1 
ATOM 1241 C C    . SER A 1 83  ? 22.413  -3.687  21.189  1.00 0.00 ? 83  SER A C    1 
ATOM 1242 O O    . SER A 1 83  ? 21.599  -2.982  20.591  1.00 0.00 ? 83  SER A O    1 
ATOM 1243 C CB   . SER A 1 83  ? 20.661  -4.826  22.568  1.00 0.00 ? 83  SER A CB   1 
ATOM 1244 O OG   . SER A 1 83  ? 20.675  -6.236  22.427  1.00 0.00 ? 83  SER A OG   1 
ATOM 1245 H H    . SER A 1 83  ? 21.463  -3.094  24.223  1.00 0.00 ? 83  SER A H    1 
ATOM 1246 H HA   . SER A 1 83  ? 22.773  -5.052  22.799  1.00 0.00 ? 83  SER A HA   1 
ATOM 1247 H HB2  . SER A 1 83  ? 20.176  -4.575  23.500  1.00 0.00 ? 83  SER A HB2  1 
ATOM 1248 H HB3  . SER A 1 83  ? 20.104  -4.399  21.746  1.00 0.00 ? 83  SER A HB3  1 
ATOM 1249 H HG   . SER A 1 83  ? 20.238  -6.638  23.181  1.00 0.00 ? 83  SER A HG   1 
ATOM 1250 N N    . PRO A 1 84  ? 23.612  -3.990  20.657  1.00 0.00 ? 84  PRO A N    1 
ATOM 1251 C CA   . PRO A 1 84  ? 24.027  -3.504  19.342  1.00 0.00 ? 84  PRO A CA   1 
ATOM 1252 C C    . PRO A 1 84  ? 23.210  -4.152  18.227  1.00 0.00 ? 84  PRO A C    1 
ATOM 1253 O O    . PRO A 1 84  ? 22.306  -3.531  17.678  1.00 0.00 ? 84  PRO A O    1 
ATOM 1254 C CB   . PRO A 1 84  ? 25.512  -3.886  19.234  1.00 0.00 ? 84  PRO A CB   1 
ATOM 1255 C CG   . PRO A 1 84  ? 25.902  -4.463  20.558  1.00 0.00 ? 84  PRO A CG   1 
ATOM 1256 C CD   . PRO A 1 84  ? 24.639  -4.830  21.286  1.00 0.00 ? 84  PRO A CD   1 
ATOM 1257 H HA   . PRO A 1 84  ? 23.923  -2.430  19.275  1.00 0.00 ? 84  PRO A HA   1 
ATOM 1258 H HB2  . PRO A 1 84  ? 25.645  -4.604  18.442  1.00 0.00 ? 84  PRO A HB2  1 
ATOM 1259 H HB3  . PRO A 1 84  ? 26.089  -3.000  19.013  1.00 0.00 ? 84  PRO A HB3  1 
ATOM 1260 H HG2  . PRO A 1 84  ? 26.505  -5.346  20.402  1.00 0.00 ? 84  PRO A HG2  1 
ATOM 1261 H HG3  . PRO A 1 84  ? 26.458  -3.729  21.124  1.00 0.00 ? 84  PRO A HG3  1 
ATOM 1262 H HD2  . PRO A 1 84  ? 24.415  -5.878  21.149  1.00 0.00 ? 84  PRO A HD2  1 
ATOM 1263 H HD3  . PRO A 1 84  ? 24.731  -4.599  22.339  1.00 0.00 ? 84  PRO A HD3  1 
ATOM 1264 N N    . SER A 1 85  ? 23.550  -5.391  17.876  1.00 0.00 ? 85  SER A N    1 
ATOM 1265 C CA   . SER A 1 85  ? 22.854  -6.111  16.814  1.00 0.00 ? 85  SER A CA   1 
ATOM 1266 C C    . SER A 1 85  ? 21.347  -6.182  17.076  1.00 0.00 ? 85  SER A C    1 
ATOM 1267 O O    . SER A 1 85  ? 20.551  -6.270  16.142  1.00 0.00 ? 85  SER A O    1 
ATOM 1268 C CB   . SER A 1 85  ? 23.432  -7.519  16.683  1.00 0.00 ? 85  SER A CB   1 
ATOM 1269 O OG   . SER A 1 85  ? 24.289  -7.613  15.559  1.00 0.00 ? 85  SER A OG   1 
ATOM 1270 H H    . SER A 1 85  ? 24.311  -5.821  18.318  1.00 0.00 ? 85  SER A H    1 
ATOM 1271 H HA   . SER A 1 85  ? 23.021  -5.579  15.890  1.00 0.00 ? 85  SER A HA   1 
ATOM 1272 H HB2  . SER A 1 85  ? 23.999  -7.754  17.573  1.00 0.00 ? 85  SER A HB2  1 
ATOM 1273 H HB3  . SER A 1 85  ? 22.627  -8.230  16.570  1.00 0.00 ? 85  SER A HB3  1 
ATOM 1274 H HG   . SER A 1 85  ? 23.770  -7.543  14.754  1.00 0.00 ? 85  SER A HG   1 
ATOM 1275 N N    . ARG A 1 86  ? 20.967  -6.130  18.349  1.00 0.00 ? 86  ARG A N    1 
ATOM 1276 C CA   . ARG A 1 86  ? 19.561  -6.174  18.750  1.00 0.00 ? 86  ARG A CA   1 
ATOM 1277 C C    . ARG A 1 86  ? 18.879  -7.475  18.335  1.00 0.00 ? 86  ARG A C    1 
ATOM 1278 O O    . ARG A 1 86  ? 18.576  -8.322  19.175  1.00 0.00 ? 86  ARG A O    1 
ATOM 1279 C CB   . ARG A 1 86  ? 18.781  -4.990  18.167  1.00 0.00 ? 86  ARG A CB   1 
ATOM 1280 C CG   . ARG A 1 86  ? 19.632  -3.772  17.847  1.00 0.00 ? 86  ARG A CG   1 
ATOM 1281 C CD   . ARG A 1 86  ? 19.893  -3.646  16.352  1.00 0.00 ? 86  ARG A CD   1 
ATOM 1282 N NE   . ARG A 1 86  ? 19.781  -2.262  15.893  1.00 0.00 ? 86  ARG A NE   1 
ATOM 1283 C CZ   . ARG A 1 86  ? 20.777  -1.570  15.338  1.00 0.00 ? 86  ARG A CZ   1 
ATOM 1284 N NH1  . ARG A 1 86  ? 21.973  -2.121  15.165  1.00 0.00 ? 86  ARG A NH1  1 
ATOM 1285 N NH2  . ARG A 1 86  ? 20.574  -0.317  14.954  1.00 0.00 ? 86  ARG A NH2  1 
ATOM 1286 H H    . ARG A 1 86  ? 21.650  -6.050  19.042  1.00 0.00 ? 86  ARG A H    1 
ATOM 1287 H HA   . ARG A 1 86  ? 19.533  -6.105  19.827  1.00 0.00 ? 86  ARG A HA   1 
ATOM 1288 H HB2  . ARG A 1 86  ? 18.297  -5.306  17.259  1.00 0.00 ? 86  ARG A HB2  1 
ATOM 1289 H HB3  . ARG A 1 86  ? 18.027  -4.693  18.879  1.00 0.00 ? 86  ARG A HB3  1 
ATOM 1290 H HG2  . ARG A 1 86  ? 19.116  -2.888  18.185  1.00 0.00 ? 86  ARG A HG2  1 
ATOM 1291 H HG3  . ARG A 1 86  ? 20.571  -3.861  18.366  1.00 0.00 ? 86  ARG A HG3  1 
ATOM 1292 H HD2  . ARG A 1 86  ? 20.884  -4.012  16.137  1.00 0.00 ? 86  ARG A HD2  1 
ATOM 1293 H HD3  . ARG A 1 86  ? 19.170  -4.249  15.824  1.00 0.00 ? 86  ARG A HD3  1 
ATOM 1294 H HE   . ARG A 1 86  ? 18.913  -1.822  16.004  1.00 0.00 ? 86  ARG A HE   1 
ATOM 1295 H HH11 . ARG A 1 86  ? 22.138  -3.064  15.450  1.00 0.00 ? 86  ARG A HH11 1 
ATOM 1296 H HH12 . ARG A 1 86  ? 22.710  -1.591  14.747  1.00 0.00 ? 86  ARG A HH12 1 
ATOM 1297 H HH21 . ARG A 1 86  ? 19.677  0.106   15.081  1.00 0.00 ? 86  ARG A HH21 1 
ATOM 1298 H HH22 . ARG A 1 86  ? 21.318  0.205   14.538  1.00 0.00 ? 86  ARG A HH22 1 
ATOM 1299 N N    . LEU A 1 87  ? 18.600  -7.611  17.042  1.00 0.00 ? 87  LEU A N    1 
ATOM 1300 C CA   . LEU A 1 87  ? 17.910  -8.788  16.527  1.00 0.00 ? 87  LEU A CA   1 
ATOM 1301 C C    . LEU A 1 87  ? 18.857  -9.781  15.866  1.00 0.00 ? 87  LEU A C    1 
ATOM 1302 O O    . LEU A 1 87  ? 19.789  -9.398  15.161  1.00 0.00 ? 87  LEU A O    1 
ATOM 1303 C CB   . LEU A 1 87  ? 16.842  -8.361  15.523  1.00 0.00 ? 87  LEU A CB   1 
ATOM 1304 C CG   . LEU A 1 87  ? 15.715  -9.366  15.289  1.00 0.00 ? 87  LEU A CG   1 
ATOM 1305 C CD1  . LEU A 1 87  ? 16.176  -10.490 14.377  1.00 0.00 ? 87  LEU A CD1  1 
ATOM 1306 C CD2  . LEU A 1 87  ? 15.202  -9.915  16.606  1.00 0.00 ? 87  LEU A CD2  1 
ATOM 1307 H H    . LEU A 1 87  ? 18.840  -6.891  16.422  1.00 0.00 ? 87  LEU A H    1 
ATOM 1308 H HA   . LEU A 1 87  ? 17.427  -9.272  17.359  1.00 0.00 ? 87  LEU A HA   1 
ATOM 1309 H HB2  . LEU A 1 87  ? 16.404  -7.435  15.868  1.00 0.00 ? 87  LEU A HB2  1 
ATOM 1310 H HB3  . LEU A 1 87  ? 17.327  -8.178  14.577  1.00 0.00 ? 87  LEU A HB3  1 
ATOM 1311 H HG   . LEU A 1 87  ? 14.900  -8.864  14.806  1.00 0.00 ? 87  LEU A HG   1 
ATOM 1312 H HD11 . LEU A 1 87  ? 16.689  -11.238 14.959  1.00 0.00 ? 87  LEU A HD11 1 
ATOM 1313 H HD12 . LEU A 1 87  ? 16.843  -10.092 13.628  1.00 0.00 ? 87  LEU A HD12 1 
ATOM 1314 H HD13 . LEU A 1 87  ? 15.318  -10.936 13.897  1.00 0.00 ? 87  LEU A HD13 1 
ATOM 1315 H HD21 . LEU A 1 87  ? 15.061  -9.100  17.295  1.00 0.00 ? 87  LEU A HD21 1 
ATOM 1316 H HD22 . LEU A 1 87  ? 15.920  -10.610 17.010  1.00 0.00 ? 87  LEU A HD22 1 
ATOM 1317 H HD23 . LEU A 1 87  ? 14.260  -10.417 16.445  1.00 0.00 ? 87  LEU A HD23 1 
ATOM 1318 N N    . ARG A 1 88  ? 18.589  -11.064 16.086  1.00 0.00 ? 88  ARG A N    1 
ATOM 1319 C CA   . ARG A 1 88  ? 19.391  -12.129 15.497  1.00 0.00 ? 88  ARG A CA   1 
ATOM 1320 C C    . ARG A 1 88  ? 18.623  -13.453 15.482  1.00 0.00 ? 88  ARG A C    1 
ATOM 1321 O O    . ARG A 1 88  ? 17.772  -13.700 16.337  1.00 0.00 ? 88  ARG A O    1 
ATOM 1322 C CB   . ARG A 1 88  ? 20.707  -12.292 16.262  1.00 0.00 ? 88  ARG A CB   1 
ATOM 1323 C CG   . ARG A 1 88  ? 21.401  -13.616 15.993  1.00 0.00 ? 88  ARG A CG   1 
ATOM 1324 C CD   . ARG A 1 88  ? 22.801  -13.646 16.585  1.00 0.00 ? 88  ARG A CD   1 
ATOM 1325 N NE   . ARG A 1 88  ? 22.805  -13.278 18.000  1.00 0.00 ? 88  ARG A NE   1 
ATOM 1326 C CZ   . ARG A 1 88  ? 23.903  -13.231 18.751  1.00 0.00 ? 88  ARG A CZ   1 
ATOM 1327 N NH1  . ARG A 1 88  ? 25.086  -13.525 18.227  1.00 0.00 ? 88  ARG A NH1  1 
ATOM 1328 N NH2  . ARG A 1 88  ? 23.817  -12.886 20.028  1.00 0.00 ? 88  ARG A NH2  1 
ATOM 1329 H H    . ARG A 1 88  ? 17.819  -11.299 16.647  1.00 0.00 ? 88  ARG A H    1 
ATOM 1330 H HA   . ARG A 1 88  ? 19.613  -11.848 14.477  1.00 0.00 ? 88  ARG A HA   1 
ATOM 1331 H HB2  . ARG A 1 88  ? 21.377  -11.494 15.978  1.00 0.00 ? 88  ARG A HB2  1 
ATOM 1332 H HB3  . ARG A 1 88  ? 20.507  -12.222 17.321  1.00 0.00 ? 88  ARG A HB3  1 
ATOM 1333 H HG2  . ARG A 1 88  ? 20.818  -14.411 16.431  1.00 0.00 ? 88  ARG A HG2  1 
ATOM 1334 H HG3  . ARG A 1 88  ? 21.464  -13.762 14.924  1.00 0.00 ? 88  ARG A HG3  1 
ATOM 1335 H HD2  . ARG A 1 88  ? 23.198  -14.645 16.484  1.00 0.00 ? 88  ARG A HD2  1 
ATOM 1336 H HD3  . ARG A 1 88  ? 23.425  -12.954 16.040  1.00 0.00 ? 88  ARG A HD3  1 
ATOM 1337 H HE   . ARG A 1 88  ? 21.943  -13.055 18.412  1.00 0.00 ? 88  ARG A HE   1 
ATOM 1338 H HH11 . ARG A 1 88  ? 25.156  -13.785 17.263  1.00 0.00 ? 88  ARG A HH11 1 
ATOM 1339 H HH12 . ARG A 1 88  ? 25.908  -13.487 18.795  1.00 0.00 ? 88  ARG A HH12 1 
ATOM 1340 H HH21 . ARG A 1 88  ? 22.928  -12.662 20.428  1.00 0.00 ? 88  ARG A HH21 1 
ATOM 1341 H HH22 . ARG A 1 88  ? 24.643  -12.851 20.593  1.00 0.00 ? 88  ARG A HH22 1 
ATOM 1342 N N    . ILE A 1 89  ? 18.943  -14.305 14.510  1.00 0.00 ? 89  ILE A N    1 
ATOM 1343 C CA   . ILE A 1 89  ? 18.302  -15.611 14.385  1.00 0.00 ? 89  ILE A CA   1 
ATOM 1344 C C    . ILE A 1 89  ? 19.304  -16.666 13.919  1.00 0.00 ? 89  ILE A C    1 
ATOM 1345 O O    . ILE A 1 89  ? 20.073  -16.434 12.985  1.00 0.00 ? 89  ILE A O    1 
ATOM 1346 C CB   . ILE A 1 89  ? 17.115  -15.575 13.400  1.00 0.00 ? 89  ILE A CB   1 
ATOM 1347 C CG1  . ILE A 1 89  ? 16.288  -16.857 13.515  1.00 0.00 ? 89  ILE A CG1  1 
ATOM 1348 C CG2  . ILE A 1 89  ? 17.615  -15.396 11.978  1.00 0.00 ? 89  ILE A CG2  1 
ATOM 1349 C CD1  . ILE A 1 89  ? 15.151  -16.935 12.518  1.00 0.00 ? 89  ILE A CD1  1 
ATOM 1350 H H    . ILE A 1 89  ? 19.636  -14.053 13.865  1.00 0.00 ? 89  ILE A H    1 
ATOM 1351 H HA   . ILE A 1 89  ? 17.927  -15.890 15.356  1.00 0.00 ? 89  ILE A HA   1 
ATOM 1352 H HB   . ILE A 1 89  ? 16.489  -14.729 13.647  1.00 0.00 ? 89  ILE A HB   1 
ATOM 1353 H HG12 . ILE A 1 89  ? 16.930  -17.710 13.352  1.00 0.00 ? 89  ILE A HG12 1 
ATOM 1354 H HG13 . ILE A 1 89  ? 15.865  -16.915 14.505  1.00 0.00 ? 89  ILE A HG13 1 
ATOM 1355 H HG21 . ILE A 1 89  ? 16.838  -14.953 11.377  1.00 0.00 ? 89  ILE A HG21 1 
ATOM 1356 H HG22 . ILE A 1 89  ? 17.879  -16.360 11.568  1.00 0.00 ? 89  ILE A HG22 1 
ATOM 1357 H HG23 . ILE A 1 89  ? 18.483  -14.752 11.983  1.00 0.00 ? 89  ILE A HG23 1 
ATOM 1358 H HD11 . ILE A 1 89  ? 15.445  -17.555 11.682  1.00 0.00 ? 89  ILE A HD11 1 
ATOM 1359 H HD12 . ILE A 1 89  ? 14.915  -15.943 12.165  1.00 0.00 ? 89  ILE A HD12 1 
ATOM 1360 H HD13 . ILE A 1 89  ? 14.282  -17.363 12.995  1.00 0.00 ? 89  ILE A HD13 1 
ATOM 1361 N N    . GLY A 1 90  ? 19.288  -17.825 14.567  1.00 0.00 ? 90  GLY A N    1 
ATOM 1362 C CA   . GLY A 1 90  ? 20.195  -18.895 14.197  1.00 0.00 ? 90  GLY A CA   1 
ATOM 1363 C C    . GLY A 1 90  ? 21.609  -18.665 14.695  1.00 0.00 ? 90  GLY A C    1 
ATOM 1364 O O    . GLY A 1 90  ? 21.813  -18.217 15.823  1.00 0.00 ? 90  GLY A O    1 
ATOM 1365 H H    . GLY A 1 90  ? 18.651  -17.958 15.299  1.00 0.00 ? 90  GLY A H    1 
ATOM 1366 H HA2  . GLY A 1 90  ? 19.827  -19.822 14.609  1.00 0.00 ? 90  GLY A HA2  1 
ATOM 1367 H HA3  . GLY A 1 90  ? 20.215  -18.976 13.120  1.00 0.00 ? 90  GLY A HA3  1 
ATOM 1368 N N    . ASP A 1 91  ? 22.586  -18.983 13.852  1.00 0.00 ? 91  ASP A N    1 
ATOM 1369 C CA   . ASP A 1 91  ? 23.992  -18.820 14.209  1.00 0.00 ? 91  ASP A CA   1 
ATOM 1370 C C    . ASP A 1 91  ? 24.635  -17.663 13.445  1.00 0.00 ? 91  ASP A C    1 
ATOM 1371 O O    . ASP A 1 91  ? 25.851  -17.633 13.257  1.00 0.00 ? 91  ASP A O    1 
ATOM 1372 C CB   . ASP A 1 91  ? 24.759  -20.114 13.935  1.00 0.00 ? 91  ASP A CB   1 
ATOM 1373 C CG   . ASP A 1 91  ? 25.742  -20.449 15.040  1.00 0.00 ? 91  ASP A CG   1 
ATOM 1374 O OD1  . ASP A 1 91  ? 25.337  -20.425 16.221  1.00 0.00 ? 91  ASP A OD1  1 
ATOM 1375 O OD2  . ASP A 1 91  ? 26.915  -20.735 14.724  1.00 0.00 ? 91  ASP A OD2  1 
ATOM 1376 H H    . ASP A 1 91  ? 22.355  -19.342 12.971  1.00 0.00 ? 91  ASP A H    1 
ATOM 1377 H HA   . ASP A 1 91  ? 24.040  -18.605 15.266  1.00 0.00 ? 91  ASP A HA   1 
ATOM 1378 H HB2  . ASP A 1 91  ? 24.057  -20.929 13.844  1.00 0.00 ? 91  ASP A HB2  1 
ATOM 1379 H HB3  . ASP A 1 91  ? 25.308  -20.012 13.009  1.00 0.00 ? 91  ASP A HB3  1 
ATOM 1380 N N    . GLN A 1 92  ? 23.815  -16.708 13.018  1.00 0.00 ? 92  GLN A N    1 
ATOM 1381 C CA   . GLN A 1 92  ? 24.307  -15.545 12.290  1.00 0.00 ? 92  GLN A CA   1 
ATOM 1382 C C    . GLN A 1 92  ? 23.799  -14.272 12.950  1.00 0.00 ? 92  GLN A C    1 
ATOM 1383 O O    . GLN A 1 92  ? 23.141  -14.333 13.983  1.00 0.00 ? 92  GLN A O    1 
ATOM 1384 C CB   . GLN A 1 92  ? 23.863  -15.597 10.829  1.00 0.00 ? 92  GLN A CB   1 
ATOM 1385 C CG   . GLN A 1 92  ? 22.384  -15.888 10.658  1.00 0.00 ? 92  GLN A CG   1 
ATOM 1386 C CD   . GLN A 1 92  ? 22.106  -17.353 10.393  1.00 0.00 ? 92  GLN A CD   1 
ATOM 1387 O OE1  . GLN A 1 92  ? 22.514  -17.900 9.367   1.00 0.00 ? 92  GLN A OE1  1 
ATOM 1388 N NE2  . GLN A 1 92  ? 21.407  -17.998 11.319  1.00 0.00 ? 92  GLN A NE2  1 
ATOM 1389 H H    . GLN A 1 92  ? 22.857  -16.779 13.206  1.00 0.00 ? 92  GLN A H    1 
ATOM 1390 H HA   . GLN A 1 92  ? 25.385  -15.555 12.334  1.00 0.00 ? 92  GLN A HA   1 
ATOM 1391 H HB2  . GLN A 1 92  ? 24.077  -14.646 10.364  1.00 0.00 ? 92  GLN A HB2  1 
ATOM 1392 H HB3  . GLN A 1 92  ? 24.421  -16.370 10.321  1.00 0.00 ? 92  GLN A HB3  1 
ATOM 1393 H HG2  . GLN A 1 92  ? 21.869  -15.598 11.561  1.00 0.00 ? 92  GLN A HG2  1 
ATOM 1394 H HG3  . GLN A 1 92  ? 22.009  -15.309 9.829   1.00 0.00 ? 92  GLN A HG3  1 
ATOM 1395 H HE21 . GLN A 1 92  ? 21.115  -17.498 12.109  1.00 0.00 ? 92  GLN A HE21 1 
ATOM 1396 H HE22 . GLN A 1 92  ? 21.213  -18.947 11.174  1.00 0.00 ? 92  GLN A HE22 1 
ATOM 1397 N N    . GLU A 1 93  ? 24.111  -13.122 12.367  1.00 0.00 ? 93  GLU A N    1 
ATOM 1398 C CA   . GLU A 1 93  ? 23.673  -11.854 12.939  1.00 0.00 ? 93  GLU A CA   1 
ATOM 1399 C C    . GLU A 1 93  ? 23.135  -10.889 11.885  1.00 0.00 ? 93  GLU A C    1 
ATOM 1400 O O    . GLU A 1 93  ? 23.696  -10.744 10.799  1.00 0.00 ? 93  GLU A O    1 
ATOM 1401 C CB   . GLU A 1 93  ? 24.811  -11.191 13.713  1.00 0.00 ? 93  GLU A CB   1 
ATOM 1402 C CG   . GLU A 1 93  ? 24.341  -10.441 14.949  1.00 0.00 ? 93  GLU A CG   1 
ATOM 1403 C CD   . GLU A 1 93  ? 25.485  -10.058 15.868  1.00 0.00 ? 93  GLU A CD   1 
ATOM 1404 O OE1  . GLU A 1 93  ? 26.432  -9.399  15.392  1.00 0.00 ? 93  GLU A OE1  1 
ATOM 1405 O OE2  . GLU A 1 93  ? 25.431  -10.416 17.063  1.00 0.00 ? 93  GLU A OE2  1 
ATOM 1406 H H    . GLU A 1 93  ? 24.650  -13.129 11.553  1.00 0.00 ? 93  GLU A H    1 
ATOM 1407 H HA   . GLU A 1 93  ? 22.876  -12.076 13.632  1.00 0.00 ? 93  GLU A HA   1 
ATOM 1408 H HB2  . GLU A 1 93  ? 25.513  -11.951 14.022  1.00 0.00 ? 93  GLU A HB2  1 
ATOM 1409 H HB3  . GLU A 1 93  ? 25.315  -10.490 13.063  1.00 0.00 ? 93  GLU A HB3  1 
ATOM 1410 H HG2  . GLU A 1 93  ? 23.828  -9.540  14.639  1.00 0.00 ? 93  GLU A HG2  1 
ATOM 1411 H HG3  . GLU A 1 93  ? 23.655  -11.073 15.495  1.00 0.00 ? 93  GLU A HG3  1 
ATOM 1412 N N    . PHE A 1 94  ? 22.044  -10.225 12.245  1.00 0.00 ? 94  PHE A N    1 
ATOM 1413 C CA   . PHE A 1 94  ? 21.401  -9.250  11.373  1.00 0.00 ? 94  PHE A CA   1 
ATOM 1414 C C    . PHE A 1 94  ? 20.958  -8.032  12.174  1.00 0.00 ? 94  PHE A C    1 
ATOM 1415 O O    . PHE A 1 94  ? 20.834  -8.100  13.396  1.00 0.00 ? 94  PHE A O    1 
ATOM 1416 C CB   . PHE A 1 94  ? 20.216  -9.886  10.647  1.00 0.00 ? 94  PHE A CB   1 
ATOM 1417 C CG   . PHE A 1 94  ? 20.634  -10.730 9.478   1.00 0.00 ? 94  PHE A CG   1 
ATOM 1418 C CD1  . PHE A 1 94  ? 20.915  -10.147 8.253   1.00 0.00 ? 94  PHE A CD1  1 
ATOM 1419 C CD2  . PHE A 1 94  ? 20.756  -12.105 9.605   1.00 0.00 ? 94  PHE A CD2  1 
ATOM 1420 C CE1  . PHE A 1 94  ? 21.308  -10.920 7.178   1.00 0.00 ? 94  PHE A CE1  1 
ATOM 1421 C CE2  . PHE A 1 94  ? 21.149  -12.881 8.532   1.00 0.00 ? 94  PHE A CE2  1 
ATOM 1422 C CZ   . PHE A 1 94  ? 21.426  -12.288 7.317   1.00 0.00 ? 94  PHE A CZ   1 
ATOM 1423 H H    . PHE A 1 94  ? 21.678  -10.407 13.136  1.00 0.00 ? 94  PHE A H    1 
ATOM 1424 H HA   . PHE A 1 94  ? 22.129  -8.934  10.642  1.00 0.00 ? 94  PHE A HA   1 
ATOM 1425 H HB2  . PHE A 1 94  ? 19.672  -10.515 11.337  1.00 0.00 ? 94  PHE A HB2  1 
ATOM 1426 H HB3  . PHE A 1 94  ? 19.563  -9.107  10.281  1.00 0.00 ? 94  PHE A HB3  1 
ATOM 1427 H HD1  . PHE A 1 94  ? 20.824  -9.077  8.142   1.00 0.00 ? 94  PHE A HD1  1 
ATOM 1428 H HD2  . PHE A 1 94  ? 20.539  -12.569 10.556  1.00 0.00 ? 94  PHE A HD2  1 
ATOM 1429 H HE1  . PHE A 1 94  ? 21.526  -10.453 6.229   1.00 0.00 ? 94  PHE A HE1  1 
ATOM 1430 H HE2  . PHE A 1 94  ? 21.241  -13.951 8.645   1.00 0.00 ? 94  PHE A HE2  1 
ATOM 1431 H HZ   . PHE A 1 94  ? 21.733  -12.893 6.477   1.00 0.00 ? 94  PHE A HZ   1 
ATOM 1432 N N    . ASP A 1 95  ? 20.744  -6.910  11.494  1.00 0.00 ? 95  ASP A N    1 
ATOM 1433 C CA   . ASP A 1 95  ? 20.346  -5.676  12.162  1.00 0.00 ? 95  ASP A CA   1 
ATOM 1434 C C    . ASP A 1 95  ? 19.027  -5.823  12.912  1.00 0.00 ? 95  ASP A C    1 
ATOM 1435 O O    . ASP A 1 95  ? 18.963  -5.591  14.119  1.00 0.00 ? 95  ASP A O    1 
ATOM 1436 C CB   . ASP A 1 95  ? 20.230  -4.543  11.141  1.00 0.00 ? 95  ASP A CB   1 
ATOM 1437 C CG   . ASP A 1 95  ? 21.542  -4.267  10.434  1.00 0.00 ? 95  ASP A CG   1 
ATOM 1438 O OD1  . ASP A 1 95  ? 21.913  -5.055  9.540   1.00 0.00 ? 95  ASP A OD1  1 
ATOM 1439 O OD2  . ASP A 1 95  ? 22.199  -3.261  10.775  1.00 0.00 ? 95  ASP A OD2  1 
ATOM 1440 H H    . ASP A 1 95  ? 20.872  -6.884  10.523  1.00 0.00 ? 95  ASP A H    1 
ATOM 1441 H HA   . ASP A 1 95  ? 21.117  -5.423  12.870  1.00 0.00 ? 95  ASP A HA   1 
ATOM 1442 H HB2  . ASP A 1 95  ? 19.492  -4.811  10.398  1.00 0.00 ? 95  ASP A HB2  1 
ATOM 1443 H HB3  . ASP A 1 95  ? 19.916  -3.642  11.646  1.00 0.00 ? 95  ASP A HB3  1 
ATOM 1444 N N    . SER A 1 96  ? 17.976  -6.196  12.197  1.00 0.00 ? 96  SER A N    1 
ATOM 1445 C CA   . SER A 1 96  ? 16.664  -6.352  12.811  1.00 0.00 ? 96  SER A CA   1 
ATOM 1446 C C    . SER A 1 96  ? 15.928  -7.563  12.257  1.00 0.00 ? 96  SER A C    1 
ATOM 1447 O O    . SER A 1 96  ? 16.367  -8.188  11.292  1.00 0.00 ? 96  SER A O    1 
ATOM 1448 C CB   . SER A 1 96  ? 15.826  -5.091  12.596  1.00 0.00 ? 96  SER A CB   1 
ATOM 1449 O OG   . SER A 1 96  ? 16.531  -3.933  13.011  1.00 0.00 ? 96  SER A OG   1 
ATOM 1450 H H    . SER A 1 96  ? 18.082  -6.366  11.238  1.00 0.00 ? 96  SER A H    1 
ATOM 1451 H HA   . SER A 1 96  ? 16.810  -6.497  13.870  1.00 0.00 ? 96  SER A HA   1 
ATOM 1452 H HB2  . SER A 1 96  ? 15.585  -4.994  11.549  1.00 0.00 ? 96  SER A HB2  1 
ATOM 1453 H HB3  . SER A 1 96  ? 14.914  -5.165  13.169  1.00 0.00 ? 96  SER A HB3  1 
ATOM 1454 H HG   . SER A 1 96  ? 16.777  -3.416  12.241  1.00 0.00 ? 96  SER A HG   1 
ATOM 1455 N N    . LEU A 1 97  ? 14.807  -7.886  12.886  1.00 0.00 ? 97  LEU A N    1 
ATOM 1456 C CA   . LEU A 1 97  ? 13.998  -9.018  12.476  1.00 0.00 ? 97  LEU A CA   1 
ATOM 1457 C C    . LEU A 1 97  ? 13.436  -8.815  11.073  1.00 0.00 ? 97  LEU A C    1 
ATOM 1458 O O    . LEU A 1 97  ? 13.675  -9.634  10.186  1.00 0.00 ? 97  LEU A O    1 
ATOM 1459 C CB   . LEU A 1 97  ? 12.867  -9.254  13.480  1.00 0.00 ? 97  LEU A CB   1 
ATOM 1460 C CG   . LEU A 1 97  ? 12.005  -10.480 13.204  1.00 0.00 ? 97  LEU A CG   1 
ATOM 1461 C CD1  . LEU A 1 97  ? 12.832  -11.599 12.584  1.00 0.00 ? 97  LEU A CD1  1 
ATOM 1462 C CD2  . LEU A 1 97  ? 11.333  -10.956 14.482  1.00 0.00 ? 97  LEU A CD2  1 
ATOM 1463 H H    . LEU A 1 97  ? 14.516  -7.349  13.649  1.00 0.00 ? 97  LEU A H    1 
ATOM 1464 H HA   . LEU A 1 97  ? 14.638  -9.887  12.465  1.00 0.00 ? 97  LEU A HA   1 
ATOM 1465 H HB2  . LEU A 1 97  ? 13.298  -9.362  14.462  1.00 0.00 ? 97  LEU A HB2  1 
ATOM 1466 H HB3  . LEU A 1 97  ? 12.226  -8.387  13.483  1.00 0.00 ? 97  LEU A HB3  1 
ATOM 1467 H HG   . LEU A 1 97  ? 11.233  -10.207 12.506  1.00 0.00 ? 97  LEU A HG   1 
ATOM 1468 H HD11 . LEU A 1 97  ? 13.748  -11.721 13.140  1.00 0.00 ? 97  LEU A HD11 1 
ATOM 1469 H HD12 . LEU A 1 97  ? 13.064  -11.349 11.557  1.00 0.00 ? 97  LEU A HD12 1 
ATOM 1470 H HD13 . LEU A 1 97  ? 12.267  -12.521 12.608  1.00 0.00 ? 97  LEU A HD13 1 
ATOM 1471 H HD21 . LEU A 1 97  ? 11.950  -10.698 15.332  1.00 0.00 ? 97  LEU A HD21 1 
ATOM 1472 H HD22 . LEU A 1 97  ? 11.205  -12.028 14.442  1.00 0.00 ? 97  LEU A HD22 1 
ATOM 1473 H HD23 . LEU A 1 97  ? 10.368  -10.481 14.580  1.00 0.00 ? 97  LEU A HD23 1 
ATOM 1474 N N    . PRO A 1 98  ? 12.686  -7.719  10.836  1.00 0.00 ? 98  PRO A N    1 
ATOM 1475 C CA   . PRO A 1 98  ? 12.119  -7.438  9.519   1.00 0.00 ? 98  PRO A CA   1 
ATOM 1476 C C    . PRO A 1 98  ? 13.158  -7.612  8.424   1.00 0.00 ? 98  PRO A C    1 
ATOM 1477 O O    . PRO A 1 98  ? 12.883  -8.183  7.369   1.00 0.00 ? 98  PRO A O    1 
ATOM 1478 C CB   . PRO A 1 98  ? 11.669  -5.971  9.605   1.00 0.00 ? 98  PRO A CB   1 
ATOM 1479 C CG   . PRO A 1 98  ? 12.152  -5.465  10.927  1.00 0.00 ? 98  PRO A CG   1 
ATOM 1480 C CD   . PRO A 1 98  ? 12.345  -6.669  11.803  1.00 0.00 ? 98  PRO A CD   1 
ATOM 1481 H HA   . PRO A 1 98  ? 11.268  -8.070  9.311   1.00 0.00 ? 98  PRO A HA   1 
ATOM 1482 H HB2  . PRO A 1 98  ? 12.107  -5.413  8.790   1.00 0.00 ? 98  PRO A HB2  1 
ATOM 1483 H HB3  . PRO A 1 98  ? 10.595  -5.923  9.536   1.00 0.00 ? 98  PRO A HB3  1 
ATOM 1484 H HG2  . PRO A 1 98  ? 13.090  -4.945  10.799  1.00 0.00 ? 98  PRO A HG2  1 
ATOM 1485 H HG3  . PRO A 1 98  ? 11.414  -4.805  11.357  1.00 0.00 ? 98  PRO A HG3  1 
ATOM 1486 H HD2  . PRO A 1 98  ? 13.148  -6.503  12.501  1.00 0.00 ? 98  PRO A HD2  1 
