data_2EYZ
# 
_entry.id   2EYZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EYZ         
RCSB  RCSB035266   
WWPDB D_1000035266 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2EYV . unspecified 
PDB 2EYW . unspecified 
PDB 2EYX . unspecified 
PDB 2EYY . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EYZ 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kobashigawa, Y.' 1 
'Tanaka, S.'      2 
'Inagaki, F.'     3 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            14 
_citation.page_first                503 
_citation.page_last                 510 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17515907 
_citation.pdbx_database_id_DOI      10.1038/nsmb1241 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kobashigawa, Y.' 1 
primary 'Sakai, M.'       2 
primary 'Naito, M.'       3 
primary 'Yokochi, M.'     4 
primary 'Kumeta, H.'      5 
primary 'Makino, Y.'      6 
primary 'Ogura, K.'       7 
primary 'Tanaka, S.'      8 
primary 'Inagaki, F.'     9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'v-crk sarcoma virus CT10 oncogene homolog isoform a' 
_entity.formula_weight             33882.605 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CT10-Regulated Kinase isoform II' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPEEDFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPEEDFS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLY n 
1 4   ASN n 
1 5   PHE n 
1 6   ASP n 
1 7   SER n 
1 8   GLU n 
1 9   GLU n 
1 10  ARG n 
1 11  SER n 
1 12  SER n 
1 13  TRP n 
1 14  TYR n 
1 15  TRP n 
1 16  GLY n 
1 17  ARG n 
1 18  LEU n 
1 19  SER n 
1 20  ARG n 
1 21  GLN n 
1 22  GLU n 
1 23  ALA n 
1 24  VAL n 
1 25  ALA n 
1 26  LEU n 
1 27  LEU n 
1 28  GLN n 
1 29  GLY n 
1 30  GLN n 
1 31  ARG n 
1 32  HIS n 
1 33  GLY n 
1 34  VAL n 
1 35  PHE n 
1 36  LEU n 
1 37  VAL n 
1 38  ARG n 
1 39  ASP n 
1 40  SER n 
1 41  SER n 
1 42  THR n 
1 43  SER n 
1 44  PRO n 
1 45  GLY n 
1 46  ASP n 
1 47  TYR n 
1 48  VAL n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  SER n 
1 53  GLU n 
1 54  ASN n 
1 55  SER n 
1 56  ARG n 
1 57  VAL n 
1 58  SER n 
1 59  HIS n 
1 60  TYR n 
1 61  ILE n 
1 62  ILE n 
1 63  ASN n 
1 64  SER n 
1 65  SER n 
1 66  GLY n 
1 67  PRO n 
1 68  ARG n 
1 69  PRO n 
1 70  PRO n 
1 71  VAL n 
1 72  PRO n 
1 73  PRO n 
1 74  SER n 
1 75  PRO n 
1 76  ALA n 
1 77  GLN n 
1 78  PRO n 
1 79  PRO n 
1 80  PRO n 
1 81  GLY n 
1 82  VAL n 
1 83  SER n 
1 84  PRO n 
1 85  SER n 
1 86  ARG n 
1 87  LEU n 
1 88  ARG n 
1 89  ILE n 
1 90  GLY n 
1 91  ASP n 
1 92  GLN n 
1 93  GLU n 
1 94  PHE n 
1 95  ASP n 
1 96  SER n 
1 97  LEU n 
1 98  PRO n 
1 99  ALA n 
1 100 LEU n 
1 101 LEU n 
1 102 GLU n 
1 103 PHE n 
1 104 TYR n 
1 105 LYS n 
1 106 ILE n 
1 107 HIS n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 THR n 
1 112 THR n 
1 113 THR n 
1 114 LEU n 
1 115 ILE n 
1 116 GLU n 
1 117 PRO n 
1 118 VAL n 
1 119 SER n 
1 120 ARG n 
1 121 SER n 
1 122 ARG n 
1 123 GLN n 
1 124 GLY n 
1 125 SER n 
1 126 GLY n 
1 127 VAL n 
1 128 ILE n 
1 129 LEU n 
1 130 ARG n 
1 131 GLN n 
1 132 GLU n 
1 133 GLU n 
1 134 ALA n 
1 135 GLU n 
1 136 TYR n 
1 137 VAL n 
1 138 ARG n 
1 139 ALA n 
1 140 LEU n 
1 141 PHE n 
1 142 ASP n 
1 143 PHE n 
1 144 ASN n 
1 145 GLY n 
1 146 ASN n 
1 147 ASP n 
1 148 GLU n 
1 149 GLU n 
1 150 ASP n 
1 151 LEU n 
1 152 PRO n 
1 153 PHE n 
1 154 LYS n 
1 155 LYS n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 LEU n 
1 160 ARG n 
1 161 ILE n 
1 162 ARG n 
1 163 ASP n 
1 164 LYS n 
1 165 PRO n 
1 166 GLU n 
1 167 GLU n 
1 168 GLN n 
1 169 TRP n 
1 170 TRP n 
1 171 ASN n 
1 172 ALA n 
1 173 GLU n 
1 174 ASP n 
1 175 SER n 
1 176 GLU n 
1 177 GLY n 
1 178 LYS n 
1 179 ARG n 
1 180 GLY n 
1 181 MET n 
1 182 ILE n 
1 183 PRO n 
1 184 VAL n 
1 185 PRO n 
1 186 TYR n 
1 187 VAL n 
1 188 GLU n 
1 189 LYS n 
1 190 TYR n 
1 191 ARG n 
1 192 PRO n 
1 193 ALA n 
1 194 SER n 
1 195 ALA n 
1 196 SER n 
1 197 VAL n 
1 198 SER n 
1 199 ALA n 
1 200 LEU n 
1 201 ILE n 
1 202 GLY n 
1 203 GLY n 
1 204 ASN n 
1 205 GLN n 
1 206 GLU n 
1 207 GLY n 
1 208 SER n 
1 209 HIS n 
1 210 PRO n 
1 211 GLN n 
1 212 PRO n 
1 213 LEU n 
1 214 GLY n 
1 215 GLY n 
1 216 PRO n 
1 217 GLU n 
1 218 PRO n 
1 219 GLY n 
1 220 PRO n 
1 221 TYR n 
1 222 ALA n 
1 223 GLN n 
1 224 PRO n 
1 225 SER n 
1 226 VAL n 
1 227 ASN n 
1 228 THR n 
1 229 PRO n 
1 230 LEU n 
1 231 PRO n 
1 232 ASN n 
1 233 LEU n 
1 234 GLN n 
1 235 ASN n 
1 236 GLY n 
1 237 PRO n 
1 238 ILE n 
1 239 TYR n 
1 240 ALA n 
1 241 ARG n 
1 242 VAL n 
1 243 ILE n 
1 244 GLN n 
1 245 LYS n 
1 246 ARG n 
1 247 VAL n 
1 248 PRO n 
1 249 ASN n 
1 250 ALA n 
1 251 TYR n 
1 252 ASP n 
1 253 LYS n 
1 254 THR n 
1 255 ALA n 
1 256 LEU n 
1 257 ALA n 
1 258 LEU n 
1 259 GLU n 
1 260 VAL n 
1 261 GLY n 
1 262 GLU n 
1 263 LEU n 
1 264 VAL n 
1 265 LYS n 
1 266 VAL n 
1 267 THR n 
1 268 LYS n 
1 269 ILE n 
1 270 ASN n 
1 271 VAL n 
1 272 SER n 
1 273 GLY n 
1 274 GLN n 
1 275 TRP n 
1 276 GLU n 
1 277 GLY n 
1 278 GLU n 
1 279 CYS n 
1 280 ASN n 
1 281 GLY n 
1 282 LYS n 
1 283 ARG n 
1 284 GLY n 
1 285 HIS n 
1 286 PHE n 
1 287 PRO n 
1 288 PHE n 
1 289 THR n 
1 290 HIS n 
1 291 VAL n 
1 292 ARG n 
1 293 LEU n 
1 294 LEU n 
1 295 ASP n 
1 296 GLN n 
1 297 GLN n 
1 298 ASN n 
1 299 PRO n 
1 300 GLU n 
1 301 GLU n 
1 302 ASP n 
1 303 PHE n 
1 304 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pPRO EX-htb' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q96HJ0_HUMAN 
_struct_ref.pdbx_db_accession          Q96HJ0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EYZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 304 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96HJ0 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  304 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       304 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2EYZ 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      300 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q96HJ0 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          300 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            300 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-SEPARATED_NOESY    1 
2 1 '3D_ 13C-SEPARATED_NOESY' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      250mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.4mM isoform II U-15N, 13C PHOSPHATE BUFFER NA; 200MM NACL;90%H2O, 10%D2O' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2EYZ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2EYZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2EYZ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CYANA   2.0 'Guetntert P.' 1 
refinement           CNS     1.1 ?              2 
'structure solution' XEASY   ?   ?              3 
'structure solution' OLIVIA  ?   ?              4 
'structure solution' NMRPIPE ?   ?              5 
'structure solution' CYANA   2.0 'Guetntert P.' 6 
# 
_exptl.entry_id          2EYZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EYZ 
_struct.title                     'CT10-Regulated Kinase isoform II' 
_struct.pdbx_descriptor           'v-crk sarcoma virus CT10 oncogene homolog isoform a' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EYZ 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SH2, SH3, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 21 ? LEU A 26  ? GLN A 21 LEU A 26  1 ? 6 
HELX_P HELX_P2 2 SER A 96 ? GLU A 102 ? SER A 96 GLU A 102 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 35  ? LEU A 36  ? PHE A 35  LEU A 36  
A 2 VAL A 48  ? VAL A 51  ? VAL A 48  VAL A 51  
A 3 SER A 58  ? ILE A 61  ? SER A 58  ILE A 61  
B 1 ARG A 179 ? PRO A 183 ? ARG A 179 PRO A 183 
B 2 TRP A 169 ? GLU A 173 ? TRP A 169 GLU A 173 
B 3 ILE A 158 ? ASP A 163 ? ILE A 158 ASP A 163 
B 4 TYR A 136 ? ALA A 139 ? TYR A 136 ALA A 139 
B 5 VAL A 187 ? LYS A 189 ? VAL A 187 LYS A 189 
C 1 LYS A 265 ? ILE A 269 ? LYS A 265 ILE A 269 
C 2 TRP A 275 ? CYS A 279 ? TRP A 275 CYS A 279 
C 3 LYS A 282 ? HIS A 285 ? LYS A 282 HIS A 285 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 36  ? N LEU A 36  O SER A 50  ? O SER A 50  
A 2 3 N LEU A 49  ? N LEU A 49  O TYR A 60  ? O TYR A 60  
B 1 2 O ILE A 182 ? O ILE A 182 N TRP A 170 ? N TRP A 170 
B 2 3 O ASN A 171 ? O ASN A 171 N ASP A 163 ? N ASP A 163 
B 3 4 O LEU A 159 ? O LEU A 159 N VAL A 137 ? N VAL A 137 
B 4 5 N ARG A 138 ? N ARG A 138 O GLU A 188 ? O GLU A 188 
C 1 2 N LYS A 268 ? N LYS A 268 O GLU A 276 ? O GLU A 276 
C 2 3 N CYS A 279 ? N CYS A 279 O LYS A 282 ? O LYS A 282 
# 
_database_PDB_matrix.entry_id          2EYZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EYZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . MET A 1 1   ? 473.005 27.133  -10.115 1.00 0.00 ? 1   MET A N    1 
ATOM 2    C CA   . MET A 1 1   ? 474.007 27.891  -10.910 1.00 0.00 ? 1   MET A CA   1 
ATOM 3    C C    . MET A 1 1   ? 473.459 29.247  -11.340 1.00 0.00 ? 1   MET A C    1 
ATOM 4    O O    . MET A 1 1   ? 474.028 30.289  -11.013 1.00 0.00 ? 1   MET A O    1 
ATOM 5    C CB   . MET A 1 1   ? 474.383 27.060  -12.138 1.00 0.00 ? 1   MET A CB   1 
ATOM 6    C CG   . MET A 1 1   ? 475.852 27.162  -12.515 1.00 0.00 ? 1   MET A CG   1 
ATOM 7    S SD   . MET A 1 1   ? 476.879 25.968  -11.637 1.00 0.00 ? 1   MET A SD   1 
ATOM 8    C CE   . MET A 1 1   ? 476.604 24.497  -12.621 1.00 0.00 ? 1   MET A CE   1 
ATOM 9    H H1   . MET A 1 1   ? 472.304 26.744  -10.777 1.00 0.00 ? 1   MET A H1   1 
ATOM 10   H H2   . MET A 1 1   ? 472.563 27.798  -9.448  1.00 0.00 ? 1   MET A H2   1 
ATOM 11   H H3   . MET A 1 1   ? 473.507 26.374  -9.613  1.00 0.00 ? 1   MET A H3   1 
ATOM 12   H HA   . MET A 1 1   ? 474.886 28.042  -10.301 1.00 0.00 ? 1   MET A HA   1 
ATOM 13   H HB2  . MET A 1 1   ? 474.156 26.023  -11.941 1.00 0.00 ? 1   MET A HB2  1 
ATOM 14   H HB3  . MET A 1 1   ? 473.794 27.394  -12.979 1.00 0.00 ? 1   MET A HB3  1 
ATOM 15   H HG2  . MET A 1 1   ? 475.951 26.988  -13.576 1.00 0.00 ? 1   MET A HG2  1 
ATOM 16   H HG3  . MET A 1 1   ? 476.202 28.157  -12.281 1.00 0.00 ? 1   MET A HG3  1 
ATOM 17   H HE1  . MET A 1 1   ? 477.484 24.290  -13.212 1.00 0.00 ? 1   MET A HE1  1 
ATOM 18   H HE2  . MET A 1 1   ? 475.759 24.654  -13.275 1.00 0.00 ? 1   MET A HE2  1 
ATOM 19   H HE3  . MET A 1 1   ? 476.404 23.659  -11.968 1.00 0.00 ? 1   MET A HE3  1 
ATOM 20   N N    . ALA A 1 2   ? 472.351 29.228  -12.073 1.00 0.00 ? 2   ALA A N    1 
ATOM 21   C CA   . ALA A 1 2   ? 471.727 30.457  -12.547 1.00 0.00 ? 2   ALA A CA   1 
ATOM 22   C C    . ALA A 1 2   ? 470.963 31.151  -11.423 1.00 0.00 ? 2   ALA A C    1 
ATOM 23   O O    . ALA A 1 2   ? 471.111 30.803  -10.252 1.00 0.00 ? 2   ALA A O    1 
ATOM 24   C CB   . ALA A 1 2   ? 470.800 30.161  -13.717 1.00 0.00 ? 2   ALA A CB   1 
ATOM 25   H H    . ALA A 1 2   ? 471.944 28.366  -12.301 1.00 0.00 ? 2   ALA A H    1 
ATOM 26   H HA   . ALA A 1 2   ? 472.509 31.115  -12.895 1.00 0.00 ? 2   ALA A HA   1 
ATOM 27   H HB1  . ALA A 1 2   ? 469.775 30.172  -13.377 1.00 0.00 ? 2   ALA A HB1  1 
ATOM 28   H HB2  . ALA A 1 2   ? 471.033 29.188  -14.124 1.00 0.00 ? 2   ALA A HB2  1 
ATOM 29   H HB3  . ALA A 1 2   ? 470.934 30.912  -14.481 1.00 0.00 ? 2   ALA A HB3  1 
ATOM 30   N N    . GLY A 1 3   ? 470.146 32.134  -11.788 1.00 0.00 ? 3   GLY A N    1 
ATOM 31   C CA   . GLY A 1 3   ? 469.373 32.860  -10.798 1.00 0.00 ? 3   GLY A CA   1 
ATOM 32   C C    . GLY A 1 3   ? 468.149 32.093  -10.338 1.00 0.00 ? 3   GLY A C    1 
ATOM 33   O O    . GLY A 1 3   ? 467.019 32.532  -10.547 1.00 0.00 ? 3   GLY A O    1 
ATOM 34   H H    . GLY A 1 3   ? 470.069 32.368  -12.736 1.00 0.00 ? 3   GLY A H    1 
ATOM 35   H HA2  . GLY A 1 3   ? 470.002 33.060  -9.943  1.00 0.00 ? 3   GLY A HA2  1 
ATOM 36   H HA3  . GLY A 1 3   ? 469.056 33.800  -11.225 1.00 0.00 ? 3   GLY A HA3  1 
ATOM 37   N N    . ASN A 1 4   ? 468.375 30.944  -9.708  1.00 0.00 ? 4   ASN A N    1 
ATOM 38   C CA   . ASN A 1 4   ? 467.280 30.116  -9.216  1.00 0.00 ? 4   ASN A CA   1 
ATOM 39   C C    . ASN A 1 4   ? 467.789 29.071  -8.227  1.00 0.00 ? 4   ASN A C    1 
ATOM 40   O O    . ASN A 1 4   ? 467.234 28.914  -7.140  1.00 0.00 ? 4   ASN A O    1 
ATOM 41   C CB   . ASN A 1 4   ? 466.565 29.429  -10.382 1.00 0.00 ? 4   ASN A CB   1 
ATOM 42   C CG   . ASN A 1 4   ? 467.513 28.634  -11.257 1.00 0.00 ? 4   ASN A CG   1 
ATOM 43   O OD1  . ASN A 1 4   ? 468.336 29.201  -11.975 1.00 0.00 ? 4   ASN A OD1  1 
ATOM 44   N ND2  . ASN A 1 4   ? 467.402 27.312  -11.202 1.00 0.00 ? 4   ASN A ND2  1 
ATOM 45   H H    . ASN A 1 4   ? 469.298 30.648  -9.570  1.00 0.00 ? 4   ASN A H    1 
ATOM 46   H HA   . ASN A 1 4   ? 466.580 30.762  -8.708  1.00 0.00 ? 4   ASN A HA   1 
ATOM 47   H HB2  . ASN A 1 4   ? 465.817 28.756  -9.991  1.00 0.00 ? 4   ASN A HB2  1 
ATOM 48   H HB3  . ASN A 1 4   ? 466.084 30.179  -10.992 1.00 0.00 ? 4   ASN A HB3  1 
ATOM 49   H HD21 . ASN A 1 4   ? 466.723 26.929  -10.608 1.00 0.00 ? 4   ASN A HD21 1 
ATOM 50   H HD22 . ASN A 1 4   ? 468.003 26.773  -11.758 1.00 0.00 ? 4   ASN A HD22 1 
ATOM 51   N N    . PHE A 1 5   ? 468.847 28.361  -8.617  1.00 0.00 ? 5   PHE A N    1 
ATOM 52   C CA   . PHE A 1 5   ? 469.447 27.324  -7.777  1.00 0.00 ? 5   PHE A CA   1 
ATOM 53   C C    . PHE A 1 5   ? 468.394 26.353  -7.243  1.00 0.00 ? 5   PHE A C    1 
ATOM 54   O O    . PHE A 1 5   ? 467.195 26.541  -7.446  1.00 0.00 ? 5   PHE A O    1 
ATOM 55   C CB   . PHE A 1 5   ? 470.224 27.954  -6.615  1.00 0.00 ? 5   PHE A CB   1 
ATOM 56   C CG   . PHE A 1 5   ? 469.353 28.592  -5.569  1.00 0.00 ? 5   PHE A CG   1 
ATOM 57   C CD1  . PHE A 1 5   ? 468.696 27.815  -4.628  1.00 0.00 ? 5   PHE A CD1  1 
ATOM 58   C CD2  . PHE A 1 5   ? 469.190 29.967  -5.530  1.00 0.00 ? 5   PHE A CD2  1 
ATOM 59   C CE1  . PHE A 1 5   ? 467.894 28.400  -3.666  1.00 0.00 ? 5   PHE A CE1  1 
ATOM 60   C CE2  . PHE A 1 5   ? 468.389 30.557  -4.570  1.00 0.00 ? 5   PHE A CE2  1 
ATOM 61   C CZ   . PHE A 1 5   ? 467.740 29.772  -3.637  1.00 0.00 ? 5   PHE A CZ   1 
ATOM 62   H H    . PHE A 1 5   ? 469.239 28.540  -9.497  1.00 0.00 ? 5   PHE A H    1 
ATOM 63   H HA   . PHE A 1 5   ? 470.139 26.769  -8.392  1.00 0.00 ? 5   PHE A HA   1 
ATOM 64   H HB2  . PHE A 1 5   ? 470.814 27.190  -6.131  1.00 0.00 ? 5   PHE A HB2  1 
ATOM 65   H HB3  . PHE A 1 5   ? 470.884 28.715  -7.006  1.00 0.00 ? 5   PHE A HB3  1 
ATOM 66   H HD1  . PHE A 1 5   ? 468.816 26.742  -4.649  1.00 0.00 ? 5   PHE A HD1  1 
ATOM 67   H HD2  . PHE A 1 5   ? 469.697 30.581  -6.259  1.00 0.00 ? 5   PHE A HD2  1 
ATOM 68   H HE1  . PHE A 1 5   ? 467.387 27.784  -2.937  1.00 0.00 ? 5   PHE A HE1  1 
ATOM 69   H HE2  . PHE A 1 5   ? 468.271 31.630  -4.550  1.00 0.00 ? 5   PHE A HE2  1 
ATOM 70   H HZ   . PHE A 1 5   ? 467.114 30.231  -2.887  1.00 0.00 ? 5   PHE A HZ   1 
ATOM 71   N N    . ASP A 1 6   ? 468.856 25.310  -6.560  1.00 0.00 ? 6   ASP A N    1 
ATOM 72   C CA   . ASP A 1 6   ? 467.961 24.307  -5.995  1.00 0.00 ? 6   ASP A CA   1 
ATOM 73   C C    . ASP A 1 6   ? 468.633 23.569  -4.842  1.00 0.00 ? 6   ASP A C    1 
ATOM 74   O O    . ASP A 1 6   ? 469.693 23.975  -4.365  1.00 0.00 ? 6   ASP A O    1 
ATOM 75   C CB   . ASP A 1 6   ? 467.532 23.305  -7.069  1.00 0.00 ? 6   ASP A CB   1 
ATOM 76   C CG   . ASP A 1 6   ? 466.878 23.973  -8.263  1.00 0.00 ? 6   ASP A CG   1 
ATOM 77   O OD1  . ASP A 1 6   ? 467.612 24.511  -9.118  1.00 0.00 ? 6   ASP A OD1  1 
ATOM 78   O OD2  . ASP A 1 6   ? 465.632 23.959  -8.342  1.00 0.00 ? 6   ASP A OD2  1 
ATOM 79   H H    . ASP A 1 6   ? 469.823 25.213  -6.432  1.00 0.00 ? 6   ASP A H    1 
ATOM 80   H HA   . ASP A 1 6   ? 467.086 24.816  -5.620  1.00 0.00 ? 6   ASP A HA   1 
ATOM 81   H HB2  . ASP A 1 6   ? 468.400 22.764  -7.415  1.00 0.00 ? 6   ASP A HB2  1 
ATOM 82   H HB3  . ASP A 1 6   ? 466.828 22.608  -6.639  1.00 0.00 ? 6   ASP A HB3  1 
ATOM 83   N N    . SER A 1 7   ? 468.010 22.481  -4.402  1.00 0.00 ? 7   SER A N    1 
ATOM 84   C CA   . SER A 1 7   ? 468.544 21.683  -3.308  1.00 0.00 ? 7   SER A CA   1 
ATOM 85   C C    . SER A 1 7   ? 468.221 20.212  -3.503  1.00 0.00 ? 7   SER A C    1 
ATOM 86   O O    . SER A 1 7   ? 469.107 19.389  -3.733  1.00 0.00 ? 7   SER A O    1 
ATOM 87   C CB   . SER A 1 7   ? 467.956 22.144  -1.976  1.00 0.00 ? 7   SER A CB   1 
ATOM 88   O OG   . SER A 1 7   ? 468.932 22.792  -1.180  1.00 0.00 ? 7   SER A OG   1 
ATOM 89   H H    . SER A 1 7   ? 467.170 22.209  -4.824  1.00 0.00 ? 7   SER A H    1 
ATOM 90   H HA   . SER A 1 7   ? 469.615 21.811  -3.286  1.00 0.00 ? 7   SER A HA   1 
ATOM 91   H HB2  . SER A 1 7   ? 467.145 22.832  -2.166  1.00 0.00 ? 7   SER A HB2  1 
ATOM 92   H HB3  . SER A 1 7   ? 467.579 21.280  -1.436  1.00 0.00 ? 7   SER A HB3  1 
ATOM 93   H HG   . SER A 1 7   ? 469.186 23.619  -1.596  1.00 0.00 ? 7   SER A HG   1 
ATOM 94   N N    . GLU A 1 8   ? 466.940 19.892  -3.384  1.00 0.00 ? 8   GLU A N    1 
ATOM 95   C CA   . GLU A 1 8   ? 466.482 18.522  -3.518  1.00 0.00 ? 8   GLU A CA   1 
ATOM 96   C C    . GLU A 1 8   ? 465.276 18.428  -4.455  1.00 0.00 ? 8   GLU A C    1 
ATOM 97   O O    . GLU A 1 8   ? 465.446 18.236  -5.656  1.00 0.00 ? 8   GLU A O    1 
ATOM 98   C CB   . GLU A 1 8   ? 466.163 17.958  -2.130  1.00 0.00 ? 8   GLU A CB   1 
ATOM 99   C CG   . GLU A 1 8   ? 465.476 18.949  -1.199  1.00 0.00 ? 8   GLU A CG   1 
ATOM 100  C CD   . GLU A 1 8   ? 464.273 18.351  -0.495  1.00 0.00 ? 8   GLU A CD   1 
ATOM 101  O OE1  . GLU A 1 8   ? 463.373 17.836  -1.191  1.00 0.00 ? 8   GLU A OE1  1 
ATOM 102  O OE2  . GLU A 1 8   ? 464.232 18.399  0.752   1.00 0.00 ? 8   GLU A OE2  1 
ATOM 103  H H    . GLU A 1 8   ? 466.289 20.596  -3.183  1.00 0.00 ? 8   GLU A H    1 
ATOM 104  H HA   . GLU A 1 8   ? 467.290 17.949  -3.947  1.00 0.00 ? 8   GLU A HA   1 
ATOM 105  H HB2  . GLU A 1 8   ? 465.527 17.094  -2.237  1.00 0.00 ? 8   GLU A HB2  1 
ATOM 106  H HB3  . GLU A 1 8   ? 467.091 17.659  -1.664  1.00 0.00 ? 8   GLU A HB3  1 
ATOM 107  H HG2  . GLU A 1 8   ? 466.186 19.272  -0.453  1.00 0.00 ? 8   GLU A HG2  1 
ATOM 108  H HG3  . GLU A 1 8   ? 465.151 19.801  -1.778  1.00 0.00 ? 8   GLU A HG3  1 
ATOM 109  N N    . GLU A 1 9   ? 464.066 18.571  -3.905  1.00 0.00 ? 9   GLU A N    1 
ATOM 110  C CA   . GLU A 1 9   ? 462.825 18.505  -4.686  1.00 0.00 ? 9   GLU A CA   1 
ATOM 111  C C    . GLU A 1 9   ? 462.790 17.288  -5.611  1.00 0.00 ? 9   GLU A C    1 
ATOM 112  O O    . GLU A 1 9   ? 462.012 16.358  -5.394  1.00 0.00 ? 9   GLU A O    1 
ATOM 113  C CB   . GLU A 1 9   ? 462.599 19.793  -5.496  1.00 0.00 ? 9   GLU A CB   1 
ATOM 114  C CG   . GLU A 1 9   ? 463.867 20.446  -6.028  1.00 0.00 ? 9   GLU A CG   1 
ATOM 115  C CD   . GLU A 1 9   ? 463.602 21.800  -6.656  1.00 0.00 ? 9   GLU A CD   1 
ATOM 116  O OE1  . GLU A 1 9   ? 462.927 21.846  -7.705  1.00 0.00 ? 9   GLU A OE1  1 
ATOM 117  O OE2  . GLU A 1 9   ? 464.070 22.815  -6.098  1.00 0.00 ? 9   GLU A OE2  1 
ATOM 118  H H    . GLU A 1 9   ? 464.000 18.727  -2.944  1.00 0.00 ? 9   GLU A H    1 
ATOM 119  H HA   . GLU A 1 9   ? 462.014 18.406  -3.978  1.00 0.00 ? 9   GLU A HA   1 
ATOM 120  H HB2  . GLU A 1 9   ? 461.965 19.562  -6.339  1.00 0.00 ? 9   GLU A HB2  1 
ATOM 121  H HB3  . GLU A 1 9   ? 462.091 20.510  -4.867  1.00 0.00 ? 9   GLU A HB3  1 
ATOM 122  H HG2  . GLU A 1 9   ? 464.561 20.577  -5.213  1.00 0.00 ? 9   GLU A HG2  1 
ATOM 123  H HG3  . GLU A 1 9   ? 464.305 19.801  -6.776  1.00 0.00 ? 9   GLU A HG3  1 
ATOM 124  N N    . ARG A 1 10  ? 463.628 17.298  -6.639  1.00 0.00 ? 10  ARG A N    1 
ATOM 125  C CA   . ARG A 1 10  ? 463.686 16.199  -7.592  1.00 0.00 ? 10  ARG A CA   1 
ATOM 126  C C    . ARG A 1 10  ? 464.750 15.182  -7.188  1.00 0.00 ? 10  ARG A C    1 
ATOM 127  O O    . ARG A 1 10  ? 465.599 14.801  -7.993  1.00 0.00 ? 10  ARG A O    1 
ATOM 128  C CB   . ARG A 1 10  ? 463.973 16.739  -8.995  1.00 0.00 ? 10  ARG A CB   1 
ATOM 129  C CG   . ARG A 1 10  ? 465.347 17.380  -9.134  1.00 0.00 ? 10  ARG A CG   1 
ATOM 130  C CD   . ARG A 1 10  ? 465.248 18.834  -9.577  1.00 0.00 ? 10  ARG A CD   1 
ATOM 131  N NE   . ARG A 1 10  ? 465.877 19.053  -10.878 1.00 0.00 ? 10  ARG A NE   1 
ATOM 132  C CZ   . ARG A 1 10  ? 465.572 20.064  -11.690 1.00 0.00 ? 10  ARG A CZ   1 
ATOM 133  N NH1  . ARG A 1 10  ? 464.649 20.953  -11.341 1.00 0.00 ? 10  ARG A NH1  1 
ATOM 134  N NH2  . ARG A 1 10  ? 466.193 20.188  -12.854 1.00 0.00 ? 10  ARG A NH2  1 
ATOM 135  H H    . ARG A 1 10  ? 464.224 18.064  -6.761  1.00 0.00 ? 10  ARG A H    1 
ATOM 136  H HA   . ARG A 1 10  ? 462.723 15.712  -7.595  1.00 0.00 ? 10  ARG A HA   1 
ATOM 137  H HB2  . ARG A 1 10  ? 463.905 15.926  -9.702  1.00 0.00 ? 10  ARG A HB2  1 
ATOM 138  H HB3  . ARG A 1 10  ? 463.227 17.481  -9.238  1.00 0.00 ? 10  ARG A HB3  1 
ATOM 139  H HG2  . ARG A 1 10  ? 465.851 17.339  -8.180  1.00 0.00 ? 10  ARG A HG2  1 
ATOM 140  H HG3  . ARG A 1 10  ? 465.917 16.828  -9.868  1.00 0.00 ? 10  ARG A HG3  1 
ATOM 141  H HD2  . ARG A 1 10  ? 464.206 19.109  -9.641  1.00 0.00 ? 10  ARG A HD2  1 
ATOM 142  H HD3  . ARG A 1 10  ? 465.739 19.454  -8.841  1.00 0.00 ? 10  ARG A HD3  1 
ATOM 143  H HE   . ARG A 1 10  ? 466.563 18.414  -11.162 1.00 0.00 ? 10  ARG A HE   1 
ATOM 144  H HH11 . ARG A 1 10  ? 464.176 20.868  -10.464 1.00 0.00 ? 10  ARG A HH11 1 
ATOM 145  H HH12 . ARG A 1 10  ? 464.425 21.708  -11.957 1.00 0.00 ? 10  ARG A HH12 1 
ATOM 146  H HH21 . ARG A 1 10  ? 466.891 19.523  -13.122 1.00 0.00 ? 10  ARG A HH21 1 
ATOM 147  H HH22 . ARG A 1 10  ? 465.965 20.946  -13.465 1.00 0.00 ? 10  ARG A HH22 1 
ATOM 148  N N    . SER A 1 11  ? 464.693 14.745  -5.934  1.00 0.00 ? 11  SER A N    1 
ATOM 149  C CA   . SER A 1 11  ? 465.646 13.769  -5.419  1.00 0.00 ? 11  SER A CA   1 
ATOM 150  C C    . SER A 1 11  ? 464.973 12.418  -5.211  1.00 0.00 ? 11  SER A C    1 
ATOM 151  O O    . SER A 1 11  ? 465.204 11.472  -5.963  1.00 0.00 ? 11  SER A O    1 
ATOM 152  C CB   . SER A 1 11  ? 466.246 14.256  -4.099  1.00 0.00 ? 11  SER A CB   1 
ATOM 153  O OG   . SER A 1 11  ? 467.661 14.183  -4.123  1.00 0.00 ? 11  SER A OG   1 
ATOM 154  H H    . SER A 1 11  ? 463.990 15.085  -5.342  1.00 0.00 ? 11  SER A H    1 
ATOM 155  H HA   . SER A 1 11  ? 466.436 13.658  -6.147  1.00 0.00 ? 11  SER A HA   1 
ATOM 156  H HB2  . SER A 1 11  ? 465.954 15.282  -3.930  1.00 0.00 ? 11  SER A HB2  1 
ATOM 157  H HB3  . SER A 1 11  ? 465.879 13.639  -3.289  1.00 0.00 ? 11  SER A HB3  1 
ATOM 158  H HG   . SER A 1 11  ? 467.935 13.264  -4.107  1.00 0.00 ? 11  SER A HG   1 
ATOM 159  N N    . SER A 1 12  ? 464.139 12.340  -4.181  1.00 0.00 ? 12  SER A N    1 
ATOM 160  C CA   . SER A 1 12  ? 463.429 11.111  -3.863  1.00 0.00 ? 12  SER A CA   1 
ATOM 161  C C    . SER A 1 12  ? 462.190 11.412  -3.015  1.00 0.00 ? 12  SER A C    1 
ATOM 162  O O    . SER A 1 12  ? 461.556 12.454  -3.185  1.00 0.00 ? 12  SER A O    1 
ATOM 163  C CB   . SER A 1 12  ? 464.365 10.140  -3.135  1.00 0.00 ? 12  SER A CB   1 
ATOM 164  O OG   . SER A 1 12  ? 464.540 10.518  -1.781  1.00 0.00 ? 12  SER A OG   1 
ATOM 165  H H    . SER A 1 12  ? 463.999 13.130  -3.619  1.00 0.00 ? 12  SER A H    1 
ATOM 166  H HA   . SER A 1 12  ? 463.113 10.665  -4.793  1.00 0.00 ? 12  SER A HA   1 
ATOM 167  H HB2  . SER A 1 12  ? 463.944 9.146   -3.166  1.00 0.00 ? 12  SER A HB2  1 
ATOM 168  H HB3  . SER A 1 12  ? 465.328 10.138  -3.623  1.00 0.00 ? 12  SER A HB3  1 
ATOM 169  H HG   . SER A 1 12  ? 464.774 9.746   -1.260  1.00 0.00 ? 12  SER A HG   1 
ATOM 170  N N    . TRP A 1 13  ? 461.847 10.504  -2.105  1.00 0.00 ? 13  TRP A N    1 
ATOM 171  C CA   . TRP A 1 13  ? 460.686 10.689  -1.241  1.00 0.00 ? 13  TRP A CA   1 
ATOM 172  C C    . TRP A 1 13  ? 460.956 11.771  -0.200  1.00 0.00 ? 13  TRP A C    1 
ATOM 173  O O    . TRP A 1 13  ? 462.049 11.850  0.361   1.00 0.00 ? 13  TRP A O    1 
ATOM 174  C CB   . TRP A 1 13  ? 460.335 9.379   -0.539  1.00 0.00 ? 13  TRP A CB   1 
ATOM 175  C CG   . TRP A 1 13  ? 461.455 8.868   0.308   1.00 0.00 ? 13  TRP A CG   1 
ATOM 176  C CD1  . TRP A 1 13  ? 462.376 7.926   -0.040  1.00 0.00 ? 13  TRP A CD1  1 
ATOM 177  C CD2  . TRP A 1 13  ? 461.781 9.281   1.639   1.00 0.00 ? 13  TRP A CD2  1 
ATOM 178  N NE1  . TRP A 1 13  ? 463.258 7.725   0.992   1.00 0.00 ? 13  TRP A NE1  1 
ATOM 179  C CE2  . TRP A 1 13  ? 462.913 8.545   2.038   1.00 0.00 ? 13  TRP A CE2  1 
ATOM 180  C CE3  . TRP A 1 13  ? 461.225 10.202  2.534   1.00 0.00 ? 13  TRP A CE3  1 
ATOM 181  C CZ2  . TRP A 1 13  ? 463.499 8.703   3.293   1.00 0.00 ? 13  TRP A CZ2  1 
ATOM 182  C CZ3  . TRP A 1 13  ? 461.806 10.355  3.778   1.00 0.00 ? 13  TRP A CZ3  1 
ATOM 183  C CH2  . TRP A 1 13  ? 462.932 9.610   4.148   1.00 0.00 ? 13  TRP A CH2  1 
ATOM 184  H H    . TRP A 1 13  ? 462.387 9.694   -2.009  1.00 0.00 ? 13  TRP A H    1 
ATOM 185  H HA   . TRP A 1 13  ? 459.855 10.994  -1.858  1.00 0.00 ? 13  TRP A HA   1 
ATOM 186  H HB2  . TRP A 1 13  ? 459.473 9.532   0.096   1.00 0.00 ? 13  TRP A HB2  1 
ATOM 187  H HB3  . TRP A 1 13  ? 460.102 8.628   -1.280  1.00 0.00 ? 13  TRP A HB3  1 
ATOM 188  H HD1  . TRP A 1 13  ? 462.396 7.420   -0.994  1.00 0.00 ? 13  TRP A HD1  1 
ATOM 189  H HE1  . TRP A 1 13  ? 464.010 7.098   0.981   1.00 0.00 ? 13  TRP A HE1  1 
ATOM 190  H HE3  . TRP A 1 13  ? 460.356 10.786  2.269   1.00 0.00 ? 13  TRP A HE3  1 
ATOM 191  H HZ2  . TRP A 1 13  ? 464.370 8.137   3.593   1.00 0.00 ? 13  TRP A HZ2  1 
ATOM 192  H HZ3  . TRP A 1 13  ? 461.388 11.060  4.482   1.00 0.00 ? 13  TRP A HZ3  1 
ATOM 193  H HH2  . TRP A 1 13  ? 463.347 9.759   5.134   1.00 0.00 ? 13  TRP A HH2  1 
ATOM 194  N N    . TYR A 1 14  ? 459.949 12.596  0.051   1.00 0.00 ? 14  TYR A N    1 
ATOM 195  C CA   . TYR A 1 14  ? 460.053 13.681  1.023   1.00 0.00 ? 14  TYR A CA   1 
ATOM 196  C C    . TYR A 1 14  ? 458.772 14.502  1.023   1.00 0.00 ? 14  TYR A C    1 
ATOM 197  O O    . TYR A 1 14  ? 458.344 15.006  2.059   1.00 0.00 ? 14  TYR A O    1 
ATOM 198  C CB   . TYR A 1 14  ? 461.248 14.579  0.710   1.00 0.00 ? 14  TYR A CB   1 
ATOM 199  C CG   . TYR A 1 14  ? 461.964 15.091  1.940   1.00 0.00 ? 14  TYR A CG   1 
ATOM 200  C CD1  . TYR A 1 14  ? 461.362 16.015  2.784   1.00 0.00 ? 14  TYR A CD1  1 
ATOM 201  C CD2  . TYR A 1 14  ? 463.243 14.650  2.256   1.00 0.00 ? 14  TYR A CD2  1 
ATOM 202  C CE1  . TYR A 1 14  ? 462.014 16.486  3.908   1.00 0.00 ? 14  TYR A CE1  1 
ATOM 203  C CE2  . TYR A 1 14  ? 463.902 15.116  3.378   1.00 0.00 ? 14  TYR A CE2  1 
ATOM 204  C CZ   . TYR A 1 14  ? 463.283 16.033  4.200   1.00 0.00 ? 14  TYR A CZ   1 
ATOM 205  O OH   . TYR A 1 14  ? 463.936 16.500  5.318   1.00 0.00 ? 14  TYR A OH   1 
ATOM 206  H H    . TYR A 1 14  ? 459.105 12.471  -0.431  1.00 0.00 ? 14  TYR A H    1 
ATOM 207  H HA   . TYR A 1 14  ? 460.186 13.240  2.000   1.00 0.00 ? 14  TYR A HA   1 
ATOM 208  H HB2  . TYR A 1 14  ? 461.960 14.024  0.122   1.00 0.00 ? 14  TYR A HB2  1 
ATOM 209  H HB3  . TYR A 1 14  ? 460.907 15.432  0.145   1.00 0.00 ? 14  TYR A HB3  1 
ATOM 210  H HD1  . TYR A 1 14  ? 460.367 16.368  2.553   1.00 0.00 ? 14  TYR A HD1  1 
ATOM 211  H HD2  . TYR A 1 14  ? 463.725 13.932  1.609   1.00 0.00 ? 14  TYR A HD2  1 
ATOM 212  H HE1  . TYR A 1 14  ? 461.529 17.205  4.552   1.00 0.00 ? 14  TYR A HE1  1 
ATOM 213  H HE2  . TYR A 1 14  ? 464.896 14.761  3.606   1.00 0.00 ? 14  TYR A HE2  1 
ATOM 214  H HH   . TYR A 1 14  ? 464.298 17.370  5.138   1.00 0.00 ? 14  TYR A HH   1 
ATOM 215  N N    . TRP A 1 15  ? 458.157 14.615  -0.149  1.00 0.00 ? 15  TRP A N    1 
ATOM 216  C CA   . TRP A 1 15  ? 456.908 15.350  -0.291  1.00 0.00 ? 15  TRP A CA   1 
ATOM 217  C C    . TRP A 1 15  ? 457.047 16.805  0.130   1.00 0.00 ? 15  TRP A C    1 
ATOM 218  O O    . TRP A 1 15  ? 458.003 17.184  0.808   1.00 0.00 ? 15  TRP A O    1 
ATOM 219  C CB   . TRP A 1 15  ? 455.829 14.685  0.553   1.00 0.00 ? 15  TRP A CB   1 
ATOM 220  C CG   . TRP A 1 15  ? 455.316 13.416  -0.036  1.00 0.00 ? 15  TRP A CG   1 
ATOM 221  C CD1  . TRP A 1 15  ? 455.731 12.147  0.245   1.00 0.00 ? 15  TRP A CD1  1 
ATOM 222  C CD2  . TRP A 1 15  ? 454.288 13.297  -1.013  1.00 0.00 ? 15  TRP A CD2  1 
ATOM 223  N NE1  . TRP A 1 15  ? 455.010 11.243  -0.497  1.00 0.00 ? 15  TRP A NE1  1 
ATOM 224  C CE2  . TRP A 1 15  ? 454.115 11.928  -1.276  1.00 0.00 ? 15  TRP A CE2  1 
ATOM 225  C CE3  . TRP A 1 15  ? 453.493 14.221  -1.686  1.00 0.00 ? 15  TRP A CE3  1 
ATOM 226  C CZ2  . TRP A 1 15  ? 453.174 11.464  -2.187  1.00 0.00 ? 15  TRP A CZ2  1 
ATOM 227  C CZ3  . TRP A 1 15  ? 452.563 13.759  -2.590  1.00 0.00 ? 15  TRP A CZ3  1 
ATOM 228  C CH2  . TRP A 1 15  ? 452.407 12.393  -2.833  1.00 0.00 ? 15  TRP A CH2  1 
ATOM 229  H H    . TRP A 1 15  ? 458.544 14.180  -0.936  1.00 0.00 ? 15  TRP A H    1 
ATOM 230  H HA   . TRP A 1 15  ? 456.613 15.311  -1.328  1.00 0.00 ? 15  TRP A HA   1 
ATOM 231  H HB2  . TRP A 1 15  ? 456.233 14.460  1.526   1.00 0.00 ? 15  TRP A HB2  1 
ATOM 232  H HB3  . TRP A 1 15  ? 454.997 15.365  0.662   1.00 0.00 ? 15  TRP A HB3  1 
ATOM 233  H HD1  . TRP A 1 15  ? 456.512 11.903  0.949   1.00 0.00 ? 15  TRP A HD1  1 
ATOM 234  H HE1  . TRP A 1 15  ? 455.117 10.269  -0.471  1.00 0.00 ? 15  TRP A HE1  1 
ATOM 235  H HE3  . TRP A 1 15  ? 453.600 15.281  -1.512  1.00 0.00 ? 15  TRP A HE3  1 
ATOM 236  H HZ2  . TRP A 1 15  ? 453.038 10.413  -2.383  1.00 0.00 ? 15  TRP A HZ2  1 
ATOM 237  H HZ3  . TRP A 1 15  ? 451.943 14.456  -3.121  1.00 0.00 ? 15  TRP A HZ3  1 
ATOM 238  H HH2  . TRP A 1 15  ? 451.665 12.078  -3.551  1.00 0.00 ? 15  TRP A HH2  1 
ATOM 239  N N    . GLY A 1 16  ? 456.070 17.613  -0.270  1.00 0.00 ? 16  GLY A N    1 
ATOM 240  C CA   . GLY A 1 16  ? 456.074 19.017  0.078   1.00 0.00 ? 16  GLY A CA   1 
ATOM 241  C C    . GLY A 1 16  ? 455.114 19.322  1.207   1.00 0.00 ? 16  GLY A C    1 
ATOM 242  O O    . GLY A 1 16  ? 454.313 18.470  1.590   1.00 0.00 ? 16  GLY A O    1 
ATOM 243  H H    . GLY A 1 16  ? 455.333 17.247  -0.803  1.00 0.00 ? 16  GLY A H    1 
ATOM 244  H HA2  . GLY A 1 16  ? 457.070 19.299  0.379   1.00 0.00 ? 16  GLY A HA2  1 
ATOM 245  H HA3  . GLY A 1 16  ? 455.791 19.595  -0.789  1.00 0.00 ? 16  GLY A HA3  1 
ATOM 246  N N    . ARG A 1 17  ? 455.198 20.531  1.748   1.00 0.00 ? 17  ARG A N    1 
ATOM 247  C CA   . ARG A 1 17  ? 454.331 20.938  2.849   1.00 0.00 ? 17  ARG A CA   1 
ATOM 248  C C    . ARG A 1 17  ? 452.857 20.758  2.492   1.00 0.00 ? 17  ARG A C    1 
ATOM 249  O O    . ARG A 1 17  ? 452.204 21.690  2.024   1.00 0.00 ? 17  ARG A O    1 
ATOM 250  C CB   . ARG A 1 17  ? 454.601 22.398  3.225   1.00 0.00 ? 17  ARG A CB   1 
ATOM 251  C CG   . ARG A 1 17  ? 455.525 22.556  4.423   1.00 0.00 ? 17  ARG A CG   1 
ATOM 252  C CD   . ARG A 1 17  ? 454.830 23.258  5.580   1.00 0.00 ? 17  ARG A CD   1 
ATOM 253  N NE   . ARG A 1 17  ? 455.784 23.897  6.484   1.00 0.00 ? 17  ARG A NE   1 
ATOM 254  C CZ   . ARG A 1 17  ? 455.589 24.044  7.794   1.00 0.00 ? 17  ARG A CZ   1 
ATOM 255  N NH1  . ARG A 1 17  ? 454.471 23.608  8.363   1.00 0.00 ? 17  ARG A NH1  1 
ATOM 256  N NH2  . ARG A 1 17  ? 456.515 24.633  8.538   1.00 0.00 ? 17  ARG A NH2  1 
ATOM 257  H H    . ARG A 1 17  ? 455.864 21.163  1.405   1.00 0.00 ? 17  ARG A H    1 
ATOM 258  H HA   . ARG A 1 17  ? 454.561 20.312  3.698   1.00 0.00 ? 17  ARG A HA   1 
ATOM 259  H HB2  . ARG A 1 17  ? 455.054 22.897  2.380   1.00 0.00 ? 17  ARG A HB2  1 
ATOM 260  H HB3  . ARG A 1 17  ? 453.662 22.879  3.455   1.00 0.00 ? 17  ARG A HB3  1 
ATOM 261  H HG2  . ARG A 1 17  ? 455.846 21.579  4.750   1.00 0.00 ? 17  ARG A HG2  1 
ATOM 262  H HG3  . ARG A 1 17  ? 456.386 23.138  4.126   1.00 0.00 ? 17  ARG A HG3  1 
ATOM 263  H HD2  . ARG A 1 17  ? 454.166 24.011  5.181   1.00 0.00 ? 17  ARG A HD2  1 
ATOM 264  H HD3  . ARG A 1 17  ? 454.256 22.529  6.130   1.00 0.00 ? 17  ARG A HD3  1 
ATOM 265  H HE   . ARG A 1 17  ? 456.618 24.234  6.094   1.00 0.00 ? 17  ARG A HE   1 
ATOM 266  H HH11 . ARG A 1 17  ? 453.765 23.166  7.811   1.00 0.00 ? 17  ARG A HH11 1 
ATOM 267  H HH12 . ARG A 1 17  ? 454.335 23.721  9.347   1.00 0.00 ? 17  ARG A HH12 1 
ATOM 268  H HH21 . ARG A 1 17  ? 457.358 24.966  8.116   1.00 0.00 ? 17  ARG A HH21 1 
ATOM 269  H HH22 . ARG A 1 17  ? 456.371 24.744  9.521   1.00 0.00 ? 17  ARG A HH22 1 
ATOM 270  N N    . LEU A 1 18  ? 452.337 19.557  2.730   1.00 0.00 ? 18  LEU A N    1 
ATOM 271  C CA   . LEU A 1 18  ? 450.937 19.261  2.447   1.00 0.00 ? 18  LEU A CA   1 
ATOM 272  C C    . LEU A 1 18  ? 450.039 20.036  3.408   1.00 0.00 ? 18  LEU A C    1 
ATOM 273  O O    . LEU A 1 18  ? 450.033 19.772  4.611   1.00 0.00 ? 18  LEU A O    1 
ATOM 274  C CB   . LEU A 1 18  ? 450.668 17.752  2.579   1.00 0.00 ? 18  LEU A CB   1 
ATOM 275  C CG   . LEU A 1 18  ? 450.860 16.887  1.313   1.00 0.00 ? 18  LEU A CG   1 
ATOM 276  C CD1  . LEU A 1 18  ? 451.167 17.721  0.078   1.00 0.00 ? 18  LEU A CD1  1 
ATOM 277  C CD2  . LEU A 1 18  ? 451.954 15.853  1.529   1.00 0.00 ? 18  LEU A CD2  1 
ATOM 278  H H    . LEU A 1 18  ? 452.905 18.857  3.113   1.00 0.00 ? 18  LEU A H    1 
ATOM 279  H HA   . LEU A 1 18  ? 450.721 19.579  1.440   1.00 0.00 ? 18  LEU A HA   1 
ATOM 280  H HB2  . LEU A 1 18  ? 451.321 17.365  3.347   1.00 0.00 ? 18  LEU A HB2  1 
ATOM 281  H HB3  . LEU A 1 18  ? 449.649 17.627  2.913   1.00 0.00 ? 18  LEU A HB3  1 
ATOM 282  H HG   . LEU A 1 18  ? 449.944 16.351  1.120   1.00 0.00 ? 18  LEU A HG   1 
ATOM 283  H HD11 . LEU A 1 18  ? 452.140 18.182  0.184   1.00 0.00 ? 18  LEU A HD11 1 
ATOM 284  H HD12 . LEU A 1 18  ? 450.414 18.485  -0.039  1.00 0.00 ? 18  LEU A HD12 1 
ATOM 285  H HD13 . LEU A 1 18  ? 451.163 17.081  -0.793  1.00 0.00 ? 18  LEU A HD13 1 
ATOM 286  H HD21 . LEU A 1 18  ? 451.687 14.936  1.019   1.00 0.00 ? 18  LEU A HD21 1 
ATOM 287  H HD22 . LEU A 1 18  ? 452.064 15.659  2.586   1.00 0.00 ? 18  LEU A HD22 1 
ATOM 288  H HD23 . LEU A 1 18  ? 452.887 16.227  1.132   1.00 0.00 ? 18  LEU A HD23 1 
ATOM 289  N N    . SER A 1 19  ? 449.295 21.001  2.871   1.00 0.00 ? 19  SER A N    1 
ATOM 290  C CA   . SER A 1 19  ? 448.399 21.835  3.675   1.00 0.00 ? 19  SER A CA   1 
ATOM 291  C C    . SER A 1 19  ? 447.679 21.022  4.750   1.00 0.00 ? 19  SER A C    1 
ATOM 292  O O    . SER A 1 19  ? 447.904 21.222  5.943   1.00 0.00 ? 19  SER A O    1 
ATOM 293  C CB   . SER A 1 19  ? 447.375 22.533  2.779   1.00 0.00 ? 19  SER A CB   1 
ATOM 294  O OG   . SER A 1 19  ? 446.770 23.624  3.451   1.00 0.00 ? 19  SER A OG   1 
ATOM 295  H H    . SER A 1 19  ? 449.356 21.166  1.907   1.00 0.00 ? 19  SER A H    1 
ATOM 296  H HA   . SER A 1 19  ? 449.002 22.586  4.162   1.00 0.00 ? 19  SER A HA   1 
ATOM 297  H HB2  . SER A 1 19  ? 447.869 22.903  1.893   1.00 0.00 ? 19  SER A HB2  1 
ATOM 298  H HB3  . SER A 1 19  ? 446.606 21.830  2.496   1.00 0.00 ? 19  SER A HB3  1 