ATOM 1487 H HD3  . PRO A 1 98  ? 11.430  -6.909  12.325  1.00 0.00 ? 98  PRO A HD3  1 
ATOM 1488 N N    . ALA A 1 99  ? 14.358  -7.111  8.686   1.00 0.00 ? 99  ALA A N    1 
ATOM 1489 C CA   . ALA A 1 99  ? 15.446  -7.207  7.731   1.00 0.00 ? 99  ALA A CA   1 
ATOM 1490 C C    . ALA A 1 99  ? 15.817  -8.659  7.460   1.00 0.00 ? 99  ALA A C    1 
ATOM 1491 O O    . ALA A 1 99  ? 16.153  -9.015  6.331   1.00 0.00 ? 99  ALA A O    1 
ATOM 1492 C CB   . ALA A 1 99  ? 16.658  -6.436  8.227   1.00 0.00 ? 99  ALA A CB   1 
ATOM 1493 H H    . ALA A 1 99  ? 14.514  -6.658  9.542   1.00 0.00 ? 99  ALA A H    1 
ATOM 1494 H HA   . ALA A 1 99  ? 15.118  -6.753  6.808   1.00 0.00 ? 99  ALA A HA   1 
ATOM 1495 H HB1  . ALA A 1 99  ? 17.349  -6.291  7.411   1.00 0.00 ? 99  ALA A HB1  1 
ATOM 1496 H HB2  . ALA A 1 99  ? 17.143  -6.994  9.015   1.00 0.00 ? 99  ALA A HB2  1 
ATOM 1497 H HB3  . ALA A 1 99  ? 16.343  -5.476  8.608   1.00 0.00 ? 99  ALA A HB3  1 
ATOM 1498 N N    . LEU A 1 100 ? 15.771  -9.504  8.494   1.00 0.00 ? 100 LEU A N    1 
ATOM 1499 C CA   . LEU A 1 100 ? 16.113  -10.918 8.380   1.00 0.00 ? 100 LEU A CA   1 
ATOM 1500 C C    . LEU A 1 100 ? 15.383  -11.622 7.238   1.00 0.00 ? 100 LEU A C    1 
ATOM 1501 O O    . LEU A 1 100 ? 15.999  -12.328 6.438   1.00 0.00 ? 100 LEU A O    1 
ATOM 1502 C CB   . LEU A 1 100 ? 15.742  -11.587 9.711   1.00 0.00 ? 100 LEU A CB   1 
ATOM 1503 C CG   . LEU A 1 100 ? 16.429  -12.909 10.024  1.00 0.00 ? 100 LEU A CG   1 
ATOM 1504 C CD1  . LEU A 1 100 ? 16.087  -13.944 8.971   1.00 0.00 ? 100 LEU A CD1  1 
ATOM 1505 C CD2  . LEU A 1 100 ? 17.933  -12.716 10.145  1.00 0.00 ? 100 LEU A CD2  1 
ATOM 1506 H H    . LEU A 1 100 ? 15.514  -9.223  9.398   1.00 0.00 ? 100 LEU A H    1 
ATOM 1507 H HA   . LEU A 1 100 ? 17.176  -11.001 8.230   1.00 0.00 ? 100 LEU A HA   1 
ATOM 1508 H HB2  . LEU A 1 100 ? 15.973  -10.895 10.506  1.00 0.00 ? 100 LEU A HB2  1 
ATOM 1509 H HB3  . LEU A 1 100 ? 14.674  -11.757 9.712   1.00 0.00 ? 100 LEU A HB3  1 
ATOM 1510 H HG   . LEU A 1 100 ? 16.064  -13.272 10.974  1.00 0.00 ? 100 LEU A HG   1 
ATOM 1511 H HD11 . LEU A 1 100 ? 15.117  -13.716 8.550   1.00 0.00 ? 100 LEU A HD11 1 
ATOM 1512 H HD12 . LEU A 1 100 ? 16.062  -14.924 9.427   1.00 0.00 ? 100 LEU A HD12 1 
ATOM 1513 H HD13 . LEU A 1 100 ? 16.833  -13.926 8.191   1.00 0.00 ? 100 LEU A HD13 1 
ATOM 1514 H HD21 . LEU A 1 100 ? 18.221  -12.784 11.186  1.00 0.00 ? 100 LEU A HD21 1 
ATOM 1515 H HD22 . LEU A 1 100 ? 18.206  -11.744 9.761   1.00 0.00 ? 100 LEU A HD22 1 
ATOM 1516 H HD23 . LEU A 1 100 ? 18.443  -13.483 9.581   1.00 0.00 ? 100 LEU A HD23 1 
ATOM 1517 N N    . LEU A 1 101 ? 14.072  -11.445 7.178   1.00 0.00 ? 101 LEU A N    1 
ATOM 1518 C CA   . LEU A 1 101 ? 13.257  -12.082 6.148   1.00 0.00 ? 101 LEU A CA   1 
ATOM 1519 C C    . LEU A 1 101 ? 13.684  -11.650 4.749   1.00 0.00 ? 101 LEU A C    1 
ATOM 1520 O O    . LEU A 1 101 ? 13.363  -12.313 3.762   1.00 0.00 ? 101 LEU A O    1 
ATOM 1521 C CB   . LEU A 1 101 ? 11.777  -11.742 6.352   1.00 0.00 ? 101 LEU A CB   1 
ATOM 1522 C CG   . LEU A 1 101 ? 11.202  -11.974 7.757   1.00 0.00 ? 101 LEU A CG   1 
ATOM 1523 C CD1  . LEU A 1 101 ? 11.884  -13.131 8.469   1.00 0.00 ? 101 LEU A CD1  1 
ATOM 1524 C CD2  . LEU A 1 101 ? 11.300  -10.708 8.592   1.00 0.00 ? 101 LEU A CD2  1 
ATOM 1525 H H    . LEU A 1 101 ? 13.637  -10.875 7.845   1.00 0.00 ? 101 LEU A H    1 
ATOM 1526 H HA   . LEU A 1 101 ? 13.386  -13.150 6.237   1.00 0.00 ? 101 LEU A HA   1 
ATOM 1527 H HB2  . LEU A 1 101 ? 11.641  -10.702 6.108   1.00 0.00 ? 101 LEU A HB2  1 
ATOM 1528 H HB3  . LEU A 1 101 ? 11.201  -12.329 5.656   1.00 0.00 ? 101 LEU A HB3  1 
ATOM 1529 H HG   . LEU A 1 101 ? 10.158  -12.220 7.660   1.00 0.00 ? 101 LEU A HG   1 
ATOM 1530 H HD11 . LEU A 1 101 ? 12.908  -13.209 8.142   1.00 0.00 ? 101 LEU A HD11 1 
ATOM 1531 H HD12 . LEU A 1 101 ? 11.360  -14.048 8.244   1.00 0.00 ? 101 LEU A HD12 1 
ATOM 1532 H HD13 . LEU A 1 101 ? 11.859  -12.956 9.535   1.00 0.00 ? 101 LEU A HD13 1 
ATOM 1533 H HD21 . LEU A 1 101 ? 11.972  -10.015 8.114   1.00 0.00 ? 101 LEU A HD21 1 
ATOM 1534 H HD22 . LEU A 1 101 ? 11.676  -10.954 9.578   1.00 0.00 ? 101 LEU A HD22 1 
ATOM 1535 H HD23 . LEU A 1 101 ? 10.322  -10.260 8.679   1.00 0.00 ? 101 LEU A HD23 1 
ATOM 1536 N N    . GLU A 1 102 ? 14.381  -10.527 4.666   1.00 0.00 ? 102 GLU A N    1 
ATOM 1537 C CA   . GLU A 1 102 ? 14.819  -9.995  3.381   1.00 0.00 ? 102 GLU A CA   1 
ATOM 1538 C C    . GLU A 1 102 ? 16.170  -10.557 2.940   1.00 0.00 ? 102 GLU A C    1 
ATOM 1539 O O    . GLU A 1 102 ? 16.469  -10.581 1.745   1.00 0.00 ? 102 GLU A O    1 
ATOM 1540 C CB   . GLU A 1 102 ? 14.900  -8.466  3.438   1.00 0.00 ? 102 GLU A CB   1 
ATOM 1541 C CG   . GLU A 1 102 ? 13.826  -7.821  4.302   1.00 0.00 ? 102 GLU A CG   1 
ATOM 1542 C CD   . GLU A 1 102 ? 13.065  -6.733  3.570   1.00 0.00 ? 102 GLU A CD   1 
ATOM 1543 O OE1  . GLU A 1 102 ? 12.138  -7.069  2.804   1.00 0.00 ? 102 GLU A OE1  1 
ATOM 1544 O OE2  . GLU A 1 102 ? 13.395  -5.545  3.764   1.00 0.00 ? 102 GLU A OE2  1 
ATOM 1545 H H    . GLU A 1 102 ? 14.587  -10.031 5.486   1.00 0.00 ? 102 GLU A H    1 
ATOM 1546 H HA   . GLU A 1 102 ? 14.078  -10.271 2.646   1.00 0.00 ? 102 GLU A HA   1 
ATOM 1547 H HB2  . GLU A 1 102 ? 15.864  -8.185  3.834   1.00 0.00 ? 102 GLU A HB2  1 
ATOM 1548 H HB3  . GLU A 1 102 ? 14.808  -8.076  2.435   1.00 0.00 ? 102 GLU A HB3  1 
ATOM 1549 H HG2  . GLU A 1 102 ? 13.125  -8.582  4.612   1.00 0.00 ? 102 GLU A HG2  1 
ATOM 1550 H HG3  . GLU A 1 102 ? 14.296  -7.389  5.173   1.00 0.00 ? 102 GLU A HG3  1 
ATOM 1551 N N    . PHE A 1 103 ? 16.989  -11.010 3.885   1.00 0.00 ? 103 PHE A N    1 
ATOM 1552 C CA   . PHE A 1 103 ? 18.299  -11.564 3.550   1.00 0.00 ? 103 PHE A CA   1 
ATOM 1553 C C    . PHE A 1 103 ? 18.261  -13.083 3.363   1.00 0.00 ? 103 PHE A C    1 
ATOM 1554 O O    . PHE A 1 103 ? 18.797  -13.612 2.389   1.00 0.00 ? 103 PHE A O    1 
ATOM 1555 C CB   . PHE A 1 103 ? 19.320  -11.192 4.625   1.00 0.00 ? 103 PHE A CB   1 
ATOM 1556 C CG   . PHE A 1 103 ? 20.138  -9.982  4.273   1.00 0.00 ? 103 PHE A CG   1 
ATOM 1557 C CD1  . PHE A 1 103 ? 19.620  -8.708  4.441   1.00 0.00 ? 103 PHE A CD1  1 
ATOM 1558 C CD2  . PHE A 1 103 ? 21.423  -10.119 3.774   1.00 0.00 ? 103 PHE A CD2  1 
ATOM 1559 C CE1  . PHE A 1 103 ? 20.368  -7.592  4.119   1.00 0.00 ? 103 PHE A CE1  1 
ATOM 1560 C CE2  . PHE A 1 103 ? 22.177  -9.006  3.450   1.00 0.00 ? 103 PHE A CE2  1 
ATOM 1561 C CZ   . PHE A 1 103 ? 21.649  -7.741  3.622   1.00 0.00 ? 103 PHE A CZ   1 
ATOM 1562 H H    . PHE A 1 103 ? 16.715  -11.006 4.827   1.00 0.00 ? 103 PHE A H    1 
ATOM 1563 H HA   . PHE A 1 103 ? 18.608  -11.116 2.617   1.00 0.00 ? 103 PHE A HA   1 
ATOM 1564 H HB2  . PHE A 1 103 ? 18.802  -10.988 5.550   1.00 0.00 ? 103 PHE A HB2  1 
ATOM 1565 H HB3  . PHE A 1 103 ? 19.997  -12.021 4.772   1.00 0.00 ? 103 PHE A HB3  1 
ATOM 1566 H HD1  . PHE A 1 103 ? 18.618  -8.590  4.829   1.00 0.00 ? 103 PHE A HD1  1 
ATOM 1567 H HD2  . PHE A 1 103 ? 21.837  -11.106 3.639   1.00 0.00 ? 103 PHE A HD2  1 
ATOM 1568 H HE1  . PHE A 1 103 ? 19.953  -6.604  4.254   1.00 0.00 ? 103 PHE A HE1  1 
ATOM 1569 H HE2  . PHE A 1 103 ? 23.178  -9.126  3.062   1.00 0.00 ? 103 PHE A HE2  1 
ATOM 1570 H HZ   . PHE A 1 103 ? 22.236  -6.871  3.369   1.00 0.00 ? 103 PHE A HZ   1 
ATOM 1571 N N    . TYR A 1 104 ? 17.659  -13.779 4.327   1.00 0.00 ? 104 TYR A N    1 
ATOM 1572 C CA   . TYR A 1 104 ? 17.584  -15.242 4.302   1.00 0.00 ? 104 TYR A CA   1 
ATOM 1573 C C    . TYR A 1 104 ? 16.774  -15.784 3.120   1.00 0.00 ? 104 TYR A C    1 
ATOM 1574 O O    . TYR A 1 104 ? 16.649  -16.998 2.960   1.00 0.00 ? 104 TYR A O    1 
ATOM 1575 C CB   . TYR A 1 104 ? 16.990  -15.764 5.616   1.00 0.00 ? 104 TYR A CB   1 
ATOM 1576 C CG   . TYR A 1 104 ? 17.928  -16.658 6.400   1.00 0.00 ? 104 TYR A CG   1 
ATOM 1577 C CD1  . TYR A 1 104 ? 18.834  -17.490 5.754   1.00 0.00 ? 104 TYR A CD1  1 
ATOM 1578 C CD2  . TYR A 1 104 ? 17.906  -16.671 7.790   1.00 0.00 ? 104 TYR A CD2  1 
ATOM 1579 C CE1  . TYR A 1 104 ? 19.691  -18.306 6.470   1.00 0.00 ? 104 TYR A CE1  1 
ATOM 1580 C CE2  . TYR A 1 104 ? 18.759  -17.483 8.512   1.00 0.00 ? 104 TYR A CE2  1 
ATOM 1581 C CZ   . TYR A 1 104 ? 19.650  -18.298 7.847   1.00 0.00 ? 104 TYR A CZ   1 
ATOM 1582 O OH   . TYR A 1 104 ? 20.500  -19.111 8.562   1.00 0.00 ? 104 TYR A OH   1 
ATOM 1583 H H    . TYR A 1 104 ? 17.277  -13.298 5.090   1.00 0.00 ? 104 TYR A H    1 
ATOM 1584 H HA   . TYR A 1 104 ? 18.591  -15.609 4.215   1.00 0.00 ? 104 TYR A HA   1 
ATOM 1585 H HB2  . TYR A 1 104 ? 16.734  -14.923 6.244   1.00 0.00 ? 104 TYR A HB2  1 
ATOM 1586 H HB3  . TYR A 1 104 ? 16.096  -16.329 5.400   1.00 0.00 ? 104 TYR A HB3  1 
ATOM 1587 H HD1  . TYR A 1 104 ? 18.864  -17.495 4.675   1.00 0.00 ? 104 TYR A HD1  1 
ATOM 1588 H HD2  . TYR A 1 104 ? 17.209  -16.033 8.308   1.00 0.00 ? 104 TYR A HD2  1 
ATOM 1589 H HE1  . TYR A 1 104 ? 20.390  -18.941 5.948   1.00 0.00 ? 104 TYR A HE1  1 
ATOM 1590 H HE2  . TYR A 1 104 ? 18.726  -17.479 9.590   1.00 0.00 ? 104 TYR A HE2  1 
ATOM 1591 H HH   . TYR A 1 104 ? 20.025  -19.502 9.297   1.00 0.00 ? 104 TYR A HH   1 
ATOM 1592 N N    . LYS A 1 105 ? 16.221  -14.898 2.300   1.00 0.00 ? 105 LYS A N    1 
ATOM 1593 C CA   . LYS A 1 105 ? 15.427  -15.324 1.153   1.00 0.00 ? 105 LYS A CA   1 
ATOM 1594 C C    . LYS A 1 105 ? 16.216  -16.247 0.225   1.00 0.00 ? 105 LYS A C    1 
ATOM 1595 O O    . LYS A 1 105 ? 15.634  -16.988 -0.567  1.00 0.00 ? 105 LYS A O    1 
ATOM 1596 C CB   . LYS A 1 105 ? 14.909  -14.095 0.392   1.00 0.00 ? 105 LYS A CB   1 
ATOM 1597 C CG   . LYS A 1 105 ? 15.757  -13.647 -0.793  1.00 0.00 ? 105 LYS A CG   1 
ATOM 1598 C CD   . LYS A 1 105 ? 14.922  -13.519 -2.059  1.00 0.00 ? 105 LYS A CD   1 
ATOM 1599 C CE   . LYS A 1 105 ? 15.534  -12.526 -3.035  1.00 0.00 ? 105 LYS A CE   1 
ATOM 1600 N NZ   . LYS A 1 105 ? 14.585  -12.158 -4.121  1.00 0.00 ? 105 LYS A NZ   1 
ATOM 1601 H H    . LYS A 1 105 ? 16.339  -13.944 2.469   1.00 0.00 ? 105 LYS A H    1 
ATOM 1602 H HA   . LYS A 1 105 ? 14.579  -15.872 1.534   1.00 0.00 ? 105 LYS A HA   1 
ATOM 1603 H HB2  . LYS A 1 105 ? 13.927  -14.315 0.026   1.00 0.00 ? 105 LYS A HB2  1 
ATOM 1604 H HB3  . LYS A 1 105 ? 14.847  -13.272 1.084   1.00 0.00 ? 105 LYS A HB3  1 
ATOM 1605 H HG2  . LYS A 1 105 ? 16.196  -12.687 -0.567  1.00 0.00 ? 105 LYS A HG2  1 
ATOM 1606 H HG3  . LYS A 1 105 ? 16.536  -14.367 -0.963  1.00 0.00 ? 105 LYS A HG3  1 
ATOM 1607 H HD2  . LYS A 1 105 ? 14.860  -14.484 -2.537  1.00 0.00 ? 105 LYS A HD2  1 
ATOM 1608 H HD3  . LYS A 1 105 ? 13.931  -13.182 -1.791  1.00 0.00 ? 105 LYS A HD3  1 
ATOM 1609 H HE2  . LYS A 1 105 ? 15.811  -11.634 -2.494  1.00 0.00 ? 105 LYS A HE2  1 
ATOM 1610 H HE3  . LYS A 1 105 ? 16.416  -12.969 -3.474  1.00 0.00 ? 105 LYS A HE3  1 
ATOM 1611 H HZ1  . LYS A 1 105 ? 13.606  -12.341 -3.819  1.00 0.00 ? 105 LYS A HZ1  1 
ATOM 1612 H HZ2  . LYS A 1 105 ? 14.783  -12.719 -4.975  1.00 0.00 ? 105 LYS A HZ2  1 
ATOM 1613 H HZ3  . LYS A 1 105 ? 14.681  -11.149 -4.353  1.00 0.00 ? 105 LYS A HZ3  1 
ATOM 1614 N N    . ILE A 1 106 ? 17.538  -16.190 0.320   1.00 0.00 ? 106 ILE A N    1 
ATOM 1615 C CA   . ILE A 1 106 ? 18.400  -17.011 -0.519  1.00 0.00 ? 106 ILE A CA   1 
ATOM 1616 C C    . ILE A 1 106 ? 19.591  -17.576 0.257   1.00 0.00 ? 106 ILE A C    1 
ATOM 1617 O O    . ILE A 1 106 ? 20.485  -18.185 -0.332  1.00 0.00 ? 106 ILE A O    1 
ATOM 1618 C CB   . ILE A 1 106 ? 18.934  -16.196 -1.713  1.00 0.00 ? 106 ILE A CB   1 
ATOM 1619 C CG1  . ILE A 1 106 ? 19.845  -15.059 -1.227  1.00 0.00 ? 106 ILE A CG1  1 
ATOM 1620 C CG2  . ILE A 1 106 ? 17.782  -15.649 -2.542  1.00 0.00 ? 106 ILE A CG2  1 
ATOM 1621 C CD1  . ILE A 1 106 ? 19.109  -13.897 -0.590  1.00 0.00 ? 106 ILE A CD1  1 
ATOM 1622 H H    . ILE A 1 106 ? 17.944  -15.580 0.963   1.00 0.00 ? 106 ILE A H    1 
ATOM 1623 H HA   . ILE A 1 106 ? 17.811  -17.829 -0.906  1.00 0.00 ? 106 ILE A HA   1 
ATOM 1624 H HB   . ILE A 1 106 ? 19.507  -16.860 -2.339  1.00 0.00 ? 106 ILE A HB   1 
ATOM 1625 H HG12 . ILE A 1 106 ? 20.534  -15.449 -0.497  1.00 0.00 ? 106 ILE A HG12 1 
ATOM 1626 H HG13 . ILE A 1 106 ? 20.402  -14.676 -2.066  1.00 0.00 ? 106 ILE A HG13 1 
ATOM 1627 H HG21 . ILE A 1 106 ? 17.832  -16.055 -3.541  1.00 0.00 ? 106 ILE A HG21 1 
ATOM 1628 H HG22 . ILE A 1 106 ? 17.849  -14.571 -2.587  1.00 0.00 ? 106 ILE A HG22 1 
ATOM 1629 H HG23 . ILE A 1 106 ? 16.845  -15.929 -2.086  1.00 0.00 ? 106 ILE A HG23 1 
ATOM 1630 H HD11 . ILE A 1 106 ? 19.616  -13.606 0.318   1.00 0.00 ? 106 ILE A HD11 1 
ATOM 1631 H HD12 . ILE A 1 106 ? 18.099  -14.189 -0.359  1.00 0.00 ? 106 ILE A HD12 1 
ATOM 1632 H HD13 . ILE A 1 106 ? 19.094  -13.063 -1.275  1.00 0.00 ? 106 ILE A HD13 1 
ATOM 1633 N N    . HIS A 1 107 ? 19.619  -17.357 1.569   1.00 0.00 ? 107 HIS A N    1 
ATOM 1634 C CA   . HIS A 1 107 ? 20.729  -17.840 2.388   1.00 0.00 ? 107 HIS A CA   1 
ATOM 1635 C C    . HIS A 1 107 ? 20.497  -19.263 2.899   1.00 0.00 ? 107 HIS A C    1 
ATOM 1636 O O    . HIS A 1 107 ? 21.453  -19.968 3.222   1.00 0.00 ? 107 HIS A O    1 
ATOM 1637 C CB   . HIS A 1 107 ? 20.977  -16.891 3.563   1.00 0.00 ? 107 HIS A CB   1 
ATOM 1638 C CG   . HIS A 1 107 ? 22.299  -16.191 3.497   1.00 0.00 ? 107 HIS A CG   1 
ATOM 1639 N ND1  . HIS A 1 107 ? 22.616  -15.270 2.520   1.00 0.00 ? 107 HIS A ND1  1 
ATOM 1640 C CD2  . HIS A 1 107 ? 23.390  -16.278 4.296   1.00 0.00 ? 107 HIS A CD2  1 
ATOM 1641 C CE1  . HIS A 1 107 ? 23.842  -14.822 2.721   1.00 0.00 ? 107 HIS A CE1  1 
ATOM 1642 N NE2  . HIS A 1 107 ? 24.333  -15.418 3.792   1.00 0.00 ? 107 HIS A NE2  1 
ATOM 1643 H H    . HIS A 1 107 ? 18.890  -16.851 1.989   1.00 0.00 ? 107 HIS A H    1 
ATOM 1644 H HA   . HIS A 1 107 ? 21.609  -17.846 1.763   1.00 0.00 ? 107 HIS A HA   1 
ATOM 1645 H HB2  . HIS A 1 107 ? 20.207  -16.139 3.576   1.00 0.00 ? 107 HIS A HB2  1 
ATOM 1646 H HB3  . HIS A 1 107 ? 20.944  -17.452 4.485   1.00 0.00 ? 107 HIS A HB3  1 
ATOM 1647 H HD1  . HIS A 1 107 ? 22.028  -14.988 1.788   1.00 0.00 ? 107 HIS A HD1  1 
ATOM 1648 H HD2  . HIS A 1 107 ? 23.496  -16.909 5.168   1.00 0.00 ? 107 HIS A HD2  1 
ATOM 1649 H HE1  . HIS A 1 107 ? 24.356  -14.091 2.114   1.00 0.00 ? 107 HIS A HE1  1 
ATOM 1650 H HE2  . HIS A 1 107 ? 25.192  -15.205 4.213   1.00 0.00 ? 107 HIS A HE2  1 
ATOM 1651 N N    . TYR A 1 108 ? 19.232  -19.680 2.984   1.00 0.00 ? 108 TYR A N    1 
ATOM 1652 C CA   . TYR A 1 108 ? 18.892  -21.024 3.468   1.00 0.00 ? 108 TYR A CA   1 
ATOM 1653 C C    . TYR A 1 108 ? 18.984  -21.088 4.991   1.00 0.00 ? 108 TYR A C    1 
ATOM 1654 O O    . TYR A 1 108 ? 20.075  -21.050 5.558   1.00 0.00 ? 108 TYR A O    1 
ATOM 1655 C CB   . TYR A 1 108 ? 19.821  -22.081 2.849   1.00 0.00 ? 108 TYR A CB   1 
ATOM 1656 C CG   . TYR A 1 108 ? 19.125  -23.196 2.088   1.00 0.00 ? 108 TYR A CG   1 
ATOM 1657 C CD1  . TYR A 1 108 ? 17.828  -23.057 1.602   1.00 0.00 ? 108 TYR A CD1  1 
ATOM 1658 C CD2  . TYR A 1 108 ? 19.784  -24.397 1.849   1.00 0.00 ? 108 TYR A CD2  1 
ATOM 1659 C CE1  . TYR A 1 108 ? 17.215  -24.080 0.902   1.00 0.00 ? 108 TYR A CE1  1 
ATOM 1660 C CE2  . TYR A 1 108 ? 19.176  -25.422 1.151   1.00 0.00 ? 108 TYR A CE2  1 
ATOM 1661 C CZ   . TYR A 1 108 ? 17.893  -25.258 0.679   1.00 0.00 ? 108 TYR A CZ   1 
ATOM 1662 O OH   . TYR A 1 108 ? 17.285  -26.278 -0.016  1.00 0.00 ? 108 TYR A OH   1 
ATOM 1663 H H    . TYR A 1 108 ? 18.508  -19.072 2.728   1.00 0.00 ? 108 TYR A H    1 
ATOM 1664 H HA   . TYR A 1 108 ? 17.876  -21.230 3.178   1.00 0.00 ? 108 TYR A HA   1 
ATOM 1665 H HB2  . TYR A 1 108 ? 20.493  -21.595 2.161   1.00 0.00 ? 108 TYR A HB2  1 
ATOM 1666 H HB3  . TYR A 1 108 ? 20.399  -22.536 3.640   1.00 0.00 ? 108 TYR A HB3  1 
ATOM 1667 H HD1  . TYR A 1 108 ? 17.297  -22.136 1.775   1.00 0.00 ? 108 TYR A HD1  1 
ATOM 1668 H HD2  . TYR A 1 108 ? 20.791  -24.524 2.221   1.00 0.00 ? 108 TYR A HD2  1 
ATOM 1669 H HE1  . TYR A 1 108 ? 16.209  -23.953 0.532   1.00 0.00 ? 108 TYR A HE1  1 
ATOM 1670 H HE2  . TYR A 1 108 ? 19.708  -26.346 0.978   1.00 0.00 ? 108 TYR A HE2  1 
ATOM 1671 H HH   . TYR A 1 108 ? 17.460  -27.114 0.422   1.00 0.00 ? 108 TYR A HH   1 
ATOM 1672 N N    . LEU A 1 109 ? 17.832  -21.186 5.643   1.00 0.00 ? 109 LEU A N    1 
ATOM 1673 C CA   . LEU A 1 109 ? 17.779  -21.254 7.101   1.00 0.00 ? 109 LEU A CA   1 
ATOM 1674 C C    . LEU A 1 109 ? 18.430  -22.539 7.616   1.00 0.00 ? 109 LEU A C    1 
ATOM 1675 O O    . LEU A 1 109 ? 19.601  -22.540 7.994   1.00 0.00 ? 109 LEU A O    1 
ATOM 1676 C CB   . LEU A 1 109 ? 16.327  -21.153 7.591   1.00 0.00 ? 109 LEU A CB   1 
ATOM 1677 C CG   . LEU A 1 109 ? 15.622  -19.829 7.272   1.00 0.00 ? 109 LEU A CG   1 
ATOM 1678 C CD1  . LEU A 1 109 ? 14.698  -19.990 6.076   1.00 0.00 ? 109 LEU A CD1  1 
ATOM 1679 C CD2  . LEU A 1 109 ? 14.834  -19.330 8.477   1.00 0.00 ? 109 LEU A CD2  1 
ATOM 1680 H H    . LEU A 1 109 ? 16.997  -21.214 5.132   1.00 0.00 ? 109 LEU A H    1 
ATOM 1681 H HA   . LEU A 1 109 ? 18.333  -20.410 7.486   1.00 0.00 ? 109 LEU A HA   1 
ATOM 1682 H HB2  . LEU A 1 109 ? 15.761  -21.955 7.139   1.00 0.00 ? 109 LEU A HB2  1 
ATOM 1683 H HB3  . LEU A 1 109 ? 16.321  -21.290 8.662   1.00 0.00 ? 109 LEU A HB3  1 
ATOM 1684 H HG   . LEU A 1 109 ? 16.362  -19.084 7.023   1.00 0.00 ? 109 LEU A HG   1 
ATOM 1685 H HD11 . LEU A 1 109 ? 13.985  -20.777 6.276   1.00 0.00 ? 109 LEU A HD11 1 
ATOM 1686 H HD12 . LEU A 1 109 ? 15.280  -20.244 5.202   1.00 0.00 ? 109 LEU A HD12 1 
ATOM 1687 H HD13 . LEU A 1 109 ? 14.173  -19.064 5.902   1.00 0.00 ? 109 LEU A HD13 1 
ATOM 1688 H HD21 . LEU A 1 109 ? 14.582  -18.288 8.334   1.00 0.00 ? 109 LEU A HD21 1 
ATOM 1689 H HD22 . LEU A 1 109 ? 15.434  -19.434 9.370   1.00 0.00 ? 109 LEU A HD22 1 
ATOM 1690 H HD23 . LEU A 1 109 ? 13.925  -19.909 8.577   1.00 0.00 ? 109 LEU A HD23 1 
ATOM 1691 N N    . ASP A 1 110 ? 17.668  -23.631 7.629   1.00 0.00 ? 110 ASP A N    1 
ATOM 1692 C CA   . ASP A 1 110 ? 18.178  -24.919 8.099   1.00 0.00 ? 110 ASP A CA   1 
ATOM 1693 C C    . ASP A 1 110 ? 17.983  -26.014 7.048   1.00 0.00 ? 110 ASP A C    1 
ATOM 1694 O O    . ASP A 1 110 ? 18.361  -27.164 7.264   1.00 0.00 ? 110 ASP A O    1 
ATOM 1695 C CB   . ASP A 1 110 ? 17.471  -25.324 9.392   1.00 0.00 ? 110 ASP A CB   1 
ATOM 1696 C CG   . ASP A 1 110 ? 18.241  -26.375 10.168  1.00 0.00 ? 110 ASP A CG   1 
ATOM 1697 O OD1  . ASP A 1 110 ? 19.079  -25.994 11.013  1.00 0.00 ? 110 ASP A OD1  1 
ATOM 1698 O OD2  . ASP A 1 110 ? 18.004  -27.578 9.933   1.00 0.00 ? 110 ASP A OD2  1 
ATOM 1699 H H    . ASP A 1 110 ? 16.742  -23.572 7.317   1.00 0.00 ? 110 ASP A H    1 
ATOM 1700 H HA   . ASP A 1 110 ? 19.233  -24.808 8.295   1.00 0.00 ? 110 ASP A HA   1 
ATOM 1701 H HB2  . ASP A 1 110 ? 17.356  -24.453 10.018  1.00 0.00 ? 110 ASP A HB2  1 
ATOM 1702 H HB3  . ASP A 1 110 ? 16.496  -25.722 9.149   1.00 0.00 ? 110 ASP A HB3  1 
ATOM 1703 N N    . THR A 1 111 ? 17.388  -25.644 5.917   1.00 0.00 ? 111 THR A N    1 
ATOM 1704 C CA   . THR A 1 111 ? 17.127  -26.577 4.823   1.00 0.00 ? 111 THR A CA   1 
ATOM 1705 C C    . THR A 1 111 ? 16.208  -25.922 3.800   1.00 0.00 ? 111 THR A C    1 
ATOM 1706 O O    . THR A 1 111 ? 16.281  -26.205 2.605   1.00 0.00 ? 111 THR A O    1 
ATOM 1707 C CB   . THR A 1 111 ? 16.488  -27.870 5.338   1.00 0.00 ? 111 THR A CB   1 
ATOM 1708 O OG1  . THR A 1 111 ? 16.134  -28.717 4.258   1.00 0.00 ? 111 THR A OG1  1 
ATOM 1709 C CG2  . THR A 1 111 ? 15.243  -27.633 6.160   1.00 0.00 ? 111 THR A CG2  1 
ATOM 1710 H H    . THR A 1 111 ? 17.113  -24.712 5.808   1.00 0.00 ? 111 THR A H    1 
ATOM 1711 H HA   . THR A 1 111 ? 18.069  -26.809 4.352   1.00 0.00 ? 111 THR A HA   1 
ATOM 1712 H HB   . THR A 1 111 ? 17.201  -28.394 5.958   1.00 0.00 ? 111 THR A HB   1 
ATOM 1713 H HG1  . THR A 1 111 ? 16.905  -29.214 3.977   1.00 0.00 ? 111 THR A HG1  1 
ATOM 1714 H HG21 . THR A 1 111 ? 15.378  -28.050 7.146   1.00 0.00 ? 111 THR A HG21 1 
ATOM 1715 H HG22 . THR A 1 111 ? 14.399  -28.108 5.680   1.00 0.00 ? 111 THR A HG22 1 
ATOM 1716 H HG23 . THR A 1 111 ? 15.062  -26.571 6.239   1.00 0.00 ? 111 THR A HG23 1 
ATOM 1717 N N    . THR A 1 112 ? 15.344  -25.037 4.288   1.00 0.00 ? 112 THR A N    1 
ATOM 1718 C CA   . THR A 1 112 ? 14.405  -24.322 3.440   1.00 0.00 ? 112 THR A CA   1 
ATOM 1719 C C    . THR A 1 112 ? 14.776  -22.845 3.369   1.00 0.00 ? 112 THR A C    1 
ATOM 1720 O O    . THR A 1 112 ? 15.382  -22.302 4.293   1.00 0.00 ? 112 THR A O    1 
ATOM 1721 C CB   . THR A 1 112 ? 12.982  -24.480 3.977   1.00 0.00 ? 112 THR A CB   1 
ATOM 1722 O OG1  . THR A 1 112 ? 12.075  -23.683 3.236   1.00 0.00 ? 112 THR A OG1  1 
ATOM 1723 C CG2  . THR A 1 112 ? 12.848  -24.094 5.435   1.00 0.00 ? 112 THR A CG2  1 
ATOM 1724 H H    . THR A 1 112 ? 15.339  -24.861 5.250   1.00 0.00 ? 112 THR A H    1 
ATOM 1725 H HA   . THR A 1 112 ? 14.459  -24.746 2.448   1.00 0.00 ? 112 THR A HA   1 
ATOM 1726 H HB   . THR A 1 112 ? 12.684  -25.514 3.880   1.00 0.00 ? 112 THR A HB   1 
ATOM 1727 H HG1  . THR A 1 112 ? 12.276  -22.755 3.374   1.00 0.00 ? 112 THR A HG1  1 
ATOM 1728 H HG21 . THR A 1 112 ? 13.574  -24.639 6.023   1.00 0.00 ? 112 THR A HG21 1 
ATOM 1729 H HG22 . THR A 1 112 ? 11.853  -24.333 5.780   1.00 0.00 ? 112 THR A HG22 1 
ATOM 1730 H HG23 . THR A 1 112 ? 13.022  -23.034 5.542   1.00 0.00 ? 112 THR A HG23 1 
ATOM 1731 N N    . THR A 1 113 ? 14.410  -22.201 2.270   1.00 0.00 ? 113 THR A N    1 
ATOM 1732 C CA   . THR A 1 113 ? 14.704  -20.784 2.078   1.00 0.00 ? 113 THR A CA   1 
ATOM 1733 C C    . THR A 1 113 ? 13.422  -19.960 2.098   1.00 0.00 ? 113 THR A C    1 
ATOM 1734 O O    . THR A 1 113 ? 12.339  -20.476 1.828   1.00 0.00 ? 113 THR A O    1 
ATOM 1735 C CB   . THR A 1 113 ? 15.441  -20.565 0.752   1.00 0.00 ? 113 THR A CB   1 
ATOM 1736 O OG1  . THR A 1 113 ? 15.826  -21.800 0.177   1.00 0.00 ? 113 THR A OG1  1 
ATOM 1737 C CG2  . THR A 1 113 ? 16.684  -19.713 0.892   1.00 0.00 ? 113 THR A CG2  1 
ATOM 1738 H H    . THR A 1 113 ? 13.929  -22.688 1.571   1.00 0.00 ? 113 THR A H    1 
ATOM 1739 H HA   . THR A 1 113 ? 15.339  -20.465 2.891   1.00 0.00 ? 113 THR A HA   1 
ATOM 1740 H HB   . THR A 1 113 ? 14.776  -20.064 0.062   1.00 0.00 ? 113 THR A HB   1 
ATOM 1741 H HG1  . THR A 1 113 ? 16.130  -21.655 -0.722  1.00 0.00 ? 113 THR A HG1  1 
ATOM 1742 H HG21 . THR A 1 113 ? 16.415  -18.743 1.282   1.00 0.00 ? 113 THR A HG21 1 
ATOM 1743 H HG22 . THR A 1 113 ? 17.149  -19.594 -0.076  1.00 0.00 ? 113 THR A HG22 1 
ATOM 1744 H HG23 . THR A 1 113 ? 17.376  -20.194 1.566   1.00 0.00 ? 113 THR A HG23 1 
ATOM 1745 N N    . LEU A 1 114 ? 13.555  -18.676 2.412   1.00 0.00 ? 114 LEU A N    1 
ATOM 1746 C CA   . LEU A 1 114 ? 12.406  -17.780 2.458   1.00 0.00 ? 114 LEU A CA   1 
ATOM 1747 C C    . LEU A 1 114 ? 12.116  -17.215 1.070   1.00 0.00 ? 114 LEU A C    1 
ATOM 1748 O O    . LEU A 1 114 ? 13.037  -16.900 0.317   1.00 0.00 ? 114 LEU A O    1 
ATOM 1749 C CB   . LEU A 1 114 ? 12.655  -16.650 3.464   1.00 0.00 ? 114 LEU A CB   1 
ATOM 1750 C CG   . LEU A 1 114 ? 12.189  -16.906 4.917   1.00 0.00 ? 114 LEU A CG   1 
ATOM 1751 C CD1  . LEU A 1 114 ? 11.800  -18.366 5.156   1.00 0.00 ? 114 LEU A CD1  1 
ATOM 1752 C CD2  . LEU A 1 114 ? 13.268  -16.481 5.904   1.00 0.00 ? 114 LEU A CD2  1 
ATOM 1753 H H    . LEU A 1 114 ? 14.445  -18.321 2.613   1.00 0.00 ? 114 LEU A H    1 
ATOM 1754 H HA   . LEU A 1 114 ? 11.554  -18.354 2.778   1.00 0.00 ? 114 LEU A HA   1 
ATOM 1755 H HB2  . LEU A 1 114 ? 13.715  -16.449 3.482   1.00 0.00 ? 114 LEU A HB2  1 
ATOM 1756 H HB3  . LEU A 1 114 ? 12.150  -15.766 3.103   1.00 0.00 ? 114 LEU A HB3  1 
ATOM 1757 H HG   . LEU A 1 114 ? 11.316  -16.302 5.111   1.00 0.00 ? 114 LEU A HG   1 
ATOM 1758 H HD11 . LEU A 1 114 ? 12.281  -19.001 4.427   1.00 0.00 ? 114 LEU A HD11 1 
ATOM 1759 H HD12 . LEU A 1 114 ? 10.729  -18.470 5.073   1.00 0.00 ? 114 LEU A HD12 1 
ATOM 1760 H HD13 . LEU A 1 114 ? 12.109  -18.663 6.149   1.00 0.00 ? 114 LEU A HD13 1 
ATOM 1761 H HD21 . LEU A 1 114 ? 13.519  -17.312 6.547   1.00 0.00 ? 114 LEU A HD21 1 
ATOM 1762 H HD22 . LEU A 1 114 ? 12.903  -15.660 6.504   1.00 0.00 ? 114 LEU A HD22 1 
ATOM 1763 H HD23 . LEU A 1 114 ? 14.149  -16.166 5.364   1.00 0.00 ? 114 LEU A HD23 1 
ATOM 1764 N N    . ILE A 1 115 ? 10.834  -17.104 0.728   1.00 0.00 ? 115 ILE A N    1 
ATOM 1765 C CA   . ILE A 1 115 ? 10.440  -16.593 -0.579  1.00 0.00 ? 115 ILE A CA   1 
ATOM 1766 C C    . ILE A 1 115 ? 9.508   -15.391 -0.459  1.00 0.00 ? 115 ILE A C    1 
ATOM 1767 O O    . ILE A 1 115 ? 9.832   -14.301 -0.931  1.00 0.00 ? 115 ILE A O    1 
ATOM 1768 C CB   . ILE A 1 115 ? 9.753   -17.682 -1.433  1.00 0.00 ? 115 ILE A CB   1 
ATOM 1769 C CG1  . ILE A 1 115 ? 10.760  -18.759 -1.835  1.00 0.00 ? 115 ILE A CG1  1 
ATOM 1770 C CG2  . ILE A 1 115 ? 9.104   -17.077 -2.672  1.00 0.00 ? 115 ILE A CG2  1 
ATOM 1771 C CD1  . ILE A 1 115 ? 10.849  -19.898 -0.847  1.00 0.00 ? 115 ILE A CD1  1 
ATOM 1772 H H    . ILE A 1 115 ? 10.142  -17.379 1.363   1.00 0.00 ? 115 ILE A H    1 
ATOM 1773 H HA   . ILE A 1 115 ? 11.339  -16.285 -1.094  1.00 0.00 ? 115 ILE A HA   1 
ATOM 1774 H HB   . ILE A 1 115 ? 8.976   -18.133 -0.838  1.00 0.00 ? 115 ILE A HB   1 
ATOM 1775 H HG12 . ILE A 1 115 ? 10.474  -19.171 -2.791  1.00 0.00 ? 115 ILE A HG12 1 
ATOM 1776 H HG13 . ILE A 1 115 ? 11.741  -18.312 -1.919  1.00 0.00 ? 115 ILE A HG13 1 
ATOM 1777 H HG21 . ILE A 1 115 ? 9.741   -16.303 -3.070  1.00 0.00 ? 115 ILE A HG21 1 
ATOM 1778 H HG22 . ILE A 1 115 ? 8.146   -16.654 -2.405  1.00 0.00 ? 115 ILE A HG22 1 
ATOM 1779 H HG23 . ILE A 1 115 ? 8.962   -17.847 -3.416  1.00 0.00 ? 115 ILE A HG23 1 
ATOM 1780 H HD11 . ILE A 1 115 ? 9.862   -20.129 -0.472  1.00 0.00 ? 115 ILE A HD11 1 
ATOM 1781 H HD12 . ILE A 1 115 ? 11.488  -19.608 -0.026  1.00 0.00 ? 115 ILE A HD12 1 
ATOM 1782 H HD13 . ILE A 1 115 ? 11.263  -20.768 -1.335  1.00 0.00 ? 115 ILE A HD13 1 
ATOM 1783 N N    . GLU A 1 116 ? 8.340   -15.590 0.151   1.00 0.00 ? 116 GLU A N    1 
ATOM 1784 C CA   . GLU A 1 116 ? 7.380   -14.504 0.284   1.00 0.00 ? 116 GLU A CA   1 
ATOM 1785 C C    . GLU A 1 116 ? 6.532   -14.652 1.541   1.00 0.00 ? 116 GLU A C    1 
ATOM 1786 O O    . GLU A 1 116 ? 6.527   -15.704 2.181   1.00 0.00 ? 116 GLU A O    1 
ATOM 1787 C CB   . GLU A 1 116 ? 6.479   -14.452 -0.951  1.00 0.00 ? 116 GLU A CB   1 
ATOM 1788 C CG   . GLU A 1 116 ? 5.680   -15.725 -1.173  1.00 0.00 ? 116 GLU A CG   1 
ATOM 1789 C CD   . GLU A 1 116 ? 4.870   -15.690 -2.454  1.00 0.00 ? 116 GLU A CD   1 
ATOM 1790 O OE1  . GLU A 1 116 ? 5.407   -16.095 -3.507  1.00 0.00 ? 116 GLU A OE1  1 
ATOM 1791 O OE2  . GLU A 1 116 ? 3.699   -15.257 -2.405  1.00 0.00 ? 116 GLU A OE2  1 
ATOM 1792 H H    . GLU A 1 116 ? 8.113   -16.484 0.499   1.00 0.00 ? 116 GLU A H    1 
ATOM 1793 H HA   . GLU A 1 116 ? 7.936   -13.580 0.348   1.00 0.00 ? 116 GLU A HA   1 
ATOM 1794 H HB2  . GLU A 1 116 ? 5.786   -13.631 -0.845  1.00 0.00 ? 116 GLU A HB2  1 
ATOM 1795 H HB3  . GLU A 1 116 ? 7.093   -14.282 -1.823  1.00 0.00 ? 116 GLU A HB3  1 
ATOM 1796 H HG2  . GLU A 1 116 ? 6.362   -16.560 -1.220  1.00 0.00 ? 116 GLU A HG2  1 
ATOM 1797 H HG3  . GLU A 1 116 ? 5.004   -15.861 -0.340  1.00 0.00 ? 116 GLU A HG3  1 
ATOM 1798 N N    . PRO A 1 117 ? 5.796   -13.590 1.907   1.00 0.00 ? 117 PRO A N    1 
ATOM 1799 C CA   . PRO A 1 117 ? 4.936   -13.588 3.088   1.00 0.00 ? 117 PRO A CA   1 
ATOM 1800 C C    . PRO A 1 117 ? 3.676   -14.418 2.880   1.00 0.00 ? 117 PRO A C    1 
ATOM 1801 O O    . PRO A 1 117 ? 3.058   -14.378 1.815   1.00 0.00 ? 117 PRO A O    1 
ATOM 1802 C CB   . PRO A 1 117 ? 4.582   -12.106 3.291   1.00 0.00 ? 117 PRO A CB   1 
ATOM 1803 C CG   . PRO A 1 117 ? 5.401   -11.343 2.300   1.00 0.00 ? 117 PRO A CG   1 
ATOM 1804 C CD   . PRO A 1 117 ? 5.745   -12.305 1.203   1.00 0.00 ? 117 PRO A CD   1 
ATOM 1805 H HA   . PRO A 1 117 ? 5.461   -13.960 3.956   1.00 0.00 ? 117 PRO A HA   1 
ATOM 1806 H HB2  . PRO A 1 117 ? 3.526   -11.961 3.121   1.00 0.00 ? 117 PRO A HB2  1 
ATOM 1807 H HB3  . PRO A 1 117 ? 4.828   -11.817 4.302   1.00 0.00 ? 117 PRO A HB3  1 
ATOM 1808 H HG2  . PRO A 1 117 ? 4.824   -10.520 1.905   1.00 0.00 ? 117 PRO A HG2  1 
ATOM 1809 H HG3  . PRO A 1 117 ? 6.300   -10.976 2.772   1.00 0.00 ? 117 PRO A HG3  1 
ATOM 1810 H HD2  . PRO A 1 117 ? 4.976   -12.308 0.445   1.00 0.00 ? 117 PRO A HD2  1 
ATOM 1811 H HD3  . PRO A 1 117 ? 6.705   -12.062 0.772   1.00 0.00 ? 117 PRO A HD3  1 
ATOM 1812 N N    . VAL A 1 118 ? 3.314   -15.182 3.902   1.00 0.00 ? 118 VAL A N    1 
ATOM 1813 C CA   . VAL A 1 118 ? 2.144   -16.043 3.850   1.00 0.00 ? 118 VAL A CA   1 
ATOM 1814 C C    . VAL A 1 118 ? 0.900   -15.314 3.350   1.00 0.00 ? 118 VAL A C    1 
ATOM 1815 O O    . VAL A 1 118 ? 0.268   -15.754 2.392   1.00 0.00 ? 118 VAL A O    1 
ATOM 1816 C CB   . VAL A 1 118 ? 1.875   -16.690 5.225   1.00 0.00 ? 118 VAL A CB   1 
ATOM 1817 C CG1  . VAL A 1 118 ? 1.518   -15.645 6.263   1.00 0.00 ? 118 VAL A CG1  1 
ATOM 1818 C CG2  . VAL A 1 118 ? 0.787   -17.740 5.125   1.00 0.00 ? 118 VAL A CG2  1 
ATOM 1819 H H    . VAL A 1 118 ? 3.860   -15.176 4.714   1.00 0.00 ? 118 VAL A H    1 
ATOM 1820 H HA   . VAL A 1 118 ? 2.361   -16.828 3.157   1.00 0.00 ? 118 VAL A HA   1 
ATOM 1821 H HB   . VAL A 1 118 ? 2.782   -17.181 5.548   1.00 0.00 ? 118 VAL A HB   1 
ATOM 1822 H HG11 . VAL A 1 118 ? 2.233   -14.839 6.218   1.00 0.00 ? 118 VAL A HG11 1 
ATOM 1823 H HG12 . VAL A 1 118 ? 1.540   -16.095 7.246   1.00 0.00 ? 118 VAL A HG12 1 
ATOM 1824 H HG13 . VAL A 1 118 ? 0.528   -15.263 6.060   1.00 0.00 ? 118 VAL A HG13 1 
ATOM 1825 H HG21 . VAL A 1 118 ? 0.835   -18.390 5.989   1.00 0.00 ? 118 VAL A HG21 1 
ATOM 1826 H HG22 . VAL A 1 118 ? 0.935   -18.319 4.227   1.00 0.00 ? 118 VAL A HG22 1 
ATOM 1827 H HG23 . VAL A 1 118 ? -0.177  -17.257 5.090   1.00 0.00 ? 118 VAL A HG23 1 
ATOM 1828 N N    . SER A 1 119 ? 0.549   -14.200 3.980   1.00 0.00 ? 119 SER A N    1 
ATOM 1829 C CA   . SER A 1 119 ? -0.623  -13.431 3.566   1.00 0.00 ? 119 SER A CA   1 
ATOM 1830 C C    . SER A 1 119 ? -1.821  -14.344 3.293   1.00 0.00 ? 119 SER A C    1 
ATOM 1831 O O    . SER A 1 119 ? -2.127  -14.655 2.142   1.00 0.00 ? 119 SER A O    1 
ATOM 1832 C CB   . SER A 1 119 ? -0.302  -12.608 2.321   1.00 0.00 ? 119 SER A CB   1 
ATOM 1833 O OG   . SER A 1 119 ? -0.193  -13.435 1.175   1.00 0.00 ? 119 SER A OG   1 
ATOM 1834 H H    . SER A 1 119 ? 1.089   -13.882 4.733   1.00 0.00 ? 119 SER A H    1 
ATOM 1835 H HA   . SER A 1 119 ? -0.876  -12.761 4.370   1.00 0.00 ? 119 SER A HA   1 
ATOM 1836 H HB2  . SER A 1 119 ? -1.088  -11.888 2.156   1.00 0.00 ? 119 SER A HB2  1 
ATOM 1837 H HB3  . SER A 1 119 ? 0.636   -12.091 2.468   1.00 0.00 ? 119 SER A HB3  1 
ATOM 1838 H HG   . SER A 1 119 ? -0.591  -12.992 0.421   1.00 0.00 ? 119 SER A HG   1 
ATOM 1839 N N    . ARG A 1 120 ? -2.495  -14.761 4.359   1.00 0.00 ? 120 ARG A N    1 
ATOM 1840 C CA   . ARG A 1 120 ? -3.660  -15.627 4.238   1.00 0.00 ? 120 ARG A CA   1 
ATOM 1841 C C    . ARG A 1 120 ? -4.785  -14.918 3.490   1.00 0.00 ? 120 ARG A C    1 
ATOM 1842 O O    . ARG A 1 120 ? -5.506  -15.537 2.707   1.00 0.00 ? 120 ARG A O    1 
ATOM 1843 C CB   . ARG A 1 120 ? -4.146  -16.065 5.622   1.00 0.00 ? 120 ARG A CB   1 
ATOM 1844 C CG   . ARG A 1 120 ? -4.499  -14.904 6.539   1.00 0.00 ? 120 ARG A CG   1 
ATOM 1845 C CD   . ARG A 1 120 ? -6.004  -14.705 6.634   1.00 0.00 ? 120 ARG A CD   1 
ATOM 1846 N NE   . ARG A 1 120 ? -6.669  -15.848 7.257   1.00 0.00 ? 120 ARG A NE   1 
ATOM 1847 C CZ   . ARG A 1 120 ? -6.622  -16.111 8.560   1.00 0.00 ? 120 ARG A CZ   1 
ATOM 1848 N NH1  . ARG A 1 120 ? -5.946  -15.318 9.382   1.00 0.00 ? 120 ARG A NH1  1 
ATOM 1849 N NH2  . ARG A 1 120 ? -7.253  -17.172 9.044   1.00 0.00 ? 120 ARG A NH2  1 
ATOM 1850 H H    . ARG A 1 120 ? -2.202  -14.468 5.244   1.00 0.00 ? 120 ARG A H    1 
ATOM 1851 H HA   . ARG A 1 120 ? -3.366  -16.502 3.677   1.00 0.00 ? 120 ARG A HA   1 
ATOM 1852 H HB2  . ARG A 1 120 ? -5.024  -16.683 5.503   1.00 0.00 ? 120 ARG A HB2  1 
ATOM 1853 H HB3  . ARG A 1 120 ? -3.369  -16.646 6.096   1.00 0.00 ? 120 ARG A HB3  1 
ATOM 1854 H HG2  . ARG A 1 120 ? -4.111  -15.106 7.526   1.00 0.00 ? 120 ARG A HG2  1 
ATOM 1855 H HG3  . ARG A 1 120 ? -4.050  -14.003 6.151   1.00 0.00 ? 120 ARG A HG3  1 
ATOM 1856 H HD2  . ARG A 1 120 ? -6.200  -13.822 7.223   1.00 0.00 ? 120 ARG A HD2  1 
ATOM 1857 H HD3  . ARG A 1 120 ? -6.400  -14.568 5.639   1.00 0.00 ? 120 ARG A HD3  1 
ATOM 1858 H HE   . ARG A 1 120 ? -7.176  -16.449 6.673   1.00 0.00 ? 120 ARG A HE   1 
ATOM 1859 H HH11 . ARG A 1 120 ? -5.468  -14.516 9.024   1.00 0.00 ? 120 ARG A HH11 1 
ATOM 1860 H HH12 . ARG A 1 120 ? -5.916  -15.522 10.361  1.00 0.00 ? 120 ARG A HH12 1 
ATOM 1861 H HH21 . ARG A 1 120 ? -7.765  -17.774 8.430   1.00 0.00 ? 120 ARG A HH21 1 
ATOM 1862 H HH22 . ARG A 1 120 ? -7.218  -17.371 10.024  1.00 0.00 ? 120 ARG A HH22 1 
ATOM 1863 N N    . SER A 1 121 ? -4.928  -13.617 3.737   1.00 0.00 ? 121 SER A N    1 
ATOM 1864 C CA   . SER A 1 121 ? -5.966  -12.817 3.088   1.00 0.00 ? 121 SER A CA   1 
ATOM 1865 C C    . SER A 1 121 ? -5.949  -11.380 3.606   1.00 0.00 ? 121 SER A C    1 
ATOM 1866 O O    . SER A 1 121 ? -5.003  -10.960 4.272   1.00 0.00 ? 121 SER A O    1 
ATOM 1867 C CB   . SER A 1 121 ? -7.346  -13.437 3.327   1.00 0.00 ? 121 SER A CB   1 
ATOM 1868 O OG   . SER A 1 121 ? -8.355  -12.720 2.636   1.00 0.00 ? 121 SER A OG   1 
ATOM 1869 H H    . SER A 1 121 ? -4.318  -13.182 4.370   1.00 0.00 ? 121 SER A H    1 
ATOM 1870 H HA   . SER A 1 121 ? -5.763  -12.809 2.028   1.00 0.00 ? 121 SER A HA   1 
ATOM 1871 H HB2  . SER A 1 121 ? -7.348  -14.458 2.980   1.00 0.00 ? 121 SER A HB2  1 
ATOM 1872 H HB3  . SER A 1 121 ? -7.569  -13.416 4.384   1.00 0.00 ? 121 SER A HB3  1 
ATOM 1873 H HG   . SER A 1 121 ? -8.165  -12.728 1.694   1.00 0.00 ? 121 SER A HG   1 
ATOM 1874 N N    . ARG A 1 122 ? -7.008  -10.634 3.298   1.00 0.00 ? 122 ARG A N    1 
ATOM 1875 C CA   . ARG A 1 122 ? -7.128  -9.245  3.733   1.00 0.00 ? 122 ARG A CA   1 
ATOM 1876 C C    . ARG A 1 122 ? -6.047  -8.370  3.107   1.00 0.00 ? 122 ARG A C    1 
ATOM 1877 O O    . ARG A 1 122 ? -4.881  -8.758  3.037   1.00 0.00 ? 122 ARG A O    1 
ATOM 1878 C CB   . ARG A 1 122 ? -7.051  -9.154  5.259   1.00 0.00 ? 122 ARG A CB   1 
ATOM 1879 C CG   . ARG A 1 122 ? -8.142  -9.937  5.971   1.00 0.00 ? 122 ARG A CG   1 
ATOM 1880 C CD   . ARG A 1 122 ? -8.305  -9.481  7.413   1.00 0.00 ? 122 ARG A CD   1 
ATOM 1881 N NE   . ARG A 1 122 ? -8.302  -10.606 8.346   1.00 0.00 ? 122 ARG A NE   1 
ATOM 1882 C CZ   . ARG A 1 122 ? -7.198  -11.225 8.756   1.00 0.00 ? 122 ARG A CZ   1 
ATOM 1883 N NH1  . ARG A 1 122 ? -6.007  -10.832 8.320   1.00 0.00 ? 122 ARG A NH1  1 
ATOM 1884 N NH2  . ARG A 1 122 ? -7.284  -12.240 9.604   1.00 0.00 ? 122 ARG A NH2  1 
ATOM 1885 H H    . ARG A 1 122 ? -7.730  -11.030 2.768   1.00 0.00 ? 122 ARG A H    1 
ATOM 1886 H HA   . ARG A 1 122 ? -8.093  -8.883  3.412   1.00 0.00 ? 122 ARG A HA   1 
ATOM 1887 H HB2  . ARG A 1 122 ? -6.094  -9.536  5.583   1.00 0.00 ? 122 ARG A HB2  1 
ATOM 1888 H HB3  . ARG A 1 122 ? -7.133  -8.117  5.551   1.00 0.00 ? 122 ARG A HB3  1 
ATOM 1889 H HG2  . ARG A 1 122 ? -9.075  -9.790  5.450   1.00 0.00 ? 122 ARG A HG2  1 
ATOM 1890 H HG3  . ARG A 1 122 ? -7.883  -10.986 5.962   1.00 0.00 ? 122 ARG A HG3  1 
ATOM 1891 H HD2  . ARG A 1 122 ? -7.492  -8.817  7.664   1.00 0.00 ? 122 ARG A HD2  1 
ATOM 1892 H HD3  . ARG A 1 122 ? -9.242  -8.952  7.505   1.00 0.00 ? 122 ARG A HD3  1 
ATOM 1893 H HE   . ARG A 1 122 ? -9.168  -10.916 8.683   1.00 0.00 ? 122 ARG A HE   1 
ATOM 1894 H HH11 . ARG A 1 122 ? -5.935  -10.067 7.681   1.00 0.00 ? 122 ARG A HH11 1 
ATOM 1895 H HH12 . ARG A 1 122 ? -5.181  -11.301 8.634   1.00 0.00 ? 122 ARG A HH12 1 
ATOM 1896 H HH21 . ARG A 1 122 ? -8.180  -12.540 9.935   1.00 0.00 ? 122 ARG A HH21 1 
ATOM 1897 H HH22 . ARG A 1 122 ? -6.455  -12.707 9.913   1.00 0.00 ? 122 ARG A HH22 1 
ATOM 1898 N N    . GLN A 1 123 ? -6.445  -7.182  2.659   1.00 0.00 ? 123 GLN A N    1 
ATOM 1899 C CA   . GLN A 1 123 ? -5.517  -6.243  2.043   1.00 0.00 ? 123 GLN A CA   1 
ATOM 1900 C C    . GLN A 1 123 ? -6.110  -4.838  2.007   1.00 0.00 ? 123 GLN A C    1 
ATOM 1901 O O    . GLN A 1 123 ? -7.321  -4.667  1.869   1.00 0.00 ? 123 GLN A O    1 
ATOM 1902 C CB   . GLN A 1 123 ? -5.156  -6.692  0.628   1.00 0.00 ? 123 GLN A CB   1 
ATOM 1903 C CG   . GLN A 1 123 ? -4.214  -5.739  -0.087  1.00 0.00 ? 123 GLN A CG   1 
ATOM 1904 C CD   . GLN A 1 123 ? -4.766  -5.261  -1.414  1.00 0.00 ? 123 GLN A CD   1 
ATOM 1905 O OE1  . GLN A 1 123 ? -4.212  -5.555  -2.474  1.00 0.00 ? 123 GLN A OE1  1 
ATOM 1906 N NE2  . GLN A 1 123 ? -5.864  -4.520  -1.360  1.00 0.00 ? 123 GLN A NE2  1 
ATOM 1907 H H    . GLN A 1 123 ? -7.387  -6.930  2.747   1.00 0.00 ? 123 GLN A H    1 
ATOM 1908 H HA   . GLN A 1 123 ? -4.620  -6.222  2.643   1.00 0.00 ? 123 GLN A HA   1 
ATOM 1909 H HB2  . GLN A 1 123 ? -4.682  -7.662  0.679   1.00 0.00 ? 123 GLN A HB2  1 
ATOM 1910 H HB3  . GLN A 1 123 ? -6.060  -6.774  0.047   1.00 0.00 ? 123 GLN A HB3  1 
ATOM 1911 H HG2  . GLN A 1 123 ? -4.051  -4.878  0.545   1.00 0.00 ? 123 GLN A HG2  1 
ATOM 1912 H HG3  . GLN A 1 123 ? -3.277  -6.242  -0.262  1.00 0.00 ? 123 GLN A HG3  1 
ATOM 1913 H HE21 . GLN A 1 123 ? -6.248  -4.327  -0.478  1.00 0.00 ? 123 GLN A HE21 1 
ATOM 1914 H HE22 . GLN A 1 123 ? -6.246  -4.194  -2.202  1.00 0.00 ? 123 GLN A HE22 1 
ATOM 1915 N N    . GLY A 1 124 ? -5.245  -3.839  2.135   1.00 0.00 ? 124 GLY A N    1 
ATOM 1916 C CA   . GLY A 1 124 ? -5.686  -2.460  2.117   1.00 0.00 ? 124 GLY A CA   1 
ATOM 1917 C C    . GLY A 1 124 ? -6.344  -2.063  0.808   1.00 0.00 ? 124 GLY A C    1 
ATOM 1918 O O    . GLY A 1 124 ? -5.715  -1.434  -0.043  1.00 0.00 ? 124 GLY A O    1 
ATOM 1919 H H    . GLY A 1 124 ? -4.292  -4.043  2.245   1.00 0.00 ? 124 GLY A H    1 
ATOM 1920 H HA2  . GLY A 1 124 ? -6.390  -2.309  2.921   1.00 0.00 ? 124 GLY A HA2  1 
ATOM 1921 H HA3  . GLY A 1 124 ? -4.829  -1.826  2.279   1.00 0.00 ? 124 GLY A HA3  1 
ATOM 1922 N N    . SER A 1 125 ? -7.613  -2.427  0.647   1.00 0.00 ? 125 SER A N    1 
ATOM 1923 C CA   . SER A 1 125 ? -8.354  -2.098  -0.567  1.00 0.00 ? 125 SER A CA   1 
ATOM 1924 C C    . SER A 1 125 ? -9.475  -1.108  -0.271  1.00 0.00 ? 125 SER A C    1 
ATOM 1925 O O    . SER A 1 125 ? -9.565  -0.049  -0.891  1.00 0.00 ? 125 SER A O    1 
ATOM 1926 C CB   . SER A 1 125 ? -8.933  -3.366  -1.196  1.00 0.00 ? 125 SER A CB   1 
ATOM 1927 O OG   . SER A 1 125 ? -9.655  -4.125  -0.240  1.00 0.00 ? 125 SER A OG   1 
ATOM 1928 H H    . SER A 1 125 ? -8.062  -2.924  1.361   1.00 0.00 ? 125 SER A H    1 
ATOM 1929 H HA   . SER A 1 125 ? -7.668  -1.643  -1.263  1.00 0.00 ? 125 SER A HA   1 
ATOM 1930 H HB2  . SER A 1 125 ? -9.601  -3.095  -2.000  1.00 0.00 ? 125 SER A HB2  1 
ATOM 1931 H HB3  . SER A 1 125 ? -8.128  -3.972  -1.584  1.00 0.00 ? 125 SER A HB3  1 
ATOM 1932 H HG   . SER A 1 125 ? -10.399 -4.553  -0.668  1.00 0.00 ? 125 SER A HG   1 
ATOM 1933 N N    . GLY A 1 126 ? -10.329 -1.465  0.682   1.00 0.00 ? 126 GLY A N    1 
ATOM 1934 C CA   . GLY A 1 126 ? -11.439 -0.605  1.050   1.00 0.00 ? 126 GLY A CA   1 
ATOM 1935 C C    . GLY A 1 126 ? -12.537 -0.569  0.009   1.00 0.00 ? 126 GLY A C    1 
ATOM 1936 O O    . GLY A 1 126 ? -13.524 0.149   0.170   1.00 0.00 ? 126 GLY A O    1 
ATOM 1937 H H    . GLY A 1 126 ? -10.204 -2.322  1.140   1.00 0.00 ? 126 GLY A H    1 
ATOM 1938 H HA2  . GLY A 1 126 ? -11.860 -0.960  1.976   1.00 0.00 ? 126 GLY A HA2  1 
ATOM 1939 H HA3  . GLY A 1 126 ? -11.067 0.397   1.196   1.00 0.00 ? 126 GLY A HA3  1 
ATOM 1940 N N    . VAL A 1 127 ? -12.370 -1.347  -1.058  1.00 0.00 ? 127 VAL A N    1 
ATOM 1941 C CA   . VAL A 1 127 ? -13.354 -1.413  -2.137  1.00 0.00 ? 127 VAL A CA   1 
ATOM 1942 C C    . VAL A 1 127 ? -13.903 -0.031  -2.476  1.00 0.00 ? 127 VAL A C    1 
ATOM 1943 O O    . VAL A 1 127 ? -15.052 0.103   -2.896  1.00 0.00 ? 127 VAL A O    1 
ATOM 1944 C CB   . VAL A 1 127 ? -14.526 -2.352  -1.785  1.00 0.00 ? 127 VAL A CB   1 
ATOM 1945 C CG1  . VAL A 1 127 ? -14.183 -3.790  -2.140  1.00 0.00 ? 127 VAL A CG1  1 
ATOM 1946 C CG2  . VAL A 1 127 ? -14.898 -2.236  -0.312  1.00 0.00 ? 127 VAL A CG2  1 
ATOM 1947 H H    . VAL A 1 127 ? -11.567 -1.893  -1.123  1.00 0.00 ? 127 VAL A H    1 
ATOM 1948 H HA   . VAL A 1 127 ? -12.858 -1.811  -3.008  1.00 0.00 ? 127 VAL A HA   1 
ATOM 1949 H HB   . VAL A 1 127 ? -15.382 -2.056  -2.372  1.00 0.00 ? 127 VAL A HB   1 
ATOM 1950 H HG11 . VAL A 1 127 ? -13.407 -3.798  -2.891  1.00 0.00 ? 127 VAL A HG11 1 
ATOM 1951 H HG12 . VAL A 1 127 ? -15.062 -4.284  -2.526  1.00 0.00 ? 127 VAL A HG12 1 
ATOM 1952 H HG13 . VAL A 1 127 ? -13.837 -4.305  -1.257  1.00 0.00 ? 127 VAL A HG13 1 
ATOM 1953 H HG21 . VAL A 1 127 ? -14.033 -2.453  0.296   1.00 0.00 ? 127 VAL A HG21 1 
ATOM 1954 H HG22 . VAL A 1 127 ? -15.685 -2.939  -0.083  1.00 0.00 ? 127 VAL A HG22 1 
ATOM 1955 H HG23 . VAL A 1 127 ? -15.242 -1.233  -0.106  1.00 0.00 ? 127 VAL A HG23 1 
ATOM 1956 N N    . ILE A 1 128 ? -13.062 0.988   -2.294  1.00 0.00 ? 128 ILE A N    1 
ATOM 1957 C CA   . ILE A 1 128 ? -13.433 2.372   -2.576  1.00 0.00 ? 128 ILE A CA   1 
ATOM 1958 C C    . ILE A 1 128 ? -14.913 2.636   -2.308  1.00 0.00 ? 128 ILE A C    1 
ATOM 1959 O O    . ILE A 1 128 ? -15.714 2.753   -3.235  1.00 0.00 ? 128 ILE A O    1 
ATOM 1960 C CB   . ILE A 1 128 ? -13.093 2.733   -4.027  1.00 0.00 ? 128 ILE A CB   1 
ATOM 1961 C CG1  . ILE A 1 128 ? -11.617 2.444   -4.290  1.00 0.00 ? 128 ILE A CG1  1 
ATOM 1962 C CG2  . ILE A 1 128 ? -13.414 4.193   -4.306  1.00 0.00 ? 128 ILE A CG2  1 
ATOM 1963 C CD1  . ILE A 1 128 ? -11.320 0.982   -4.536  1.00 0.00 ? 128 ILE A CD1  1 
ATOM 1964 H H    . ILE A 1 128 ? -12.159 0.804   -1.967  1.00 0.00 ? 128 ILE A H    1 
ATOM 1965 H HA   . ILE A 1 128 ? -12.844 3.008   -1.931  1.00 0.00 ? 128 ILE A HA   1 
ATOM 1966 H HB   . ILE A 1 128 ? -13.693 2.119   -4.678  1.00 0.00 ? 128 ILE A HB   1 
ATOM 1967 H HG12 . ILE A 1 128 ? -11.299 2.998   -5.154  1.00 0.00 ? 128 ILE A HG12 1 
ATOM 1968 H HG13 . ILE A 1 128 ? -11.039 2.760   -3.433  1.00 0.00 ? 128 ILE A HG13 1 
ATOM 1969 H HG21 . ILE A 1 128 ? -14.453 4.384   -4.077  1.00 0.00 ? 128 ILE A HG21 1 
ATOM 1970 H HG22 . ILE A 1 128 ? -13.229 4.411   -5.348  1.00 0.00 ? 128 ILE A HG22 1 
ATOM 1971 H HG23 . ILE A 1 128 ? -12.789 4.822   -3.691  1.00 0.00 ? 128 ILE A HG23 1 
ATOM 1972 H HD11 . ILE A 1 128 ? -12.188 0.506   -4.970  1.00 0.00 ? 128 ILE A HD11 1 
ATOM 1973 H HD12 . ILE A 1 128 ? -11.077 0.501   -3.599  1.00 0.00 ? 128 ILE A HD12 1 
ATOM 1974 H HD13 . ILE A 1 128 ? -10.484 0.892   -5.214  1.00 0.00 ? 128 ILE A HD13 1 
ATOM 1975 N N    . LEU A 1 129 ? -15.263 2.719   -1.031  1.00 0.00 ? 129 LEU A N    1 
ATOM 1976 C CA   . LEU A 1 129 ? -16.644 2.959   -0.628  1.00 0.00 ? 129 LEU A CA   1 
ATOM 1977 C C    . LEU A 1 129 ? -16.965 4.451   -0.619  1.00 0.00 ? 129 LEU A C    1 