ATOM 299  H HG   . SER A 1 19  ? 446.435 23.330  4.301   1.00 0.00 ? 19  SER A HG   1 
ATOM 300  N N    . ARG A 1 20  ? 446.814 20.107  4.325   1.00 0.00 ? 20  ARG A N    1 
ATOM 301  C CA   . ARG A 1 20  ? 446.072 19.275  5.266   1.00 0.00 ? 20  ARG A CA   1 
ATOM 302  C C    . ARG A 1 20  ? 445.333 18.155  4.554   1.00 0.00 ? 20  ARG A C    1 
ATOM 303  O O    . ARG A 1 20  ? 445.326 17.019  5.026   1.00 0.00 ? 20  ARG A O    1 
ATOM 304  C CB   . ARG A 1 20  ? 445.089 20.123  6.077   1.00 0.00 ? 20  ARG A CB   1 
ATOM 305  C CG   . ARG A 1 20  ? 444.419 21.227  5.270   1.00 0.00 ? 20  ARG A CG   1 
ATOM 306  C CD   . ARG A 1 20  ? 442.902 21.128  5.326   1.00 0.00 ? 20  ARG A CD   1 
ATOM 307  N NE   . ARG A 1 20  ? 442.303 21.149  3.994   1.00 0.00 ? 20  ARG A NE   1 
ATOM 308  C CZ   . ARG A 1 20  ? 442.372 22.189  3.165   1.00 0.00 ? 20  ARG A CZ   1 
ATOM 309  N NH1  . ARG A 1 20  ? 443.005 23.297  3.530   1.00 0.00 ? 20  ARG A NH1  1 
ATOM 310  N NH2  . ARG A 1 20  ? 441.804 22.121  1.969   1.00 0.00 ? 20  ARG A NH2  1 
ATOM 311  H H    . ARG A 1 20  ? 446.673 19.988  3.362   1.00 0.00 ? 20  ARG A H    1 
ATOM 312  H HA   . ARG A 1 20  ? 446.786 18.825  5.939   1.00 0.00 ? 20  ARG A HA   1 
ATOM 313  H HB2  . ARG A 1 20  ? 444.320 19.477  6.474   1.00 0.00 ? 20  ARG A HB2  1 
ATOM 314  H HB3  . ARG A 1 20  ? 445.621 20.580  6.899   1.00 0.00 ? 20  ARG A HB3  1 
ATOM 315  H HG2  . ARG A 1 20  ? 444.721 22.183  5.669   1.00 0.00 ? 20  ARG A HG2  1 
ATOM 316  H HG3  . ARG A 1 20  ? 444.737 21.149  4.240   1.00 0.00 ? 20  ARG A HG3  1 
ATOM 317  H HD2  . ARG A 1 20  ? 442.629 20.206  5.817   1.00 0.00 ? 20  ARG A HD2  1 
ATOM 318  H HD3  . ARG A 1 20  ? 442.521 21.964  5.895   1.00 0.00 ? 20  ARG A HD3  1 
ATOM 319  H HE   . ARG A 1 20  ? 441.826 20.344  3.699   1.00 0.00 ? 20  ARG A HE   1 
ATOM 320  H HH11 . ARG A 1 20  ? 443.434 23.355  4.432   1.00 0.00 ? 20  ARG A HH11 1 
ATOM 321  H HH12 . ARG A 1 20  ? 443.053 24.074  2.903   1.00 0.00 ? 20  ARG A HH12 1 
ATOM 322  H HH21 . ARG A 1 20  ? 441.325 21.289  1.689   1.00 0.00 ? 20  ARG A HH21 1 
ATOM 323  H HH22 . ARG A 1 20  ? 441.855 22.901  1.346   1.00 0.00 ? 20  ARG A HH22 1 
ATOM 324  N N    . GLN A 1 21  ? 444.720 18.459  3.416   1.00 0.00 ? 21  GLN A N    1 
ATOM 325  C CA   . GLN A 1 21  ? 444.002 17.447  2.662   1.00 0.00 ? 21  GLN A CA   1 
ATOM 326  C C    . GLN A 1 21  ? 444.980 16.638  1.822   1.00 0.00 ? 21  GLN A C    1 
ATOM 327  O O    . GLN A 1 21  ? 444.846 15.431  1.680   1.00 0.00 ? 21  GLN A O    1 
ATOM 328  C CB   . GLN A 1 21  ? 442.952 18.099  1.760   1.00 0.00 ? 21  GLN A CB   1 
ATOM 329  C CG   . GLN A 1 21  ? 441.757 17.204  1.474   1.00 0.00 ? 21  GLN A CG   1 
ATOM 330  C CD   . GLN A 1 21  ? 440.540 17.575  2.300   1.00 0.00 ? 21  GLN A CD   1 
ATOM 331  O OE1  . GLN A 1 21  ? 440.620 17.702  3.522   1.00 0.00 ? 21  GLN A OE1  1 
ATOM 332  N NE2  . GLN A 1 21  ? 439.404 17.751  1.635   1.00 0.00 ? 21  GLN A NE2  1 
ATOM 333  H H    . GLN A 1 21  ? 444.752 19.369  3.055   1.00 0.00 ? 21  GLN A H    1 
ATOM 334  H HA   . GLN A 1 21  ? 443.510 16.794  3.363   1.00 0.00 ? 21  GLN A HA   1 
ATOM 335  H HB2  . GLN A 1 21  ? 442.595 19.000  2.235   1.00 0.00 ? 21  GLN A HB2  1 
ATOM 336  H HB3  . GLN A 1 21  ? 443.413 18.357  0.818   1.00 0.00 ? 21  GLN A HB3  1 
ATOM 337  H HG2  . GLN A 1 21  ? 441.502 17.288  0.429   1.00 0.00 ? 21  GLN A HG2  1 
ATOM 338  H HG3  . GLN A 1 21  ? 442.027 16.182  1.698   1.00 0.00 ? 21  GLN A HG3  1 
ATOM 339  H HE21 . GLN A 1 21  ? 439.413 17.633  0.662   1.00 0.00 ? 21  GLN A HE21 1 
ATOM 340  H HE22 . GLN A 1 21  ? 438.602 17.992  2.144   1.00 0.00 ? 21  GLN A HE22 1 
ATOM 341  N N    . GLU A 1 22  ? 445.962 17.329  1.260   1.00 0.00 ? 22  GLU A N    1 
ATOM 342  C CA   . GLU A 1 22  ? 446.977 16.710  0.417   1.00 0.00 ? 22  GLU A CA   1 
ATOM 343  C C    . GLU A 1 22  ? 447.516 15.408  1.010   1.00 0.00 ? 22  GLU A C    1 
ATOM 344  O O    . GLU A 1 22  ? 447.422 14.345  0.397   1.00 0.00 ? 22  GLU A O    1 
ATOM 345  C CB   . GLU A 1 22  ? 448.128 17.692  0.220   1.00 0.00 ? 22  GLU A CB   1 
ATOM 346  C CG   . GLU A 1 22  ? 447.701 19.019  -0.386  1.00 0.00 ? 22  GLU A CG   1 
ATOM 347  C CD   . GLU A 1 22  ? 447.500 20.098  0.658   1.00 0.00 ? 22  GLU A CD   1 
ATOM 348  O OE1  . GLU A 1 22  ? 446.937 19.789  1.729   1.00 0.00 ? 22  GLU A OE1  1 
ATOM 349  O OE2  . GLU A 1 22  ? 447.906 21.251  0.405   1.00 0.00 ? 22  GLU A OE2  1 
ATOM 350  H H    . GLU A 1 22  ? 446.003 18.296  1.401   1.00 0.00 ? 22  GLU A H    1 
ATOM 351  H HA   . GLU A 1 22  ? 446.535 16.502  -0.545  1.00 0.00 ? 22  GLU A HA   1 
ATOM 352  H HB2  . GLU A 1 22  ? 448.585 17.889  1.179   1.00 0.00 ? 22  GLU A HB2  1 
ATOM 353  H HB3  . GLU A 1 22  ? 448.860 17.241  -0.432  1.00 0.00 ? 22  GLU A HB3  1 
ATOM 354  H HG2  . GLU A 1 22  ? 448.462 19.347  -1.077  1.00 0.00 ? 22  GLU A HG2  1 
ATOM 355  H HG3  . GLU A 1 22  ? 446.771 18.875  -0.916  1.00 0.00 ? 22  GLU A HG3  1 
ATOM 356  N N    . ALA A 1 23  ? 448.111 15.515  2.190   1.00 0.00 ? 23  ALA A N    1 
ATOM 357  C CA   . ALA A 1 23  ? 448.713 14.372  2.870   1.00 0.00 ? 23  ALA A CA   1 
ATOM 358  C C    . ALA A 1 23  ? 447.703 13.299  3.260   1.00 0.00 ? 23  ALA A C    1 
ATOM 359  O O    . ALA A 1 23  ? 448.078 12.152  3.503   1.00 0.00 ? 23  ALA A O    1 
ATOM 360  C CB   . ALA A 1 23  ? 449.448 14.852  4.100   1.00 0.00 ? 23  ALA A CB   1 
ATOM 361  H H    . ALA A 1 23  ? 448.171 16.399  2.609   1.00 0.00 ? 23  ALA A H    1 
ATOM 362  H HA   . ALA A 1 23  ? 449.441 13.937  2.203   1.00 0.00 ? 23  ALA A HA   1 
ATOM 363  H HB1  . ALA A 1 23  ? 450.359 15.348  3.802   1.00 0.00 ? 23  ALA A HB1  1 
ATOM 364  H HB2  . ALA A 1 23  ? 449.683 14.005  4.730   1.00 0.00 ? 23  ALA A HB2  1 
ATOM 365  H HB3  . ALA A 1 23  ? 448.819 15.544  4.642   1.00 0.00 ? 23  ALA A HB3  1 
ATOM 366  N N    . VAL A 1 24  ? 446.430 13.657  3.308   1.00 0.00 ? 24  VAL A N    1 
ATOM 367  C CA   . VAL A 1 24  ? 445.398 12.692  3.656   1.00 0.00 ? 24  VAL A CA   1 
ATOM 368  C C    . VAL A 1 24  ? 444.674 12.187  2.409   1.00 0.00 ? 24  VAL A C    1 
ATOM 369  O O    . VAL A 1 24  ? 444.489 10.985  2.224   1.00 0.00 ? 24  VAL A O    1 
ATOM 370  C CB   . VAL A 1 24  ? 444.378 13.280  4.650   1.00 0.00 ? 24  VAL A CB   1 
ATOM 371  C CG1  . VAL A 1 24  ? 443.804 14.586  4.132   1.00 0.00 ? 24  VAL A CG1  1 
ATOM 372  C CG2  . VAL A 1 24  ? 443.271 12.279  4.934   1.00 0.00 ? 24  VAL A CG2  1 
ATOM 373  H H    . VAL A 1 24  ? 446.180 14.575  3.076   1.00 0.00 ? 24  VAL A H    1 
ATOM 374  H HA   . VAL A 1 24  ? 445.886 11.855  4.135   1.00 0.00 ? 24  VAL A HA   1 
ATOM 375  H HB   . VAL A 1 24  ? 444.890 13.486  5.577   1.00 0.00 ? 24  VAL A HB   1 
ATOM 376  H HG11 . VAL A 1 24  ? 443.172 15.026  4.889   1.00 0.00 ? 24  VAL A HG11 1 
ATOM 377  H HG12 . VAL A 1 24  ? 443.221 14.396  3.244   1.00 0.00 ? 24  VAL A HG12 1 
ATOM 378  H HG13 . VAL A 1 24  ? 444.610 15.266  3.897   1.00 0.00 ? 24  VAL A HG13 1 
ATOM 379  H HG21 . VAL A 1 24  ? 442.403 12.527  4.343   1.00 0.00 ? 24  VAL A HG21 1 
ATOM 380  H HG22 . VAL A 1 24  ? 443.015 12.312  5.982   1.00 0.00 ? 24  VAL A HG22 1 
ATOM 381  H HG23 . VAL A 1 24  ? 443.611 11.286  4.676   1.00 0.00 ? 24  VAL A HG23 1 
ATOM 382  N N    . ALA A 1 25  ? 444.266 13.126  1.567   1.00 0.00 ? 25  ALA A N    1 
ATOM 383  C CA   . ALA A 1 25  ? 443.552 12.824  0.332   1.00 0.00 ? 25  ALA A CA   1 
ATOM 384  C C    . ALA A 1 25  ? 444.412 12.030  -0.643  1.00 0.00 ? 25  ALA A C    1 
ATOM 385  O O    . ALA A 1 25  ? 443.951 11.064  -1.252  1.00 0.00 ? 25  ALA A O    1 
ATOM 386  C CB   . ALA A 1 25  ? 443.101 14.121  -0.320  1.00 0.00 ? 25  ALA A CB   1 
ATOM 387  H H    . ALA A 1 25  ? 444.448 14.061  1.785   1.00 0.00 ? 25  ALA A H    1 
ATOM 388  H HA   . ALA A 1 25  ? 442.674 12.250  0.581   1.00 0.00 ? 25  ALA A HA   1 
ATOM 389  H HB1  . ALA A 1 25  ? 442.375 13.905  -1.090  1.00 0.00 ? 25  ALA A HB1  1 
ATOM 390  H HB2  . ALA A 1 25  ? 443.956 14.619  -0.760  1.00 0.00 ? 25  ALA A HB2  1 
ATOM 391  H HB3  . ALA A 1 25  ? 442.656 14.763  0.426   1.00 0.00 ? 25  ALA A HB3  1 
ATOM 392  N N    . LEU A 1 26  ? 445.654 12.460  -0.803  1.00 0.00 ? 26  LEU A N    1 
ATOM 393  C CA   . LEU A 1 26  ? 446.578 11.814  -1.723  1.00 0.00 ? 26  LEU A CA   1 
ATOM 394  C C    . LEU A 1 26  ? 446.964 10.409  -1.260  1.00 0.00 ? 26  LEU A C    1 
ATOM 395  O O    . LEU A 1 26  ? 447.339 9.566   -2.073  1.00 0.00 ? 26  LEU A O    1 
ATOM 396  C CB   . LEU A 1 26  ? 447.814 12.697  -1.916  1.00 0.00 ? 26  LEU A CB   1 
ATOM 397  C CG   . LEU A 1 26  ? 449.007 12.393  -1.018  1.00 0.00 ? 26  LEU A CG   1 
ATOM 398  C CD1  . LEU A 1 26  ? 449.883 11.343  -1.670  1.00 0.00 ? 26  LEU A CD1  1 
ATOM 399  C CD2  . LEU A 1 26  ? 449.792 13.672  -0.744  1.00 0.00 ? 26  LEU A CD2  1 
ATOM 400  H H    . LEU A 1 26  ? 445.953 13.246  -0.299  1.00 0.00 ? 26  LEU A H    1 
ATOM 401  H HA   . LEU A 1 26  ? 446.080 11.726  -2.673  1.00 0.00 ? 26  LEU A HA   1 
ATOM 402  H HB2  . LEU A 1 26  ? 448.137 12.600  -2.940  1.00 0.00 ? 26  LEU A HB2  1 
ATOM 403  H HB3  . LEU A 1 26  ? 447.522 13.723  -1.748  1.00 0.00 ? 26  LEU A HB3  1 
ATOM 404  H HG   . LEU A 1 26  ? 448.659 11.996  -0.076  1.00 0.00 ? 26  LEU A HG   1 
ATOM 405  H HD11 . LEU A 1 26  ? 450.861 11.353  -1.213  1.00 0.00 ? 26  LEU A HD11 1 
ATOM 406  H HD12 . LEU A 1 26  ? 449.972 11.558  -2.724  1.00 0.00 ? 26  LEU A HD12 1 
ATOM 407  H HD13 . LEU A 1 26  ? 449.432 10.371  -1.539  1.00 0.00 ? 26  LEU A HD13 1 
ATOM 408  H HD21 . LEU A 1 26  ? 450.844 13.490  -0.896  1.00 0.00 ? 26  LEU A HD21 1 
ATOM 409  H HD22 . LEU A 1 26  ? 449.627 13.987  0.277   1.00 0.00 ? 26  LEU A HD22 1 
ATOM 410  H HD23 . LEU A 1 26  ? 449.457 14.451  -1.420  1.00 0.00 ? 26  LEU A HD23 1 
ATOM 411  N N    . LEU A 1 27  ? 446.879 10.157  0.041   1.00 0.00 ? 27  LEU A N    1 
ATOM 412  C CA   . LEU A 1 27  ? 447.233 8.846   0.581   1.00 0.00 ? 27  LEU A CA   1 
ATOM 413  C C    . LEU A 1 27  ? 446.006 7.981   0.876   1.00 0.00 ? 27  LEU A C    1 
ATOM 414  O O    . LEU A 1 27  ? 446.138 6.833   1.291   1.00 0.00 ? 27  LEU A O    1 
ATOM 415  C CB   . LEU A 1 27  ? 448.053 9.010   1.858   1.00 0.00 ? 27  LEU A CB   1 
ATOM 416  C CG   . LEU A 1 27  ? 449.065 7.894   2.163   1.00 0.00 ? 27  LEU A CG   1 
ATOM 417  C CD1  . LEU A 1 27  ? 449.122 6.845   1.058   1.00 0.00 ? 27  LEU A CD1  1 
ATOM 418  C CD2  . LEU A 1 27  ? 450.434 8.497   2.392   1.00 0.00 ? 27  LEU A CD2  1 
ATOM 419  H H    . LEU A 1 27  ? 446.581 10.863  0.651   1.00 0.00 ? 27  LEU A H    1 
ATOM 420  H HA   . LEU A 1 27  ? 447.837 8.347   -0.158  1.00 0.00 ? 27  LEU A HA   1 
ATOM 421  H HB2  . LEU A 1 27  ? 448.591 9.944   1.791   1.00 0.00 ? 27  LEU A HB2  1 
ATOM 422  H HB3  . LEU A 1 27  ? 447.368 9.073   2.689   1.00 0.00 ? 27  LEU A HB3  1 
ATOM 423  H HG   . LEU A 1 27  ? 448.772 7.396   3.070   1.00 0.00 ? 27  LEU A HG   1 
ATOM 424  H HD11 . LEU A 1 27  ? 449.566 5.941   1.447   1.00 0.00 ? 27  LEU A HD11 1 
ATOM 425  H HD12 . LEU A 1 27  ? 449.719 7.216   0.240   1.00 0.00 ? 27  LEU A HD12 1 
ATOM 426  H HD13 . LEU A 1 27  ? 448.123 6.630   0.707   1.00 0.00 ? 27  LEU A HD13 1 
ATOM 427  H HD21 . LEU A 1 27  ? 450.552 8.737   3.437   1.00 0.00 ? 27  LEU A HD21 1 
ATOM 428  H HD22 . LEU A 1 27  ? 450.524 9.399   1.806   1.00 0.00 ? 27  LEU A HD22 1 
ATOM 429  H HD23 . LEU A 1 27  ? 451.196 7.792   2.093   1.00 0.00 ? 27  LEU A HD23 1 
ATOM 430  N N    . GLN A 1 28  ? 444.821 8.540   0.692   1.00 0.00 ? 28  GLN A N    1 
ATOM 431  C CA   . GLN A 1 28  ? 443.584 7.811   0.969   1.00 0.00 ? 28  GLN A CA   1 
ATOM 432  C C    . GLN A 1 28  ? 443.491 6.534   0.120   1.00 0.00 ? 28  GLN A C    1 
ATOM 433  O O    . GLN A 1 28  ? 444.343 5.656   0.238   1.00 0.00 ? 28  GLN A O    1 
ATOM 434  C CB   . GLN A 1 28  ? 442.367 8.720   0.756   1.00 0.00 ? 28  GLN A CB   1 
ATOM 435  C CG   . GLN A 1 28  ? 442.115 9.675   1.911   1.00 0.00 ? 28  GLN A CG   1 
ATOM 436  C CD   . GLN A 1 28  ? 440.663 9.691   2.350   1.00 0.00 ? 28  GLN A CD   1 
ATOM 437  O OE1  . GLN A 1 28  ? 440.116 8.668   2.762   1.00 0.00 ? 28  GLN A OE1  1 
ATOM 438  N NE2  . GLN A 1 28  ? 440.030 10.855  2.263   1.00 0.00 ? 28  GLN A NE2  1 
ATOM 439  H H    . GLN A 1 28  ? 444.778 9.464   0.386   1.00 0.00 ? 28  GLN A H    1 
ATOM 440  H HA   . GLN A 1 28  ? 443.615 7.518   2.010   1.00 0.00 ? 28  GLN A HA   1 
ATOM 441  H HB2  . GLN A 1 28  ? 442.517 9.302   -0.140  1.00 0.00 ? 28  GLN A HB2  1 
ATOM 442  H HB3  . GLN A 1 28  ? 441.489 8.104   0.633   1.00 0.00 ? 28  GLN A HB3  1 
ATOM 443  H HG2  . GLN A 1 28  ? 442.724 9.375   2.750   1.00 0.00 ? 28  GLN A HG2  1 
ATOM 444  H HG3  . GLN A 1 28  ? 442.393 10.671  1.604   1.00 0.00 ? 28  GLN A HG3  1 
ATOM 445  H HE21 . GLN A 1 28  ? 440.529 11.629  1.925   1.00 0.00 ? 28  GLN A HE21 1 
ATOM 446  H HE22 . GLN A 1 28  ? 439.091 10.894  2.540   1.00 0.00 ? 28  GLN A HE22 1 
ATOM 447  N N    . GLY A 1 29  ? 442.443 6.413   -0.700  1.00 0.00 ? 29  GLY A N    1 
ATOM 448  C CA   . GLY A 1 29  ? 442.255 5.225   -1.518  1.00 0.00 ? 29  GLY A CA   1 
ATOM 449  C C    . GLY A 1 29  ? 443.393 4.962   -2.488  1.00 0.00 ? 29  GLY A C    1 
ATOM 450  O O    . GLY A 1 29  ? 443.181 4.896   -3.698  1.00 0.00 ? 29  GLY A O    1 
ATOM 451  H H    . GLY A 1 29  ? 441.774 7.115   -0.720  1.00 0.00 ? 29  GLY A H    1 
ATOM 452  H HA2  . GLY A 1 29  ? 442.156 4.370   -0.865  1.00 0.00 ? 29  GLY A HA2  1 
ATOM 453  H HA3  . GLY A 1 29  ? 441.339 5.336   -2.080  1.00 0.00 ? 29  GLY A HA3  1 
ATOM 454  N N    . GLN A 1 30  ? 444.597 4.798   -1.955  1.00 0.00 ? 30  GLN A N    1 
ATOM 455  C CA   . GLN A 1 30  ? 445.768 4.525   -2.771  1.00 0.00 ? 30  GLN A CA   1 
ATOM 456  C C    . GLN A 1 30  ? 446.034 3.022   -2.830  1.00 0.00 ? 30  GLN A C    1 
ATOM 457  O O    . GLN A 1 30  ? 445.179 2.219   -2.457  1.00 0.00 ? 30  GLN A O    1 
ATOM 458  C CB   . GLN A 1 30  ? 446.979 5.260   -2.197  1.00 0.00 ? 30  GLN A CB   1 
ATOM 459  C CG   . GLN A 1 30  ? 446.978 6.750   -2.490  1.00 0.00 ? 30  GLN A CG   1 
ATOM 460  C CD   . GLN A 1 30  ? 447.212 7.054   -3.959  1.00 0.00 ? 30  GLN A CD   1 
ATOM 461  O OE1  . GLN A 1 30  ? 446.981 6.209   -4.823  1.00 0.00 ? 30  GLN A OE1  1 
ATOM 462  N NE2  . GLN A 1 30  ? 447.672 8.265   -4.249  1.00 0.00 ? 30  GLN A NE2  1 
ATOM 463  H H    . GLN A 1 30  ? 444.700 4.856   -0.983  1.00 0.00 ? 30  GLN A H    1 
ATOM 464  H HA   . GLN A 1 30  ? 445.574 4.886   -3.769  1.00 0.00 ? 30  GLN A HA   1 
ATOM 465  H HB2  . GLN A 1 30  ? 446.986 5.130   -1.126  1.00 0.00 ? 30  GLN A HB2  1 
ATOM 466  H HB3  . GLN A 1 30  ? 447.880 4.835   -2.609  1.00 0.00 ? 30  GLN A HB3  1 
ATOM 467  H HG2  . GLN A 1 30  ? 446.022 7.159   -2.200  1.00 0.00 ? 30  GLN A HG2  1 
ATOM 468  H HG3  . GLN A 1 30  ? 447.759 7.216   -1.910  1.00 0.00 ? 30  GLN A HG3  1 
ATOM 469  H HE21 . GLN A 1 30  ? 447.834 8.888   -3.511  1.00 0.00 ? 30  GLN A HE21 1 
ATOM 470  H HE22 . GLN A 1 30  ? 447.831 8.486   -5.191  1.00 0.00 ? 30  GLN A HE22 1 
ATOM 471  N N    . ARG A 1 31  ? 447.219 2.644   -3.299  1.00 0.00 ? 31  ARG A N    1 
ATOM 472  C CA   . ARG A 1 31  ? 447.588 1.234   -3.405  1.00 0.00 ? 31  ARG A CA   1 
ATOM 473  C C    . ARG A 1 31  ? 447.361 0.505   -2.084  1.00 0.00 ? 31  ARG A C    1 
ATOM 474  O O    . ARG A 1 31  ? 447.085 1.127   -1.059  1.00 0.00 ? 31  ARG A O    1 
ATOM 475  C CB   . ARG A 1 31  ? 449.053 1.096   -3.821  1.00 0.00 ? 31  ARG A CB   1 
ATOM 476  C CG   . ARG A 1 31  ? 449.457 2.011   -4.967  1.00 0.00 ? 31  ARG A CG   1 
ATOM 477  C CD   . ARG A 1 31  ? 450.758 2.734   -4.659  1.00 0.00 ? 31  ARG A CD   1 
ATOM 478  N NE   . ARG A 1 31  ? 451.818 1.799   -4.288  1.00 0.00 ? 31  ARG A NE   1 
ATOM 479  C CZ   . ARG A 1 31  ? 452.387 0.951   -5.142  1.00 0.00 ? 31  ARG A CZ   1 
ATOM 480  N NH1  . ARG A 1 31  ? 452.033 0.951   -6.422  1.00 0.00 ? 31  ARG A NH1  1 
ATOM 481  N NH2  . ARG A 1 31  ? 453.314 0.103   -4.719  1.00 0.00 ? 31  ARG A NH2  1 
ATOM 482  H H    . ARG A 1 31  ? 447.860 3.327   -3.582  1.00 0.00 ? 31  ARG A H    1 
ATOM 483  H HA   . ARG A 1 31  ? 446.965 0.784   -4.161  1.00 0.00 ? 31  ARG A HA   1 
ATOM 484  H HB2  . ARG A 1 31  ? 449.677 1.324   -2.969  1.00 0.00 ? 31  ARG A HB2  1 
ATOM 485  H HB3  . ARG A 1 31  ? 449.232 0.075   -4.123  1.00 0.00 ? 31  ARG A HB3  1 
ATOM 486  H HG2  . ARG A 1 31  ? 449.590 1.416   -5.858  1.00 0.00 ? 31  ARG A HG2  1 
ATOM 487  H HG3  . ARG A 1 31  ? 448.678 2.739   -5.131  1.00 0.00 ? 31  ARG A HG3  1 
ATOM 488  H HD2  . ARG A 1 31  ? 451.066 3.286   -5.532  1.00 0.00 ? 31  ARG A HD2  1 
ATOM 489  H HD3  . ARG A 1 31  ? 450.588 3.419   -3.841  1.00 0.00 ? 31  ARG A HD3  1 
ATOM 490  H HE   . ARG A 1 31  ? 452.109 1.793   -3.353  1.00 0.00 ? 31  ARG A HE   1 
ATOM 491  H HH11 . ARG A 1 31  ? 451.337 1.590   -6.749  1.00 0.00 ? 31  ARG A HH11 1 
ATOM 492  H HH12 . ARG A 1 31  ? 452.463 0.312   -7.059  1.00 0.00 ? 31  ARG A HH12 1 
ATOM 493  H HH21 . ARG A 1 31  ? 453.587 0.099   -3.757  1.00 0.00 ? 31  ARG A HH21 1 
ATOM 494  H HH22 . ARG A 1 31  ? 453.741 -0.532  -5.362  1.00 0.00 ? 31  ARG A HH22 1 
ATOM 495  N N    . HIS A 1 32  ? 447.487 -0.819  -2.117  1.00 0.00 ? 32  HIS A N    1 
ATOM 496  C CA   . HIS A 1 32  ? 447.302 -1.632  -0.919  1.00 0.00 ? 32  HIS A CA   1 
ATOM 497  C C    . HIS A 1 32  ? 448.351 -1.290  0.140   1.00 0.00 ? 32  HIS A C    1 
ATOM 498  O O    . HIS A 1 32  ? 448.171 -1.583  1.315   1.00 0.00 ? 32  HIS A O    1 
ATOM 499  C CB   . HIS A 1 32  ? 447.376 -3.121  -1.269  1.00 0.00 ? 32  HIS A CB   1 
ATOM 500  C CG   . HIS A 1 32  ? 446.198 -3.908  -0.785  1.00 0.00 ? 32  HIS A CG   1 
ATOM 501  N ND1  . HIS A 1 32  ? 445.923 -4.109  0.552   1.00 0.00 ? 32  HIS A ND1  1 
ATOM 502  C CD2  . HIS A 1 32  ? 445.219 -4.548  -1.468  1.00 0.00 ? 32  HIS A CD2  1 
ATOM 503  C CE1  . HIS A 1 32  ? 444.828 -4.837  0.670   1.00 0.00 ? 32  HIS A CE1  1 
ATOM 504  N NE2  . HIS A 1 32  ? 444.381 -5.116  -0.541  1.00 0.00 ? 32  HIS A NE2  1 
ATOM 505  H H    . HIS A 1 32  ? 447.714 -1.258  -2.966  1.00 0.00 ? 32  HIS A H    1 
ATOM 506  H HA   . HIS A 1 32  ? 446.322 -1.414  -0.520  1.00 0.00 ? 32  HIS A HA   1 
ATOM 507  H HB2  . HIS A 1 32  ? 447.429 -3.229  -2.342  1.00 0.00 ? 32  HIS A HB2  1 
ATOM 508  H HB3  . HIS A 1 32  ? 448.266 -3.545  -0.826  1.00 0.00 ? 32  HIS A HB3  1 
ATOM 509  H HD1  . HIS A 1 32  ? 446.453 -3.768  1.303   1.00 0.00 ? 32  HIS A HD1  1 
ATOM 510  H HD2  . HIS A 1 32  ? 445.116 -4.600  -2.543  1.00 0.00 ? 32  HIS A HD2  1 
ATOM 511  H HE1  . HIS A 1 32  ? 444.373 -5.150  1.598   1.00 0.00 ? 32  HIS A HE1  1 
ATOM 512  H HE2  . HIS A 1 32  ? 443.544 -5.584  -0.741  1.00 0.00 ? 32  HIS A HE2  1 
ATOM 513  N N    . GLY A 1 33  ? 449.433 -0.655  -0.295  1.00 0.00 ? 33  GLY A N    1 
ATOM 514  C CA   . GLY A 1 33  ? 450.499 -0.249  0.599   1.00 0.00 ? 33  GLY A CA   1 
ATOM 515  C C    . GLY A 1 33  ? 451.108 1.072   0.166   1.00 0.00 ? 33  GLY A C    1 
ATOM 516  O O    . GLY A 1 33  ? 451.657 1.171   -0.931  1.00 0.00 ? 33  GLY A O    1 
ATOM 517  H H    . GLY A 1 33  ? 449.495 -0.431  -1.234  1.00 0.00 ? 33  GLY A H    1 
ATOM 518  H HA2  . GLY A 1 33  ? 450.101 -0.144  1.599   1.00 0.00 ? 33  GLY A HA2  1 
ATOM 519  H HA3  . GLY A 1 33  ? 451.267 -1.007  0.601   1.00 0.00 ? 33  GLY A HA3  1 
ATOM 520  N N    . VAL A 1 34  ? 451.016 2.091   1.012   1.00 0.00 ? 34  VAL A N    1 
ATOM 521  C CA   . VAL A 1 34  ? 451.572 3.399   0.672   1.00 0.00 ? 34  VAL A CA   1 
ATOM 522  C C    . VAL A 1 34  ? 451.808 4.264   1.902   1.00 0.00 ? 34  VAL A C    1 
ATOM 523  O O    . VAL A 1 34  ? 451.041 4.223   2.862   1.00 0.00 ? 34  VAL A O    1 
ATOM 524  C CB   . VAL A 1 34  ? 450.664 4.178   -0.308  1.00 0.00 ? 34  VAL A CB   1 
ATOM 525  C CG1  . VAL A 1 34  ? 451.265 4.182   -1.701  1.00 0.00 ? 34  VAL A CG1  1 
ATOM 526  C CG2  . VAL A 1 34  ? 449.252 3.607   -0.330  1.00 0.00 ? 34  VAL A CG2  1 
ATOM 527  H H    . VAL A 1 34  ? 450.574 1.961   1.877   1.00 0.00 ? 34  VAL A H    1 
ATOM 528  H HA   . VAL A 1 34  ? 452.519 3.233   0.184   1.00 0.00 ? 34  VAL A HA   1 
ATOM 529  H HB   . VAL A 1 34  ? 450.607 5.202   0.027   1.00 0.00 ? 34  VAL A HB   1 
ATOM 530  H HG11 . VAL A 1 34  ? 450.605 4.709   -2.375  1.00 0.00 ? 34  VAL A HG11 1 
ATOM 531  H HG12 . VAL A 1 34  ? 451.391 3.165   -2.042  1.00 0.00 ? 34  VAL A HG12 1 
ATOM 532  H HG13 . VAL A 1 34  ? 452.224 4.676   -1.678  1.00 0.00 ? 34  VAL A HG13 1 
ATOM 533  H HG21 . VAL A 1 34  ? 449.044 3.123   0.612   1.00 0.00 ? 34  VAL A HG21 1 
ATOM 534  H HG22 . VAL A 1 34  ? 449.166 2.888   -1.131  1.00 0.00 ? 34  VAL A HG22 1 
ATOM 535  H HG23 . VAL A 1 34  ? 448.544 4.406   -0.486  1.00 0.00 ? 34  VAL A HG23 1 
ATOM 536  N N    . PHE A 1 35  ? 452.865 5.068   1.848   1.00 0.00 ? 35  PHE A N    1 
ATOM 537  C CA   . PHE A 1 35  ? 453.197 5.973   2.935   1.00 0.00 ? 35  PHE A CA   1 
ATOM 538  C C    . PHE A 1 35  ? 453.701 7.290   2.371   1.00 0.00 ? 35  PHE A C    1 
ATOM 539  O O    . PHE A 1 35  ? 454.147 7.348   1.229   1.00 0.00 ? 35  PHE A O    1 
ATOM 540  C CB   . PHE A 1 35  ? 454.270 5.369   3.848   1.00 0.00 ? 35  PHE A CB   1 
ATOM 541  C CG   . PHE A 1 35  ? 455.663 5.481   3.295   1.00 0.00 ? 35  PHE A CG   1 
ATOM 542  C CD1  . PHE A 1 35  ? 456.325 6.697   3.326   1.00 0.00 ? 35  PHE A CD1  1 
ATOM 543  C CD2  . PHE A 1 35  ? 456.306 4.386   2.741   1.00 0.00 ? 35  PHE A CD2  1 
ATOM 544  C CE1  . PHE A 1 35  ? 457.598 6.821   2.817   1.00 0.00 ? 35  PHE A CE1  1 
ATOM 545  C CE2  . PHE A 1 35  ? 457.585 4.506   2.230   1.00 0.00 ? 35  PHE A CE2  1 
ATOM 546  C CZ   . PHE A 1 35  ? 458.230 5.727   2.271   1.00 0.00 ? 35  PHE A CZ   1 
ATOM 547  H H    . PHE A 1 35  ? 453.429 5.068   1.044   1.00 0.00 ? 35  PHE A H    1 
ATOM 548  H HA   . PHE A 1 35  ? 452.302 6.152   3.507   1.00 0.00 ? 35  PHE A HA   1 
ATOM 549  H HB2  . PHE A 1 35  ? 454.255 5.886   4.798   1.00 0.00 ? 35  PHE A HB2  1 
ATOM 550  H HB3  . PHE A 1 35  ? 454.052 4.326   4.005   1.00 0.00 ? 35  PHE A HB3  1 
ATOM 551  H HD1  . PHE A 1 35  ? 455.832 7.555   3.757   1.00 0.00 ? 35  PHE A HD1  1 
ATOM 552  H HD2  . PHE A 1 35  ? 455.800 3.433   2.709   1.00 0.00 ? 35  PHE A HD2  1 
ATOM 553  H HE1  . PHE A 1 35  ? 458.098 7.774   2.841   1.00 0.00 ? 35  PHE A HE1  1 
ATOM 554  H HE2  . PHE A 1 35  ? 458.080 3.649   1.801   1.00 0.00 ? 35  PHE A HE2  1 
ATOM 555  H HZ   . PHE A 1 35  ? 459.226 5.826   1.874   1.00 0.00 ? 35  PHE A HZ   1 
ATOM 556  N N    . LEU A 1 36  ? 453.647 8.339   3.170   1.00 0.00 ? 36  LEU A N    1 
ATOM 557  C CA   . LEU A 1 36  ? 454.128 9.635   2.724   1.00 0.00 ? 36  LEU A CA   1 
ATOM 558  C C    . LEU A 1 36  ? 454.649 10.446  3.904   1.00 0.00 ? 36  LEU A C    1 
ATOM 559  O O    . LEU A 1 36  ? 454.215 10.259  5.041   1.00 0.00 ? 36  LEU A O    1 
ATOM 560  C CB   . LEU A 1 36  ? 453.036 10.365  1.929   1.00 0.00 ? 36  LEU A CB   1 
ATOM 561  C CG   . LEU A 1 36  ? 452.328 11.531  2.618   1.00 0.00 ? 36  LEU A CG   1 
ATOM 562  C CD1  . LEU A 1 36  ? 451.160 12.020  1.769   1.00 0.00 ? 36  LEU A CD1  1 
ATOM 563  C CD2  . LEU A 1 36  ? 451.853 11.132  4.006   1.00 0.00 ? 36  LEU A CD2  1 
ATOM 564  H H    . LEU A 1 36  ? 453.284 8.243   4.076   1.00 0.00 ? 36  LEU A H    1 
ATOM 565  H HA   . LEU A 1 36  ? 454.959 9.448   2.062   1.00 0.00 ? 36  LEU A HA   1 
ATOM 566  H HB2  . LEU A 1 36  ? 453.483 10.740  1.025   1.00 0.00 ? 36  LEU A HB2  1 
ATOM 567  H HB3  . LEU A 1 36  ? 452.295 9.638   1.657   1.00 0.00 ? 36  LEU A HB3  1 
ATOM 568  H HG   . LEU A 1 36  ? 453.024 12.345  2.718   1.00 0.00 ? 36  LEU A HG   1 
ATOM 569  H HD11 . LEU A 1 36  ? 451.190 11.539  0.801   1.00 0.00 ? 36  LEU A HD11 1 
ATOM 570  H HD12 . LEU A 1 36  ? 451.232 13.090  1.640   1.00 0.00 ? 36  LEU A HD12 1 
ATOM 571  H HD13 . LEU A 1 36  ? 450.230 11.779  2.262   1.00 0.00 ? 36  LEU A HD13 1 
ATOM 572  H HD21 . LEU A 1 36  ? 451.935 10.060  4.119   1.00 0.00 ? 36  LEU A HD21 1 
ATOM 573  H HD22 . LEU A 1 36  ? 450.823 11.432  4.136   1.00 0.00 ? 36  LEU A HD22 1 
ATOM 574  H HD23 . LEU A 1 36  ? 452.466 11.619  4.749   1.00 0.00 ? 36  LEU A HD23 1 
ATOM 575  N N    . VAL A 1 37  ? 455.599 11.327  3.629   1.00 0.00 ? 37  VAL A N    1 
ATOM 576  C CA   . VAL A 1 37  ? 456.203 12.145  4.670   1.00 0.00 ? 37  VAL A CA   1 
ATOM 577  C C    . VAL A 1 37  ? 456.026 13.629  4.380   1.00 0.00 ? 37  VAL A C    1 
ATOM 578  O O    . VAL A 1 37  ? 456.704 14.187  3.524   1.00 0.00 ? 37  VAL A O    1 
ATOM 579  C CB   . VAL A 1 37  ? 457.703 11.823  4.816   1.00 0.00 ? 37  VAL A CB   1 
ATOM 580  C CG1  . VAL A 1 37  ? 458.264 12.470  6.075   1.00 0.00 ? 37  VAL A CG1  1 
ATOM 581  C CG2  . VAL A 1 37  ? 457.924 10.311  4.830   1.00 0.00 ? 37  VAL A CG2  1 
ATOM 582  H H    . VAL A 1 37  ? 455.912 11.420  2.707   1.00 0.00 ? 37  VAL A H    1 
ATOM 583  H HA   . VAL A 1 37  ? 455.714 11.910  5.604   1.00 0.00 ? 37  VAL A HA   1 
ATOM 584  H HB   . VAL A 1 37  ? 458.228 12.236  3.961   1.00 0.00 ? 37  VAL A HB   1 
ATOM 585  H HG11 . VAL A 1 37  ? 457.461 12.950  6.619   1.00 0.00 ? 37  VAL A HG11 1 
ATOM 586  H HG12 . VAL A 1 37  ? 459.004 13.207  5.800   1.00 0.00 ? 37  VAL A HG12 1 
ATOM 587  H HG13 . VAL A 1 37  ? 458.723 11.714  6.698   1.00 0.00 ? 37  VAL A HG13 1 
ATOM 588  H HG21 . VAL A 1 37  ? 456.971 9.806   4.936   1.00 0.00 ? 37  VAL A HG21 1 
ATOM 589  H HG22 . VAL A 1 37  ? 458.563 10.046  5.659   1.00 0.00 ? 37  VAL A HG22 1 
ATOM 590  H HG23 . VAL A 1 37  ? 458.390 10.004  3.905   1.00 0.00 ? 37  VAL A HG23 1 
ATOM 591  N N    . ARG A 1 38  ? 455.110 14.263  5.101   1.00 0.00 ? 38  ARG A N    1 
ATOM 592  C CA   . ARG A 1 38  ? 454.843 15.686  4.915   1.00 0.00 ? 38  ARG A CA   1 
ATOM 593  C C    . ARG A 1 38  ? 455.527 16.515  5.998   1.00 0.00 ? 38  ARG A C    1 
ATOM 594  O O    . ARG A 1 38  ? 456.007 15.974  6.994   1.00 0.00 ? 38  ARG A O    1 
ATOM 595  C CB   . ARG A 1 38  ? 453.326 15.949  4.884   1.00 0.00 ? 38  ARG A CB   1 
ATOM 596  C CG   . ARG A 1 38  ? 452.699 16.278  6.236   1.00 0.00 ? 38  ARG A CG   1 
ATOM 597  C CD   . ARG A 1 38  ? 451.741 15.187  6.691   1.00 0.00 ? 38  ARG A CD   1 
ATOM 598  N NE   . ARG A 1 38  ? 450.771 15.682  7.665   1.00 0.00 ? 38  ARG A NE   1 
ATOM 599  C CZ   . ARG A 1 38  ? 449.831 16.582  7.384   1.00 0.00 ? 38  ARG A CZ   1 
ATOM 600  N NH1  . ARG A 1 38  ? 449.726 17.083  6.160   1.00 0.00 ? 38  ARG A NH1  1 
ATOM 601  N NH2  . ARG A 1 38  ? 448.992 16.980  8.330   1.00 0.00 ? 38  ARG A NH2  1 
ATOM 602  H H    . ARG A 1 38  ? 454.604 13.763  5.773   1.00 0.00 ? 38  ARG A H    1 
ATOM 603  H HA   . ARG A 1 38  ? 455.260 15.970  3.959   1.00 0.00 ? 38  ARG A HA   1 
ATOM 604  H HB2  . ARG A 1 38  ? 453.134 16.777  4.219   1.00 0.00 ? 38  ARG A HB2  1 
ATOM 605  H HB3  . ARG A 1 38  ? 452.834 15.070  4.491   1.00 0.00 ? 38  ARG A HB3  1 
ATOM 606  H HG2  . ARG A 1 38  ? 453.477 16.386  6.972   1.00 0.00 ? 38  ARG A HG2  1 
ATOM 607  H HG3  . ARG A 1 38  ? 452.154 17.207  6.150   1.00 0.00 ? 38  ARG A HG3  1 
ATOM 608  H HD2  . ARG A 1 38  ? 451.211 14.810  5.829   1.00 0.00 ? 38  ARG A HD2  1 
ATOM 609  H HD3  . ARG A 1 38  ? 452.312 14.388  7.139   1.00 0.00 ? 38  ARG A HD3  1 
ATOM 610  H HE   . ARG A 1 38  ? 450.823 15.327  8.576   1.00 0.00 ? 38  ARG A HE   1 
ATOM 611  H HH11 . ARG A 1 38  ? 450.354 16.786  5.441   1.00 0.00 ? 38  ARG A HH11 1 
ATOM 612  H HH12 . ARG A 1 38  ? 449.018 17.760  5.956   1.00 0.00 ? 38  ARG A HH12 1 
ATOM 613  H HH21 . ARG A 1 38  ? 449.065 16.605  9.254   1.00 0.00 ? 38  ARG A HH21 1 
ATOM 614  H HH22 . ARG A 1 38  ? 448.286 17.657  8.120   1.00 0.00 ? 38  ARG A HH22 1 
ATOM 615  N N    . ASP A 1 39  ? 455.579 17.827  5.797   1.00 0.00 ? 39  ASP A N    1 
ATOM 616  C CA   . ASP A 1 39  ? 456.218 18.714  6.761   1.00 0.00 ? 39  ASP A CA   1 
ATOM 617  C C    . ASP A 1 39  ? 455.192 19.542  7.535   1.00 0.00 ? 39  ASP A C    1 
ATOM 618  O O    . ASP A 1 39  ? 454.784 20.613  7.088   1.00 0.00 ? 39  ASP A O    1 
ATOM 619  C CB   . ASP A 1 39  ? 457.204 19.644  6.053   1.00 0.00 ? 39  ASP A CB   1 
ATOM 620  C CG   . ASP A 1 39  ? 458.583 19.029  5.917   1.00 0.00 ? 39  ASP A CG   1 
ATOM 621  O OD1  . ASP A 1 39  ? 458.705 17.987  5.239   1.00 0.00 ? 39  ASP A OD1  1 
ATOM 622  O OD2  . ASP A 1 39  ? 459.541 19.589  6.490   1.00 0.00 ? 39  ASP A OD2  1 
ATOM 623  H H    . ASP A 1 39  ? 455.187 18.205  4.982   1.00 0.00 ? 39  ASP A H    1 
ATOM 624  H HA   . ASP A 1 39  ? 456.762 18.097  7.457   1.00 0.00 ? 39  ASP A HA   1 
ATOM 625  H HB2  . ASP A 1 39  ? 456.831 19.868  5.065   1.00 0.00 ? 39  ASP A HB2  1 
ATOM 626  H HB3  . ASP A 1 39  ? 457.292 20.560  6.618   1.00 0.00 ? 39  ASP A HB3  1 
ATOM 627  N N    . SER A 1 40  ? 454.787 19.045  8.702   1.00 0.00 ? 40  SER A N    1 
ATOM 628  C CA   . SER A 1 40  ? 453.820 19.748  9.540   1.00 0.00 ? 40  SER A CA   1 
ATOM 629  C C    . SER A 1 40  ? 453.784 19.158  10.951  1.00 0.00 ? 40  SER A C    1 
ATOM 630  O O    . SER A 1 40  ? 452.753 18.652  11.395  1.00 0.00 ? 40  SER A O    1 
ATOM 631  C CB   . SER A 1 40  ? 452.427 19.684  8.909   1.00 0.00 ? 40  SER A CB   1 
ATOM 632  O OG   . SER A 1 40  ? 451.980 18.345  8.791   1.00 0.00 ? 40  SER A OG   1 
ATOM 633  H H    . SER A 1 40  ? 455.151 18.189  9.008   1.00 0.00 ? 40  SER A H    1 
ATOM 634  H HA   . SER A 1 40  ? 454.128 20.780  9.603   1.00 0.00 ? 40  SER A HA   1 
ATOM 635  H HB2  . SER A 1 40  ? 451.729 20.230  9.526   1.00 0.00 ? 40  SER A HB2  1 
ATOM 636  H HB3  . SER A 1 40  ? 452.459 20.128  7.924   1.00 0.00 ? 40  SER A HB3  1 
ATOM 637  H HG   . SER A 1 40  ? 451.024 18.333  8.705   1.00 0.00 ? 40  SER A HG   1 
ATOM 638  N N    . SER A 1 41  ? 454.916 19.224  11.651  1.00 0.00 ? 41  SER A N    1 
ATOM 639  C CA   . SER A 1 41  ? 455.005 18.691  13.010  1.00 0.00 ? 41  SER A CA   1 
ATOM 640  C C    . SER A 1 41  ? 455.856 19.587  13.912  1.00 0.00 ? 41  SER A C    1 
ATOM 641  O O    . SER A 1 41  ? 456.504 20.524  13.446  1.00 0.00 ? 41  SER A O    1 
ATOM 642  C CB   . SER A 1 41  ? 455.583 17.275  12.986  1.00 0.00 ? 41  SER A CB   1 
ATOM 643  O OG   . SER A 1 41  ? 454.832 16.403  13.813  1.00 0.00 ? 41  SER A OG   1 
ATOM 644  H H    . SER A 1 41  ? 455.707 19.636  11.246  1.00 0.00 ? 41  SER A H    1 
ATOM 645  H HA   . SER A 1 41  ? 454.004 18.650  13.412  1.00 0.00 ? 41  SER A HA   1 
ATOM 646  H HB2  . SER A 1 41  ? 455.562 16.898  11.975  1.00 0.00 ? 41  SER A HB2  1 
ATOM 647  H HB3  . SER A 1 41  ? 456.603 17.298  13.341  1.00 0.00 ? 41  SER A HB3  1 
ATOM 648  H HG   . SER A 1 41  ? 454.642 16.837  14.648  1.00 0.00 ? 41  SER A HG   1 
ATOM 649  N N    . THR A 1 42  ? 455.846 19.281  15.209  1.00 0.00 ? 42  THR A N    1 
ATOM 650  C CA   . THR A 1 42  ? 456.611 20.041  16.197  1.00 0.00 ? 42  THR A CA   1 
ATOM 651  C C    . THR A 1 42  ? 458.113 19.869  15.983  1.00 0.00 ? 42  THR A C    1 
ATOM 652  O O    . THR A 1 42  ? 458.541 19.228  15.023  1.00 0.00 ? 42  THR A O    1 
ATOM 653  C CB   . THR A 1 42  ? 456.231 19.603  17.612  1.00 0.00 ? 42  THR A CB   1 
ATOM 654  O OG1  . THR A 1 42  ? 456.922 20.376  18.578  1.00 0.00 ? 42  THR A OG1  1 
ATOM 655  C CG2  . THR A 1 42  ? 456.530 18.146  17.890  1.00 0.00 ? 42  THR A CG2  1 
ATOM 656  H H    . THR A 1 42  ? 455.309 18.520  15.511  1.00 0.00 ? 42  THR A H    1 
ATOM 657  H HA   . THR A 1 42  ? 456.362 21.085  16.075  1.00 0.00 ? 42  THR A HA   1 
ATOM 658  H HB   . THR A 1 42  ? 455.171 19.756  17.752  1.00 0.00 ? 42  THR A HB   1 
ATOM 659  H HG1  . THR A 1 42  ? 456.450 21.198  18.728  1.00 0.00 ? 42  THR A HG1  1 
ATOM 660  H HG21 . THR A 1 42  ? 457.144 18.067  18.776  1.00 0.00 ? 42  THR A HG21 1 
ATOM 661  H HG22 . THR A 1 42  ? 457.056 17.719  17.049  1.00 0.00 ? 42  THR A HG22 1 
ATOM 662  H HG23 . THR A 1 42  ? 455.605 17.612  18.045  1.00 0.00 ? 42  THR A HG23 1 
ATOM 663  N N    . SER A 1 43  ? 458.912 20.455  16.881  1.00 0.00 ? 43  SER A N    1 
ATOM 664  C CA   . SER A 1 43  ? 460.373 20.377  16.792  1.00 0.00 ? 43  SER A CA   1 
ATOM 665  C C    . SER A 1 43  ? 460.884 21.367  15.744  1.00 0.00 ? 43  SER A C    1 
ATOM 666  O O    . SER A 1 43  ? 460.094 22.125  15.181  1.00 0.00 ? 43  SER A O    1 
ATOM 667  C CB   . SER A 1 43  ? 460.820 18.947  16.458  1.00 0.00 ? 43  SER A CB   1 
ATOM 668  O OG   . SER A 1 43  ? 459.805 18.003  16.756  1.00 0.00 ? 43  SER A OG   1 
ATOM 669  H H    . SER A 1 43  ? 458.510 20.958  17.620  1.00 0.00 ? 43  SER A H    1 
ATOM 670  H HA   . SER A 1 43  ? 460.775 20.656  17.755  1.00 0.00 ? 43  SER A HA   1 
ATOM 671  H HB2  . SER A 1 43  ? 461.056 18.882  15.406  1.00 0.00 ? 43  SER A HB2  1 
ATOM 672  H HB3  . SER A 1 43  ? 461.698 18.704  17.039  1.00 0.00 ? 43  SER A HB3  1 
ATOM 673  H HG   . SER A 1 43  ? 459.738 17.893  17.707  1.00 0.00 ? 43  SER A HG   1 
ATOM 674  N N    . PRO A 1 44  ? 462.201 21.387  15.449  1.00 0.00 ? 44  PRO A N    1 
ATOM 675  C CA   . PRO A 1 44  ? 462.749 22.307  14.451  1.00 0.00 ? 44  PRO A CA   1 
ATOM 676  C C    . PRO A 1 44  ? 462.410 21.848  13.042  1.00 0.00 ? 44  PRO A C    1 
ATOM 677  O O    . PRO A 1 44  ? 462.221 22.657  12.134  1.00 0.00 ? 44  PRO A O    1 
ATOM 678  C CB   . PRO A 1 44  ? 464.251 22.238  14.704  1.00 0.00 ? 44  PRO A CB   1 
ATOM 679  C CG   . PRO A 1 44  ? 464.468 20.860  15.211  1.00 0.00 ? 44  PRO A CG   1 
ATOM 680  C CD   . PRO A 1 44  ? 463.257 20.525  16.031  1.00 0.00 ? 44  PRO A CD   1 
ATOM 681  H HA   . PRO A 1 44  ? 462.394 23.317  14.600  1.00 0.00 ? 44  PRO A HA   1 
ATOM 682  H HB2  . PRO A 1 44  ? 464.786 22.414  13.782  1.00 0.00 ? 44  PRO A HB2  1 
ATOM 683  H HB3  . PRO A 1 44  ? 464.533 22.977  15.442  1.00 0.00 ? 44  PRO A HB3  1 
ATOM 684  H HG2  . PRO A 1 44  ? 464.566 20.173  14.385  1.00 0.00 ? 44  PRO A HG2  1 
ATOM 685  H HG3  . PRO A 1 44  ? 465.346 20.835  15.827  1.00 0.00 ? 44  PRO A HG3  1 
ATOM 686  H HD2  . PRO A 1 44  ? 463.014 19.481  15.923  1.00 0.00 ? 44  PRO A HD2  1 
ATOM 687  H HD3  . PRO A 1 44  ? 463.438 20.769  17.066  1.00 0.00 ? 44  PRO A HD3  1 
ATOM 688  N N    . GLY A 1 45  ? 462.313 20.534  12.881  1.00 0.00 ? 45  GLY A N    1 
ATOM 689  C CA   . GLY A 1 45  ? 461.972 19.958  11.598  1.00 0.00 ? 45  GLY A CA   1 
ATOM 690  C C    . GLY A 1 45  ? 460.655 19.214  11.663  1.00 0.00 ? 45  GLY A C    1 
ATOM 691  O O    . GLY A 1 45  ? 460.255 18.746  12.729  1.00 0.00 ? 45  GLY A O    1 
ATOM 692  H H    . GLY A 1 45  ? 462.460 19.946  13.651  1.00 0.00 ? 45  GLY A H    1 
ATOM 693  H HA2  . GLY A 1 45  ? 461.898 20.748  10.865  1.00 0.00 ? 45  GLY A HA2  1 
ATOM 694  H HA3  . GLY A 1 45  ? 462.750 19.271  11.301  1.00 0.00 ? 45  GLY A HA3  1 
ATOM 695  N N    . ASP A 1 46  ? 459.972 19.108  10.533  1.00 0.00 ? 46  ASP A N    1 
ATOM 696  C CA   . ASP A 1 46  ? 458.690 18.418  10.490  1.00 0.00 ? 46  ASP A CA   1 