ATOM 1978 O O    . LEU A 1 129 ? -16.633 5.162   0.329   1.00 0.00 ? 129 LEU A O    1 
ATOM 1979 C CB   . LEU A 1 129 ? -16.900 2.361   0.757   1.00 0.00 ? 129 LEU A CB   1 
ATOM 1980 C CG   . LEU A 1 129 ? -18.263 1.690   0.930   1.00 0.00 ? 129 LEU A CG   1 
ATOM 1981 C CD1  . LEU A 1 129 ? -19.384 2.678   0.646   1.00 0.00 ? 129 LEU A CD1  1 
ATOM 1982 C CD2  . LEU A 1 129 ? -18.378 0.475   0.022   1.00 0.00 ? 129 LEU A CD2  1 
ATOM 1983 H H    . LEU A 1 129 ? -14.576 2.611   -0.341  1.00 0.00 ? 129 LEU A H    1 
ATOM 1984 H HA   . LEU A 1 129 ? -17.288 2.471   -1.344  1.00 0.00 ? 129 LEU A HA   1 
ATOM 1985 H HB2  . LEU A 1 129 ? -16.131 1.626   0.955   1.00 0.00 ? 129 LEU A HB2  1 
ATOM 1986 H HB3  . LEU A 1 129 ? -16.816 3.150   1.489   1.00 0.00 ? 129 LEU A HB3  1 
ATOM 1987 H HG   . LEU A 1 129 ? -18.365 1.355   1.953   1.00 0.00 ? 129 LEU A HG   1 
ATOM 1988 H HD11 . LEU A 1 129 ? -19.430 3.408   1.441   1.00 0.00 ? 129 LEU A HD11 1 
ATOM 1989 H HD12 . LEU A 1 129 ? -20.323 2.149   0.588   1.00 0.00 ? 129 LEU A HD12 1 
ATOM 1990 H HD13 . LEU A 1 129 ? -19.192 3.179   -0.291  1.00 0.00 ? 129 LEU A HD13 1 
ATOM 1991 H HD21 . LEU A 1 129 ? -17.562 -0.203  0.224   1.00 0.00 ? 129 LEU A HD21 1 
ATOM 1992 H HD22 . LEU A 1 129 ? -18.336 0.792   -1.009  1.00 0.00 ? 129 LEU A HD22 1 
ATOM 1993 H HD23 . LEU A 1 129 ? -19.317 -0.026  0.208   1.00 0.00 ? 129 LEU A HD23 1 
ATOM 1994 N N    . ARG A 1 130 ? -17.615 4.917   -1.681  1.00 0.00 ? 130 ARG A N    1 
ATOM 1995 C CA   . ARG A 1 130 ? -17.987 6.323   -1.797  1.00 0.00 ? 130 ARG A CA   1 
ATOM 1996 C C    . ARG A 1 130 ? -19.140 6.660   -0.860  1.00 0.00 ? 130 ARG A C    1 
ATOM 1997 O O    . ARG A 1 130 ? -18.942 7.253   0.201   1.00 0.00 ? 130 ARG A O    1 
ATOM 1998 C CB   . ARG A 1 130 ? -18.379 6.646   -3.239  1.00 0.00 ? 130 ARG A CB   1 
ATOM 1999 C CG   . ARG A 1 130 ? -17.192 6.923   -4.142  1.00 0.00 ? 130 ARG A CG   1 
ATOM 2000 C CD   . ARG A 1 130 ? -16.623 8.306   -3.890  1.00 0.00 ? 130 ARG A CD   1 
ATOM 2001 N NE   . ARG A 1 130 ? -15.513 8.280   -2.941  1.00 0.00 ? 130 ARG A NE   1 
ATOM 2002 C CZ   . ARG A 1 130 ? -14.257 7.987   -3.273  1.00 0.00 ? 130 ARG A CZ   1 
ATOM 2003 N NH1  . ARG A 1 130 ? -13.947 7.686   -4.528  1.00 0.00 ? 130 ARG A NH1  1 
ATOM 2004 N NH2  . ARG A 1 130 ? -13.309 7.994   -2.347  1.00 0.00 ? 130 ARG A NH2  1 
ATOM 2005 H H    . ARG A 1 130 ? -17.854 4.301   -2.403  1.00 0.00 ? 130 ARG A H    1 
ATOM 2006 H HA   . ARG A 1 130 ? -17.132 6.918   -1.524  1.00 0.00 ? 130 ARG A HA   1 
ATOM 2007 H HB2  . ARG A 1 130 ? -18.927 5.812   -3.648  1.00 0.00 ? 130 ARG A HB2  1 
ATOM 2008 H HB3  . ARG A 1 130 ? -19.015 7.519   -3.240  1.00 0.00 ? 130 ARG A HB3  1 
ATOM 2009 H HG2  . ARG A 1 130 ? -16.426 6.188   -3.952  1.00 0.00 ? 130 ARG A HG2  1 
ATOM 2010 H HG3  . ARG A 1 130 ? -17.513 6.857   -5.171  1.00 0.00 ? 130 ARG A HG3  1 
ATOM 2011 H HD2  . ARG A 1 130 ? -16.275 8.714   -4.827  1.00 0.00 ? 130 ARG A HD2  1 
ATOM 2012 H HD3  . ARG A 1 130 ? -17.407 8.933   -3.495  1.00 0.00 ? 130 ARG A HD3  1 
ATOM 2013 H HE   . ARG A 1 130 ? -15.713 8.495   -2.006  1.00 0.00 ? 130 ARG A HE   1 
ATOM 2014 H HH11 . ARG A 1 130 ? -14.658 7.677   -5.232  1.00 0.00 ? 130 ARG A HH11 1 
ATOM 2015 H HH12 . ARG A 1 130 ? -13.002 7.467   -4.771  1.00 0.00 ? 130 ARG A HH12 1 
ATOM 2016 H HH21 . ARG A 1 130 ? -13.537 8.219   -1.399  1.00 0.00 ? 130 ARG A HH21 1 
ATOM 2017 H HH22 . ARG A 1 130 ? -12.366 7.775   -2.595  1.00 0.00 ? 130 ARG A HH22 1 
ATOM 2018 N N    . GLN A 1 131 ? -20.346 6.279   -1.264  1.00 0.00 ? 131 GLN A N    1 
ATOM 2019 C CA   . GLN A 1 131 ? -21.542 6.537   -0.471  1.00 0.00 ? 131 GLN A CA   1 
ATOM 2020 C C    . GLN A 1 131 ? -21.835 8.033   -0.381  1.00 0.00 ? 131 GLN A C    1 
ATOM 2021 O O    . GLN A 1 131 ? -22.606 8.470   0.474   1.00 0.00 ? 131 GLN A O    1 
ATOM 2022 C CB   . GLN A 1 131 ? -21.392 5.944   0.931   1.00 0.00 ? 131 GLN A CB   1 
ATOM 2023 C CG   . GLN A 1 131 ? -22.207 4.681   1.143   1.00 0.00 ? 131 GLN A CG   1 
ATOM 2024 C CD   . GLN A 1 131 ? -22.834 4.616   2.522   1.00 0.00 ? 131 GLN A CD   1 
ATOM 2025 O OE1  . GLN A 1 131 ? -22.283 4.006   3.438   1.00 0.00 ? 131 GLN A OE1  1 
ATOM 2026 N NE2  . GLN A 1 131 ? -23.993 5.246   2.675   1.00 0.00 ? 131 GLN A NE2  1 
ATOM 2027 H H    . GLN A 1 131 ? -20.432 5.813   -2.121  1.00 0.00 ? 131 GLN A H    1 
ATOM 2028 H HA   . GLN A 1 131 ? -22.370 6.054   -0.963  1.00 0.00 ? 131 GLN A HA   1 
ATOM 2029 H HB2  . GLN A 1 131 ? -20.351 5.708   1.100   1.00 0.00 ? 131 GLN A HB2  1 
ATOM 2030 H HB3  . GLN A 1 131 ? -21.709 6.677   1.656   1.00 0.00 ? 131 GLN A HB3  1 
ATOM 2031 H HG2  . GLN A 1 131 ? -22.995 4.650   0.405   1.00 0.00 ? 131 GLN A HG2  1 
ATOM 2032 H HG3  . GLN A 1 131 ? -21.562 3.825   1.014   1.00 0.00 ? 131 GLN A HG3  1 
ATOM 2033 H HE21 . GLN A 1 131 ? -24.374 5.710   1.902   1.00 0.00 ? 131 GLN A HE21 1 
ATOM 2034 H HE22 . GLN A 1 131 ? -24.420 5.219   3.557   1.00 0.00 ? 131 GLN A HE22 1 
ATOM 2035 N N    . GLU A 1 132 ? -21.222 8.815   -1.266  1.00 0.00 ? 132 GLU A N    1 
ATOM 2036 C CA   . GLU A 1 132 ? -21.430 10.261  -1.280  1.00 0.00 ? 132 GLU A CA   1 
ATOM 2037 C C    . GLU A 1 132 ? -22.913 10.591  -1.437  1.00 0.00 ? 132 GLU A C    1 
ATOM 2038 O O    . GLU A 1 132 ? -23.585 10.040  -2.307  1.00 0.00 ? 132 GLU A O    1 
ATOM 2039 C CB   . GLU A 1 132 ? -20.626 10.912  -2.409  1.00 0.00 ? 132 GLU A CB   1 
ATOM 2040 C CG   . GLU A 1 132 ? -20.564 10.080  -3.681  1.00 0.00 ? 132 GLU A CG   1 
ATOM 2041 C CD   . GLU A 1 132 ? -20.591 10.930  -4.936  1.00 0.00 ? 132 GLU A CD   1 
ATOM 2042 O OE1  . GLU A 1 132 ? -19.812 11.903  -5.010  1.00 0.00 ? 132 GLU A OE1  1 
ATOM 2043 O OE2  . GLU A 1 132 ? -21.391 10.622  -5.844  1.00 0.00 ? 132 GLU A OE2  1 
ATOM 2044 H H    . GLU A 1 132 ? -20.620 8.409   -1.927  1.00 0.00 ? 132 GLU A H    1 
ATOM 2045 H HA   . GLU A 1 132 ? -21.087 10.652  -0.333  1.00 0.00 ? 132 GLU A HA   1 
ATOM 2046 H HB2  . GLU A 1 132 ? -21.075 11.864  -2.651  1.00 0.00 ? 132 GLU A HB2  1 
ATOM 2047 H HB3  . GLU A 1 132 ? -19.616 11.079  -2.065  1.00 0.00 ? 132 GLU A HB3  1 
ATOM 2048 H HG2  . GLU A 1 132 ? -19.651 9.503   -3.674  1.00 0.00 ? 132 GLU A HG2  1 
ATOM 2049 H HG3  . GLU A 1 132 ? -21.411 9.410   -3.699  1.00 0.00 ? 132 GLU A HG3  1 
ATOM 2050 N N    . GLU A 1 133 ? -23.410 11.489  -0.581  1.00 0.00 ? 133 GLU A N    1 
ATOM 2051 C CA   . GLU A 1 133 ? -24.816 11.907  -0.595  1.00 0.00 ? 133 GLU A CA   1 
ATOM 2052 C C    . GLU A 1 133 ? -25.749 10.724  -0.861  1.00 0.00 ? 133 GLU A C    1 
ATOM 2053 O O    . GLU A 1 133 ? -25.341 9.568   -0.748  1.00 0.00 ? 133 GLU A O    1 
ATOM 2054 C CB   . GLU A 1 133 ? -25.037 13.012  -1.633  1.00 0.00 ? 133 GLU A CB   1 
ATOM 2055 C CG   . GLU A 1 133 ? -24.967 12.531  -3.072  1.00 0.00 ? 133 GLU A CG   1 
ATOM 2056 C CD   . GLU A 1 133 ? -23.864 13.207  -3.864  1.00 0.00 ? 133 GLU A CD   1 
ATOM 2057 O OE1  . GLU A 1 133 ? -22.710 13.220  -3.385  1.00 0.00 ? 133 GLU A OE1  1 
ATOM 2058 O OE2  . GLU A 1 133 ? -24.154 13.723  -4.963  1.00 0.00 ? 133 GLU A OE2  1 
ATOM 2059 H H    . GLU A 1 133 ? -22.812 11.880  0.087   1.00 0.00 ? 133 GLU A H    1 
ATOM 2060 H HA   . GLU A 1 133 ? -25.044 12.303  0.382   1.00 0.00 ? 133 GLU A HA   1 
ATOM 2061 H HB2  . GLU A 1 133 ? -26.010 13.450  -1.472  1.00 0.00 ? 133 GLU A HB2  1 
ATOM 2062 H HB3  . GLU A 1 133 ? -24.284 13.771  -1.494  1.00 0.00 ? 133 GLU A HB3  1 
ATOM 2063 H HG2  . GLU A 1 133 ? -24.789 11.470  -3.072  1.00 0.00 ? 133 GLU A HG2  1 
ATOM 2064 H HG3  . GLU A 1 133 ? -25.911 12.736  -3.550  1.00 0.00 ? 133 GLU A HG3  1 
ATOM 2065 N N    . ALA A 1 134 ? -27.004 11.010  -1.207  1.00 0.00 ? 134 ALA A N    1 
ATOM 2066 C CA   . ALA A 1 134 ? -27.966 9.947   -1.479  1.00 0.00 ? 134 ALA A CA   1 
ATOM 2067 C C    . ALA A 1 134 ? -29.339 10.483  -1.859  1.00 0.00 ? 134 ALA A C    1 
ATOM 2068 O O    . ALA A 1 134 ? -29.742 10.411  -3.018  1.00 0.00 ? 134 ALA A O    1 
ATOM 2069 C CB   . ALA A 1 134 ? -28.089 9.022   -0.278  1.00 0.00 ? 134 ALA A CB   1 
ATOM 2070 H H    . ALA A 1 134 ? -27.283 11.947  -1.280  1.00 0.00 ? 134 ALA A H    1 
ATOM 2071 H HA   . ALA A 1 134 ? -27.590 9.368   -2.301  1.00 0.00 ? 134 ALA A HA   1 
ATOM 2072 H HB1  . ALA A 1 134 ? -27.204 9.103   0.334   1.00 0.00 ? 134 ALA A HB1  1 
ATOM 2073 H HB2  . ALA A 1 134 ? -28.200 8.003   -0.621  1.00 0.00 ? 134 ALA A HB2  1 
ATOM 2074 H HB3  . ALA A 1 134 ? -28.956 9.298   0.302   1.00 0.00 ? 134 ALA A HB3  1 
ATOM 2075 N N    . GLU A 1 135 ? -30.056 11.000  -0.875  1.00 0.00 ? 135 GLU A N    1 
ATOM 2076 C CA   . GLU A 1 135 ? -31.394 11.532  -1.102  1.00 0.00 ? 135 GLU A CA   1 
ATOM 2077 C C    . GLU A 1 135 ? -31.314 12.984  -1.524  1.00 0.00 ? 135 GLU A C    1 
ATOM 2078 O O    . GLU A 1 135 ? -31.033 13.860  -0.705  1.00 0.00 ? 135 GLU A O    1 
ATOM 2079 C CB   . GLU A 1 135 ? -32.237 11.398  0.164   1.00 0.00 ? 135 GLU A CB   1 
ATOM 2080 C CG   . GLU A 1 135 ? -32.324 9.974   0.687   1.00 0.00 ? 135 GLU A CG   1 
ATOM 2081 C CD   . GLU A 1 135 ? -32.226 9.900   2.199   1.00 0.00 ? 135 GLU A CD   1 
ATOM 2082 O OE1  . GLU A 1 135 ? -31.092 9.933   2.721   1.00 0.00 ? 135 GLU A OE1  1 
ATOM 2083 O OE2  . GLU A 1 135 ? -33.281 9.809   2.859   1.00 0.00 ? 135 GLU A OE2  1 
ATOM 2084 H H    . GLU A 1 135 ? -29.673 11.031  0.024   1.00 0.00 ? 135 GLU A H    1 
ATOM 2085 H HA   . GLU A 1 135 ? -31.851 10.965  -1.897  1.00 0.00 ? 135 GLU A HA   1 
ATOM 2086 H HB2  . GLU A 1 135 ? -31.803 12.015  0.937   1.00 0.00 ? 135 GLU A HB2  1 
ATOM 2087 H HB3  . GLU A 1 135 ? -33.237 11.746  -0.044  1.00 0.00 ? 135 GLU A HB3  1 
ATOM 2088 H HG2  . GLU A 1 135 ? -33.270 9.550   0.384   1.00 0.00 ? 135 GLU A HG2  1 
ATOM 2089 H HG3  . GLU A 1 135 ? -31.519 9.396   0.260   1.00 0.00 ? 135 GLU A HG3  1 
ATOM 2090 N N    . TYR A 1 136 ? -31.530 13.246  -2.810  1.00 0.00 ? 136 TYR A N    1 
ATOM 2091 C CA   . TYR A 1 136 ? -31.440 14.602  -3.305  1.00 0.00 ? 136 TYR A CA   1 
ATOM 2092 C C    . TYR A 1 136 ? -31.949 14.741  -4.736  1.00 0.00 ? 136 TYR A C    1 
ATOM 2093 O O    . TYR A 1 136 ? -31.529 15.645  -5.456  1.00 0.00 ? 136 TYR A O    1 
ATOM 2094 C CB   . TYR A 1 136 ? -29.999 15.090  -3.238  1.00 0.00 ? 136 TYR A CB   1 
ATOM 2095 C CG   . TYR A 1 136 ? -29.049 14.238  -4.045  1.00 0.00 ? 136 TYR A CG   1 
ATOM 2096 C CD1  . TYR A 1 136 ? -29.208 12.863  -4.085  1.00 0.00 ? 136 TYR A CD1  1 
ATOM 2097 C CD2  . TYR A 1 136 ? -28.007 14.802  -4.768  1.00 0.00 ? 136 TYR A CD2  1 
ATOM 2098 C CE1  . TYR A 1 136 ? -28.357 12.065  -4.823  1.00 0.00 ? 136 TYR A CE1  1 
ATOM 2099 C CE2  . TYR A 1 136 ? -27.147 14.013  -5.510  1.00 0.00 ? 136 TYR A CE2  1 
ATOM 2100 C CZ   . TYR A 1 136 ? -27.327 12.646  -5.534  1.00 0.00 ? 136 TYR A CZ   1 
ATOM 2101 O OH   . TYR A 1 136 ? -26.475 11.857  -6.272  1.00 0.00 ? 136 TYR A OH   1 
ATOM 2102 H H    . TYR A 1 136 ? -31.725 12.523  -3.441  1.00 0.00 ? 136 TYR A H    1 
ATOM 2103 H HA   . TYR A 1 136 ? -32.029 15.203  -2.666  1.00 0.00 ? 136 TYR A HA   1 
ATOM 2104 H HB2  . TYR A 1 136 ? -29.950 16.097  -3.619  1.00 0.00 ? 136 TYR A HB2  1 
ATOM 2105 H HB3  . TYR A 1 136 ? -29.673 15.077  -2.211  1.00 0.00 ? 136 TYR A HB3  1 
ATOM 2106 H HD1  . TYR A 1 136 ? -30.023 12.420  -3.523  1.00 0.00 ? 136 TYR A HD1  1 
ATOM 2107 H HD2  . TYR A 1 136 ? -27.870 15.874  -4.744  1.00 0.00 ? 136 TYR A HD2  1 
ATOM 2108 H HE1  . TYR A 1 136 ? -28.499 10.995  -4.841  1.00 0.00 ? 136 TYR A HE1  1 
ATOM 2109 H HE2  . TYR A 1 136 ? -26.341 14.469  -6.065  1.00 0.00 ? 136 TYR A HE2  1 
ATOM 2110 H HH   . TYR A 1 136 ? -26.580 12.056  -7.205  1.00 0.00 ? 136 TYR A HH   1 
ATOM 2111 N N    . VAL A 1 137 ? -32.848 13.860  -5.150  1.00 0.00 ? 137 VAL A N    1 
ATOM 2112 C CA   . VAL A 1 137 ? -33.388 13.931  -6.505  1.00 0.00 ? 137 VAL A CA   1 
ATOM 2113 C C    . VAL A 1 137 ? -34.860 13.561  -6.562  1.00 0.00 ? 137 VAL A C    1 
ATOM 2114 O O    . VAL A 1 137 ? -35.313 12.631  -5.899  1.00 0.00 ? 137 VAL A O    1 
ATOM 2115 C CB   . VAL A 1 137 ? -32.611 13.044  -7.491  1.00 0.00 ? 137 VAL A CB   1 
ATOM 2116 C CG1  . VAL A 1 137 ? -31.119 13.239  -7.304  1.00 0.00 ? 137 VAL A CG1  1 
ATOM 2117 C CG2  . VAL A 1 137 ? -33.017 11.585  -7.335  1.00 0.00 ? 137 VAL A CG2  1 
ATOM 2118 H H    . VAL A 1 137 ? -33.151 13.162  -4.536  1.00 0.00 ? 137 VAL A H    1 
ATOM 2119 H HA   . VAL A 1 137 ? -33.283 14.953  -6.834  1.00 0.00 ? 137 VAL A HA   1 
ATOM 2120 H HB   . VAL A 1 137 ? -32.865 13.359  -8.493  1.00 0.00 ? 137 VAL A HB   1 
ATOM 2121 H HG11 . VAL A 1 137 ? -30.906 14.297  -7.217  1.00 0.00 ? 137 VAL A HG11 1 
ATOM 2122 H HG12 . VAL A 1 137 ? -30.593 12.833  -8.155  1.00 0.00 ? 137 VAL A HG12 1 
ATOM 2123 H HG13 . VAL A 1 137 ? -30.798 12.733  -6.406  1.00 0.00 ? 137 VAL A HG13 1 
ATOM 2124 H HG21 . VAL A 1 137 ? -34.083 11.492  -7.518  1.00 0.00 ? 137 VAL A HG21 1 
ATOM 2125 H HG22 . VAL A 1 137 ? -32.793 11.254  -6.333  1.00 0.00 ? 137 VAL A HG22 1 
ATOM 2126 H HG23 . VAL A 1 137 ? -32.477 10.982  -8.047  1.00 0.00 ? 137 VAL A HG23 1 
ATOM 2127 N N    . ARG A 1 138 ? -35.591 14.323  -7.352  1.00 0.00 ? 138 ARG A N    1 
ATOM 2128 C CA   . ARG A 1 138 ? -37.020 14.129  -7.506  1.00 0.00 ? 138 ARG A CA   1 
ATOM 2129 C C    . ARG A 1 138 ? -37.381 13.692  -8.922  1.00 0.00 ? 138 ARG A C    1 
ATOM 2130 O O    . ARG A 1 138 ? -37.278 14.462  -9.870  1.00 0.00 ? 138 ARG A O    1 
ATOM 2131 C CB   . ARG A 1 138 ? -37.744 15.425  -7.135  1.00 0.00 ? 138 ARG A CB   1 
ATOM 2132 C CG   . ARG A 1 138 ? -39.220 15.457  -7.497  1.00 0.00 ? 138 ARG A CG   1 
ATOM 2133 C CD   . ARG A 1 138 ? -39.765 16.874  -7.418  1.00 0.00 ? 138 ARG A CD   1 
ATOM 2134 N NE   . ARG A 1 138 ? -40.744 17.150  -8.468  1.00 0.00 ? 138 ARG A NE   1 
ATOM 2135 C CZ   . ARG A 1 138 ? -41.628 18.144  -8.415  1.00 0.00 ? 138 ARG A CZ   1 
ATOM 2136 N NH1  . ARG A 1 138 ? -41.664 18.954  -7.363  1.00 0.00 ? 138 ARG A NH1  1 
ATOM 2137 N NH2  . ARG A 1 138 ? -42.477 18.329  -9.415  1.00 0.00 ? 138 ARG A NH2  1 
ATOM 2138 H H    . ARG A 1 138 ? -35.146 15.060  -7.815  1.00 0.00 ? 138 ARG A H    1 
ATOM 2139 H HA   . ARG A 1 138 ? -37.317 13.348  -6.825  1.00 0.00 ? 138 ARG A HA   1 
ATOM 2140 H HB2  . ARG A 1 138 ? -37.659 15.574  -6.070  1.00 0.00 ? 138 ARG A HB2  1 
ATOM 2141 H HB3  . ARG A 1 138 ? -37.257 16.247  -7.639  1.00 0.00 ? 138 ARG A HB3  1 
ATOM 2142 H HG2  . ARG A 1 138 ? -39.347 15.087  -8.504  1.00 0.00 ? 138 ARG A HG2  1 
ATOM 2143 H HG3  . ARG A 1 138 ? -39.764 14.831  -6.807  1.00 0.00 ? 138 ARG A HG3  1 
ATOM 2144 H HD2  . ARG A 1 138 ? -40.234 17.010  -6.455  1.00 0.00 ? 138 ARG A HD2  1 
ATOM 2145 H HD3  . ARG A 1 138 ? -38.941 17.565  -7.518  1.00 0.00 ? 138 ARG A HD3  1 
ATOM 2146 H HE   . ARG A 1 138 ? -40.741 16.565  -9.254  1.00 0.00 ? 138 ARG A HE   1 
ATOM 2147 H HH11 . ARG A 1 138 ? -41.027 18.821  -6.605  1.00 0.00 ? 138 ARG A HH11 1 
ATOM 2148 H HH12 . ARG A 1 138 ? -42.330 19.699  -7.330  1.00 0.00 ? 138 ARG A HH12 1 
ATOM 2149 H HH21 . ARG A 1 138 ? -42.455 17.721  -10.209 1.00 0.00 ? 138 ARG A HH21 1 
ATOM 2150 H HH22 . ARG A 1 138 ? -43.142 19.075  -9.375  1.00 0.00 ? 138 ARG A HH22 1 
ATOM 2151 N N    . ALA A 1 139 ? -37.818 12.445  -9.040  1.00 0.00 ? 139 ALA A N    1 
ATOM 2152 C CA   . ALA A 1 139 ? -38.215 11.881  -10.325 1.00 0.00 ? 139 ALA A CA   1 
ATOM 2153 C C    . ALA A 1 139 ? -39.066 12.872  -11.122 1.00 0.00 ? 139 ALA A C    1 
ATOM 2154 O O    . ALA A 1 139 ? -39.694 13.761  -10.549 1.00 0.00 ? 139 ALA A O    1 
ATOM 2155 C CB   . ALA A 1 139 ? -38.984 10.589  -10.102 1.00 0.00 ? 139 ALA A CB   1 
ATOM 2156 H H    . ALA A 1 139 ? -37.875 11.893  -8.233  1.00 0.00 ? 139 ALA A H    1 
ATOM 2157 H HA   . ALA A 1 139 ? -37.319 11.652  -10.883 1.00 0.00 ? 139 ALA A HA   1 
ATOM 2158 H HB1  . ALA A 1 139 ? -38.346 9.748   -10.326 1.00 0.00 ? 139 ALA A HB1  1 
ATOM 2159 H HB2  . ALA A 1 139 ? -39.850 10.567  -10.747 1.00 0.00 ? 139 ALA A HB2  1 
ATOM 2160 H HB3  . ALA A 1 139 ? -39.302 10.537  -9.070  1.00 0.00 ? 139 ALA A HB3  1 
ATOM 2161 N N    . LEU A 1 140 ? -39.088 12.709  -12.440 1.00 0.00 ? 140 LEU A N    1 
ATOM 2162 C CA   . LEU A 1 140 ? -39.874 13.591  -13.302 1.00 0.00 ? 140 LEU A CA   1 
ATOM 2163 C C    . LEU A 1 140 ? -40.793 12.785  -14.215 1.00 0.00 ? 140 LEU A C    1 
ATOM 2164 O O    . LEU A 1 140 ? -41.287 13.298  -15.219 1.00 0.00 ? 140 LEU A O    1 
ATOM 2165 C CB   . LEU A 1 140 ? -38.980 14.507  -14.155 1.00 0.00 ? 140 LEU A CB   1 
ATOM 2166 C CG   . LEU A 1 140 ? -37.470 14.365  -13.954 1.00 0.00 ? 140 LEU A CG   1 
ATOM 2167 C CD1  . LEU A 1 140 ? -37.094 14.637  -12.506 1.00 0.00 ? 140 LEU A CD1  1 
ATOM 2168 C CD2  . LEU A 1 140 ? -37.004 12.986  -14.395 1.00 0.00 ? 140 LEU A CD2  1 
ATOM 2169 H H    . LEU A 1 140 ? -38.576 11.978  -12.839 1.00 0.00 ? 140 LEU A H    1 
ATOM 2170 H HA   . LEU A 1 140 ? -40.484 14.207  -12.660 1.00 0.00 ? 140 LEU A HA   1 
ATOM 2171 H HB2  . LEU A 1 140 ? -39.193 14.314  -15.195 1.00 0.00 ? 140 LEU A HB2  1 
ATOM 2172 H HB3  . LEU A 1 140 ? -39.251 15.529  -13.939 1.00 0.00 ? 140 LEU A HB3  1 
ATOM 2173 H HG   . LEU A 1 140 ? -36.967 15.098  -14.567 1.00 0.00 ? 140 LEU A HG   1 
ATOM 2174 H HD11 . LEU A 1 140 ? -37.937 15.072  -11.989 1.00 0.00 ? 140 LEU A HD11 1 
ATOM 2175 H HD12 . LEU A 1 140 ? -36.260 15.322  -12.474 1.00 0.00 ? 140 LEU A HD12 1 
ATOM 2176 H HD13 . LEU A 1 140 ? -36.817 13.710  -12.026 1.00 0.00 ? 140 LEU A HD13 1 
ATOM 2177 H HD21 . LEU A 1 140 ? -36.328 12.580  -13.657 1.00 0.00 ? 140 LEU A HD21 1 
ATOM 2178 H HD22 . LEU A 1 140 ? -36.496 13.066  -15.343 1.00 0.00 ? 140 LEU A HD22 1 
ATOM 2179 H HD23 . LEU A 1 140 ? -37.856 12.332  -14.501 1.00 0.00 ? 140 LEU A HD23 1 
ATOM 2180 N N    . PHE A 1 141 ? -41.015 11.523  -13.867 1.00 0.00 ? 141 PHE A N    1 
ATOM 2181 C CA   . PHE A 1 141 ? -41.871 10.658  -14.668 1.00 0.00 ? 141 PHE A CA   1 
ATOM 2182 C C    . PHE A 1 141 ? -42.531 9.580   -13.816 1.00 0.00 ? 141 PHE A C    1 
ATOM 2183 O O    . PHE A 1 141 ? -41.914 9.015   -12.913 1.00 0.00 ? 141 PHE A O    1 
ATOM 2184 C CB   . PHE A 1 141 ? -41.060 10.004  -15.790 1.00 0.00 ? 141 PHE A CB   1 
ATOM 2185 C CG   . PHE A 1 141 ? -40.541 10.980  -16.807 1.00 0.00 ? 141 PHE A CG   1 
ATOM 2186 C CD1  . PHE A 1 141 ? -41.344 11.404  -17.853 1.00 0.00 ? 141 PHE A CD1  1 
ATOM 2187 C CD2  . PHE A 1 141 ? -39.248 11.470  -16.718 1.00 0.00 ? 141 PHE A CD2  1 
ATOM 2188 C CE1  . PHE A 1 141 ? -40.867 12.299  -18.792 1.00 0.00 ? 141 PHE A CE1  1 
ATOM 2189 C CE2  . PHE A 1 141 ? -38.766 12.366  -17.654 1.00 0.00 ? 141 PHE A CE2  1 
ATOM 2190 C CZ   . PHE A 1 141 ? -39.577 12.781  -18.692 1.00 0.00 ? 141 PHE A CZ   1 
ATOM 2191 H H    . PHE A 1 141 ? -40.592 11.166  -13.061 1.00 0.00 ? 141 PHE A H    1 
ATOM 2192 H HA   . PHE A 1 141 ? -42.641 11.272  -15.109 1.00 0.00 ? 141 PHE A HA   1 
ATOM 2193 H HB2  . PHE A 1 141 ? -40.213 9.491   -15.359 1.00 0.00 ? 141 PHE A HB2  1 
ATOM 2194 H HB3  . PHE A 1 141 ? -41.685 9.288   -16.304 1.00 0.00 ? 141 PHE A HB3  1 
ATOM 2195 H HD1  . PHE A 1 141 ? -42.353 11.029  -17.932 1.00 0.00 ? 141 PHE A HD1  1 
ATOM 2196 H HD2  . PHE A 1 141 ? -38.612 11.145  -15.907 1.00 0.00 ? 141 PHE A HD2  1 
ATOM 2197 H HE1  . PHE A 1 141 ? -41.504 12.623  -19.602 1.00 0.00 ? 141 PHE A HE1  1 
ATOM 2198 H HE2  . PHE A 1 141 ? -37.756 12.740  -17.573 1.00 0.00 ? 141 PHE A HE2  1 
ATOM 2199 H HZ   . PHE A 1 141 ? -39.202 13.481  -19.424 1.00 0.00 ? 141 PHE A HZ   1 
ATOM 2200 N N    . ASP A 1 142 ? -43.786 9.288   -14.133 1.00 0.00 ? 142 ASP A N    1 
ATOM 2201 C CA   . ASP A 1 142 ? -44.542 8.262   -13.427 1.00 0.00 ? 142 ASP A CA   1 
ATOM 2202 C C    . ASP A 1 142 ? -44.491 6.959   -14.215 1.00 0.00 ? 142 ASP A C    1 
ATOM 2203 O O    . ASP A 1 142 ? -44.456 6.981   -15.446 1.00 0.00 ? 142 ASP A O    1 
ATOM 2204 C CB   . ASP A 1 142 ? -45.991 8.714   -13.233 1.00 0.00 ? 142 ASP A CB   1 
ATOM 2205 C CG   . ASP A 1 142 ? -46.773 8.749   -14.533 1.00 0.00 ? 142 ASP A CG   1 
ATOM 2206 O OD1  . ASP A 1 142 ? -46.594 9.712   -15.308 1.00 0.00 ? 142 ASP A OD1  1 
ATOM 2207 O OD2  . ASP A 1 142 ? -47.563 7.812   -14.777 1.00 0.00 ? 142 ASP A OD2  1 
ATOM 2208 H H    . ASP A 1 142 ? -44.207 9.766   -14.877 1.00 0.00 ? 142 ASP A H    1 
ATOM 2209 H HA   . ASP A 1 142 ? -44.081 8.110   -12.462 1.00 0.00 ? 142 ASP A HA   1 
ATOM 2210 H HB2  . ASP A 1 142 ? -46.486 8.036   -12.555 1.00 0.00 ? 142 ASP A HB2  1 
ATOM 2211 H HB3  . ASP A 1 142 ? -45.994 9.707   -12.809 1.00 0.00 ? 142 ASP A HB3  1 
ATOM 2212 N N    . PHE A 1 143 ? -44.478 5.825   -13.524 1.00 0.00 ? 143 PHE A N    1 
ATOM 2213 C CA   . PHE A 1 143 ? -44.422 4.535   -14.195 1.00 0.00 ? 143 PHE A CA   1 
ATOM 2214 C C    . PHE A 1 143 ? -44.841 3.421   -13.240 1.00 0.00 ? 143 PHE A C    1 
ATOM 2215 O O    . PHE A 1 143 ? -44.285 3.283   -12.150 1.00 0.00 ? 143 PHE A O    1 
ATOM 2216 C CB   . PHE A 1 143 ? -43.007 4.277   -14.715 1.00 0.00 ? 143 PHE A CB   1 
ATOM 2217 C CG   . PHE A 1 143 ? -42.914 3.113   -15.656 1.00 0.00 ? 143 PHE A CG   1 
ATOM 2218 C CD1  . PHE A 1 143 ? -42.843 1.820   -15.168 1.00 0.00 ? 143 PHE A CD1  1 
ATOM 2219 C CD2  . PHE A 1 143 ? -42.898 3.311   -17.027 1.00 0.00 ? 143 PHE A CD2  1 
ATOM 2220 C CE1  . PHE A 1 143 ? -42.757 0.743   -16.030 1.00 0.00 ? 143 PHE A CE1  1 
ATOM 2221 C CE2  . PHE A 1 143 ? -42.813 2.238   -17.895 1.00 0.00 ? 143 PHE A CE2  1 
ATOM 2222 C CZ   . PHE A 1 143 ? -42.743 0.953   -17.395 1.00 0.00 ? 143 PHE A CZ   1 
ATOM 2223 H H    . PHE A 1 143 ? -44.504 5.832   -12.543 1.00 0.00 ? 143 PHE A H    1 