ATOM 697  C C    . ASP A 1 46  ? 458.881 16.923  10.257  1.00 0.00 ? 46  ASP A C    1 
ATOM 698  O O    . ASP A 1 46  ? 459.690 16.514  9.425   1.00 0.00 ? 46  ASP A O    1 
ATOM 699  C CB   . ASP A 1 46  ? 457.811 19.010  9.394   1.00 0.00 ? 46  ASP A CB   1 
ATOM 700  C CG   . ASP A 1 46  ? 457.449 20.458  9.659   1.00 0.00 ? 46  ASP A CG   1 
ATOM 701  O OD1  . ASP A 1 46  ? 457.054 20.772  10.802  1.00 0.00 ? 46  ASP A OD1  1 
ATOM 702  O OD2  . ASP A 1 46  ? 457.560 21.278  8.724   1.00 0.00 ? 46  ASP A OD2  1 
ATOM 703  H H    . ASP A 1 46  ? 460.334 19.504  9.713   1.00 0.00 ? 46  ASP A H    1 
ATOM 704  H HA   . ASP A 1 46  ? 458.205 18.562  11.444  1.00 0.00 ? 46  ASP A HA   1 
ATOM 705  H HB2  . ASP A 1 46  ? 458.334 18.955  8.451   1.00 0.00 ? 46  ASP A HB2  1 
ATOM 706  H HB3  . ASP A 1 46  ? 456.901 18.435  9.330   1.00 0.00 ? 46  ASP A HB3  1 
ATOM 707  N N    . TYR A 1 47  ? 458.125 16.111  10.991  1.00 0.00 ? 47  TYR A N    1 
ATOM 708  C CA   . TYR A 1 47  ? 458.212 14.662  10.850  1.00 0.00 ? 47  TYR A CA   1 
ATOM 709  C C    . TYR A 1 47  ? 456.850 13.993  11.045  1.00 0.00 ? 47  TYR A C    1 
ATOM 710  O O    . TYR A 1 47  ? 456.317 13.957  12.154  1.00 0.00 ? 47  TYR A O    1 
ATOM 711  C CB   . TYR A 1 47  ? 459.222 14.076  11.842  1.00 0.00 ? 47  TYR A CB   1 
ATOM 712  C CG   . TYR A 1 47  ? 460.248 15.066  12.354  1.00 0.00 ? 47  TYR A CG   1 
ATOM 713  C CD1  . TYR A 1 47  ? 461.306 15.480  11.555  1.00 0.00 ? 47  TYR A CD1  1 
ATOM 714  C CD2  . TYR A 1 47  ? 460.159 15.580  13.642  1.00 0.00 ? 47  TYR A CD2  1 
ATOM 715  C CE1  . TYR A 1 47  ? 462.247 16.378  12.025  1.00 0.00 ? 47  TYR A CE1  1 
ATOM 716  C CE2  . TYR A 1 47  ? 461.094 16.478  14.118  1.00 0.00 ? 47  TYR A CE2  1 
ATOM 717  C CZ   . TYR A 1 47  ? 462.136 16.874  13.306  1.00 0.00 ? 47  TYR A CZ   1 
ATOM 718  O OH   . TYR A 1 47  ? 463.069 17.768  13.779  1.00 0.00 ? 47  TYR A OH   1 
ATOM 719  H H    . TYR A 1 47  ? 457.486 16.495  11.626  1.00 0.00 ? 47  TYR A H    1 
ATOM 720  H HA   . TYR A 1 47  ? 458.553 14.454  9.847   1.00 0.00 ? 47  TYR A HA   1 
ATOM 721  H HB2  . TYR A 1 47  ? 458.690 13.685  12.694  1.00 0.00 ? 47  TYR A HB2  1 
ATOM 722  H HB3  . TYR A 1 47  ? 459.755 13.269  11.359  1.00 0.00 ? 47  TYR A HB3  1 
ATOM 723  H HD1  . TYR A 1 47  ? 461.390 15.089  10.551  1.00 0.00 ? 47  TYR A HD1  1 
ATOM 724  H HD2  . TYR A 1 47  ? 459.342 15.267  14.276  1.00 0.00 ? 47  TYR A HD2  1 
ATOM 725  H HE1  . TYR A 1 47  ? 463.062 16.688  11.388  1.00 0.00 ? 47  TYR A HE1  1 
ATOM 726  H HE2  . TYR A 1 47  ? 461.006 16.866  15.122  1.00 0.00 ? 47  TYR A HE2  1 
ATOM 727  H HH   . TYR A 1 47  ? 463.249 17.585  14.703  1.00 0.00 ? 47  TYR A HH   1 
ATOM 728  N N    . VAL A 1 48  ? 456.306 13.447  9.962   1.00 0.00 ? 48  VAL A N    1 
ATOM 729  C CA   . VAL A 1 48  ? 455.023 12.755  9.999   1.00 0.00 ? 48  VAL A CA   1 
ATOM 730  C C    . VAL A 1 48  ? 455.051 11.596  9.001   1.00 0.00 ? 48  VAL A C    1 
ATOM 731  O O    . VAL A 1 48  ? 455.907 11.558  8.117   1.00 0.00 ? 48  VAL A O    1 
ATOM 732  C CB   . VAL A 1 48  ? 453.842 13.719  9.704   1.00 0.00 ? 48  VAL A CB   1 
ATOM 733  C CG1  . VAL A 1 48  ? 454.237 14.761  8.670   1.00 0.00 ? 48  VAL A CG1  1 
ATOM 734  C CG2  . VAL A 1 48  ? 452.593 12.967  9.254   1.00 0.00 ? 48  VAL A CG2  1 
ATOM 735  H H    . VAL A 1 48  ? 456.787 13.496  9.112   1.00 0.00 ? 48  VAL A H    1 
ATOM 736  H HA   . VAL A 1 48  ? 454.895 12.351  10.995  1.00 0.00 ? 48  VAL A HA   1 
ATOM 737  H HB   . VAL A 1 48  ? 453.604 14.240  10.620  1.00 0.00 ? 48  VAL A HB   1 
ATOM 738  H HG11 . VAL A 1 48  ? 455.198 15.183  8.928   1.00 0.00 ? 48  VAL A HG11 1 
ATOM 739  H HG12 . VAL A 1 48  ? 453.495 15.545  8.653   1.00 0.00 ? 48  VAL A HG12 1 
ATOM 740  H HG13 . VAL A 1 48  ? 454.295 14.299  7.696   1.00 0.00 ? 48  VAL A HG13 1 
ATOM 741  H HG21 . VAL A 1 48  ? 452.815 12.408  8.358   1.00 0.00 ? 48  VAL A HG21 1 
ATOM 742  H HG22 . VAL A 1 48  ? 451.803 13.673  9.050   1.00 0.00 ? 48  VAL A HG22 1 
ATOM 743  H HG23 . VAL A 1 48  ? 452.275 12.289  10.033  1.00 0.00 ? 48  VAL A HG23 1 
ATOM 744  N N    . LEU A 1 49  ? 454.114 10.663  9.127   1.00 0.00 ? 49  LEU A N    1 
ATOM 745  C CA   . LEU A 1 49  ? 454.054 9.536   8.211   1.00 0.00 ? 49  LEU A CA   1 
ATOM 746  C C    . LEU A 1 49  ? 452.633 9.000   8.065   1.00 0.00 ? 49  LEU A C    1 
ATOM 747  O O    . LEU A 1 49  ? 452.127 8.317   8.955   1.00 0.00 ? 49  LEU A O    1 
ATOM 748  C CB   . LEU A 1 49  ? 454.988 8.426   8.677   1.00 0.00 ? 49  LEU A CB   1 
ATOM 749  C CG   . LEU A 1 49  ? 455.160 7.276   7.688   1.00 0.00 ? 49  LEU A CG   1 
ATOM 750  C CD1  . LEU A 1 49  ? 453.939 6.378   7.702   1.00 0.00 ? 49  LEU A CD1  1 
ATOM 751  C CD2  . LEU A 1 49  ? 455.418 7.805   6.282   1.00 0.00 ? 49  LEU A CD2  1 
ATOM 752  H H    . LEU A 1 49  ? 453.431 10.757  9.816   1.00 0.00 ? 49  LEU A H    1 
ATOM 753  H HA   . LEU A 1 49  ? 454.387 9.884   7.246   1.00 0.00 ? 49  LEU A HA   1 
ATOM 754  H HB2  . LEU A 1 49  ? 455.960 8.859   8.868   1.00 0.00 ? 49  LEU A HB2  1 
ATOM 755  H HB3  . LEU A 1 49  ? 454.604 8.022   9.601   1.00 0.00 ? 49  LEU A HB3  1 
ATOM 756  H HG   . LEU A 1 49  ? 456.007 6.687   7.987   1.00 0.00 ? 49  LEU A HG   1 
ATOM 757  H HD11 . LEU A 1 49  ? 453.311 6.613   6.856   1.00 0.00 ? 49  LEU A HD11 1 
ATOM 758  H HD12 . LEU A 1 49  ? 453.386 6.540   8.615   1.00 0.00 ? 49  LEU A HD12 1 
ATOM 759  H HD13 . LEU A 1 49  ? 454.250 5.345   7.646   1.00 0.00 ? 49  LEU A HD13 1 
ATOM 760  H HD21 . LEU A 1 49  ? 455.856 8.790   6.342   1.00 0.00 ? 49  LEU A HD21 1 
ATOM 761  H HD22 . LEU A 1 49  ? 454.484 7.860   5.739   1.00 0.00 ? 49  LEU A HD22 1 
ATOM 762  H HD23 . LEU A 1 49  ? 456.096 7.141   5.765   1.00 0.00 ? 49  LEU A HD23 1 
ATOM 763  N N    . SER A 1 50  ? 451.997 9.292   6.938   1.00 0.00 ? 50  SER A N    1 
ATOM 764  C CA   . SER A 1 50  ? 450.643 8.816   6.686   1.00 0.00 ? 50  SER A CA   1 
ATOM 765  C C    . SER A 1 50  ? 450.679 7.535   5.853   1.00 0.00 ? 50  SER A C    1 
ATOM 766  O O    . SER A 1 50  ? 451.432 7.440   4.888   1.00 0.00 ? 50  SER A O    1 
ATOM 767  C CB   . SER A 1 50  ? 449.827 9.900   5.976   1.00 0.00 ? 50  SER A CB   1 
ATOM 768  O OG   . SER A 1 50  ? 448.612 10.154  6.659   1.00 0.00 ? 50  SER A OG   1 
ATOM 769  H H    . SER A 1 50  ? 452.448 9.831   6.255   1.00 0.00 ? 50  SER A H    1 
ATOM 770  H HA   . SER A 1 50  ? 450.185 8.596   7.638   1.00 0.00 ? 50  SER A HA   1 
ATOM 771  H HB2  . SER A 1 50  ? 450.400 10.814  5.945   1.00 0.00 ? 50  SER A HB2  1 
ATOM 772  H HB3  . SER A 1 50  ? 449.602 9.581   4.970   1.00 0.00 ? 50  SER A HB3  1 
ATOM 773  H HG   . SER A 1 50  ? 448.784 10.239  7.599   1.00 0.00 ? 50  SER A HG   1 
ATOM 774  N N    . VAL A 1 51  ? 449.875 6.547   6.242   1.00 0.00 ? 51  VAL A N    1 
ATOM 775  C CA   . VAL A 1 51  ? 449.833 5.269   5.532   1.00 0.00 ? 51  VAL A CA   1 
ATOM 776  C C    . VAL A 1 51  ? 448.397 4.865   5.200   1.00 0.00 ? 51  VAL A C    1 
ATOM 777  O O    . VAL A 1 51  ? 447.505 4.956   6.044   1.00 0.00 ? 51  VAL A O    1 
ATOM 778  C CB   . VAL A 1 51  ? 450.492 4.146   6.366   1.00 0.00 ? 51  VAL A CB   1 
ATOM 779  C CG1  . VAL A 1 51  ? 450.422 2.804   5.648   1.00 0.00 ? 51  VAL A CG1  1 
ATOM 780  C CG2  . VAL A 1 51  ? 451.936 4.493   6.695   1.00 0.00 ? 51  VAL A CG2  1 
ATOM 781  H H    . VAL A 1 51  ? 449.304 6.676   7.028   1.00 0.00 ? 51  VAL A H    1 
ATOM 782  H HA   . VAL A 1 51  ? 450.388 5.380   4.612   1.00 0.00 ? 51  VAL A HA   1 
ATOM 783  H HB   . VAL A 1 51  ? 449.948 4.059   7.295   1.00 0.00 ? 51  VAL A HB   1 
ATOM 784  H HG11 . VAL A 1 51  ? 450.443 2.963   4.581   1.00 0.00 ? 51  VAL A HG11 1 
ATOM 785  H HG12 . VAL A 1 51  ? 449.508 2.298   5.920   1.00 0.00 ? 51  VAL A HG12 1 
ATOM 786  H HG13 . VAL A 1 51  ? 451.271 2.197   5.939   1.00 0.00 ? 51  VAL A HG13 1 
ATOM 787  H HG21 . VAL A 1 51  ? 452.544 3.599   6.640   1.00 0.00 ? 51  VAL A HG21 1 
ATOM 788  H HG22 . VAL A 1 51  ? 451.987 4.901   7.693   1.00 0.00 ? 51  VAL A HG22 1 
ATOM 789  H HG23 . VAL A 1 51  ? 452.302 5.222   5.986   1.00 0.00 ? 51  VAL A HG23 1 
ATOM 790  N N    . SER A 1 52  ? 448.183 4.411   3.967   1.00 0.00 ? 52  SER A N    1 
ATOM 791  C CA   . SER A 1 52  ? 446.857 3.984   3.526   1.00 0.00 ? 52  SER A CA   1 
ATOM 792  C C    . SER A 1 52  ? 446.651 2.500   3.812   1.00 0.00 ? 52  SER A C    1 
ATOM 793  O O    . SER A 1 52  ? 447.604 1.777   4.104   1.00 0.00 ? 52  SER A O    1 
ATOM 794  C CB   . SER A 1 52  ? 446.669 4.273   2.029   1.00 0.00 ? 52  SER A CB   1 
ATOM 795  O OG   . SER A 1 52  ? 446.694 3.081   1.258   1.00 0.00 ? 52  SER A OG   1 
ATOM 796  H H    . SER A 1 52  ? 448.935 4.357   3.341   1.00 0.00 ? 52  SER A H    1 
ATOM 797  H HA   . SER A 1 52  ? 446.126 4.545   4.086   1.00 0.00 ? 52  SER A HA   1 
ATOM 798  H HB2  . SER A 1 52  ? 445.717 4.759   1.877   1.00 0.00 ? 52  SER A HB2  1 
ATOM 799  H HB3  . SER A 1 52  ? 447.461 4.925   1.687   1.00 0.00 ? 52  SER A HB3  1 
ATOM 800  H HG   . SER A 1 52  ? 447.457 2.554   1.506   1.00 0.00 ? 52  SER A HG   1 
ATOM 801  N N    . GLU A 1 53  ? 445.404 2.048   3.724   1.00 0.00 ? 53  GLU A N    1 
ATOM 802  C CA   . GLU A 1 53  ? 445.091 0.647   3.972   1.00 0.00 ? 53  GLU A CA   1 
ATOM 803  C C    . GLU A 1 53  ? 443.656 0.313   3.572   1.00 0.00 ? 53  GLU A C    1 
ATOM 804  O O    . GLU A 1 53  ? 443.427 -0.555  2.730   1.00 0.00 ? 53  GLU A O    1 
ATOM 805  C CB   . GLU A 1 53  ? 445.320 0.298   5.445   1.00 0.00 ? 53  GLU A CB   1 
ATOM 806  C CG   . GLU A 1 53  ? 444.833 1.365   6.414   1.00 0.00 ? 53  GLU A CG   1 
ATOM 807  C CD   . GLU A 1 53  ? 445.533 1.292   7.757   1.00 0.00 ? 53  GLU A CD   1 
ATOM 808  O OE1  . GLU A 1 53  ? 445.085 0.506   8.617   1.00 0.00 ? 53  GLU A OE1  1 
ATOM 809  O OE2  . GLU A 1 53  ? 446.528 2.022   7.948   1.00 0.00 ? 53  GLU A OE2  1 
ATOM 810  H H    . GLU A 1 53  ? 444.685 2.668   3.482   1.00 0.00 ? 53  GLU A H    1 
ATOM 811  H HA   . GLU A 1 53  ? 445.762 0.056   3.369   1.00 0.00 ? 53  GLU A HA   1 
ATOM 812  H HB2  . GLU A 1 53  ? 444.802 -0.622  5.668   1.00 0.00 ? 53  GLU A HB2  1 
ATOM 813  H HB3  . GLU A 1 53  ? 446.378 0.152   5.606   1.00 0.00 ? 53  GLU A HB3  1 
ATOM 814  H HG2  . GLU A 1 53  ? 445.016 2.337   5.983   1.00 0.00 ? 53  GLU A HG2  1 
ATOM 815  H HG3  . GLU A 1 53  ? 443.773 1.234   6.570   1.00 0.00 ? 53  GLU A HG3  1 
ATOM 816  N N    . ASN A 1 54  ? 442.693 0.998   4.181   1.00 0.00 ? 54  ASN A N    1 
ATOM 817  C CA   . ASN A 1 54  ? 441.285 0.758   3.881   1.00 0.00 ? 54  ASN A CA   1 
ATOM 818  C C    . ASN A 1 54  ? 440.415 1.936   4.312   1.00 0.00 ? 54  ASN A C    1 
ATOM 819  O O    . ASN A 1 54  ? 439.707 2.525   3.496   1.00 0.00 ? 54  ASN A O    1 
ATOM 820  C CB   . ASN A 1 54  ? 440.803 -0.524  4.568   1.00 0.00 ? 54  ASN A CB   1 
ATOM 821  C CG   . ASN A 1 54  ? 441.335 -0.665  5.982   1.00 0.00 ? 54  ASN A CG   1 
ATOM 822  O OD1  . ASN A 1 54  ? 440.662 -0.311  6.950   1.00 0.00 ? 54  ASN A OD1  1 
ATOM 823  N ND2  . ASN A 1 54  ? 442.551 -1.185  6.107   1.00 0.00 ? 54  ASN A ND2  1 
ATOM 824  H H    . ASN A 1 54  ? 442.933 1.676   4.847   1.00 0.00 ? 54  ASN A H    1 
ATOM 825  H HA   . ASN A 1 54  ? 441.193 0.635   2.813   1.00 0.00 ? 54  ASN A HA   1 
ATOM 826  H HB2  . ASN A 1 54  ? 439.724 -0.518  4.611   1.00 0.00 ? 54  ASN A HB2  1 
ATOM 827  H HB3  . ASN A 1 54  ? 441.130 -1.377  3.993   1.00 0.00 ? 54  ASN A HB3  1 
ATOM 828  H HD21 . ASN A 1 54  ? 443.029 -1.445  5.292   1.00 0.00 ? 54  ASN A HD21 1 
ATOM 829  H HD22 . ASN A 1 54  ? 442.919 -1.288  7.009   1.00 0.00 ? 54  ASN A HD22 1 
ATOM 830  N N    . SER A 1 55  ? 440.469 2.276   5.597   1.00 0.00 ? 55  SER A N    1 
ATOM 831  C CA   . SER A 1 55  ? 439.679 3.383   6.125   1.00 0.00 ? 55  SER A CA   1 
ATOM 832  C C    . SER A 1 55  ? 440.559 4.596   6.405   1.00 0.00 ? 55  SER A C    1 
ATOM 833  O O    . SER A 1 55  ? 441.294 4.622   7.391   1.00 0.00 ? 55  SER A O    1 
ATOM 834  C CB   . SER A 1 55  ? 438.957 2.956   7.403   1.00 0.00 ? 55  SER A CB   1 
ATOM 835  O OG   . SER A 1 55  ? 437.730 3.650   7.552   1.00 0.00 ? 55  SER A OG   1 
ATOM 836  H H    . SER A 1 55  ? 441.051 1.771   6.202   1.00 0.00 ? 55  SER A H    1 
ATOM 837  H HA   . SER A 1 55  ? 438.945 3.651   5.380   1.00 0.00 ? 55  SER A HA   1 
ATOM 838  H HB2  . SER A 1 55  ? 438.754 1.896   7.363   1.00 0.00 ? 55  SER A HB2  1 
ATOM 839  H HB3  . SER A 1 55  ? 439.584 3.170   8.257   1.00 0.00 ? 55  SER A HB3  1 
ATOM 840  H HG   . SER A 1 55  ? 437.681 4.029   8.433   1.00 0.00 ? 55  SER A HG   1 
ATOM 841  N N    . ARG A 1 56  ? 440.468 5.597   5.529   1.00 0.00 ? 56  ARG A N    1 
ATOM 842  C CA   . ARG A 1 56  ? 441.244 6.832   5.656   1.00 0.00 ? 56  ARG A CA   1 
ATOM 843  C C    . ARG A 1 56  ? 442.727 6.548   5.897   1.00 0.00 ? 56  ARG A C    1 
ATOM 844  O O    . ARG A 1 56  ? 443.118 5.418   6.188   1.00 0.00 ? 56  ARG A O    1 
ATOM 845  C CB   . ARG A 1 56  ? 440.677 7.710   6.778   1.00 0.00 ? 56  ARG A CB   1 
ATOM 846  C CG   . ARG A 1 56  ? 440.999 7.218   8.179   1.00 0.00 ? 56  ARG A CG   1 
ATOM 847  C CD   . ARG A 1 56  ? 441.389 8.366   9.096   1.00 0.00 ? 56  ARG A CD   1 
ATOM 848  N NE   . ARG A 1 56  ? 441.173 8.042   10.504  1.00 0.00 ? 56  ARG A NE   1 
ATOM 849  C CZ   . ARG A 1 56  ? 441.972 7.248   11.214  1.00 0.00 ? 56  ARG A CZ   1 
ATOM 850  N NH1  . ARG A 1 56  ? 443.036 6.691   10.649  1.00 0.00 ? 56  ARG A NH1  1 
ATOM 851  N NH2  . ARG A 1 56  ? 441.706 7.011   12.491  1.00 0.00 ? 56  ARG A NH2  1 
ATOM 852  H H    . ARG A 1 56  ? 439.856 5.504   4.772   1.00 0.00 ? 56  ARG A H    1 
ATOM 853  H HA   . ARG A 1 56  ? 441.150 7.367   4.722   1.00 0.00 ? 56  ARG A HA   1 
ATOM 854  H HB2  . ARG A 1 56  ? 441.076 8.708   6.672   1.00 0.00 ? 56  ARG A HB2  1 
ATOM 855  H HB3  . ARG A 1 56  ? 439.603 7.751   6.675   1.00 0.00 ? 56  ARG A HB3  1 
ATOM 856  H HG2  . ARG A 1 56  ? 440.128 6.726   8.583   1.00 0.00 ? 56  ARG A HG2  1 
ATOM 857  H HG3  . ARG A 1 56  ? 441.818 6.518   8.127   1.00 0.00 ? 56  ARG A HG3  1 
ATOM 858  H HD2  . ARG A 1 56  ? 442.435 8.589   8.944   1.00 0.00 ? 56  ARG A HD2  1 
ATOM 859  H HD3  . ARG A 1 56  ? 440.796 9.231   8.839   1.00 0.00 ? 56  ARG A HD3  1 
ATOM 860  H HE   . ARG A 1 56  ? 440.393 8.438   10.945  1.00 0.00 ? 56  ARG A HE   1 
ATOM 861  H HH11 . ARG A 1 56  ? 443.242 6.865   9.686   1.00 0.00 ? 56  ARG A HH11 1 
ATOM 862  H HH12 . ARG A 1 56  ? 443.633 6.096   11.187  1.00 0.00 ? 56  ARG A HH12 1 
ATOM 863  H HH21 . ARG A 1 56  ? 440.905 7.428   12.920  1.00 0.00 ? 56  ARG A HH21 1 
ATOM 864  H HH22 . ARG A 1 56  ? 442.306 6.415   13.024  1.00 0.00 ? 56  ARG A HH22 1 
ATOM 865  N N    . VAL A 1 57  ? 443.552 7.580   5.765   1.00 0.00 ? 57  VAL A N    1 
ATOM 866  C CA   . VAL A 1 57  ? 444.987 7.429   5.964   1.00 0.00 ? 57  VAL A CA   1 
ATOM 867  C C    . VAL A 1 57  ? 445.330 7.328   7.441   1.00 0.00 ? 57  VAL A C    1 
ATOM 868  O O    . VAL A 1 57  ? 444.538 7.706   8.303   1.00 0.00 ? 57  VAL A O    1 
ATOM 869  C CB   . VAL A 1 57  ? 445.783 8.599   5.362   1.00 0.00 ? 57  VAL A CB   1 
ATOM 870  C CG1  . VAL A 1 57  ? 447.261 8.249   5.293   1.00 0.00 ? 57  VAL A CG1  1 
ATOM 871  C CG2  . VAL A 1 57  ? 445.250 8.966   3.988   1.00 0.00 ? 57  VAL A CG2  1 
ATOM 872  H H    . VAL A 1 57  ? 443.190 8.456   5.518   1.00 0.00 ? 57  VAL A H    1 
ATOM 873  H HA   . VAL A 1 57  ? 445.296 6.520   5.472   1.00 0.00 ? 57  VAL A HA   1 
ATOM 874  H HB   . VAL A 1 57  ? 445.669 9.457   6.010   1.00 0.00 ? 57  VAL A HB   1 
ATOM 875  H HG11 . VAL A 1 57  ? 447.780 8.993   4.709   1.00 0.00 ? 57  VAL A HG11 1 
ATOM 876  H HG12 . VAL A 1 57  ? 447.380 7.279   4.831   1.00 0.00 ? 57  VAL A HG12 1 
ATOM 877  H HG13 . VAL A 1 57  ? 447.671 8.223   6.293   1.00 0.00 ? 57  VAL A HG13 1 
ATOM 878  H HG21 . VAL A 1 57  ? 445.806 9.806   3.600   1.00 0.00 ? 57  VAL A HG21 1 
ATOM 879  H HG22 . VAL A 1 57  ? 444.206 9.232   4.065   1.00 0.00 ? 57  VAL A HG22 1 
ATOM 880  H HG23 . VAL A 1 57  ? 445.361 8.123   3.324   1.00 0.00 ? 57  VAL A HG23 1 
ATOM 881  N N    . SER A 1 58  ? 446.522 6.820   7.724   1.00 0.00 ? 58  SER A N    1 
ATOM 882  C CA   . SER A 1 58  ? 446.980 6.674   9.096   1.00 0.00 ? 58  SER A CA   1 
ATOM 883  C C    . SER A 1 58  ? 448.242 7.494   9.344   1.00 0.00 ? 58  SER A C    1 
ATOM 884  O O    . SER A 1 58  ? 449.356 6.993   9.193   1.00 0.00 ? 58  SER A O    1 
ATOM 885  C CB   . SER A 1 58  ? 447.247 5.201   9.412   1.00 0.00 ? 58  SER A CB   1 
ATOM 886  O OG   . SER A 1 58  ? 447.284 4.977   10.811  1.00 0.00 ? 58  SER A OG   1 
ATOM 887  H H    . SER A 1 58  ? 447.108 6.539   6.991   1.00 0.00 ? 58  SER A H    1 
ATOM 888  H HA   . SER A 1 58  ? 446.199 7.036   9.743   1.00 0.00 ? 58  SER A HA   1 
ATOM 889  H HB2  . SER A 1 58  ? 446.462 4.595   8.984   1.00 0.00 ? 58  SER A HB2  1 
ATOM 890  H HB3  . SER A 1 58  ? 448.198 4.910   8.987   1.00 0.00 ? 58  SER A HB3  1 
ATOM 891  H HG   . SER A 1 58  ? 448.187 4.793   11.082  1.00 0.00 ? 58  SER A HG   1 
ATOM 892  N N    . HIS A 1 59  ? 448.063 8.752   9.737   1.00 0.00 ? 59  HIS A N    1 
ATOM 893  C CA   . HIS A 1 59  ? 449.197 9.626   10.016  1.00 0.00 ? 59  HIS A CA   1 
ATOM 894  C C    . HIS A 1 59  ? 449.906 9.176   11.285  1.00 0.00 ? 59  HIS A C    1 
ATOM 895  O O    . HIS A 1 59  ? 449.276 8.949   12.318  1.00 0.00 ? 59  HIS A O    1 
ATOM 896  C CB   . HIS A 1 59  ? 448.746 11.082  10.151  1.00 0.00 ? 59  HIS A CB   1 
ATOM 897  C CG   . HIS A 1 59  ? 447.705 11.294  11.204  1.00 0.00 ? 59  HIS A CG   1 
ATOM 898  N ND1  . HIS A 1 59  ? 446.397 11.617  10.914  1.00 0.00 ? 59  HIS A ND1  1 
ATOM 899  C CD2  . HIS A 1 59  ? 447.784 11.229  12.555  1.00 0.00 ? 59  HIS A CD2  1 
ATOM 900  C CE1  . HIS A 1 59  ? 445.715 11.741  12.039  1.00 0.00 ? 59  HIS A CE1  1 
ATOM 901  N NE2  . HIS A 1 59  ? 446.534 11.509  13.049  1.00 0.00 ? 59  HIS A NE2  1 
ATOM 902  H H    . HIS A 1 59  ? 447.152 9.096   9.850   1.00 0.00 ? 59  HIS A H    1 
ATOM 903  H HA   . HIS A 1 59  ? 449.888 9.550   9.191   1.00 0.00 ? 59  HIS A HA   1 
ATOM 904  H HB2  . HIS A 1 59  ? 449.603 11.695  10.399  1.00 0.00 ? 59  HIS A HB2  1 
ATOM 905  H HB3  . HIS A 1 59  ? 448.338 11.412  9.207   1.00 0.00 ? 59  HIS A HB3  1 
ATOM 906  H HD1  . HIS A 1 59  ? 446.023 11.737  10.016  1.00 0.00 ? 59  HIS A HD1  1 
ATOM 907  H HD2  . HIS A 1 59  ? 448.666 10.999  13.135  1.00 0.00 ? 59  HIS A HD2  1 
ATOM 908  H HE1  . HIS A 1 59  ? 444.667 11.988  12.119  1.00 0.00 ? 59  HIS A HE1  1 
ATOM 909  H HE2  . HIS A 1 59  ? 446.258 11.408  13.984  1.00 0.00 ? 59  HIS A HE2  1 
ATOM 910  N N    . TYR A 1 60  ? 451.219 9.050   11.195  1.00 0.00 ? 60  TYR A N    1 
ATOM 911  C CA   . TYR A 1 60  ? 452.023 8.628   12.330  1.00 0.00 ? 60  TYR A CA   1 
ATOM 912  C C    . TYR A 1 60  ? 452.907 9.770   12.807  1.00 0.00 ? 60  TYR A C    1 
ATOM 913  O O    . TYR A 1 60  ? 453.340 10.604  12.011  1.00 0.00 ? 60  TYR A O    1 
ATOM 914  C CB   . TYR A 1 60  ? 452.875 7.416   11.954  1.00 0.00 ? 60  TYR A CB   1 
ATOM 915  C CG   . TYR A 1 60  ? 452.112 6.109   11.983  1.00 0.00 ? 60  TYR A CG   1 
ATOM 916  C CD1  . TYR A 1 60  ? 451.628 5.590   13.178  1.00 0.00 ? 60  TYR A CD1  1 
ATOM 917  C CD2  . TYR A 1 60  ? 451.874 5.396   10.815  1.00 0.00 ? 60  TYR A CD2  1 
ATOM 918  C CE1  . TYR A 1 60  ? 450.929 4.398   13.207  1.00 0.00 ? 60  TYR A CE1  1 
ATOM 919  C CE2  . TYR A 1 60  ? 451.176 4.203   10.835  1.00 0.00 ? 60  TYR A CE2  1 
ATOM 920  C CZ   . TYR A 1 60  ? 450.705 3.708   12.033  1.00 0.00 ? 60  TYR A CZ   1 
ATOM 921  O OH   . TYR A 1 60  ? 450.008 2.519   12.062  1.00 0.00 ? 60  TYR A OH   1 
ATOM 922  H H    . TYR A 1 60  ? 451.653 9.254   10.339  1.00 0.00 ? 60  TYR A H    1 
ATOM 923  H HA   . TYR A 1 60  ? 451.350 8.352   13.128  1.00 0.00 ? 60  TYR A HA   1 
ATOM 924  H HB2  . TYR A 1 60  ? 453.259 7.553   10.955  1.00 0.00 ? 60  TYR A HB2  1 
ATOM 925  H HB3  . TYR A 1 60  ? 453.700 7.338   12.645  1.00 0.00 ? 60  TYR A HB3  1 
ATOM 926  H HD1  . TYR A 1 60  ? 451.803 6.132   14.095  1.00 0.00 ? 60  TYR A HD1  1 
ATOM 927  H HD2  . TYR A 1 60  ? 452.243 5.785   9.879   1.00 0.00 ? 60  TYR A HD2  1 
ATOM 928  H HE1  . TYR A 1 60  ? 450.561 4.011   14.146  1.00 0.00 ? 60  TYR A HE1  1 
ATOM 929  H HE2  . TYR A 1 60  ? 451.001 3.664   9.914   1.00 0.00 ? 60  TYR A HE2  1 
ATOM 930  H HH   . TYR A 1 60  ? 449.964 2.148   11.177  1.00 0.00 ? 60  TYR A HH   1 
ATOM 931  N N    . ILE A 1 61  ? 453.177 9.804   14.105  1.00 0.00 ? 61  ILE A N    1 
ATOM 932  C CA   . ILE A 1 61  ? 454.014 10.844  14.673  1.00 0.00 ? 61  ILE A CA   1 
ATOM 933  C C    . ILE A 1 61  ? 455.471 10.400  14.693  1.00 0.00 ? 61  ILE A C    1 
ATOM 934  O O    . ILE A 1 61  ? 455.779 9.263   15.050  1.00 0.00 ? 61  ILE A O    1 
ATOM 935  C CB   . ILE A 1 61  ? 453.560 11.217  16.101  1.00 0.00 ? 61  ILE A CB   1 
ATOM 936  C CG1  . ILE A 1 61  ? 453.952 12.656  16.421  1.00 0.00 ? 61  ILE A CG1  1 
ATOM 937  C CG2  . ILE A 1 61  ? 454.162 10.270  17.125  1.00 0.00 ? 61  ILE A CG2  1 
ATOM 938  C CD1  . ILE A 1 61  ? 453.202 13.241  17.598  1.00 0.00 ? 61  ILE A CD1  1 
ATOM 939  H H    . ILE A 1 61  ? 452.815 9.112   14.694  1.00 0.00 ? 61  ILE A H    1 
ATOM 940  H HA   . ILE A 1 61  ? 453.925 11.721  14.048  1.00 0.00 ? 61  ILE A HA   1 
ATOM 941  H HB   . ILE A 1 61  ? 452.486 11.125  16.150  1.00 0.00 ? 61  ILE A HB   1 
ATOM 942  H HG12 . ILE A 1 61  ? 455.006 12.691  16.648  1.00 0.00 ? 61  ILE A HG12 1 
ATOM 943  H HG13 . ILE A 1 61  ? 453.754 13.273  15.560  1.00 0.00 ? 61  ILE A HG13 1 
ATOM 944  H HG21 . ILE A 1 61  ? 453.726 10.464  18.094  1.00 0.00 ? 61  ILE A HG21 1 
ATOM 945  H HG22 . ILE A 1 61  ? 455.229 10.430  17.170  1.00 0.00 ? 61  ILE A HG22 1 
ATOM 946  H HG23 . ILE A 1 61  ? 453.962 9.250   16.835  1.00 0.00 ? 61  ILE A HG23 1 
ATOM 947  H HD11 . ILE A 1 61  ? 453.321 14.314  17.603  1.00 0.00 ? 61  ILE A HD11 1 
ATOM 948  H HD12 . ILE A 1 61  ? 453.597 12.831  18.516  1.00 0.00 ? 61  ILE A HD12 1 
ATOM 949  H HD13 . ILE A 1 61  ? 452.154 12.995  17.516  1.00 0.00 ? 61  ILE A HD13 1 
ATOM 950  N N    . ILE A 1 62  ? 456.362 11.298  14.308  1.00 0.00 ? 62  ILE A N    1 
ATOM 951  C CA   . ILE A 1 62  ? 457.781 10.992  14.283  1.00 0.00 ? 62  ILE A CA   1 
ATOM 952  C C    . ILE A 1 62  ? 458.597 12.124  14.893  1.00 0.00 ? 62  ILE A C    1 
ATOM 953  O O    . ILE A 1 62  ? 458.243 13.298  14.781  1.00 0.00 ? 62  ILE A O    1 
ATOM 954  C CB   . ILE A 1 62  ? 458.280 10.729  12.842  1.00 0.00 ? 62  ILE A CB   1 
ATOM 955  C CG1  . ILE A 1 62  ? 457.923 9.311   12.398  1.00 0.00 ? 62  ILE A CG1  1 
ATOM 956  C CG2  . ILE A 1 62  ? 459.784 10.941  12.748  1.00 0.00 ? 62  ILE A CG2  1 
ATOM 957  C CD1  . ILE A 1 62  ? 457.968 9.118   10.898  1.00 0.00 ? 62  ILE A CD1  1 
ATOM 958  H H    . ILE A 1 62  ? 456.058 12.186  14.035  1.00 0.00 ? 62  ILE A H    1 
ATOM 959  H HA   . ILE A 1 62  ? 457.939 10.096  14.864  1.00 0.00 ? 62  ILE A HA   1 
ATOM 960  H HB   . ILE A 1 62  ? 457.800 11.437  12.183  1.00 0.00 ? 62  ILE A HB   1 
ATOM 961  H HG12 . ILE A 1 62  ? 458.624 8.618   12.838  1.00 0.00 ? 62  ILE A HG12 1 
ATOM 962  H HG13 . ILE A 1 62  ? 456.925 9.073   12.736  1.00 0.00 ? 62  ILE A HG13 1 
ATOM 963  H HG21 . ILE A 1 62  ? 460.003 11.995  12.796  1.00 0.00 ? 62  ILE A HG21 1 
ATOM 964  H HG22 . ILE A 1 62  ? 460.149 10.538  11.816  1.00 0.00 ? 62  ILE A HG22 1 
ATOM 965  H HG23 . ILE A 1 62  ? 460.266 10.438  13.573  1.00 0.00 ? 62  ILE A HG23 1 
ATOM 966  H HD11 . ILE A 1 62  ? 457.820 10.068  10.408  1.00 0.00 ? 62  ILE A HD11 1 
ATOM 967  H HD12 . ILE A 1 62  ? 457.189 8.433   10.599  1.00 0.00 ? 62  ILE A HD12 1 
ATOM 968  H HD13 . ILE A 1 62  ? 458.930 8.714   10.617  1.00 0.00 ? 62  ILE A HD13 1 
ATOM 969  N N    . ASN A 1 63  ? 459.701 11.756  15.523  1.00 0.00 ? 63  ASN A N    1 
ATOM 970  C CA   . ASN A 1 63  ? 460.596 12.731  16.136  1.00 0.00 ? 63  ASN A CA   1 
ATOM 971  C C    . ASN A 1 63  ? 461.955 12.700  15.439  1.00 0.00 ? 63  ASN A C    1 
ATOM 972  O O    . ASN A 1 63  ? 462.323 11.692  14.842  1.00 0.00 ? 63  ASN A O    1 
ATOM 973  C CB   . ASN A 1 63  ? 460.755 12.445  17.631  1.00 0.00 ? 63  ASN A CB   1 
ATOM 974  C CG   . ASN A 1 63  ? 461.141 13.681  18.419  1.00 0.00 ? 63  ASN A CG   1 
ATOM 975  O OD1  . ASN A 1 63  ? 460.481 14.716  18.335  1.00 0.00 ? 63  ASN A OD1  1 
ATOM 976  N ND2  . ASN A 1 63  ? 462.217 13.578  19.190  1.00 0.00 ? 63  ASN A ND2  1 
ATOM 977  H H    . ASN A 1 63  ? 459.927 10.799  15.565  1.00 0.00 ? 63  ASN A H    1 
ATOM 978  H HA   . ASN A 1 63  ? 460.160 13.711  16.007  1.00 0.00 ? 63  ASN A HA   1 
ATOM 979  H HB2  . ASN A 1 63  ? 459.820 12.071  18.021  1.00 0.00 ? 63  ASN A HB2  1 
ATOM 980  H HB3  . ASN A 1 63  ? 461.521 11.697  17.770  1.00 0.00 ? 63  ASN A HB3  1 
ATOM 981  H HD21 . ASN A 1 63  ? 462.694 12.722  19.208  1.00 0.00 ? 63  ASN A HD21 1 
ATOM 982  H HD22 . ASN A 1 63  ? 462.490 14.362  19.711  1.00 0.00 ? 63  ASN A HD22 1 
ATOM 983  N N    . SER A 1 64  ? 462.698 13.800  15.501  1.00 0.00 ? 64  SER A N    1 
ATOM 984  C CA   . SER A 1 64  ? 464.008 13.855  14.853  1.00 0.00 ? 64  SER A CA   1 
ATOM 985  C C    . SER A 1 64  ? 464.701 15.193  15.088  1.00 0.00 ? 64  SER A C    1 
ATOM 986  O O    . SER A 1 64  ? 464.089 16.151  15.561  1.00 0.00 ? 64  SER A O    1 
ATOM 987  C CB   . SER A 1 64  ? 463.868 13.604  13.350  1.00 0.00 ? 64  SER A CB   1 
ATOM 988  O OG   . SER A 1 64  ? 465.065 13.928  12.665  1.00 0.00 ? 64  SER A OG   1 
ATOM 989  H H    . SER A 1 64  ? 462.362 14.586  15.981  1.00 0.00 ? 64  SER A H    1 
ATOM 990  H HA   . SER A 1 64  ? 464.617 13.072  15.279  1.00 0.00 ? 64  SER A HA   1 
ATOM 991  H HB2  . SER A 1 64  ? 463.642 12.562  13.181  1.00 0.00 ? 64  SER A HB2  1 
ATOM 992  H HB3  . SER A 1 64  ? 463.067 14.214  12.959  1.00 0.00 ? 64  SER A HB3  1 
ATOM 993  H HG   . SER A 1 64  ? 464.857 14.432  11.876  1.00 0.00 ? 64  SER A HG   1 
ATOM 994  N N    . SER A 1 65  ? 465.987 15.243  14.751  1.00 0.00 ? 65  SER A N    1 
ATOM 995  C CA   . SER A 1 65  ? 466.782 16.454  14.918  1.00 0.00 ? 65  SER A CA   1 
ATOM 996  C C    . SER A 1 65  ? 468.044 16.400  14.059  1.00 0.00 ? 65  SER A C    1 
ATOM 997  O O    . SER A 1 65  ? 468.302 15.409  13.376  1.00 0.00 ? 65  SER A O    1 
ATOM 998  C CB   . SER A 1 65  ? 467.158 16.645  16.389  1.00 0.00 ? 65  SER A CB   1 
ATOM 999  O OG   . SER A 1 65  ? 467.018 18.000  16.780  1.00 0.00 ? 65  SER A OG   1 
ATOM 1000 H H    . SER A 1 65  ? 466.413 14.443  14.380  1.00 0.00 ? 65  SER A H    1 
ATOM 1001 H HA   . SER A 1 65  ? 466.180 17.291  14.599  1.00 0.00 ? 65  SER A HA   1 
ATOM 1002 H HB2  . SER A 1 65  ? 466.512 16.038  17.005  1.00 0.00 ? 65  SER A HB2  1 
ATOM 1003 H HB3  . SER A 1 65  ? 468.184 16.343  16.539  1.00 0.00 ? 65  SER A HB3  1 
ATOM 1004 H HG   . SER A 1 65  ? 466.087 18.207  16.890  1.00 0.00 ? 65  SER A HG   1 
ATOM 1005 N N    . GLY A 1 66  ? 468.819 17.479  14.094  1.00 0.00 ? 66  GLY A N    1 
ATOM 1006 C CA   . GLY A 1 66  ? 470.041 17.554  13.312  1.00 0.00 ? 66  GLY A CA   1 
ATOM 1007 C C    . GLY A 1 66  ? 471.179 16.692  13.849  1.00 0.00 ? 66  GLY A C    1 
ATOM 1008 O O    . GLY A 1 66  ? 471.835 15.995  13.075  1.00 0.00 ? 66  GLY A O    1 
ATOM 1009 H H    . GLY A 1 66  ? 468.552 18.240  14.650  1.00 0.00 ? 66  GLY A H    1 
ATOM 1010 H HA2  . GLY A 1 66  ? 469.822 17.240  12.303  1.00 0.00 ? 66  GLY A HA2  1 
ATOM 1011 H HA3  . GLY A 1 66  ? 470.370 18.582  13.288  1.00 0.00 ? 66  GLY A HA3  1 
ATOM 1012 N N    . PRO A 1 67  ? 471.460 16.724  15.168  1.00 0.00 ? 67  PRO A N    1 
ATOM 1013 C CA   . PRO A 1 67  ? 472.549 15.947  15.771  1.00 0.00 ? 67  PRO A CA   1 
ATOM 1014 C C    . PRO A 1 67  ? 472.638 14.517  15.243  1.00 0.00 ? 67  PRO A C    1 
ATOM 1015 O O    . PRO A 1 67  ? 471.727 14.025  14.577  1.00 0.00 ? 67  PRO A O    1 
ATOM 1016 C CB   . PRO A 1 67  ? 472.218 15.946  17.273  1.00 0.00 ? 67  PRO A CB   1 
ATOM 1017 C CG   . PRO A 1 67  ? 470.918 16.673  17.413  1.00 0.00 ? 67  PRO A CG   1 
ATOM 1018 C CD   . PRO A 1 67  ? 470.769 17.523  16.185  1.00 0.00 ? 67  PRO A CD   1 
ATOM 1019 H HA   . PRO A 1 67  ? 473.501 16.434  15.618  1.00 0.00 ? 67  PRO A HA   1 
ATOM 1020 H HB2  . PRO A 1 67  ? 472.136 14.928  17.623  1.00 0.00 ? 67  PRO A HB2  1 
ATOM 1021 H HB3  . PRO A 1 67  ? 473.006 16.450  17.813  1.00 0.00 ? 67  PRO A HB3  1 
ATOM 1022 H HG2  . PRO A 1 67  ? 470.107 15.962  17.474  1.00 0.00 ? 67  PRO A HG2  1 
ATOM 1023 H HG3  . PRO A 1 67  ? 470.940 17.292  18.296  1.00 0.00 ? 67  PRO A HG3  1 
ATOM 1024 H HD2  . PRO A 1 67  ? 469.729 17.653  15.945  1.00 0.00 ? 67  PRO A HD2  1 
ATOM 1025 H HD3  . PRO A 1 67  ? 471.253 18.479  16.322  1.00 0.00 ? 67  PRO A HD3  1 
ATOM 1026 N N    . ARG A 1 68  ? 473.754 13.859  15.553  1.00 0.00 ? 68  ARG A N    1 
ATOM 1027 C CA   . ARG A 1 68  ? 473.993 12.486  15.122  1.00 0.00 ? 68  ARG A CA   1 
ATOM 1028 C C    . ARG A 1 68  ? 473.111 11.506  15.899  1.00 0.00 ? 68  ARG A C    1 
ATOM 1029 O O    . ARG A 1 68  ? 473.104 11.515  17.130  1.00 0.00 ? 68  ARG A O    1 
ATOM 1030 C CB   . ARG A 1 68  ? 475.470 12.129  15.325  1.00 0.00 ? 68  ARG A CB   1 
ATOM 1031 C CG   . ARG A 1 68  ? 476.081 11.351  14.170  1.00 0.00 ? 68  ARG A CG   1 
ATOM 1032 C CD   . ARG A 1 68  ? 477.436 10.773  14.544  1.00 0.00 ? 68  ARG A CD   1 
ATOM 1033 N NE   . ARG A 1 68  ? 478.352 11.798  15.041  1.00 0.00 ? 68  ARG A NE   1 
ATOM 1034 C CZ   . ARG A 1 68  ? 479.072 12.595  14.255  1.00 0.00 ? 68  ARG A CZ   1 
ATOM 1035 N NH1  . ARG A 1 68  ? 478.981 12.495  12.934  1.00 0.00 ? 68  ARG A NH1  1 
ATOM 1036 N NH2  . ARG A 1 68  ? 479.883 13.496  14.791  1.00 0.00 ? 68  ARG A NH2  1 
ATOM 1037 H H    . ARG A 1 68  ? 474.438 14.314  16.086  1.00 0.00 ? 68  ARG A H    1 
ATOM 1038 H HA   . ARG A 1 68  ? 473.758 12.421  14.072  1.00 0.00 ? 68  ARG A HA   1 
ATOM 1039 H HB2  . ARG A 1 68  ? 476.033 13.042  15.451  1.00 0.00 ? 68  ARG A HB2  1 
ATOM 1040 H HB3  . ARG A 1 68  ? 475.564 11.533  16.221  1.00 0.00 ? 68  ARG A HB3  1 
ATOM 1041 H HG2  . ARG A 1 68  ? 475.420 10.543  13.904  1.00 0.00 ? 68  ARG A HG2  1 
ATOM 1042 H HG3  . ARG A 1 68  ? 476.203 12.012  13.325  1.00 0.00 ? 68  ARG A HG3  1 
ATOM 1043 H HD2  . ARG A 1 68  ? 477.295 10.029  15.313  1.00 0.00 ? 68  ARG A HD2  1 
ATOM 1044 H HD3  . ARG A 1 68  ? 477.870 10.309  13.671  1.00 0.00 ? 68  ARG A HD3  1 
ATOM 1045 H HE   . ARG A 1 68  ? 478.436 11.896  16.013  1.00 0.00 ? 68  ARG A HE   1 
ATOM 1046 H HH11 . ARG A 1 68  ? 478.370 11.819  12.523  1.00 0.00 ? 68  ARG A HH11 1 
ATOM 1047 H HH12 . ARG A 1 68  ? 479.526 13.097  12.350  1.00 0.00 ? 68  ARG A HH12 1 
ATOM 1048 H HH21 . ARG A 1 68  ? 479.954 13.577  15.785  1.00 0.00 ? 68  ARG A HH21 1 
ATOM 1049 H HH22 . ARG A 1 68  ? 480.425 14.095  14.201  1.00 0.00 ? 68  ARG A HH22 1 
ATOM 1050 N N    . PRO A 1 69  ? 472.340 10.652  15.192  1.00 0.00 ? 69  PRO A N    1 
ATOM 1051 C CA   . PRO A 1 69  ? 471.445 9.683   15.810  1.00 0.00 ? 69  PRO A CA   1 
ATOM 1052 C C    . PRO A 1 69  ? 471.965 8.231   15.839  1.00 0.00 ? 69  PRO A C    1 
ATOM 1053 O O    . PRO A 1 69  ? 471.159 7.301   15.856  1.00 0.00 ? 69  PRO A O    1 
ATOM 1054 C CB   . PRO A 1 69  ? 470.250 9.773   14.870  1.00 0.00 ? 69  PRO A CB   1 
ATOM 1055 C CG   . PRO A 1 69  ? 470.856 9.986   13.512  1.00 0.00 ? 69  PRO A CG   1 
ATOM 1056 C CD   . PRO A 1 69  ? 472.237 10.576  13.728  1.00 0.00 ? 69  PRO A CD   1 
ATOM 1057 H HA   . PRO A 1 69  ? 471.145 9.985   16.800  1.00 0.00 ? 69  PRO A HA   1 
ATOM 1058 H HB2  . PRO A 1 69  ? 469.684 8.854   14.913  1.00 0.00 ? 69  PRO A HB2  1 
ATOM 1059 H HB3  . PRO A 1 69  ? 469.623 10.604  15.156  1.00 0.00 ? 69  PRO A HB3  1 
ATOM 1060 H HG2  . PRO A 1 69  ? 470.933 9.041   12.996  1.00 0.00 ? 69  PRO A HG2  1 
ATOM 1061 H HG3  . PRO A 1 69  ? 470.244 10.672  12.944  1.00 0.00 ? 69  PRO A HG3  1 
ATOM 1062 H HD2  . PRO A 1 69  ? 472.995 9.924   13.321  1.00 0.00 ? 69  PRO A HD2  1 
ATOM 1063 H HD3  . PRO A 1 69  ? 472.300 11.557  13.284  1.00 0.00 ? 69  PRO A HD3  1 
ATOM 1064 N N    . PRO A 1 70  ? 473.297 7.988   15.847  1.00 0.00 ? 70  PRO A N    1 
ATOM 1065 C CA   . PRO A 1 70  ? 473.831 6.621   15.875  1.00 0.00 ? 70  PRO A CA   1 
ATOM 1066 C C    . PRO A 1 70  ? 473.153 5.754   16.932  1.00 0.00 ? 70  PRO A C    1 
ATOM 1067 O O    . PRO A 1 70  ? 472.467 4.785   16.609  1.00 0.00 ? 70  PRO A O    1 
ATOM 1068 C CB   . PRO A 1 70  ? 475.307 6.817   16.220  1.00 0.00 ? 70  PRO A CB   1 
ATOM 1069 C CG   . PRO A 1 70  ? 475.638 8.183   15.732  1.00 0.00 ? 70  PRO A CG   1 
ATOM 1070 C CD   . PRO A 1 70  ? 474.373 8.994   15.827  1.00 0.00 ? 70  PRO A CD   1 
ATOM 1071 H HA   . PRO A 1 70  ? 473.744 6.143   14.910  1.00 0.00 ? 70  PRO A HA   1 
ATOM 1072 H HB2  . PRO A 1 70  ? 475.446 6.734   17.287  1.00 0.00 ? 70  PRO A HB2  1 
ATOM 1073 H HB3  . PRO A 1 70  ? 475.899 6.067   15.716  1.00 0.00 ? 70  PRO A HB3  1 
ATOM 1074 H HG2  . PRO A 1 70  ? 476.405 8.616   16.356  1.00 0.00 ? 70  PRO A HG2  1 
ATOM 1075 H HG3  . PRO A 1 70  ? 475.973 8.134   14.707  1.00 0.00 ? 70  PRO A HG3  1 
ATOM 1076 H HD2  . PRO A 1 70  ? 474.369 9.579   16.735  1.00 0.00 ? 70  PRO A HD2  1 
ATOM 1077 H HD3  . PRO A 1 70  ? 474.281 9.634   14.965  1.00 0.00 ? 70  PRO A HD3  1 
ATOM 1078 N N    . VAL A 1 71  ? 473.350 6.113   18.197  1.00 0.00 ? 71  VAL A N    1 
ATOM 1079 C CA   . VAL A 1 71  ? 472.760 5.374   19.305  1.00 0.00 ? 71  VAL A CA   1 
ATOM 1080 C C    . VAL A 1 71  ? 471.957 6.304   20.211  1.00 0.00 ? 71  VAL A C    1 
ATOM 1081 O O    . VAL A 1 71  ? 472.277 7.486   20.335  1.00 0.00 ? 71  VAL A O    1 
ATOM 1082 C CB   . VAL A 1 71  ? 473.840 4.660   20.142  1.00 0.00 ? 71  VAL A CB   1 
ATOM 1083 C CG1  . VAL A 1 71  ? 474.595 3.647   19.293  1.00 0.00 ? 71  VAL A CG1  1 
ATOM 1084 C CG2  . VAL A 1 71  ? 474.799 5.672   20.755  1.00 0.00 ? 71  VAL A CG2  1 
ATOM 1085 H H    . VAL A 1 71  ? 473.904 6.896   18.390  1.00 0.00 ? 71  VAL A H    1 
ATOM 1086 H HA   . VAL A 1 71  ? 472.097 4.626   18.894  1.00 0.00 ? 71  VAL A HA   1 
ATOM 1087 H HB   . VAL A 1 71  ? 473.351 4.128   20.945  1.00 0.00 ? 71  VAL A HB   1 
ATOM 1088 H HG11 . VAL A 1 71  ? 475.647 3.890   19.290  1.00 0.00 ? 71  VAL A HG11 1 
ATOM 1089 H HG12 . VAL A 1 71  ? 474.218 3.671   18.281  1.00 0.00 ? 71  VAL A HG12 1 
ATOM 1090 H HG13 . VAL A 1 71  ? 474.455 2.658   19.704  1.00 0.00 ? 71  VAL A HG13 1 
ATOM 1091 H HG21 . VAL A 1 71  ? 475.185 6.317   19.980  1.00 0.00 ? 71  VAL A HG21 1 
ATOM 1092 H HG22 . VAL A 1 71  ? 475.616 5.150   21.231  1.00 0.00 ? 71  VAL A HG22 1 
ATOM 1093 H HG23 . VAL A 1 71  ? 474.274 6.265   21.490  1.00 0.00 ? 71  VAL A HG23 1 
ATOM 1094 N N    . PRO A 1 72  ? 470.901 5.782   20.860  1.00 0.00 ? 72  PRO A N    1 