ATOM 2224 H HA   . PHE A 1 143 ? -45.108 4.559   -15.027 1.00 0.00 ? 143 PHE A HA   1 
ATOM 2225 H HB2  . PHE A 1 143 ? -42.660 5.156   -15.239 1.00 0.00 ? 143 PHE A HB2  1 
ATOM 2226 H HB3  . PHE A 1 143 ? -42.352 4.084   -13.877 1.00 0.00 ? 143 PHE A HB3  1 
ATOM 2227 H HD1  . PHE A 1 143 ? -42.855 1.657   -14.100 1.00 0.00 ? 143 PHE A HD1  1 
ATOM 2228 H HD2  . PHE A 1 143 ? -42.954 4.317   -17.418 1.00 0.00 ? 143 PHE A HD2  1 
ATOM 2229 H HE1  . PHE A 1 143 ? -42.701 -0.261  -15.637 1.00 0.00 ? 143 PHE A HE1  1 
ATOM 2230 H HE2  . PHE A 1 143 ? -42.802 2.405   -18.962 1.00 0.00 ? 143 PHE A HE2  1 
ATOM 2231 H HZ   . PHE A 1 143 ? -42.676 0.113   -18.071 1.00 0.00 ? 143 PHE A HZ   1 
ATOM 2232 N N    . ASN A 1 144 ? -45.830 2.634   -13.650 1.00 0.00 ? 144 ASN A N    1 
ATOM 2233 C CA   . ASN A 1 144 ? -46.331 1.540   -12.825 1.00 0.00 ? 144 ASN A CA   1 
ATOM 2234 C C    . ASN A 1 144 ? -45.220 0.551   -12.486 1.00 0.00 ? 144 ASN A C    1 
ATOM 2235 O O    . ASN A 1 144 ? -45.022 0.200   -11.324 1.00 0.00 ? 144 ASN A O    1 
ATOM 2236 C CB   . ASN A 1 144 ? -47.478 0.819   -13.538 1.00 0.00 ? 144 ASN A CB   1 
ATOM 2237 C CG   . ASN A 1 144 ? -47.084 0.315   -14.912 1.00 0.00 ? 144 ASN A CG   1 
ATOM 2238 O OD1  . ASN A 1 144 ? -46.545 -0.783  -15.052 1.00 0.00 ? 144 ASN A OD1  1 
ATOM 2239 N ND2  . ASN A 1 144 ? -47.352 1.117   -15.936 1.00 0.00 ? 144 ASN A ND2  1 
ATOM 2240 H H    . ASN A 1 144 ? -46.238 2.797   -14.526 1.00 0.00 ? 144 ASN A H    1 
ATOM 2241 H HA   . ASN A 1 144 ? -46.705 1.966   -11.907 1.00 0.00 ? 144 ASN A HA   1 
ATOM 2242 H HB2  . ASN A 1 144 ? -47.790 -0.025  -12.941 1.00 0.00 ? 144 ASN A HB2  1 
ATOM 2243 H HB3  . ASN A 1 144 ? -48.307 1.502   -13.648 1.00 0.00 ? 144 ASN A HB3  1 
ATOM 2244 H HD21 . ASN A 1 144 ? -47.782 1.978   -15.750 1.00 0.00 ? 144 ASN A HD21 1 
ATOM 2245 H HD22 . ASN A 1 144 ? -47.108 0.816   -16.836 1.00 0.00 ? 144 ASN A HD22 1 
ATOM 2246 N N    . GLY A 1 145 ? -44.498 0.104   -13.508 1.00 0.00 ? 145 GLY A N    1 
ATOM 2247 C CA   . GLY A 1 145 ? -43.417 -0.840  -13.296 1.00 0.00 ? 145 GLY A CA   1 
ATOM 2248 C C    . GLY A 1 145 ? -43.660 -2.161  -13.997 1.00 0.00 ? 145 GLY A C    1 
ATOM 2249 O O    . GLY A 1 145 ? -44.777 -2.679  -13.991 1.00 0.00 ? 145 GLY A O    1 
ATOM 2250 H H    . GLY A 1 145 ? -44.701 0.418   -14.413 1.00 0.00 ? 145 GLY A H    1 
ATOM 2251 H HA2  . GLY A 1 145 ? -42.498 -0.411  -13.668 1.00 0.00 ? 145 GLY A HA2  1 
ATOM 2252 H HA3  . GLY A 1 145 ? -43.313 -1.022  -12.238 1.00 0.00 ? 145 GLY A HA3  1 
ATOM 2253 N N    . ASN A 1 146 ? -42.612 -2.707  -14.602 1.00 0.00 ? 146 ASN A N    1 
ATOM 2254 C CA   . ASN A 1 146 ? -42.715 -3.975  -15.311 1.00 0.00 ? 146 ASN A CA   1 
ATOM 2255 C C    . ASN A 1 146 ? -41.634 -4.943  -14.846 1.00 0.00 ? 146 ASN A C    1 
ATOM 2256 O O    . ASN A 1 146 ? -41.894 -6.127  -14.635 1.00 0.00 ? 146 ASN A O    1 
ATOM 2257 C CB   . ASN A 1 146 ? -42.598 -3.745  -16.817 1.00 0.00 ? 146 ASN A CB   1 
ATOM 2258 C CG   . ASN A 1 146 ? -43.936 -3.434  -17.459 1.00 0.00 ? 146 ASN A CG   1 
ATOM 2259 O OD1  . ASN A 1 146 ? -44.440 -4.205  -18.275 1.00 0.00 ? 146 ASN A OD1  1 
ATOM 2260 N ND2  . ASN A 1 146 ? -44.518 -2.299  -17.090 1.00 0.00 ? 146 ASN A ND2  1 
ATOM 2261 H H    . ASN A 1 146 ? -41.748 -2.245  -14.571 1.00 0.00 ? 146 ASN A H    1 
ATOM 2262 H HA   . ASN A 1 146 ? -43.683 -4.400  -15.093 1.00 0.00 ? 146 ASN A HA   1 
ATOM 2263 H HB2  . ASN A 1 146 ? -41.933 -2.914  -16.996 1.00 0.00 ? 146 ASN A HB2  1 
ATOM 2264 H HB3  . ASN A 1 146 ? -42.194 -4.633  -17.281 1.00 0.00 ? 146 ASN A HB3  1 
ATOM 2265 H HD21 . ASN A 1 146 ? -44.058 -1.735  -16.434 1.00 0.00 ? 146 ASN A HD21 1 
ATOM 2266 H HD22 . ASN A 1 146 ? -45.383 -2.073  -17.489 1.00 0.00 ? 146 ASN A HD22 1 
ATOM 2267 N N    . ASP A 1 147 ? -40.420 -4.428  -14.684 1.00 0.00 ? 147 ASP A N    1 
ATOM 2268 C CA   . ASP A 1 147 ? -39.298 -5.242  -14.241 1.00 0.00 ? 147 ASP A CA   1 
ATOM 2269 C C    . ASP A 1 147 ? -38.958 -4.947  -12.784 1.00 0.00 ? 147 ASP A C    1 
ATOM 2270 O O    . ASP A 1 147 ? -39.114 -3.820  -12.316 1.00 0.00 ? 147 ASP A O    1 
ATOM 2271 C CB   . ASP A 1 147 ? -38.077 -4.982  -15.122 1.00 0.00 ? 147 ASP A CB   1 
ATOM 2272 C CG   . ASP A 1 147 ? -38.081 -5.826  -16.381 1.00 0.00 ? 147 ASP A CG   1 
ATOM 2273 O OD1  . ASP A 1 147 ? -37.954 -7.064  -16.268 1.00 0.00 ? 147 ASP A OD1  1 
ATOM 2274 O OD2  . ASP A 1 147 ? -38.214 -5.250  -17.482 1.00 0.00 ? 147 ASP A OD2  1 
ATOM 2275 H H    . ASP A 1 147 ? -40.276 -3.477  -14.867 1.00 0.00 ? 147 ASP A H    1 
ATOM 2276 H HA   . ASP A 1 147 ? -39.582 -6.279  -14.330 1.00 0.00 ? 147 ASP A HA   1 
ATOM 2277 H HB2  . ASP A 1 147 ? -38.064 -3.941  -15.409 1.00 0.00 ? 147 ASP A HB2  1 
ATOM 2278 H HB3  . ASP A 1 147 ? -37.182 -5.208  -14.561 1.00 0.00 ? 147 ASP A HB3  1 
ATOM 2279 N N    . GLU A 1 148 ? -38.493 -5.967  -12.073 1.00 0.00 ? 148 GLU A N    1 
ATOM 2280 C CA   . GLU A 1 148 ? -38.130 -5.817  -10.669 1.00 0.00 ? 148 GLU A CA   1 
ATOM 2281 C C    . GLU A 1 148 ? -36.893 -4.937  -10.516 1.00 0.00 ? 148 GLU A C    1 
ATOM 2282 O O    . GLU A 1 148 ? -36.669 -4.345  -9.460  1.00 0.00 ? 148 GLU A O    1 
ATOM 2283 C CB   . GLU A 1 148 ? -37.874 -7.188  -10.041 1.00 0.00 ? 148 GLU A CB   1 
ATOM 2284 C CG   . GLU A 1 148 ? -36.691 -7.924  -10.649 1.00 0.00 ? 148 GLU A CG   1 
ATOM 2285 C CD   . GLU A 1 148 ? -36.045 -8.891  -9.677  1.00 0.00 ? 148 GLU A CD   1 
ATOM 2286 O OE1  . GLU A 1 148 ? -36.746 -9.805  -9.194  1.00 0.00 ? 148 GLU A OE1  1 
ATOM 2287 O OE2  . GLU A 1 148 ? -34.837 -8.734  -9.398  1.00 0.00 ? 148 GLU A OE2  1 
ATOM 2288 H H    . GLU A 1 148 ? -38.390 -6.842  -12.503 1.00 0.00 ? 148 GLU A H    1 
ATOM 2289 H HA   . GLU A 1 148 ? -38.958 -5.347  -10.161 1.00 0.00 ? 148 GLU A HA   1 
ATOM 2290 H HB2  . GLU A 1 148 ? -37.686 -7.058  -8.986  1.00 0.00 ? 148 GLU A HB2  1 
ATOM 2291 H HB3  . GLU A 1 148 ? -38.755 -7.799  -10.170 1.00 0.00 ? 148 GLU A HB3  1 
ATOM 2292 H HG2  . GLU A 1 148 ? -37.033 -8.478  -11.510 1.00 0.00 ? 148 GLU A HG2  1 
ATOM 2293 H HG3  . GLU A 1 148 ? -35.953 -7.199  -10.958 1.00 0.00 ? 148 GLU A HG3  1 
ATOM 2294 N N    . GLU A 1 149 ? -36.090 -4.860  -11.572 1.00 0.00 ? 149 GLU A N    1 
ATOM 2295 C CA   . GLU A 1 149 ? -34.873 -4.058  -11.548 1.00 0.00 ? 149 GLU A CA   1 
ATOM 2296 C C    . GLU A 1 149 ? -35.176 -2.579  -11.771 1.00 0.00 ? 149 GLU A C    1 
ATOM 2297 O O    . GLU A 1 149 ? -34.465 -1.713  -11.266 1.00 0.00 ? 149 GLU A O    1 
ATOM 2298 C CB   . GLU A 1 149 ? -33.889 -4.554  -12.609 1.00 0.00 ? 149 GLU A CB   1 
ATOM 2299 C CG   . GLU A 1 149 ? -34.431 -4.476  -14.027 1.00 0.00 ? 149 GLU A CG   1 
ATOM 2300 C CD   . GLU A 1 149 ? -33.387 -4.824  -15.069 1.00 0.00 ? 149 GLU A CD   1 
ATOM 2301 O OE1  . GLU A 1 149 ? -32.363 -4.113  -15.146 1.00 0.00 ? 149 GLU A OE1  1 
ATOM 2302 O OE2  . GLU A 1 149 ? -33.595 -5.808  -15.810 1.00 0.00 ? 149 GLU A OE2  1 
ATOM 2303 H H    . GLU A 1 149 ? -36.317 -5.358  -12.384 1.00 0.00 ? 149 GLU A H    1 
ATOM 2304 H HA   . GLU A 1 149 ? -34.422 -4.175  -10.576 1.00 0.00 ? 149 GLU A HA   1 
ATOM 2305 H HB2  . GLU A 1 149 ? -32.990 -3.959  -12.558 1.00 0.00 ? 149 GLU A HB2  1 
ATOM 2306 H HB3  . GLU A 1 149 ? -33.640 -5.584  -12.399 1.00 0.00 ? 149 GLU A HB3  1 
ATOM 2307 H HG2  . GLU A 1 149 ? -35.256 -5.164  -14.121 1.00 0.00 ? 149 GLU A HG2  1 
ATOM 2308 H HG3  . GLU A 1 149 ? -34.779 -3.469  -14.209 1.00 0.00 ? 149 GLU A HG3  1 
ATOM 2309 N N    . ASP A 1 150 ? -36.225 -2.290  -12.536 1.00 0.00 ? 150 ASP A N    1 
ATOM 2310 C CA   . ASP A 1 150 ? -36.602 -0.909  -12.822 1.00 0.00 ? 150 ASP A CA   1 
ATOM 2311 C C    . ASP A 1 150 ? -37.340 -0.279  -11.644 1.00 0.00 ? 150 ASP A C    1 
ATOM 2312 O O    . ASP A 1 150 ? -38.287 -0.857  -11.112 1.00 0.00 ? 150 ASP A O    1 
ATOM 2313 C CB   . ASP A 1 150 ? -37.476 -0.848  -14.076 1.00 0.00 ? 150 ASP A CB   1 
ATOM 2314 C CG   . ASP A 1 150 ? -36.675 -1.039  -15.348 1.00 0.00 ? 150 ASP A CG   1 
ATOM 2315 O OD1  . ASP A 1 150 ? -36.039 -2.104  -15.495 1.00 0.00 ? 150 ASP A OD1  1 
ATOM 2316 O OD2  . ASP A 1 150 ? -36.683 -0.124  -16.198 1.00 0.00 ? 150 ASP A OD2  1 
ATOM 2317 H H    . ASP A 1 150 ? -36.756 -3.017  -12.924 1.00 0.00 ? 150 ASP A H    1 
ATOM 2318 H HA   . ASP A 1 150 ? -35.696 -0.350  -13.001 1.00 0.00 ? 150 ASP A HA   1 
ATOM 2319 H HB2  . ASP A 1 150 ? -38.223 -1.625  -14.024 1.00 0.00 ? 150 ASP A HB2  1 
ATOM 2320 H HB3  . ASP A 1 150 ? -37.965 0.114   -14.120 1.00 0.00 ? 150 ASP A HB3  1 
ATOM 2321 N N    . LEU A 1 151 ? -36.894 0.911   -11.242 1.00 0.00 ? 151 LEU A N    1 
ATOM 2322 C CA   . LEU A 1 151 ? -37.499 1.634   -10.125 1.00 0.00 ? 151 LEU A CA   1 
ATOM 2323 C C    . LEU A 1 151 ? -38.787 2.331   -10.556 1.00 0.00 ? 151 LEU A C    1 
ATOM 2324 O O    . LEU A 1 151 ? -38.742 3.331   -11.274 1.00 0.00 ? 151 LEU A O    1 
ATOM 2325 C CB   . LEU A 1 151 ? -36.514 2.684   -9.585  1.00 0.00 ? 151 LEU A CB   1 
ATOM 2326 C CG   . LEU A 1 151 ? -36.383 2.805   -8.054  1.00 0.00 ? 151 LEU A CG   1 
ATOM 2327 C CD1  . LEU A 1 151 ? -36.369 4.266   -7.638  1.00 0.00 ? 151 LEU A CD1  1 
ATOM 2328 C CD2  . LEU A 1 151 ? -37.493 2.063   -7.321  1.00 0.00 ? 151 LEU A CD2  1 
ATOM 2329 H H    . LEU A 1 151 ? -36.132 1.312   -11.707 1.00 0.00 ? 151 LEU A H    1 
ATOM 2330 H HA   . LEU A 1 151 ? -37.724 0.923   -9.348  1.00 0.00 ? 151 LEU A HA   1 
ATOM 2331 H HB2  . LEU A 1 151 ? -35.539 2.455   -9.982  1.00 0.00 ? 151 LEU A HB2  1 
ATOM 2332 H HB3  . LEU A 1 151 ? -36.814 3.648   -9.969  1.00 0.00 ? 151 LEU A HB3  1 
ATOM 2333 H HG   . LEU A 1 151 ? -35.443 2.374   -7.754  1.00 0.00 ? 151 LEU A HG   1 
ATOM 2334 H HD11 . LEU A 1 151 ? -37.305 4.727   -7.915  1.00 0.00 ? 151 LEU A HD11 1 
ATOM 2335 H HD12 . LEU A 1 151 ? -35.556 4.775   -8.134  1.00 0.00 ? 151 LEU A HD12 1 
ATOM 2336 H HD13 . LEU A 1 151 ? -36.237 4.335   -6.568  1.00 0.00 ? 151 LEU A HD13 1 
ATOM 2337 H HD21 . LEU A 1 151 ? -38.419 2.181   -7.859  1.00 0.00 ? 151 LEU A HD21 1 
ATOM 2338 H HD22 . LEU A 1 151 ? -37.599 2.473   -6.325  1.00 0.00 ? 151 LEU A HD22 1 
ATOM 2339 H HD23 . LEU A 1 151 ? -37.243 1.014   -7.252  1.00 0.00 ? 151 LEU A HD23 1 
ATOM 2340 N N    . PRO A 1 152 ? -39.953 1.840   -10.107 1.00 0.00 ? 152 PRO A N    1 
ATOM 2341 C CA   . PRO A 1 152 ? -41.229 2.453   -10.438 1.00 0.00 ? 152 PRO A CA   1 
ATOM 2342 C C    . PRO A 1 152 ? -41.525 3.606   -9.494  1.00 0.00 ? 152 PRO A C    1 
ATOM 2343 O O    . PRO A 1 152 ? -41.870 3.396   -8.332  1.00 0.00 ? 152 PRO A O    1 
ATOM 2344 C CB   . PRO A 1 152 ? -42.215 1.311   -10.234 1.00 0.00 ? 152 PRO A CB   1 
ATOM 2345 C CG   . PRO A 1 152 ? -41.624 0.502   -9.131  1.00 0.00 ? 152 PRO A CG   1 
ATOM 2346 C CD   . PRO A 1 152 ? -40.126 0.674   -9.219  1.00 0.00 ? 152 PRO A CD   1 
ATOM 2347 H HA   . PRO A 1 152 ? -41.260 2.795   -11.462 1.00 0.00 ? 152 PRO A HA   1 
ATOM 2348 H HB2  . PRO A 1 152 ? -43.182 1.709   -9.962  1.00 0.00 ? 152 PRO A HB2  1 
ATOM 2349 H HB3  . PRO A 1 152 ? -42.296 0.735   -11.143 1.00 0.00 ? 152 PRO A HB3  1 
ATOM 2350 H HG2  . PRO A 1 152 ? -41.984 0.864   -8.181  1.00 0.00 ? 152 PRO A HG2  1 
ATOM 2351 H HG3  . PRO A 1 152 ? -41.888 -0.535  -9.261  1.00 0.00 ? 152 PRO A HG3  1 
ATOM 2352 H HD2  . PRO A 1 152 ? -39.716 0.872   -8.243  1.00 0.00 ? 152 PRO A HD2  1 
ATOM 2353 H HD3  . PRO A 1 152 ? -39.672 -0.206  -9.646  1.00 0.00 ? 152 PRO A HD3  1 
ATOM 2354 N N    . PHE A 1 153 ? -41.371 4.823   -9.992  1.00 0.00 ? 153 PHE A N    1 
ATOM 2355 C CA   . PHE A 1 153 ? -41.603 6.010   -9.180  1.00 0.00 ? 153 PHE A CA   1 
ATOM 2356 C C    . PHE A 1 153 ? -42.661 6.905   -9.807  1.00 0.00 ? 153 PHE A C    1 
ATOM 2357 O O    . PHE A 1 153 ? -42.914 6.839   -11.010 1.00 0.00 ? 153 PHE A O    1 
ATOM 2358 C CB   . PHE A 1 153 ? -40.297 6.790   -9.003  1.00 0.00 ? 153 PHE A CB   1 
ATOM 2359 C CG   . PHE A 1 153 ? -39.557 7.022   -10.290 1.00 0.00 ? 153 PHE A CG   1 
ATOM 2360 C CD1  . PHE A 1 153 ? -40.003 7.969   -11.199 1.00 0.00 ? 153 PHE A CD1  1 
ATOM 2361 C CD2  . PHE A 1 153 ? -38.417 6.295   -10.589 1.00 0.00 ? 153 PHE A CD2  1 
ATOM 2362 C CE1  . PHE A 1 153 ? -39.324 8.185   -12.383 1.00 0.00 ? 153 PHE A CE1  1 
ATOM 2363 C CE2  . PHE A 1 153 ? -37.733 6.508   -11.772 1.00 0.00 ? 153 PHE A CE2  1 
ATOM 2364 C CZ   . PHE A 1 153 ? -38.187 7.454   -12.670 1.00 0.00 ? 153 PHE A CZ   1 
ATOM 2365 H H    . PHE A 1 153 ? -41.089 4.934   -10.923 1.00 0.00 ? 153 PHE A H    1 
ATOM 2366 H HA   . PHE A 1 153 ? -41.950 5.687   -8.210  1.00 0.00 ? 153 PHE A HA   1 
ATOM 2367 H HB2  . PHE A 1 153 ? -40.517 7.753   -8.568  1.00 0.00 ? 153 PHE A HB2  1 
ATOM 2368 H HB3  . PHE A 1 153 ? -39.644 6.241   -8.339  1.00 0.00 ? 153 PHE A HB3  1 
ATOM 2369 H HD1  . PHE A 1 153 ? -40.891 8.541   -10.976 1.00 0.00 ? 153 PHE A HD1  1 
ATOM 2370 H HD2  . PHE A 1 153 ? -38.061 5.555   -9.888  1.00 0.00 ? 153 PHE A HD2  1 
ATOM 2371 H HE1  . PHE A 1 153 ? -39.681 8.925   -13.083 1.00 0.00 ? 153 PHE A HE1  1 
ATOM 2372 H HE2  . PHE A 1 153 ? -36.845 5.935   -11.993 1.00 0.00 ? 153 PHE A HE2  1 
ATOM 2373 H HZ   . PHE A 1 153 ? -37.655 7.622   -13.594 1.00 0.00 ? 153 PHE A HZ   1 
ATOM 2374 N N    . LYS A 1 154 ? -43.271 7.746   -8.983  1.00 0.00 ? 154 LYS A N    1 
ATOM 2375 C CA   . LYS A 1 154 ? -44.297 8.664   -9.453  1.00 0.00 ? 154 LYS A CA   1 
ATOM 2376 C C    . LYS A 1 154 ? -43.737 10.075  -9.552  1.00 0.00 ? 154 LYS A C    1 
ATOM 2377 O O    . LYS A 1 154 ? -42.889 10.472  -8.753  1.00 0.00 ? 154 LYS A O    1 
ATOM 2378 C CB   . LYS A 1 154 ? -45.505 8.640   -8.515  1.00 0.00 ? 154 LYS A CB   1 
ATOM 2379 C CG   . LYS A 1 154 ? -46.621 7.721   -8.982  1.00 0.00 ? 154 LYS A CG   1 
ATOM 2380 C CD   . LYS A 1 154 ? -46.215 6.258   -8.880  1.00 0.00 ? 154 LYS A CD   1 
ATOM 2381 C CE   . LYS A 1 154 ? -46.923 5.557   -7.732  1.00 0.00 ? 154 LYS A CE   1 
ATOM 2382 N NZ   . LYS A 1 154 ? -45.961 4.917   -6.793  1.00 0.00 ? 154 LYS A NZ   1 
ATOM 2383 H H    . LYS A 1 154 ? -43.020 7.755   -8.036  1.00 0.00 ? 154 LYS A H    1 
ATOM 2384 H HA   . LYS A 1 154 ? -44.607 8.341   -10.436 1.00 0.00 ? 154 LYS A HA   1 
ATOM 2385 H HB2  . LYS A 1 154 ? -45.182 8.311   -7.539  1.00 0.00 ? 154 LYS A HB2  1 
ATOM 2386 H HB3  . LYS A 1 154 ? -45.903 9.640   -8.433  1.00 0.00 ? 154 LYS A HB3  1 
ATOM 2387 H HG2  . LYS A 1 154 ? -47.492 7.886   -8.368  1.00 0.00 ? 154 LYS A HG2  1 
ATOM 2388 H HG3  . LYS A 1 154 ? -46.854 7.949   -10.012 1.00 0.00 ? 154 LYS A HG3  1 
ATOM 2389 H HD2  . LYS A 1 154 ? -46.468 5.760   -9.803  1.00 0.00 ? 154 LYS A HD2  1 
ATOM 2390 H HD3  . LYS A 1 154 ? -45.148 6.203   -8.721  1.00 0.00 ? 154 LYS A HD3  1 
ATOM 2391 H HE2  . LYS A 1 154 ? -47.511 6.282   -7.189  1.00 0.00 ? 154 LYS A HE2  1 
ATOM 2392 H HE3  . LYS A 1 154 ? -47.576 4.798   -8.138  1.00 0.00 ? 154 LYS A HE3  1 
ATOM 2393 H HZ1  . LYS A 1 154 ? -46.390 4.074   -6.361  1.00 0.00 ? 154 LYS A HZ1  1 
ATOM 2394 H HZ2  . LYS A 1 154 ? -45.699 5.583   -6.040  1.00 0.00 ? 154 LYS A HZ2  1 
ATOM 2395 H HZ3  . LYS A 1 154 ? -45.101 4.632   -7.304  1.00 0.00 ? 154 LYS A HZ3  1 
ATOM 2396 N N    . LYS A 1 155 ? -44.212 10.830  -10.537 1.00 0.00 ? 155 LYS A N    1 
ATOM 2397 C CA   . LYS A 1 155 ? -43.754 12.200  -10.741 1.00 0.00 ? 155 LYS A CA   1 
ATOM 2398 C C    . LYS A 1 155 ? -43.703 12.965  -9.422  1.00 0.00 ? 155 LYS A C    1 
ATOM 2399 O O    . LYS A 1 155 ? -44.683 13.008  -8.678  1.00 0.00 ? 155 LYS A O    1 
ATOM 2400 C CB   . LYS A 1 155 ? -44.672 12.924  -11.729 1.00 0.00 ? 155 LYS A CB   1 
ATOM 2401 C CG   . LYS A 1 155 ? -44.278 12.719  -13.183 1.00 0.00 ? 155 LYS A CG   1 
ATOM 2402 C CD   . LYS A 1 155 ? -45.074 13.626  -14.110 1.00 0.00 ? 155 LYS A CD   1 
ATOM 2403 C CE   . LYS A 1 155 ? -44.168 14.358  -15.088 1.00 0.00 ? 155 LYS A CE   1 
ATOM 2404 N NZ   . LYS A 1 155 ? -44.633 15.748  -15.343 1.00 0.00 ? 155 LYS A NZ   1 
ATOM 2405 H H    . LYS A 1 155 ? -44.885 10.456  -11.143 1.00 0.00 ? 155 LYS A H    1 
ATOM 2406 H HA   . LYS A 1 155 ? -42.759 12.156  -11.156 1.00 0.00 ? 155 LYS A HA   1 
ATOM 2407 H HB2  . LYS A 1 155 ? -45.681 12.563  -11.596 1.00 0.00 ? 155 LYS A HB2  1 
ATOM 2408 H HB3  . LYS A 1 155 ? -44.646 13.982  -11.516 1.00 0.00 ? 155 LYS A HB3  1 
ATOM 2409 H HG2  . LYS A 1 155 ? -43.227 12.938  -13.296 1.00 0.00 ? 155 LYS A HG2  1 
ATOM 2410 H HG3  . LYS A 1 155 ? -44.465 11.690  -13.455 1.00 0.00 ? 155 LYS A HG3  1 
ATOM 2411 H HD2  . LYS A 1 155 ? -45.778 13.028  -14.668 1.00 0.00 ? 155 LYS A HD2  1 
ATOM 2412 H HD3  . LYS A 1 155 ? -45.608 14.354  -13.515 1.00 0.00 ? 155 LYS A HD3  1 
ATOM 2413 H HE2  . LYS A 1 155 ? -43.169 14.390  -14.678 1.00 0.00 ? 155 LYS A HE2  1 
ATOM 2414 H HE3  . LYS A 1 155 ? -44.155 13.814  -16.022 1.00 0.00 ? 155 LYS A HE3  1 
ATOM 2415 H HZ1  . LYS A 1 155 ? -45.659 15.817  -15.187 1.00 0.00 ? 155 LYS A HZ1  1 
ATOM 2416 H HZ2  . LYS A 1 155 ? -44.424 16.022  -16.324 1.00 0.00 ? 155 LYS A HZ2  1 
ATOM 2417 H HZ3  . LYS A 1 155 ? -44.150 16.410  -14.700 1.00 0.00 ? 155 LYS A HZ3  1 
ATOM 2418 N N    . GLY A 1 156 ? -42.557 13.574  -9.145  1.00 0.00 ? 156 GLY A N    1 
ATOM 2419 C CA   . GLY A 1 156 ? -42.401 14.339  -7.923  1.00 0.00 ? 156 GLY A CA   1 
ATOM 2420 C C    . GLY A 1 156 ? -41.823 13.538  -6.770  1.00 0.00 ? 156 GLY A C    1 
ATOM 2421 O O    . GLY A 1 156 ? -41.647 14.072  -5.675  1.00 0.00 ? 156 GLY A O    1 
ATOM 2422 H H    . GLY A 1 156 ? -41.816 13.516  -9.784  1.00 0.00 ? 156 GLY A H    1 
ATOM 2423 H HA2  . GLY A 1 156 ? -41.748 15.173  -8.121  1.00 0.00 ? 156 GLY A HA2  1 
ATOM 2424 H HA3  . GLY A 1 156 ? -43.368 14.720  -7.630  1.00 0.00 ? 156 GLY A HA3  1 
ATOM 2425 N N    . ASP A 1 157 ? -41.532 12.258  -6.994  1.00 0.00 ? 157 ASP A N    1 
ATOM 2426 C CA   . ASP A 1 157 ? -40.981 11.414  -5.939  1.00 0.00 ? 157 ASP A CA   1 
ATOM 2427 C C    . ASP A 1 157 ? -39.495 11.689  -5.734  1.00 0.00 ? 157 ASP A C    1 
ATOM 2428 O O    . ASP A 1 157 ? -38.709 11.637  -6.680  1.00 0.00 ? 157 ASP A O    1 
ATOM 2429 C CB   . ASP A 1 157 ? -41.194 9.939   -6.280  1.00 0.00 ? 157 ASP A CB   1 
ATOM 2430 C CG   . ASP A 1 157 ? -42.487 9.394   -5.705  1.00 0.00 ? 157 ASP A CG   1 
ATOM 2431 O OD1  . ASP A 1 157 ? -43.385 10.203  -5.391  1.00 0.00 ? 157 ASP A OD1  1 
ATOM 2432 O OD2  . ASP A 1 157 ? -42.602 8.157   -5.569  1.00 0.00 ? 157 ASP A OD2  1 
ATOM 2433 H H    . ASP A 1 157 ? -41.694 11.863  -7.877  1.00 0.00 ? 157 ASP A H    1 
ATOM 2434 H HA   . ASP A 1 157 ? -41.506 11.640  -5.024  1.00 0.00 ? 157 ASP A HA   1 
ATOM 2435 H HB2  . ASP A 1 157 ? -41.224 9.824   -7.354  1.00 0.00 ? 157 ASP A HB2  1 
ATOM 2436 H HB3  . ASP A 1 157 ? -40.372 9.360   -5.884  1.00 0.00 ? 157 ASP A HB3  1 
ATOM 2437 N N    . ILE A 1 158 ? -39.114 11.979  -4.492  1.00 0.00 ? 158 ILE A N    1 
ATOM 2438 C CA   . ILE A 1 158 ? -37.718 12.257  -4.171  1.00 0.00 ? 158 ILE A CA   1 
ATOM 2439 C C    . ILE A 1 158 ? -36.965 10.964  -3.891  1.00 0.00 ? 158 ILE A C    1 
ATOM 2440 O O    . ILE A 1 158 ? -37.044 10.408  -2.795  1.00 0.00 ? 158 ILE A O    1 
ATOM 2441 C CB   . ILE A 1 158 ? -37.570 13.203  -2.958  1.00 0.00 ? 158 ILE A CB   1 
ATOM 2442 C CG1  . ILE A 1 158 ? -38.734 14.202  -2.883  1.00 0.00 ? 158 ILE A CG1  1 
ATOM 2443 C CG2  . ILE A 1 158 ? -36.239 13.942  -3.023  1.00 0.00 ? 158 ILE A CG2  1 
ATOM 2444 C CD1  . ILE A 1 158 ? -39.096 14.838  -4.210  1.00 0.00 ? 158 ILE A CD1  1 
ATOM 2445 H H    . ILE A 1 158 ? -39.784 12.001  -3.778  1.00 0.00 ? 158 ILE A H    1 
ATOM 2446 H HA   . ILE A 1 158 ? -37.275 12.737  -5.028  1.00 0.00 ? 158 ILE A HA   1 
ATOM 2447 H HB   . ILE A 1 158 ? -37.569 12.599  -2.064  1.00 0.00 ? 158 ILE A HB   1 
ATOM 2448 H HG12 . ILE A 1 158 ? -39.612 13.693  -2.513  1.00 0.00 ? 158 ILE A HG12 1 
ATOM 2449 H HG13 . ILE A 1 158 ? -38.469 14.994  -2.196  1.00 0.00 ? 158 ILE A HG13 1 
ATOM 2450 H HG21 . ILE A 1 158 ? -36.377 14.963  -2.695  1.00 0.00 ? 158 ILE A HG21 1 
ATOM 2451 H HG22 . ILE A 1 158 ? -35.874 13.939  -4.040  1.00 0.00 ? 158 ILE A HG22 1 
ATOM 2452 H HG23 . ILE A 1 158 ? -35.520 13.452  -2.382  1.00 0.00 ? 158 ILE A HG23 1 
ATOM 2453 H HD11 . ILE A 1 158 ? -38.776 14.201  -5.019  1.00 0.00 ? 158 ILE A HD11 1 
ATOM 2454 H HD12 . ILE A 1 158 ? -38.607 15.796  -4.295  1.00 0.00 ? 158 ILE A HD12 1 
ATOM 2455 H HD13 . ILE A 1 158 ? -40.166 14.976  -4.262  1.00 0.00 ? 158 ILE A HD13 1 
ATOM 2456 N N    . LEU A 1 159 ? -36.241 10.488  -4.896  1.00 0.00 ? 159 LEU A N    1 
ATOM 2457 C CA   . LEU A 1 159 ? -35.475 9.255   -4.775  1.00 0.00 ? 159 LEU A CA   1 
ATOM 2458 C C    . LEU A 1 159 ? -34.040 9.552   -4.355  1.00 0.00 ? 159 LEU A C    1 
ATOM 2459 O O    . LEU A 1 159 ? -33.643 10.710  -4.235  1.00 0.00 ? 159 LEU A O    1 
ATOM 2460 C CB   . LEU A 1 159 ? -35.497 8.472   -6.097  1.00 0.00 ? 159 LEU A CB   1 
ATOM 2461 C CG   . LEU A 1 159 ? -36.658 8.814   -7.044  1.00 0.00 ? 159 LEU A CG   1 
ATOM 2462 C CD1  . LEU A 1 159 ? -36.129 9.332   -8.373  1.00 0.00 ? 159 LEU A CD1  1 
ATOM 2463 C CD2  . LEU A 1 159 ? -37.562 7.604   -7.257  1.00 0.00 ? 159 LEU A CD2  1 
ATOM 2464 H H    . LEU A 1 159 ? -36.224 10.977  -5.745  1.00 0.00 ? 159 LEU A H    1 
ATOM 2465 H HA   . LEU A 1 159 ? -35.938 8.654   -4.008  1.00 0.00 ? 159 LEU A HA   1 
ATOM 2466 H HB2  . LEU A 1 159 ? -34.569 8.657   -6.616  1.00 0.00 ? 159 LEU A HB2  1 
ATOM 2467 H HB3  . LEU A 1 159 ? -35.552 7.421   -5.863  1.00 0.00 ? 159 LEU A HB3  1 
ATOM 2468 H HG   . LEU A 1 159 ? -37.256 9.596   -6.603  1.00 0.00 ? 159 LEU A HG   1 