ATOM 1095 C CA   . PRO A 1 72  ? 470.054 6.577   21.757  1.00 0.00 ? 72  PRO A CA   1 
ATOM 1096 C C    . PRO A 1 72  ? 470.798 7.014   23.018  1.00 0.00 ? 72  PRO A C    1 
ATOM 1097 O O    . PRO A 1 72  ? 471.087 6.197   23.891  1.00 0.00 ? 72  PRO A O    1 
ATOM 1098 C CB   . PRO A 1 72  ? 468.914 5.619   22.115  1.00 0.00 ? 72  PRO A CB   1 
ATOM 1099 C CG   . PRO A 1 72  ? 469.480 4.257   21.909  1.00 0.00 ? 72  PRO A CG   1 
ATOM 1100 C CD   . PRO A 1 72  ? 470.452 4.381   20.770  1.00 0.00 ? 72  PRO A CD   1 
ATOM 1101 H HA   . PRO A 1 72  ? 469.654 7.445   21.255  1.00 0.00 ? 72  PRO A HA   1 
ATOM 1102 H HB2  . PRO A 1 72  ? 468.620 5.774   23.143  1.00 0.00 ? 72  PRO A HB2  1 
ATOM 1103 H HB3  . PRO A 1 72  ? 468.072 5.798   21.463  1.00 0.00 ? 72  PRO A HB3  1 
ATOM 1104 H HG2  . PRO A 1 72  ? 469.990 3.932   22.804  1.00 0.00 ? 72  PRO A HG2  1 
ATOM 1105 H HG3  . PRO A 1 72  ? 468.690 3.566   21.654  1.00 0.00 ? 72  PRO A HG3  1 
ATOM 1106 H HD2  . PRO A 1 72  ? 471.280 3.701   20.904  1.00 0.00 ? 72  PRO A HD2  1 
ATOM 1107 H HD3  . PRO A 1 72  ? 469.957 4.195   19.829  1.00 0.00 ? 72  PRO A HD3  1 
ATOM 1108 N N    . PRO A 1 73  ? 471.127 8.315   23.127  1.00 0.00 ? 73  PRO A N    1 
ATOM 1109 C CA   . PRO A 1 73  ? 471.840 8.861   24.269  1.00 0.00 ? 73  PRO A CA   1 
ATOM 1110 C C    . PRO A 1 73  ? 470.900 9.466   25.307  1.00 0.00 ? 73  PRO A C    1 
ATOM 1111 O O    . PRO A 1 73  ? 469.688 9.256   25.259  1.00 0.00 ? 73  PRO A O    1 
ATOM 1112 C CB   . PRO A 1 73  ? 472.691 9.946   23.616  1.00 0.00 ? 73  PRO A CB   1 
ATOM 1113 C CG   . PRO A 1 73  ? 471.888 10.423  22.439  1.00 0.00 ? 73  PRO A CG   1 
ATOM 1114 C CD   . PRO A 1 73  ? 470.841 9.369   22.145  1.00 0.00 ? 73  PRO A CD   1 
ATOM 1115 H HA   . PRO A 1 73  ? 472.478 8.126   24.736  1.00 0.00 ? 73  PRO A HA   1 
ATOM 1116 H HB2  . PRO A 1 73  ? 472.867 10.743  24.323  1.00 0.00 ? 73  PRO A HB2  1 
ATOM 1117 H HB3  . PRO A 1 73  ? 473.634 9.525   23.301  1.00 0.00 ? 73  PRO A HB3  1 
ATOM 1118 H HG2  . PRO A 1 73  ? 471.410 11.360  22.682  1.00 0.00 ? 73  PRO A HG2  1 
ATOM 1119 H HG3  . PRO A 1 73  ? 472.538 10.550  21.585  1.00 0.00 ? 73  PRO A HG3  1 
ATOM 1120 H HD2  . PRO A 1 73  ? 469.850 9.772   22.292  1.00 0.00 ? 73  PRO A HD2  1 
ATOM 1121 H HD3  . PRO A 1 73  ? 470.951 8.998   21.137  1.00 0.00 ? 73  PRO A HD3  1 
ATOM 1122 N N    . SER A 1 74  ? 471.466 10.223  26.243  1.00 0.00 ? 74  SER A N    1 
ATOM 1123 C CA   . SER A 1 74  ? 470.676 10.862  27.289  1.00 0.00 ? 74  SER A CA   1 
ATOM 1124 C C    . SER A 1 74  ? 471.023 12.346  27.404  1.00 0.00 ? 74  SER A C    1 
ATOM 1125 O O    . SER A 1 74  ? 471.342 12.836  28.488  1.00 0.00 ? 74  SER A O    1 
ATOM 1126 C CB   . SER A 1 74  ? 470.911 10.167  28.631  1.00 0.00 ? 74  SER A CB   1 
ATOM 1127 O OG   . SER A 1 74  ? 469.973 9.124   28.837  1.00 0.00 ? 74  SER A OG   1 
ATOM 1128 H H    . SER A 1 74  ? 472.436 10.356  26.227  1.00 0.00 ? 74  SER A H    1 
ATOM 1129 H HA   . SER A 1 74  ? 469.634 10.768  27.022  1.00 0.00 ? 74  SER A HA   1 
ATOM 1130 H HB2  . SER A 1 74  ? 471.906 9.747   28.647  1.00 0.00 ? 74  SER A HB2  1 
ATOM 1131 H HB3  . SER A 1 74  ? 470.812 10.888  29.429  1.00 0.00 ? 74  SER A HB3  1 
ATOM 1132 H HG   . SER A 1 74  ? 470.388 8.279   28.651  1.00 0.00 ? 74  SER A HG   1 
ATOM 1133 N N    . PRO A 1 75  ? 470.967 13.086  26.283  1.00 0.00 ? 75  PRO A N    1 
ATOM 1134 C CA   . PRO A 1 75  ? 471.277 14.514  26.267  1.00 0.00 ? 75  PRO A CA   1 
ATOM 1135 C C    . PRO A 1 75  ? 470.099 15.367  26.724  1.00 0.00 ? 75  PRO A C    1 
ATOM 1136 O O    . PRO A 1 75  ? 469.123 14.852  27.270  1.00 0.00 ? 75  PRO A O    1 
ATOM 1137 C CB   . PRO A 1 75  ? 471.587 14.774  24.796  1.00 0.00 ? 75  PRO A CB   1 
ATOM 1138 C CG   . PRO A 1 75  ? 470.718 13.812  24.061  1.00 0.00 ? 75  PRO A CG   1 
ATOM 1139 C CD   . PRO A 1 75  ? 470.598 12.592  24.940  1.00 0.00 ? 75  PRO A CD   1 
ATOM 1140 H HA   . PRO A 1 75  ? 472.144 14.739  26.870  1.00 0.00 ? 75  PRO A HA   1 
ATOM 1141 H HB2  . PRO A 1 75  ? 471.346 15.798  24.549  1.00 0.00 ? 75  PRO A HB2  1 
ATOM 1142 H HB3  . PRO A 1 75  ? 472.633 14.586  24.605  1.00 0.00 ? 75  PRO A HB3  1 
ATOM 1143 H HG2  . PRO A 1 75  ? 469.745 14.250  23.896  1.00 0.00 ? 75  PRO A HG2  1 
ATOM 1144 H HG3  . PRO A 1 75  ? 471.177 13.550  23.119  1.00 0.00 ? 75  PRO A HG3  1 
ATOM 1145 H HD2  . PRO A 1 75  ? 469.584 12.220  24.933  1.00 0.00 ? 75  PRO A HD2  1 
ATOM 1146 H HD3  . PRO A 1 75  ? 471.282 11.826  24.611  1.00 0.00 ? 75  PRO A HD3  1 
ATOM 1147 N N    . ALA A 1 76  ? 470.194 16.672  26.496  1.00 0.00 ? 76  ALA A N    1 
ATOM 1148 C CA   . ALA A 1 76  ? 469.133 17.594  26.882  1.00 0.00 ? 76  ALA A CA   1 
ATOM 1149 C C    . ALA A 1 76  ? 468.431 18.161  25.660  1.00 0.00 ? 76  ALA A C    1 
ATOM 1150 O O    . ALA A 1 76  ? 467.301 17.783  25.353  1.00 0.00 ? 76  ALA A O    1 
ATOM 1151 C CB   . ALA A 1 76  ? 469.690 18.713  27.750  1.00 0.00 ? 76  ALA A CB   1 
ATOM 1152 H H    . ALA A 1 76  ? 470.996 17.024  26.055  1.00 0.00 ? 76  ALA A H    1 
ATOM 1153 H HA   . ALA A 1 76  ? 468.412 17.045  27.462  1.00 0.00 ? 76  ALA A HA   1 
ATOM 1154 H HB1  . ALA A 1 76  ? 470.702 18.471  28.042  1.00 0.00 ? 76  ALA A HB1  1 
ATOM 1155 H HB2  . ALA A 1 76  ? 469.077 18.823  28.632  1.00 0.00 ? 76  ALA A HB2  1 
ATOM 1156 H HB3  . ALA A 1 76  ? 469.688 19.638  27.193  1.00 0.00 ? 76  ALA A HB3  1 
ATOM 1157 N N    . GLN A 1 77  ? 469.099 19.068  24.963  1.00 0.00 ? 77  GLN A N    1 
ATOM 1158 C CA   . GLN A 1 77  ? 468.519 19.672  23.777  1.00 0.00 ? 77  GLN A CA   1 
ATOM 1159 C C    . GLN A 1 77  ? 469.606 20.181  22.828  1.00 0.00 ? 77  GLN A C    1 
ATOM 1160 O O    . GLN A 1 77  ? 470.485 20.940  23.235  1.00 0.00 ? 77  GLN A O    1 
ATOM 1161 C CB   . GLN A 1 77  ? 467.586 20.819  24.172  1.00 0.00 ? 77  GLN A CB   1 
ATOM 1162 C CG   . GLN A 1 77  ? 466.969 21.542  22.985  1.00 0.00 ? 77  GLN A CG   1 
ATOM 1163 C CD   . GLN A 1 77  ? 467.158 23.046  23.053  1.00 0.00 ? 77  GLN A CD   1 
ATOM 1164 O OE1  . GLN A 1 77  ? 468.229 23.533  23.415  1.00 0.00 ? 77  GLN A OE1  1 
ATOM 1165 N NE2  . GLN A 1 77  ? 466.113 23.789  22.706  1.00 0.00 ? 77  GLN A NE2  1 
ATOM 1166 H H    . GLN A 1 77  ? 469.998 19.334  25.251  1.00 0.00 ? 77  GLN A H    1 
ATOM 1167 H HA   . GLN A 1 77  ? 467.942 18.909  23.283  1.00 0.00 ? 77  GLN A HA   1 
ATOM 1168 H HB2  . GLN A 1 77  ? 466.786 20.421  24.778  1.00 0.00 ? 77  GLN A HB2  1 
ATOM 1169 H HB3  . GLN A 1 77  ? 468.145 21.537  24.754  1.00 0.00 ? 77  GLN A HB3  1 
ATOM 1170 H HG2  . GLN A 1 77  ? 467.430 21.178  22.079  1.00 0.00 ? 77  GLN A HG2  1 
ATOM 1171 H HG3  . GLN A 1 77  ? 465.911 21.328  22.961  1.00 0.00 ? 77  GLN A HG3  1 
ATOM 1172 H HE21 . GLN A 1 77  ? 465.292 23.333  22.429  1.00 0.00 ? 77  GLN A HE21 1 
ATOM 1173 H HE22 . GLN A 1 77  ? 466.207 24.764  22.740  1.00 0.00 ? 77  GLN A HE22 1 
ATOM 1174 N N    . PRO A 1 78  ? 469.561 19.774  21.545  1.00 0.00 ? 78  PRO A N    1 
ATOM 1175 C CA   . PRO A 1 78  ? 470.549 20.202  20.547  1.00 0.00 ? 78  PRO A CA   1 
ATOM 1176 C C    . PRO A 1 78  ? 470.571 21.718  20.374  1.00 0.00 ? 78  PRO A C    1 
ATOM 1177 O O    . PRO A 1 78  ? 469.542 22.379  20.514  1.00 0.00 ? 78  PRO A O    1 
ATOM 1178 C CB   . PRO A 1 78  ? 470.078 19.529  19.253  1.00 0.00 ? 78  PRO A CB   1 
ATOM 1179 C CG   . PRO A 1 78  ? 469.206 18.405  19.697  1.00 0.00 ? 78  PRO A CG   1 
ATOM 1180 C CD   . PRO A 1 78  ? 468.552 18.872  20.964  1.00 0.00 ? 78  PRO A CD   1 
ATOM 1181 H HA   . PRO A 1 78  ? 471.539 19.853  20.799  1.00 0.00 ? 78  PRO A HA   1 
ATOM 1182 H HB2  . PRO A 1 78  ? 469.530 20.241  18.654  1.00 0.00 ? 78  PRO A HB2  1 
ATOM 1183 H HB3  . PRO A 1 78  ? 470.933 19.170  18.701  1.00 0.00 ? 78  PRO A HB3  1 
ATOM 1184 H HG2  . PRO A 1 78  ? 468.461 18.198  18.943  1.00 0.00 ? 78  PRO A HG2  1 
ATOM 1185 H HG3  . PRO A 1 78  ? 469.805 17.527  19.886  1.00 0.00 ? 78  PRO A HG3  1 
ATOM 1186 H HD2  . PRO A 1 78  ? 467.639 19.405  20.744  1.00 0.00 ? 78  PRO A HD2  1 
ATOM 1187 H HD3  . PRO A 1 78  ? 468.357 18.036  21.619  1.00 0.00 ? 78  PRO A HD3  1 
ATOM 1188 N N    . PRO A 1 79  ? 471.746 22.295  20.065  1.00 0.00 ? 79  PRO A N    1 
ATOM 1189 C CA   . PRO A 1 79  ? 471.881 23.742  19.876  1.00 0.00 ? 79  PRO A CA   1 
ATOM 1190 C C    . PRO A 1 79  ? 470.985 24.273  18.756  1.00 0.00 ? 79  PRO A C    1 
ATOM 1191 O O    . PRO A 1 79  ? 470.280 25.265  18.937  1.00 0.00 ? 79  PRO A O    1 
ATOM 1192 C CB   . PRO A 1 79  ? 473.360 23.935  19.515  1.00 0.00 ? 79  PRO A CB   1 
ATOM 1193 C CG   . PRO A 1 79  ? 474.044 22.691  19.974  1.00 0.00 ? 79  PRO A CG   1 
ATOM 1194 C CD   . PRO A 1 79  ? 473.026 21.590  19.879  1.00 0.00 ? 79  PRO A CD   1 
ATOM 1195 H HA   . PRO A 1 79  ? 471.661 24.278  20.788  1.00 0.00 ? 79  PRO A HA   1 
ATOM 1196 H HB2  . PRO A 1 79  ? 473.458 24.070  18.449  1.00 0.00 ? 79  PRO A HB2  1 
ATOM 1197 H HB3  . PRO A 1 79  ? 473.744 24.804  20.028  1.00 0.00 ? 79  PRO A HB3  1 
ATOM 1198 H HG2  . PRO A 1 79  ? 474.886 22.478  19.331  1.00 0.00 ? 79  PRO A HG2  1 
ATOM 1199 H HG3  . PRO A 1 79  ? 474.373 22.809  20.996  1.00 0.00 ? 79  PRO A HG3  1 
ATOM 1200 H HD2  . PRO A 1 79  ? 473.071 21.117  18.909  1.00 0.00 ? 79  PRO A HD2  1 
ATOM 1201 H HD3  . PRO A 1 79  ? 473.184 20.864  20.662  1.00 0.00 ? 79  PRO A HD3  1 
ATOM 1202 N N    . PRO A 1 80  ? 471.002 23.624  17.576  1.00 0.00 ? 80  PRO A N    1 
ATOM 1203 C CA   . PRO A 1 80  ? 470.194 24.045  16.434  1.00 0.00 ? 80  PRO A CA   1 
ATOM 1204 C C    . PRO A 1 80  ? 468.780 23.468  16.456  1.00 0.00 ? 80  PRO A C    1 
ATOM 1205 O O    . PRO A 1 80  ? 467.808 24.176  16.190  1.00 0.00 ? 80  PRO A O    1 
ATOM 1206 C CB   . PRO A 1 80  ? 470.978 23.486  15.252  1.00 0.00 ? 80  PRO A CB   1 
ATOM 1207 C CG   . PRO A 1 80  ? 471.597 22.231  15.773  1.00 0.00 ? 80  PRO A CG   1 
ATOM 1208 C CD   . PRO A 1 80  ? 471.817 22.435  17.254  1.00 0.00 ? 80  PRO A CD   1 
ATOM 1209 H HA   . PRO A 1 80  ? 470.143 25.121  16.358  1.00 0.00 ? 80  PRO A HA   1 
ATOM 1210 H HB2  . PRO A 1 80  ? 470.305 23.285  14.432  1.00 0.00 ? 80  PRO A HB2  1 
ATOM 1211 H HB3  . PRO A 1 80  ? 471.730 24.197  14.945  1.00 0.00 ? 80  PRO A HB3  1 
ATOM 1212 H HG2  . PRO A 1 80  ? 470.928 21.399  15.607  1.00 0.00 ? 80  PRO A HG2  1 
ATOM 1213 H HG3  . PRO A 1 80  ? 472.540 22.056  15.276  1.00 0.00 ? 80  PRO A HG3  1 
ATOM 1214 H HD2  . PRO A 1 80  ? 471.473 21.574  17.806  1.00 0.00 ? 80  PRO A HD2  1 
ATOM 1215 H HD3  . PRO A 1 80  ? 472.861 22.617  17.454  1.00 0.00 ? 80  PRO A HD3  1 
ATOM 1216 N N    . GLY A 1 81  ? 468.672 22.178  16.761  1.00 0.00 ? 81  GLY A N    1 
ATOM 1217 C CA   . GLY A 1 81  ? 467.372 21.532  16.794  1.00 0.00 ? 81  GLY A CA   1 
ATOM 1218 C C    . GLY A 1 81  ? 466.517 21.975  17.968  1.00 0.00 ? 81  GLY A C    1 
ATOM 1219 O O    . GLY A 1 81  ? 466.855 22.937  18.658  1.00 0.00 ? 81  GLY A O    1 
ATOM 1220 H H    . GLY A 1 81  ? 469.479 21.659  16.954  1.00 0.00 ? 81  GLY A H    1 
ATOM 1221 H HA2  . GLY A 1 81  ? 466.851 21.766  15.879  1.00 0.00 ? 81  GLY A HA2  1 
ATOM 1222 H HA3  . GLY A 1 81  ? 467.515 20.463  16.851  1.00 0.00 ? 81  GLY A HA3  1 
ATOM 1223 N N    . VAL A 1 82  ? 465.409 21.268  18.206  1.00 0.00 ? 82  VAL A N    1 
ATOM 1224 C CA   . VAL A 1 82  ? 464.522 21.602  19.316  1.00 0.00 ? 82  VAL A CA   1 
ATOM 1225 C C    . VAL A 1 82  ? 464.662 20.611  20.456  1.00 0.00 ? 82  VAL A C    1 
ATOM 1226 O O    . VAL A 1 82  ? 464.237 20.885  21.578  1.00 0.00 ? 82  VAL A O    1 
ATOM 1227 C CB   . VAL A 1 82  ? 463.039 21.698  18.898  1.00 0.00 ? 82  VAL A CB   1 
ATOM 1228 C CG1  . VAL A 1 82  ? 462.145 21.929  20.108  1.00 0.00 ? 82  VAL A CG1  1 
ATOM 1229 C CG2  . VAL A 1 82  ? 462.858 22.813  17.878  1.00 0.00 ? 82  VAL A CG2  1 
ATOM 1230 H H    . VAL A 1 82  ? 465.194 20.505  17.633  1.00 0.00 ? 82  VAL A H    1 
ATOM 1231 H HA   . VAL A 1 82  ? 464.813 22.556  19.670  1.00 0.00 ? 82  VAL A HA   1 
ATOM 1232 H HB   . VAL A 1 82  ? 462.748 20.765  18.443  1.00 0.00 ? 82  VAL A HB   1 
ATOM 1233 H HG11 . VAL A 1 82  ? 462.168 21.055  20.742  1.00 0.00 ? 82  VAL A HG11 1 
ATOM 1234 H HG12 . VAL A 1 82  ? 461.132 22.109  19.779  1.00 0.00 ? 82  VAL A HG12 1 
ATOM 1235 H HG13 . VAL A 1 82  ? 462.502 22.785  20.662  1.00 0.00 ? 82  VAL A HG13 1 
ATOM 1236 H HG21 . VAL A 1 82  ? 463.022 23.767  18.355  1.00 0.00 ? 82  VAL A HG21 1 
ATOM 1237 H HG22 . VAL A 1 82  ? 461.855 22.777  17.479  1.00 0.00 ? 82  VAL A HG22 1 
ATOM 1238 H HG23 . VAL A 1 82  ? 463.573 22.683  17.075  1.00 0.00 ? 82  VAL A HG23 1 
ATOM 1239 N N    . SER A 1 83  ? 465.248 19.453  20.171  1.00 0.00 ? 83  SER A N    1 
ATOM 1240 C CA   . SER A 1 83  ? 465.421 18.431  21.188  1.00 0.00 ? 83  SER A CA   1 
ATOM 1241 C C    . SER A 1 83  ? 465.992 17.152  20.578  1.00 0.00 ? 83  SER A C    1 
ATOM 1242 O O    . SER A 1 83  ? 466.018 16.999  19.356  1.00 0.00 ? 83  SER A O    1 
ATOM 1243 C CB   . SER A 1 83  ? 464.073 18.164  21.862  1.00 0.00 ? 83  SER A CB   1 
ATOM 1244 O OG   . SER A 1 83  ? 463.578 16.871  21.555  1.00 0.00 ? 83  SER A OG   1 
ATOM 1245 H H    . SER A 1 83  ? 465.562 19.281  19.259  1.00 0.00 ? 83  SER A H    1 
ATOM 1246 H HA   . SER A 1 83  ? 466.115 18.807  21.924  1.00 0.00 ? 83  SER A HA   1 
ATOM 1247 H HB2  . SER A 1 83  ? 464.186 18.249  22.931  1.00 0.00 ? 83  SER A HB2  1 
ATOM 1248 H HB3  . SER A 1 83  ? 463.360 18.904  21.516  1.00 0.00 ? 83  SER A HB3  1 
ATOM 1249 H HG   . SER A 1 83  ? 463.286 16.848  20.641  1.00 0.00 ? 83  SER A HG   1 
ATOM 1250 N N    . PRO A 1 84  ? 466.461 16.211  21.421  1.00 0.00 ? 84  PRO A N    1 
ATOM 1251 C CA   . PRO A 1 84  ? 467.032 14.943  20.965  1.00 0.00 ? 84  PRO A CA   1 
ATOM 1252 C C    . PRO A 1 84  ? 466.254 14.345  19.795  1.00 0.00 ? 84  PRO A C    1 
ATOM 1253 O O    . PRO A 1 84  ? 465.046 14.130  19.889  1.00 0.00 ? 84  PRO A O    1 
ATOM 1254 C CB   . PRO A 1 84  ? 466.941 14.033  22.204  1.00 0.00 ? 84  PRO A CB   1 
ATOM 1255 C CG   . PRO A 1 84  ? 466.319 14.861  23.290  1.00 0.00 ? 84  PRO A CG   1 
ATOM 1256 C CD   . PRO A 1 84  ? 466.474 16.299  22.882  1.00 0.00 ? 84  PRO A CD   1 
ATOM 1257 H HA   . PRO A 1 84  ? 468.067 15.061  20.679  1.00 0.00 ? 84  PRO A HA   1 
ATOM 1258 H HB2  . PRO A 1 84  ? 466.331 13.173  21.972  1.00 0.00 ? 84  PRO A HB2  1 
ATOM 1259 H HB3  . PRO A 1 84  ? 467.933 13.707  22.481  1.00 0.00 ? 84  PRO A HB3  1 
ATOM 1260 H HG2  . PRO A 1 84  ? 465.272 14.612  23.384  1.00 0.00 ? 84  PRO A HG2  1 
ATOM 1261 H HG3  . PRO A 1 84  ? 466.831 14.681  24.224  1.00 0.00 ? 84  PRO A HG3  1 
ATOM 1262 H HD2  . PRO A 1 84  ? 465.646 16.889  23.246  1.00 0.00 ? 84  PRO A HD2  1 
ATOM 1263 H HD3  . PRO A 1 84  ? 467.412 16.697  23.238  1.00 0.00 ? 84  PRO A HD3  1 
ATOM 1264 N N    . SER A 1 85  ? 466.953 14.096  18.690  1.00 0.00 ? 85  SER A N    1 
ATOM 1265 C CA   . SER A 1 85  ? 466.326 13.540  17.492  1.00 0.00 ? 85  SER A CA   1 
ATOM 1266 C C    . SER A 1 85  ? 465.571 12.244  17.797  1.00 0.00 ? 85  SER A C    1 
ATOM 1267 O O    . SER A 1 85  ? 464.517 12.275  18.432  1.00 0.00 ? 85  SER A O    1 
ATOM 1268 C CB   . SER A 1 85  ? 467.368 13.307  16.392  1.00 0.00 ? 85  SER A CB   1 
ATOM 1269 O OG   . SER A 1 85  ? 468.511 12.644  16.904  1.00 0.00 ? 85  SER A OG   1 
ATOM 1270 H H    . SER A 1 85  ? 467.910 14.305  18.674  1.00 0.00 ? 85  SER A H    1 
ATOM 1271 H HA   . SER A 1 85  ? 465.613 14.269  17.140  1.00 0.00 ? 85  SER A HA   1 
ATOM 1272 H HB2  . SER A 1 85  ? 466.931 12.697  15.610  1.00 0.00 ? 85  SER A HB2  1 
ATOM 1273 H HB3  . SER A 1 85  ? 467.673 14.257  15.979  1.00 0.00 ? 85  SER A HB3  1 
ATOM 1274 H HG   . SER A 1 85  ? 468.715 11.885  16.352  1.00 0.00 ? 85  SER A HG   1 
ATOM 1275 N N    . ARG A 1 86  ? 466.094 11.107  17.329  1.00 0.00 ? 86  ARG A N    1 
ATOM 1276 C CA   . ARG A 1 86  ? 465.437 9.826   17.544  1.00 0.00 ? 86  ARG A CA   1 
ATOM 1277 C C    . ARG A 1 86  ? 464.064 9.839   16.884  1.00 0.00 ? 86  ARG A C    1 
ATOM 1278 O O    . ARG A 1 86  ? 463.330 10.819  16.992  1.00 0.00 ? 86  ARG A O    1 
ATOM 1279 C CB   . ARG A 1 86  ? 465.300 9.533   19.040  1.00 0.00 ? 86  ARG A CB   1 
ATOM 1280 C CG   . ARG A 1 86  ? 465.323 8.049   19.372  1.00 0.00 ? 86  ARG A CG   1 
ATOM 1281 C CD   . ARG A 1 86  ? 466.351 7.728   20.445  1.00 0.00 ? 86  ARG A CD   1 
ATOM 1282 N NE   . ARG A 1 86  ? 465.816 6.825   21.461  1.00 0.00 ? 86  ARG A NE   1 
ATOM 1283 C CZ   . ARG A 1 86  ? 464.999 7.210   22.439  1.00 0.00 ? 86  ARG A CZ   1 
ATOM 1284 N NH1  . ARG A 1 86  ? 464.624 8.479   22.538  1.00 0.00 ? 86  ARG A NH1  1 
ATOM 1285 N NH2  . ARG A 1 86  ? 464.556 6.324   23.320  1.00 0.00 ? 86  ARG A NH2  1 
ATOM 1286 H H    . ARG A 1 86  ? 466.928 11.133  16.818  1.00 0.00 ? 86  ARG A H    1 
ATOM 1287 H HA   . ARG A 1 86  ? 466.041 9.058   17.084  1.00 0.00 ? 86  ARG A HA   1 
ATOM 1288 H HB2  . ARG A 1 86  ? 466.115 10.012  19.564  1.00 0.00 ? 86  ARG A HB2  1 
ATOM 1289 H HB3  . ARG A 1 86  ? 464.366 9.945   19.392  1.00 0.00 ? 86  ARG A HB3  1 
ATOM 1290 H HG2  . ARG A 1 86  ? 464.346 7.755   19.726  1.00 0.00 ? 86  ARG A HG2  1 
ATOM 1291 H HG3  . ARG A 1 86  ? 465.565 7.495   18.476  1.00 0.00 ? 86  ARG A HG3  1 
ATOM 1292 H HD2  . ARG A 1 86  ? 467.206 7.261   19.978  1.00 0.00 ? 86  ARG A HD2  1 
ATOM 1293 H HD3  . ARG A 1 86  ? 466.659 8.648   20.920  1.00 0.00 ? 86  ARG A HD3  1 
ATOM 1294 H HE   . ARG A 1 86  ? 466.079 5.882   21.412  1.00 0.00 ? 86  ARG A HE   1 
ATOM 1295 H HH11 . ARG A 1 86  ? 464.955 9.153   21.876  1.00 0.00 ? 86  ARG A HH11 1 
ATOM 1296 H HH12 . ARG A 1 86  ? 464.010 8.763   23.274  1.00 0.00 ? 86  ARG A HH12 1 
ATOM 1297 H HH21 . ARG A 1 86  ? 464.835 5.366   23.250  1.00 0.00 ? 86  ARG A HH21 1 
ATOM 1298 H HH22 . ARG A 1 86  ? 463.942 6.614   24.054  1.00 0.00 ? 86  ARG A HH22 1 
ATOM 1299 N N    . LEU A 1 87  ? 463.721 8.769   16.180  1.00 0.00 ? 87  LEU A N    1 
ATOM 1300 C CA   . LEU A 1 87  ? 462.440 8.712   15.502  1.00 0.00 ? 87  LEU A CA   1 
ATOM 1301 C C    . LEU A 1 87  ? 461.360 8.112   16.392  1.00 0.00 ? 87  LEU A C    1 
ATOM 1302 O O    . LEU A 1 87  ? 461.649 7.487   17.411  1.00 0.00 ? 87  LEU A O    1 
ATOM 1303 C CB   . LEU A 1 87  ? 462.569 7.926   14.203  1.00 0.00 ? 87  LEU A CB   1 
ATOM 1304 C CG   . LEU A 1 87  ? 462.525 8.781   12.938  1.00 0.00 ? 87  LEU A CG   1 
ATOM 1305 C CD1  . LEU A 1 87  ? 463.646 9.814   12.930  1.00 0.00 ? 87  LEU A CD1  1 
ATOM 1306 C CD2  . LEU A 1 87  ? 462.611 7.902   11.711  1.00 0.00 ? 87  LEU A CD2  1 
ATOM 1307 H H    . LEU A 1 87  ? 464.343 8.016   16.100  1.00 0.00 ? 87  LEU A H    1 
ATOM 1308 H HA   . LEU A 1 87  ? 462.156 9.722   15.263  1.00 0.00 ? 87  LEU A HA   1 
ATOM 1309 H HB2  . LEU A 1 87  ? 463.508 7.390   14.221  1.00 0.00 ? 87  LEU A HB2  1 
ATOM 1310 H HB3  . LEU A 1 87  ? 461.763 7.208   14.154  1.00 0.00 ? 87  LEU A HB3  1 
ATOM 1311 H HG   . LEU A 1 87  ? 461.587 9.309   12.902  1.00 0.00 ? 87  LEU A HG   1 
ATOM 1312 H HD11 . LEU A 1 87  ? 463.421 10.582  12.200  1.00 0.00 ? 87  LEU A HD11 1 
ATOM 1313 H HD12 . LEU A 1 87  ? 464.577 9.334   12.668  1.00 0.00 ? 87  LEU A HD12 1 
ATOM 1314 H HD13 . LEU A 1 87  ? 463.737 10.264  13.909  1.00 0.00 ? 87  LEU A HD13 1 
ATOM 1315 H HD21 . LEU A 1 87  ? 463.243 7.053   11.927  1.00 0.00 ? 87  LEU A HD21 1 
ATOM 1316 H HD22 . LEU A 1 87  ? 463.030 8.471   10.897  1.00 0.00 ? 87  LEU A HD22 1 
ATOM 1317 H HD23 . LEU A 1 87  ? 461.622 7.559   11.444  1.00 0.00 ? 87  LEU A HD23 1 
ATOM 1318 N N    . ARG A 1 88  ? 460.112 8.333   15.999  1.00 0.00 ? 88  ARG A N    1 
ATOM 1319 C CA   . ARG A 1 88  ? 458.963 7.847   16.748  1.00 0.00 ? 88  ARG A CA   1 
ATOM 1320 C C    . ARG A 1 88  ? 457.881 7.346   15.803  1.00 0.00 ? 88  ARG A C    1 
ATOM 1321 O O    . ARG A 1 88  ? 457.918 7.633   14.610  1.00 0.00 ? 88  ARG A O    1 
ATOM 1322 C CB   . ARG A 1 88  ? 458.409 8.939   17.664  1.00 0.00 ? 88  ARG A CB   1 
ATOM 1323 C CG   . ARG A 1 88  ? 457.776 8.394   18.934  1.00 0.00 ? 88  ARG A CG   1 
ATOM 1324 C CD   . ARG A 1 88  ? 458.285 9.114   20.173  1.00 0.00 ? 88  ARG A CD   1 
ATOM 1325 N NE   . ARG A 1 88  ? 459.696 8.837   20.435  1.00 0.00 ? 88  ARG A NE   1 
ATOM 1326 C CZ   . ARG A 1 88  ? 460.272 8.988   21.628  1.00 0.00 ? 88  ARG A CZ   1 
ATOM 1327 N NH1  . ARG A 1 88  ? 459.561 9.407   22.668  1.00 0.00 ? 88  ARG A NH1  1 
ATOM 1328 N NH2  . ARG A 1 88  ? 461.562 8.720   21.782  1.00 0.00 ? 88  ARG A NH2  1 
ATOM 1329 H H    . ARG A 1 88  ? 459.959 8.855   15.183  1.00 0.00 ? 88  ARG A H    1 
ATOM 1330 H HA   . ARG A 1 88  ? 459.297 7.016   17.352  1.00 0.00 ? 88  ARG A HA   1 
ATOM 1331 H HB2  . ARG A 1 88  ? 459.215 9.603   17.942  1.00 0.00 ? 88  ARG A HB2  1 
ATOM 1332 H HB3  . ARG A 1 88  ? 457.660 9.500   17.126  1.00 0.00 ? 88  ARG A HB3  1 
ATOM 1333 H HG2  . ARG A 1 88  ? 456.705 8.521   18.873  1.00 0.00 ? 88  ARG A HG2  1 
ATOM 1334 H HG3  . ARG A 1 88  ? 458.010 7.343   19.018  1.00 0.00 ? 88  ARG A HG3  1 
ATOM 1335 H HD2  . ARG A 1 88  ? 458.158 10.176  20.034  1.00 0.00 ? 88  ARG A HD2  1 
ATOM 1336 H HD3  . ARG A 1 88  ? 457.702 8.790   21.023  1.00 0.00 ? 88  ARG A HD3  1 
ATOM 1337 H HE   . ARG A 1 88  ? 460.244 8.525   19.685  1.00 0.00 ? 88  ARG A HE   1 
ATOM 1338 H HH11 . ARG A 1 88  ? 458.589 9.613   22.560  1.00 0.00 ? 88  ARG A HH11 1 
ATOM 1339 H HH12 . ARG A 1 88  ? 459.998 9.517   23.560  1.00 0.00 ? 88  ARG A HH12 1 
ATOM 1340 H HH21 . ARG A 1 88  ? 462.104 8.405   21.003  1.00 0.00 ? 88  ARG A HH21 1 
ATOM 1341 H HH22 . ARG A 1 88  ? 461.992 8.833   22.678  1.00 0.00 ? 88  ARG A HH22 1 
ATOM 1342 N N    . ILE A 1 89  ? 456.916 6.610   16.358  1.00 0.00 ? 89  ILE A N    1 
ATOM 1343 C CA   . ILE A 1 89  ? 455.791 6.060   15.589  1.00 0.00 ? 89  ILE A CA   1 
ATOM 1344 C C    . ILE A 1 89  ? 455.318 4.739   16.188  1.00 0.00 ? 89  ILE A C    1 
ATOM 1345 O O    . ILE A 1 89  ? 456.129 3.894   16.560  1.00 0.00 ? 89  ILE A O    1 
ATOM 1346 C CB   . ILE A 1 89  ? 456.147 5.826   14.105  1.00 0.00 ? 89  ILE A CB   1 
ATOM 1347 C CG1  . ILE A 1 89  ? 454.962 5.216   13.353  1.00 0.00 ? 89  ILE A CG1  1 
ATOM 1348 C CG2  . ILE A 1 89  ? 457.361 4.924   13.993  1.00 0.00 ? 89  ILE A CG2  1 
ATOM 1349 C CD1  . ILE A 1 89  ? 455.122 5.249   11.849  1.00 0.00 ? 89  ILE A CD1  1 
ATOM 1350 H H    . ILE A 1 89  ? 456.938 6.469   17.325  1.00 0.00 ? 89  ILE A H    1 
ATOM 1351 H HA   . ILE A 1 89  ? 454.980 6.773   15.635  1.00 0.00 ? 89  ILE A HA   1 
ATOM 1352 H HB   . ILE A 1 89  ? 456.394 6.781   13.661  1.00 0.00 ? 89  ILE A HB   1 
ATOM 1353 H HG12 . ILE A 1 89  ? 454.850 4.184   13.650  1.00 0.00 ? 89  ILE A HG12 1 
ATOM 1354 H HG13 . ILE A 1 89  ? 454.064 5.758   13.607  1.00 0.00 ? 89  ILE A HG13 1 
ATOM 1355 H HG21 . ILE A 1 89  ? 457.295 4.137   14.729  1.00 0.00 ? 89  ILE A HG21 1 
ATOM 1356 H HG22 . ILE A 1 89  ? 458.258 5.501   14.163  1.00 0.00 ? 89  ILE A HG22 1 
ATOM 1357 H HG23 . ILE A 1 89  ? 457.395 4.489   13.005  1.00 0.00 ? 89  ILE A HG23 1 
ATOM 1358 H HD11 . ILE A 1 89  ? 454.343 4.659   11.391  1.00 0.00 ? 89  ILE A HD11 1 
ATOM 1359 H HD12 . ILE A 1 89  ? 456.087 4.843   11.581  1.00 0.00 ? 89  ILE A HD12 1 
ATOM 1360 H HD13 . ILE A 1 89  ? 455.053 6.270   11.502  1.00 0.00 ? 89  ILE A HD13 1 
ATOM 1361 N N    . GLY A 1 90  ? 453.998 4.566   16.257  1.00 0.00 ? 90  GLY A N    1 
ATOM 1362 C CA   . GLY A 1 90  ? 453.418 3.340   16.795  1.00 0.00 ? 90  GLY A CA   1 
ATOM 1363 C C    . GLY A 1 90  ? 454.219 2.746   17.941  1.00 0.00 ? 90  GLY A C    1 
ATOM 1364 O O    . GLY A 1 90  ? 454.734 1.633   17.833  1.00 0.00 ? 90  GLY A O    1 
ATOM 1365 H H    . GLY A 1 90  ? 453.410 5.275   15.923  1.00 0.00 ? 90  GLY A H    1 
ATOM 1366 H HA2  . GLY A 1 90  ? 452.420 3.555   17.146  1.00 0.00 ? 90  GLY A HA2  1 
ATOM 1367 H HA3  . GLY A 1 90  ? 453.355 2.610   16.001  1.00 0.00 ? 90  GLY A HA3  1 
ATOM 1368 N N    . ASP A 1 91  ? 454.330 3.495   19.035  1.00 0.00 ? 91  ASP A N    1 
ATOM 1369 C CA   . ASP A 1 91  ? 455.079 3.048   20.209  1.00 0.00 ? 91  ASP A CA   1 
ATOM 1370 C C    . ASP A 1 91  ? 456.454 2.505   19.815  1.00 0.00 ? 91  ASP A C    1 
ATOM 1371 O O    . ASP A 1 91  ? 457.009 1.639   20.491  1.00 0.00 ? 91  ASP A O    1 
ATOM 1372 C CB   . ASP A 1 91  ? 454.287 1.986   20.982  1.00 0.00 ? 91  ASP A CB   1 
ATOM 1373 C CG   . ASP A 1 91  ? 454.217 0.656   20.255  1.00 0.00 ? 91  ASP A CG   1 
ATOM 1374 O OD1  . ASP A 1 91  ? 455.145 -0.163  20.424  1.00 0.00 ? 91  ASP A OD1  1 
ATOM 1375 O OD2  . ASP A 1 91  ? 453.235 0.434   19.516  1.00 0.00 ? 91  ASP A OD2  1 
ATOM 1376 H H    . ASP A 1 91  ? 453.902 4.377   19.049  1.00 0.00 ? 91  ASP A H    1 
ATOM 1377 H HA   . ASP A 1 91  ? 455.222 3.906   20.849  1.00 0.00 ? 91  ASP A HA   1 
ATOM 1378 H HB2  . ASP A 1 91  ? 454.757 1.824   21.940  1.00 0.00 ? 91  ASP A HB2  1 
ATOM 1379 H HB3  . ASP A 1 91  ? 453.280 2.343   21.138  1.00 0.00 ? 91  ASP A HB3  1 
ATOM 1380 N N    . GLN A 1 92  ? 456.994 3.027   18.719  1.00 0.00 ? 92  GLN A N    1 
ATOM 1381 C CA   . GLN A 1 92  ? 458.302 2.608   18.227  1.00 0.00 ? 92  GLN A CA   1 
ATOM 1382 C C    . GLN A 1 92  ? 459.269 3.787   18.223  1.00 0.00 ? 92  GLN A C    1 
ATOM 1383 O O    . GLN A 1 92  ? 458.858 4.931   18.412  1.00 0.00 ? 92  GLN A O    1 
ATOM 1384 C CB   . GLN A 1 92  ? 458.180 2.021   16.819  1.00 0.00 ? 92  GLN A CB   1 
ATOM 1385 C CG   . GLN A 1 92  ? 458.873 0.677   16.658  1.00 0.00 ? 92  GLN A CG   1 
ATOM 1386 C CD   . GLN A 1 92  ? 457.910 -0.438  16.299  1.00 0.00 ? 92  GLN A CD   1 
ATOM 1387 O OE1  . GLN A 1 92  ? 457.122 -0.886  17.131  1.00 0.00 ? 92  GLN A OE1  1 
ATOM 1388 N NE2  . GLN A 1 92  ? 457.969 -0.892  15.052  1.00 0.00 ? 92  GLN A NE2  1 
ATOM 1389 H H    . GLN A 1 92  ? 456.501 3.716   18.227  1.00 0.00 ? 92  GLN A H    1 
ATOM 1390 H HA   . GLN A 1 92  ? 458.680 1.849   18.895  1.00 0.00 ? 92  GLN A HA   1 
ATOM 1391 H HB2  . GLN A 1 92  ? 457.133 1.893   16.585  1.00 0.00 ? 92  GLN A HB2  1 
ATOM 1392 H HB3  . GLN A 1 92  ? 458.615 2.712   16.112  1.00 0.00 ? 92  GLN A HB3  1 
ATOM 1393 H HG2  . GLN A 1 92  ? 459.612 0.759   15.875  1.00 0.00 ? 92  GLN A HG2  1 
ATOM 1394 H HG3  . GLN A 1 92  ? 459.361 0.425   17.588  1.00 0.00 ? 92  GLN A HG3  1 
ATOM 1395 H HE21 . GLN A 1 92  ? 458.621 -0.487  14.442  1.00 0.00 ? 92  GLN A HE21 1 
ATOM 1396 H HE22 . GLN A 1 92  ? 457.358 -1.613  14.792  1.00 0.00 ? 92  GLN A HE22 1 
ATOM 1397 N N    . GLU A 1 93  ? 460.548 3.506   17.986  1.00 0.00 ? 93  GLU A N    1 
ATOM 1398 C CA   . GLU A 1 93  ? 461.569 4.548   17.938  1.00 0.00 ? 93  GLU A CA   1 
ATOM 1399 C C    . GLU A 1 93  ? 462.801 4.068   17.171  1.00 0.00 ? 93  GLU A C    1 
ATOM 1400 O O    . GLU A 1 93  ? 463.487 3.147   17.615  1.00 0.00 ? 93  GLU A O    1 
ATOM 1401 C CB   . GLU A 1 93  ? 461.973 4.960   19.355  1.00 0.00 ? 93  GLU A CB   1 
ATOM 1402 C CG   . GLU A 1 93  ? 461.117 6.073   19.935  1.00 0.00 ? 93  GLU A CG   1 
ATOM 1403 C CD   . GLU A 1 93  ? 460.961 5.965   21.439  1.00 0.00 ? 93  GLU A CD   1 
ATOM 1404 O OE1  . GLU A 1 93  ? 461.991 5.857   22.137  1.00 0.00 ? 93  GLU A OE1  1 
ATOM 1405 O OE2  . GLU A 1 93  ? 459.808 5.988   21.919  1.00 0.00 ? 93  GLU A OE2  1 
ATOM 1406 H H    . GLU A 1 93  ? 460.809 2.583   17.808  1.00 0.00 ? 93  GLU A H    1 
ATOM 1407 H HA   . GLU A 1 93  ? 461.149 5.400   17.428  1.00 0.00 ? 93  GLU A HA   1 
ATOM 1408 H HB2  . GLU A 1 93  ? 461.895 4.100   20.004  1.00 0.00 ? 93  GLU A HB2  1 
ATOM 1409 H HB3  . GLU A 1 93  ? 462.999 5.296   19.340  1.00 0.00 ? 93  GLU A HB3  1 
ATOM 1410 H HG2  . GLU A 1 93  ? 461.577 7.021   19.703  1.00 0.00 ? 93  GLU A HG2  1 
ATOM 1411 H HG3  . GLU A 1 93  ? 460.141 6.029   19.483  1.00 0.00 ? 93  GLU A HG3  1 
ATOM 1412 N N    . PHE A 1 94  ? 463.091 4.689   16.028  1.00 0.00 ? 94  PHE A N    1 
ATOM 1413 C CA   . PHE A 1 94  ? 464.251 4.308   15.227  1.00 0.00 ? 94  PHE A CA   1 
ATOM 1414 C C    . PHE A 1 94  ? 465.419 5.263   15.482  1.00 0.00 ? 94  PHE A C    1 
ATOM 1415 O O    . PHE A 1 94  ? 465.965 5.307   16.584  1.00 0.00 ? 94  PHE A O    1 
ATOM 1416 C CB   . PHE A 1 94  ? 463.872 4.282   13.739  1.00 0.00 ? 94  PHE A CB   1 
ATOM 1417 C CG   . PHE A 1 94  ? 462.627 3.499   13.455  1.00 0.00 ? 94  PHE A CG   1 
ATOM 1418 C CD1  . PHE A 1 94  ? 461.388 4.102   13.559  1.00 0.00 ? 94  PHE A CD1  1 
ATOM 1419 C CD2  . PHE A 1 94  ? 462.695 2.166   13.085  1.00 0.00 ? 94  PHE A CD2  1 
ATOM 1420 C CE1  . PHE A 1 94  ? 460.235 3.393   13.299  1.00 0.00 ? 94  PHE A CE1  1 
ATOM 1421 C CE2  . PHE A 1 94  ? 461.543 1.449   12.823  1.00 0.00 ? 94  PHE A CE2  1 
ATOM 1422 C CZ   . PHE A 1 94  ? 460.311 2.063   12.930  1.00 0.00 ? 94  PHE A CZ   1 
ATOM 1423 H H    . PHE A 1 94  ? 462.526 5.419   15.701  1.00 0.00 ? 94  PHE A H    1 
ATOM 1424 H HA   . PHE A 1 94  ? 464.553 3.323   15.522  1.00 0.00 ? 94  PHE A HA   1 
ATOM 1425 H HB2  . PHE A 1 94  ? 463.707 5.292   13.398  1.00 0.00 ? 94  PHE A HB2  1 
ATOM 1426 H HB3  . PHE A 1 94  ? 464.680 3.843   13.171  1.00 0.00 ? 94  PHE A HB3  1 
ATOM 1427 H HD1  . PHE A 1 94  ? 461.326 5.141   13.846  1.00 0.00 ? 94  PHE A HD1  1 
ATOM 1428 H HD2  . PHE A 1 94  ? 463.659 1.686   13.001  1.00 0.00 ? 94  PHE A HD2  1 
ATOM 1429 H HE1  . PHE A 1 94  ? 459.278 3.877   13.386  1.00 0.00 ? 94  PHE A HE1  1 
ATOM 1430 H HE2  . PHE A 1 94  ? 461.607 0.410   12.535  1.00 0.00 ? 94  PHE A HE2  1 
ATOM 1431 H HZ   . PHE A 1 94  ? 459.408 1.506   12.726  1.00 0.00 ? 94  PHE A HZ   1 
ATOM 1432 N N    . ASP A 1 95  ? 465.793 6.025   14.464  1.00 0.00 ? 95  ASP A N    1 
ATOM 1433 C CA   . ASP A 1 95  ? 466.886 6.979   14.573  1.00 0.00 ? 95  ASP A CA   1 
ATOM 1434 C C    . ASP A 1 95  ? 466.903 7.899   13.358  1.00 0.00 ? 95  ASP A C    1 
ATOM 1435 O O    . ASP A 1 95  ? 467.221 9.083   13.465  1.00 0.00 ? 95  ASP A O    1 
ATOM 1436 C CB   . ASP A 1 95  ? 468.224 6.247   14.695  1.00 0.00 ? 95  ASP A CB   1 
ATOM 1437 C CG   . ASP A 1 95  ? 468.586 5.942   16.136  1.00 0.00 ? 95  ASP A CG   1 
ATOM 1438 O OD1  . ASP A 1 95  ? 468.472 6.853   16.982  1.00 0.00 ? 95  ASP A OD1  1 
ATOM 1439 O OD2  . ASP A 1 95  ? 468.984 4.792   16.418  1.00 0.00 ? 95  ASP A OD2  1 
ATOM 1440 H H    . ASP A 1 95  ? 465.320 5.947   13.618  1.00 0.00 ? 95  ASP A H    1 
ATOM 1441 H HA   . ASP A 1 95  ? 466.725 7.573   15.460  1.00 0.00 ? 95  ASP A HA   1 
ATOM 1442 H HB2  . ASP A 1 95  ? 468.169 5.315   14.153  1.00 0.00 ? 95  ASP A HB2  1 
ATOM 1443 H HB3  . ASP A 1 95  ? 469.004 6.861   14.269  1.00 0.00 ? 95  ASP A HB3  1 
ATOM 1444 N N    . SER A 1 96  ? 466.560 7.340   12.201  1.00 0.00 ? 96  SER A N    1 
ATOM 1445 C CA   . SER A 1 96  ? 466.537 8.110   10.961  1.00 0.00 ? 96  SER A CA   1 
ATOM 1446 C C    . SER A 1 96  ? 465.269 7.849   10.159  1.00 0.00 ? 96  SER A C    1 
ATOM 1447 O O    . SER A 1 96  ? 464.673 6.776   10.242  1.00 0.00 ? 96  SER A O    1 
ATOM 1448 C CB   . SER A 1 96  ? 467.761 7.779   10.108  1.00 0.00 ? 96  SER A CB   1 
ATOM 1449 O OG   . SER A 1 96  ? 467.444 6.856   9.080   1.00 0.00 ? 96  SER A OG   1 
ATOM 1450 H H    . SER A 1 96  ? 466.322 6.388   12.187  1.00 0.00 ? 96  SER A H    1 
ATOM 1451 H HA   . SER A 1 96  ? 466.570 9.156   11.224  1.00 0.00 ? 96  SER A HA   1 
ATOM 1452 H HB2  . SER A 1 96  ? 468.131 8.683   9.653   1.00 0.00 ? 96  SER A HB2  1 
ATOM 1453 H HB3  . SER A 1 96  ? 468.526 7.351   10.734  1.00 0.00 ? 96  SER A HB3  1 
ATOM 1454 H HG   . SER A 1 96  ? 468.097 6.920   8.380   1.00 0.00 ? 96  SER A HG   1 
ATOM 1455 N N    . LEU A 1 97  ? 464.877 8.842   9.369   1.00 0.00 ? 97  LEU A N    1 
ATOM 1456 C CA   . LEU A 1 97  ? 463.697 8.736   8.531   1.00 0.00 ? 97  LEU A CA   1 
ATOM 1457 C C    . LEU A 1 97  ? 463.848 7.598   7.530   1.00 0.00 ? 97  LEU A C    1 
ATOM 1458 O O    . LEU A 1 97  ? 463.060 6.652   7.539   1.00 0.00 ? 97  LEU A O    1 
ATOM 1459 C CB   . LEU A 1 97  ? 463.451 10.062  7.818   1.00 0.00 ? 97  LEU A CB   1 
ATOM 1460 C CG   . LEU A 1 97  ? 462.358 10.924  8.444   1.00 0.00 ? 97  LEU A CG   1 
ATOM 1461 C CD1  . LEU A 1 97  ? 460.995 10.320  8.161   1.00 0.00 ? 97  LEU A CD1  1 
ATOM 1462 C CD2  . LEU A 1 97  ? 462.580 11.074  9.942   1.00 0.00 ? 97  LEU A CD2  1 
ATOM 1463 H H    . LEU A 1 97  ? 465.402 9.667   9.342   1.00 0.00 ? 97  LEU A H    1 
ATOM 1464 H HA   . LEU A 1 97  ? 462.854 8.522   9.168   1.00 0.00 ? 97  LEU A HA   1 
ATOM 1465 H HB2  . LEU A 1 97  ? 464.373 10.625  7.817   1.00 0.00 ? 97  LEU A HB2  1 
ATOM 1466 H HB3  . LEU A 1 97  ? 463.173 9.854   6.799   1.00 0.00 ? 97  LEU A HB3  1 
ATOM 1467 H HG   . LEU A 1 97  ? 462.387 11.906  8.004   1.00 0.00 ? 97  LEU A HG   1 
ATOM 1468 H HD11 . LEU A 1 97  ? 460.293 11.105  7.916   1.00 0.00 ? 97  LEU A HD11 1 
ATOM 1469 H HD12 . LEU A 1 97  ? 460.652 9.786   9.035   1.00 0.00 ? 97  LEU A HD12 1 
ATOM 1470 H HD13 . LEU A 1 97  ? 461.074 9.636   7.328   1.00 0.00 ? 97  LEU A HD13 1 
ATOM 1471 H HD21 . LEU A 1 97  ? 461.629 11.038  10.452  1.00 0.00 ? 97  LEU A HD21 1 
ATOM 1472 H HD22 . LEU A 1 97  ? 463.059 12.020  10.141  1.00 0.00 ? 97  LEU A HD22 1 
ATOM 1473 H HD23 . LEU A 1 97  ? 463.208 10.271  10.297  1.00 0.00 ? 97  LEU A HD23 1 
ATOM 1474 N N    . PRO A 1 98  ? 464.876 7.649   6.664   1.00 0.00 ? 98  PRO A N    1 
ATOM 1475 C CA   . PRO A 1 98  ? 465.111 6.589   5.688   1.00 0.00 ? 98  PRO A CA   1 
ATOM 1476 C C    . PRO A 1 98  ? 465.225 5.241   6.375   1.00 0.00 ? 98  PRO A C    1 
ATOM 1477 O O    . PRO A 1 98  ? 464.864 4.208   5.813   1.00 0.00 ? 98  PRO A O    1 
ATOM 1478 C CB   . PRO A 1 98  ? 466.434 6.976   5.015   1.00 0.00 ? 98  PRO A CB   1 
ATOM 1479 C CG   . PRO A 1 98  ? 467.037 8.023   5.890   1.00 0.00 ? 98  PRO A CG   1 
ATOM 1480 C CD   . PRO A 1 98  ? 465.891 8.709   6.579   1.00 0.00 ? 98  PRO A CD   1 
ATOM 1481 H HA   . PRO A 1 98  ? 464.323 6.547   4.956   1.00 0.00 ? 98  PRO A HA   1 
ATOM 1482 H HB2  . PRO A 1 98  ? 467.071 6.106   4.948   1.00 0.00 ? 98  PRO A HB2  1 
ATOM 1483 H HB3  . PRO A 1 98  ? 466.236 7.358   4.024   1.00 0.00 ? 98  PRO A HB3  1 
ATOM 1484 H HG2  . PRO A 1 98  ? 467.687 7.561   6.617   1.00 0.00 ? 98  PRO A HG2  1 
ATOM 1485 H HG3  . PRO A 1 98  ? 467.589 8.730   5.288   1.00 0.00 ? 98  PRO A HG3  1 
ATOM 1486 H HD2  . PRO A 1 98  ? 466.188 9.044   7.561   1.00 0.00 ? 98  PRO A HD2  1 
ATOM 1487 H HD3  . PRO A 1 98  ? 465.534 9.538   5.986   1.00 0.00 ? 98  PRO A HD3  1 
ATOM 1488 N N    . ALA A 1 99  ? 465.713 5.265   7.610   1.00 0.00 ? 99  ALA A N    1 
ATOM 1489 C CA   . ALA A 1 99  ? 465.855 4.051   8.392   1.00 0.00 ? 99  ALA A CA   1 
ATOM 1490 C C    . ALA A 1 99  ? 464.488 3.514   8.796   1.00 0.00 ? 99  ALA A C    1 
ATOM 1491 O O    . ALA A 1 99  ? 464.294 2.305   8.919   1.00 0.00 ? 99  ALA A O    1 
ATOM 1492 C CB   . ALA A 1 99  ? 466.697 4.326   9.622   1.00 0.00 ? 99  ALA A CB   1 