ATOM 2469 H HD11 . LEU A 1 159 ? -36.879 9.192   -9.137  1.00 0.00 ? 159 LEU A HD11 1 
ATOM 2470 H HD12 . LEU A 1 159 ? -35.233 8.791   -8.642  1.00 0.00 ? 159 LEU A HD12 1 
ATOM 2471 H HD13 . LEU A 1 159 ? -35.899 10.384  -8.282  1.00 0.00 ? 159 LEU A HD13 1 
ATOM 2472 H HD21 . LEU A 1 159 ? -37.220 6.779   -6.649  1.00 0.00 ? 159 LEU A HD21 1 
ATOM 2473 H HD22 . LEU A 1 159 ? -37.541 7.316   -8.298  1.00 0.00 ? 159 LEU A HD22 1 
ATOM 2474 H HD23 . LEU A 1 159 ? -38.574 7.861   -6.976  1.00 0.00 ? 159 LEU A HD23 1 
ATOM 2475 N N    . ARG A 1 160 ? -33.269 8.496   -4.131  1.00 0.00 ? 160 ARG A N    1 
ATOM 2476 C CA   . ARG A 1 160 ? -31.881 8.630   -3.724  1.00 0.00 ? 160 ARG A CA   1 
ATOM 2477 C C    . ARG A 1 160 ? -31.001 7.710   -4.557  1.00 0.00 ? 160 ARG A C    1 
ATOM 2478 O O    . ARG A 1 160 ? -31.133 6.492   -4.491  1.00 0.00 ? 160 ARG A O    1 
ATOM 2479 C CB   . ARG A 1 160 ? -31.748 8.299   -2.234  1.00 0.00 ? 160 ARG A CB   1 
ATOM 2480 C CG   . ARG A 1 160 ? -30.365 7.824   -1.812  1.00 0.00 ? 160 ARG A CG   1 
ATOM 2481 C CD   . ARG A 1 160 ? -30.200 6.334   -2.003  1.00 0.00 ? 160 ARG A CD   1 
ATOM 2482 N NE   . ARG A 1 160 ? -29.607 5.693   -0.831  1.00 0.00 ? 160 ARG A NE   1 
ATOM 2483 C CZ   . ARG A 1 160 ? -28.296 5.550   -0.641  1.00 0.00 ? 160 ARG A CZ   1 
ATOM 2484 N NH1  . ARG A 1 160 ? -27.431 6.011   -1.536  1.00 0.00 ? 160 ARG A NH1  1 
ATOM 2485 N NH2  . ARG A 1 160 ? -27.848 4.950   0.454   1.00 0.00 ? 160 ARG A NH2  1 
ATOM 2486 H H    . ARG A 1 160 ? -33.643 7.602   -4.246  1.00 0.00 ? 160 ARG A H    1 
ATOM 2487 H HA   . ARG A 1 160 ? -31.581 9.653   -3.890  1.00 0.00 ? 160 ARG A HA   1 
ATOM 2488 H HB2  . ARG A 1 160 ? -31.985 9.182   -1.662  1.00 0.00 ? 160 ARG A HB2  1 
ATOM 2489 H HB3  . ARG A 1 160 ? -32.458 7.524   -1.990  1.00 0.00 ? 160 ARG A HB3  1 
ATOM 2490 H HG2  . ARG A 1 160 ? -29.624 8.326   -2.409  1.00 0.00 ? 160 ARG A HG2  1 
ATOM 2491 H HG3  . ARG A 1 160 ? -30.218 8.062   -0.769  1.00 0.00 ? 160 ARG A HG3  1 
ATOM 2492 H HD2  . ARG A 1 160 ? -31.170 5.900   -2.191  1.00 0.00 ? 160 ARG A HD2  1 
ATOM 2493 H HD3  . ARG A 1 160 ? -29.562 6.171   -2.858  1.00 0.00 ? 160 ARG A HD3  1 
ATOM 2494 H HE   . ARG A 1 160 ? -30.218 5.352   -0.147  1.00 0.00 ? 160 ARG A HE   1 
ATOM 2495 H HH11 . ARG A 1 160 ? -27.759 6.471   -2.360  1.00 0.00 ? 160 ARG A HH11 1 
ATOM 2496 H HH12 . ARG A 1 160 ? -26.449 5.899   -1.384  1.00 0.00 ? 160 ARG A HH12 1 
ATOM 2497 H HH21 . ARG A 1 160 ? -28.494 4.606   1.135   1.00 0.00 ? 160 ARG A HH21 1 
ATOM 2498 H HH22 . ARG A 1 160 ? -26.864 4.843   0.598   1.00 0.00 ? 160 ARG A HH22 1 
ATOM 2499 N N    . ILE A 1 161 ? -30.107 8.294   -5.344  1.00 0.00 ? 161 ILE A N    1 
ATOM 2500 C CA   . ILE A 1 161 ? -29.219 7.505   -6.184  1.00 0.00 ? 161 ILE A CA   1 
ATOM 2501 C C    . ILE A 1 161 ? -28.349 6.580   -5.333  1.00 0.00 ? 161 ILE A C    1 
ATOM 2502 O O    . ILE A 1 161 ? -27.297 6.976   -4.832  1.00 0.00 ? 161 ILE A O    1 
ATOM 2503 C CB   . ILE A 1 161 ? -28.330 8.399   -7.075  1.00 0.00 ? 161 ILE A CB   1 
ATOM 2504 C CG1  . ILE A 1 161 ? -29.189 9.392   -7.869  1.00 0.00 ? 161 ILE A CG1  1 
ATOM 2505 C CG2  . ILE A 1 161 ? -27.495 7.547   -8.016  1.00 0.00 ? 161 ILE A CG2  1 
ATOM 2506 C CD1  . ILE A 1 161 ? -30.520 8.827   -8.322  1.00 0.00 ? 161 ILE A CD1  1 
ATOM 2507 H H    . ILE A 1 161 ? -30.047 9.271   -5.360  1.00 0.00 ? 161 ILE A H    1 
ATOM 2508 H HA   . ILE A 1 161 ? -29.838 6.900   -6.830  1.00 0.00 ? 161 ILE A HA   1 
ATOM 2509 H HB   . ILE A 1 161 ? -27.659 8.949   -6.438  1.00 0.00 ? 161 ILE A HB   1 
ATOM 2510 H HG12 . ILE A 1 161 ? -29.390 10.256  -7.256  1.00 0.00 ? 161 ILE A HG12 1 
ATOM 2511 H HG13 . ILE A 1 161 ? -28.644 9.701   -8.750  1.00 0.00 ? 161 ILE A HG13 1 
ATOM 2512 H HG21 . ILE A 1 161 ? -28.124 7.163   -8.806  1.00 0.00 ? 161 ILE A HG21 1 
ATOM 2513 H HG22 . ILE A 1 161 ? -27.065 6.723   -7.466  1.00 0.00 ? 161 ILE A HG22 1 
ATOM 2514 H HG23 . ILE A 1 161 ? -26.705 8.147   -8.445  1.00 0.00 ? 161 ILE A HG23 1 
ATOM 2515 H HD11 . ILE A 1 161 ? -31.183 8.743   -7.474  1.00 0.00 ? 161 ILE A HD11 1 
ATOM 2516 H HD12 . ILE A 1 161 ? -30.366 7.850   -8.756  1.00 0.00 ? 161 ILE A HD12 1 
ATOM 2517 H HD13 . ILE A 1 161 ? -30.958 9.484   -9.059  1.00 0.00 ? 161 ILE A HD13 1 
ATOM 2518 N N    . ARG A 1 162 ? -28.817 5.344   -5.173  1.00 0.00 ? 162 ARG A N    1 
ATOM 2519 C CA   . ARG A 1 162 ? -28.117 4.337   -4.381  1.00 0.00 ? 162 ARG A CA   1 
ATOM 2520 C C    . ARG A 1 162 ? -26.836 3.868   -5.052  1.00 0.00 ? 162 ARG A C    1 
ATOM 2521 O O    . ARG A 1 162 ? -26.055 3.130   -4.453  1.00 0.00 ? 162 ARG A O    1 
ATOM 2522 C CB   . ARG A 1 162 ? -29.016 3.123   -4.155  1.00 0.00 ? 162 ARG A CB   1 
ATOM 2523 C CG   . ARG A 1 162 ? -30.434 3.472   -3.740  1.00 0.00 ? 162 ARG A CG   1 
ATOM 2524 C CD   . ARG A 1 162 ? -30.793 2.871   -2.390  1.00 0.00 ? 162 ARG A CD   1 
ATOM 2525 N NE   . ARG A 1 162 ? -30.235 1.529   -2.208  1.00 0.00 ? 162 ARG A NE   1 
ATOM 2526 C CZ   . ARG A 1 162 ? -29.231 1.239   -1.380  1.00 0.00 ? 162 ARG A CZ   1 
ATOM 2527 N NH1  . ARG A 1 162 ? -28.648 2.191   -0.661  1.00 0.00 ? 162 ARG A NH1  1 
ATOM 2528 N NH2  . ARG A 1 162 ? -28.801 -0.011  -1.278  1.00 0.00 ? 162 ARG A NH2  1 
ATOM 2529 H H    . ARG A 1 162 ? -29.663 5.104   -5.599  1.00 0.00 ? 162 ARG A H    1 
ATOM 2530 H HA   . ARG A 1 162 ? -27.874 4.774   -3.426  1.00 0.00 ? 162 ARG A HA   1 
ATOM 2531 H HB2  . ARG A 1 162 ? -29.064 2.553   -5.071  1.00 0.00 ? 162 ARG A HB2  1 
ATOM 2532 H HB3  . ARG A 1 162 ? -28.576 2.510   -3.387  1.00 0.00 ? 162 ARG A HB3  1 
ATOM 2533 H HG2  . ARG A 1 162 ? -30.526 4.544   -3.679  1.00 0.00 ? 162 ARG A HG2  1 
ATOM 2534 H HG3  . ARG A 1 162 ? -31.119 3.093   -4.484  1.00 0.00 ? 162 ARG A HG3  1 
ATOM 2535 H HD2  . ARG A 1 162 ? -30.417 3.517   -1.614  1.00 0.00 ? 162 ARG A HD2  1 
ATOM 2536 H HD3  . ARG A 1 162 ? -31.868 2.813   -2.316  1.00 0.00 ? 162 ARG A HD3  1 
ATOM 2537 H HE   . ARG A 1 162 ? -30.633 0.803   -2.730  1.00 0.00 ? 162 ARG A HE   1 
ATOM 2538 H HH11 . ARG A 1 162 ? -28.959 3.138   -0.733  1.00 0.00 ? 162 ARG A HH11 1 
ATOM 2539 H HH12 . ARG A 1 162 ? -27.896 1.960   -0.043  1.00 0.00 ? 162 ARG A HH12 1 
ATOM 2540 H HH21 . ARG A 1 162 ? -29.231 -0.733  -1.821  1.00 0.00 ? 162 ARG A HH21 1 
ATOM 2541 H HH22 . ARG A 1 162 ? -28.048 -0.232  -0.658  1.00 0.00 ? 162 ARG A HH22 1 
ATOM 2542 N N    . ASP A 1 163 ? -26.616 4.284   -6.291  1.00 0.00 ? 163 ASP A N    1 
ATOM 2543 C CA   . ASP A 1 163 ? -25.427 3.893   -7.032  1.00 0.00 ? 163 ASP A CA   1 
ATOM 2544 C C    . ASP A 1 163 ? -25.473 4.533   -8.414  1.00 0.00 ? 163 ASP A C    1 
ATOM 2545 O O    . ASP A 1 163 ? -26.504 5.068   -8.818  1.00 0.00 ? 163 ASP A O    1 
ATOM 2546 C CB   . ASP A 1 163 ? -25.341 2.368   -7.161  1.00 0.00 ? 163 ASP A CB   1 
ATOM 2547 C CG   . ASP A 1 163 ? -24.313 1.767   -6.223  1.00 0.00 ? 163 ASP A CG   1 
ATOM 2548 O OD1  . ASP A 1 163 ? -23.127 2.144   -6.321  1.00 0.00 ? 163 ASP A OD1  1 
ATOM 2549 O OD2  . ASP A 1 163 ? -24.695 0.917   -5.391  1.00 0.00 ? 163 ASP A OD2  1 
ATOM 2550 H H    . ASP A 1 163 ? -27.246 4.874   -6.751  1.00 0.00 ? 163 ASP A H    1 
ATOM 2551 H HA   . ASP A 1 163 ? -24.561 4.259   -6.500  1.00 0.00 ? 163 ASP A HA   1 
ATOM 2552 H HB2  . ASP A 1 163 ? -26.305 1.939   -6.932  1.00 0.00 ? 163 ASP A HB2  1 
ATOM 2553 H HB3  . ASP A 1 163 ? -25.069 2.112   -8.177  1.00 0.00 ? 163 ASP A HB3  1 
ATOM 2554 N N    . LYS A 1 164 ? -24.368 4.477   -9.139  1.00 0.00 ? 164 LYS A N    1 
ATOM 2555 C CA   . LYS A 1 164 ? -24.332 5.061   -10.472 1.00 0.00 ? 164 LYS A CA   1 
ATOM 2556 C C    . LYS A 1 164 ? -23.545 4.199   -11.449 1.00 0.00 ? 164 LYS A C    1 
ATOM 2557 O O    . LYS A 1 164 ? -22.426 4.539   -11.833 1.00 0.00 ? 164 LYS A O    1 
ATOM 2558 C CB   . LYS A 1 164 ? -23.763 6.479   -10.427 1.00 0.00 ? 164 LYS A CB   1 
ATOM 2559 C CG   . LYS A 1 164 ? -22.356 6.571   -9.868  1.00 0.00 ? 164 LYS A CG   1 
ATOM 2560 C CD   . LYS A 1 164 ? -21.638 7.791   -10.419 1.00 0.00 ? 164 LYS A CD   1 
ATOM 2561 C CE   . LYS A 1 164 ? -22.079 9.059   -9.705  1.00 0.00 ? 164 LYS A CE   1 
ATOM 2562 N NZ   . LYS A 1 164 ? -21.760 10.280  -10.495 1.00 0.00 ? 164 LYS A NZ   1 
ATOM 2563 H H    . LYS A 1 164 ? -23.578 4.031   -8.770  1.00 0.00 ? 164 LYS A H    1 
ATOM 2564 H HA   . LYS A 1 164 ? -25.352 5.117   -10.821 1.00 0.00 ? 164 LYS A HA   1 
ATOM 2565 H HB2  . LYS A 1 164 ? -23.752 6.879   -11.429 1.00 0.00 ? 164 LYS A HB2  1 
ATOM 2566 H HB3  . LYS A 1 164 ? -24.409 7.092   -9.815  1.00 0.00 ? 164 LYS A HB3  1 
ATOM 2567 H HG2  . LYS A 1 164 ? -22.410 6.651   -8.792  1.00 0.00 ? 164 LYS A HG2  1 
ATOM 2568 H HG3  . LYS A 1 164 ? -21.806 5.685   -10.140 1.00 0.00 ? 164 LYS A HG3  1 
ATOM 2569 H HD2  . LYS A 1 164 ? -20.574 7.664   -10.285 1.00 0.00 ? 164 LYS A HD2  1 
ATOM 2570 H HD3  . LYS A 1 164 ? -21.866 7.883   -11.472 1.00 0.00 ? 164 LYS A HD3  1 
ATOM 2571 H HE2  . LYS A 1 164 ? -23.148 9.013   -9.546  1.00 0.00 ? 164 LYS A HE2  1 
ATOM 2572 H HE3  . LYS A 1 164 ? -21.576 9.114   -8.752  1.00 0.00 ? 164 LYS A HE3  1 
ATOM 2573 H HZ1  . LYS A 1 164 ? -20.782 10.233  -10.846 1.00 0.00 ? 164 LYS A HZ1  1 
ATOM 2574 H HZ2  . LYS A 1 164 ? -21.863 11.128  -9.901  1.00 0.00 ? 164 LYS A HZ2  1 
ATOM 2575 H HZ3  . LYS A 1 164 ? -22.406 10.361  -11.307 1.00 0.00 ? 164 LYS A HZ3  1 
ATOM 2576 N N    . PRO A 1 165 ? -24.133 3.073   -11.884 1.00 0.00 ? 165 PRO A N    1 
ATOM 2577 C CA   . PRO A 1 165 ? -23.493 2.171   -12.839 1.00 0.00 ? 165 PRO A CA   1 
ATOM 2578 C C    . PRO A 1 165 ? -22.968 2.930   -14.054 1.00 0.00 ? 165 PRO A C    1 
ATOM 2579 O O    . PRO A 1 165 ? -21.760 2.987   -14.279 1.00 0.00 ? 165 PRO A O    1 
ATOM 2580 C CB   . PRO A 1 165 ? -24.613 1.193   -13.233 1.00 0.00 ? 165 PRO A CB   1 
ATOM 2581 C CG   . PRO A 1 165 ? -25.873 1.790   -12.699 1.00 0.00 ? 165 PRO A CG   1 
ATOM 2582 C CD   . PRO A 1 165 ? -25.468 2.598   -11.503 1.00 0.00 ? 165 PRO A CD   1 
ATOM 2583 H HA   . PRO A 1 165 ? -22.680 1.626   -12.381 1.00 0.00 ? 165 PRO A HA   1 
ATOM 2584 H HB2  . PRO A 1 165 ? -24.648 1.097   -14.308 1.00 0.00 ? 165 PRO A HB2  1 
ATOM 2585 H HB3  . PRO A 1 165 ? -24.419 0.230   -12.786 1.00 0.00 ? 165 PRO A HB3  1 
ATOM 2586 H HG2  . PRO A 1 165 ? -26.324 2.425   -13.446 1.00 0.00 ? 165 PRO A HG2  1 
ATOM 2587 H HG3  . PRO A 1 165 ? -26.558 1.006   -12.408 1.00 0.00 ? 165 PRO A HG3  1 
ATOM 2588 H HD2  . PRO A 1 165 ? -26.147 3.423   -11.352 1.00 0.00 ? 165 PRO A HD2  1 
ATOM 2589 H HD3  . PRO A 1 165 ? -25.419 1.976   -10.621 1.00 0.00 ? 165 PRO A HD3  1 
ATOM 2590 N N    . GLU A 1 166 ? -23.873 3.528   -14.830 1.00 0.00 ? 166 GLU A N    1 
ATOM 2591 C CA   . GLU A 1 166 ? -23.475 4.294   -16.007 1.00 0.00 ? 166 GLU A CA   1 
ATOM 2592 C C    . GLU A 1 166 ? -24.315 5.560   -16.145 1.00 0.00 ? 166 GLU A C    1 
ATOM 2593 O O    . GLU A 1 166 ? -25.315 5.740   -15.451 1.00 0.00 ? 166 GLU A O    1 
ATOM 2594 C CB   . GLU A 1 166 ? -23.597 3.462   -17.293 1.00 0.00 ? 166 GLU A CB   1 
ATOM 2595 C CG   . GLU A 1 166 ? -24.473 2.228   -17.166 1.00 0.00 ? 166 GLU A CG   1 
ATOM 2596 C CD   . GLU A 1 166 ? -24.015 1.094   -18.063 1.00 0.00 ? 166 GLU A CD   1 
ATOM 2597 O OE1  . GLU A 1 166 ? -22.788 0.909   -18.205 1.00 0.00 ? 166 GLU A OE1  1 
ATOM 2598 O OE2  . GLU A 1 166 ? -24.883 0.391   -18.622 1.00 0.00 ? 166 GLU A OE2  1 
ATOM 2599 H H    . GLU A 1 166 ? -24.827 3.465   -14.619 1.00 0.00 ? 166 GLU A H    1 
ATOM 2600 H HA   . GLU A 1 166 ? -22.442 4.580   -15.876 1.00 0.00 ? 166 GLU A HA   1 
ATOM 2601 H HB2  . GLU A 1 166 ? -24.018 4.089   -18.070 1.00 0.00 ? 166 GLU A HB2  1 
ATOM 2602 H HB3  . GLU A 1 166 ? -22.611 3.148   -17.597 1.00 0.00 ? 166 GLU A HB3  1 
ATOM 2603 H HG2  . GLU A 1 166 ? -24.455 1.886   -16.143 1.00 0.00 ? 166 GLU A HG2  1 
ATOM 2604 H HG3  . GLU A 1 166 ? -25.481 2.495   -17.437 1.00 0.00 ? 166 GLU A HG3  1 
ATOM 2605 N N    . GLU A 1 167 ? -23.880 6.436   -17.041 1.00 0.00 ? 167 GLU A N    1 
ATOM 2606 C CA   . GLU A 1 167 ? -24.562 7.705   -17.281 1.00 0.00 ? 167 GLU A CA   1 
ATOM 2607 C C    . GLU A 1 167 ? -25.872 7.533   -18.061 1.00 0.00 ? 167 GLU A C    1 
ATOM 2608 O O    . GLU A 1 167 ? -26.461 8.519   -18.501 1.00 0.00 ? 167 GLU A O    1 
ATOM 2609 C CB   . GLU A 1 167 ? -23.636 8.659   -18.038 1.00 0.00 ? 167 GLU A CB   1 
ATOM 2610 C CG   . GLU A 1 167 ? -23.424 8.272   -19.493 1.00 0.00 ? 167 GLU A CG   1 
ATOM 2611 C CD   . GLU A 1 167 ? -22.653 9.323   -20.270 1.00 0.00 ? 167 GLU A CD   1 
ATOM 2612 O OE1  . GLU A 1 167 ? -23.034 10.510  -20.202 1.00 0.00 ? 167 GLU A OE1  1 
ATOM 2613 O OE2  . GLU A 1 167 ? -21.668 8.957   -20.945 1.00 0.00 ? 167 GLU A OE2  1 
ATOM 2614 H H    . GLU A 1 167 ? -23.061 6.222   -17.534 1.00 0.00 ? 167 GLU A H    1 
ATOM 2615 H HA   . GLU A 1 167 ? -24.791 8.138   -16.320 1.00 0.00 ? 167 GLU A HA   1 
ATOM 2616 H HB2  . GLU A 1 167 ? -24.061 9.651   -18.009 1.00 0.00 ? 167 GLU A HB2  1 
ATOM 2617 H HB3  . GLU A 1 167 ? -22.675 8.672   -17.546 1.00 0.00 ? 167 GLU A HB3  1 
ATOM 2618 H HG2  . GLU A 1 167 ? -22.873 7.344   -19.528 1.00 0.00 ? 167 GLU A HG2  1 
ATOM 2619 H HG3  . GLU A 1 167 ? -24.389 8.137   -19.958 1.00 0.00 ? 167 GLU A HG3  1 
ATOM 2620 N N    . GLN A 1 168 ? -26.333 6.294   -18.233 1.00 0.00 ? 168 GLN A N    1 
ATOM 2621 C CA   . GLN A 1 168 ? -27.577 6.052   -18.966 1.00 0.00 ? 168 GLN A CA   1 
ATOM 2622 C C    . GLN A 1 168 ? -28.634 5.372   -18.095 1.00 0.00 ? 168 GLN A C    1 
ATOM 2623 O O    . GLN A 1 168 ? -29.660 4.913   -18.597 1.00 0.00 ? 168 GLN A O    1 
ATOM 2624 C CB   . GLN A 1 168 ? -27.306 5.213   -20.212 1.00 0.00 ? 168 GLN A CB   1 
ATOM 2625 C CG   . GLN A 1 168 ? -26.587 3.908   -19.921 1.00 0.00 ? 168 GLN A CG   1 
ATOM 2626 C CD   . GLN A 1 168 ? -25.529 3.583   -20.958 1.00 0.00 ? 168 GLN A CD   1 
ATOM 2627 O OE1  . GLN A 1 168 ? -25.494 2.479   -21.502 1.00 0.00 ? 168 GLN A OE1  1 
ATOM 2628 N NE2  . GLN A 1 168 ? -24.660 4.548   -21.236 1.00 0.00 ? 168 GLN A NE2  1 
ATOM 2629 H H    . GLN A 1 168 ? -25.833 5.537   -17.869 1.00 0.00 ? 168 GLN A H    1 
ATOM 2630 H HA   . GLN A 1 168 ? -27.959 7.011   -19.269 1.00 0.00 ? 168 GLN A HA   1 
ATOM 2631 H HB2  . GLN A 1 168 ? -28.247 4.985   -20.689 1.00 0.00 ? 168 GLN A HB2  1 
ATOM 2632 H HB3  . GLN A 1 168 ? -26.699 5.792   -20.890 1.00 0.00 ? 168 GLN A HB3  1 
ATOM 2633 H HG2  . GLN A 1 168 ? -26.113 3.981   -18.954 1.00 0.00 ? 168 GLN A HG2  1 
ATOM 2634 H HG3  . GLN A 1 168 ? -27.314 3.108   -19.906 1.00 0.00 ? 168 GLN A HG3  1 
ATOM 2635 H HE21 . GLN A 1 168 ? -24.749 5.402   -20.764 1.00 0.00 ? 168 GLN A HE21 1 
ATOM 2636 H HE22 . GLN A 1 168 ? -23.966 4.366   -21.903 1.00 0.00 ? 168 GLN A HE22 1 
ATOM 2637 N N    . TRP A 1 169 ? -28.383 5.345   -16.791 1.00 0.00 ? 169 TRP A N    1 
ATOM 2638 C CA   . TRP A 1 169 ? -29.300 4.763   -15.810 1.00 0.00 ? 169 TRP A CA   1 
ATOM 2639 C C    . TRP A 1 169 ? -28.555 4.492   -14.515 1.00 0.00 ? 169 TRP A C    1 
ATOM 2640 O O    . TRP A 1 169 ? -27.450 3.950   -14.523 1.00 0.00 ? 169 TRP A O    1 
ATOM 2641 C CB   . TRP A 1 169 ? -29.989 3.485   -16.317 1.00 0.00 ? 169 TRP A CB   1 
ATOM 2642 C CG   . TRP A 1 169 ? -29.067 2.342   -16.615 1.00 0.00 ? 169 TRP A CG   1 
ATOM 2643 C CD1  . TRP A 1 169 ? -27.870 2.390   -17.265 1.00 0.00 ? 169 TRP A CD1  1 
ATOM 2644 C CD2  . TRP A 1 169 ? -29.289 0.965   -16.285 1.00 0.00 ? 169 TRP A CD2  1 
ATOM 2645 N NE1  . TRP A 1 169 ? -27.333 1.128   -17.356 1.00 0.00 ? 169 TRP A NE1  1 
ATOM 2646 C CE2  . TRP A 1 169 ? -28.184 0.237   -16.760 1.00 0.00 ? 169 TRP A CE2  1 
ATOM 2647 C CE3  . TRP A 1 169 ? -30.315 0.278   -15.629 1.00 0.00 ? 169 TRP A CE3  1 
ATOM 2648 C CZ2  . TRP A 1 169 ? -28.076 -1.143  -16.603 1.00 0.00 ? 169 TRP A CZ2  1 
ATOM 2649 C CZ3  . TRP A 1 169 ? -30.208 -1.090  -15.473 1.00 0.00 ? 169 TRP A CZ3  1 
ATOM 2650 C CH2  . TRP A 1 169 ? -29.095 -1.788  -15.958 1.00 0.00 ? 169 TRP A CH2  1 
ATOM 2651 H H    . TRP A 1 169 ? -27.556 5.761   -16.472 1.00 0.00 ? 169 TRP A H    1 
ATOM 2652 H HA   . TRP A 1 169 ? -30.060 5.505   -15.609 1.00 0.00 ? 169 TRP A HA   1 
ATOM 2653 H HB2  . TRP A 1 169 ? -30.684 3.147   -15.565 1.00 0.00 ? 169 TRP A HB2  1 
ATOM 2654 H HB3  . TRP A 1 169 ? -30.537 3.713   -17.217 1.00 0.00 ? 169 TRP A HB3  1 
ATOM 2655 H HD1  . TRP A 1 169 ? -27.421 3.294   -17.647 1.00 0.00 ? 169 TRP A HD1  1 
ATOM 2656 H HE1  . TRP A 1 169 ? -26.479 0.902   -17.778 1.00 0.00 ? 169 TRP A HE1  1 
ATOM 2657 H HE3  . TRP A 1 169 ? -31.181 0.799   -15.249 1.00 0.00 ? 169 TRP A HE3  1 
ATOM 2658 H HZ2  . TRP A 1 169 ? -27.224 -1.695  -16.971 1.00 0.00 ? 169 TRP A HZ2  1 
ATOM 2659 H HZ3  . TRP A 1 169 ? -30.993 -1.637  -14.971 1.00 0.00 ? 169 TRP A HZ3  1 
ATOM 2660 H HH2  . TRP A 1 169 ? -29.053 -2.858  -15.815 1.00 0.00 ? 169 TRP A HH2  1 
ATOM 2661 N N    . TRP A 1 170 ? -29.153 4.897   -13.403 1.00 0.00 ? 170 TRP A N    1 
ATOM 2662 C CA   . TRP A 1 170 ? -28.538 4.724   -12.097 1.00 0.00 ? 170 TRP A CA   1 
ATOM 2663 C C    . TRP A 1 170 ? -29.418 3.870   -11.194 1.00 0.00 ? 170 TRP A C    1 
ATOM 2664 O O    . TRP A 1 170 ? -30.393 3.277   -11.643 1.00 0.00 ? 170 TRP A O    1 
ATOM 2665 C CB   . TRP A 1 170 ? -28.308 6.094   -11.451 1.00 0.00 ? 170 TRP A CB   1 
ATOM 2666 C CG   . TRP A 1 170 ? -27.144 6.847   -12.021 1.00 0.00 ? 170 TRP A CG   1 
ATOM 2667 C CD1  . TRP A 1 170 ? -26.136 6.347   -12.797 1.00 0.00 ? 170 TRP A CD1  1 
ATOM 2668 C CD2  . TRP A 1 170 ? -26.869 8.244   -11.861 1.00 0.00 ? 170 TRP A CD2  1 
ATOM 2669 N NE1  . TRP A 1 170 ? -25.252 7.347   -13.126 1.00 0.00 ? 170 TRP A NE1  1 
ATOM 2670 C CE2  . TRP A 1 170 ? -25.682 8.519   -12.564 1.00 0.00 ? 170 TRP A CE2  1 
ATOM 2671 C CE3  . TRP A 1 170 ? -27.512 9.288   -11.191 1.00 0.00 ? 170 TRP A CE3  1 
ATOM 2672 C CZ2  . TRP A 1 170 ? -25.127 9.795   -12.616 1.00 0.00 ? 170 TRP A CZ2  1 
ATOM 2673 C CZ3  . TRP A 1 170 ? -26.959 10.554  -11.243 1.00 0.00 ? 170 TRP A CZ3  1 
ATOM 2674 C CH2  . TRP A 1 170 ? -25.777 10.798  -11.952 1.00 0.00 ? 170 TRP A CH2  1 
ATOM 2675 H H    . TRP A 1 170 ? -30.029 5.335   -13.459 1.00 0.00 ? 170 TRP A H    1 
ATOM 2676 H HA   . TRP A 1 170 ? -27.589 4.232   -12.235 1.00 0.00 ? 170 TRP A HA   1 
ATOM 2677 H HB2  . TRP A 1 170 ? -29.191 6.698   -11.591 1.00 0.00 ? 170 TRP A HB2  1 
ATOM 2678 H HB3  . TRP A 1 170 ? -28.140 5.966   -10.396 1.00 0.00 ? 170 TRP A HB3  1 
ATOM 2679 H HD1  . TRP A 1 170 ? -26.057 5.312   -13.099 1.00 0.00 ? 170 TRP A HD1  1 
ATOM 2680 H HE1  . TRP A 1 170 ? -24.445 7.239   -13.674 1.00 0.00 ? 170 TRP A HE1  1 
ATOM 2681 H HE3  . TRP A 1 170 ? -28.424 9.120   -10.639 1.00 0.00 ? 170 TRP A HE3  1 
ATOM 2682 H HZ2  . TRP A 1 170 ? -24.218 9.998   -13.159 1.00 0.00 ? 170 TRP A HZ2  1 
ATOM 2683 H HZ3  . TRP A 1 170 ? -27.443 11.373  -10.732 1.00 0.00 ? 170 TRP A HZ3  1 
ATOM 2684 H HH2  . TRP A 1 170 ? -25.381 11.802  -11.965 1.00 0.00 ? 170 TRP A HH2  1 
ATOM 2685 N N    . ASN A 1 171 ? -29.075 3.832   -9.916  1.00 0.00 ? 171 ASN A N    1 
ATOM 2686 C CA   . ASN A 1 171 ? -29.841 3.075   -8.936  1.00 0.00 ? 171 ASN A CA   1 
ATOM 2687 C C    . ASN A 1 171 ? -30.377 4.025   -7.876  1.00 0.00 ? 171 ASN A C    1 
ATOM 2688 O O    . ASN A 1 171 ? -29.638 4.869   -7.377  1.00 0.00 ? 171 ASN A O    1 
ATOM 2689 C CB   . ASN A 1 171 ? -28.964 2.001   -8.289  1.00 0.00 ? 171 ASN A CB   1 
ATOM 2690 C CG   . ASN A 1 171 ? -29.698 0.689   -8.088  1.00 0.00 ? 171 ASN A CG   1 
ATOM 2691 O OD1  . ASN A 1 171 ? -29.156 -0.383  -8.353  1.00 0.00 ? 171 ASN A OD1  1 
ATOM 2692 N ND2  . ASN A 1 171 ? -30.937 0.765   -7.618  1.00 0.00 ? 171 ASN A ND2  1 
ATOM 2693 H H    . ASN A 1 171 ? -28.295 4.341   -9.616  1.00 0.00 ? 171 ASN A H    1 
ATOM 2694 H HA   . ASN A 1 171 ? -30.667 2.605   -9.444  1.00 0.00 ? 171 ASN A HA   1 
ATOM 2695 H HB2  . ASN A 1 171 ? -28.107 1.817   -8.922  1.00 0.00 ? 171 ASN A HB2  1 
ATOM 2696 H HB3  . ASN A 1 171 ? -28.624 2.354   -7.326  1.00 0.00 ? 171 ASN A HB3  1 
ATOM 2697 H HD21 . ASN A 1 171 ? -31.309 1.652   -7.429  1.00 0.00 ? 171 ASN A HD21 1 
ATOM 2698 H HD22 . ASN A 1 171 ? -31.429 -0.070  -7.475  1.00 0.00 ? 171 ASN A HD22 1 
ATOM 2699 N N    . ALA A 1 172 ? -31.657 3.908   -7.538  1.00 0.00 ? 172 ALA A N    1 
ATOM 2700 C CA   . ALA A 1 172 ? -32.250 4.789   -6.538  1.00 0.00 ? 172 ALA A CA   1 
ATOM 2701 C C    . ALA A 1 172 ? -33.431 4.146   -5.834  1.00 0.00 ? 172 ALA A C    1 
ATOM 2702 O O    . ALA A 1 172 ? -34.124 3.310   -6.404  1.00 0.00 ? 172 ALA A O    1 
ATOM 2703 C CB   . ALA A 1 172 ? -32.693 6.091   -7.181  1.00 0.00 ? 172 ALA A CB   1 
ATOM 2704 H H    . ALA A 1 172 ? -32.214 3.226   -7.969  1.00 0.00 ? 172 ALA A H    1 
ATOM 2705 H HA   . ALA A 1 172 ? -31.491 5.018   -5.810  1.00 0.00 ? 172 ALA A HA   1 
ATOM 2706 H HB1  . ALA A 1 172 ? -32.536 6.906   -6.491  1.00 0.00 ? 172 ALA A HB1  1 
ATOM 2707 H HB2  . ALA A 1 172 ? -33.744 6.026   -7.428  1.00 0.00 ? 172 ALA A HB2  1 
ATOM 2708 H HB3  . ALA A 1 172 ? -32.120 6.261   -8.080  1.00 0.00 ? 172 ALA A HB3  1 
ATOM 2709 N N    . GLU A 1 173 ? -33.666 4.563   -4.595  1.00 0.00 ? 173 GLU A N    1 
ATOM 2710 C CA   . GLU A 1 173 ? -34.780 4.047   -3.814  1.00 0.00 ? 173 GLU A CA   1 
ATOM 2711 C C    . GLU A 1 173 ? -36.023 4.897   -4.053  1.00 0.00 ? 173 GLU A C    1 
ATOM 2712 O O    . GLU A 1 173 ? -35.943 6.124   -4.111  1.00 0.00 ? 173 GLU A O    1 
ATOM 2713 C CB   . GLU A 1 173 ? -34.433 4.033   -2.325  1.00 0.00 ? 173 GLU A CB   1 
ATOM 2714 C CG   . GLU A 1 173 ? -34.959 2.810   -1.595  1.00 0.00 ? 173 GLU A CG   1 
ATOM 2715 C CD   . GLU A 1 173 ? -35.242 3.081   -0.130  1.00 0.00 ? 173 GLU A CD   1 
ATOM 2716 O OE1  . GLU A 1 173 ? -36.249 3.759   0.165   1.00 0.00 ? 173 GLU A OE1  1 
ATOM 2717 O OE2  . GLU A 1 173 ? -34.456 2.617   0.722   1.00 0.00 ? 173 GLU A OE2  1 
ATOM 2718 H H    . GLU A 1 173 ? -33.082 5.246   -4.201  1.00 0.00 ? 173 GLU A H    1 
ATOM 2719 H HA   . GLU A 1 173 ? -34.978 3.038   -4.142  1.00 0.00 ? 173 GLU A HA   1 
ATOM 2720 H HB2  . GLU A 1 173 ? -33.359 4.057   -2.217  1.00 0.00 ? 173 GLU A HB2  1 
ATOM 2721 H HB3  . GLU A 1 173 ? -34.854 4.912   -1.859  1.00 0.00 ? 173 GLU A HB3  1 
ATOM 2722 H HG2  . GLU A 1 173 ? -35.877 2.491   -2.069  1.00 0.00 ? 173 GLU A HG2  1 
ATOM 2723 H HG3  . GLU A 1 173 ? -34.226 2.021   -1.665  1.00 0.00 ? 173 GLU A HG3  1 
ATOM 2724 N N    . ASP A 1 174 ? -37.166 4.241   -4.197  1.00 0.00 ? 174 ASP A N    1 
ATOM 2725 C CA   . ASP A 1 174 ? -38.418 4.946   -4.440  1.00 0.00 ? 174 ASP A CA   1 
ATOM 2726 C C    . ASP A 1 174 ? -39.235 5.089   -3.152  1.00 0.00 ? 174 ASP A C    1 
ATOM 2727 O O    . ASP A 1 174 ? -38.969 4.421   -2.153  1.00 0.00 ? 174 ASP A O    1 
ATOM 2728 C CB   . ASP A 1 174 ? -39.219 4.226   -5.527  1.00 0.00 ? 174 ASP A CB   1 
ATOM 2729 C CG   . ASP A 1 174 ? -40.599 4.817   -5.744  1.00 0.00 ? 174 ASP A CG   1 
ATOM 2730 O OD1  . ASP A 1 174 ? -40.723 6.060   -5.718  1.00 0.00 ? 174 ASP A OD1  1 
ATOM 2731 O OD2  . ASP A 1 174 ? -41.554 4.039   -5.941  1.00 0.00 ? 174 ASP A OD2  1 
ATOM 2732 H H    . ASP A 1 174 ? -37.165 3.262   -4.143  1.00 0.00 ? 174 ASP A H    1 
ATOM 2733 H HA   . ASP A 1 174 ? -38.168 5.935   -4.794  1.00 0.00 ? 174 ASP A HA   1 
ATOM 2734 H HB2  . ASP A 1 174 ? -38.674 4.294   -6.460  1.00 0.00 ? 174 ASP A HB2  1 
ATOM 2735 H HB3  . ASP A 1 174 ? -39.329 3.186   -5.256  1.00 0.00 ? 174 ASP A HB3  1 
ATOM 2736 N N    . SER A 1 175 ? -40.215 5.987   -3.191  1.00 0.00 ? 175 SER A N    1 
ATOM 2737 C CA   . SER A 1 175 ? -41.079 6.271   -2.042  1.00 0.00 ? 175 SER A CA   1 
ATOM 2738 C C    . SER A 1 175 ? -41.563 5.003   -1.333  1.00 0.00 ? 175 SER A C    1 
ATOM 2739 O O    . SER A 1 175 ? -41.868 5.037   -0.142  1.00 0.00 ? 175 SER A O    1 
ATOM 2740 C CB   . SER A 1 175 ? -42.281 7.105   -2.489  1.00 0.00 ? 175 SER A CB   1 
ATOM 2741 O OG   . SER A 1 175 ? -42.236 8.406   -1.929  1.00 0.00 ? 175 SER A OG   1 
ATOM 2742 H H    . SER A 1 175 ? -40.354 6.493   -4.017  1.00 0.00 ? 175 SER A H    1 
ATOM 2743 H HA   . SER A 1 175 ? -40.502 6.853   -1.340  1.00 0.00 ? 175 SER A HA   1 
ATOM 2744 H HB2  . SER A 1 175 ? -42.277 7.191   -3.565  1.00 0.00 ? 175 SER A HB2  1 
ATOM 2745 H HB3  . SER A 1 175 ? -43.193 6.622   -2.171  1.00 0.00 ? 175 SER A HB3  1 
ATOM 2746 H HG   . SER A 1 175 ? -41.352 8.767   -2.029  1.00 0.00 ? 175 SER A HG   1 
ATOM 2747 N N    . GLU A 1 176 ? -41.639 3.892   -2.056  1.00 0.00 ? 176 GLU A N    1 
ATOM 2748 C CA   . GLU A 1 176 ? -42.095 2.638   -1.459  1.00 0.00 ? 176 GLU A CA   1 
ATOM 2749 C C    . GLU A 1 176 ? -40.981 2.009   -0.638  1.00 0.00 ? 176 GLU A C    1 
ATOM 2750 O O    . GLU A 1 176 ? -41.222 1.426   0.419   1.00 0.00 ? 176 GLU A O    1 
ATOM 2751 C CB   . GLU A 1 176 ? -42.579 1.648   -2.528  1.00 0.00 ? 176 GLU A CB   1 
ATOM 2752 C CG   . GLU A 1 176 ? -42.025 1.904   -3.921  1.00 0.00 ? 176 GLU A CG   1 
ATOM 2753 C CD   . GLU A 1 176 ? -42.371 0.796   -4.896  1.00 0.00 ? 176 GLU A CD   1 
ATOM 2754 O OE1  . GLU A 1 176 ? -42.395 -0.379  -4.475  1.00 0.00 ? 176 GLU A OE1  1 
ATOM 2755 O OE2  . GLU A 1 176 ? -42.621 1.105   -6.080  1.00 0.00 ? 176 GLU A OE2  1 
ATOM 2756 H H    . GLU A 1 176 ? -41.384 3.913   -2.999  1.00 0.00 ? 176 GLU A H    1 
ATOM 2757 H HA   . GLU A 1 176 ? -42.919 2.871   -0.799  1.00 0.00 ? 176 GLU A HA   1 
ATOM 2758 H HB2  . GLU A 1 176 ? -42.287 0.652   -2.232  1.00 0.00 ? 176 GLU A HB2  1 
ATOM 2759 H HB3  . GLU A 1 176 ? -43.656 1.695   -2.580  1.00 0.00 ? 176 GLU A HB3  1 
ATOM 2760 H HG2  . GLU A 1 176 ? -42.437 2.830   -4.293  1.00 0.00 ? 176 GLU A HG2  1 
ATOM 2761 H HG3  . GLU A 1 176 ? -40.949 1.988   -3.858  1.00 0.00 ? 176 GLU A HG3  1 
ATOM 2762 N N    . GLY A 1 177 ? -39.760 2.140   -1.134  1.00 0.00 ? 177 GLY A N    1 
ATOM 2763 C CA   . GLY A 1 177 ? -38.617 1.587   -0.438  1.00 0.00 ? 177 GLY A CA   1 
ATOM 2764 C C    . GLY A 1 177 ? -37.745 0.730   -1.330  1.00 0.00 ? 177 GLY A C    1 
ATOM 2765 O O    . GLY A 1 177 ? -36.605 0.423   -0.981  1.00 0.00 ? 177 GLY A O    1 
ATOM 2766 H H    . GLY A 1 177 ? -39.642 2.618   -1.981  1.00 0.00 ? 177 GLY A H    1 
ATOM 2767 H HA2  . GLY A 1 177 ? -38.023 2.398   -0.045  1.00 0.00 ? 177 GLY A HA2  1 
ATOM 2768 H HA3  . GLY A 1 177 ? -38.973 0.985   0.383   1.00 0.00 ? 177 GLY A HA3  1 
ATOM 2769 N N    . LYS A 1 178 ? -38.271 0.349   -2.489  1.00 0.00 ? 178 LYS A N    1 
ATOM 2770 C CA   . LYS A 1 178 ? -37.515 -0.469  -3.427  1.00 0.00 ? 178 LYS A CA   1 
ATOM 2771 C C    . LYS A 1 178 ? -36.659 0.413   -4.323  1.00 0.00 ? 178 LYS A C    1 
ATOM 2772 O O    . LYS A 1 178 ? -36.867 1.625   -4.393  1.00 0.00 ? 178 LYS A O    1 
ATOM 2773 C CB   . LYS A 1 178 ? -38.453 -1.336  -4.269  1.00 0.00 ? 178 LYS A CB   1 
ATOM 2774 C CG   . LYS A 1 178 ? -39.213 -0.573  -5.345  1.00 0.00 ? 178 LYS A CG   1 
ATOM 2775 C CD   . LYS A 1 178 ? -39.104 -1.263  -6.697  1.00 0.00 ? 178 LYS A CD   1 
ATOM 2776 C CE   . LYS A 1 178 ? -40.437 -1.849  -7.134  1.00 0.00 ? 178 LYS A CE   1 
ATOM 2777 N NZ   . LYS A 1 178 ? -40.321 -2.599  -8.415  1.00 0.00 ? 178 LYS A NZ   1 
ATOM 2778 H H    . LYS A 1 178 ? -39.181 0.630   -2.724  1.00 0.00 ? 178 LYS A H    1 
ATOM 2779 H HA   . LYS A 1 178 ? -36.864 -1.110  -2.854  1.00 0.00 ? 178 LYS A HA   1 
ATOM 2780 H HB2  . LYS A 1 178 ? -37.869 -2.106  -4.751  1.00 0.00 ? 178 LYS A HB2  1 
ATOM 2781 H HB3  . LYS A 1 178 ? -39.174 -1.804  -3.615  1.00 0.00 ? 178 LYS A HB3  1 
ATOM 2782 H HG2  . LYS A 1 178 ? -40.253 -0.513  -5.063  1.00 0.00 ? 178 LYS A HG2  1 
ATOM 2783 H HG3  . LYS A 1 178 ? -38.803 0.424   -5.425  1.00 0.00 ? 178 LYS A HG3  1 
ATOM 2784 H HD2  . LYS A 1 178 ? -38.779 -0.542  -7.432  1.00 0.00 ? 178 LYS A HD2  1 
ATOM 2785 H HD3  . LYS A 1 178 ? -38.377 -2.058  -6.628  1.00 0.00 ? 178 LYS A HD3  1 
ATOM 2786 H HE2  . LYS A 1 178 ? -40.789 -2.520  -6.366  1.00 0.00 ? 178 LYS A HE2  1 
ATOM 2787 H HE3  . LYS A 1 178 ? -41.146 -1.044  -7.259  1.00 0.00 ? 178 LYS A HE3  1 
ATOM 2788 H HZ1  . LYS A 1 178 ? -40.496 -1.964  -9.220  1.00 0.00 ? 178 LYS A HZ1  1 
ATOM 2789 H HZ2  . LYS A 1 178 ? -41.017 -3.372  -8.441  1.00 0.00 ? 178 LYS A HZ2  1 
ATOM 2790 H HZ3  . LYS A 1 178 ? -39.367 -3.004  -8.507  1.00 0.00 ? 178 LYS A HZ3  1 
ATOM 2791 N N    . ARG A 1 179 ? -35.692 -0.190  -5.000  1.00 0.00 ? 179 ARG A N    1 
ATOM 2792 C CA   . ARG A 1 179 ? -34.814 0.568   -5.877  1.00 0.00 ? 179 ARG A CA   1 
ATOM 2793 C C    . ARG A 1 179 ? -34.892 0.076   -7.317  1.00 0.00 ? 179 ARG A C    1 
ATOM 2794 O O    . ARG A 1 179 ? -35.669 -0.818  -7.650  1.00 0.00 ? 179 ARG A O    1 
ATOM 2795 C CB   . ARG A 1 179 ? -33.361 0.518   -5.390  1.00 0.00 ? 179 ARG A CB   1 
ATOM 2796 C CG   . ARG A 1 179 ? -33.179 -0.133  -4.028  1.00 0.00 ? 179 ARG A CG   1 
ATOM 2797 C CD   . ARG A 1 179 ? -33.022 -1.641  -4.148  1.00 0.00 ? 179 ARG A CD   1 
ATOM 2798 N NE   . ARG A 1 179 ? -31.772 -2.109  -3.556  1.00 0.00 ? 179 ARG A NE   1 
ATOM 2799 C CZ   . ARG A 1 179 ? -31.210 -3.282  -3.841  1.00 0.00 ? 179 ARG A CZ   1 
ATOM 2800 N NH1  . ARG A 1 179 ? -31.782 -4.108  -4.707  1.00 0.00 ? 179 ARG A NH1  1 
ATOM 2801 N NH2  . ARG A 1 179 ? -30.070 -3.628  -3.258  1.00 0.00 ? 179 ARG A NH2  1 
ATOM 2802 H H    . ARG A 1 179 ? -35.564 -1.156  -4.903  1.00 0.00 ? 179 ARG A H    1 
ATOM 2803 H HA   . ARG A 1 179 ? -35.148 1.593   -5.855  1.00 0.00 ? 179 ARG A HA   1 
ATOM 2804 H HB2  . ARG A 1 179 ? -32.773 -0.036  -6.106  1.00 0.00 ? 179 ARG A HB2  1 
ATOM 2805 H HB3  . ARG A 1 179 ? -32.980 1.528   -5.334  1.00 0.00 ? 179 ARG A HB3  1 
ATOM 2806 H HG2  . ARG A 1 179 ? -32.295 0.273   -3.561  1.00 0.00 ? 179 ARG A HG2  1 
ATOM 2807 H HG3  . ARG A 1 179 ? -34.042 0.084   -3.418  1.00 0.00 ? 179 ARG A HG3  1 
ATOM 2808 H HD2  . ARG A 1 179 ? -33.849 -2.117  -3.642  1.00 0.00 ? 179 ARG A HD2  1 
ATOM 2809 H HD3  . ARG A 1 179 ? -33.038 -1.910  -5.195  1.00 0.00 ? 179 ARG A HD3  1 
ATOM 2810 H HE   . ARG A 1 179 ? -31.327 -1.519  -2.912  1.00 0.00 ? 179 ARG A HE   1 
ATOM 2811 H HH11 . ARG A 1 179 ? -32.641 -3.853  -5.150  1.00 0.00 ? 179 ARG A HH11 1 
ATOM 2812 H HH12 . ARG A 1 179 ? -31.354 -4.987  -4.917  1.00 0.00 ? 179 ARG A HH12 1 
ATOM 2813 H HH21 . ARG A 1 179 ? -29.634 -3.010  -2.604  1.00 0.00 ? 179 ARG A HH21 1 
ATOM 2814 H HH22 . ARG A 1 179 ? -29.647 -4.509  -3.471  1.00 0.00 ? 179 ARG A HH22 1 
ATOM 2815 N N    . GLY A 1 180 ? -34.070 0.685   -8.158  1.00 0.00 ? 180 GLY A N    1 
ATOM 2816 C CA   . GLY A 1 180 ? -34.028 0.335   -9.561  1.00 0.00 ? 180 GLY A CA   1 
ATOM 2817 C C    . GLY A 1 180 ? -33.411 1.437   -10.397 1.00 0.00 ? 180 GLY A C    1 
ATOM 2818 O O    . GLY A 1 180 ? -32.674 2.272   -9.877  1.00 0.00 ? 180 GLY A O    1 
ATOM 2819 H H    . GLY A 1 180 ? -33.483 1.388   -7.814  1.00 0.00 ? 180 GLY A H    1 
ATOM 2820 H HA2  . GLY A 1 180 ? -33.445 -0.566  -9.679  1.00 0.00 ? 180 GLY A HA2  1 
ATOM 2821 H HA3  . GLY A 1 180 ? -35.034 0.153   -9.908  1.00 0.00 ? 180 GLY A HA3  1 
ATOM 2822 N N    . MET A 1 181 ? -33.715 1.454   -11.689 1.00 0.00 ? 181 MET A N    1 
ATOM 2823 C CA   . MET A 1 181 ? -33.180 2.475   -12.578 1.00 0.00 ? 181 MET A CA   1 
ATOM 2824 C C    . MET A 1 181 ? -33.870 3.814   -12.354 1.00 0.00 ? 181 MET A C    1 
ATOM 2825 O O    . MET A 1 181 ? -35.033 3.869   -11.952 1.00 0.00 ? 181 MET A O    1 
ATOM 2826 C CB   . MET A 1 181 ? -33.331 2.052   -14.039 1.00 0.00 ? 181 MET A CB   1 
ATOM 2827 C CG   . MET A 1 181 ? -34.778 1.866   -14.471 1.00 0.00 ? 181 MET A CG   1 
ATOM 2828 S SD   . MET A 1 181 ? -35.155 2.695   -16.028 1.00 0.00 ? 181 MET A SD   1 
ATOM 2829 C CE   . MET A 1 181 ? -34.830 4.401   -15.591 1.00 0.00 ? 181 MET A CE   1 
ATOM 2830 H H    . MET A 1 181 ? -34.313 0.775   -12.054 1.00 0.00 ? 181 MET A H    1 
ATOM 2831 H HA   . MET A 1 181 ? -32.133 2.586   -12.355 1.00 0.00 ? 181 MET A HA   1 
ATOM 2832 H HB2  . MET A 1 181 ? -32.882 2.809   -14.668 1.00 0.00 ? 181 MET A HB2  1 
ATOM 2833 H HB3  . MET A 1 181 ? -32.811 1.119   -14.187 1.00 0.00 ? 181 MET A HB3  1 
ATOM 2834 H HG2  . MET A 1 181 ? -34.971 0.810   -14.587 1.00 0.00 ? 181 MET A HG2  1 
ATOM 2835 H HG3  . MET A 1 181 ? -35.422 2.266   -13.701 1.00 0.00 ? 181 MET A HG3  1 
ATOM 2836 H HE1  . MET A 1 181 ? -34.141 4.435   -14.760 1.00 0.00 ? 181 MET A HE1  1 
ATOM 2837 H HE2  . MET A 1 181 ? -35.755 4.884   -15.314 1.00 0.00 ? 181 MET A HE2  1 
ATOM 2838 H HE3  . MET A 1 181 ? -34.396 4.913   -16.438 1.00 0.00 ? 181 MET A HE3  1 
ATOM 2839 N N    . ILE A 1 182 ? -33.142 4.887   -12.622 1.00 0.00 ? 182 ILE A N    1 
ATOM 2840 C CA   . ILE A 1 182 ? -33.668 6.236   -12.460 1.00 0.00 ? 182 ILE A CA   1 
ATOM 2841 C C    . ILE A 1 182 ? -33.179 7.141   -13.584 1.00 0.00 ? 182 ILE A C    1 
ATOM 2842 O O    . ILE A 1 182 ? -32.257 6.786   -14.318 1.00 0.00 ? 182 ILE A O    1 
ATOM 2843 C CB   . ILE A 1 182 ? -33.247 6.842   -11.108 1.00 0.00 ? 182 ILE A CB   1 
ATOM 2844 C CG1  . ILE A 1 182 ? -31.720 6.852   -10.979 1.00 0.00 ? 182 ILE A CG1  1 
ATOM 2845 C CG2  . ILE A 1 182 ? -33.876 6.064   -9.965  1.00 0.00 ? 182 ILE A CG2  1 
ATOM 2846 C CD1  . ILE A 1 182 ? -31.104 8.217   -11.198 1.00 0.00 ? 182 ILE A CD1  1 
ATOM 2847 H H    . ILE A 1 182 ? -32.224 4.770   -12.942 1.00 0.00 ? 182 ILE A H    1 
ATOM 2848 H HA   . ILE A 1 182 ? -34.746 6.183   -12.491 1.00 0.00 ? 182 ILE A HA   1 
ATOM 2849 H HB   . ILE A 1 182 ? -33.610 7.856   -11.063 1.00 0.00 ? 182 ILE A HB   1 
ATOM 2850 H HG12 . ILE A 1 182 ? -31.446 6.520   -9.989  1.00 0.00 ? 182 ILE A HG12 1 
ATOM 2851 H HG13 . ILE A 1 182 ? -31.299 6.176   -11.709 1.00 0.00 ? 182 ILE A HG13 1 
ATOM 2852 H HG21 . ILE A 1 182 ? -34.717 5.496   -10.335 1.00 0.00 ? 182 ILE A HG21 1 
ATOM 2853 H HG22 . ILE A 1 182 ? -34.216 6.754   -9.205  1.00 0.00 ? 182 ILE A HG22 1 
ATOM 2854 H HG23 . ILE A 1 182 ? -33.145 5.392   -9.541  1.00 0.00 ? 182 ILE A HG23 1 
ATOM 2855 H HD11 . ILE A 1 182 ? -31.769 8.977   -10.815 1.00 0.00 ? 182 ILE A HD11 1 
ATOM 2856 H HD12 . ILE A 1 182 ? -30.945 8.375   -12.255 1.00 0.00 ? 182 ILE A HD12 1 
ATOM 2857 H HD13 . ILE A 1 182 ? -30.158 8.271   -10.677 1.00 0.00 ? 182 ILE A HD13 1 
ATOM 2858 N N    . PRO A 1 183 ? -33.785 8.330   -13.737 1.00 0.00 ? 183 PRO A N    1 
ATOM 2859 C CA   . PRO A 1 183 ? -33.393 9.273   -14.775 1.00 0.00 ? 183 PRO A CA   1 
ATOM 2860 C C    . PRO A 1 183 ? -32.098 9.988   -14.427 1.00 0.00 ? 183 PRO A C    1 
ATOM 2861 O O    . PRO A 1 183 ? -32.109 11.055  -13.825 1.00 0.00 ? 183 PRO A O    1 
ATOM 2862 C CB   . PRO A 1 183 ? -34.554 10.272  -14.847 1.00 0.00 ? 183 PRO A CB   1 
ATOM 2863 C CG   . PRO A 1 183 ? -35.551 9.851   -13.814 1.00 0.00 ? 183 PRO A CG   1 
ATOM 2864 C CD   . PRO A 1 183 ? -34.881 8.847   -12.913 1.00 0.00 ? 183 PRO A CD   1 
ATOM 2865 H HA   . PRO A 1 183 ? -33.278 8.782   -15.729 1.00 0.00 ? 183 PRO A HA   1 
ATOM 2866 H HB2  . PRO A 1 183 ? -34.183 11.263  -14.644 1.00 0.00 ? 183 PRO A HB2  1 
ATOM 2867 H HB3  . PRO A 1 183 ? -34.985 10.246  -15.837 1.00 0.00 ? 183 PRO A HB3  1 
ATOM 2868 H HG2  . PRO A 1 183 ? -35.856 10.715  -13.242 1.00 0.00 ? 183 PRO A HG2  1 
ATOM 2869 H HG3  . PRO A 1 183 ? -36.409 9.406   -14.297 1.00 0.00 ? 183 PRO A HG3  1 
ATOM 2870 H HD2  . PRO A 1 183 ? -34.502 9.329   -12.024 1.00 0.00 ? 183 PRO A HD2  1 
ATOM 2871 H HD3  . PRO A 1 183 ? -35.571 8.059   -12.650 1.00 0.00 ? 183 PRO A HD3  1 
ATOM 2872 N N    . VAL A 1 184 ? -30.984 9.391   -14.823 1.00 0.00 ? 184 VAL A N    1 
ATOM 2873 C CA   . VAL A 1 184 ? -29.674 9.968   -14.567 1.00 0.00 ? 184 VAL A CA   1 
ATOM 2874 C C    . VAL A 1 184 ? -29.422 11.194  -15.448 1.00 0.00 ? 184 VAL A C    1 
ATOM 2875 O O    . VAL A 1 184 ? -28.772 12.147  -15.017 1.00 0.00 ? 184 VAL A O    1 
ATOM 2876 C CB   . VAL A 1 184 ? -28.540 8.925   -14.752 1.00 0.00 ? 184 VAL A CB   1 
ATOM 2877 C CG1  . VAL A 1 184 ? -28.979 7.572   -14.221 1.00 0.00 ? 184 VAL A CG1  1 
ATOM 2878 C CG2  . VAL A 1 184 ? -28.086 8.798   -16.206 1.00 0.00 ? 184 VAL A CG2  1 
ATOM 2879 H H    . VAL A 1 184 ? -31.054 8.545   -15.307 1.00 0.00 ? 184 VAL A H    1 
ATOM 2880 H HA   . VAL A 1 184 ? -29.662 10.287  -13.536 1.00 0.00 ? 184 VAL A HA   1 
ATOM 2881 H HB   . VAL A 1 184 ? -27.694 9.250   -14.164 1.00 0.00 ? 184 VAL A HB   1 
ATOM 2882 H HG11 . VAL A 1 184 ? -29.804 7.206   -14.813 1.00 0.00 ? 184 VAL A HG11 1 
ATOM 2883 H HG12 . VAL A 1 184 ? -29.289 7.671   -13.190 1.00 0.00 ? 184 VAL A HG12 1 
ATOM 2884 H HG13 . VAL A 1 184 ? -28.154 6.878   -14.283 1.00 0.00 ? 184 VAL A HG13 1 
ATOM 2885 H HG21 . VAL A 1 184 ? -28.219 9.739   -16.715 1.00 0.00 ? 184 VAL A HG21 1 
ATOM 2886 H HG22 . VAL A 1 184 ? -28.668 8.035   -16.703 1.00 0.00 ? 184 VAL A HG22 1 
ATOM 2887 H HG23 . VAL A 1 184 ? -27.042 8.522   -16.228 1.00 0.00 ? 184 VAL A HG23 1 
ATOM 2888 N N    . PRO A 1 185 ? -29.924 11.193  -16.701 1.00 0.00 ? 185 PRO A N    1 
ATOM 2889 C CA   . PRO A 1 185 ? -29.730 12.314  -17.617 1.00 0.00 ? 185 PRO A CA   1 
ATOM 2890 C C    . PRO A 1 185 ? -30.678 13.482  -17.350 1.00 0.00 ? 185 PRO A C    1 
ATOM 2891 O O    . PRO A 1 185 ? -30.539 14.543  -17.957 1.00 0.00 ? 185 PRO A O    1 
ATOM 2892 C CB   . PRO A 1 185 ? -30.018 11.701  -18.985 1.00 0.00 ? 185 PRO A CB   1 
ATOM 2893 C CG   . PRO A 1 185 ? -31.001 10.616  -18.713 1.00 0.00 ? 185 PRO A CG   1 
ATOM 2894 C CD   . PRO A 1 185 ? -30.705 10.105  -17.328 1.00 0.00 ? 185 PRO A CD   1 
ATOM 2895 H HA   . PRO A 1 185 ? -28.710 12.669  -17.591 1.00 0.00 ? 185 PRO A HA   1 
ATOM 2896 H HB2  . PRO A 1 185 ? -30.434 12.455  -19.638 1.00 0.00 ? 185 PRO A HB2  1 
ATOM 2897 H HB3  . PRO A 1 185 ? -29.105 11.310  -19.409 1.00 0.00 ? 185 PRO A HB3  1 
ATOM 2898 H HG2  . PRO A 1 185 ? -32.003 11.012  -18.757 1.00 0.00 ? 185 PRO A HG2  1 
ATOM 2899 H HG3  . PRO A 1 185 ? -30.880 9.824   -19.437 1.00 0.00 ? 185 PRO A HG3  1 
ATOM 2900 H HD2  . PRO A 1 185 ? -31.624 9.935   -16.793 1.00 0.00 ? 185 PRO A HD2  1 
ATOM 2901 H HD3  . PRO A 1 185 ? -30.128 9.195   -17.378 1.00 0.00 ? 185 PRO A HD3  1 
ATOM 2902 N N    . TYR A 1 186 ? -31.639 13.295  -16.446 1.00 0.00 ? 186 TYR A N    1 
ATOM 2903 C CA   . TYR A 1 186 ? -32.584 14.365  -16.136 1.00 0.00 ? 186 TYR A CA   1 
ATOM 2904 C C    . TYR A 1 186 ? -33.395 14.074  -14.877 1.00 0.00 ? 186 TYR A C    1 
ATOM 2905 O O    . TYR A 1 186 ? -34.391 13.360  -14.922 1.00 0.00 ? 186 TYR A O    1 
ATOM 2906 C CB   . TYR A 1 186 ? -33.539 14.609  -17.313 1.00 0.00 ? 186 TYR A CB   1 
ATOM 2907 C CG   . TYR A 1 186 ? -33.764 13.403  -18.201 1.00 0.00 ? 186 TYR A CG   1 
ATOM 2908 C CD1  . TYR A 1 186 ? -34.403 12.267  -17.719 1.00 0.00 ? 186 TYR A CD1  1 
ATOM 2909 C CD2  . TYR A 1 186 ? -33.345 13.406  -19.525 1.00 0.00 ? 186 TYR A CD2  1 
ATOM 2910 C CE1  . TYR A 1 186 ? -34.616 11.169  -18.530 1.00 0.00 ? 186 TYR A CE1  1 
ATOM 2911 C CE2  . TYR A 1 186 ? -33.555 12.312  -20.344 1.00 0.00 ? 186 TYR A CE2  1 
ATOM 2912 C CZ   . TYR A 1 186 ? -34.191 11.196  -19.841 1.00 0.00 ? 186 TYR A CZ   1 
ATOM 2913 O OH   . TYR A 1 186 ? -34.403 10.105  -20.653 1.00 0.00 ? 186 TYR A OH   1 
ATOM 2914 H H    . TYR A 1 186 ? -31.715 12.433  -15.981 1.00 0.00 ? 186 TYR A H    1 
ATOM 2915 H HA   . TYR A 1 186 ? -32.011 15.264  -15.970 1.00 0.00 ? 186 TYR A HA   1 
ATOM 2916 H HB2  . TYR A 1 186 ? -34.501 14.910  -16.924 1.00 0.00 ? 186 TYR A HB2  1 
ATOM 2917 H HB3  . TYR A 1 186 ? -33.142 15.404  -17.926 1.00 0.00 ? 186 TYR A HB3  1 
ATOM 2918 H HD1  . TYR A 1 186 ? -34.734 12.248  -16.692 1.00 0.00 ? 186 TYR A HD1  1 
ATOM 2919 H HD2  . TYR A 1 186 ? -32.845 14.281  -19.916 1.00 0.00 ? 186 TYR A HD2  1 
ATOM 2920 H HE1  . TYR A 1 186 ? -35.115 10.296  -18.136 1.00 0.00 ? 186 TYR A HE1  1 
ATOM 2921 H HE2  . TYR A 1 186 ? -33.220 12.334  -21.370 1.00 0.00 ? 186 TYR A HE2  1 
ATOM 2922 H HH   . TYR A 1 186 ? -33.568 9.660   -20.815 1.00 0.00 ? 186 TYR A HH   1 
ATOM 2923 N N    . VAL A 1 187 ? -32.978 14.657  -13.761 1.00 0.00 ? 187 VAL A N    1 
ATOM 2924 C CA   . VAL A 1 187 ? -33.684 14.483  -12.495 1.00 0.00 ? 187 VAL A CA   1 
ATOM 2925 C C    . VAL A 1 187 ? -33.787 15.816  -11.774 1.00 0.00 ? 187 VAL A C    1 
ATOM 2926 O O    . VAL A 1 187 ? -33.152 16.794  -12.165 1.00 0.00 ? 187 VAL A O    1 
ATOM 2927 C CB   . VAL A 1 187 ? -33.012 13.446  -11.562 1.00 0.00 ? 187 VAL A CB   1 
ATOM 2928 C CG1  . VAL A 1 187 ? -33.934 12.255  -11.352 1.00 0.00 ? 187 VAL A CG1  1 
ATOM 2929 C CG2  . VAL A 1 187 ? -31.661 12.996  -12.103 1.00 0.00 ? 187 VAL A CG2  1 
ATOM 2930 H H    . VAL A 1 187 ? -32.187 15.234  -13.789 1.00 0.00 ? 187 VAL A H    1 
ATOM 2931 H HA   . VAL A 1 187 ? -34.688 14.137  -12.720 1.00 0.00 ? 187 VAL A HA   1 
ATOM 2932 H HB   . VAL A 1 187 ? -32.851 13.913  -10.600 1.00 0.00 ? 187 VAL A HB   1 
ATOM 2933 H HG11 . VAL A 1 187 ? -34.891 12.600  -10.978 1.00 0.00 ? 187 VAL A HG11 1 
ATOM 2934 H HG12 . VAL A 1 187 ? -33.491 11.578  -10.637 1.00 0.00 ? 187 VAL A HG12 1 
ATOM 2935 H HG13 . VAL A 1 187 ? -34.079 11.741  -12.292 1.00 0.00 ? 187 VAL A HG13 1 
ATOM 2936 H HG21 . VAL A 1 187 ? -31.672 13.029  -13.182 1.00 0.00 ? 187 VAL A HG21 1 
ATOM 2937 H HG22 . VAL A 1 187 ? -31.462 11.985  -11.779 1.00 0.00 ? 187 VAL A HG22 1 
ATOM 2938 H HG23 . VAL A 1 187 ? -30.889 13.652  -11.731 1.00 0.00 ? 187 VAL A HG23 1 
ATOM 2939 N N    . GLU A 1 188 ? -34.609 15.859  -10.739 1.00 0.00 ? 188 GLU A N    1 
ATOM 2940 C CA   . GLU A 1 188 ? -34.809 17.090  -9.992  1.00 0.00 ? 188 GLU A CA   1 
ATOM 2941 C C    . GLU A 1 188 ? -34.052 17.095  -8.672  1.00 0.00 ? 188 GLU A C    1 
ATOM 2942 O O    . GLU A 1 188 ? -34.443 16.433  -7.718  1.00 0.00 ? 188 GLU A O    1 
ATOM 2943 C CB   . GLU A 1 188 ? -36.296 17.298  -9.729  1.00 0.00 ? 188 GLU A CB   1 
ATOM 2944 C CG   . GLU A 1 188 ? -37.031 17.971  -10.877 1.00 0.00 ? 188 GLU A CG   1 
ATOM 2945 C CD   . GLU A 1 188 ? -38.511 18.141  -10.601 1.00 0.00 ? 188 GLU A CD   1 
ATOM 2946 O OE1  . GLU A 1 188 ? -38.892 19.186  -10.032 1.00 0.00 ? 188 GLU A OE1  1 
ATOM 2947 O OE2  . GLU A 1 188 ? -39.290 17.231  -10.952 1.00 0.00 ? 188 GLU A OE2  1 
ATOM 2948 H H    . GLU A 1 188 ? -35.108 15.054  -10.487 1.00 0.00 ? 188 GLU A H    1 
ATOM 2949 H HA   . GLU A 1 188 ? -34.449 17.903  -10.601 1.00 0.00 ? 188 GLU A HA   1 
ATOM 2950 H HB2  . GLU A 1 188 ? -36.749 16.335  -9.556  1.00 0.00 ? 188 GLU A HB2  1 
ATOM 2951 H HB3  . GLU A 1 188 ? -36.412 17.907  -8.846  1.00 0.00 ? 188 GLU A HB3  1 
ATOM 2952 H HG2  . GLU A 1 188 ? -36.596 18.944  -11.044 1.00 0.00 ? 188 GLU A HG2  1 
ATOM 2953 H HG3  . GLU A 1 188 ? -36.912 17.368  -11.766 1.00 0.00 ? 188 GLU A HG3  1 
ATOM 2954 N N    . LYS A 1 189 ? -32.995 17.888  -8.612  1.00 0.00 ? 189 LYS A N    1 
ATOM 2955 C CA   . LYS A 1 189 ? -32.223 18.010  -7.383  1.00 0.00 ? 189 LYS A CA   1 
ATOM 2956 C C    . LYS A 1 189 ? -33.055 18.784  -6.368  1.00 0.00 ? 189 LYS A C    1 
ATOM 2957 O O    . LYS A 1 189 ? -32.802 19.958  -6.099  1.00 0.00 ? 189 LYS A O    1 
ATOM 2958 C CB   . LYS A 1 189 ? -30.890 18.711  -7.643  1.00 0.00 ? 189 LYS A CB   1 
ATOM 2959 C CG   . LYS A 1 189 ? -29.699 17.768  -7.633  1.00 0.00 ? 189 LYS A CG   1 
ATOM 2960 C CD   . LYS A 1 189 ? -29.805 16.726  -8.736  1.00 0.00 ? 189 LYS A CD   1 