ATOM 1493 H H    . ALA A 1 99  ? 465.972 6.126   8.010   1.00 0.00 ? 99  ALA A H    1 
ATOM 1494 H HA   . ALA A 1 99  ? 466.362 3.314   7.786   1.00 0.00 ? 99  ALA A HA   1 
ATOM 1495 H HB1  . ALA A 1 99  ? 466.352 5.235   10.092  1.00 0.00 ? 99  ALA A HB1  1 
ATOM 1496 H HB2  . ALA A 1 99  ? 467.729 4.441   9.330   1.00 0.00 ? 99  ALA A HB2  1 
ATOM 1497 H HB3  . ALA A 1 99  ? 466.604 3.505   10.314  1.00 0.00 ? 99  ALA A HB3  1 
ATOM 1498 N N    . LEU A 1 100 ? 463.541 4.427   8.995   1.00 0.00 ? 100 LEU A N    1 
ATOM 1499 C CA   . LEU A 1 100 ? 462.189 4.055   9.376   1.00 0.00 ? 100 LEU A CA   1 
ATOM 1500 C C    . LEU A 1 100 ? 461.438 3.474   8.183   1.00 0.00 ? 100 LEU A C    1 
ATOM 1501 O O    . LEU A 1 100 ? 461.005 2.324   8.213   1.00 0.00 ? 100 LEU A O    1 
ATOM 1502 C CB   . LEU A 1 100 ? 461.450 5.276   9.924   1.00 0.00 ? 100 LEU A CB   1 
ATOM 1503 C CG   . LEU A 1 100 ? 460.017 5.021   10.384  1.00 0.00 ? 100 LEU A CG   1 
ATOM 1504 C CD1  . LEU A 1 100 ? 459.692 5.887   11.590  1.00 0.00 ? 100 LEU A CD1  1 
ATOM 1505 C CD2  . LEU A 1 100 ? 459.040 5.293   9.252   1.00 0.00 ? 100 LEU A CD2  1 
ATOM 1506 H H    . LEU A 1 100 ? 463.755 5.376   8.875   1.00 0.00 ? 100 LEU A H    1 
ATOM 1507 H HA   . LEU A 1 100 ? 462.254 3.305   10.149  1.00 0.00 ? 100 LEU A HA   1 
ATOM 1508 H HB2  . LEU A 1 100 ? 462.011 5.660   10.764  1.00 0.00 ? 100 LEU A HB2  1 
ATOM 1509 H HB3  . LEU A 1 100 ? 461.428 6.032   9.154   1.00 0.00 ? 100 LEU A HB3  1 
ATOM 1510 H HG   . LEU A 1 100 ? 459.916 3.986   10.677  1.00 0.00 ? 100 LEU A HG   1 
ATOM 1511 H HD11 . LEU A 1 100 ? 460.582 6.019   12.187  1.00 0.00 ? 100 LEU A HD11 1 
ATOM 1512 H HD12 . LEU A 1 100 ? 458.928 5.407   12.181  1.00 0.00 ? 100 LEU A HD12 1 
ATOM 1513 H HD13 . LEU A 1 100 ? 459.337 6.851   11.256  1.00 0.00 ? 100 LEU A HD13 1 
ATOM 1514 H HD21 . LEU A 1 100 ? 459.302 4.688   8.397   1.00 0.00 ? 100 LEU A HD21 1 
ATOM 1515 H HD22 . LEU A 1 100 ? 459.086 6.337   8.980   1.00 0.00 ? 100 LEU A HD22 1 
ATOM 1516 H HD23 . LEU A 1 100 ? 458.038 5.048   9.573   1.00 0.00 ? 100 LEU A HD23 1 
ATOM 1517 N N    . LEU A 1 101 ? 461.300 4.273   7.127   1.00 0.00 ? 101 LEU A N    1 
ATOM 1518 C CA   . LEU A 1 101 ? 460.607 3.832   5.914   1.00 0.00 ? 101 LEU A CA   1 
ATOM 1519 C C    . LEU A 1 101 ? 461.176 2.510   5.405   1.00 0.00 ? 101 LEU A C    1 
ATOM 1520 O O    . LEU A 1 101 ? 460.518 1.788   4.656   1.00 0.00 ? 101 LEU A O    1 
ATOM 1521 C CB   . LEU A 1 101 ? 460.713 4.878   4.800   1.00 0.00 ? 101 LEU A CB   1 
ATOM 1522 C CG   . LEU A 1 101 ? 460.722 6.338   5.249   1.00 0.00 ? 101 LEU A CG   1 
ATOM 1523 C CD1  . LEU A 1 101 ? 460.824 7.252   4.044   1.00 0.00 ? 101 LEU A CD1  1 
ATOM 1524 C CD2  . LEU A 1 101 ? 459.478 6.666   6.056   1.00 0.00 ? 101 LEU A CD2  1 
ATOM 1525 H H    . LEU A 1 101 ? 461.680 5.174   7.164   1.00 0.00 ? 101 LEU A H    1 
ATOM 1526 H HA   . LEU A 1 101 ? 459.566 3.689   6.163   1.00 0.00 ? 101 LEU A HA   1 
ATOM 1527 H HB2  . LEU A 1 101 ? 461.623 4.690   4.250   1.00 0.00 ? 101 LEU A HB2  1 
ATOM 1528 H HB3  . LEU A 1 101 ? 459.877 4.738   4.131   1.00 0.00 ? 101 LEU A HB3  1 
ATOM 1529 H HG   . LEU A 1 101 ? 461.586 6.514   5.873   1.00 0.00 ? 101 LEU A HG   1 
ATOM 1530 H HD11 . LEU A 1 101 ? 460.843 8.277   4.373   1.00 0.00 ? 101 LEU A HD11 1 
ATOM 1531 H HD12 . LEU A 1 101 ? 459.972 7.096   3.401   1.00 0.00 ? 101 LEU A HD12 1 
ATOM 1532 H HD13 . LEU A 1 101 ? 461.729 7.028   3.502   1.00 0.00 ? 101 LEU A HD13 1 
ATOM 1533 H HD21 . LEU A 1 101 ? 459.501 7.707   6.342   1.00 0.00 ? 101 LEU A HD21 1 
ATOM 1534 H HD22 . LEU A 1 101 ? 459.450 6.049   6.941   1.00 0.00 ? 101 LEU A HD22 1 
ATOM 1535 H HD23 . LEU A 1 101 ? 458.601 6.476   5.456   1.00 0.00 ? 101 LEU A HD23 1 
ATOM 1536 N N    . GLU A 1 102 ? 462.403 2.200   5.811   1.00 0.00 ? 102 GLU A N    1 
ATOM 1537 C CA   . GLU A 1 102 ? 463.069 0.971   5.398   1.00 0.00 ? 102 GLU A CA   1 
ATOM 1538 C C    . GLU A 1 102 ? 462.591 -0.224  6.226   1.00 0.00 ? 102 GLU A C    1 
ATOM 1539 O O    . GLU A 1 102 ? 463.394 -1.046  6.668   1.00 0.00 ? 102 GLU A O    1 
ATOM 1540 C CB   . GLU A 1 102 ? 464.580 1.152   5.548   1.00 0.00 ? 102 GLU A CB   1 
ATOM 1541 C CG   . GLU A 1 102 ? 465.254 1.672   4.288   1.00 0.00 ? 102 GLU A CG   1 
ATOM 1542 C CD   . GLU A 1 102 ? 466.754 1.455   4.294   1.00 0.00 ? 102 GLU A CD   1 
ATOM 1543 O OE1  . GLU A 1 102 ? 467.184 0.283   4.343   1.00 0.00 ? 102 GLU A OE1  1 
ATOM 1544 O OE2  . GLU A 1 102 ? 467.499 2.456   4.252   1.00 0.00 ? 102 GLU A OE2  1 
ATOM 1545 H H    . GLU A 1 102 ? 462.879 2.814   6.408   1.00 0.00 ? 102 GLU A H    1 
ATOM 1546 H HA   . GLU A 1 102 ? 462.838 0.794   4.359   1.00 0.00 ? 102 GLU A HA   1 
ATOM 1547 H HB2  . GLU A 1 102 ? 464.767 1.855   6.346   1.00 0.00 ? 102 GLU A HB2  1 
ATOM 1548 H HB3  . GLU A 1 102 ? 465.024 0.203   5.807   1.00 0.00 ? 102 GLU A HB3  1 
ATOM 1549 H HG2  . GLU A 1 102 ? 464.836 1.159   3.435   1.00 0.00 ? 102 GLU A HG2  1 
ATOM 1550 H HG3  . GLU A 1 102 ? 465.058 2.730   4.200   1.00 0.00 ? 102 GLU A HG3  1 
ATOM 1551 N N    . PHE A 1 103 ? 461.277 -0.317  6.430   1.00 0.00 ? 103 PHE A N    1 
ATOM 1552 C CA   . PHE A 1 103 ? 460.706 -1.417  7.202   1.00 0.00 ? 103 PHE A CA   1 
ATOM 1553 C C    . PHE A 1 103 ? 460.186 -2.561  6.330   1.00 0.00 ? 103 PHE A C    1 
ATOM 1554 O O    . PHE A 1 103 ? 460.137 -3.706  6.775   1.00 0.00 ? 103 PHE A O    1 
ATOM 1555 C CB   . PHE A 1 103 ? 459.593 -0.931  8.144   1.00 0.00 ? 103 PHE A CB   1 
ATOM 1556 C CG   . PHE A 1 103 ? 458.783 0.230   7.627   1.00 0.00 ? 103 PHE A CG   1 
ATOM 1557 C CD1  . PHE A 1 103 ? 458.216 0.199   6.363   1.00 0.00 ? 103 PHE A CD1  1 
ATOM 1558 C CD2  . PHE A 1 103 ? 458.585 1.352   8.417   1.00 0.00 ? 103 PHE A CD2  1 
ATOM 1559 C CE1  . PHE A 1 103 ? 457.469 1.264   5.897   1.00 0.00 ? 103 PHE A CE1  1 
ATOM 1560 C CE2  . PHE A 1 103 ? 457.839 2.420   7.955   1.00 0.00 ? 103 PHE A CE2  1 
ATOM 1561 C CZ   . PHE A 1 103 ? 457.280 2.376   6.694   1.00 0.00 ? 103 PHE A CZ   1 
ATOM 1562 H H    . PHE A 1 103 ? 460.694 0.358   6.030   1.00 0.00 ? 103 PHE A H    1 
ATOM 1563 H HA   . PHE A 1 103 ? 461.512 -1.811  7.802   1.00 0.00 ? 103 PHE A HA   1 
ATOM 1564 H HB2  . PHE A 1 103 ? 458.911 -1.748  8.324   1.00 0.00 ? 103 PHE A HB2  1 
ATOM 1565 H HB3  . PHE A 1 103 ? 460.038 -0.633  9.082   1.00 0.00 ? 103 PHE A HB3  1 
ATOM 1566 H HD1  . PHE A 1 103 ? 458.357 -0.667  5.741   1.00 0.00 ? 103 PHE A HD1  1 
ATOM 1567 H HD2  . PHE A 1 103 ? 459.021 1.388   9.404   1.00 0.00 ? 103 PHE A HD2  1 
ATOM 1568 H HE1  . PHE A 1 103 ? 457.034 1.227   4.910   1.00 0.00 ? 103 PHE A HE1  1 
ATOM 1569 H HE2  . PHE A 1 103 ? 457.694 3.288   8.581   1.00 0.00 ? 103 PHE A HE2  1 
ATOM 1570 H HZ   . PHE A 1 103 ? 456.697 3.209   6.331   1.00 0.00 ? 103 PHE A HZ   1 
ATOM 1571 N N    . TYR A 1 104 ? 459.761 -2.254  5.111   1.00 0.00 ? 104 TYR A N    1 
ATOM 1572 C CA   . TYR A 1 104 ? 459.205 -3.266  4.214   1.00 0.00 ? 104 TYR A CA   1 
ATOM 1573 C C    . TYR A 1 104 ? 460.284 -4.144  3.586   1.00 0.00 ? 104 TYR A C    1 
ATOM 1574 O O    . TYR A 1 104 ? 459.989 -5.176  2.989   1.00 0.00 ? 104 TYR A O    1 
ATOM 1575 C CB   . TYR A 1 104 ? 458.375 -2.590  3.116   1.00 0.00 ? 104 TYR A CB   1 
ATOM 1576 C CG   . TYR A 1 104 ? 458.831 -1.193  2.763   1.00 0.00 ? 104 TYR A CG   1 
ATOM 1577 C CD1  . TYR A 1 104 ? 460.121 -0.957  2.312   1.00 0.00 ? 104 TYR A CD1  1 
ATOM 1578 C CD2  . TYR A 1 104 ? 457.969 -0.113  2.881   1.00 0.00 ? 104 TYR A CD2  1 
ATOM 1579 C CE1  . TYR A 1 104 ? 460.540 0.319   1.986   1.00 0.00 ? 104 TYR A CE1  1 
ATOM 1580 C CE2  . TYR A 1 104 ? 458.378 1.165   2.559   1.00 0.00 ? 104 TYR A CE2  1 
ATOM 1581 C CZ   . TYR A 1 104 ? 459.665 1.377   2.111   1.00 0.00 ? 104 TYR A CZ   1 
ATOM 1582 O OH   . TYR A 1 104 ? 460.077 2.649   1.787   1.00 0.00 ? 104 TYR A OH   1 
ATOM 1583 H H    . TYR A 1 104 ? 459.789 -1.330  4.799   1.00 0.00 ? 104 TYR A H    1 
ATOM 1584 H HA   . TYR A 1 104 ? 458.552 -3.894  4.798   1.00 0.00 ? 104 TYR A HA   1 
ATOM 1585 H HB2  . TYR A 1 104 ? 458.427 -3.183  2.220   1.00 0.00 ? 104 TYR A HB2  1 
ATOM 1586 H HB3  . TYR A 1 104 ? 457.349 -2.529  3.444   1.00 0.00 ? 104 TYR A HB3  1 
ATOM 1587 H HD1  . TYR A 1 104 ? 460.803 -1.790  2.220   1.00 0.00 ? 104 TYR A HD1  1 
ATOM 1588 H HD2  . TYR A 1 104 ? 456.964 -0.282  3.234   1.00 0.00 ? 104 TYR A HD2  1 
ATOM 1589 H HE1  . TYR A 1 104 ? 461.547 0.484   1.634   1.00 0.00 ? 104 TYR A HE1  1 
ATOM 1590 H HE2  . TYR A 1 104 ? 457.691 1.992   2.659   1.00 0.00 ? 104 TYR A HE2  1 
ATOM 1591 H HH   . TYR A 1 104 ? 459.725 2.891   0.928   1.00 0.00 ? 104 TYR A HH   1 
ATOM 1592 N N    . LYS A 1 105 ? 461.531 -3.743  3.730   1.00 0.00 ? 105 LYS A N    1 
ATOM 1593 C CA   . LYS A 1 105 ? 462.638 -4.512  3.173   1.00 0.00 ? 105 LYS A CA   1 
ATOM 1594 C C    . LYS A 1 105 ? 462.816 -5.822  3.925   1.00 0.00 ? 105 LYS A C    1 
ATOM 1595 O O    . LYS A 1 105 ? 463.456 -6.749  3.428   1.00 0.00 ? 105 LYS A O    1 
ATOM 1596 C CB   . LYS A 1 105 ? 463.953 -3.723  3.198   1.00 0.00 ? 105 LYS A CB   1 
ATOM 1597 C CG   . LYS A 1 105 ? 463.893 -2.393  3.926   1.00 0.00 ? 105 LYS A CG   1 
ATOM 1598 C CD   . LYS A 1 105 ? 465.090 -1.533  3.573   1.00 0.00 ? 105 LYS A CD   1 
ATOM 1599 C CE   . LYS A 1 105 ? 464.985 -0.969  2.166   1.00 0.00 ? 105 LYS A CE   1 
ATOM 1600 N NZ   . LYS A 1 105 ? 463.587 -0.602  1.809   1.00 0.00 ? 105 LYS A NZ   1 
ATOM 1601 H H    . LYS A 1 105 ? 461.708 -2.928  4.223   1.00 0.00 ? 105 LYS A H    1 
ATOM 1602 H HA   . LYS A 1 105 ? 462.389 -4.739  2.147   1.00 0.00 ? 105 LYS A HA   1 
ATOM 1603 H HB2  . LYS A 1 105 ? 464.712 -4.326  3.671   1.00 0.00 ? 105 LYS A HB2  1 
ATOM 1604 H HB3  . LYS A 1 105 ? 464.250 -3.531  2.183   1.00 0.00 ? 105 LYS A HB3  1 
ATOM 1605 H HG2  . LYS A 1 105 ? 462.993 -1.872  3.639   1.00 0.00 ? 105 LYS A HG2  1 
ATOM 1606 H HG3  . LYS A 1 105 ? 463.890 -2.573  4.991   1.00 0.00 ? 105 LYS A HG3  1 
ATOM 1607 H HD2  . LYS A 1 105 ? 465.153 -0.720  4.269   1.00 0.00 ? 105 LYS A HD2  1 
ATOM 1608 H HD3  . LYS A 1 105 ? 465.979 -2.134  3.646   1.00 0.00 ? 105 LYS A HD3  1 
ATOM 1609 H HE2  . LYS A 1 105 ? 465.603 -0.086  2.102   1.00 0.00 ? 105 LYS A HE2  1 
ATOM 1610 H HE3  . LYS A 1 105 ? 465.344 -1.710  1.467   1.00 0.00 ? 105 LYS A HE3  1 
ATOM 1611 H HZ1  . LYS A 1 105 ? 463.585 0.067   1.012   1.00 0.00 ? 105 LYS A HZ1  1 
ATOM 1612 H HZ2  . LYS A 1 105 ? 463.116 -0.157  2.621   1.00 0.00 ? 105 LYS A HZ2  1 
ATOM 1613 H HZ3  . LYS A 1 105 ? 463.053 -1.452  1.535   1.00 0.00 ? 105 LYS A HZ3  1 
ATOM 1614 N N    . ILE A 1 106 ? 462.252 -5.898  5.125   1.00 0.00 ? 106 ILE A N    1 
ATOM 1615 C CA   . ILE A 1 106 ? 462.363 -7.101  5.929   1.00 0.00 ? 106 ILE A CA   1 
ATOM 1616 C C    . ILE A 1 106 ? 461.039 -7.860  5.987   1.00 0.00 ? 106 ILE A C    1 
ATOM 1617 O O    . ILE A 1 106 ? 460.973 -9.017  5.572   1.00 0.00 ? 106 ILE A O    1 
ATOM 1618 C CB   . ILE A 1 106 ? 462.871 -6.796  7.354   1.00 0.00 ? 106 ILE A CB   1 
ATOM 1619 C CG1  . ILE A 1 106 ? 462.306 -5.468  7.873   1.00 0.00 ? 106 ILE A CG1  1 
ATOM 1620 C CG2  . ILE A 1 106 ? 464.394 -6.769  7.362   1.00 0.00 ? 106 ILE A CG2  1 
ATOM 1621 C CD1  . ILE A 1 106 ? 463.061 -4.251  7.386   1.00 0.00 ? 106 ILE A CD1  1 
ATOM 1622 H H    . ILE A 1 106 ? 461.755 -5.130  5.474   1.00 0.00 ? 106 ILE A H    1 
ATOM 1623 H HA   . ILE A 1 106 ? 463.093 -7.738  5.451   1.00 0.00 ? 106 ILE A HA   1 
ATOM 1624 H HB   . ILE A 1 106 ? 462.549 -7.594  8.004   1.00 0.00 ? 106 ILE A HB   1 
ATOM 1625 H HG12 . ILE A 1 106 ? 461.285 -5.370  7.551   1.00 0.00 ? 106 ILE A HG12 1 
ATOM 1626 H HG13 . ILE A 1 106 ? 462.339 -5.470  8.952   1.00 0.00 ? 106 ILE A HG13 1 
ATOM 1627 H HG21 . ILE A 1 106 ? 464.743 -6.397  8.314   1.00 0.00 ? 106 ILE A HG21 1 
ATOM 1628 H HG22 . ILE A 1 106 ? 464.745 -6.120  6.571   1.00 0.00 ? 106 ILE A HG22 1 
ATOM 1629 H HG23 . ILE A 1 106 ? 464.773 -7.768  7.203   1.00 0.00 ? 106 ILE A HG23 1 
ATOM 1630 H HD11 . ILE A 1 106 ? 463.675 -4.524  6.542   1.00 0.00 ? 106 ILE A HD11 1 
ATOM 1631 H HD12 . ILE A 1 106 ? 463.688 -3.876  8.181   1.00 0.00 ? 106 ILE A HD12 1 
ATOM 1632 H HD13 . ILE A 1 106 ? 462.360 -3.486  7.090   1.00 0.00 ? 106 ILE A HD13 1 
ATOM 1633 N N    . HIS A 1 107 ? 459.985 -7.228  6.503   1.00 0.00 ? 107 HIS A N    1 
ATOM 1634 C CA   . HIS A 1 107 ? 458.691 -7.901  6.595   1.00 0.00 ? 107 HIS A CA   1 
ATOM 1635 C C    . HIS A 1 107 ? 457.541 -6.937  6.891   1.00 0.00 ? 107 HIS A C    1 
ATOM 1636 O O    . HIS A 1 107 ? 457.359 -6.498  8.026   1.00 0.00 ? 107 HIS A O    1 
ATOM 1637 C CB   . HIS A 1 107 ? 458.741 -8.979  7.678   1.00 0.00 ? 107 HIS A CB   1 
ATOM 1638 C CG   . HIS A 1 107 ? 459.172 -10.321 7.172   1.00 0.00 ? 107 HIS A CG   1 
ATOM 1639 N ND1  . HIS A 1 107 ? 458.367 -11.125 6.393   1.00 0.00 ? 107 HIS A ND1  1 
ATOM 1640 C CD2  . HIS A 1 107 ? 460.331 -11.002 7.340   1.00 0.00 ? 107 HIS A CD2  1 
ATOM 1641 C CE1  . HIS A 1 107 ? 459.011 -12.243 6.105   1.00 0.00 ? 107 HIS A CE1  1 
ATOM 1642 N NE2  . HIS A 1 107 ? 460.204 -12.192 6.667   1.00 0.00 ? 107 HIS A NE2  1 
ATOM 1643 H H    . HIS A 1 107 ? 460.079 -6.312  6.835   1.00 0.00 ? 107 HIS A H    1 
ATOM 1644 H HA   . HIS A 1 107 ? 458.502 -8.377  5.645   1.00 0.00 ? 107 HIS A HA   1 
ATOM 1645 H HB2  . HIS A 1 107 ? 459.437 -8.676  8.445   1.00 0.00 ? 107 HIS A HB2  1 
ATOM 1646 H HB3  . HIS A 1 107 ? 457.758 -9.087  8.113   1.00 0.00 ? 107 HIS A HB3  1 
ATOM 1647 H HD1  . HIS A 1 107 ? 457.458 -10.910 6.096   1.00 0.00 ? 107 HIS A HD1  1 
ATOM 1648 H HD2  . HIS A 1 107 ? 461.194 -10.670 7.899   1.00 0.00 ? 107 HIS A HD2  1 
ATOM 1649 H HE1  . HIS A 1 107 ? 458.626 -13.058 5.511   1.00 0.00 ? 107 HIS A HE1  1 
ATOM 1650 H HE2  . HIS A 1 107 ? 460.851 -12.928 6.686   1.00 0.00 ? 107 HIS A HE2  1 
ATOM 1651 N N    . TYR A 1 108 ? 456.746 -6.648  5.862   1.00 0.00 ? 108 TYR A N    1 
ATOM 1652 C CA   . TYR A 1 108 ? 455.579 -5.779  5.982   1.00 0.00 ? 108 TYR A CA   1 
ATOM 1653 C C    . TYR A 1 108 ? 455.844 -4.525  6.814   1.00 0.00 ? 108 TYR A C    1 
ATOM 1654 O O    . TYR A 1 108 ? 456.983 -4.208  7.158   1.00 0.00 ? 108 TYR A O    1 
ATOM 1655 C CB   . TYR A 1 108 ? 454.410 -6.569  6.578   1.00 0.00 ? 108 TYR A CB   1 
ATOM 1656 C CG   . TYR A 1 108 ? 454.676 -7.100  7.969   1.00 0.00 ? 108 TYR A CG   1 
ATOM 1657 C CD1  . TYR A 1 108 ? 454.369 -6.344  9.093   1.00 0.00 ? 108 TYR A CD1  1 
ATOM 1658 C CD2  . TYR A 1 108 ? 455.231 -8.360  8.157   1.00 0.00 ? 108 TYR A CD2  1 
ATOM 1659 C CE1  . TYR A 1 108 ? 454.607 -6.828  10.366  1.00 0.00 ? 108 TYR A CE1  1 
ATOM 1660 C CE2  . TYR A 1 108 ? 455.472 -8.851  9.426   1.00 0.00 ? 108 TYR A CE2  1 
ATOM 1661 C CZ   . TYR A 1 108 ? 455.159 -8.082  10.527  1.00 0.00 ? 108 TYR A CZ   1 
ATOM 1662 O OH   . TYR A 1 108 ? 455.397 -8.569  11.792  1.00 0.00 ? 108 TYR A OH   1 
ATOM 1663 H H    . TYR A 1 108 ? 456.929 -7.049  4.991   1.00 0.00 ? 108 TYR A H    1 
ATOM 1664 H HA   . TYR A 1 108 ? 455.305 -5.471  4.985   1.00 0.00 ? 108 TYR A HA   1 
ATOM 1665 H HB2  . TYR A 1 108 ? 453.540 -5.934  6.628   1.00 0.00 ? 108 TYR A HB2  1 
ATOM 1666 H HB3  . TYR A 1 108 ? 454.195 -7.413  5.938   1.00 0.00 ? 108 TYR A HB3  1 
ATOM 1667 H HD1  . TYR A 1 108 ? 453.937 -5.362  8.964   1.00 0.00 ? 108 TYR A HD1  1 
ATOM 1668 H HD2  . TYR A 1 108 ? 455.476 -8.959  7.293   1.00 0.00 ? 108 TYR A HD2  1 
ATOM 1669 H HE1  . TYR A 1 108 ? 454.361 -6.226  11.228  1.00 0.00 ? 108 TYR A HE1  1 
ATOM 1670 H HE2  . TYR A 1 108 ? 455.905 -9.832  9.551   1.00 0.00 ? 108 TYR A HE2  1 
ATOM 1671 H HH   . TYR A 1 108 ? 455.707 -7.857  12.356  1.00 0.00 ? 108 TYR A HH   1 
ATOM 1672 N N    . LEU A 1 109 ? 454.758 -3.821  7.123   1.00 0.00 ? 109 LEU A N    1 
ATOM 1673 C CA   . LEU A 1 109 ? 454.806 -2.589  7.909   1.00 0.00 ? 109 LEU A CA   1 
ATOM 1674 C C    . LEU A 1 109 ? 453.578 -2.468  8.803   1.00 0.00 ? 109 LEU A C    1 
ATOM 1675 O O    . LEU A 1 109 ? 452.734 -3.365  8.838   1.00 0.00 ? 109 LEU A O    1 
ATOM 1676 C CB   . LEU A 1 109 ? 454.906 -1.348  7.001   1.00 0.00 ? 109 LEU A CB   1 
ATOM 1677 C CG   . LEU A 1 109 ? 453.764 -1.110  5.996   1.00 0.00 ? 109 LEU A CG   1 
ATOM 1678 C CD1  . LEU A 1 109 ? 452.915 -2.349  5.767   1.00 0.00 ? 109 LEU A CD1  1 
ATOM 1679 C CD2  . LEU A 1 109 ? 452.902 0.052   6.458   1.00 0.00 ? 109 LEU A CD2  1 
ATOM 1680 H H    . LEU A 1 109 ? 453.893 -4.148  6.810   1.00 0.00 ? 109 LEU A H    1 
ATOM 1681 H HA   . LEU A 1 109 ? 455.682 -2.632  8.534   1.00 0.00 ? 109 LEU A HA   1 
ATOM 1682 H HB2  . LEU A 1 109 ? 454.954 -0.475  7.639   1.00 0.00 ? 109 LEU A HB2  1 
ATOM 1683 H HB3  . LEU A 1 109 ? 455.830 -1.412  6.447   1.00 0.00 ? 109 LEU A HB3  1 
ATOM 1684 H HG   . LEU A 1 109 ? 454.193 -0.838  5.048   1.00 0.00 ? 109 LEU A HG   1 
ATOM 1685 H HD11 . LEU A 1 109 ? 452.073 -2.095  5.145   1.00 0.00 ? 109 LEU A HD11 1 
ATOM 1686 H HD12 . LEU A 1 109 ? 452.561 -2.727  6.712   1.00 0.00 ? 109 LEU A HD12 1 
ATOM 1687 H HD13 . LEU A 1 109 ? 453.509 -3.104  5.274   1.00 0.00 ? 109 LEU A HD13 1 
ATOM 1688 H HD21 . LEU A 1 109 ? 453.060 0.893   5.804   1.00 0.00 ? 109 LEU A HD21 1 
ATOM 1689 H HD22 . LEU A 1 109 ? 453.173 0.323   7.467   1.00 0.00 ? 109 LEU A HD22 1 
ATOM 1690 H HD23 . LEU A 1 109 ? 451.866 -0.235  6.430   1.00 0.00 ? 109 LEU A HD23 1 
ATOM 1691 N N    . ASP A 1 110 ? 453.492 -1.356  9.531   1.00 0.00 ? 110 ASP A N    1 
ATOM 1692 C CA   . ASP A 1 110 ? 452.374 -1.103  10.439  1.00 0.00 ? 110 ASP A CA   1 
ATOM 1693 C C    . ASP A 1 110 ? 451.049 -1.595  9.857   1.00 0.00 ? 110 ASP A C    1 
ATOM 1694 O O    . ASP A 1 110 ? 450.366 -2.419  10.465  1.00 0.00 ? 110 ASP A O    1 
ATOM 1695 C CB   . ASP A 1 110 ? 452.279 0.391   10.755  1.00 0.00 ? 110 ASP A CB   1 
ATOM 1696 C CG   . ASP A 1 110 ? 453.171 0.794   11.913  1.00 0.00 ? 110 ASP A CG   1 
ATOM 1697 O OD1  . ASP A 1 110 ? 454.406 0.660   11.786  1.00 0.00 ? 110 ASP A OD1  1 
ATOM 1698 O OD2  . ASP A 1 110 ? 452.634 1.245   12.947  1.00 0.00 ? 110 ASP A OD2  1 
ATOM 1699 H H    . ASP A 1 110 ? 454.210 -0.692  9.464   1.00 0.00 ? 110 ASP A H    1 
ATOM 1700 H HA   . ASP A 1 110 ? 452.568 -1.640  11.355  1.00 0.00 ? 110 ASP A HA   1 
ATOM 1701 H HB2  . ASP A 1 110 ? 452.573 0.957   9.884   1.00 0.00 ? 110 ASP A HB2  1 
ATOM 1702 H HB3  . ASP A 1 110 ? 451.257 0.634   11.010  1.00 0.00 ? 110 ASP A HB3  1 
ATOM 1703 N N    . THR A 1 111 ? 450.685 -1.085  8.682   1.00 0.00 ? 111 THR A N    1 
ATOM 1704 C CA   . THR A 1 111 ? 449.433 -1.482  8.038   1.00 0.00 ? 111 THR A CA   1 
ATOM 1705 C C    . THR A 1 111 ? 449.628 -1.764  6.550   1.00 0.00 ? 111 THR A C    1 
ATOM 1706 O O    . THR A 1 111 ? 450.064 -0.896  5.802   1.00 0.00 ? 111 THR A O    1 
ATOM 1707 C CB   . THR A 1 111 ? 448.376 -0.392  8.218   1.00 0.00 ? 111 THR A CB   1 
ATOM 1708 O OG1  . THR A 1 111 ? 448.987 0.872   8.412   1.00 0.00 ? 111 THR A OG1  1 
ATOM 1709 C CG2  . THR A 1 111 ? 447.452 -0.641  9.391   1.00 0.00 ? 111 THR A CG2  1 
ATOM 1710 H H    . THR A 1 111 ? 451.260 -0.425  8.240   1.00 0.00 ? 111 THR A H    1 
ATOM 1711 H HA   . THR A 1 111 ? 449.087 -2.384  8.519   1.00 0.00 ? 111 THR A HA   1 
ATOM 1712 H HB   . THR A 1 111 ? 447.771 -0.343  7.323   1.00 0.00 ? 111 THR A HB   1 
ATOM 1713 H HG1  . THR A 1 111 ? 448.309 1.540   8.534   1.00 0.00 ? 111 THR A HG1  1 
ATOM 1714 H HG21 . THR A 1 111 ? 447.034 0.298   9.725   1.00 0.00 ? 111 THR A HG21 1 
ATOM 1715 H HG22 . THR A 1 111 ? 448.007 -1.096  10.197  1.00 0.00 ? 111 THR A HG22 1 
ATOM 1716 H HG23 . THR A 1 111 ? 446.653 -1.301  9.086   1.00 0.00 ? 111 THR A HG23 1 
ATOM 1717 N N    . THR A 1 112 ? 449.305 -2.998  6.150   1.00 0.00 ? 112 THR A N    1 
ATOM 1718 C CA   . THR A 1 112 ? 449.427 -3.478  4.768   1.00 0.00 ? 112 THR A CA   1 
ATOM 1719 C C    . THR A 1 112 ? 450.711 -4.283  4.600   1.00 0.00 ? 112 THR A C    1 
ATOM 1720 O O    . THR A 1 112 ? 451.401 -4.575  5.576   1.00 0.00 ? 112 THR A O    1 
ATOM 1721 C CB   . THR A 1 112 ? 449.382 -2.355  3.719   1.00 0.00 ? 112 THR A CB   1 
ATOM 1722 O OG1  . THR A 1 112 ? 450.585 -1.606  3.705   1.00 0.00 ? 112 THR A OG1  1 
ATOM 1723 C CG2  . THR A 1 112 ? 448.222 -1.388  3.868   1.00 0.00 ? 112 THR A CG2  1 
ATOM 1724 H H    . THR A 1 112 ? 448.986 -3.627  6.823   1.00 0.00 ? 112 THR A H    1 
ATOM 1725 H HA   . THR A 1 112 ? 448.593 -4.143  4.593   1.00 0.00 ? 112 THR A HA   1 
ATOM 1726 H HB   . THR A 1 112 ? 449.281 -2.820  2.756   1.00 0.00 ? 112 THR A HB   1 
ATOM 1727 H HG1  . THR A 1 112 ? 450.530 -0.891  4.342   1.00 0.00 ? 112 THR A HG1  1 
ATOM 1728 H HG21 . THR A 1 112 ? 447.302 -1.892  3.612   1.00 0.00 ? 112 THR A HG21 1 
ATOM 1729 H HG22 . THR A 1 112 ? 448.370 -0.551  3.194   1.00 0.00 ? 112 THR A HG22 1 
ATOM 1730 H HG23 . THR A 1 112 ? 448.167 -1.029  4.881   1.00 0.00 ? 112 THR A HG23 1 
ATOM 1731 N N    . THR A 1 113 ? 451.023 -4.648  3.360   1.00 0.00 ? 113 THR A N    1 
ATOM 1732 C CA   . THR A 1 113 ? 452.221 -5.426  3.074   1.00 0.00 ? 113 THR A CA   1 
ATOM 1733 C C    . THR A 1 113 ? 453.129 -4.700  2.087   1.00 0.00 ? 113 THR A C    1 
ATOM 1734 O O    . THR A 1 113 ? 452.796 -4.555  0.910   1.00 0.00 ? 113 THR A O    1 
ATOM 1735 C CB   . THR A 1 113 ? 451.844 -6.803  2.522   1.00 0.00 ? 113 THR A CB   1 
ATOM 1736 O OG1  . THR A 1 113 ? 450.440 -6.993  2.556   1.00 0.00 ? 113 THR A OG1  1 
ATOM 1737 C CG2  . THR A 1 113 ? 452.479 -7.943  3.287   1.00 0.00 ? 113 THR A CG2  1 
ATOM 1738 H H    . THR A 1 113 ? 450.432 -4.395  2.623   1.00 0.00 ? 113 THR A H    1 
ATOM 1739 H HA   . THR A 1 113 ? 452.757 -5.558  4.003   1.00 0.00 ? 113 THR A HA   1 
ATOM 1740 H HB   . THR A 1 113 ? 452.171 -6.872  1.495   1.00 0.00 ? 113 THR A HB   1 
ATOM 1741 H HG1  . THR A 1 113 ? 450.156 -7.425  1.747   1.00 0.00 ? 113 THR A HG1  1 
ATOM 1742 H HG21 . THR A 1 113 ? 453.453 -7.639  3.641   1.00 0.00 ? 113 THR A HG21 1 
ATOM 1743 H HG22 . THR A 1 113 ? 452.582 -8.799  2.637   1.00 0.00 ? 113 THR A HG22 1 
ATOM 1744 H HG23 . THR A 1 113 ? 451.855 -8.202  4.129   1.00 0.00 ? 113 THR A HG23 1 
ATOM 1745 N N    . LEU A 1 114 ? 454.280 -4.253  2.575   1.00 0.00 ? 114 LEU A N    1 
ATOM 1746 C CA   . LEU A 1 114 ? 455.247 -3.549  1.743   1.00 0.00 ? 114 LEU A CA   1 
ATOM 1747 C C    . LEU A 1 114 ? 454.650 -2.277  1.148   1.00 0.00 ? 114 LEU A C    1 
ATOM 1748 O O    . LEU A 1 114 ? 454.031 -2.305  0.084   1.00 0.00 ? 114 LEU A O    1 
ATOM 1749 C CB   . LEU A 1 114 ? 455.751 -4.465  0.626   1.00 0.00 ? 114 LEU A CB   1 
ATOM 1750 C CG   . LEU A 1 114 ? 456.464 -5.736  1.099   1.00 0.00 ? 114 LEU A CG   1 
ATOM 1751 C CD1  . LEU A 1 114 ? 457.609 -5.393  2.042   1.00 0.00 ? 114 LEU A CD1  1 
ATOM 1752 C CD2  . LEU A 1 114 ? 455.482 -6.680  1.777   1.00 0.00 ? 114 LEU A CD2  1 
ATOM 1753 H H    . LEU A 1 114 ? 454.487 -4.406  3.521   1.00 0.00 ? 114 LEU A H    1 
ATOM 1754 H HA   . LEU A 1 114 ? 456.079 -3.276  2.369   1.00 0.00 ? 114 LEU A HA   1 
ATOM 1755 H HB2  . LEU A 1 114 ? 454.906 -4.756  0.019   1.00 0.00 ? 114 LEU A HB2  1 
ATOM 1756 H HB3  . LEU A 1 114 ? 456.438 -3.903  0.011   1.00 0.00 ? 114 LEU A HB3  1 
ATOM 1757 H HG   . LEU A 1 114 ? 456.881 -6.246  0.243   1.00 0.00 ? 114 LEU A HG   1 
ATOM 1758 H HD11 . LEU A 1 114 ? 458.002 -6.299  2.478   1.00 0.00 ? 114 LEU A HD11 1 
ATOM 1759 H HD12 . LEU A 1 114 ? 457.253 -4.743  2.827   1.00 0.00 ? 114 LEU A HD12 1 
ATOM 1760 H HD13 . LEU A 1 114 ? 458.394 -4.892  1.491   1.00 0.00 ? 114 LEU A HD13 1 
ATOM 1761 H HD21 . LEU A 1 114 ? 455.875 -7.685  1.753   1.00 0.00 ? 114 LEU A HD21 1 
ATOM 1762 H HD22 . LEU A 1 114 ? 454.536 -6.650  1.256   1.00 0.00 ? 114 LEU A HD22 1 
ATOM 1763 H HD23 . LEU A 1 114 ? 455.338 -6.373  2.803   1.00 0.00 ? 114 LEU A HD23 1 
ATOM 1764 N N    . ILE A 1 115 ? 454.847 -1.161  1.844   1.00 0.00 ? 115 ILE A N    1 
ATOM 1765 C CA   . ILE A 1 115 ? 454.338 0.129   1.394   1.00 0.00 ? 115 ILE A CA   1 
ATOM 1766 C C    . ILE A 1 115 ? 455.418 0.918   0.663   1.00 0.00 ? 115 ILE A C    1 
ATOM 1767 O O    . ILE A 1 115 ? 456.578 0.510   0.622   1.00 0.00 ? 115 ILE A O    1 
ATOM 1768 C CB   . ILE A 1 115 ? 453.836 0.971   2.581   1.00 0.00 ? 115 ILE A CB   1 
ATOM 1769 C CG1  . ILE A 1 115 ? 454.936 1.088   3.638   1.00 0.00 ? 115 ILE A CG1  1 
ATOM 1770 C CG2  . ILE A 1 115 ? 452.578 0.356   3.174   1.00 0.00 ? 115 ILE A CG2  1 
ATOM 1771 C CD1  . ILE A 1 115 ? 454.676 2.145   4.684   1.00 0.00 ? 115 ILE A CD1  1 
ATOM 1772 H H    . ILE A 1 115 ? 455.350 -1.206  2.683   1.00 0.00 ? 115 ILE A H    1 
ATOM 1773 H HA   . ILE A 1 115 ? 453.510 -0.047  0.724   1.00 0.00 ? 115 ILE A HA   1 
ATOM 1774 H HB   . ILE A 1 115 ? 453.589 1.957   2.217   1.00 0.00 ? 115 ILE A HB   1 
ATOM 1775 H HG12 . ILE A 1 115 ? 455.035 0.145   4.148   1.00 0.00 ? 115 ILE A HG12 1 
ATOM 1776 H HG13 . ILE A 1 115 ? 455.869 1.328   3.150   1.00 0.00 ? 115 ILE A HG13 1 
ATOM 1777 H HG21 . ILE A 1 115 ? 452.303 0.891   4.069   1.00 0.00 ? 115 ILE A HG21 1 
ATOM 1778 H HG22 . ILE A 1 115 ? 452.763 -0.680  3.416   1.00 0.00 ? 115 ILE A HG22 1 
ATOM 1779 H HG23 . ILE A 1 115 ? 451.776 0.419   2.457   1.00 0.00 ? 115 ILE A HG23 1 
ATOM 1780 H HD11 . ILE A 1 115 ? 454.822 1.722   5.666   1.00 0.00 ? 115 ILE A HD11 1 
ATOM 1781 H HD12 . ILE A 1 115 ? 453.660 2.500   4.592   1.00 0.00 ? 115 ILE A HD12 1 
ATOM 1782 H HD13 . ILE A 1 115 ? 455.359 2.968   4.543   1.00 0.00 ? 115 ILE A HD13 1 
ATOM 1783 N N    . GLU A 1 116 ? 455.031 2.053   0.092   1.00 0.00 ? 116 GLU A N    1 
ATOM 1784 C CA   . GLU A 1 116 ? 455.968 2.904   -0.629  1.00 0.00 ? 116 GLU A CA   1 
ATOM 1785 C C    . GLU A 1 116 ? 455.404 4.314   -0.778  1.00 0.00 ? 116 GLU A C    1 
ATOM 1786 O O    . GLU A 1 116 ? 454.190 4.507   -0.727  1.00 0.00 ? 116 GLU A O    1 
ATOM 1787 C CB   . GLU A 1 116 ? 456.276 2.305   -2.006  1.00 0.00 ? 116 GLU A CB   1 
ATOM 1788 C CG   . GLU A 1 116 ? 455.143 2.439   -3.014  1.00 0.00 ? 116 GLU A CG   1 
ATOM 1789 C CD   . GLU A 1 116 ? 455.646 2.554   -4.439  1.00 0.00 ? 116 GLU A CD   1 
ATOM 1790 O OE1  . GLU A 1 116 ? 456.426 3.488   -4.720  1.00 0.00 ? 116 GLU A OE1  1 
ATOM 1791 O OE2  . GLU A 1 116 ? 455.261 1.710   -5.275  1.00 0.00 ? 116 GLU A OE2  1 
ATOM 1792 H H    . GLU A 1 116 ? 454.093 2.326   0.159   1.00 0.00 ? 116 GLU A H    1 
ATOM 1793 H HA   . GLU A 1 116 ? 456.881 2.953   -0.055  1.00 0.00 ? 116 GLU A HA   1 
ATOM 1794 H HB2  . GLU A 1 116 ? 457.147 2.794   -2.412  1.00 0.00 ? 116 GLU A HB2  1 
ATOM 1795 H HB3  . GLU A 1 116 ? 456.491 1.254   -1.882  1.00 0.00 ? 116 GLU A HB3  1 
ATOM 1796 H HG2  . GLU A 1 116 ? 454.509 1.569   -2.941  1.00 0.00 ? 116 GLU A HG2  1 
ATOM 1797 H HG3  . GLU A 1 116 ? 454.567 3.322   -2.779  1.00 0.00 ? 116 GLU A HG3  1 
ATOM 1798 N N    . PRO A 1 117 ? 456.271 5.324   -0.974  1.00 0.00 ? 117 PRO A N    1 
ATOM 1799 C CA   . PRO A 1 117 ? 455.833 6.707   -1.140  1.00 0.00 ? 117 PRO A CA   1 
ATOM 1800 C C    . PRO A 1 117 ? 454.672 6.803   -2.124  1.00 0.00 ? 117 PRO A C    1 
ATOM 1801 O O    . PRO A 1 117 ? 454.662 6.118   -3.147  1.00 0.00 ? 117 PRO A O    1 
ATOM 1802 C CB   . PRO A 1 117 ? 457.070 7.436   -1.684  1.00 0.00 ? 117 PRO A CB   1 
ATOM 1803 C CG   . PRO A 1 117 ? 458.120 6.393   -1.883  1.00 0.00 ? 117 PRO A CG   1 
ATOM 1804 C CD   . PRO A 1 117 ? 457.727 5.200   -1.060  1.00 0.00 ? 117 PRO A CD   1 
ATOM 1805 H HA   . PRO A 1 117 ? 455.545 7.145   -0.198  1.00 0.00 ? 117 PRO A HA   1 
ATOM 1806 H HB2  . PRO A 1 117 ? 456.820 7.920   -2.616  1.00 0.00 ? 117 PRO A HB2  1 
ATOM 1807 H HB3  . PRO A 1 117 ? 457.391 8.180   -0.968  1.00 0.00 ? 117 PRO A HB3  1 
ATOM 1808 H HG2  . PRO A 1 117 ? 458.166 6.123   -2.924  1.00 0.00 ? 117 PRO A HG2  1 
ATOM 1809 H HG3  . PRO A 1 117 ? 459.074 6.775   -1.551  1.00 0.00 ? 117 PRO A HG3  1 
ATOM 1810 H HD2  . PRO A 1 117 ? 458.010 4.287   -1.560  1.00 0.00 ? 117 PRO A HD2  1 
ATOM 1811 H HD3  . PRO A 1 117 ? 458.178 5.251   -0.082  1.00 0.00 ? 117 PRO A HD3  1 
ATOM 1812 N N    . VAL A 1 118 ? 453.698 7.652   -1.821  1.00 0.00 ? 118 VAL A N    1 
ATOM 1813 C CA   . VAL A 1 118 ? 452.542 7.820   -2.701  1.00 0.00 ? 118 VAL A CA   1 
ATOM 1814 C C    . VAL A 1 118 ? 452.959 8.533   -3.984  1.00 0.00 ? 118 VAL A C    1 
ATOM 1815 O O    . VAL A 1 118 ? 454.076 9.043   -4.078  1.00 0.00 ? 118 VAL A O    1 
ATOM 1816 C CB   . VAL A 1 118 ? 451.386 8.622   -2.036  1.00 0.00 ? 118 VAL A CB   1 
ATOM 1817 C CG1  . VAL A 1 118 ? 450.084 7.844   -2.125  1.00 0.00 ? 118 VAL A CG1  1 
ATOM 1818 C CG2  . VAL A 1 118 ? 451.684 8.981   -0.580  1.00 0.00 ? 118 VAL A CG2  1 
ATOM 1819 H H    . VAL A 1 118 ? 453.757 8.182   -1.003  1.00 0.00 ? 118 VAL A H    1 
ATOM 1820 H HA   . VAL A 1 118 ? 452.171 6.835   -2.951  1.00 0.00 ? 118 VAL A HA   1 
ATOM 1821 H HB   . VAL A 1 118 ? 451.258 9.542   -2.588  1.00 0.00 ? 118 VAL A HB   1 
ATOM 1822 H HG11 . VAL A 1 118 ? 449.676 7.940   -3.120  1.00 0.00 ? 118 VAL A HG11 1 
ATOM 1823 H HG12 . VAL A 1 118 ? 449.378 8.239   -1.405  1.00 0.00 ? 118 VAL A HG12 1 
ATOM 1824 H HG13 . VAL A 1 118 ? 450.273 6.801   -1.912  1.00 0.00 ? 118 VAL A HG13 1 
ATOM 1825 H HG21 . VAL A 1 118 ? 450.788 9.371   -0.115  1.00 0.00 ? 118 VAL A HG21 1 
ATOM 1826 H HG22 . VAL A 1 118 ? 452.463 9.730   -0.539  1.00 0.00 ? 118 VAL A HG22 1 
ATOM 1827 H HG23 . VAL A 1 118 ? 452.006 8.097   -0.049  1.00 0.00 ? 118 VAL A HG23 1 
ATOM 1828 N N    . SER A 1 119 ? 452.056 8.588   -4.964  1.00 0.00 ? 119 SER A N    1 
ATOM 1829 C CA   . SER A 1 119 ? 452.343 9.274   -6.223  1.00 0.00 ? 119 SER A CA   1 
ATOM 1830 C C    . SER A 1 119 ? 452.604 10.748  -5.929  1.00 0.00 ? 119 SER A C    1 
ATOM 1831 O O    . SER A 1 119 ? 453.141 11.070  -4.875  1.00 0.00 ? 119 SER A O    1 
ATOM 1832 C CB   . SER A 1 119 ? 451.169 9.115   -7.192  1.00 0.00 ? 119 SER A CB   1 
ATOM 1833 O OG   . SER A 1 119 ? 450.070 9.916   -6.796  1.00 0.00 ? 119 SER A OG   1 
ATOM 1834 H H    . SER A 1 119 ? 451.176 8.178   -4.830  1.00 0.00 ? 119 SER A H    1 
ATOM 1835 H HA   . SER A 1 119 ? 453.231 8.834   -6.654  1.00 0.00 ? 119 SER A HA   1 
ATOM 1836 H HB2  . SER A 1 119 ? 451.479 9.415   -8.181  1.00 0.00 ? 119 SER A HB2  1 
ATOM 1837 H HB3  . SER A 1 119 ? 450.857 8.081   -7.210  1.00 0.00 ? 119 SER A HB3  1 
ATOM 1838 H HG   . SER A 1 119 ? 449.294 9.671   -7.306  1.00 0.00 ? 119 SER A HG   1 
ATOM 1839 N N    . ARG A 1 120 ? 452.219 11.658  -6.821  1.00 0.00 ? 120 ARG A N    1 
ATOM 1840 C CA   . ARG A 1 120 ? 452.419 13.079  -6.561  1.00 0.00 ? 120 ARG A CA   1 
ATOM 1841 C C    . ARG A 1 120 ? 451.116 13.670  -6.047  1.00 0.00 ? 120 ARG A C    1 
ATOM 1842 O O    . ARG A 1 120 ? 451.001 14.040  -4.882  1.00 0.00 ? 120 ARG A O    1 
ATOM 1843 C CB   . ARG A 1 120 ? 452.882 13.825  -7.824  1.00 0.00 ? 120 ARG A CB   1 
ATOM 1844 C CG   . ARG A 1 120 ? 453.004 12.948  -9.064  1.00 0.00 ? 120 ARG A CG   1 
ATOM 1845 C CD   . ARG A 1 120 ? 453.322 13.773  -10.302 1.00 0.00 ? 120 ARG A CD   1 
ATOM 1846 N NE   . ARG A 1 120 ? 454.381 13.167  -11.107 1.00 0.00 ? 120 ARG A NE   1 
ATOM 1847 C CZ   . ARG A 1 120 ? 455.670 13.191  -10.776 1.00 0.00 ? 120 ARG A CZ   1 
ATOM 1848 N NH1  . ARG A 1 120 ? 456.064 13.788  -9.658  1.00 0.00 ? 120 ARG A NH1  1 
ATOM 1849 N NH2  . ARG A 1 120 ? 456.568 12.617  -11.565 1.00 0.00 ? 120 ARG A NH2  1 
ATOM 1850 H H    . ARG A 1 120 ? 451.781 11.408  -7.659  1.00 0.00 ? 120 ARG A H    1 
ATOM 1851 H HA   . ARG A 1 120 ? 453.169 13.174  -5.792  1.00 0.00 ? 120 ARG A HA   1 
ATOM 1852 H HB2  . ARG A 1 120 ? 452.177 14.613  -8.040  1.00 0.00 ? 120 ARG A HB2  1 
ATOM 1853 H HB3  . ARG A 1 120 ? 453.849 14.266  -7.629  1.00 0.00 ? 120 ARG A HB3  1 
ATOM 1854 H HG2  . ARG A 1 120 ? 453.795 12.230  -8.909  1.00 0.00 ? 120 ARG A HG2  1 
ATOM 1855 H HG3  . ARG A 1 120 ? 452.069 12.428  -9.219  1.00 0.00 ? 120 ARG A HG3  1 
ATOM 1856 H HD2  . ARG A 1 120 ? 452.429 13.854  -10.903 1.00 0.00 ? 120 ARG A HD2  1 
ATOM 1857 H HD3  . ARG A 1 120 ? 453.638 14.758  -9.992  1.00 0.00 ? 120 ARG A HD3  1 
ATOM 1858 H HE   . ARG A 1 120 ? 454.117 12.719  -11.938 1.00 0.00 ? 120 ARG A HE   1 
ATOM 1859 H HH11 . ARG A 1 120 ? 455.393 14.223  -9.059  1.00 0.00 ? 120 ARG A HH11 1 
ATOM 1860 H HH12 . ARG A 1 120 ? 457.034 13.803  -9.415  1.00 0.00 ? 120 ARG A HH12 1 
ATOM 1861 H HH21 . ARG A 1 120 ? 456.276 12.165  -12.408 1.00 0.00 ? 120 ARG A HH21 1 
ATOM 1862 H HH22 . ARG A 1 120 ? 457.536 12.635  -11.316 1.00 0.00 ? 120 ARG A HH22 1 
ATOM 1863 N N    . SER A 1 121 ? 450.120 13.714  -6.920  1.00 0.00 ? 121 SER A N    1 
ATOM 1864 C CA   . SER A 1 121 ? 448.800 14.211  -6.555  1.00 0.00 ? 121 SER A CA   1 
ATOM 1865 C C    . SER A 1 121 ? 448.863 15.535  -5.783  1.00 0.00 ? 121 SER A C    1 
ATOM 1866 O O    . SER A 1 121 ? 449.798 16.318  -5.945  1.00 0.00 ? 121 SER A O    1 
ATOM 1867 C CB   . SER A 1 121 ? 448.089 13.143  -5.725  1.00 0.00 ? 121 SER A CB   1 
ATOM 1868 O OG   . SER A 1 121 ? 446.749 12.970  -6.151  1.00 0.00 ? 121 SER A OG   1 
ATOM 1869 H H    . SER A 1 121 ? 450.266 13.374  -7.827  1.00 0.00 ? 121 SER A H    1 
ATOM 1870 H HA   . SER A 1 121 ? 448.244 14.367  -7.466  1.00 0.00 ? 121 SER A HA   1 
ATOM 1871 H HB2  . SER A 1 121 ? 448.614 12.205  -5.832  1.00 0.00 ? 121 SER A HB2  1 
ATOM 1872 H HB3  . SER A 1 121 ? 448.091 13.439  -4.687  1.00 0.00 ? 121 SER A HB3  1 
ATOM 1873 H HG   . SER A 1 121 ? 446.154 13.360  -5.506  1.00 0.00 ? 121 SER A HG   1 
ATOM 1874 N N    . ARG A 1 122 ? 447.836 15.779  -4.965  1.00 0.00 ? 122 ARG A N    1 
ATOM 1875 C CA   . ARG A 1 122 ? 447.719 17.001  -4.171  1.00 0.00 ? 122 ARG A CA   1 
ATOM 1876 C C    . ARG A 1 122 ? 448.035 18.258  -4.993  1.00 0.00 ? 122 ARG A C    1 
ATOM 1877 O O    . ARG A 1 122 ? 448.362 19.306  -4.436  1.00 0.00 ? 122 ARG A O    1 
ATOM 1878 C CB   . ARG A 1 122 ? 448.571 16.928  -2.897  1.00 0.00 ? 122 ARG A CB   1 
ATOM 1879 C CG   . ARG A 1 122 ? 449.921 17.612  -2.975  1.00 0.00 ? 122 ARG A CG   1 
ATOM 1880 C CD   . ARG A 1 122 ? 451.004 16.595  -3.193  1.00 0.00 ? 122 ARG A CD   1 
ATOM 1881 N NE   . ARG A 1 122 ? 452.333 17.124  -2.891  1.00 0.00 ? 122 ARG A NE   1 
ATOM 1882 C CZ   . ARG A 1 122 ? 453.056 17.850  -3.741  1.00 0.00 ? 122 ARG A CZ   1 
ATOM 1883 N NH1  . ARG A 1 122 ? 452.588 18.134  -4.950  1.00 0.00 ? 122 ARG A NH1  1 
ATOM 1884 N NH2  . ARG A 1 122 ? 454.252 18.296  -3.379  1.00 0.00 ? 122 ARG A NH2  1 
ATOM 1885 H H    . ARG A 1 122 ? 447.116 15.118  -4.906  1.00 0.00 ? 122 ARG A H    1 
ATOM 1886 H HA   . ARG A 1 122 ? 446.701 17.056  -3.864  1.00 0.00 ? 122 ARG A HA   1 
ATOM 1887 H HB2  . ARG A 1 122 ? 448.018 17.384  -2.095  1.00 0.00 ? 122 ARG A HB2  1 
ATOM 1888 H HB3  . ARG A 1 122 ? 448.735 15.889  -2.648  1.00 0.00 ? 122 ARG A HB3  1 
ATOM 1889 H HG2  . ARG A 1 122 ? 449.929 18.313  -3.791  1.00 0.00 ? 122 ARG A HG2  1 
ATOM 1890 H HG3  . ARG A 1 122 ? 450.103 18.130  -2.048  1.00 0.00 ? 122 ARG A HG3  1 
ATOM 1891 H HD2  . ARG A 1 122 ? 450.800 15.752  -2.554  1.00 0.00 ? 122 ARG A HD2  1 