ATOM 2961 C CE   . LYS A 1 189 ? -28.439 16.373  -9.302  1.00 0.00 ? 189 LYS A CE   1 
ATOM 2962 N NZ   . LYS A 1 189 ? -27.946 15.062  -8.796  1.00 0.00 ? 189 LYS A NZ   1 
ATOM 2963 H H    . LYS A 1 189 ? -32.772 18.425  -9.401  1.00 0.00 ? 189 LYS A H    1 
ATOM 2964 H HA   . LYS A 1 189 ? -32.040 17.017  -7.004  1.00 0.00 ? 189 LYS A HA   1 
ATOM 2965 H HB2  . LYS A 1 189 ? -30.933 19.191  -8.607  1.00 0.00 ? 189 LYS A HB2  1 
ATOM 2966 H HB3  . LYS A 1 189 ? -30.734 19.458  -6.882  1.00 0.00 ? 189 LYS A HB3  1 
ATOM 2967 H HG2  . LYS A 1 189 ? -28.795 18.340  -7.779  1.00 0.00 ? 189 LYS A HG2  1 
ATOM 2968 H HG3  . LYS A 1 189 ? -29.659 17.263  -6.678  1.00 0.00 ? 189 LYS A HG3  1 
ATOM 2969 H HD2  . LYS A 1 189 ? -30.257 15.834  -8.332  1.00 0.00 ? 189 LYS A HD2  1 
ATOM 2970 H HD3  . LYS A 1 189 ? -30.423 17.119  -9.529  1.00 0.00 ? 189 LYS A HD3  1 
ATOM 2971 H HE2  . LYS A 1 189 ? -28.511 16.327  -10.379 1.00 0.00 ? 189 LYS A HE2  1 
ATOM 2972 H HE3  . LYS A 1 189 ? -27.737 17.145  -9.023  1.00 0.00 ? 189 LYS A HE3  1 
ATOM 2973 H HZ1  . LYS A 1 189 ? -27.155 15.209  -8.135  1.00 0.00 ? 189 LYS A HZ1  1 
ATOM 2974 H HZ2  . LYS A 1 189 ? -27.618 14.472  -9.586  1.00 0.00 ? 189 LYS A HZ2  1 
ATOM 2975 H HZ3  . LYS A 1 189 ? -28.710 14.560  -8.298  1.00 0.00 ? 189 LYS A HZ3  1 
ATOM 2976 N N    . TYR A 1 190 ? -34.087 18.122  -5.851  1.00 0.00 ? 190 TYR A N    1 
ATOM 2977 C CA   . TYR A 1 190 ? -35.012 18.750  -4.912  1.00 0.00 ? 190 TYR A CA   1 
ATOM 2978 C C    . TYR A 1 190 ? -34.733 18.387  -3.451  1.00 0.00 ? 190 TYR A C    1 
ATOM 2979 O O    . TYR A 1 190 ? -34.919 17.249  -3.028  1.00 0.00 ? 190 TYR A O    1 
ATOM 2980 C CB   . TYR A 1 190 ? -36.452 18.375  -5.279  1.00 0.00 ? 190 TYR A CB   1 
ATOM 2981 C CG   . TYR A 1 190 ? -37.464 18.686  -4.197  1.00 0.00 ? 190 TYR A CG   1 
ATOM 2982 C CD1  . TYR A 1 190 ? -37.704 17.782  -3.172  1.00 0.00 ? 190 TYR A CD1  1 
ATOM 2983 C CD2  . TYR A 1 190 ? -38.172 19.880  -4.201  1.00 0.00 ? 190 TYR A CD2  1 
ATOM 2984 C CE1  . TYR A 1 190 ? -38.623 18.057  -2.180  1.00 0.00 ? 190 TYR A CE1  1 
ATOM 2985 C CE2  . TYR A 1 190 ? -39.095 20.164  -3.211  1.00 0.00 ? 190 TYR A CE2  1 
ATOM 2986 C CZ   . TYR A 1 190 ? -39.316 19.249  -2.204  1.00 0.00 ? 190 TYR A CZ   1 
ATOM 2987 O OH   . TYR A 1 190 ? -40.233 19.528  -1.216  1.00 0.00 ? 190 TYR A OH   1 
ATOM 2988 H H    . TYR A 1 190 ? -34.252 17.198  -6.140  1.00 0.00 ? 190 TYR A H    1 
ATOM 2989 H HA   . TYR A 1 190 ? -34.904 19.818  -5.020  1.00 0.00 ? 190 TYR A HA   1 
ATOM 2990 H HB2  . TYR A 1 190 ? -36.742 18.917  -6.166  1.00 0.00 ? 190 TYR A HB2  1 
ATOM 2991 H HB3  . TYR A 1 190 ? -36.499 17.314  -5.481  1.00 0.00 ? 190 TYR A HB3  1 
ATOM 2992 H HD1  . TYR A 1 190 ? -37.160 16.849  -3.156  1.00 0.00 ? 190 TYR A HD1  1 
ATOM 2993 H HD2  . TYR A 1 190 ? -37.996 20.593  -4.993  1.00 0.00 ? 190 TYR A HD2  1 
ATOM 2994 H HE1  . TYR A 1 190 ? -38.795 17.340  -1.392  1.00 0.00 ? 190 TYR A HE1  1 
ATOM 2995 H HE2  . TYR A 1 190 ? -39.637 21.098  -3.231  1.00 0.00 ? 190 TYR A HE2  1 
ATOM 2996 H HH   . TYR A 1 190 ? -40.990 19.978  -1.599  1.00 0.00 ? 190 TYR A HH   1 
ATOM 2997 N N    . ARG A 1 191 ? -34.317 19.399  -2.699  1.00 0.00 ? 191 ARG A N    1 
ATOM 2998 C CA   . ARG A 1 191 ? -34.035 19.244  -1.273  1.00 0.00 ? 191 ARG A CA   1 
ATOM 2999 C C    . ARG A 1 191 ? -35.299 18.779  -0.542  1.00 0.00 ? 191 ARG A C    1 
ATOM 3000 O O    . ARG A 1 191 ? -36.229 19.561  -0.346  1.00 0.00 ? 191 ARG A O    1 
ATOM 3001 C CB   . ARG A 1 191 ? -33.538 20.562  -0.679  1.00 0.00 ? 191 ARG A CB   1 
ATOM 3002 C CG   . ARG A 1 191 ? -33.018 20.429  0.743   1.00 0.00 ? 191 ARG A CG   1 
ATOM 3003 C CD   . ARG A 1 191 ? -34.005 20.990  1.753   1.00 0.00 ? 191 ARG A CD   1 
ATOM 3004 N NE   . ARG A 1 191 ? -33.913 20.309  3.042   1.00 0.00 ? 191 ARG A NE   1 
ATOM 3005 C CZ   . ARG A 1 191 ? -34.336 20.833  4.192   1.00 0.00 ? 191 ARG A CZ   1 
ATOM 3006 N NH1  . ARG A 1 191 ? -34.885 22.041  4.218   1.00 0.00 ? 191 ARG A NH1  1 
ATOM 3007 N NH2  . ARG A 1 191 ? -34.211 20.145  5.319   1.00 0.00 ? 191 ARG A NH2  1 
ATOM 3008 H H    . ARG A 1 191 ? -34.222 20.265  -3.148  1.00 0.00 ? 191 ARG A H    1 
ATOM 3009 H HA   . ARG A 1 191 ? -33.268 18.493  -1.166  1.00 0.00 ? 191 ARG A HA   1 
ATOM 3010 H HB2  . ARG A 1 191 ? -32.739 20.944  -1.298  1.00 0.00 ? 191 ARG A HB2  1 
ATOM 3011 H HB3  . ARG A 1 191 ? -34.351 21.273  -0.678  1.00 0.00 ? 191 ARG A HB3  1 
ATOM 3012 H HG2  . ARG A 1 191 ? -32.854 19.383  0.958   1.00 0.00 ? 191 ARG A HG2  1 
ATOM 3013 H HG3  . ARG A 1 191 ? -32.084 20.966  0.827   1.00 0.00 ? 191 ARG A HG3  1 
ATOM 3014 H HD2  . ARG A 1 191 ? -33.796 22.039  1.894   1.00 0.00 ? 191 ARG A HD2  1 
ATOM 3015 H HD3  . ARG A 1 191 ? -35.005 20.871  1.362   1.00 0.00 ? 191 ARG A HD3  1 
ATOM 3016 H HE   . ARG A 1 191 ? -33.514 19.414  3.053   1.00 0.00 ? 191 ARG A HE   1 
ATOM 3017 H HH11 . ARG A 1 191 ? -34.985 22.565  3.372   1.00 0.00 ? 191 ARG A HH11 1 
ATOM 3018 H HH12 . ARG A 1 191 ? -35.200 22.427  5.084   1.00 0.00 ? 191 ARG A HH12 1 
ATOM 3019 H HH21 . ARG A 1 191 ? -33.799 19.233  5.305   1.00 0.00 ? 191 ARG A HH21 1 
ATOM 3020 H HH22 . ARG A 1 191 ? -34.528 20.537  6.182   1.00 0.00 ? 191 ARG A HH22 1 
ATOM 3021 N N    . PRO A 1 192 ? -35.365 17.489  -0.148  1.00 0.00 ? 192 PRO A N    1 
ATOM 3022 C CA   . PRO A 1 192 ? -36.532 16.927  0.531   1.00 0.00 ? 192 PRO A CA   1 
ATOM 3023 C C    . PRO A 1 192 ? -36.466 17.032  2.051   1.00 0.00 ? 192 PRO A C    1 
ATOM 3024 O O    . PRO A 1 192 ? -35.515 16.563  2.678   1.00 0.00 ? 192 PRO A O    1 
ATOM 3025 C CB   . PRO A 1 192 ? -36.477 15.467  0.101   1.00 0.00 ? 192 PRO A CB   1 
ATOM 3026 C CG   . PRO A 1 192 ? -35.017 15.165  -0.005  1.00 0.00 ? 192 PRO A CG   1 
ATOM 3027 C CD   . PRO A 1 192 ? -34.324 16.463  -0.357  1.00 0.00 ? 192 PRO A CD   1 
ATOM 3028 H HA   . PRO A 1 192 ? -37.450 17.373  0.180   1.00 0.00 ? 192 PRO A HA   1 
ATOM 3029 H HB2  . PRO A 1 192 ? -36.958 14.851  0.846   1.00 0.00 ? 192 PRO A HB2  1 
ATOM 3030 H HB3  . PRO A 1 192 ? -36.974 15.349  -0.850  1.00 0.00 ? 192 PRO A HB3  1 
ATOM 3031 H HG2  . PRO A 1 192 ? -34.654 14.793  0.941   1.00 0.00 ? 192 PRO A HG2  1 
ATOM 3032 H HG3  . PRO A 1 192 ? -34.852 14.432  -0.782  1.00 0.00 ? 192 PRO A HG3  1 
ATOM 3033 H HD2  . PRO A 1 192 ? -33.485 16.630  0.303   1.00 0.00 ? 192 PRO A HD2  1 
ATOM 3034 H HD3  . PRO A 1 192 ? -33.998 16.446  -1.383  1.00 0.00 ? 192 PRO A HD3  1 
ATOM 3035 N N    . ALA A 1 193 ? -37.496 17.642  2.636   1.00 0.00 ? 193 ALA A N    1 
ATOM 3036 C CA   . ALA A 1 193 ? -37.590 17.810  4.082   1.00 0.00 ? 193 ALA A CA   1 
ATOM 3037 C C    . ALA A 1 193 ? -38.662 18.830  4.441   1.00 0.00 ? 193 ALA A C    1 
ATOM 3038 O O    . ALA A 1 193 ? -38.537 20.012  4.120   1.00 0.00 ? 193 ALA A O    1 
ATOM 3039 C CB   . ALA A 1 193 ? -36.256 18.240  4.658   1.00 0.00 ? 193 ALA A CB   1 
ATOM 3040 H H    . ALA A 1 193 ? -38.219 17.984  2.076   1.00 0.00 ? 193 ALA A H    1 
ATOM 3041 H HA   . ALA A 1 193 ? -37.854 16.855  4.515   1.00 0.00 ? 193 ALA A HA   1 
ATOM 3042 H HB1  . ALA A 1 193 ? -35.703 18.780  3.906   1.00 0.00 ? 193 ALA A HB1  1 
ATOM 3043 H HB2  . ALA A 1 193 ? -35.697 17.368  4.961   1.00 0.00 ? 193 ALA A HB2  1 
ATOM 3044 H HB3  . ALA A 1 193 ? -36.423 18.876  5.513   1.00 0.00 ? 193 ALA A HB3  1 
ATOM 3045 N N    . SER A 1 194 ? -39.715 18.371  5.111   1.00 0.00 ? 194 SER A N    1 
ATOM 3046 C CA   . SER A 1 194 ? -40.807 19.258  5.514   1.00 0.00 ? 194 SER A CA   1 
ATOM 3047 C C    . SER A 1 194 ? -41.992 18.484  6.071   1.00 0.00 ? 194 SER A C    1 
ATOM 3048 O O    . SER A 1 194 ? -42.703 18.971  6.951   1.00 0.00 ? 194 SER A O    1 
ATOM 3049 C CB   . SER A 1 194 ? -41.264 20.120  4.333   1.00 0.00 ? 194 SER A CB   1 
ATOM 3050 O OG   . SER A 1 194 ? -42.548 20.676  4.571   1.00 0.00 ? 194 SER A OG   1 
ATOM 3051 H H    . SER A 1 194 ? -39.755 17.422  5.342   1.00 0.00 ? 194 SER A H    1 
ATOM 3052 H HA   . SER A 1 194 ? -40.439 19.898  6.286   1.00 0.00 ? 194 SER A HA   1 
ATOM 3053 H HB2  . SER A 1 194 ? -40.562 20.926  4.186   1.00 0.00 ? 194 SER A HB2  1 
ATOM 3054 H HB3  . SER A 1 194 ? -41.307 19.512  3.442   1.00 0.00 ? 194 SER A HB3  1 
ATOM 3055 H HG   . SER A 1 194 ? -43.213 19.989  4.491   1.00 0.00 ? 194 SER A HG   1 
ATOM 3056 N N    . ALA A 1 195 ? -42.216 17.295  5.544   1.00 0.00 ? 195 ALA A N    1 
ATOM 3057 C CA   . ALA A 1 195 ? -43.336 16.479  5.982   1.00 0.00 ? 195 ALA A CA   1 
ATOM 3058 C C    . ALA A 1 195 ? -42.884 15.232  6.733   1.00 0.00 ? 195 ALA A C    1 
ATOM 3059 O O    . ALA A 1 195 ? -43.069 15.127  7.946   1.00 0.00 ? 195 ALA A O    1 
ATOM 3060 C CB   . ALA A 1 195 ? -44.172 16.103  4.777   1.00 0.00 ? 195 ALA A CB   1 
ATOM 3061 H H    . ALA A 1 195 ? -41.628 16.966  4.836   1.00 0.00 ? 195 ALA A H    1 
ATOM 3062 H HA   . ALA A 1 195 ? -43.950 17.079  6.637   1.00 0.00 ? 195 ALA A HA   1 
ATOM 3063 H HB1  . ALA A 1 195 ? -45.218 16.206  5.018   1.00 0.00 ? 195 ALA A HB1  1 
ATOM 3064 H HB2  . ALA A 1 195 ? -43.962 15.081  4.498   1.00 0.00 ? 195 ALA A HB2  1 
ATOM 3065 H HB3  . ALA A 1 195 ? -43.923 16.762  3.957   1.00 0.00 ? 195 ALA A HB3  1 
ATOM 3066 N N    . SER A 1 196 ? -42.303 14.285  6.006   1.00 0.00 ? 196 SER A N    1 
ATOM 3067 C CA   . SER A 1 196 ? -41.842 13.040  6.607   1.00 0.00 ? 196 SER A CA   1 
ATOM 3068 C C    . SER A 1 196 ? -43.001 12.306  7.275   1.00 0.00 ? 196 SER A C    1 
ATOM 3069 O O    . SER A 1 196 ? -42.861 11.769  8.374   1.00 0.00 ? 196 SER A O    1 
ATOM 3070 C CB   . SER A 1 196 ? -40.736 13.318  7.628   1.00 0.00 ? 196 SER A CB   1 
ATOM 3071 O OG   . SER A 1 196 ? -40.407 12.148  8.355   1.00 0.00 ? 196 SER A OG   1 
ATOM 3072 H H    . SER A 1 196 ? -42.190 14.422  5.042   1.00 0.00 ? 196 SER A H    1 
ATOM 3073 H HA   . SER A 1 196 ? -41.447 12.421  5.818   1.00 0.00 ? 196 SER A HA   1 
ATOM 3074 H HB2  . SER A 1 196 ? -39.853 13.668  7.114   1.00 0.00 ? 196 SER A HB2  1 
ATOM 3075 H HB3  . SER A 1 196 ? -41.073 14.075  8.321   1.00 0.00 ? 196 SER A HB3  1 
ATOM 3076 H HG   . SER A 1 196 ? -41.105 11.954  8.985   1.00 0.00 ? 196 SER A HG   1 
ATOM 3077 N N    . VAL A 1 197 ? -44.149 12.296  6.605   1.00 0.00 ? 197 VAL A N    1 
ATOM 3078 C CA   . VAL A 1 197 ? -45.342 11.636  7.131   1.00 0.00 ? 197 VAL A CA   1 
ATOM 3079 C C    . VAL A 1 197 ? -46.062 10.851  6.048   1.00 0.00 ? 197 VAL A C    1 
ATOM 3080 O O    . VAL A 1 197 ? -47.231 10.490  6.186   1.00 0.00 ? 197 VAL A O    1 
ATOM 3081 C CB   . VAL A 1 197 ? -46.311 12.659  7.751   1.00 0.00 ? 197 VAL A CB   1 
ATOM 3082 C CG1  . VAL A 1 197 ? -45.537 13.842  8.301   1.00 0.00 ? 197 VAL A CG1  1 
ATOM 3083 C CG2  . VAL A 1 197 ? -47.352 13.134  6.742   1.00 0.00 ? 197 VAL A CG2  1 
ATOM 3084 H H    . VAL A 1 197 ? -44.198 12.747  5.736   1.00 0.00 ? 197 VAL A H    1 
ATOM 3085 H HA   . VAL A 1 197 ? -45.028 10.952  7.900   1.00 0.00 ? 197 VAL A HA   1 
ATOM 3086 H HB   . VAL A 1 197 ? -46.821 12.178  8.563   1.00 0.00 ? 197 VAL A HB   1 
ATOM 3087 H HG11 . VAL A 1 197 ? -44.750 13.485  8.947   1.00 0.00 ? 197 VAL A HG11 1 
ATOM 3088 H HG12 . VAL A 1 197 ? -46.203 14.483  8.856   1.00 0.00 ? 197 VAL A HG12 1 
ATOM 3089 H HG13 . VAL A 1 197 ? -45.105 14.392  7.477   1.00 0.00 ? 197 VAL A HG13 1 
ATOM 3090 H HG21 . VAL A 1 197 ? -48.180 12.442  6.724   1.00 0.00 ? 197 VAL A HG21 1 
ATOM 3091 H HG22 . VAL A 1 197 ? -46.905 13.183  5.760   1.00 0.00 ? 197 VAL A HG22 1 
ATOM 3092 H HG23 . VAL A 1 197 ? -47.707 14.113  7.025   1.00 0.00 ? 197 VAL A HG23 1 
ATOM 3093 N N    . SER A 1 198 ? -45.345 10.603  4.978   1.00 0.00 ? 198 SER A N    1 
ATOM 3094 C CA   . SER A 1 198 ? -45.865 9.873   3.837   1.00 0.00 ? 198 SER A CA   1 
ATOM 3095 C C    . SER A 1 198 ? -47.175 10.469  3.338   1.00 0.00 ? 198 SER A C    1 
ATOM 3096 O O    . SER A 1 198 ? -48.219 10.343  3.978   1.00 0.00 ? 198 SER A O    1 
ATOM 3097 C CB   . SER A 1 198 ? -46.055 8.401   4.184   1.00 0.00 ? 198 SER A CB   1 
ATOM 3098 O OG   . SER A 1 198 ? -47.061 8.232   5.168   1.00 0.00 ? 198 SER A OG   1 
ATOM 3099 H H    . SER A 1 198 ? -44.428 10.924  4.956   1.00 0.00 ? 198 SER A H    1 
ATOM 3100 H HA   . SER A 1 198 ? -45.134 9.956   3.052   1.00 0.00 ? 198 SER A HA   1 
ATOM 3101 H HB2  . SER A 1 198 ? -46.343 7.861   3.296   1.00 0.00 ? 198 SER A HB2  1 
ATOM 3102 H HB3  . SER A 1 198 ? -45.126 8.005   4.564   1.00 0.00 ? 198 SER A HB3  1 
ATOM 3103 H HG   . SER A 1 198 ? -47.901 8.050   4.739   1.00 0.00 ? 198 SER A HG   1 
ATOM 3104 N N    . ALA A 1 199 ? -47.106 11.117  2.184   1.00 0.00 ? 199 ALA A N    1 
ATOM 3105 C CA   . ALA A 1 199 ? -48.272 11.740  1.578   1.00 0.00 ? 199 ALA A CA   1 
ATOM 3106 C C    . ALA A 1 199 ? -49.238 10.695  1.030   1.00 0.00 ? 199 ALA A C    1 
ATOM 3107 O O    . ALA A 1 199 ? -50.415 10.675  1.388   1.00 0.00 ? 199 ALA A O    1 
ATOM 3108 C CB   . ALA A 1 199 ? -47.828 12.686  0.475   1.00 0.00 ? 199 ALA A CB   1 
ATOM 3109 H H    . ALA A 1 199 ? -46.242 11.179  1.725   1.00 0.00 ? 199 ALA A H    1 
ATOM 3110 H HA   . ALA A 1 199 ? -48.774 12.321  2.337   1.00 0.00 ? 199 ALA A HA   1 
ATOM 3111 H HB1  . ALA A 1 199 ? -48.381 12.473  -0.429  1.00 0.00 ? 199 ALA A HB1  1 
ATOM 3112 H HB2  . ALA A 1 199 ? -46.772 12.546  0.292   1.00 0.00 ? 199 ALA A HB2  1 
ATOM 3113 H HB3  . ALA A 1 199 ? -48.010 13.705  0.779   1.00 0.00 ? 199 ALA A HB3  1 
ATOM 3114 N N    . LEU A 1 200 ? -48.733 9.831   0.156   1.00 0.00 ? 200 LEU A N    1 
ATOM 3115 C CA   . LEU A 1 200 ? -49.554 8.785   -0.446  1.00 0.00 ? 200 LEU A CA   1 
ATOM 3116 C C    . LEU A 1 200 ? -48.879 7.420   -0.334  1.00 0.00 ? 200 LEU A C    1 
ATOM 3117 O O    . LEU A 1 200 ? -49.372 6.530   0.358   1.00 0.00 ? 200 LEU A O    1 
ATOM 3118 C CB   . LEU A 1 200 ? -49.838 9.108   -1.916  1.00 0.00 ? 200 LEU A CB   1 
ATOM 3119 C CG   . LEU A 1 200 ? -48.700 9.813   -2.665  1.00 0.00 ? 200 LEU A CG   1 
ATOM 3120 C CD1  . LEU A 1 200 ? -48.300 9.021   -3.901  1.00 0.00 ? 200 LEU A CD1  1 
ATOM 3121 C CD2  . LEU A 1 200 ? -49.105 11.229  -3.047  1.00 0.00 ? 200 LEU A CD2  1 
ATOM 3122 H H    . LEU A 1 200 ? -47.789 9.900   -0.094  1.00 0.00 ? 200 LEU A H    1 
ATOM 3123 H HA   . LEU A 1 200 ? -50.490 8.753   0.090   1.00 0.00 ? 200 LEU A HA   1 
ATOM 3124 H HB2  . LEU A 1 200 ? -50.061 8.183   -2.427  1.00 0.00 ? 200 LEU A HB2  1 
ATOM 3125 H HB3  . LEU A 1 200 ? -50.712 9.741   -1.959  1.00 0.00 ? 200 LEU A HB3  1 
ATOM 3126 H HG   . LEU A 1 200 ? -47.837 9.876   -2.018  1.00 0.00 ? 200 LEU A HG   1 
ATOM 3127 H HD11 . LEU A 1 200 ? -47.232 9.099   -4.049  1.00 0.00 ? 200 LEU A HD11 1 
ATOM 3128 H HD12 . LEU A 1 200 ? -48.811 9.420   -4.765  1.00 0.00 ? 200 LEU A HD12 1 
ATOM 3129 H HD13 . LEU A 1 200 ? -48.570 7.985   -3.769  1.00 0.00 ? 200 LEU A HD13 1 
ATOM 3130 H HD21 . LEU A 1 200 ? -48.263 11.892  -2.918  1.00 0.00 ? 200 LEU A HD21 1 
ATOM 3131 H HD22 . LEU A 1 200 ? -49.919 11.553  -2.415  1.00 0.00 ? 200 LEU A HD22 1 
ATOM 3132 H HD23 . LEU A 1 200 ? -49.423 11.247  -4.079  1.00 0.00 ? 200 LEU A HD23 1 
ATOM 3133 N N    . ILE A 1 201 ? -47.754 7.261   -1.023  1.00 0.00 ? 201 ILE A N    1 
ATOM 3134 C CA   . ILE A 1 201 ? -47.019 6.002   -1.002  1.00 0.00 ? 201 ILE A CA   1 
ATOM 3135 C C    . ILE A 1 201 ? -47.865 4.866   -1.565  1.00 0.00 ? 201 ILE A C    1 
ATOM 3136 O O    . ILE A 1 201 ? -48.778 4.371   -0.905  1.00 0.00 ? 201 ILE A O    1 
ATOM 3137 C CB   . ILE A 1 201 ? -46.568 5.635   0.426   1.00 0.00 ? 201 ILE A CB   1 
ATOM 3138 C CG1  . ILE A 1 201 ? -45.807 6.802   1.057   1.00 0.00 ? 201 ILE A CG1  1 
ATOM 3139 C CG2  . ILE A 1 201 ? -45.704 4.383   0.408   1.00 0.00 ? 201 ILE A CG2  1 
ATOM 3140 C CD1  . ILE A 1 201 ? -44.530 7.156   0.328   1.00 0.00 ? 201 ILE A CD1  1 
ATOM 3141 H H    . ILE A 1 201 ? -47.411 8.005   -1.558  1.00 0.00 ? 201 ILE A H    1 
ATOM 3142 H HA   . ILE A 1 201 ? -46.137 6.122   -1.616  1.00 0.00 ? 201 ILE A HA   1 
ATOM 3143 H HB   . ILE A 1 201 ? -47.448 5.428   1.015   1.00 0.00 ? 201 ILE A HB   1 
ATOM 3144 H HG12 . ILE A 1 201 ? -46.441 7.677   1.059   1.00 0.00 ? 201 ILE A HG12 1 
ATOM 3145 H HG13 . ILE A 1 201 ? -45.550 6.547   2.074   1.00 0.00 ? 201 ILE A HG13 1 
ATOM 3146 H HG21 . ILE A 1 201 ? -45.600 4.002   1.412   1.00 0.00 ? 201 ILE A HG21 1 
ATOM 3147 H HG22 . ILE A 1 201 ? -44.728 4.625   0.012   1.00 0.00 ? 201 ILE A HG22 1 
ATOM 3148 H HG23 . ILE A 1 201 ? -46.169 3.633   -0.215  1.00 0.00 ? 201 ILE A HG23 1 
ATOM 3149 H HD11 . ILE A 1 201 ? -43.680 6.890   0.939   1.00 0.00 ? 201 ILE A HD11 1 
ATOM 3150 H HD12 . ILE A 1 201 ? -44.511 8.218   0.129   1.00 0.00 ? 201 ILE A HD12 1 
ATOM 3151 H HD13 . ILE A 1 201 ? -44.486 6.614   -0.605  1.00 0.00 ? 201 ILE A HD13 1 
ATOM 3152 N N    . GLY A 1 202 ? -47.552 4.459   -2.790  1.00 0.00 ? 202 GLY A N    1 
ATOM 3153 C CA   . GLY A 1 202 ? -48.292 3.384   -3.426  1.00 0.00 ? 202 GLY A CA   1 
ATOM 3154 C C    . GLY A 1 202 ? -47.525 2.749   -4.570  1.00 0.00 ? 202 GLY A C    1 
ATOM 3155 O O    . GLY A 1 202 ? -47.705 3.121   -5.729  1.00 0.00 ? 202 GLY A O    1 
ATOM 3156 H H    . GLY A 1 202 ? -46.814 4.893   -3.267  1.00 0.00 ? 202 GLY A H    1 
ATOM 3157 H HA2  . GLY A 1 202 ? -48.509 2.627   -2.688  1.00 0.00 ? 202 GLY A HA2  1 
ATOM 3158 H HA3  . GLY A 1 202 ? -49.223 3.778   -3.807  1.00 0.00 ? 202 GLY A HA3  1 
ATOM 3159 N N    . GLY A 1 203 ? -46.668 1.788   -4.243  1.00 0.00 ? 203 GLY A N    1 
ATOM 3160 C CA   . GLY A 1 203 ? -45.883 1.114   -5.261  1.00 0.00 ? 203 GLY A CA   1 
ATOM 3161 C C    . GLY A 1 203 ? -46.291 -0.334  -5.442  1.00 0.00 ? 203 GLY A C    1 
ATOM 3162 O O    . GLY A 1 203 ? -46.830 -0.709  -6.484  1.00 0.00 ? 203 GLY A O    1 
ATOM 3163 H H    . GLY A 1 203 ? -46.567 1.533   -3.301  1.00 0.00 ? 203 GLY A H    1 
ATOM 3164 H HA2  . GLY A 1 203 ? -46.012 1.633   -6.201  1.00 0.00 ? 203 GLY A HA2  1 
ATOM 3165 H HA3  . GLY A 1 203 ? -44.841 1.152   -4.981  1.00 0.00 ? 203 GLY A HA3  1 
ATOM 3166 N N    . ASN A 1 204 ? -46.030 -1.152  -4.427  1.00 0.00 ? 204 ASN A N    1 
ATOM 3167 C CA   . ASN A 1 204 ? -46.373 -2.568  -4.479  1.00 0.00 ? 204 ASN A CA   1 
ATOM 3168 C C    . ASN A 1 204 ? -47.224 -2.967  -3.277  1.00 0.00 ? 204 ASN A C    1 
ATOM 3169 O O    . ASN A 1 204 ? -48.308 -3.548  -3.488  1.00 0.00 ? 204 ASN A O    1 
ATOM 3170 C CB   . ASN A 1 204 ? -45.103 -3.420  -4.522  1.00 0.00 ? 204 ASN A CB   1 
ATOM 3171 C CG   . ASN A 1 204 ? -45.257 -4.645  -5.402  1.00 0.00 ? 204 ASN A CG   1 
ATOM 3172 O OD1  . ASN A 1 204 ? -45.213 -4.551  -6.629  1.00 0.00 ? 204 ASN A OD1  1 
ATOM 3173 N ND2  . ASN A 1 204 ? -45.441 -5.803  -4.779  1.00 0.00 ? 204 ASN A ND2  1 
ATOM 3174 O OXT  . ASN A 1 204 ? -46.798 -2.693  -2.135  1.00 0.00 ? 204 ASN A OXT  1 
ATOM 3175 H H    . ASN A 1 204 ? -45.598 -0.794  -3.624  1.00 0.00 ? 204 ASN A H    1 
ATOM 3176 H HA   . ASN A 1 204 ? -46.942 -2.740  -5.380  1.00 0.00 ? 204 ASN A HA   1 
ATOM 3177 H HB2  . ASN A 1 204 ? -44.290 -2.824  -4.909  1.00 0.00 ? 204 ASN A HB2  1 
ATOM 3178 H HB3  . ASN A 1 204 ? -44.860 -3.746  -3.522  1.00 0.00 ? 204 ASN A HB3  1 
ATOM 3179 H HD21 . ASN A 1 204 ? -45.465 -5.802  -3.799  1.00 0.00 ? 204 ASN A HD21 1 
ATOM 3180 H HD22 . ASN A 1 204 ? -45.543 -6.610  -5.324  1.00 0.00 ? 204 ASN A HD22 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   ASN 4   4   4   ASN ASN A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  TRP 13  13  13  TRP TRP A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 TRP 170 170 170 TRP TRP A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 TYR 186 186 186 TYR TYR A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 H A ARG 38  ? ? O A VAL 48  ? ? 1.51 
2 1 H A ARG 138 ? ? O A GLU 188 ? ? 1.55 
3 1 O A ALA 23  ? ? H A LEU 27  ? ? 1.58 
4 1 H A LEU 49  ? ? O A TYR 60  ? ? 1.59 
5 1 O A SER 19  ? ? H A GLU 22  ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 5   ? ? -132.16 -55.62  
2  1 GLU A 9   ? ? 57.19   106.22  
3  1 SER A 12  ? ? -99.23  -63.22  
4  1 TRP A 15  ? ? -90.80  -72.27  
5  1 ARG A 17  ? ? 45.58   167.25  
6  1 LEU A 18  ? ? 172.20  -156.74 
7  1 ARG A 20  ? ? -31.27  -37.19  
8  1 SER A 40  ? ? -55.99  84.80   
9  1 SER A 52  ? ? -64.86  90.59   
10 1 ASN A 54  ? ? 69.61   -92.67  
11 1 ARG A 56  ? ? -108.32 -162.12 
12 1 PRO A 73  ? ? -59.83  -156.89 
13 1 SER A 74  ? ? 78.98   108.27  
14 1 GLN A 77  ? ? -150.91 85.80   
15 1 PRO A 80  ? ? -55.51  -73.24  
16 1 VAL A 82  ? ? -149.17 -46.50  
17 1 SER A 83  ? ? -51.71  103.44  
18 1 PRO A 84  ? ? -68.67  -78.64  
19 1 ARG A 86  ? ? 61.71   -73.78  
20 1 TYR A 108 ? ? 77.93   109.10  
21 1 LEU A 109 ? ? -65.37  -83.62  
22 1 THR A 111 ? ? 169.16  -30.93  
23 1 ILE A 115 ? ? -123.76 -61.56  
24 1 SER A 119 ? ? 44.52   79.92   
25 1 SER A 121 ? ? 177.07  -166.80 
26 1 ARG A 122 ? ? 64.45   137.14  
27 1 ILE A 128 ? ? 32.72   74.47   
28 1 ARG A 130 ? ? -73.05  -77.85  
29 1 GLU A 133 ? ? 39.65   -164.73 
30 1 ALA A 134 ? ? -179.90 -73.48  
31 1 TYR A 136 ? ? -170.15 26.16   
32 1 ALA A 139 ? ? -43.79  156.50  
33 1 ILE A 161 ? ? -60.43  94.60   
34 1 ASP A 163 ? ? 179.99  168.59  
35 1 TRP A 169 ? ? 162.10  132.88  
36 1 TRP A 170 ? ? -120.19 -168.95 
37 1 TYR A 186 ? ? -167.22 98.94   
38 1 ARG A 191 ? ? -59.89  105.18  
39 1 ALA A 193 ? ? 165.56  114.89  
40 1 SER A 194 ? ? 171.12  -33.17  
41 1 ALA A 195 ? ? -111.79 -71.00  
42 1 SER A 198 ? ? 52.46   108.12  
43 1 LEU A 200 ? ? -130.11 -66.22  
44 1 ILE A 201 ? ? 61.76   104.71  
#