ATOM 1892 H HD3  . ARG A 1 122 ? 450.968 16.280  -4.222  1.00 0.00 ? 122 ARG A HD3  1 
ATOM 1893 H HE   . ARG A 1 122 ? 452.706 16.930  -2.007  1.00 0.00 ? 122 ARG A HE   1 
ATOM 1894 H HH11 . ARG A 1 122 ? 451.687 17.803  -5.229  1.00 0.00 ? 122 ARG A HH11 1 
ATOM 1895 H HH12 . ARG A 1 122 ? 453.137 18.680  -5.582  1.00 0.00 ? 122 ARG A HH12 1 
ATOM 1896 H HH21 . ARG A 1 122 ? 454.609 18.086  -2.469  1.00 0.00 ? 122 ARG A HH21 1 
ATOM 1897 H HH22 . ARG A 1 122 ? 454.796 18.841  -4.017  1.00 0.00 ? 122 ARG A HH22 1 
ATOM 1898 N N    . GLN A 1 123 ? 447.930 18.150  -6.317  1.00 0.00 ? 123 GLN A N    1 
ATOM 1899 C CA   . GLN A 1 123 ? 448.209 19.279  -7.199  1.00 0.00 ? 123 GLN A CA   1 
ATOM 1900 C C    . GLN A 1 123 ? 449.681 19.673  -7.116  1.00 0.00 ? 123 GLN A C    1 
ATOM 1901 O O    . GLN A 1 123 ? 450.066 20.502  -6.291  1.00 0.00 ? 123 GLN A O    1 
ATOM 1902 C CB   . GLN A 1 123 ? 447.326 20.476  -6.838  1.00 0.00 ? 123 GLN A CB   1 
ATOM 1903 C CG   . GLN A 1 123 ? 447.440 21.635  -7.816  1.00 0.00 ? 123 GLN A CG   1 
ATOM 1904 C CD   . GLN A 1 123 ? 448.624 22.535  -7.518  1.00 0.00 ? 123 GLN A CD   1 
ATOM 1905 O OE1  . GLN A 1 123 ? 449.618 22.533  -8.245  1.00 0.00 ? 123 GLN A OE1  1 
ATOM 1906 N NE2  . GLN A 1 123 ? 448.523 23.311  -6.445  1.00 0.00 ? 123 GLN A NE2  1 
ATOM 1907 H H    . GLN A 1 123 ? 447.657 17.296  -6.709  1.00 0.00 ? 123 GLN A H    1 
ATOM 1908 H HA   . GLN A 1 123 ? 447.988 18.971  -8.210  1.00 0.00 ? 123 GLN A HA   1 
ATOM 1909 H HB2  . GLN A 1 123 ? 446.295 20.154  -6.814  1.00 0.00 ? 123 GLN A HB2  1 
ATOM 1910 H HB3  . GLN A 1 123 ? 447.605 20.833  -5.858  1.00 0.00 ? 123 GLN A HB3  1 
ATOM 1911 H HG2  . GLN A 1 123 ? 447.553 21.237  -8.813  1.00 0.00 ? 123 GLN A HG2  1 
ATOM 1912 H HG3  . GLN A 1 123 ? 446.536 22.224  -7.763  1.00 0.00 ? 123 GLN A HG3  1 
ATOM 1913 H HE21 . GLN A 1 123 ? 447.702 23.260  -5.912  1.00 0.00 ? 123 GLN A HE21 1 
ATOM 1914 H HE22 . GLN A 1 123 ? 449.274 23.903  -6.230  1.00 0.00 ? 123 GLN A HE22 1 
ATOM 1915 N N    . GLY A 1 124 ? 450.502 19.068  -7.971  1.00 0.00 ? 124 GLY A N    1 
ATOM 1916 C CA   . GLY A 1 124 ? 451.923 19.365  -7.972  1.00 0.00 ? 124 GLY A CA   1 
ATOM 1917 C C    . GLY A 1 124 ? 452.306 20.402  -9.010  1.00 0.00 ? 124 GLY A C    1 
ATOM 1918 O O    . GLY A 1 124 ? 451.598 20.593  -9.998  1.00 0.00 ? 124 GLY A O    1 
ATOM 1919 H H    . GLY A 1 124 ? 450.140 18.412  -8.603  1.00 0.00 ? 124 GLY A H    1 
ATOM 1920 H HA2  . GLY A 1 124 ? 452.202 19.732  -6.995  1.00 0.00 ? 124 GLY A HA2  1 
ATOM 1921 H HA3  . GLY A 1 124 ? 452.469 18.455  -8.170  1.00 0.00 ? 124 GLY A HA3  1 
ATOM 1922 N N    . SER A 1 125 ? 453.431 21.074  -8.782  1.00 0.00 ? 125 SER A N    1 
ATOM 1923 C CA   . SER A 1 125 ? 453.910 22.099  -9.703  1.00 0.00 ? 125 SER A CA   1 
ATOM 1924 C C    . SER A 1 125 ? 455.112 21.611  -10.512 1.00 0.00 ? 125 SER A C    1 
ATOM 1925 O O    . SER A 1 125 ? 455.549 22.280  -11.448 1.00 0.00 ? 125 SER A O    1 
ATOM 1926 C CB   . SER A 1 125 ? 454.286 23.366  -8.932  1.00 0.00 ? 125 SER A CB   1 
ATOM 1927 O OG   . SER A 1 125 ? 455.305 23.102  -7.983  1.00 0.00 ? 125 SER A OG   1 
ATOM 1928 H H    . SER A 1 125 ? 453.951 20.876  -7.975  1.00 0.00 ? 125 SER A H    1 
ATOM 1929 H HA   . SER A 1 125 ? 453.106 22.332  -10.384 1.00 0.00 ? 125 SER A HA   1 
ATOM 1930 H HB2  . SER A 1 125 ? 454.642 24.114  -9.624  1.00 0.00 ? 125 SER A HB2  1 
ATOM 1931 H HB3  . SER A 1 125 ? 453.416 23.741  -8.413  1.00 0.00 ? 125 SER A HB3  1 
ATOM 1932 H HG   . SER A 1 125 ? 455.403 23.858  -7.399  1.00 0.00 ? 125 SER A HG   1 
ATOM 1933 N N    . GLY A 1 126 ? 455.650 20.448  -10.147 1.00 0.00 ? 126 GLY A N    1 
ATOM 1934 C CA   . GLY A 1 126 ? 456.798 19.911  -10.856 1.00 0.00 ? 126 GLY A CA   1 
ATOM 1935 C C    . GLY A 1 126 ? 456.509 18.581  -11.525 1.00 0.00 ? 126 GLY A C    1 
ATOM 1936 O O    . GLY A 1 126 ? 455.887 17.700  -10.932 1.00 0.00 ? 126 GLY A O    1 
ATOM 1937 H H    . GLY A 1 126 ? 455.269 19.955  -9.392  1.00 0.00 ? 126 GLY A H    1 
ATOM 1938 H HA2  . GLY A 1 126 ? 457.105 20.620  -11.611 1.00 0.00 ? 126 GLY A HA2  1 
ATOM 1939 H HA3  . GLY A 1 126 ? 457.609 19.778  -10.154 1.00 0.00 ? 126 GLY A HA3  1 
ATOM 1940 N N    . VAL A 1 127 ? 456.967 18.437  -12.766 1.00 0.00 ? 127 VAL A N    1 
ATOM 1941 C CA   . VAL A 1 127 ? 456.763 17.207  -13.524 1.00 0.00 ? 127 VAL A CA   1 
ATOM 1942 C C    . VAL A 1 127 ? 458.093 16.605  -13.963 1.00 0.00 ? 127 VAL A C    1 
ATOM 1943 O O    . VAL A 1 127 ? 459.003 17.322  -14.378 1.00 0.00 ? 127 VAL A O    1 
ATOM 1944 C CB   . VAL A 1 127 ? 455.878 17.434  -14.769 1.00 0.00 ? 127 VAL A CB   1 
ATOM 1945 C CG1  . VAL A 1 127 ? 454.427 17.107  -14.454 1.00 0.00 ? 127 VAL A CG1  1 
ATOM 1946 C CG2  . VAL A 1 127 ? 456.013 18.861  -15.282 1.00 0.00 ? 127 VAL A CG2  1 
ATOM 1947 H H    . VAL A 1 127 ? 457.459 19.176  -13.181 1.00 0.00 ? 127 VAL A H    1 
ATOM 1948 H HA   . VAL A 1 127 ? 456.260 16.501  -12.878 1.00 0.00 ? 127 VAL A HA   1 
ATOM 1949 H HB   . VAL A 1 127 ? 456.210 16.762  -15.548 1.00 0.00 ? 127 VAL A HB   1 
ATOM 1950 H HG11 . VAL A 1 127 ? 454.379 16.167  -13.923 1.00 0.00 ? 127 VAL A HG11 1 
ATOM 1951 H HG12 . VAL A 1 127 ? 453.867 17.031  -15.374 1.00 0.00 ? 127 VAL A HG12 1 
ATOM 1952 H HG13 . VAL A 1 127 ? 454.007 17.890  -13.840 1.00 0.00 ? 127 VAL A HG13 1 
ATOM 1953 H HG21 . VAL A 1 127 ? 455.812 19.553  -14.478 1.00 0.00 ? 127 VAL A HG21 1 
ATOM 1954 H HG22 . VAL A 1 127 ? 455.307 19.024  -16.083 1.00 0.00 ? 127 VAL A HG22 1 
ATOM 1955 H HG23 . VAL A 1 127 ? 457.016 19.018  -15.650 1.00 0.00 ? 127 VAL A HG23 1 
ATOM 1956 N N    . ILE A 1 128 ? 458.201 15.285  -13.859 1.00 0.00 ? 128 ILE A N    1 
ATOM 1957 C CA   . ILE A 1 128 ? 459.421 14.581  -14.238 1.00 0.00 ? 128 ILE A CA   1 
ATOM 1958 C C    . ILE A 1 128 ? 459.552 14.463  -15.758 1.00 0.00 ? 128 ILE A C    1 
ATOM 1959 O O    . ILE A 1 128 ? 458.565 14.253  -16.462 1.00 0.00 ? 128 ILE A O    1 
ATOM 1960 C CB   . ILE A 1 128 ? 459.472 13.174  -13.595 1.00 0.00 ? 128 ILE A CB   1 
ATOM 1961 C CG1  . ILE A 1 128 ? 460.914 12.806  -13.248 1.00 0.00 ? 128 ILE A CG1  1 
ATOM 1962 C CG2  . ILE A 1 128 ? 458.853 12.121  -14.508 1.00 0.00 ? 128 ILE A CG2  1 
ATOM 1963 C CD1  . ILE A 1 128 ? 461.446 13.553  -12.047 1.00 0.00 ? 128 ILE A CD1  1 
ATOM 1964 H H    . ILE A 1 128 ? 457.443 14.771  -13.514 1.00 0.00 ? 128 ILE A H    1 
ATOM 1965 H HA   . ILE A 1 128 ? 460.259 15.151  -13.863 1.00 0.00 ? 128 ILE A HA   1 
ATOM 1966 H HB   . ILE A 1 128 ? 458.893 13.203  -12.685 1.00 0.00 ? 128 ILE A HB   1 
ATOM 1967 H HG12 . ILE A 1 128 ? 460.968 11.749  -13.033 1.00 0.00 ? 128 ILE A HG12 1 
ATOM 1968 H HG13 . ILE A 1 128 ? 461.550 13.032  -14.091 1.00 0.00 ? 128 ILE A HG13 1 
ATOM 1969 H HG21 . ILE A 1 128 ? 458.789 11.181  -13.981 1.00 0.00 ? 128 ILE A HG21 1 
ATOM 1970 H HG22 . ILE A 1 128 ? 459.469 12.000  -15.387 1.00 0.00 ? 128 ILE A HG22 1 
ATOM 1971 H HG23 . ILE A 1 128 ? 457.863 12.437  -14.803 1.00 0.00 ? 128 ILE A HG23 1 
ATOM 1972 H HD11 . ILE A 1 128 ? 460.733 14.310  -11.752 1.00 0.00 ? 128 ILE A HD11 1 
ATOM 1973 H HD12 . ILE A 1 128 ? 462.385 14.022  -12.301 1.00 0.00 ? 128 ILE A HD12 1 
ATOM 1974 H HD13 . ILE A 1 128 ? 461.596 12.863  -11.231 1.00 0.00 ? 128 ILE A HD13 1 
ATOM 1975 N N    . LEU A 1 129 ? 460.781 14.594  -16.253 1.00 0.00 ? 129 LEU A N    1 
ATOM 1976 C CA   . LEU A 1 129 ? 461.047 14.497  -17.684 1.00 0.00 ? 129 LEU A CA   1 
ATOM 1977 C C    . LEU A 1 129 ? 462.540 14.321  -17.949 1.00 0.00 ? 129 LEU A C    1 
ATOM 1978 O O    . LEU A 1 129 ? 463.160 15.125  -18.646 1.00 0.00 ? 129 LEU A O    1 
ATOM 1979 C CB   . LEU A 1 129 ? 460.524 15.737  -18.409 1.00 0.00 ? 129 LEU A CB   1 
ATOM 1980 C CG   . LEU A 1 129 ? 461.151 17.060  -17.972 1.00 0.00 ? 129 LEU A CG   1 
ATOM 1981 C CD1  . LEU A 1 129 ? 460.759 18.175  -18.928 1.00 0.00 ? 129 LEU A CD1  1 
ATOM 1982 C CD2  . LEU A 1 129 ? 460.726 17.396  -16.553 1.00 0.00 ? 129 LEU A CD2  1 
ATOM 1983 H H    . LEU A 1 129 ? 461.527 14.756  -15.641 1.00 0.00 ? 129 LEU A H    1 
ATOM 1984 H HA   . LEU A 1 129 ? 460.524 13.630  -18.056 1.00 0.00 ? 129 LEU A HA   1 
ATOM 1985 H HB2  . LEU A 1 129 ? 460.701 15.610  -19.467 1.00 0.00 ? 129 LEU A HB2  1 
ATOM 1986 H HB3  . LEU A 1 129 ? 459.460 15.798  -18.244 1.00 0.00 ? 129 LEU A HB3  1 
ATOM 1987 H HG   . LEU A 1 129 ? 462.226 16.969  -17.988 1.00 0.00 ? 129 LEU A HG   1 
ATOM 1988 H HD11 . LEU A 1 129 ? 459.933 18.733  -18.512 1.00 0.00 ? 129 LEU A HD11 1 
ATOM 1989 H HD12 . LEU A 1 129 ? 460.465 17.749  -19.876 1.00 0.00 ? 129 LEU A HD12 1 
ATOM 1990 H HD13 . LEU A 1 129 ? 461.601 18.835  -19.075 1.00 0.00 ? 129 LEU A HD13 1 
ATOM 1991 H HD21 . LEU A 1 129 ? 461.318 16.823  -15.856 1.00 0.00 ? 129 LEU A HD21 1 
ATOM 1992 H HD22 . LEU A 1 129 ? 459.683 17.149  -16.427 1.00 0.00 ? 129 LEU A HD22 1 
ATOM 1993 H HD23 . LEU A 1 129 ? 460.873 18.450  -16.372 1.00 0.00 ? 129 LEU A HD23 1 
ATOM 1994 N N    . ARG A 1 130 ? 463.111 13.262  -17.387 1.00 0.00 ? 130 ARG A N    1 
ATOM 1995 C CA   . ARG A 1 130 ? 464.531 12.975  -17.555 1.00 0.00 ? 130 ARG A CA   1 
ATOM 1996 C C    . ARG A 1 130 ? 464.729 11.748  -18.439 1.00 0.00 ? 130 ARG A C    1 
ATOM 1997 O O    . ARG A 1 130 ? 463.870 10.868  -18.498 1.00 0.00 ? 130 ARG A O    1 
ATOM 1998 C CB   . ARG A 1 130 ? 465.218 12.763  -16.195 1.00 0.00 ? 130 ARG A CB   1 
ATOM 1999 C CG   . ARG A 1 130 ? 464.271 12.768  -14.999 1.00 0.00 ? 130 ARG A CG   1 
ATOM 2000 C CD   . ARG A 1 130 ? 464.918 13.396  -13.777 1.00 0.00 ? 130 ARG A CD   1 
ATOM 2001 N NE   . ARG A 1 130 ? 465.459 14.722  -14.065 1.00 0.00 ? 130 ARG A NE   1 
ATOM 2002 C CZ   . ARG A 1 130 ? 464.705 15.800  -14.272 1.00 0.00 ? 130 ARG A CZ   1 
ATOM 2003 N NH1  . ARG A 1 130 ? 463.381 15.713  -14.224 1.00 0.00 ? 130 ARG A NH1  1 
ATOM 2004 N NH2  . ARG A 1 130 ? 465.276 16.969  -14.528 1.00 0.00 ? 130 ARG A NH2  1 
ATOM 2005 H H    . ARG A 1 130 ? 462.564 12.659  -16.844 1.00 0.00 ? 130 ARG A H    1 
ATOM 2006 H HA   . ARG A 1 130 ? 464.981 13.826  -18.044 1.00 0.00 ? 130 ARG A HA   1 
ATOM 2007 H HB2  . ARG A 1 130 ? 465.732 11.814  -16.209 1.00 0.00 ? 130 ARG A HB2  1 
ATOM 2008 H HB3  . ARG A 1 130 ? 465.945 13.549  -16.050 1.00 0.00 ? 130 ARG A HB3  1 
ATOM 2009 H HG2  . ARG A 1 130 ? 463.388 13.333  -15.249 1.00 0.00 ? 130 ARG A HG2  1 
ATOM 2010 H HG3  . ARG A 1 130 ? 463.996 11.749  -14.767 1.00 0.00 ? 130 ARG A HG3  1 
ATOM 2011 H HD2  . ARG A 1 130 ? 464.174 13.483  -12.999 1.00 0.00 ? 130 ARG A HD2  1 
ATOM 2012 H HD3  . ARG A 1 130 ? 465.719 12.755  -13.439 1.00 0.00 ? 130 ARG A HD3  1 
ATOM 2013 H HE   . ARG A 1 130 ? 466.433 14.815  -14.106 1.00 0.00 ? 130 ARG A HE   1 
ATOM 2014 H HH11 . ARG A 1 130 ? 462.944 14.835  -14.031 1.00 0.00 ? 130 ARG A HH11 1 
ATOM 2015 H HH12 . ARG A 1 130 ? 462.821 16.526  -14.381 1.00 0.00 ? 130 ARG A HH12 1 
ATOM 2016 H HH21 . ARG A 1 130 ? 466.273 17.042  -14.566 1.00 0.00 ? 130 ARG A HH21 1 
ATOM 2017 H HH22 . ARG A 1 130 ? 464.710 17.779  -14.685 1.00 0.00 ? 130 ARG A HH22 1 
ATOM 2018 N N    . GLN A 1 131 ? 465.862 11.699  -19.132 1.00 0.00 ? 131 GLN A N    1 
ATOM 2019 C CA   . GLN A 1 131 ? 466.164 10.581  -20.021 1.00 0.00 ? 131 GLN A CA   1 
ATOM 2020 C C    . GLN A 1 131 ? 467.343 9.758   -19.506 1.00 0.00 ? 131 GLN A C    1 
ATOM 2021 O O    . GLN A 1 131 ? 468.215 9.357   -20.277 1.00 0.00 ? 131 GLN A O    1 
ATOM 2022 C CB   . GLN A 1 131 ? 466.459 11.093  -21.433 1.00 0.00 ? 131 GLN A CB   1 
ATOM 2023 C CG   . GLN A 1 131 ? 465.783 10.281  -22.526 1.00 0.00 ? 131 GLN A CG   1 
ATOM 2024 C CD   . GLN A 1 131 ? 466.467 10.431  -23.871 1.00 0.00 ? 131 GLN A CD   1 
ATOM 2025 O OE1  . GLN A 1 131 ? 466.463 11.509  -24.466 1.00 0.00 ? 131 GLN A OE1  1 
ATOM 2026 N NE2  . GLN A 1 131 ? 467.058 9.346   -24.359 1.00 0.00 ? 131 GLN A NE2  1 
ATOM 2027 H H    . GLN A 1 131 ? 466.505 12.433  -19.049 1.00 0.00 ? 131 GLN A H    1 
ATOM 2028 H HA   . GLN A 1 131 ? 465.292 9.947   -20.057 1.00 0.00 ? 131 GLN A HA   1 
ATOM 2029 H HB2  . GLN A 1 131 ? 466.118 12.115  -21.511 1.00 0.00 ? 131 GLN A HB2  1 
ATOM 2030 H HB3  . GLN A 1 131 ? 467.526 11.064  -21.600 1.00 0.00 ? 131 GLN A HB3  1 
ATOM 2031 H HG2  . GLN A 1 131 ? 465.801 9.238   -22.246 1.00 0.00 ? 131 GLN A HG2  1 
ATOM 2032 H HG3  . GLN A 1 131 ? 464.759 10.610  -22.621 1.00 0.00 ? 131 GLN A HG3  1 
ATOM 2033 H HE21 . GLN A 1 131 ? 467.021 8.522   -23.830 1.00 0.00 ? 131 GLN A HE21 1 
ATOM 2034 H HE22 . GLN A 1 131 ? 467.508 9.415   -25.227 1.00 0.00 ? 131 GLN A HE22 1 
ATOM 2035 N N    . GLU A 1 132 ? 467.356 9.494   -18.203 1.00 0.00 ? 132 GLU A N    1 
ATOM 2036 C CA   . GLU A 1 132 ? 468.418 8.703   -17.597 1.00 0.00 ? 132 GLU A CA   1 
ATOM 2037 C C    . GLU A 1 132 ? 468.139 7.220   -17.801 1.00 0.00 ? 132 GLU A C    1 
ATOM 2038 O O    . GLU A 1 132 ? 466.987 6.816   -17.952 1.00 0.00 ? 132 GLU A O    1 
ATOM 2039 C CB   . GLU A 1 132 ? 468.534 9.016   -16.104 1.00 0.00 ? 132 GLU A CB   1 
ATOM 2040 C CG   . GLU A 1 132 ? 469.966 9.029   -15.596 1.00 0.00 ? 132 GLU A CG   1 
ATOM 2041 C CD   . GLU A 1 132 ? 470.783 10.162  -16.186 1.00 0.00 ? 132 GLU A CD   1 
ATOM 2042 O OE1  . GLU A 1 132 ? 470.614 11.314  -15.733 1.00 0.00 ? 132 GLU A OE1  1 
ATOM 2043 O OE2  . GLU A 1 132 ? 471.592 9.897   -17.099 1.00 0.00 ? 132 GLU A OE2  1 
ATOM 2044 H H    . GLU A 1 132 ? 466.631 9.826   -17.640 1.00 0.00 ? 132 GLU A H    1 
ATOM 2045 H HA   . GLU A 1 132 ? 469.346 8.957   -18.087 1.00 0.00 ? 132 GLU A HA   1 
ATOM 2046 H HB2  . GLU A 1 132 ? 468.099 9.987   -15.916 1.00 0.00 ? 132 GLU A HB2  1 
ATOM 2047 H HB3  . GLU A 1 132 ? 467.984 8.271   -15.548 1.00 0.00 ? 132 GLU A HB3  1 
ATOM 2048 H HG2  . GLU A 1 132 ? 469.952 9.137   -14.521 1.00 0.00 ? 132 GLU A HG2  1 
ATOM 2049 H HG3  . GLU A 1 132 ? 470.435 8.092   -15.857 1.00 0.00 ? 132 GLU A HG3  1 
ATOM 2050 N N    . GLU A 1 133 ? 469.191 6.411   -17.822 1.00 0.00 ? 133 GLU A N    1 
ATOM 2051 C CA   . GLU A 1 133 ? 469.025 4.978   -18.029 1.00 0.00 ? 133 GLU A CA   1 
ATOM 2052 C C    . GLU A 1 133 ? 470.084 4.153   -17.300 1.00 0.00 ? 133 GLU A C    1 
ATOM 2053 O O    . GLU A 1 133 ? 470.927 4.682   -16.576 1.00 0.00 ? 133 GLU A O    1 
ATOM 2054 C CB   . GLU A 1 133 ? 469.064 4.659   -19.522 1.00 0.00 ? 133 GLU A CB   1 
ATOM 2055 C CG   . GLU A 1 133 ? 468.109 3.550   -19.930 1.00 0.00 ? 133 GLU A CG   1 
ATOM 2056 C CD   . GLU A 1 133 ? 466.963 4.050   -20.789 1.00 0.00 ? 133 GLU A CD   1 
ATOM 2057 O OE1  . GLU A 1 133 ? 467.229 4.775   -21.770 1.00 0.00 ? 133 GLU A OE1  1 
ATOM 2058 O OE2  . GLU A 1 133 ? 465.800 3.715   -20.480 1.00 0.00 ? 133 GLU A OE2  1 
ATOM 2059 H H    . GLU A 1 133 ? 470.087 6.785   -17.710 1.00 0.00 ? 133 GLU A H    1 
ATOM 2060 H HA   . GLU A 1 133 ? 468.054 4.704   -17.645 1.00 0.00 ? 133 GLU A HA   1 
ATOM 2061 H HB2  . GLU A 1 133 ? 468.808 5.550   -20.075 1.00 0.00 ? 133 GLU A HB2  1 
ATOM 2062 H HB3  . GLU A 1 133 ? 470.066 4.358   -19.787 1.00 0.00 ? 133 GLU A HB3  1 
ATOM 2063 H HG2  . GLU A 1 133 ? 468.658 2.806   -20.487 1.00 0.00 ? 133 GLU A HG2  1 
ATOM 2064 H HG3  . GLU A 1 133 ? 467.701 3.100   -19.036 1.00 0.00 ? 133 GLU A HG3  1 
ATOM 2065 N N    . ALA A 1 134 ? 470.011 2.843   -17.512 1.00 0.00 ? 134 ALA A N    1 
ATOM 2066 C CA   . ALA A 1 134 ? 470.924 1.882   -16.908 1.00 0.00 ? 134 ALA A CA   1 
ATOM 2067 C C    . ALA A 1 134 ? 470.605 0.492   -17.453 1.00 0.00 ? 134 ALA A C    1 
ATOM 2068 O O    . ALA A 1 134 ? 470.096 0.376   -18.567 1.00 0.00 ? 134 ALA A O    1 
ATOM 2069 C CB   . ALA A 1 134 ? 470.795 1.920   -15.393 1.00 0.00 ? 134 ALA A CB   1 
ATOM 2070 H H    . ALA A 1 134 ? 469.306 2.505   -18.100 1.00 0.00 ? 134 ALA A H    1 
ATOM 2071 H HA   . ALA A 1 134 ? 471.935 2.152   -17.179 1.00 0.00 ? 134 ALA A HA   1 
ATOM 2072 H HB1  . ALA A 1 134 ? 470.297 2.832   -15.100 1.00 0.00 ? 134 ALA A HB1  1 
ATOM 2073 H HB2  . ALA A 1 134 ? 471.778 1.885   -14.946 1.00 0.00 ? 134 ALA A HB2  1 
ATOM 2074 H HB3  . ALA A 1 134 ? 470.217 1.071   -15.060 1.00 0.00 ? 134 ALA A HB3  1 
ATOM 2075 N N    . GLU A 1 135 ? 470.863 -0.563  -16.683 1.00 0.00 ? 135 GLU A N    1 
ATOM 2076 C CA   . GLU A 1 135 ? 470.551 -1.916  -17.126 1.00 0.00 ? 135 GLU A CA   1 
ATOM 2077 C C    . GLU A 1 135 ? 469.095 -2.227  -16.803 1.00 0.00 ? 135 GLU A C    1 
ATOM 2078 O O    . GLU A 1 135 ? 468.500 -1.571  -15.948 1.00 0.00 ? 135 GLU A O    1 
ATOM 2079 C CB   . GLU A 1 135 ? 471.470 -2.930  -16.441 1.00 0.00 ? 135 GLU A CB   1 
ATOM 2080 C CG   . GLU A 1 135 ? 471.374 -2.910  -14.924 1.00 0.00 ? 135 GLU A CG   1 
ATOM 2081 C CD   . GLU A 1 135 ? 472.452 -2.058  -14.283 1.00 0.00 ? 135 GLU A CD   1 
ATOM 2082 O OE1  . GLU A 1 135 ? 473.646 -2.319  -14.539 1.00 0.00 ? 135 GLU A OE1  1 
ATOM 2083 O OE2  . GLU A 1 135 ? 472.102 -1.130  -13.524 1.00 0.00 ? 135 GLU A OE2  1 
ATOM 2084 H H    . GLU A 1 135 ? 471.245 -0.472  -15.786 1.00 0.00 ? 135 GLU A H    1 
ATOM 2085 H HA   . GLU A 1 135 ? 470.695 -1.964  -18.195 1.00 0.00 ? 135 GLU A HA   1 
ATOM 2086 H HB2  . GLU A 1 135 ? 471.210 -3.921  -16.782 1.00 0.00 ? 135 GLU A HB2  1 
ATOM 2087 H HB3  . GLU A 1 135 ? 472.491 -2.718  -16.719 1.00 0.00 ? 135 GLU A HB3  1 
ATOM 2088 H HG2  . GLU A 1 135 ? 470.410 -2.514  -14.642 1.00 0.00 ? 135 GLU A HG2  1 
ATOM 2089 H HG3  . GLU A 1 135 ? 471.469 -3.921  -14.557 1.00 0.00 ? 135 GLU A HG3  1 
ATOM 2090 N N    . TYR A 1 136 ? 468.498 -3.181  -17.509 1.00 0.00 ? 136 TYR A N    1 
ATOM 2091 C CA   . TYR A 1 136 ? 467.090 -3.491  -17.293 1.00 0.00 ? 136 TYR A CA   1 
ATOM 2092 C C    . TYR A 1 136 ? 466.895 -4.585  -16.246 1.00 0.00 ? 136 TYR A C    1 
ATOM 2093 O O    . TYR A 1 136 ? 467.811 -5.341  -15.921 1.00 0.00 ? 136 TYR A O    1 
ATOM 2094 C CB   . TYR A 1 136 ? 466.444 -3.922  -18.611 1.00 0.00 ? 136 TYR A CB   1 
ATOM 2095 C CG   . TYR A 1 136 ? 467.128 -5.102  -19.264 1.00 0.00 ? 136 TYR A CG   1 
ATOM 2096 C CD1  . TYR A 1 136 ? 467.022 -6.377  -18.723 1.00 0.00 ? 136 TYR A CD1  1 
ATOM 2097 C CD2  . TYR A 1 136 ? 467.880 -4.940  -20.421 1.00 0.00 ? 136 TYR A CD2  1 
ATOM 2098 C CE1  . TYR A 1 136 ? 467.647 -7.458  -19.317 1.00 0.00 ? 136 TYR A CE1  1 
ATOM 2099 C CE2  . TYR A 1 136 ? 468.507 -6.015  -21.020 1.00 0.00 ? 136 TYR A CE2  1 
ATOM 2100 C CZ   . TYR A 1 136 ? 468.387 -7.272  -20.465 1.00 0.00 ? 136 TYR A CZ   1 
ATOM 2101 O OH   . TYR A 1 136 ? 469.011 -8.345  -21.059 1.00 0.00 ? 136 TYR A OH   1 
ATOM 2102 H H    . TYR A 1 136 ? 468.984 -3.643  -18.223 1.00 0.00 ? 136 TYR A H    1 
ATOM 2103 H HA   . TYR A 1 136 ? 466.604 -2.593  -16.948 1.00 0.00 ? 136 TYR A HA   1 
ATOM 2104 H HB2  . TYR A 1 136 ? 465.416 -4.195  -18.427 1.00 0.00 ? 136 TYR A HB2  1 
ATOM 2105 H HB3  . TYR A 1 136 ? 466.472 -3.094  -19.304 1.00 0.00 ? 136 TYR A HB3  1 
ATOM 2106 H HD1  . TYR A 1 136 ? 466.441 -6.520  -17.824 1.00 0.00 ? 136 TYR A HD1  1 
ATOM 2107 H HD2  . TYR A 1 136 ? 467.972 -3.954  -20.853 1.00 0.00 ? 136 TYR A HD2  1 
ATOM 2108 H HE1  . TYR A 1 136 ? 467.553 -8.441  -18.882 1.00 0.00 ? 136 TYR A HE1  1 
ATOM 2109 H HE2  . TYR A 1 136 ? 469.088 -5.869  -21.920 1.00 0.00 ? 136 TYR A HE2  1 
ATOM 2110 H HH   . TYR A 1 136 ? 468.415 -8.751  -21.693 1.00 0.00 ? 136 TYR A HH   1 
ATOM 2111 N N    . VAL A 1 137 ? 465.679 -4.621  -15.711 1.00 0.00 ? 137 VAL A N    1 
ATOM 2112 C CA   . VAL A 1 137 ? 465.299 -5.572  -14.671 1.00 0.00 ? 137 VAL A CA   1 
ATOM 2113 C C    . VAL A 1 137 ? 464.074 -6.383  -15.095 1.00 0.00 ? 137 VAL A C    1 
ATOM 2114 O O    . VAL A 1 137 ? 463.363 -6.000  -16.021 1.00 0.00 ? 137 VAL A O    1 
ATOM 2115 C CB   . VAL A 1 137 ? 465.007 -4.821  -13.347 1.00 0.00 ? 137 VAL A CB   1 
ATOM 2116 C CG1  . VAL A 1 137 ? 464.259 -3.525  -13.619 1.00 0.00 ? 137 VAL A CG1  1 
ATOM 2117 C CG2  . VAL A 1 137 ? 464.228 -5.684  -12.365 1.00 0.00 ? 137 VAL A CG2  1 
ATOM 2118 H H    . VAL A 1 137 ? 465.023 -3.967  -16.031 1.00 0.00 ? 137 VAL A H    1 
ATOM 2119 H HA   . VAL A 1 137 ? 466.130 -6.244  -14.507 1.00 0.00 ? 137 VAL A HA   1 
ATOM 2120 H HB   . VAL A 1 137 ? 465.954 -4.567  -12.891 1.00 0.00 ? 137 VAL A HB   1 
ATOM 2121 H HG11 . VAL A 1 137 ? 464.820 -2.925  -14.320 1.00 0.00 ? 137 VAL A HG11 1 
ATOM 2122 H HG12 . VAL A 1 137 ? 464.136 -2.978  -12.696 1.00 0.00 ? 137 VAL A HG12 1 
ATOM 2123 H HG13 . VAL A 1 137 ? 463.288 -3.750  -14.035 1.00 0.00 ? 137 VAL A HG13 1 
ATOM 2124 H HG21 . VAL A 1 137 ? 463.260 -5.919  -12.784 1.00 0.00 ? 137 VAL A HG21 1 
ATOM 2125 H HG22 . VAL A 1 137 ? 464.098 -5.143  -11.441 1.00 0.00 ? 137 VAL A HG22 1 
ATOM 2126 H HG23 . VAL A 1 137 ? 464.771 -6.596  -12.175 1.00 0.00 ? 137 VAL A HG23 1 
ATOM 2127 N N    . ARG A 1 138 ? 463.825 -7.498  -14.410 1.00 0.00 ? 138 ARG A N    1 
ATOM 2128 C CA   . ARG A 1 138 ? 462.680 -8.348  -14.714 1.00 0.00 ? 138 ARG A CA   1 
ATOM 2129 C C    . ARG A 1 138 ? 461.792 -8.496  -13.481 1.00 0.00 ? 138 ARG A C    1 
ATOM 2130 O O    . ARG A 1 138 ? 462.287 -8.548  -12.355 1.00 0.00 ? 138 ARG A O    1 
ATOM 2131 C CB   . ARG A 1 138 ? 463.156 -9.727  -15.180 1.00 0.00 ? 138 ARG A CB   1 
ATOM 2132 C CG   . ARG A 1 138 ? 462.024 -10.704 -15.462 1.00 0.00 ? 138 ARG A CG   1 
ATOM 2133 C CD   . ARG A 1 138 ? 462.264 -12.054 -14.800 1.00 0.00 ? 138 ARG A CD   1 
ATOM 2134 N NE   . ARG A 1 138 ? 462.600 -13.090 -15.774 1.00 0.00 ? 138 ARG A NE   1 
ATOM 2135 C CZ   . ARG A 1 138 ? 463.813 -13.248 -16.301 1.00 0.00 ? 138 ARG A CZ   1 
ATOM 2136 N NH1  . ARG A 1 138 ? 464.808 -12.444 -15.948 1.00 0.00 ? 138 ARG A NH1  1 
ATOM 2137 N NH2  . ARG A 1 138 ? 464.031 -14.214 -17.183 1.00 0.00 ? 138 ARG A NH2  1 
ATOM 2138 H H    . ARG A 1 138 ? 464.412 -7.763  -13.673 1.00 0.00 ? 138 ARG A H    1 
ATOM 2139 H HA   . ARG A 1 138 ? 462.112 -7.881  -15.504 1.00 0.00 ? 138 ARG A HA   1 
ATOM 2140 H HB2  . ARG A 1 138 ? 463.735 -9.609  -16.083 1.00 0.00 ? 138 ARG A HB2  1 
ATOM 2141 H HB3  . ARG A 1 138 ? 463.787 -10.152 -14.413 1.00 0.00 ? 138 ARG A HB3  1 
ATOM 2142 H HG2  . ARG A 1 138 ? 461.103 -10.290 -15.084 1.00 0.00 ? 138 ARG A HG2  1 
ATOM 2143 H HG3  . ARG A 1 138 ? 461.943 -10.848 -16.529 1.00 0.00 ? 138 ARG A HG3  1 
ATOM 2144 H HD2  . ARG A 1 138 ? 463.077 -11.957 -14.096 1.00 0.00 ? 138 ARG A HD2  1 
ATOM 2145 H HD3  . ARG A 1 138 ? 461.367 -12.346 -14.274 1.00 0.00 ? 138 ARG A HD3  1 
ATOM 2146 H HE   . ARG A 1 138 ? 461.885 -13.700 -16.051 1.00 0.00 ? 138 ARG A HE   1 
ATOM 2147 H HH11 . ARG A 1 138 ? 464.652 -11.715 -15.283 1.00 0.00 ? 138 ARG A HH11 1 
ATOM 2148 H HH12 . ARG A 1 138 ? 465.716 -12.568 -16.349 1.00 0.00 ? 138 ARG A HH12 1 
ATOM 2149 H HH21 . ARG A 1 138 ? 463.286 -14.824 -17.451 1.00 0.00 ? 138 ARG A HH21 1 
ATOM 2150 H HH22 . ARG A 1 138 ? 464.942 -14.332 -17.580 1.00 0.00 ? 138 ARG A HH22 1 
ATOM 2151 N N    . ALA A 1 139 ? 460.483 -8.568  -13.695 1.00 0.00 ? 139 ALA A N    1 
ATOM 2152 C CA   . ALA A 1 139 ? 459.542 -8.716  -12.592 1.00 0.00 ? 139 ALA A CA   1 
ATOM 2153 C C    . ALA A 1 139 ? 459.516 -10.154 -12.087 1.00 0.00 ? 139 ALA A C    1 
ATOM 2154 O O    . ALA A 1 139 ? 459.540 -11.099 -12.875 1.00 0.00 ? 139 ALA A O    1 
ATOM 2155 C CB   . ALA A 1 139 ? 458.153 -8.277  -13.021 1.00 0.00 ? 139 ALA A CB   1 
ATOM 2156 H H    . ALA A 1 139 ? 460.142 -8.528  -14.612 1.00 0.00 ? 139 ALA A H    1 
ATOM 2157 H HA   . ALA A 1 139 ? 459.866 -8.069  -11.789 1.00 0.00 ? 139 ALA A HA   1 
ATOM 2158 H HB1  . ALA A 1 139 ? 457.798 -8.926  -13.808 1.00 0.00 ? 139 ALA A HB1  1 
ATOM 2159 H HB2  . ALA A 1 139 ? 458.193 -7.261  -13.384 1.00 0.00 ? 139 ALA A HB2  1 
ATOM 2160 H HB3  . ALA A 1 139 ? 457.481 -8.333  -12.177 1.00 0.00 ? 139 ALA A HB3  1 
ATOM 2161 N N    . LEU A 1 140 ? 459.471 -10.313 -10.768 1.00 0.00 ? 140 LEU A N    1 
ATOM 2162 C CA   . LEU A 1 140 ? 459.449 -11.639 -10.159 1.00 0.00 ? 140 LEU A CA   1 
ATOM 2163 C C    . LEU A 1 140 ? 458.077 -11.966 -9.572  1.00 0.00 ? 140 LEU A C    1 
ATOM 2164 O O    . LEU A 1 140 ? 457.903 -13.003 -8.930  1.00 0.00 ? 140 LEU A O    1 
ATOM 2165 C CB   . LEU A 1 140 ? 460.515 -11.731 -9.066  1.00 0.00 ? 140 LEU A CB   1 
ATOM 2166 C CG   . LEU A 1 140 ? 461.521 -12.870 -9.242  1.00 0.00 ? 140 LEU A CG   1 
ATOM 2167 C CD1  . LEU A 1 140 ? 462.869 -12.328 -9.692  1.00 0.00 ? 140 LEU A CD1  1 
ATOM 2168 C CD2  . LEU A 1 140 ? 461.667 -13.662 -7.951  1.00 0.00 ? 140 LEU A CD2  1 
ATOM 2169 H H    . LEU A 1 140 ? 459.458 -9.522  -10.191 1.00 0.00 ? 140 LEU A H    1 
ATOM 2170 H HA   . LEU A 1 140 ? 459.677 -12.360 -10.929 1.00 0.00 ? 140 LEU A HA   1 
ATOM 2171 H HB2  . LEU A 1 140 ? 461.055 -10.796 -9.044  1.00 0.00 ? 140 LEU A HB2  1 
ATOM 2172 H HB3  . LEU A 1 140 ? 460.019 -11.862 -8.115  1.00 0.00 ? 140 LEU A HB3  1 
ATOM 2173 H HG   . LEU A 1 140 ? 461.161 -13.540 -10.008 1.00 0.00 ? 140 LEU A HG   1 
ATOM 2174 H HD11 . LEU A 1 140 ? 462.744 -11.763 -10.603 1.00 0.00 ? 140 LEU A HD11 1 
ATOM 2175 H HD12 . LEU A 1 140 ? 463.547 -13.151 -9.868  1.00 0.00 ? 140 LEU A HD12 1 
ATOM 2176 H HD13 . LEU A 1 140 ? 463.274 -11.687 -8.923  1.00 0.00 ? 140 LEU A HD13 1 
ATOM 2177 H HD21 . LEU A 1 140 ? 462.453 -13.229 -7.349  1.00 0.00 ? 140 LEU A HD21 1 
ATOM 2178 H HD22 . LEU A 1 140 ? 461.916 -14.687 -8.184  1.00 0.00 ? 140 LEU A HD22 1 
ATOM 2179 H HD23 . LEU A 1 140 ? 460.737 -13.633 -7.404  1.00 0.00 ? 140 LEU A HD23 1 
ATOM 2180 N N    . PHE A 1 141 ? 457.105 -11.085 -9.786  1.00 0.00 ? 141 PHE A N    1 
ATOM 2181 C CA   . PHE A 1 141 ? 455.761 -11.303 -9.264  1.00 0.00 ? 141 PHE A CA   1 
ATOM 2182 C C    . PHE A 1 141 ? 454.700 -10.709 -10.185 1.00 0.00 ? 141 PHE A C    1 
ATOM 2183 O O    . PHE A 1 141 ? 455.009 -9.965  -11.115 1.00 0.00 ? 141 PHE A O    1 
ATOM 2184 C CB   . PHE A 1 141 ? 455.632 -10.699 -7.864  1.00 0.00 ? 141 PHE A CB   1 
ATOM 2185 C CG   . PHE A 1 141 ? 455.719 -11.714 -6.760  1.00 0.00 ? 141 PHE A CG   1 
ATOM 2186 C CD1  . PHE A 1 141 ? 454.640 -12.534 -6.468  1.00 0.00 ? 141 PHE A CD1  1 
ATOM 2187 C CD2  . PHE A 1 141 ? 456.879 -11.849 -6.015  1.00 0.00 ? 141 PHE A CD2  1 
ATOM 2188 C CE1  . PHE A 1 141 ? 454.717 -13.468 -5.453  1.00 0.00 ? 141 PHE A CE1  1 
ATOM 2189 C CE2  . PHE A 1 141 ? 456.962 -12.781 -4.998  1.00 0.00 ? 141 PHE A CE2  1 
ATOM 2190 C CZ   . PHE A 1 141 ? 455.880 -13.592 -4.717  1.00 0.00 ? 141 PHE A CZ   1 
ATOM 2191 H H    . PHE A 1 141 ? 457.294 -10.273 -10.300 1.00 0.00 ? 141 PHE A H    1 
ATOM 2192 H HA   . PHE A 1 141 ? 455.604 -12.369 -9.198  1.00 0.00 ? 141 PHE A HA   1 
ATOM 2193 H HB2  . PHE A 1 141 ? 456.422 -9.980  -7.716  1.00 0.00 ? 141 PHE A HB2  1 
ATOM 2194 H HB3  . PHE A 1 141 ? 454.677 -10.199 -7.781  1.00 0.00 ? 141 PHE A HB3  1 
ATOM 2195 H HD1  . PHE A 1 141 ? 453.731 -12.437 -7.042  1.00 0.00 ? 141 PHE A HD1  1 
ATOM 2196 H HD2  . PHE A 1 141 ? 457.726 -11.215 -6.234  1.00 0.00 ? 141 PHE A HD2  1 
ATOM 2197 H HE1  . PHE A 1 141 ? 453.869 -14.101 -5.235  1.00 0.00 ? 141 PHE A HE1  1 
ATOM 2198 H HE2  . PHE A 1 141 ? 457.872 -12.876 -4.425  1.00 0.00 ? 141 PHE A HE2  1 
ATOM 2199 H HZ   . PHE A 1 141 ? 455.942 -14.322 -3.923  1.00 0.00 ? 141 PHE A HZ   1 
ATOM 2200 N N    . ASP A 1 142 ? 453.448 -11.052 -9.910  1.00 0.00 ? 142 ASP A N    1 
ATOM 2201 C CA   . ASP A 1 142 ? 452.319 -10.566 -10.696 1.00 0.00 ? 142 ASP A CA   1 
ATOM 2202 C C    . ASP A 1 142 ? 452.139 -9.060  -10.524 1.00 0.00 ? 142 ASP A C    1 
ATOM 2203 O O    . ASP A 1 142 ? 452.661 -8.464  -9.582  1.00 0.00 ? 142 ASP A O    1 
ATOM 2204 C CB   . ASP A 1 142 ? 451.036 -11.293 -10.288 1.00 0.00 ? 142 ASP A CB   1 
ATOM 2205 C CG   . ASP A 1 142 ? 450.949 -12.687 -10.878 1.00 0.00 ? 142 ASP A CG   1 
ATOM 2206 O OD1  . ASP A 1 142 ? 451.853 -13.505 -10.605 1.00 0.00 ? 142 ASP A OD1  1 
ATOM 2207 O OD2  . ASP A 1 142 ? 449.976 -12.961 -11.612 1.00 0.00 ? 142 ASP A OD2  1 
ATOM 2208 H H    . ASP A 1 142 ? 453.281 -11.651 -9.157  1.00 0.00 ? 142 ASP A H    1 
ATOM 2209 H HA   . ASP A 1 142 ? 452.525 -10.776 -11.734 1.00 0.00 ? 142 ASP A HA   1 
ATOM 2210 H HB2  . ASP A 1 142 ? 451.003 -11.376 -9.212  1.00 0.00 ? 142 ASP A HB2  1 
ATOM 2211 H HB3  . ASP A 1 142 ? 450.184 -10.724 -10.628 1.00 0.00 ? 142 ASP A HB3  1 
ATOM 2212 N N    . PHE A 1 143 ? 451.414 -8.450  -11.457 1.00 0.00 ? 143 PHE A N    1 
ATOM 2213 C CA   . PHE A 1 143 ? 451.176 -7.008  -11.435 1.00 0.00 ? 143 PHE A CA   1 
ATOM 2214 C C    . PHE A 1 143 ? 449.861 -6.658  -10.746 1.00 0.00 ? 143 PHE A C    1 
ATOM 2215 O O    . PHE A 1 143 ? 448.868 -7.374  -10.878 1.00 0.00 ? 143 PHE A O    1 
ATOM 2216 C CB   . PHE A 1 143 ? 451.193 -6.453  -12.869 1.00 0.00 ? 143 PHE A CB   1 
ATOM 2217 C CG   . PHE A 1 143 ? 449.879 -6.563  -13.603 1.00 0.00 ? 143 PHE A CG   1 
ATOM 2218 C CD1  . PHE A 1 143 ? 449.101 -7.707  -13.508 1.00 0.00 ? 143 PHE A CD1  1 
ATOM 2219 C CD2  . PHE A 1 143 ? 449.426 -5.517  -14.393 1.00 0.00 ? 143 PHE A CD2  1 
ATOM 2220 C CE1  . PHE A 1 143 ? 447.900 -7.805  -14.185 1.00 0.00 ? 143 PHE A CE1  1 
ATOM 2221 C CE2  . PHE A 1 143 ? 448.226 -5.611  -15.073 1.00 0.00 ? 143 PHE A CE2  1 
ATOM 2222 C CZ   . PHE A 1 143 ? 447.462 -6.756  -14.968 1.00 0.00 ? 143 PHE A CZ   1 
ATOM 2223 H H    . PHE A 1 143 ? 451.047 -8.981  -12.189 1.00 0.00 ? 143 PHE A H    1 
ATOM 2224 H HA   . PHE A 1 143 ? 451.983 -6.553  -10.880 1.00 0.00 ? 143 PHE A HA   1 
ATOM 2225 H HB2  . PHE A 1 143 ? 451.464 -5.410  -12.837 1.00 0.00 ? 143 PHE A HB2  1 
ATOM 2226 H HB3  . PHE A 1 143 ? 451.934 -6.991  -13.441 1.00 0.00 ? 143 PHE A HB3  1 
ATOM 2227 H HD1  . PHE A 1 143 ? 449.439 -8.529  -12.896 1.00 0.00 ? 143 PHE A HD1  1 
ATOM 2228 H HD2  . PHE A 1 143 ? 450.022 -4.621  -14.478 1.00 0.00 ? 143 PHE A HD2  1 
ATOM 2229 H HE1  . PHE A 1 143 ? 447.304 -8.702  -14.101 1.00 0.00 ? 143 PHE A HE1  1 
ATOM 2230 H HE2  . PHE A 1 143 ? 447.886 -4.788  -15.684 1.00 0.00 ? 143 PHE A HE2  1 
ATOM 2231 H HZ   . PHE A 1 143 ? 446.524 -6.831  -15.498 1.00 0.00 ? 143 PHE A HZ   1 
ATOM 2232 N N    . ASN A 1 144 ? 449.862 -5.543  -10.016 1.00 0.00 ? 144 ASN A N    1 
ATOM 2233 C CA   . ASN A 1 144 ? 448.665 -5.086  -9.316  1.00 0.00 ? 144 ASN A CA   1 
ATOM 2234 C C    . ASN A 1 144 ? 448.977 -3.951  -8.341  1.00 0.00 ? 144 ASN A C    1 
ATOM 2235 O O    . ASN A 1 144 ? 449.952 -4.006  -7.592  1.00 0.00 ? 144 ASN A O    1 
ATOM 2236 C CB   . ASN A 1 144 ? 447.999 -6.246  -8.567  1.00 0.00 ? 144 ASN A CB   1 
ATOM 2237 C CG   . ASN A 1 144 ? 446.688 -6.666  -9.201  1.00 0.00 ? 144 ASN A CG   1 
ATOM 2238 O OD1  . ASN A 1 144 ? 446.469 -7.845  -9.481  1.00 0.00 ? 144 ASN A OD1  1 
ATOM 2239 N ND2  . ASN A 1 144 ? 445.807 -5.699  -9.433  1.00 0.00 ? 144 ASN A ND2  1 
ATOM 2240 H H    . ASN A 1 144 ? 450.683 -5.011  -9.955  1.00 0.00 ? 144 ASN A H    1 
ATOM 2241 H HA   . ASN A 1 144 ? 447.982 -4.717  -10.063 1.00 0.00 ? 144 ASN A HA   1 
ATOM 2242 H HB2  . ASN A 1 144 ? 448.665 -7.096  -8.567  1.00 0.00 ? 144 ASN A HB2  1 
ATOM 2243 H HB3  . ASN A 1 144 ? 447.805 -5.947  -7.547  1.00 0.00 ? 144 ASN A HB3  1 
ATOM 2244 H HD21 . ASN A 1 144 ? 446.050 -4.783  -9.185  1.00 0.00 ? 144 ASN A HD21 1 
ATOM 2245 H HD22 . ASN A 1 144 ? 444.951 -5.942  -9.843  1.00 0.00 ? 144 ASN A HD22 1 
ATOM 2246 N N    . GLY A 1 145 ? 448.125 -2.929  -8.357  1.00 0.00 ? 145 GLY A N    1 
ATOM 2247 C CA   . GLY A 1 145 ? 448.295 -1.787  -7.473  1.00 0.00 ? 145 GLY A CA   1 
ATOM 2248 C C    . GLY A 1 145 ? 447.070 -0.891  -7.462  1.00 0.00 ? 145 GLY A C    1 
ATOM 2249 O O    . GLY A 1 145 ? 445.940 -1.379  -7.431  1.00 0.00 ? 145 GLY A O    1 
ATOM 2250 H H    . GLY A 1 145 ? 447.366 -2.952  -8.975  1.00 0.00 ? 145 GLY A H    1 
ATOM 2251 H HA2  . GLY A 1 145 ? 448.476 -2.142  -6.470  1.00 0.00 ? 145 GLY A HA2  1 
ATOM 2252 H HA3  . GLY A 1 145 ? 449.147 -1.211  -7.798  1.00 0.00 ? 145 GLY A HA3  1 
ATOM 2253 N N    . ASN A 1 146 ? 447.289 0.420   -7.491  1.00 0.00 ? 146 ASN A N    1 
ATOM 2254 C CA   . ASN A 1 146 ? 446.185 1.375   -7.487  1.00 0.00 ? 146 ASN A CA   1 
ATOM 2255 C C    . ASN A 1 146 ? 446.607 2.709   -8.091  1.00 0.00 ? 146 ASN A C    1 
ATOM 2256 O O    . ASN A 1 146 ? 445.862 3.316   -8.860  1.00 0.00 ? 146 ASN A O    1 
ATOM 2257 C CB   . ASN A 1 146 ? 445.672 1.591   -6.063  1.00 0.00 ? 146 ASN A CB   1 
ATOM 2258 C CG   . ASN A 1 146 ? 444.335 2.306   -6.034  1.00 0.00 ? 146 ASN A CG   1 
ATOM 2259 O OD1  . ASN A 1 146 ? 444.254 3.506   -6.296  1.00 0.00 ? 146 ASN A OD1  1 
ATOM 2260 N ND2  . ASN A 1 146 ? 443.277 1.570   -5.713  1.00 0.00 ? 146 ASN A ND2  1 
ATOM 2261 H H    . ASN A 1 146 ? 448.211 0.752   -7.516  1.00 0.00 ? 146 ASN A H    1 
ATOM 2262 H HA   . ASN A 1 146 ? 445.389 0.960   -8.086  1.00 0.00 ? 146 ASN A HA   1 
ATOM 2263 H HB2  . ASN A 1 146 ? 445.557 0.632   -5.579  1.00 0.00 ? 146 ASN A HB2  1 
ATOM 2264 H HB3  . ASN A 1 146 ? 446.390 2.183   -5.514  1.00 0.00 ? 146 ASN A HB3  1 
ATOM 2265 H HD21 . ASN A 1 146 ? 443.416 0.620   -5.517  1.00 0.00 ? 146 ASN A HD21 1 
ATOM 2266 H HD22 . ASN A 1 146 ? 442.400 2.007   -5.687  1.00 0.00 ? 146 ASN A HD22 1 
ATOM 2267 N N    . ASP A 1 147 ? 447.803 3.164   -7.736  1.00 0.00 ? 147 ASP A N    1 
ATOM 2268 C CA   . ASP A 1 147 ? 448.317 4.432   -8.242  1.00 0.00 ? 147 ASP A CA   1 
ATOM 2269 C C    . ASP A 1 147 ? 448.718 4.313   -9.708  1.00 0.00 ? 147 ASP A C    1 
ATOM 2270 O O    . ASP A 1 147 ? 449.409 3.373   -10.101 1.00 0.00 ? 147 ASP A O    1 
ATOM 2271 C CB   . ASP A 1 147 ? 449.514 4.891   -7.408  1.00 0.00 ? 147 ASP A CB   1 
ATOM 2272 C CG   . ASP A 1 147 ? 449.159 6.022   -6.463  1.00 0.00 ? 147 ASP A CG   1 
ATOM 2273 O OD1  . ASP A 1 147 ? 448.571 7.021   -6.928  1.00 0.00 ? 147 ASP A OD1  1 
ATOM 2274 O OD2  . ASP A 1 147 ? 449.468 5.909   -5.258  1.00 0.00 ? 147 ASP A OD2  1 
ATOM 2275 H H    . ASP A 1 147 ? 448.352 2.638   -7.116  1.00 0.00 ? 147 ASP A H    1 
ATOM 2276 H HA   . ASP A 1 147 ? 447.529 5.165   -8.157  1.00 0.00 ? 147 ASP A HA   1 
ATOM 2277 H HB2  . ASP A 1 147 ? 449.875 4.060   -6.823  1.00 0.00 ? 147 ASP A HB2  1 
ATOM 2278 H HB3  . ASP A 1 147 ? 450.299 5.230   -8.068  1.00 0.00 ? 147 ASP A HB3  1 
ATOM 2279 N N    . GLU A 1 148 ? 448.279 5.275   -10.513 1.00 0.00 ? 148 GLU A N    1 
ATOM 2280 C CA   . GLU A 1 148 ? 448.591 5.283   -11.937 1.00 0.00 ? 148 GLU A CA   1 
ATOM 2281 C C    . GLU A 1 148 ? 450.028 5.734   -12.177 1.00 0.00 ? 148 GLU A C    1 
ATOM 2282 O O    . GLU A 1 148 ? 450.653 5.349   -13.165 1.00 0.00 ? 148 GLU A O    1 
ATOM 2283 C CB   . GLU A 1 148 ? 447.624 6.202   -12.686 1.00 0.00 ? 148 GLU A CB   1 
ATOM 2284 C CG   . GLU A 1 148 ? 446.174 5.752   -12.610 1.00 0.00 ? 148 GLU A CG   1 
ATOM 2285 C CD   . GLU A 1 148 ? 445.415 6.419   -11.480 1.00 0.00 ? 148 GLU A CD   1 
ATOM 2286 O OE1  . GLU A 1 148 ? 445.288 7.661   -11.503 1.00 0.00 ? 148 GLU A OE1  1 
ATOM 2287 O OE2  . GLU A 1 148 ? 444.947 5.699   -10.573 1.00 0.00 ? 148 GLU A OE2  1 
ATOM 2288 H H    . GLU A 1 148 ? 447.733 5.998   -10.140 1.00 0.00 ? 148 GLU A H    1 
ATOM 2289 H HA   . GLU A 1 148 ? 448.475 4.276   -12.307 1.00 0.00 ? 148 GLU A HA   1 
ATOM 2290 H HB2  . GLU A 1 148 ? 447.692 7.196   -12.267 1.00 0.00 ? 148 GLU A HB2  1 
ATOM 2291 H HB3  . GLU A 1 148 ? 447.913 6.239   -13.726 1.00 0.00 ? 148 GLU A HB3  1 
ATOM 2292 H HG2  . GLU A 1 148 ? 445.686 5.993   -13.543 1.00 0.00 ? 148 GLU A HG2  1 
ATOM 2293 H HG3  . GLU A 1 148 ? 446.151 4.683   -12.459 1.00 0.00 ? 148 GLU A HG3  1 
ATOM 2294 N N    . GLU A 1 149 ? 450.548 6.554   -11.268 1.00 0.00 ? 149 GLU A N    1 
ATOM 2295 C CA   . GLU A 1 149 ? 451.913 7.056   -11.383 1.00 0.00 ? 149 GLU A CA   1 
ATOM 2296 C C    . GLU A 1 149 ? 452.915 5.905   -11.417 1.00 0.00 ? 149 GLU A C    1 
ATOM 2297 O O    . GLU A 1 149 ? 453.848 5.908   -12.219 1.00 0.00 ? 149 GLU A O    1 
ATOM 2298 C CB   . GLU A 1 149 ? 452.230 8.002   -10.223 1.00 0.00 ? 149 GLU A CB   1 
ATOM 2299 C CG   . GLU A 1 149 ? 452.982 9.254   -10.646 1.00 0.00 ? 149 GLU A CG   1 
ATOM 2300 C CD   . GLU A 1 149 ? 454.431 9.243   -10.201 1.00 0.00 ? 149 GLU A CD   1 
ATOM 2301 O OE1  . GLU A 1 149 ? 455.253 8.579   -10.867 1.00 0.00 ? 149 GLU A OE1  1 
ATOM 2302 O OE2  . GLU A 1 149 ? 454.745 9.898   -9.185  1.00 0.00 ? 149 GLU A OE2  1 
ATOM 2303 H H    . GLU A 1 149 ? 450.002 6.828   -10.502 1.00 0.00 ? 149 GLU A H    1 
ATOM 2304 H HA   . GLU A 1 149 ? 451.984 7.604   -12.311 1.00 0.00 ? 149 GLU A HA   1 
ATOM 2305 H HB2  . GLU A 1 149 ? 451.303 8.305   -9.760  1.00 0.00 ? 149 GLU A HB2  1 
ATOM 2306 H HB3  . GLU A 1 149 ? 452.830 7.476   -9.495  1.00 0.00 ? 149 GLU A HB3  1 
ATOM 2307 H HG2  . GLU A 1 149 ? 452.954 9.328   -11.723 1.00 0.00 ? 149 GLU A HG2  1 
ATOM 2308 H HG3  . GLU A 1 149 ? 452.494 10.115  -10.214 1.00 0.00 ? 149 GLU A HG3  1 
ATOM 2309 N N    . ASP A 1 150 ? 452.711 4.919   -10.549 1.00 0.00 ? 150 ASP A N    1 
ATOM 2310 C CA   . ASP A 1 150 ? 453.596 3.760   -10.492 1.00 0.00 ? 150 ASP A CA   1 
ATOM 2311 C C    . ASP A 1 150 ? 453.306 2.813   -11.653 1.00 0.00 ? 150 ASP A C    1 
ATOM 2312 O O    . ASP A 1 150 ? 452.403 3.063   -12.451 1.00 0.00 ? 150 ASP A O    1 
ATOM 2313 C CB   . ASP A 1 150 ? 453.428 3.024   -9.160  1.00 0.00 ? 150 ASP A CB   1 
ATOM 2314 C CG   . ASP A 1 150 ? 452.037 2.446   -8.987  1.00 0.00 ? 150 ASP A CG   1 
ATOM 2315 O OD1  . ASP A 1 150 ? 451.658 1.561   -9.782  1.00 0.00 ? 150 ASP A OD1  1 
ATOM 2316 O OD2  . ASP A 1 150 ? 451.326 2.879   -8.055  1.00 0.00 ? 150 ASP A OD2  1 
ATOM 2317 H H    . ASP A 1 150 ? 451.947 4.968   -9.938  1.00 0.00 ? 150 ASP A H    1 
ATOM 2318 H HA   . ASP A 1 150 ? 454.611 4.115   -10.573 1.00 0.00 ? 150 ASP A HA   1 
ATOM 2319 H HB2  . ASP A 1 150 ? 454.141 2.215   -9.111  1.00 0.00 ? 150 ASP A HB2  1 
ATOM 2320 H HB3  . ASP A 1 150 ? 453.615 3.713   -8.351  1.00 0.00 ? 150 ASP A HB3  1 
ATOM 2321 N N    . LEU A 1 151 ? 454.066 1.723   -11.748 1.00 0.00 ? 151 LEU A N    1 
ATOM 2322 C CA   . LEU A 1 151 ? 453.860 0.758   -12.823 1.00 0.00 ? 151 LEU A CA   1 
ATOM 2323 C C    . LEU A 1 151 ? 453.785 -0.671  -12.293 1.00 0.00 ? 151 LEU A C    1 
ATOM 2324 O O    . LEU A 1 151 ? 454.794 -1.232  -11.867 1.00 0.00 ? 151 LEU A O    1 
ATOM 2325 C CB   . LEU A 1 151 ? 454.986 0.850   -13.853 1.00 0.00 ? 151 LEU A CB   1 
ATOM 2326 C CG   . LEU A 1 151 ? 454.556 0.616   -15.303 1.00 0.00 ? 151 LEU A CG   1 
ATOM 2327 C CD1  . LEU A 1 151 ? 453.937 -0.765  -15.458 1.00 0.00 ? 151 LEU A CD1  1 
ATOM 2328 C CD2  . LEU A 1 151 ? 453.577 1.694   -15.750 1.00 0.00 ? 151 LEU A CD2  1 
ATOM 2329 H H    . LEU A 1 151 ? 454.774 1.564   -11.085 1.00 0.00 ? 151 LEU A H    1 
ATOM 2330 H HA   . LEU A 1 151 ? 452.927 1.000   -13.308 1.00 0.00 ? 151 LEU A HA   1 
ATOM 2331 H HB2  . LEU A 1 151 ? 455.432 1.827   -13.784 1.00 0.00 ? 151 LEU A HB2  1 
ATOM 2332 H HB3  . LEU A 1 151 ? 455.736 0.114   -13.603 1.00 0.00 ? 151 LEU A HB3  1 
ATOM 2333 H HG   . LEU A 1 151 ? 455.426 0.667   -15.943 1.00 0.00 ? 151 LEU A HG   1 
ATOM 2334 H HD11 . LEU A 1 151 ? 453.222 -0.931  -14.666 1.00 0.00 ? 151 LEU A HD11 1 
ATOM 2335 H HD12 . LEU A 1 151 ? 454.713 -1.515  -15.407 1.00 0.00 ? 151 LEU A HD12 1 
ATOM 2336 H HD13 . LEU A 1 151 ? 453.437 -0.830  -16.413 1.00 0.00 ? 151 LEU A HD13 1 
ATOM 2337 H HD21 . LEU A 1 151 ? 452.618 1.245   -15.965 1.00 0.00 ? 151 LEU A HD21 1 
ATOM 2338 H HD22 . LEU A 1 151 ? 453.955 2.176   -16.638 1.00 0.00 ? 151 LEU A HD22 1 
ATOM 2339 H HD23 . LEU A 1 151 ? 453.463 2.427   -14.965 1.00 0.00 ? 151 LEU A HD23 1 
ATOM 2340 N N    . PRO A 1 152 ? 452.595 -1.301  -12.341 1.00 0.00 ? 152 PRO A N    1 
ATOM 2341 C CA   . PRO A 1 152 ? 452.433 -2.684  -11.891 1.00 0.00 ? 152 PRO A CA   1 
ATOM 2342 C C    . PRO A 1 152 ? 453.411 -3.593  -12.624 1.00 0.00 ? 152 PRO A C    1 
ATOM 2343 O O    . PRO A 1 152 ? 453.739 -3.342  -13.783 1.00 0.00 ? 152 PRO A O    1 
ATOM 2344 C CB   . PRO A 1 152 ? 450.992 -3.028  -12.273 1.00 0.00 ? 152 PRO A CB   1 
ATOM 2345 C CG   . PRO A 1 152 ? 450.299 -1.712  -12.385 1.00 0.00 ? 152 PRO A CG   1 
ATOM 2346 C CD   . PRO A 1 152 ? 451.338 -0.737  -12.863 1.00 0.00 ? 152 PRO A CD   1 
ATOM 2347 H HA   . PRO A 1 152 ? 452.568 -2.780  -10.823 1.00 0.00 ? 152 PRO A HA   1 
ATOM 2348 H HB2  . PRO A 1 152 ? 450.987 -3.559  -13.212 1.00 0.00 ? 152 PRO A HB2  1 
ATOM 2349 H HB3  . PRO A 1 152 ? 450.549 -3.642  -11.503 1.00 0.00 ? 152 PRO A HB3  1 
ATOM 2350 H HG2  . PRO A 1 152 ? 449.493 -1.782  -13.100 1.00 0.00 ? 152 PRO A HG2  1 
ATOM 2351 H HG3  . PRO A 1 152 ? 449.921 -1.413  -11.419 1.00 0.00 ? 152 PRO A HG3  1 
ATOM 2352 H HD2  . PRO A 1 152 ? 451.351 -0.697  -13.943 1.00 0.00 ? 152 PRO A HD2  1 
ATOM 2353 H HD3  . PRO A 1 152 ? 451.154 0.244   -12.449 1.00 0.00 ? 152 PRO A HD3  1 
ATOM 2354 N N    . PHE A 1 153 ? 453.903 -4.624  -11.954 1.00 0.00 ? 153 PHE A N    1 
ATOM 2355 C CA   . PHE A 1 153 ? 454.873 -5.528  -12.568 1.00 0.00 ? 153 PHE A CA   1 
ATOM 2356 C C    . PHE A 1 153 ? 454.274 -6.901  -12.823 1.00 0.00 ? 153 PHE A C    1 
ATOM 2357 O O    . PHE A 1 153 ? 453.668 -7.488  -11.938 1.00 0.00 ? 153 PHE A O    1 
ATOM 2358 C CB   . PHE A 1 153 ? 456.083 -5.678  -11.651 1.00 0.00 ? 153 PHE A CB   1 
ATOM 2359 C CG   . PHE A 1 153 ? 455.703 -5.844  -10.207 1.00 0.00 ? 153 PHE A CG   1 
ATOM 2360 C CD1  . PHE A 1 153 ? 455.268 -7.069  -9.729  1.00 0.00 ? 153 PHE A CD1  1 
ATOM 2361 C CD2  . PHE A 1 153 ? 455.765 -4.771  -9.333  1.00 0.00 ? 153 PHE A CD2  1 
ATOM 2362 C CE1  . PHE A 1 153 ? 454.906 -7.224  -8.405  1.00 0.00 ? 153 PHE A CE1  1 
ATOM 2363 C CE2  . PHE A 1 153 ? 455.402 -4.919  -8.008  1.00 0.00 ? 153 PHE A CE2  1 
ATOM 2364 C CZ   . PHE A 1 153 ? 454.973 -6.147  -7.543  1.00 0.00 ? 153 PHE A CZ   1 
ATOM 2365 H H    . PHE A 1 153 ? 453.640 -4.784  -11.022 1.00 0.00 ? 153 PHE A H    1 
ATOM 2366 H HA   . PHE A 1 153 ? 455.187 -5.097  -13.505 1.00 0.00 ? 153 PHE A HA   1 
ATOM 2367 H HB2  . PHE A 1 153 ? 456.644 -6.551  -11.949 1.00 0.00 ? 153 PHE A HB2  1 
ATOM 2368 H HB3  . PHE A 1 153 ? 456.709 -4.802  -11.736 1.00 0.00 ? 153 PHE A HB3  1 
ATOM 2369 H HD1  . PHE A 1 153 ? 455.214 -7.911  -10.403 1.00 0.00 ? 153 PHE A HD1  1 
ATOM 2370 H HD2  . PHE A 1 153 ? 456.102 -3.811  -9.694  1.00 0.00 ? 153 PHE A HD2  1 
ATOM 2371 H HE1  . PHE A 1 153 ? 454.571 -8.185  -8.044  1.00 0.00 ? 153 PHE A HE1  1 
ATOM 2372 H HE2  . PHE A 1 153 ? 455.454 -4.075  -7.336  1.00 0.00 ? 153 PHE A HE2  1 
ATOM 2373 H HZ   . PHE A 1 153 ? 454.688 -6.264  -6.508  1.00 0.00 ? 153 PHE A HZ   1 
ATOM 2374 N N    . LYS A 1 154 ? 454.467 -7.424  -14.027 1.00 0.00 ? 154 LYS A N    1 
ATOM 2375 C CA   . LYS A 1 154 ? 453.946 -8.743  -14.368 1.00 0.00 ? 154 LYS A CA   1 
ATOM 2376 C C    . LYS A 1 154 ? 455.074 -9.766  -14.399 1.00 0.00 ? 154 LYS A C    1 
ATOM 2377 O O    . LYS A 1 154 ? 456.074 -9.577  -15.089 1.00 0.00 ? 154 LYS A O    1 
ATOM 2378 C CB   . LYS A 1 154 ? 453.237 -8.703  -15.724 1.00 0.00 ? 154 LYS A CB   1 
ATOM 2379 C CG   . LYS A 1 154 ? 451.735 -8.483  -15.619 1.00 0.00 ? 154 LYS A CG   1 
ATOM 2380 C CD   . LYS A 1 154 ? 450.961 -9.509  -16.432 1.00 0.00 ? 154 LYS A CD   1 
ATOM 2381 C CE   . LYS A 1 154 ? 451.168 -9.310  -17.924 1.00 0.00 ? 154 LYS A CE   1 
ATOM 2382 N NZ   . LYS A 1 154 ? 450.262 -10.172 -18.731 1.00 0.00 ? 154 LYS A NZ   1 
ATOM 2383 H H    . LYS A 1 154 ? 454.978 -6.920  -14.695 1.00 0.00 ? 154 LYS A H    1 
ATOM 2384 H HA   . LYS A 1 154 ? 453.236 -9.028  -13.606 1.00 0.00 ? 154 LYS A HA   1 
ATOM 2385 H HB2  . LYS A 1 154 ? 453.656 -7.900  -16.313 1.00 0.00 ? 154 LYS A HB2  1 
ATOM 2386 H HB3  . LYS A 1 154 ? 453.408 -9.639  -16.235 1.00 0.00 ? 154 LYS A HB3  1 
ATOM 2387 H HG2  . LYS A 1 154 ? 451.441 -8.564  -14.583 1.00 0.00 ? 154 LYS A HG2  1 
ATOM 2388 H HG3  . LYS A 1 154 ? 451.500 -7.494  -15.986 1.00 0.00 ? 154 LYS A HG3  1 
ATOM 2389 H HD2  . LYS A 1 154 ? 451.299 -10.498 -16.161 1.00 0.00 ? 154 LYS A HD2  1 
ATOM 2390 H HD3  . LYS A 1 154 ? 449.908 -9.412  -16.207 1.00 0.00 ? 154 LYS A HD3  1 
ATOM 2391 H HE2  . LYS A 1 154 ? 450.976 -8.275  -18.167 1.00 0.00 ? 154 LYS A HE2  1 
ATOM 2392 H HE3  . LYS A 1 154 ? 452.192 -9.551  -18.168 1.00 0.00 ? 154 LYS A HE3  1 
ATOM 2393 H HZ1  . LYS A 1 154 ? 449.269 -9.926  -18.539 1.00 0.00 ? 154 LYS A HZ1  1 
ATOM 2394 H HZ2  . LYS A 1 154 ? 450.411 -11.172 -18.490 1.00 0.00 ? 154 LYS A HZ2  1 
ATOM 2395 H HZ3  . LYS A 1 154 ? 450.451 -10.040 -19.745 1.00 0.00 ? 154 LYS A HZ3  1 
ATOM 2396 N N    . LYS A 1 155 ? 454.919 -10.838 -13.624 1.00 0.00 ? 155 LYS A N    1 
ATOM 2397 C CA   . LYS A 1 155 ? 455.930 -11.890 -13.536 1.00 0.00 ? 155 LYS A CA   1 
ATOM 2398 C C    . LYS A 1 155 ? 456.579 -12.191 -14.890 1.00 0.00 ? 155 LYS A C    1 
ATOM 2399 O O    . LYS A 1 155 ? 455.897 -12.310 -15.908 1.00 0.00 ? 155 LYS A O    1 
ATOM 2400 C CB   . LYS A 1 155 ? 455.304 -13.166 -12.971 1.00 0.00 ? 155 LYS A CB   1 
ATOM 2401 C CG   . LYS A 1 155 ? 456.174 -13.861 -11.936 1.00 0.00 ? 155 LYS A CG   1 
ATOM 2402 C CD   . LYS A 1 155 ? 455.683 -15.272 -11.652 1.00 0.00 ? 155 LYS A CD   1 
ATOM 2403 C CE   . LYS A 1 155 ? 454.516 -15.271 -10.678 1.00 0.00 ? 155 LYS A CE   1 
ATOM 2404 N NZ   . LYS A 1 155 ? 454.969 -15.128 -9.267  1.00 0.00 ? 155 LYS A NZ   1 
ATOM 2405 H H    . LYS A 1 155 ? 454.114 -10.929 -13.072 1.00 0.00 ? 155 LYS A H    1 
ATOM 2406 H HA   . LYS A 1 155 ? 456.690 -11.550 -12.850 1.00 0.00 ? 155 LYS A HA   1 
ATOM 2407 H HB2  . LYS A 1 155 ? 454.361 -12.916 -12.507 1.00 0.00 ? 155 LYS A HB2  1 
ATOM 2408 H HB3  . LYS A 1 155 ? 455.125 -13.857 -13.781 1.00 0.00 ? 155 LYS A HB3  1 
ATOM 2409 H HG2  . LYS A 1 155 ? 457.187 -13.911 -12.305 1.00 0.00 ? 155 LYS A HG2  1 
ATOM 2410 H HG3  . LYS A 1 155 ? 456.151 -13.290 -11.019 1.00 0.00 ? 155 LYS A HG3  1 
ATOM 2411 H HD2  . LYS A 1 155 ? 455.366 -15.725 -12.579 1.00 0.00 ? 155 LYS A HD2  1 
ATOM 2412 H HD3  . LYS A 1 155 ? 456.494 -15.845 -11.227 1.00 0.00 ? 155 LYS A HD3  1 
ATOM 2413 H HE2  . LYS A 1 155 ? 453.862 -14.447 -10.922 1.00 0.00 ? 155 LYS A HE2  1 
ATOM 2414 H HE3  . LYS A 1 155 ? 453.976 -16.200 -10.782 1.00 0.00 ? 155 LYS A HE3  1 
ATOM 2415 H HZ1  . LYS A 1 155 ? 454.160 -14.901 -8.653  1.00 0.00 ? 155 LYS A HZ1  1 
ATOM 2416 H HZ2  . LYS A 1 155 ? 455.671 -14.365 -9.192  1.00 0.00 ? 155 LYS A HZ2  1 
ATOM 2417 H HZ3  . LYS A 1 155 ? 455.401 -16.015 -8.939  1.00 0.00 ? 155 LYS A HZ3  1 
ATOM 2418 N N    . GLY A 1 156 ? 457.901 -12.339 -14.877 1.00 0.00 ? 156 GLY A N    1 
ATOM 2419 C CA   . GLY A 1 156 ? 458.640 -12.657 -16.088 1.00 0.00 ? 156 GLY A CA   1 
ATOM 2420 C C    . GLY A 1 156 ? 458.752 -11.504 -17.072 1.00 0.00 ? 156 GLY A C    1 
ATOM 2421 O O    . GLY A 1 156 ? 459.387 -11.644 -18.117 1.00 0.00 ? 156 GLY A O    1 
ATOM 2422 H H    . GLY A 1 156 ? 458.379 -12.256 -14.027 1.00 0.00 ? 156 GLY A H    1 
ATOM 2423 H HA2  . GLY A 1 156 ? 459.636 -12.966 -15.811 1.00 0.00 ? 156 GLY A HA2  1 
ATOM 2424 H HA3  . GLY A 1 156 ? 458.150 -13.484 -16.581 1.00 0.00 ? 156 GLY A HA3  1 
ATOM 2425 N N    . ASP A 1 157 ? 458.134 -10.370 -16.760 1.00 0.00 ? 157 ASP A N    1 
ATOM 2426 C CA   . ASP A 1 157 ? 458.176 -9.218  -17.653 1.00 0.00 ? 157 ASP A CA   1 
ATOM 2427 C C    . ASP A 1 157 ? 459.424 -8.371  -17.419 1.00 0.00 ? 157 ASP A C    1 
ATOM 2428 O O    . ASP A 1 157 ? 459.772 -8.057  -16.281 1.00 0.00 ? 157 ASP A O    1 
ATOM 2429 C CB   . ASP A 1 157 ? 456.923 -8.365  -17.466 1.00 0.00 ? 157 ASP A CB   1 
ATOM 2430 C CG   . ASP A 1 157 ? 456.492 -7.681  -18.748 1.00 0.00 ? 157 ASP A CG   1 
ATOM 2431 O OD1  . ASP A 1 157 ? 455.763 -8.312  -19.542 1.00 0.00 ? 157 ASP A OD1  1 
ATOM 2432 O OD2  . ASP A 1 157 ? 456.885 -6.514  -18.960 1.00 0.00 ? 157 ASP A OD2  1 
ATOM 2433 H H    . ASP A 1 157 ? 457.628 -10.303 -15.925 1.00 0.00 ? 157 ASP A H    1 
ATOM 2434 H HA   . ASP A 1 157 ? 458.196 -9.588  -18.667 1.00 0.00 ? 157 ASP A HA   1 
ATOM 2435 H HB2  . ASP A 1 157 ? 456.117 -8.998  -17.129 1.00 0.00 ? 157 ASP A HB2  1 
ATOM 2436 H HB3  . ASP A 1 157 ? 457.118 -7.607  -16.721 1.00 0.00 ? 157 ASP A HB3  1 
ATOM 2437 N N    . ILE A 1 158 ? 460.105 -8.026  -18.509 1.00 0.00 ? 158 ILE A N    1 
ATOM 2438 C CA   . ILE A 1 158 ? 461.331 -7.240  -18.428 1.00 0.00 ? 158 ILE A CA   1 
ATOM 2439 C C    . ILE A 1 158 ? 461.044 -5.744  -18.498 1.00 0.00 ? 158 ILE A C    1 
ATOM 2440 O O    . ILE A 1 158 ? 460.361 -5.266  -19.404 1.00 0.00 ? 158 ILE A O    1 
ATOM 2441 C CB   . ILE A 1 158 ? 462.308 -7.601  -19.564 1.00 0.00 ? 158 ILE A CB   1 
ATOM 2442 C CG1  . ILE A 1 158 ? 462.396 -9.119  -19.738 1.00 0.00 ? 158 ILE A CG1  1 
ATOM 2443 C CG2  . ILE A 1 158 ? 463.683 -7.013  -19.283 1.00 0.00 ? 158 ILE A CG2  1 
ATOM 2444 C CD1  . ILE A 1 158 ? 462.968 -9.833  -18.534 1.00 0.00 ? 158 ILE A CD1  1 
ATOM 2445 H H    . ILE A 1 158 ? 459.791 -8.345  -19.380 1.00 0.00 ? 158 ILE A H    1 
ATOM 2446 H HA   . ILE A 1 158 ? 461.809 -7.462  -17.486 1.00 0.00 ? 158 ILE A HA   1 
ATOM 2447 H HB   . ILE A 1 158 ? 461.938 -7.163  -20.479 1.00 0.00 ? 158 ILE A HB   1 
ATOM 2448 H HG12 . ILE A 1 158 ? 461.406 -9.513  -19.916 1.00 0.00 ? 158 ILE A HG12 1 
ATOM 2449 H HG13 . ILE A 1 158 ? 463.025 -9.342  -20.587 1.00 0.00 ? 158 ILE A HG13 1 
ATOM 2450 H HG21 . ILE A 1 158 ? 464.312 -7.766  -18.834 1.00 0.00 ? 158 ILE A HG21 1 
ATOM 2451 H HG22 . ILE A 1 158 ? 463.585 -6.176  -18.607 1.00 0.00 ? 158 ILE A HG22 1 
ATOM 2452 H HG23 . ILE A 1 158 ? 464.127 -6.678  -20.209 1.00 0.00 ? 158 ILE A HG23 1 
ATOM 2453 H HD11 . ILE A 1 158 ? 464.046 -9.782  -18.563 1.00 0.00 ? 158 ILE A HD11 1 
ATOM 2454 H HD12 . ILE A 1 158 ? 462.655 -10.867 -18.546 1.00 0.00 ? 158 ILE A HD12 1 
ATOM 2455 H HD13 . ILE A 1 158 ? 462.609 -9.359  -17.633 1.00 0.00 ? 158 ILE A HD13 1 
ATOM 2456 N N    . LEU A 1 159 ? 461.582 -5.017  -17.525 1.00 0.00 ? 159 LEU A N    1 
ATOM 2457 C CA   . LEU A 1 159 ? 461.406 -3.573  -17.443 1.00 0.00 ? 159 LEU A CA   1 
ATOM 2458 C C    . LEU A 1 159 ? 462.756 -2.864  -17.513 1.00 0.00 ? 159 LEU A C    1 
ATOM 2459 O O    . LEU A 1 159 ? 463.732 -3.311  -16.911 1.00 0.00 ? 159 LEU A O    1 
ATOM 2460 C CB   . LEU A 1 159 ? 460.696 -3.206  -16.139 1.00 0.00 ? 159 LEU A CB   1 
ATOM 2461 C CG   . LEU A 1 159 ? 459.341 -3.889  -15.925 1.00 0.00 ? 159 LEU A CG   1 
ATOM 2462 C CD1  . LEU A 1 159 ? 459.281 -4.543  -14.552 1.00 0.00 ? 159 LEU A CD1  1 
ATOM 2463 C CD2  . LEU A 1 159 ? 458.203 -2.891  -16.094 1.00 0.00 ? 159 LEU A CD2  1 
ATOM 2464 H H    . LEU A 1 159 ? 462.115 -5.467  -16.838 1.00 0.00 ? 159 LEU A H    1 
ATOM 2465 H HA   . LEU A 1 159 ? 460.799 -3.260  -18.279 1.00 0.00 ? 159 LEU A HA   1 
ATOM 2466 H HB2  . LEU A 1 159 ? 461.346 -3.472  -15.314 1.00 0.00 ? 159 LEU A HB2  1 
ATOM 2467 H HB3  . LEU A 1 159 ? 460.543 -2.137  -16.124 1.00 0.00 ? 159 LEU A HB3  1 
ATOM 2468 H HG   . LEU A 1 159 ? 459.218 -4.665  -16.667 1.00 0.00 ? 159 LEU A HG   1 
ATOM 2469 H HD11 . LEU A 1 159 ? 458.264 -4.838  -14.337 1.00 0.00 ? 159 LEU A HD11 1 
ATOM 2470 H HD12 . LEU A 1 159 ? 459.617 -3.840  -13.803 1.00 0.00 ? 159 LEU A HD12 1 
ATOM 2471 H HD13 . LEU A 1 159 ? 459.919 -5.414  -14.540 1.00 0.00 ? 159 LEU A HD13 1 
ATOM 2472 H HD21 . LEU A 1 159 ? 457.488 -3.278  -16.805 1.00 0.00 ? 159 LEU A HD21 1 
ATOM 2473 H HD22 . LEU A 1 159 ? 458.597 -1.952  -16.455 1.00 0.00 ? 159 LEU A HD22 1 
ATOM 2474 H HD23 . LEU A 1 159 ? 457.715 -2.734  -15.143 1.00 0.00 ? 159 LEU A HD23 1 
ATOM 2475 N N    . ARG A 1 160 ? 462.807 -1.758  -18.247 1.00 0.00 ? 160 ARG A N    1 
ATOM 2476 C CA   . ARG A 1 160 ? 464.041 -0.993  -18.387 1.00 0.00 ? 160 ARG A CA   1 
ATOM 2477 C C    . ARG A 1 160 ? 464.049 0.200   -17.437 1.00 0.00 ? 160 ARG A C    1 
ATOM 2478 O O    . ARG A 1 160 ? 463.055 0.915   -17.318 1.00 0.00 ? 160 ARG A O    1 
ATOM 2479 C CB   . ARG A 1 160 ? 464.212 -0.515  -19.830 1.00 0.00 ? 160 ARG A CB   1 
ATOM 2480 C CG   . ARG A 1 160 ? 465.660 -0.263  -20.220 1.00 0.00 ? 160 ARG A CG   1 
ATOM 2481 C CD   . ARG A 1 160 ? 465.780 0.868   -21.229 1.00 0.00 ? 160 ARG A CD   1 
ATOM 2482 N NE   . ARG A 1 160 ? 466.259 0.396   -22.525 1.00 0.00 ? 160 ARG A NE   1 
ATOM 2483 C CZ   . ARG A 1 160 ? 465.497 -0.245  -23.409 1.00 0.00 ? 160 ARG A CZ   1 
ATOM 2484 N NH1  . ARG A 1 160 ? 464.220 -0.490  -23.141 1.00 0.00 ? 160 ARG A NH1  1 
ATOM 2485 N NH2  . ARG A 1 160 ? 466.013 -0.642  -24.564 1.00 0.00 ? 160 ARG A NH2  1 
ATOM 2486 H H    . ARG A 1 160 ? 461.997 -1.448  -18.704 1.00 0.00 ? 160 ARG A H    1 
ATOM 2487 H HA   . ARG A 1 160 ? 464.865 -1.645  -18.134 1.00 0.00 ? 160 ARG A HA   1 
ATOM 2488 H HB2  . ARG A 1 160 ? 463.808 -1.264  -20.496 1.00 0.00 ? 160 ARG A HB2  1 
ATOM 2489 H HB3  . ARG A 1 160 ? 463.661 0.404   -19.961 1.00 0.00 ? 160 ARG A HB3  1 
ATOM 2490 H HG2  . ARG A 1 160 ? 466.220 -0.002  -19.334 1.00 0.00 ? 160 ARG A HG2  1 
ATOM 2491 H HG3  . ARG A 1 160 ? 466.067 -1.165  -20.653 1.00 0.00 ? 160 ARG A HG3  1 
ATOM 2492 H HD2  . ARG A 1 160 ? 464.809 1.324   -21.359 1.00 0.00 ? 160 ARG A HD2  1 
ATOM 2493 H HD3  . ARG A 1 160 ? 466.473 1.603   -20.845 1.00 0.00 ? 160 ARG A HD3  1 
ATOM 2494 H HE   . ARG A 1 160 ? 467.198 0.565   -22.750 1.00 0.00 ? 160 ARG A HE   1 
ATOM 2495 H HH11 . ARG A 1 160 ? 463.824 -0.192  -22.273 1.00 0.00 ? 160 ARG A HH11 1 
ATOM 2496 H HH12 . ARG A 1 160 ? 463.654 -0.973  -23.809 1.00 0.00 ? 160 ARG A HH12 1 
ATOM 2497 H HH21 . ARG A 1 160 ? 466.974 -0.460  -24.771 1.00 0.00 ? 160 ARG A HH21 1 
ATOM 2498 H HH22 . ARG A 1 160 ? 465.442 -1.125  -25.227 1.00 0.00 ? 160 ARG A HH22 1 
ATOM 2499 N N    . ILE A 1 161 ? 465.175 0.409   -16.762 1.00 0.00 ? 161 ILE A N    1 
ATOM 2500 C CA   . ILE A 1 161 ? 465.306 1.516   -15.821 1.00 0.00 ? 161 ILE A CA   1 
ATOM 2501 C C    . ILE A 1 161 ? 465.390 2.852   -16.551 1.00 0.00 ? 161 ILE A C    1 
ATOM 2502 O O    . ILE A 1 161 ? 465.957 2.943   -17.639 1.00 0.00 ? 161 ILE A O    1 
ATOM 2503 C CB   . ILE A 1 161 ? 466.551 1.347   -14.928 1.00 0.00 ? 161 ILE A CB   1 
ATOM 2504 C CG1  . ILE A 1 161 ? 466.560 -0.041  -14.285 1.00 0.00 ? 161 ILE A CG1  1 
ATOM 2505 C CG2  . ILE A 1 161 ? 466.592 2.432   -13.862 1.00 0.00 ? 161 ILE A CG2  1 
ATOM 2506 C CD1  . ILE A 1 161 ? 465.320 -0.342  -13.473 1.00 0.00 ? 161 ILE A CD1  1 
ATOM 2507 H H    . ILE A 1 161 ? 465.934 -0.195  -16.898 1.00 0.00 ? 161 ILE A H    1 
ATOM 2508 H HA   . ILE A 1 161 ? 464.432 1.518   -15.186 1.00 0.00 ? 161 ILE A HA   1 
ATOM 2509 H HB   . ILE A 1 161 ? 467.428 1.455   -15.549 1.00 0.00 ? 161 ILE A HB   1 
ATOM 2510 H HG12 . ILE A 1 161 ? 466.636 -0.789  -15.060 1.00 0.00 ? 161 ILE A HG12 1 
ATOM 2511 H HG13 . ILE A 1 161 ? 467.415 -0.121  -13.630 1.00 0.00 ? 161 ILE A HG13 1 
ATOM 2512 H HG21 . ILE A 1 161 ? 467.513 2.353   -13.304 1.00 0.00 ? 161 ILE A HG21 1 
ATOM 2513 H HG22 . ILE A 1 161 ? 465.753 2.311   -13.192 1.00 0.00 ? 161 ILE A HG22 1 
ATOM 2514 H HG23 . ILE A 1 161 ? 466.539 3.402   -14.333 1.00 0.00 ? 161 ILE A HG23 1 
ATOM 2515 H HD11 . ILE A 1 161 ? 465.421 -1.312  -13.007 1.00 0.00 ? 161 ILE A HD11 1 
ATOM 2516 H HD12 . ILE A 1 161 ? 464.456 -0.343  -14.122 1.00 0.00 ? 161 ILE A HD12 1 
ATOM 2517 H HD13 . ILE A 1 161 ? 465.196 0.412   -12.710 1.00 0.00 ? 161 ILE A HD13 1 
ATOM 2518 N N    . ARG A 1 162 ? 464.814 3.886   -15.946 1.00 0.00 ? 162 ARG A N    1 
ATOM 2519 C CA   . ARG A 1 162 ? 464.816 5.215   -16.541 1.00 0.00 ? 162 ARG A CA   1 
ATOM 2520 C C    . ARG A 1 162 ? 465.150 6.304   -15.520 1.00 0.00 ? 162 ARG A C    1 
ATOM 2521 O O    . ARG A 1 162 ? 465.459 7.435   -15.896 1.00 0.00 ? 162 ARG A O    1 
ATOM 2522 C CB   . ARG A 1 162 ? 463.456 5.497   -17.170 1.00 0.00 ? 162 ARG A CB   1 
ATOM 2523 C CG   . ARG A 1 162 ? 463.410 5.209   -18.659 1.00 0.00 ? 162 ARG A CG   1 
ATOM 2524 C CD   . ARG A 1 162 ? 462.799 6.368   -19.420 1.00 0.00 ? 162 ARG A CD   1 
ATOM 2525 N NE   . ARG A 1 162 ? 463.376 6.519   -20.753 1.00 0.00 ? 162 ARG A NE   1 
ATOM 2526 C CZ   . ARG A 1 162 ? 462.847 7.279   -21.709 1.00 0.00 ? 162 ARG A CZ   1 
ATOM 2527 N NH1  . ARG A 1 162 ? 461.727 7.956   -21.485 1.00 0.00 ? 162 ARG A NH1  1 
ATOM 2528 N NH2  . ARG A 1 162 ? 463.439 7.362   -22.893 1.00 0.00 ? 162 ARG A NH2  1 
ATOM 2529 H H    . ARG A 1 162 ? 464.375 3.747   -15.086 1.00 0.00 ? 162 ARG A H    1 
ATOM 2530 H HA   . ARG A 1 162 ? 465.565 5.226   -17.317 1.00 0.00 ? 162 ARG A HA   1 
ATOM 2531 H HB2  . ARG A 1 162 ? 462.712 4.883   -16.683 1.00 0.00 ? 162 ARG A HB2  1 
ATOM 2532 H HB3  . ARG A 1 162 ? 463.208 6.537   -17.017 1.00 0.00 ? 162 ARG A HB3  1 
ATOM 2533 H HG2  . ARG A 1 162 ? 464.415 5.045   -19.016 1.00 0.00 ? 162 ARG A HG2  1 
ATOM 2534 H HG3  . ARG A 1 162 ? 462.815 4.324   -18.827 1.00 0.00 ? 162 ARG A HG3  1 
ATOM 2535 H HD2  . ARG A 1 162 ? 461.737 6.199   -19.512 1.00 0.00 ? 162 ARG A HD2  1 
ATOM 2536 H HD3  . ARG A 1 162 ? 462.971 7.273   -18.857 1.00 0.00 ? 162 ARG A HD3  1 
ATOM 2537 H HE   . ARG A 1 162 ? 464.203 6.028   -20.946 1.00 0.00 ? 162 ARG A HE   1 
ATOM 2538 H HH11 . ARG A 1 162 ? 461.276 7.897   -20.595 1.00 0.00 ? 162 ARG A HH11 1 
ATOM 2539 H HH12 . ARG A 1 162 ? 461.335 8.525   -22.208 1.00 0.00 ? 162 ARG A HH12 1 
ATOM 2540 H HH21 . ARG A 1 162 ? 464.283 6.854   -23.066 1.00 0.00 ? 162 ARG A HH21 1 
ATOM 2541 H HH22 . ARG A 1 162 ? 463.042 7.932   -23.612 1.00 0.00 ? 162 ARG A HH22 1 
ATOM 2542 N N    . ASP A 1 163 ? 465.089 5.970   -14.231 1.00 0.00 ? 163 ASP A N    1 
ATOM 2543 C CA   . ASP A 1 163 ? 465.387 6.934   -13.174 1.00 0.00 ? 163 ASP A CA   1 
ATOM 2544 C C    . ASP A 1 163 ? 465.071 6.345   -11.803 1.00 0.00 ? 163 ASP A C    1 
ATOM 2545 O O    . ASP A 1 163 ? 464.275 5.414   -11.687 1.00 0.00 ? 163 ASP A O    1 
ATOM 2546 C CB   . ASP A 1 163 ? 464.584 8.225   -13.376 1.00 0.00 ? 163 ASP A CB   1 
ATOM 2547 C CG   . ASP A 1 163 ? 465.461 9.462   -13.350 1.00 0.00 ? 163 ASP A CG   1 
ATOM 2548 O OD1  . ASP A 1 163 ? 466.448 9.506   -14.113 1.00 0.00 ? 163 ASP A OD1  1 
ATOM 2549 O OD2  . ASP A 1 163 ? 465.159 10.386  -12.566 1.00 0.00 ? 163 ASP A OD2  1 
ATOM 2550 H H    . ASP A 1 163 ? 464.844 5.058   -13.979 1.00 0.00 ? 163 ASP A H    1 
ATOM 2551 H HA   . ASP A 1 163 ? 466.441 7.164   -13.221 1.00 0.00 ? 163 ASP A HA   1 
ATOM 2552 H HB2  . ASP A 1 163 ? 464.081 8.184   -14.330 1.00 0.00 ? 163 ASP A HB2  1 
ATOM 2553 H HB3  . ASP A 1 163 ? 463.848 8.311   -12.590 1.00 0.00 ? 163 ASP A HB3  1 
ATOM 2554 N N    . LYS A 1 164 ? 465.693 6.897   -10.766 1.00 0.00 ? 164 LYS A N    1 
ATOM 2555 C CA   . LYS A 1 164 ? 465.464 6.428   -9.405  1.00 0.00 ? 164 LYS A CA   1 
ATOM 2556 C C    . LYS A 1 164 ? 464.758 7.500   -8.578  1.00 0.00 ? 164 LYS A C    1 
ATOM 2557 O O    . LYS A 1 164 ? 465.402 8.384   -8.013  1.00 0.00 ? 164 LYS A O    1 
ATOM 2558 C CB   . LYS A 1 164 ? 466.791 6.050   -8.743  1.00 0.00 ? 164 LYS A CB   1 
ATOM 2559 C CG   . LYS A 1 164 ? 467.615 5.064   -9.553  1.00 0.00 ? 164 LYS A CG   1 
ATOM 2560 C CD   . LYS A 1 164 ? 467.114 3.640   -9.374  1.00 0.00 ? 164 LYS A CD   1 
ATOM 2561 C CE   . LYS A 1 164 ? 467.874 2.667   -10.259 1.00 0.00 ? 164 LYS A CE   1 
ATOM 2562 N NZ   . LYS A 1 164 ? 468.990 2.006   -9.527  1.00 0.00 ? 164 LYS A NZ   1 
ATOM 2563 H H    . LYS A 1 164 ? 466.312 7.641   -10.919 1.00 0.00 ? 164 LYS A H    1 
ATOM 2564 H HA   . LYS A 1 164 ? 464.835 5.552   -9.456  1.00 0.00 ? 164 LYS A HA   1 
ATOM 2565 H HB2  . LYS A 1 164 ? 467.377 6.946   -8.603  1.00 0.00 ? 164 LYS A HB2  1 
ATOM 2566 H HB3  . LYS A 1 164 ? 466.586 5.610   -7.779  1.00 0.00 ? 164 LYS A HB3  1 
ATOM 2567 H HG2  . LYS A 1 164 ? 467.551 5.328   -10.598 1.00 0.00 ? 164 LYS A HG2  1 
ATOM 2568 H HG3  . LYS A 1 164 ? 468.644 5.117   -9.228  1.00 0.00 ? 164 LYS A HG3  1 
ATOM 2569 H HD2  . LYS A 1 164 ? 467.244 3.350   -8.342  1.00 0.00 ? 164 LYS A HD2  1 
ATOM 2570 H HD3  . LYS A 1 164 ? 466.065 3.603   -9.631  1.00 0.00 ? 164 LYS A HD3  1 
ATOM 2571 H HE2  . LYS A 1 164 ? 467.189 1.910   -10.612 1.00 0.00 ? 164 LYS A HE2  1 
ATOM 2572 H HE3  . LYS A 1 164 ? 468.278 3.208   -11.103 1.00 0.00 ? 164 LYS A HE3  1 
ATOM 2573 H HZ1  . LYS A 1 164 ? 469.573 1.454   -10.188 1.00 0.00 ? 164 LYS A HZ1  1 
ATOM 2574 H HZ2  . LYS A 1 164 ? 468.612 1.368   -8.799  1.00 0.00 ? 164 LYS A HZ2  1 
ATOM 2575 H HZ3  . LYS A 1 164 ? 469.589 2.722   -9.068  1.00 0.00 ? 164 LYS A HZ3  1 
ATOM 2576 N N    . PRO A 1 165 ? 463.418 7.438   -8.502  1.00 0.00 ? 165 PRO A N    1 
ATOM 2577 C CA   . PRO A 1 165 ? 462.623 8.406   -7.751  1.00 0.00 ? 165 PRO A CA   1 
ATOM 2578 C C    . PRO A 1 165 ? 462.495 8.055   -6.271  1.00 0.00 ? 165 PRO A C    1 
ATOM 2579 O O    . PRO A 1 165 ? 462.079 8.886   -5.465  1.00 0.00 ? 165 PRO A O    1 
ATOM 2580 C CB   . PRO A 1 165 ? 461.264 8.323   -8.438  1.00 0.00 ? 165 PRO A CB   1 
ATOM 2581 C CG   . PRO A 1 165 ? 461.159 6.906   -8.895  1.00 0.00 ? 165 PRO A CG   1 
ATOM 2582 C CD   . PRO A 1 165 ? 462.567 6.426   -9.157  1.00 0.00 ? 165 PRO A CD   1 
ATOM 2583 H HA   . PRO A 1 165 ? 463.018 9.406   -7.851  1.00 0.00 ? 165 PRO A HA   1 
ATOM 2584 H HB2  . PRO A 1 165 ? 460.485 8.571   -7.733  1.00 0.00 ? 165 PRO A HB2  1 
ATOM 2585 H HB3  . PRO A 1 165 ? 461.236 9.008   -9.272  1.00 0.00 ? 165 PRO A HB3  1 
ATOM 2586 H HG2  . PRO A 1 165 ? 460.700 6.307   -8.122  1.00 0.00 ? 165 PRO A HG2  1 
ATOM 2587 H HG3  . PRO A 1 165 ? 460.575 6.858   -9.801  1.00 0.00 ? 165 PRO A HG3  1 
ATOM 2588 H HD2  . PRO A 1 165 ? 462.721 5.454   -8.717  1.00 0.00 ? 165 PRO A HD2  1 
ATOM 2589 H HD3  . PRO A 1 165 ? 462.760 6.393   -10.219 1.00 0.00 ? 165 PRO A HD3  1 
ATOM 2590 N N    . GLU A 1 166 ? 462.843 6.821   -5.913  1.00 0.00 ? 166 GLU A N    1 
ATOM 2591 C CA   . GLU A 1 166 ? 462.751 6.381   -4.524  1.00 0.00 ? 166 GLU A CA   1 
ATOM 2592 C C    . GLU A 1 166 ? 463.935 5.500   -4.141  1.00 0.00 ? 166 GLU A C    1 
ATOM 2593 O O    . GLU A 1 166 ? 464.810 5.218   -4.960  1.00 0.00 ? 166 GLU A O    1 
ATOM 2594 C CB   . GLU A 1 166 ? 461.441 5.624   -4.294  1.00 0.00 ? 166 GLU A CB   1 
ATOM 2595 C CG   . GLU A 1 166 ? 460.201 6.472   -4.530  1.00 0.00 ? 166 GLU A CG   1 
ATOM 2596 C CD   . GLU A 1 166 ? 459.077 5.695   -5.188  1.00 0.00 ? 166 GLU A CD   1 
ATOM 2597 O OE1  . GLU A 1 166 ? 458.585 4.727   -4.572  1.00 0.00 ? 166 GLU A OE1  1 
ATOM 2598 O OE2  . GLU A 1 166 ? 458.691 6.055   -6.319  1.00 0.00 ? 166 GLU A OE2  1 
ATOM 2599 H H    . GLU A 1 166 ? 463.161 6.193   -6.595  1.00 0.00 ? 166 GLU A H    1 
ATOM 2600 H HA   . GLU A 1 166 ? 462.760 7.261   -3.896  1.00 0.00 ? 166 GLU A HA   1 
ATOM 2601 H HB2  . GLU A 1 166 ? 461.404 4.776   -4.961  1.00 0.00 ? 166 GLU A HB2  1 
ATOM 2602 H HB3  . GLU A 1 166 ? 461.418 5.270   -3.274  1.00 0.00 ? 166 GLU A HB3  1 
ATOM 2603 H HG2  . GLU A 1 166 ? 459.852 6.848   -3.582  1.00 0.00 ? 166 GLU A HG2  1 
ATOM 2604 H HG3  . GLU A 1 166 ? 460.464 7.302   -5.168  1.00 0.00 ? 166 GLU A HG3  1 
ATOM 2605 N N    . GLU A 1 167 ? 463.948 5.070   -2.885  1.00 0.00 ? 167 GLU A N    1 
ATOM 2606 C CA   . GLU A 1 167 ? 465.016 4.218   -2.374  1.00 0.00 ? 167 GLU A CA   1 
ATOM 2607 C C    . GLU A 1 167 ? 464.651 2.740   -2.499  1.00 0.00 ? 167 GLU A C    1 
ATOM 2608 O O    . GLU A 1 167 ? 465.506 1.867   -2.359  1.00 0.00 ? 167 GLU A O    1 
ATOM 2609 C CB   . GLU A 1 167 ? 465.308 4.553   -0.911  1.00 0.00 ? 167 GLU A CB   1 
ATOM 2610 C CG   . GLU A 1 167 ? 466.132 5.817   -0.727  1.00 0.00 ? 167 GLU A CG   1 
ATOM 2611 C CD   . GLU A 1 167 ? 467.612 5.586   -0.961  1.00 0.00 ? 167 GLU A CD   1 
ATOM 2612 O OE1  . GLU A 1 167 ? 467.968 5.071   -2.042  1.00 0.00 ? 167 GLU A OE1  1 
ATOM 2613 O OE2  . GLU A 1 167 ? 468.415 5.918   -0.064  1.00 0.00 ? 167 GLU A OE2  1 
ATOM 2614 H H    . GLU A 1 167 ? 463.214 5.335   -2.292  1.00 0.00 ? 167 GLU A H    1 
ATOM 2615 H HA   . GLU A 1 167 ? 465.900 4.411   -2.961  1.00 0.00 ? 167 GLU A HA   1 
ATOM 2616 H HB2  . GLU A 1 167 ? 464.372 4.680   -0.390  1.00 0.00 ? 167 GLU A HB2  1 
ATOM 2617 H HB3  . GLU A 1 167 ? 465.848 3.729   -0.469  1.00 0.00 ? 167 GLU A HB3  1 
ATOM 2618 H HG2  . GLU A 1 167 ? 465.785 6.563   -1.425  1.00 0.00 ? 167 GLU A HG2  1 
ATOM 2619 H HG3  . GLU A 1 167 ? 465.994 6.177   0.283   1.00 0.00 ? 167 GLU A HG3  1 
ATOM 2620 N N    . GLN A 1 168 ? 463.377 2.468   -2.763  1.00 0.00 ? 168 GLN A N    1 
ATOM 2621 C CA   . GLN A 1 168 ? 462.894 1.110   -2.908  1.00 0.00 ? 168 GLN A CA   1 
ATOM 2622 C C    . GLN A 1 168 ? 462.086 0.941   -4.195  1.00 0.00 ? 168 GLN A C    1 
ATOM 2623 O O    . GLN A 1 168 ? 461.464 -0.099  -4.410  1.00 0.00 ? 168 GLN A O    1 
ATOM 2624 C CB   . GLN A 1 168 ? 462.029 0.743   -1.706  1.00 0.00 ? 168 GLN A CB   1 
ATOM 2625 C CG   . GLN A 1 168 ? 461.446 1.940   -0.968  1.00 0.00 ? 168 GLN A CG   1 
ATOM 2626 C CD   . GLN A 1 168 ? 462.383 2.483   0.093   1.00 0.00 ? 168 GLN A CD   1 
ATOM 2627 O OE1  . GLN A 1 168 ? 463.152 1.738   0.699   1.00 0.00 ? 168 GLN A OE1  1 
ATOM 2628 N NE2  . GLN A 1 168 ? 462.321 3.789   0.323   1.00 0.00 ? 168 GLN A NE2  1 
ATOM 2629 H H    . GLN A 1 168 ? 462.745 3.199   -2.872  1.00 0.00 ? 168 GLN A H    1 
ATOM 2630 H HA   . GLN A 1 168 ? 463.749 0.452   -2.941  1.00 0.00 ? 168 GLN A HA   1 
ATOM 2631 H HB2  . GLN A 1 168 ? 461.214 0.132   -2.046  1.00 0.00 ? 168 GLN A HB2  1 
ATOM 2632 H HB3  . GLN A 1 168 ? 462.629 0.181   -1.013  1.00 0.00 ? 168 GLN A HB3  1 
ATOM 2633 H HG2  . GLN A 1 168 ? 461.243 2.724   -1.681  1.00 0.00 ? 168 GLN A HG2  1 
ATOM 2634 H HG3  . GLN A 1 168 ? 460.524 1.639   -0.493  1.00 0.00 ? 168 GLN A HG3  1 
ATOM 2635 H HE21 . GLN A 1 168 ? 461.683 4.321   -0.198  1.00 0.00 ? 168 GLN A HE21 1 
ATOM 2636 H HE22 . GLN A 1 168 ? 462.915 4.168   1.003   1.00 0.00 ? 168 GLN A HE22 1 
ATOM 2637 N N    . TRP A 1 169 ? 462.082 1.969   -5.040  1.00 0.00 ? 169 TRP A N    1 
ATOM 2638 C CA   . TRP A 1 169 ? 461.327 1.913   -6.287  1.00 0.00 ? 169 TRP A CA   1 
ATOM 2639 C C    . TRP A 1 169 ? 461.987 2.717   -7.401  1.00 0.00 ? 169 TRP A C    1 
ATOM 2640 O O    . TRP A 1 169 ? 462.215 3.919   -7.266  1.00 0.00 ? 169 TRP A O    1 
ATOM 2641 C CB   . TRP A 1 169 ? 459.903 2.421   -6.065  1.00 0.00 ? 169 TRP A CB   1 
ATOM 2642 C CG   . TRP A 1 169 ? 459.157 1.652   -5.020  1.00 0.00 ? 169 TRP A CG   1 
ATOM 2643 C CD1  . TRP A 1 169 ? 459.323 1.738   -3.669  1.00 0.00 ? 169 TRP A CD1  1 
ATOM 2644 C CD2  . TRP A 1 169 ? 458.128 0.680   -5.238  1.00 0.00 ? 169 TRP A CD2  1 
ATOM 2645 N NE1  . TRP A 1 169 ? 458.468 0.874   -3.033  1.00 0.00 ? 169 TRP A NE1  1 
ATOM 2646 C CE2  . TRP A 1 169 ? 457.720 0.215   -3.974  1.00 0.00 ? 169 TRP A CE2  1 
ATOM 2647 C CE3  . TRP A 1 169 ? 457.512 0.157   -6.379  1.00 0.00 ? 169 TRP A CE3  1 
ATOM 2648 C CZ2  . TRP A 1 169 ? 456.725 -0.747  -3.819  1.00 0.00 ? 169 TRP A CZ2  1 
ATOM 2649 C CZ3  . TRP A 1 169 ? 456.524 -0.797  -6.224  1.00 0.00 ? 169 TRP A CZ3  1 
ATOM 2650 C CH2  . TRP A 1 169 ? 456.138 -1.240  -4.952  1.00 0.00 ? 169 TRP A CH2  1 
ATOM 2651 H H    . TRP A 1 169 ? 462.592 2.773   -4.811  1.00 0.00 ? 169 TRP A H    1 
ATOM 2652 H HA   . TRP A 1 169 ? 461.280 0.880   -6.592  1.00 0.00 ? 169 TRP A HA   1 
ATOM 2653 H HB2  . TRP A 1 169 ? 459.943 3.453   -5.754  1.00 0.00 ? 169 TRP A HB2  1 
ATOM 2654 H HB3  . TRP A 1 169 ? 459.354 2.350   -6.991  1.00 0.00 ? 169 TRP A HB3  1 
ATOM 2655 H HD1  . TRP A 1 169 ? 460.034 2.390   -3.185  1.00 0.00 ? 169 TRP A HD1  1 
ATOM 2656 H HE1  . TRP A 1 169 ? 458.403 0.752   -2.064  1.00 0.00 ? 169 TRP A HE1  1 
ATOM 2657 H HE3  . TRP A 1 169 ? 457.795 0.487   -7.367  1.00 0.00 ? 169 TRP A HE3  1 
ATOM 2658 H HZ2  . TRP A 1 169 ? 456.416 -1.098  -2.845  1.00 0.00 ? 169 TRP A HZ2  1 
ATOM 2659 H HZ3  . TRP A 1 169 ? 456.037 -1.212  -7.094  1.00 0.00 ? 169 TRP A HZ3  1 
ATOM 2660 H HH2  . TRP A 1 169 ? 455.363 -1.988  -4.879  1.00 0.00 ? 169 TRP A HH2  1 
ATOM 2661 N N    . TRP A 1 170 ? 462.274 2.040   -8.507  1.00 0.00 ? 170 TRP A N    1 
ATOM 2662 C CA   . TRP A 1 170 ? 462.889 2.677   -9.666  1.00 0.00 ? 170 TRP A CA   1 
ATOM 2663 C C    . TRP A 1 170 ? 461.865 2.825   -10.787 1.00 0.00 ? 170 TRP A C    1 
ATOM 2664 O O    . TRP A 1 170 ? 460.868 2.105   -10.820 1.00 0.00 ? 170 TRP A O    1 
ATOM 2665 C CB   . TRP A 1 170 ? 464.089 1.858   -10.147 1.00 0.00 ? 170 TRP A CB   1 
ATOM 2666 C CG   . TRP A 1 170 ? 464.991 1.417   -9.034  1.00 0.00 ? 170 TRP A CG   1 
ATOM 2667 C CD1  . TRP A 1 170 ? 465.052 1.935   -7.771  1.00 0.00 ? 170 TRP A CD1  1 
ATOM 2668 C CD2  . TRP A 1 170 ? 465.965 0.368   -9.083  1.00 0.00 ? 170 TRP A CD2  1 
ATOM 2669 N NE1  . TRP A 1 170 ? 465.999 1.270   -7.032  1.00 0.00 ? 170 TRP A NE1  1 
ATOM 2670 C CE2  . TRP A 1 170 ? 466.575 0.305   -7.816  1.00 0.00 ? 170 TRP A CE2  1 
ATOM 2671 C CE3  . TRP A 1 170 ? 466.380 -0.525  -10.075 1.00 0.00 ? 170 TRP A CE3  1 
ATOM 2672 C CZ2  . TRP A 1 170 ? 467.576 -0.614  -7.516  1.00 0.00 ? 170 TRP A CZ2  1 
ATOM 2673 C CZ3  . TRP A 1 170 ? 467.374 -1.437  -9.776  1.00 0.00 ? 170 TRP A CZ3  1 
ATOM 2674 C CH2  . TRP A 1 170 ? 467.963 -1.475  -8.505  1.00 0.00 ? 170 TRP A CH2  1 
ATOM 2675 H H    . TRP A 1 170 ? 462.058 1.085   -8.544  1.00 0.00 ? 170 TRP A H    1 
ATOM 2676 H HA   . TRP A 1 170 ? 463.226 3.658   -9.367  1.00 0.00 ? 170 TRP A HA   1 
ATOM 2677 H HB2  . TRP A 1 170 ? 463.732 0.975   -10.657 1.00 0.00 ? 170 TRP A HB2  1 
ATOM 2678 H HB3  . TRP A 1 170 ? 464.671 2.455   -10.834 1.00 0.00 ? 170 TRP A HB3  1 
ATOM 2679 H HD1  . TRP A 1 170 ? 464.437 2.748   -7.418  1.00 0.00 ? 170 TRP A HD1  1 
ATOM 2680 H HE1  . TRP A 1 170 ? 466.226 1.456   -6.096  1.00 0.00 ? 170 TRP A HE1  1 
ATOM 2681 H HE3  . TRP A 1 170 ? 465.937 -0.511  -11.060 1.00 0.00 ? 170 TRP A HE3  1 
ATOM 2682 H HZ2  . TRP A 1 170 ? 468.040 -0.655  -6.542  1.00 0.00 ? 170 TRP A HZ2  1 
ATOM 2683 H HZ3  . TRP A 1 170 ? 467.708 -2.134  -10.530 1.00 0.00 ? 170 TRP A HZ3  1 
ATOM 2684 H HH2  . TRP A 1 170 ? 468.737 -2.204  -8.316  1.00 0.00 ? 170 TRP A HH2  1 
ATOM 2685 N N    . ASN A 1 171 ? 462.097 3.771   -11.693 1.00 0.00 ? 171 ASN A N    1 
ATOM 2686 C CA   . ASN A 1 171 ? 461.166 4.011   -12.792 1.00 0.00 ? 171 ASN A CA   1 
ATOM 2687 C C    . ASN A 1 171 ? 461.498 3.147   -14.004 1.00 0.00 ? 171 ASN A C    1 
ATOM 2688 O O    . ASN A 1 171 ? 462.632 3.139   -14.484 1.00 0.00 ? 171 ASN A O    1 
ATOM 2689 C CB   . ASN A 1 171 ? 461.190 5.488   -13.188 1.00 0.00 ? 171 ASN A CB   1 
ATOM 2690 C CG   . ASN A 1 171 ? 460.194 6.313   -12.398 1.00 0.00 ? 171 ASN A CG   1 
ATOM 2691 O OD1  . ASN A 1 171 ? 459.088 5.859   -12.105 1.00 0.00 ? 171 ASN A OD1  1 
ATOM 2692 N ND2  . ASN A 1 171 ? 460.582 7.534   -12.049 1.00 0.00 ? 171 ASN A ND2  1 
ATOM 2693 H H    . ASN A 1 171 ? 462.893 4.336   -11.610 1.00 0.00 ? 171 ASN A H    1 
ATOM 2694 H HA   . ASN A 1 171 ? 460.177 3.759   -12.448 1.00 0.00 ? 171 ASN A HA   1 
ATOM 2695 H HB2  . ASN A 1 171 ? 462.178 5.886   -13.012 1.00 0.00 ? 171 ASN A HB2  1 
ATOM 2696 H HB3  . ASN A 1 171 ? 460.952 5.577   -14.238 1.00 0.00 ? 171 ASN A HB3  1 
ATOM 2697 H HD21 . ASN A 1 171 ? 461.477 7.829   -12.316 1.00 0.00 ? 171 ASN A HD21 1 
ATOM 2698 H HD22 . ASN A 1 171 ? 459.957 8.089   -11.537 1.00 0.00 ? 171 ASN A HD22 1 
ATOM 2699 N N    . ALA A 1 172 ? 460.496 2.419   -14.493 1.00 0.00 ? 172 ALA A N    1 
ATOM 2700 C CA   . ALA A 1 172 ? 460.677 1.550   -15.650 1.00 0.00 ? 172 ALA A CA   1 
ATOM 2701 C C    . ALA A 1 172 ? 459.398 1.448   -16.477 1.00 0.00 ? 172 ALA A C    1 
ATOM 2702 O O    . ALA A 1 172 ? 458.301 1.697   -15.977 1.00 0.00 ? 172 ALA A O    1 
ATOM 2703 C CB   . ALA A 1 172 ? 461.131 0.168   -15.204 1.00 0.00 ? 172 ALA A CB   1 
ATOM 2704 H H    . ALA A 1 172 ? 459.613 2.469   -14.067 1.00 0.00 ? 172 ALA A H    1 
ATOM 2705 H HA   . ALA A 1 172 ? 461.456 1.976   -16.264 1.00 0.00 ? 172 ALA A HA   1 
ATOM 2706 H HB1  . ALA A 1 172 ? 460.276 -0.402  -14.872 1.00 0.00 ? 172 ALA A HB1  1 
ATOM 2707 H HB2  . ALA A 1 172 ? 461.836 0.265   -14.392 1.00 0.00 ? 172 ALA A HB2  1 
ATOM 2708 H HB3  . ALA A 1 172 ? 461.603 -0.341  -16.032 1.00 0.00 ? 172 ALA A HB3  1 
ATOM 2709 N N    . GLU A 1 173 ? 459.550 1.079   -17.746 1.00 0.00 ? 173 GLU A N    1 
ATOM 2710 C CA   . GLU A 1 173 ? 458.412 0.940   -18.650 1.00 0.00 ? 173 GLU A CA   1 
ATOM 2711 C C    . GLU A 1 173 ? 457.983 -0.518  -18.763 1.00 0.00 ? 173 GLU A C    1 
ATOM 2712 O O    . GLU A 1 173 ? 458.798 -1.429  -18.617 1.00 0.00 ? 173 GLU A O    1 
ATOM 2713 C CB   . GLU A 1 173 ? 458.767 1.481   -20.037 1.00 0.00 ? 173 GLU A CB   1 
ATOM 2714 C CG   . GLU A 1 173 ? 457.556 1.729   -20.923 1.00 0.00 ? 173 GLU A CG   1 
ATOM 2715 C CD   . GLU A 1 173 ? 457.901 1.709   -22.399 1.00 0.00 ? 173 GLU A CD   1 
ATOM 2716 O OE1  . GLU A 1 173 ? 458.524 2.680   -22.877 1.00 0.00 ? 173 GLU A OE1  1 
ATOM 2717 O OE2  . GLU A 1 173 ? 457.548 0.721   -23.077 1.00 0.00 ? 173 GLU A OE2  1 
ATOM 2718 H H    . GLU A 1 173 ? 460.450 0.894   -18.084 1.00 0.00 ? 173 GLU A H    1 
ATOM 2719 H HA   . GLU A 1 173 ? 457.592 1.516   -18.247 1.00 0.00 ? 173 GLU A HA   1 
ATOM 2720 H HB2  . GLU A 1 173 ? 459.300 2.412   -19.922 1.00 0.00 ? 173 GLU A HB2  1 
ATOM 2721 H HB3  . GLU A 1 173 ? 459.409 0.768   -20.533 1.00 0.00 ? 173 GLU A HB3  1 
ATOM 2722 H HG2  . GLU A 1 173 ? 456.822 0.962   -20.730 1.00 0.00 ? 173 GLU A HG2  1 
ATOM 2723 H HG3  . GLU A 1 173 ? 457.139 2.695   -20.678 1.00 0.00 ? 173 GLU A HG3  1 
ATOM 2724 N N    . ASP A 1 174 ? 456.699 -0.733  -19.028 1.00 0.00 ? 174 ASP A N    1 
ATOM 2725 C CA   . ASP A 1 174 ? 456.163 -2.081  -19.164 1.00 0.00 ? 174 ASP A CA   1 
ATOM 2726 C C    . ASP A 1 174 ? 456.111 -2.497  -20.631 1.00 0.00 ? 174 ASP A C    1 
ATOM 2727 O O    . ASP A 1 174 ? 456.322 -1.678  -21.526 1.00 0.00 ? 174 ASP A O    1 
ATOM 2728 C CB   . ASP A 1 174 ? 454.766 -2.158  -18.546 1.00 0.00 ? 174 ASP A CB   1 
ATOM 2729 C CG   . ASP A 1 174 ? 454.351 -3.578  -18.218 1.00 0.00 ? 174 ASP A CG   1 
ATOM 2730 O OD1  . ASP A 1 174 ? 454.937 -4.169  -17.286 1.00 0.00 ? 174 ASP A OD1  1 
ATOM 2731 O OD2  . ASP A 1 174 ? 453.438 -4.101  -18.892 1.00 0.00 ? 174 ASP A OD2  1 
ATOM 2732 H H    . ASP A 1 174 ? 456.097 0.035   -19.136 1.00 0.00 ? 174 ASP A H    1 
ATOM 2733 H HA   . ASP A 1 174 ? 456.820 -2.755  -18.634 1.00 0.00 ? 174 ASP A HA   1 
ATOM 2734 H HB2  . ASP A 1 174 ? 454.754 -1.581  -17.634 1.00 0.00 ? 174 ASP A HB2  1 
ATOM 2735 H HB3  . ASP A 1 174 ? 454.049 -1.742  -19.238 1.00 0.00 ? 174 ASP A HB3  1 
ATOM 2736 N N    . SER A 1 175 ? 455.834 -3.775  -20.871 1.00 0.00 ? 175 SER A N    1 
ATOM 2737 C CA   . SER A 1 175 ? 455.760 -4.304  -22.230 1.00 0.00 ? 175 SER A CA   1 
ATOM 2738 C C    . SER A 1 175 ? 454.532 -3.784  -22.982 1.00 0.00 ? 175 SER A C    1 
ATOM 2739 O O    . SER A 1 175 ? 454.286 -4.182  -24.121 1.00 0.00 ? 175 SER A O    1 
ATOM 2740 C CB   . SER A 1 175 ? 455.737 -5.833  -22.198 1.00 0.00 ? 175 SER A CB   1 
ATOM 2741 O OG   . SER A 1 175 ? 456.304 -6.377  -23.378 1.00 0.00 ? 175 SER A OG   1 
ATOM 2742 H H    . SER A 1 175 ? 455.684 -4.381  -20.116 1.00 0.00 ? 175 SER A H    1 
ATOM 2743 H HA   . SER A 1 175 ? 456.647 -3.982  -22.755 1.00 0.00 ? 175 SER A HA   1 
ATOM 2744 H HB2  . SER A 1 175 ? 456.305 -6.182  -21.349 1.00 0.00 ? 175 SER A HB2  1 
ATOM 2745 H HB3  . SER A 1 175 ? 454.716 -6.174  -22.114 1.00 0.00 ? 175 SER A HB3  1 
ATOM 2746 H HG   . SER A 1 175 ? 456.828 -7.149  -23.156 1.00 0.00 ? 175 SER A HG   1 
ATOM 2747 N N    . GLU A 1 176 ? 453.767 -2.892  -22.355 1.00 0.00 ? 176 GLU A N    1 
ATOM 2748 C CA   . GLU A 1 176 ? 452.580 -2.328  -22.986 1.00 0.00 ? 176 GLU A CA   1 
ATOM 2749 C C    . GLU A 1 176 ? 452.805 -0.867  -23.378 1.00 0.00 ? 176 GLU A C    1 
ATOM 2750 O O    . GLU A 1 176 ? 452.005 -0.284  -24.111 1.00 0.00 ? 176 GLU A O    1 
ATOM 2751 C CB   . GLU A 1 176 ? 451.377 -2.440  -22.045 1.00 0.00 ? 176 GLU A CB   1 
ATOM 2752 C CG   . GLU A 1 176 ? 450.353 -3.471  -22.488 1.00 0.00 ? 176 GLU A CG   1 
ATOM 2753 C CD   . GLU A 1 176 ? 449.344 -2.907  -23.470 1.00 0.00 ? 176 GLU A CD   1 
ATOM 2754 O OE1  . GLU A 1 176 ? 448.365 -2.276  -23.018 1.00 0.00 ? 176 GLU A OE1  1 
ATOM 2755 O OE2  . GLU A 1 176 ? 449.533 -3.096  -24.690 1.00 0.00 ? 176 GLU A OE2  1 
ATOM 2756 H H    . GLU A 1 176 ? 454.004 -2.598  -21.454 1.00 0.00 ? 176 GLU A H    1 
ATOM 2757 H HA   . GLU A 1 176 ? 452.378 -2.900  -23.880 1.00 0.00 ? 176 GLU A HA   1 
ATOM 2758 H HB2  . GLU A 1 176 ? 451.730 -2.715  -21.062 1.00 0.00 ? 176 GLU A HB2  1 
ATOM 2759 H HB3  . GLU A 1 176 ? 450.887 -1.480  -21.986 1.00 0.00 ? 176 GLU A HB3  1 
ATOM 2760 H HG2  . GLU A 1 176 ? 450.869 -4.294  -22.960 1.00 0.00 ? 176 GLU A HG2  1 
ATOM 2761 H HG3  . GLU A 1 176 ? 449.824 -3.832  -21.618 1.00 0.00 ? 176 GLU A HG3  1 
ATOM 2762 N N    . GLY A 1 177 ? 453.896 -0.278  -22.890 1.00 0.00 ? 177 GLY A N    1 
ATOM 2763 C CA   . GLY A 1 177 ? 454.198 1.107   -23.206 1.00 0.00 ? 177 GLY A CA   1 
ATOM 2764 C C    . GLY A 1 177 ? 454.064 2.024   -22.004 1.00 0.00 ? 177 GLY A C    1 
ATOM 2765 O O    . GLY A 1 177 ? 454.669 3.095   -21.961 1.00 0.00 ? 177 GLY A O    1 
ATOM 2766 H H    . GLY A 1 177 ? 454.502 -0.787  -22.312 1.00 0.00 ? 177 GLY A H    1 
ATOM 2767 H HA2  . GLY A 1 177 ? 455.209 1.167   -23.579 1.00 0.00 ? 177 GLY A HA2  1 
ATOM 2768 H HA3  . GLY A 1 177 ? 453.521 1.443   -23.978 1.00 0.00 ? 177 GLY A HA3  1 
ATOM 2769 N N    . LYS A 1 178 ? 453.248 1.614   -21.039 1.00 0.00 ? 178 LYS A N    1 
ATOM 2770 C CA   . LYS A 1 178 ? 453.011 2.418   -19.845 1.00 0.00 ? 178 LYS A CA   1 
ATOM 2771 C C    . LYS A 1 178 ? 454.292 2.616   -19.041 1.00 0.00 ? 178 LYS A C    1 
ATOM 2772 O O    . LYS A 1 178 ? 455.147 1.733   -18.978 1.00 0.00 ? 178 LYS A O    1 
ATOM 2773 C CB   . LYS A 1 178 ? 451.948 1.758   -18.964 1.00 0.00 ? 178 LYS A CB   1 
ATOM 2774 C CG   . LYS A 1 178 ? 450.646 1.466   -19.691 1.00 0.00 ? 178 LYS A CG   1 
ATOM 2775 C CD   . LYS A 1 178 ? 449.724 0.596   -18.852 1.00 0.00 ? 178 LYS A CD   1 
ATOM 2776 C CE   . LYS A 1 178 ? 449.910 -0.880  -19.165 1.00 0.00 ? 178 LYS A CE   1 
ATOM 2777 N NZ   . LYS A 1 178 ? 450.679 -1.582  -18.100 1.00 0.00 ? 178 LYS A NZ   1 
ATOM 2778 H H    . LYS A 1 178 ? 452.768 0.768   -21.152 1.00 0.00 ? 178 LYS A H    1 
ATOM 2779 H HA   . LYS A 1 178 ? 452.650 3.383   -20.163 1.00 0.00 ? 178 LYS A HA   1 
ATOM 2780 H HB2  . LYS A 1 178 ? 452.340 0.826   -18.586 1.00 0.00 ? 178 LYS A HB2  1 
ATOM 2781 H HB3  . LYS A 1 178 ? 451.732 2.411   -18.131 1.00 0.00 ? 178 LYS A HB3  1 
ATOM 2782 H HG2  . LYS A 1 178 ? 450.147 2.399   -19.906 1.00 0.00 ? 178 LYS A HG2  1 
ATOM 2783 H HG3  . LYS A 1 178 ? 450.868 0.953   -20.616 1.00 0.00 ? 178 LYS A HG3  1 
ATOM 2784 H HD2  . LYS A 1 178 ? 449.942 0.761   -17.807 1.00 0.00 ? 178 LYS A HD2  1 
ATOM 2785 H HD3  . LYS A 1 178 ? 448.700 0.872   -19.056 1.00 0.00 ? 178 LYS A HD3  1 
ATOM 2786 H HE2  . LYS A 1 178 ? 448.938 -1.341  -19.257 1.00 0.00 ? 178 LYS A HE2  1 
ATOM 2787 H HE3  . LYS A 1 178 ? 450.441 -0.973  -20.101 1.00 0.00 ? 178 LYS A HE3  1 
ATOM 2788 H HZ1  . LYS A 1 178 ? 450.223 -1.437  -17.176 1.00 0.00 ? 178 LYS A HZ1  1 
ATOM 2789 H HZ2  . LYS A 1 178 ? 451.650 -1.213  -18.057 1.00 0.00 ? 178 LYS A HZ2  1 
ATOM 2790 H HZ3  . LYS A 1 178 ? 450.717 -2.602  -18.299 1.00 0.00 ? 178 LYS A HZ3  1 
ATOM 2791 N N    . ARG A 1 179 ? 454.410 3.793   -18.429 1.00 0.00 ? 179 ARG A N    1 
ATOM 2792 C CA   . ARG A 1 179 ? 455.576 4.136   -17.625 1.00 0.00 ? 179 ARG A CA   1 
ATOM 2793 C C    . ARG A 1 179 ? 455.205 4.272   -16.156 1.00 0.00 ? 179 ARG A C    1 
ATOM 2794 O O    . ARG A 1 179 ? 454.056 4.550   -15.814 1.00 0.00 ? 179 ARG A O    1 
ATOM 2795 C CB   . ARG A 1 179 ? 456.199 5.441   -18.118 1.00 0.00 ? 179 ARG A CB   1 
ATOM 2796 C CG   . ARG A 1 179 ? 456.728 5.359   -19.537 1.00 0.00 ? 179 ARG A CG   1 
ATOM 2797 C CD   . ARG A 1 179 ? 458.104 4.720   -19.579 1.00 0.00 ? 179 ARG A CD   1 
ATOM 2798 N NE   . ARG A 1 179 ? 458.662 4.711   -20.929 1.00 0.00 ? 179 ARG A NE   1 
ATOM 2799 C CZ   . ARG A 1 179 ? 459.939 4.451   -21.203 1.00 0.00 ? 179 ARG A CZ   1 
ATOM 2800 N NH1  . ARG A 1 179 ? 460.791 4.171   -20.226 1.00 0.00 ? 179 ARG A NH1  1 
ATOM 2801 N NH2  . ARG A 1 179 ? 460.364 4.469   -22.459 1.00 0.00 ? 179 ARG A NH2  1 
ATOM 2802 H H    . ARG A 1 179 ? 453.692 4.450   -18.523 1.00 0.00 ? 179 ARG A H    1 
ATOM 2803 H HA   . ARG A 1 179 ? 456.299 3.340   -17.729 1.00 0.00 ? 179 ARG A HA   1 
ATOM 2804 H HB2  . ARG A 1 179 ? 455.452 6.220   -18.079 1.00 0.00 ? 179 ARG A HB2  1 
ATOM 2805 H HB3  . ARG A 1 179 ? 457.018 5.705   -17.466 1.00 0.00 ? 179 ARG A HB3  1 
ATOM 2806 H HG2  . ARG A 1 179 ? 456.049 4.766   -20.128 1.00 0.00 ? 179 ARG A HG2  1 
ATOM 2807 H HG3  . ARG A 1 179 ? 456.790 6.356   -19.945 1.00 0.00 ? 179 ARG A HG3  1 
ATOM 2808 H HD2  . ARG A 1 179 ? 458.764 5.275   -18.929 1.00 0.00 ? 179 ARG A HD2  1 
ATOM 2809 H HD3  . ARG A 1 179 ? 458.022 3.704   -19.225 1.00 0.00 ? 179 ARG A HD3  1 
ATOM 2810 H HE   . ARG A 1 179 ? 458.055 4.913   -21.671 1.00 0.00 ? 179 ARG A HE   1 
ATOM 2811 H HH11 . ARG A 1 179 ? 460.478 4.155   -19.276 1.00 0.00 ? 179 ARG A HH11 1 
ATOM 2812 H HH12 . ARG A 1 179 ? 461.748 3.974   -20.439 1.00 0.00 ? 179 ARG A HH12 1 
ATOM 2813 H HH21 . ARG A 1 179 ? 459.727 4.678   -23.200 1.00 0.00 ? 179 ARG A HH21 1 
ATOM 2814 H HH22 . ARG A 1 179 ? 461.323 4.273   -22.665 1.00 0.00 ? 179 ARG A HH22 1 
ATOM 2815 N N    . GLY A 1 180 ? 456.192 4.079   -15.294 1.00 0.00 ? 180 GLY A N    1 
ATOM 2816 C CA   . GLY A 1 180 ? 455.966 4.185   -13.865 1.00 0.00 ? 180 GLY A CA   1 
ATOM 2817 C C    . GLY A 1 180 ? 457.148 3.685   -13.061 1.00 0.00 ? 180 GLY A C    1 
ATOM 2818 O O    . GLY A 1 180 ? 458.276 3.676   -13.552 1.00 0.00 ? 180 GLY A O    1 
ATOM 2819 H H    . GLY A 1 180 ? 457.086 3.865   -15.634 1.00 0.00 ? 180 GLY A H    1 
ATOM 2820 H HA2  . GLY A 1 180 ? 455.789 5.222   -13.617 1.00 0.00 ? 180 GLY A HA2  1 
ATOM 2821 H HA3  . GLY A 1 180 ? 455.092 3.610   -13.602 1.00 0.00 ? 180 GLY A HA3  1 
ATOM 2822 N N    . MET A 1 181 ? 456.898 3.279   -11.819 1.00 0.00 ? 181 MET A N    1 
ATOM 2823 C CA   . MET A 1 181 ? 457.966 2.793   -10.953 1.00 0.00 ? 181 MET A CA   1 
ATOM 2824 C C    . MET A 1 181 ? 457.718 1.363   -10.476 1.00 0.00 ? 181 MET A C    1 
ATOM 2825 O O    . MET A 1 181 ? 456.587 0.973   -10.183 1.00 0.00 ? 181 MET A O    1 
ATOM 2826 C CB   . MET A 1 181 ? 458.138 3.726   -9.752  1.00 0.00 ? 181 MET A CB   1 
ATOM 2827 C CG   . MET A 1 181 ? 457.014 3.628   -8.732  1.00 0.00 ? 181 MET A CG   1 
ATOM 2828 S SD   . MET A 1 181 ? 456.518 5.238   -8.089  1.00 0.00 ? 181 MET A SD   1 
ATOM 2829 C CE   . MET A 1 181 ? 455.297 4.758   -6.871  1.00 0.00 ? 181 MET A CE   1 
ATOM 2830 H H    . MET A 1 181 ? 455.983 3.318   -11.478 1.00 0.00 ? 181 MET A H    1 
ATOM 2831 H HA   . MET A 1 181 ? 458.878 2.803   -11.527 1.00 0.00 ? 181 MET A HA   1 
ATOM 2832 H HB2  . MET A 1 181 ? 459.066 3.486   -9.255  1.00 0.00 ? 181 MET A HB2  1 
ATOM 2833 H HB3  . MET A 1 181 ? 458.184 4.744   -10.108 1.00 0.00 ? 181 MET A HB3  1 
ATOM 2834 H HG2  . MET A 1 181 ? 456.159 3.165   -9.201  1.00 0.00 ? 181 MET A HG2  1 
ATOM 2835 H HG3  . MET A 1 181 ? 457.349 3.013   -7.909  1.00 0.00 ? 181 MET A HG3  1 
ATOM 2836 H HE1  . MET A 1 181 ? 454.327 5.128   -7.170  1.00 0.00 ? 181 MET A HE1  1 
ATOM 2837 H HE2  . MET A 1 181 ? 455.561 5.177   -5.911  1.00 0.00 ? 181 MET A HE2  1 
ATOM 2838 H HE3  . MET A 1 181 ? 455.265 3.681   -6.798  1.00 0.00 ? 181 MET A HE3  1 
ATOM 2839 N N    . ILE A 1 182 ? 458.802 0.600   -10.389 1.00 0.00 ? 182 ILE A N    1 
ATOM 2840 C CA   . ILE A 1 182 ? 458.751 -0.784  -9.935  1.00 0.00 ? 182 ILE A CA   1 
ATOM 2841 C C    . ILE A 1 182 ? 459.489 -0.931  -8.605  1.00 0.00 ? 182 ILE A C    1 
ATOM 2842 O O    . ILE A 1 182 ? 460.341 -0.109  -8.272  1.00 0.00 ? 182 ILE A O    1 
ATOM 2843 C CB   . ILE A 1 182 ? 459.374 -1.741  -10.969 1.00 0.00 ? 182 ILE A CB   1 
ATOM 2844 C CG1  . ILE A 1 182 ? 460.754 -1.237  -11.396 1.00 0.00 ? 182 ILE A CG1  1 
ATOM 2845 C CG2  . ILE A 1 182 ? 458.460 -1.884  -12.177 1.00 0.00 ? 182 ILE A CG2  1 
ATOM 2846 C CD1  . ILE A 1 182 ? 461.571 -2.271  -12.140 1.00 0.00 ? 182 ILE A CD1  1 
ATOM 2847 H H    . ILE A 1 182 ? 459.663 0.990   -10.631 1.00 0.00 ? 182 ILE A H    1 
ATOM 2848 H HA   . ILE A 1 182 ? 457.714 -1.056  -9.795  1.00 0.00 ? 182 ILE A HA   1 
ATOM 2849 H HB   . ILE A 1 182 ? 459.479 -2.713  -10.511 1.00 0.00 ? 182 ILE A HB   1 
ATOM 2850 H HG12 . ILE A 1 182 ? 460.633 -0.382  -12.043 1.00 0.00 ? 182 ILE A HG12 1 
ATOM 2851 H HG13 . ILE A 1 182 ? 461.309 -0.943  -10.517 1.00 0.00 ? 182 ILE A HG13 1 
ATOM 2852 H HG21 . ILE A 1 182 ? 457.782 -2.710  -12.020 1.00 0.00 ? 182 ILE A HG21 1 
ATOM 2853 H HG22 . ILE A 1 182 ? 459.056 -2.070  -13.058 1.00 0.00 ? 182 ILE A HG22 1 
ATOM 2854 H HG23 . ILE A 1 182 ? 457.895 -0.974  -12.309 1.00 0.00 ? 182 ILE A HG23 1 
ATOM 2855 H HD11 . ILE A 1 182 ? 461.695 -1.960  -13.167 1.00 0.00 ? 182 ILE A HD11 1 
ATOM 2856 H HD12 . ILE A 1 182 ? 461.061 -3.222  -12.111 1.00 0.00 ? 182 ILE A HD12 1 
ATOM 2857 H HD13 . ILE A 1 182 ? 462.540 -2.367  -11.673 1.00 0.00 ? 182 ILE A HD13 1 
ATOM 2858 N N    . PRO A 1 183 ? 459.164 -1.971  -7.818  1.00 0.00 ? 183 PRO A N    1 
ATOM 2859 C CA   . PRO A 1 183 ? 459.795 -2.200  -6.514  1.00 0.00 ? 183 PRO A CA   1 
ATOM 2860 C C    . PRO A 1 183 ? 461.214 -2.754  -6.612  1.00 0.00 ? 183 PRO A C    1 
ATOM 2861 O O    . PRO A 1 183 ? 461.565 -3.443  -7.569  1.00 0.00 ? 183 PRO A O    1 
ATOM 2862 C CB   . PRO A 1 183 ? 458.873 -3.223  -5.858  1.00 0.00 ? 183 PRO A CB   1 
ATOM 2863 C CG   . PRO A 1 183 ? 458.289 -3.981  -6.998  1.00 0.00 ? 183 PRO A CG   1 
ATOM 2864 C CD   . PRO A 1 183 ? 458.147 -2.993  -8.126  1.00 0.00 ? 183 PRO A CD   1 
ATOM 2865 H HA   . PRO A 1 183 ? 459.806 -1.298  -5.921  1.00 0.00 ? 183 PRO A HA   1 
ATOM 2866 H HB2  . PRO A 1 183 ? 459.447 -3.864  -5.206  1.00 0.00 ? 183 PRO A HB2  1 
ATOM 2867 H HB3  . PRO A 1 183 ? 458.109 -2.713  -5.291  1.00 0.00 ? 183 PRO A HB3  1 
ATOM 2868 H HG2  . PRO A 1 183 ? 458.953 -4.783  -7.283  1.00 0.00 ? 183 PRO A HG2  1 
ATOM 2869 H HG3  . PRO A 1 183 ? 457.325 -4.373  -6.718  1.00 0.00 ? 183 PRO A HG3  1 
ATOM 2870 H HD2  . PRO A 1 183 ? 458.354 -3.469  -9.073  1.00 0.00 ? 183 PRO A HD2  1 
ATOM 2871 H HD3  . PRO A 1 183 ? 457.157 -2.562  -8.129  1.00 0.00 ? 183 PRO A HD3  1 
ATOM 2872 N N    . VAL A 1 184 ? 462.019 -2.436  -5.604  1.00 0.00 ? 184 VAL A N    1 
ATOM 2873 C CA   . VAL A 1 184 ? 463.407 -2.887  -5.550  1.00 0.00 ? 184 VAL A CA   1 
ATOM 2874 C C    . VAL A 1 184 ? 463.514 -4.311  -4.994  1.00 0.00 ? 184 VAL A C    1 
ATOM 2875 O O    . VAL A 1 184 ? 464.201 -5.155  -5.569  1.00 0.00 ? 184 VAL A O    1 
ATOM 2876 C CB   . VAL A 1 184 ? 464.280 -1.932  -4.699  1.00 0.00 ? 184 VAL A CB   1 
ATOM 2877 C CG1  . VAL A 1 184 ? 465.548 -2.625  -4.218  1.00 0.00 ? 184 VAL A CG1  1 
ATOM 2878 C CG2  . VAL A 1 184 ? 464.627 -0.678  -5.488  1.00 0.00 ? 184 VAL A CG2  1 
ATOM 2879 H H    . VAL A 1 184 ? 461.657 -1.876  -4.886  1.00 0.00 ? 184 VAL A H    1 
ATOM 2880 H HA   . VAL A 1 184 ? 463.792 -2.882  -6.560  1.00 0.00 ? 184 VAL A HA   1 
ATOM 2881 H HB   . VAL A 1 184 ? 463.711 -1.634  -3.831  1.00 0.00 ? 184 VAL A HB   1 
ATOM 2882 H HG11 . VAL A 1 184 ? 465.866 -3.347  -4.956  1.00 0.00 ? 184 VAL A HG11 1 
ATOM 2883 H HG12 . VAL A 1 184 ? 465.351 -3.129  -3.283  1.00 0.00 ? 184 VAL A HG12 1 
ATOM 2884 H HG13 . VAL A 1 184 ? 466.327 -1.891  -4.074  1.00 0.00 ? 184 VAL A HG13 1 
ATOM 2885 H HG21 . VAL A 1 184 ? 464.072 -0.668  -6.414  1.00 0.00 ? 184 VAL A HG21 1 
ATOM 2886 H HG22 . VAL A 1 184 ? 465.687 -0.670  -5.703  1.00 0.00 ? 184 VAL A HG22 1 
ATOM 2887 H HG23 . VAL A 1 184 ? 464.373 0.196   -4.906  1.00 0.00 ? 184 VAL A HG23 1 
ATOM 2888 N N    . PRO A 1 185 ? 462.852 -4.597  -3.857  1.00 0.00 ? 185 PRO A N    1 
ATOM 2889 C CA   . PRO A 1 185 ? 462.898 -5.917  -3.226  1.00 0.00 ? 185 PRO A CA   1 
ATOM 2890 C C    . PRO A 1 185 ? 461.835 -6.879  -3.753  1.00 0.00 ? 185 PRO A C    1 
ATOM 2891 O O    . PRO A 1 185 ? 461.381 -7.765  -3.029  1.00 0.00 ? 185 PRO A O    1 
ATOM 2892 C CB   . PRO A 1 185 ? 462.624 -5.580  -1.766  1.00 0.00 ? 185 PRO A CB   1 
ATOM 2893 C CG   . PRO A 1 185 ? 461.673 -4.432  -1.829  1.00 0.00 ? 185 PRO A CG   1 
ATOM 2894 C CD   . PRO A 1 185 ? 462.021 -3.656  -3.078  1.00 0.00 ? 185 PRO A CD   1 
ATOM 2895 H HA   . PRO A 1 185 ? 463.874 -6.370  -3.316  1.00 0.00 ? 185 PRO A HA   1 
ATOM 2896 H HB2  . PRO A 1 185 ? 462.186 -6.435  -1.270  1.00 0.00 ? 185 PRO A HB2  1 
ATOM 2897 H HB3  . PRO A 1 185 ? 463.545 -5.302  -1.276  1.00 0.00 ? 185 PRO A HB3  1 
ATOM 2898 H HG2  . PRO A 1 185 ? 460.659 -4.801  -1.889  1.00 0.00 ? 185 PRO A HG2  1 
ATOM 2899 H HG3  . PRO A 1 185 ? 461.794 -3.808  -0.956  1.00 0.00 ? 185 PRO A HG3  1 
ATOM 2900 H HD2  . PRO A 1 185 ? 461.124 -3.396  -3.621  1.00 0.00 ? 185 PRO A HD2  1 
ATOM 2901 H HD3  . PRO A 1 185 ? 462.579 -2.768  -2.824  1.00 0.00 ? 185 PRO A HD3  1 
ATOM 2902 N N    . TYR A 1 186 ? 461.435 -6.704  -5.008  1.00 0.00 ? 186 TYR A N    1 
ATOM 2903 C CA   . TYR A 1 186 ? 460.418 -7.566  -5.604  1.00 0.00 ? 186 TYR A CA   1 
ATOM 2904 C C    . TYR A 1 186 ? 460.830 -8.068  -6.990  1.00 0.00 ? 186 TYR A C    1 
ATOM 2905 O O    . TYR A 1 186 ? 460.218 -8.992  -7.525  1.00 0.00 ? 186 TYR A O    1 
ATOM 2906 C CB   . TYR A 1 186 ? 459.085 -6.821  -5.694  1.00 0.00 ? 186 TYR A CB   1 
ATOM 2907 C CG   . TYR A 1 186 ? 458.091 -7.234  -4.632  1.00 0.00 ? 186 TYR A CG   1 
ATOM 2908 C CD1  . TYR A 1 186 ? 457.431 -8.454  -4.710  1.00 0.00 ? 186 TYR A CD1  1 
ATOM 2909 C CD2  . TYR A 1 186 ? 457.815 -6.406  -3.552  1.00 0.00 ? 186 TYR A CD2  1 
ATOM 2910 C CE1  . TYR A 1 186 ? 456.523 -8.836  -3.741  1.00 0.00 ? 186 TYR A CE1  1 
ATOM 2911 C CE2  . TYR A 1 186 ? 456.909 -6.781  -2.578  1.00 0.00 ? 186 TYR A CE2  1 
ATOM 2912 C CZ   . TYR A 1 186 ? 456.266 -7.997  -2.678  1.00 0.00 ? 186 TYR A CZ   1 
ATOM 2913 O OH   . TYR A 1 186 ? 455.362 -8.375  -1.711  1.00 0.00 ? 186 TYR A OH   1 
ATOM 2914 H H    . TYR A 1 186 ? 461.823 -5.980  -5.539  1.00 0.00 ? 186 TYR A H    1 
ATOM 2915 H HA   . TYR A 1 186 ? 460.293 -8.420  -4.955  1.00 0.00 ? 186 TYR A HA   1 
ATOM 2916 H HB2  . TYR A 1 186 ? 459.266 -5.764  -5.583  1.00 0.00 ? 186 TYR A HB2  1 
ATOM 2917 H HB3  . TYR A 1 186 ? 458.638 -7.007  -6.659  1.00 0.00 ? 186 TYR A HB3  1 
ATOM 2918 H HD1  . TYR A 1 186 ? 457.636 -9.109  -5.543  1.00 0.00 ? 186 TYR A HD1  1 
ATOM 2919 H HD2  . TYR A 1 186 ? 458.320 -5.454  -3.477  1.00 0.00 ? 186 TYR A HD2  1 
ATOM 2920 H HE1  . TYR A 1 186 ? 456.020 -9.788  -3.819  1.00 0.00 ? 186 TYR A HE1  1 
ATOM 2921 H HE2  . TYR A 1 186 ? 456.707 -6.123  -1.746  1.00 0.00 ? 186 TYR A HE2  1 
ATOM 2922 H HH   . TYR A 1 186 ? 454.627 -7.758  -1.702  1.00 0.00 ? 186 TYR A HH   1 
ATOM 2923 N N    . VAL A 1 187 ? 461.860 -7.460  -7.572  1.00 0.00 ? 187 VAL A N    1 
ATOM 2924 C CA   . VAL A 1 187 ? 462.332 -7.856  -8.894  1.00 0.00 ? 187 VAL A CA   1 
ATOM 2925 C C    . VAL A 1 187 ? 463.760 -8.390  -8.832  1.00 0.00 ? 187 VAL A C    1 
ATOM 2926 O O    . VAL A 1 187 ? 464.426 -8.289  -7.801  1.00 0.00 ? 187 VAL A O    1 
ATOM 2927 C CB   . VAL A 1 187 ? 462.282 -6.672  -9.878  1.00 0.00 ? 187 VAL A CB   1 
ATOM 2928 C CG1  . VAL A 1 187 ? 460.841 -6.315  -10.215 1.00 0.00 ? 187 VAL A CG1  1 
ATOM 2929 C CG2  . VAL A 1 187 ? 463.017 -5.470  -9.301  1.00 0.00 ? 187 VAL A CG2  1 
ATOM 2930 H H    . VAL A 1 187 ? 462.313 -6.727  -7.109  1.00 0.00 ? 187 VAL A H    1 
ATOM 2931 H HA   . VAL A 1 187 ? 461.679 -8.635  -9.265  1.00 0.00 ? 187 VAL A HA   1 
ATOM 2932 H HB   . VAL A 1 187 ? 462.779 -6.966  -10.790 1.00 0.00 ? 187 VAL A HB   1 
ATOM 2933 H HG11 . VAL A 1 187 ? 460.731 -6.239  -11.287 1.00 0.00 ? 187 VAL A HG11 1 
ATOM 2934 H HG12 . VAL A 1 187 ? 460.588 -5.368  -9.760  1.00 0.00 ? 187 VAL A HG12 1 
ATOM 2935 H HG13 . VAL A 1 187 ? 460.181 -7.083  -9.839  1.00 0.00 ? 187 VAL A HG13 1 
ATOM 2936 H HG21 . VAL A 1 187 ? 462.620 -5.239  -8.324  1.00 0.00 ? 187 VAL A HG21 1 
ATOM 2937 H HG22 . VAL A 1 187 ? 462.883 -4.620  -9.953  1.00 0.00 ? 187 VAL A HG22 1 
ATOM 2938 H HG23 . VAL A 1 187 ? 464.070 -5.698  -9.218  1.00 0.00 ? 187 VAL A HG23 1 
ATOM 2939 N N    . GLU A 1 188 ? 464.227 -8.956  -9.941  1.00 0.00 ? 188 GLU A N    1 
ATOM 2940 C CA   . GLU A 1 188 ? 465.579 -9.502  -10.010 1.00 0.00 ? 188 GLU A CA   1 
ATOM 2941 C C    . GLU A 1 188 ? 466.487 -8.601  -10.842 1.00 0.00 ? 188 GLU A C    1 
ATOM 2942 O O    . GLU A 1 188 ? 466.173 -8.274  -11.986 1.00 0.00 ? 188 GLU A O    1 
ATOM 2943 C CB   . GLU A 1 188 ? 465.555 -10.913 -10.603 1.00 0.00 ? 188 GLU A CB   1 
ATOM 2944 C CG   . GLU A 1 188 ? 465.869 -12.003 -9.591  1.00 0.00 ? 188 GLU A CG   1 
ATOM 2945 C CD   . GLU A 1 188 ? 467.350 -12.103 -9.283  1.00 0.00 ? 188 GLU A CD   1 
ATOM 2946 O OE1  . GLU A 1 188 ? 467.834 -11.327 -8.432  1.00 0.00 ? 188 GLU A OE1  1 
ATOM 2947 O OE2  . GLU A 1 188 ? 468.027 -12.958 -9.893  1.00 0.00 ? 188 GLU A OE2  1 
ATOM 2948 H H    . GLU A 1 188 ? 463.651 -9.006  -10.732 1.00 0.00 ? 188 GLU A H    1 
ATOM 2949 H HA   . GLU A 1 188 ? 465.967 -9.551  -9.003  1.00 0.00 ? 188 GLU A HA   1 
ATOM 2950 H HB2  . GLU A 1 188 ? 464.575 -11.103 -11.012 1.00 0.00 ? 188 GLU A HB2  1 
ATOM 2951 H HB3  . GLU A 1 188 ? 466.284 -10.972 -11.399 1.00 0.00 ? 188 GLU A HB3  1 
ATOM 2952 H HG2  . GLU A 1 188 ? 465.341 -11.788 -8.674  1.00 0.00 ? 188 GLU A HG2  1 
ATOM 2953 H HG3  . GLU A 1 188 ? 465.533 -12.951 -9.985  1.00 0.00 ? 188 GLU A HG3  1 
ATOM 2954 N N    . LYS A 1 189 ? 467.614 -8.206  -10.260 1.00 0.00 ? 189 LYS A N    1 
ATOM 2955 C CA   . LYS A 1 189 ? 468.568 -7.344  -10.948 1.00 0.00 ? 189 LYS A CA   1 
ATOM 2956 C C    . LYS A 1 189 ? 469.231 -8.080  -12.109 1.00 0.00 ? 189 LYS A C    1 
ATOM 2957 O O    . LYS A 1 189 ? 469.910 -9.087  -11.911 1.00 0.00 ? 189 LYS A O    1 
ATOM 2958 C CB   . LYS A 1 189 ? 469.633 -6.847  -9.969  1.00 0.00 ? 189 LYS A CB   1 
ATOM 2959 C CG   . LYS A 1 189 ? 469.090 -5.912  -8.900  1.00 0.00 ? 189 LYS A CG   1 
ATOM 2960 C CD   . LYS A 1 189 ? 469.624 -6.268  -7.520  1.00 0.00 ? 189 LYS A CD   1 
ATOM 2961 C CE   . LYS A 1 189 ? 468.548 -6.898  -6.650  1.00 0.00 ? 189 LYS A CE   1 
ATOM 2962 N NZ   . LYS A 1 189 ? 467.459 -5.935  -6.326  1.00 0.00 ? 189 LYS A NZ   1 
ATOM 2963 H H    . LYS A 1 189 ? 467.810 -8.504  -9.348  1.00 0.00 ? 189 LYS A H    1 
ATOM 2964 H HA   . LYS A 1 189 ? 468.026 -6.495  -11.339 1.00 0.00 ? 189 LYS A HA   1 
ATOM 2965 H HB2  . LYS A 1 189 ? 470.080 -7.699  -9.480  1.00 0.00 ? 189 LYS A HB2  1 
ATOM 2966 H HB3  . LYS A 1 189 ? 470.396 -6.320  -10.523 1.00 0.00 ? 189 LYS A HB3  1 
ATOM 2967 H HG2  . LYS A 1 189 ? 469.384 -4.901  -9.137  1.00 0.00 ? 189 LYS A HG2  1 
ATOM 2968 H HG3  . LYS A 1 189 ? 468.012 -5.981  -8.889  1.00 0.00 ? 189 LYS A HG3  1 
ATOM 2969 H HD2  . LYS A 1 189 ? 470.439 -6.967  -7.628  1.00 0.00 ? 189 LYS A HD2  1 
ATOM 2970 H HD3  . LYS A 1 189 ? 469.981 -5.368  -7.040  1.00 0.00 ? 189 LYS A HD3  1 
ATOM 2971 H HE2  . LYS A 1 189 ? 468.125 -7.741  -7.176  1.00 0.00 ? 189 LYS A HE2  1 
ATOM 2972 H HE3  . LYS A 1 189 ? 469.000 -7.239  -5.730  1.00 0.00 ? 189 LYS A HE3  1 
ATOM 2973 H HZ1  . LYS A 1 189 ? 466.768 -6.378  -5.688  1.00 0.00 ? 189 LYS A HZ1  1 
ATOM 2974 H HZ2  . LYS A 1 189 ? 466.972 -5.641  -7.196  1.00 0.00 ? 189 LYS A HZ2  1 
ATOM 2975 H HZ3  . LYS A 1 189 ? 467.854 -5.092  -5.862  1.00 0.00 ? 189 LYS A HZ3  1 
ATOM 2976 N N    . TYR A 1 190 ? 469.030 -7.569  -13.321 1.00 0.00 ? 190 TYR A N    1 
ATOM 2977 C CA   . TYR A 1 190 ? 469.610 -8.178  -14.513 1.00 0.00 ? 190 TYR A CA   1 
ATOM 2978 C C    . TYR A 1 190 ? 470.614 -7.238  -15.174 1.00 0.00 ? 190 TYR A C    1 
ATOM 2979 O O    . TYR A 1 190 ? 470.343 -6.051  -15.355 1.00 0.00 ? 190 TYR A O    1 
ATOM 2980 C CB   . TYR A 1 190 ? 468.507 -8.550  -15.508 1.00 0.00 ? 190 TYR A CB   1 
ATOM 2981 C CG   . TYR A 1 190 ? 468.608 -9.970  -16.018 1.00 0.00 ? 190 TYR A CG   1 
ATOM 2982 C CD1  . TYR A 1 190 ? 468.143 -11.036 -15.257 1.00 0.00 ? 190 TYR A CD1  1 
ATOM 2983 C CD2  . TYR A 1 190 ? 469.168 -10.245 -17.259 1.00 0.00 ? 190 TYR A CD2  1 
ATOM 2984 C CE1  . TYR A 1 190 ? 468.233 -12.335 -15.719 1.00 0.00 ? 190 TYR A CE1  1 
ATOM 2985 C CE2  . TYR A 1 190 ? 469.261 -11.542 -17.728 1.00 0.00 ? 190 TYR A CE2  1 
ATOM 2986 C CZ   . TYR A 1 190 ? 468.793 -12.583 -16.954 1.00 0.00 ? 190 TYR A CZ   1 
ATOM 2987 O OH   . TYR A 1 190 ? 468.884 -13.875 -17.417 1.00 0.00 ? 190 TYR A OH   1 
ATOM 2988 H H    . TYR A 1 190 ? 468.479 -6.764  -13.415 1.00 0.00 ? 190 TYR A H    1 
ATOM 2989 H HA   . TYR A 1 190 ? 470.124 -9.077  -14.209 1.00 0.00 ? 190 TYR A HA   1 
ATOM 2990 H HB2  . TYR A 1 190 ? 467.547 -8.438  -15.028 1.00 0.00 ? 190 TYR A HB2  1 
ATOM 2991 H HB3  . TYR A 1 190 ? 468.558 -7.887  -16.359 1.00 0.00 ? 190 TYR A HB3  1 
ATOM 2992 H HD1  . TYR A 1 190 ? 467.705 -10.838 -14.290 1.00 0.00 ? 190 TYR A HD1  1 
ATOM 2993 H HD2  . TYR A 1 190 ? 469.534 -9.428  -17.862 1.00 0.00 ? 190 TYR A HD2  1 
ATOM 2994 H HE1  . TYR A 1 190 ? 467.866 -13.150 -15.112 1.00 0.00 ? 190 TYR A HE1  1 
ATOM 2995 H HE2  . TYR A 1 190 ? 469.700 -11.735 -18.695 1.00 0.00 ? 190 TYR A HE2  1 
ATOM 2996 H HH   . TYR A 1 190 ? 468.026 -14.300 -17.351 1.00 0.00 ? 190 TYR A HH   1 
ATOM 2997 N N    . ARG A 1 191 ? 471.777 -7.777  -15.529 1.00 0.00 ? 191 ARG A N    1 
ATOM 2998 C CA   . ARG A 1 191 ? 472.825 -6.986  -16.167 1.00 0.00 ? 191 ARG A CA   1 
ATOM 2999 C C    . ARG A 1 191 ? 473.140 -7.519  -17.563 1.00 0.00 ? 191 ARG A C    1 
ATOM 3000 O O    . ARG A 1 191 ? 473.785 -8.557  -17.708 1.00 0.00 ? 191 ARG A O    1 
ATOM 3001 C CB   . ARG A 1 191 ? 474.091 -6.992  -15.305 1.00 0.00 ? 191 ARG A CB   1 
ATOM 3002 C CG   . ARG A 1 191 ? 474.462 -5.622  -14.761 1.00 0.00 ? 191 ARG A CG   1 
ATOM 3003 C CD   . ARG A 1 191 ? 475.149 -5.724  -13.408 1.00 0.00 ? 191 ARG A CD   1 
ATOM 3004 N NE   . ARG A 1 191 ? 474.468 -4.931  -12.388 1.00 0.00 ? 191 ARG A NE   1 
ATOM 3005 C CZ   . ARG A 1 191 ? 473.382 -5.338  -11.734 1.00 0.00 ? 191 ARG A CZ   1 
ATOM 3006 N NH1  . ARG A 1 191 ? 472.851 -6.527  -11.989 1.00 0.00 ? 191 ARG A NH1  1 
ATOM 3007 N NH2  . ARG A 1 191 ? 472.826 -4.552  -10.822 1.00 0.00 ? 191 ARG A NH2  1 
ATOM 3008 H H    . ARG A 1 191 ? 471.935 -8.728  -15.355 1.00 0.00 ? 191 ARG A H    1 
ATOM 3009 H HA   . ARG A 1 191 ? 472.466 -5.973  -16.256 1.00 0.00 ? 191 ARG A HA   1 
ATOM 3010 H HB2  . ARG A 1 191 ? 473.939 -7.659  -14.469 1.00 0.00 ? 191 ARG A HB2  1 
ATOM 3011 H HB3  . ARG A 1 191 ? 474.917 -7.356  -15.898 1.00 0.00 ? 191 ARG A HB3  1 
ATOM 3012 H HG2  . ARG A 1 191 ? 475.131 -5.139  -15.457 1.00 0.00 ? 191 ARG A HG2  1 
ATOM 3013 H HG3  . ARG A 1 191 ? 473.563 -5.033  -14.655 1.00 0.00 ? 191 ARG A HG3  1 
ATOM 3014 H HD2  . ARG A 1 191 ? 475.160 -6.759  -13.099 1.00 0.00 ? 191 ARG A HD2  1 
ATOM 3015 H HD3  . ARG A 1 191 ? 476.165 -5.370  -13.508 1.00 0.00 ? 191 ARG A HD3  1 
ATOM 3016 H HE   . ARG A 1 191 ? 474.839 -4.049  -12.179 1.00 0.00 ? 191 ARG A HE   1 
ATOM 3017 H HH11 . ARG A 1 191 ? 473.264 -7.124  -12.676 1.00 0.00 ? 191 ARG A HH11 1 
ATOM 3018 H HH12 . ARG A 1 191 ? 472.036 -6.826  -11.494 1.00 0.00 ? 191 ARG A HH12 1 
ATOM 3019 H HH21 . ARG A 1 191 ? 473.223 -3.655  -10.626 1.00 0.00 ? 191 ARG A HH21 1 
ATOM 3020 H HH22 . ARG A 1 191 ? 472.010 -4.856  -10.330 1.00 0.00 ? 191 ARG A HH22 1 
ATOM 3021 N N    . PRO A 1 192 ? 472.687 -6.812  -18.613 1.00 0.00 ? 192 PRO A N    1 
ATOM 3022 C CA   . PRO A 1 192 ? 472.927 -7.223  -19.994 1.00 0.00 ? 192 PRO A CA   1 
ATOM 3023 C C    . PRO A 1 192 ? 474.365 -6.965  -20.443 1.00 0.00 ? 192 PRO A C    1 
ATOM 3024 O O    . PRO A 1 192 ? 475.183 -7.884  -20.486 1.00 0.00 ? 192 PRO A O    1 
ATOM 3025 C CB   . PRO A 1 192 ? 471.934 -6.379  -20.796 1.00 0.00 ? 192 PRO A CB   1 
ATOM 3026 C CG   . PRO A 1 192 ? 471.666 -5.171  -19.962 1.00 0.00 ? 192 PRO A CG   1 
ATOM 3027 C CD   . PRO A 1 192 ? 471.906 -5.563  -18.527 1.00 0.00 ? 192 PRO A CD   1 
ATOM 3028 H HA   . PRO A 1 192 ? 472.701 -8.268  -20.133 1.00 0.00 ? 192 PRO A HA   1 
ATOM 3029 H HB2  . PRO A 1 192 ? 472.373 -6.112  -21.745 1.00 0.00 ? 192 PRO A HB2  1 
ATOM 3030 H HB3  . PRO A 1 192 ? 471.032 -6.948  -20.960 1.00 0.00 ? 192 PRO A HB3  1 
ATOM 3031 H HG2  . PRO A 1 192 ? 472.334 -4.373  -20.246 1.00 0.00 ? 192 PRO A HG2  1 
ATOM 3032 H HG3  . PRO A 1 192 ? 470.640 -4.861  -20.094 1.00 0.00 ? 192 PRO A HG3  1 
ATOM 3033 H HD2  . PRO A 1 192 ? 472.471 -4.795  -18.020 1.00 0.00 ? 192 PRO A HD2  1 
ATOM 3034 H HD3  . PRO A 1 192 ? 470.966 -5.732  -18.023 1.00 0.00 ? 192 PRO A HD3  1 
ATOM 3035 N N    . ALA A 1 193 ? 474.670 -5.715  -20.774 1.00 0.00 ? 193 ALA A N    1 
ATOM 3036 C CA   . ALA A 1 193 ? 476.010 -5.346  -21.215 1.00 0.00 ? 193 ALA A CA   1 
ATOM 3037 C C    . ALA A 1 193 ? 476.127 -3.839  -21.414 1.00 0.00 ? 193 ALA A C    1 
ATOM 3038 O O    . ALA A 1 193 ? 477.080 -3.214  -20.949 1.00 0.00 ? 193 ALA A O    1 
ATOM 3039 C CB   . ALA A 1 193 ? 476.362 -6.079  -22.501 1.00 0.00 ? 193 ALA A CB   1 
ATOM 3040 H H    . ALA A 1 193 ? 473.981 -5.027  -20.720 1.00 0.00 ? 193 ALA A H    1 
ATOM 3041 H HA   . ALA A 1 193 ? 476.708 -5.654  -20.451 1.00 0.00 ? 193 ALA A HA   1 
ATOM 3042 H HB1  . ALA A 1 193 ? 475.770 -6.979  -22.576 1.00 0.00 ? 193 ALA A HB1  1 
ATOM 3043 H HB2  . ALA A 1 193 ? 477.411 -6.337  -22.493 1.00 0.00 ? 193 ALA A HB2  1 
ATOM 3044 H HB3  . ALA A 1 193 ? 476.155 -5.440  -23.347 1.00 0.00 ? 193 ALA A HB3  1 
ATOM 3045 N N    . SER A 1 194 ? 475.152 -3.260  -22.108 1.00 0.00 ? 194 SER A N    1 
ATOM 3046 C CA   . SER A 1 194 ? 475.147 -1.824  -22.368 1.00 0.00 ? 194 SER A CA   1 
ATOM 3047 C C    . SER A 1 194 ? 474.521 -1.062  -21.204 1.00 0.00 ? 194 SER A C    1 
ATOM 3048 O O    . SER A 1 194 ? 473.358 -0.663  -21.264 1.00 0.00 ? 194 SER A O    1 
ATOM 3049 C CB   . SER A 1 194 ? 474.386 -1.521  -23.659 1.00 0.00 ? 194 SER A CB   1 
ATOM 3050 O OG   . SER A 1 194 ? 473.112 -2.143  -23.659 1.00 0.00 ? 194 SER A OG   1 
ATOM 3051 H H    . SER A 1 194 ? 474.419 -3.810  -22.453 1.00 0.00 ? 194 SER A H    1 
ATOM 3052 H HA   . SER A 1 194 ? 476.172 -1.505  -22.481 1.00 0.00 ? 194 SER A HA   1 
ATOM 3053 H HB2  . SER A 1 194 ? 474.251 -0.454  -23.753 1.00 0.00 ? 194 SER A HB2  1 
ATOM 3054 H HB3  . SER A 1 194 ? 474.952 -1.888  -24.503 1.00 0.00 ? 194 SER A HB3  1 
ATOM 3055 H HG   . SER A 1 194 ? 472.807 -2.249  -24.563 1.00 0.00 ? 194 SER A HG   1 
ATOM 3056 N N    . ALA A 1 195 ? 475.300 -0.866  -20.145 1.00 0.00 ? 195 ALA A N    1 
ATOM 3057 C CA   . ALA A 1 195 ? 474.820 -0.154  -18.966 1.00 0.00 ? 195 ALA A CA   1 
ATOM 3058 C C    . ALA A 1 195 ? 475.899 0.757   -18.387 1.00 0.00 ? 195 ALA A C    1 
ATOM 3059 O O    . ALA A 1 195 ? 475.615 1.875   -17.958 1.00 0.00 ? 195 ALA A O    1 
ATOM 3060 C CB   . ALA A 1 195 ? 474.343 -1.144  -17.914 1.00 0.00 ? 195 ALA A CB   1 
ATOM 3061 H H    . ALA A 1 195 ? 476.216 -1.210  -20.157 1.00 0.00 ? 195 ALA A H    1 
ATOM 3062 H HA   . ALA A 1 195 ? 473.976 0.451   -19.264 1.00 0.00 ? 195 ALA A HA   1 
ATOM 3063 H HB1  . ALA A 1 195 ? 474.878 -2.075  -18.029 1.00 0.00 ? 195 ALA A HB1  1 
ATOM 3064 H HB2  . ALA A 1 195 ? 473.285 -1.318  -18.038 1.00 0.00 ? 195 ALA A HB2  1 
ATOM 3065 H HB3  . ALA A 1 195 ? 474.530 -0.740  -16.930 1.00 0.00 ? 195 ALA A HB3  1 
ATOM 3066 N N    . SER A 1 196 ? 477.137 0.272   -18.375 1.00 0.00 ? 196 SER A N    1 
ATOM 3067 C CA   . SER A 1 196 ? 478.256 1.045   -17.847 1.00 0.00 ? 196 SER A CA   1 
ATOM 3068 C C    . SER A 1 196 ? 479.202 1.459   -18.967 1.00 0.00 ? 196 SER A C    1 
ATOM 3069 O O    . SER A 1 196 ? 480.188 0.778   -19.247 1.00 0.00 ? 196 SER A O    1 
ATOM 3070 C CB   . SER A 1 196 ? 479.016 0.234   -16.799 1.00 0.00 ? 196 SER A CB   1 
ATOM 3071 O OG   . SER A 1 196 ? 478.125 -0.413  -15.907 1.00 0.00 ? 196 SER A OG   1 
ATOM 3072 H H    . SER A 1 196 ? 477.303 -0.624  -18.731 1.00 0.00 ? 196 SER A H    1 
ATOM 3073 H HA   . SER A 1 196 ? 477.856 1.933   -17.382 1.00 0.00 ? 196 SER A HA   1 
ATOM 3074 H HB2  . SER A 1 196 ? 479.618 -0.514  -17.292 1.00 0.00 ? 196 SER A HB2  1 
ATOM 3075 H HB3  . SER A 1 196 ? 479.656 0.895   -16.233 1.00 0.00 ? 196 SER A HB3  1 
ATOM 3076 H HG   . SER A 1 196 ? 477.497 0.226   -15.561 1.00 0.00 ? 196 SER A HG   1 
ATOM 3077 N N    . VAL A 1 197 ? 478.887 2.577   -19.606 1.00 0.00 ? 197 VAL A N    1 
ATOM 3078 C CA   . VAL A 1 197 ? 479.698 3.087   -20.701 1.00 0.00 ? 197 VAL A CA   1 
ATOM 3079 C C    . VAL A 1 197 ? 479.740 4.614   -20.689 1.00 0.00 ? 197 VAL A C    1 
ATOM 3080 O O    . VAL A 1 197 ? 480.803 5.216   -20.845 1.00 0.00 ? 197 VAL A O    1 
ATOM 3081 C CB   . VAL A 1 197 ? 479.158 2.591   -22.057 1.00 0.00 ? 197 VAL A CB   1 
ATOM 3082 C CG1  . VAL A 1 197 ? 477.659 2.827   -22.154 1.00 0.00 ? 197 VAL A CG1  1 
ATOM 3083 C CG2  . VAL A 1 197 ? 479.890 3.253   -23.217 1.00 0.00 ? 197 VAL A CG2  1 
ATOM 3084 H H    . VAL A 1 197 ? 478.086 3.068   -19.338 1.00 0.00 ? 197 VAL A H    1 
ATOM 3085 H HA   . VAL A 1 197 ? 480.702 2.708   -20.577 1.00 0.00 ? 197 VAL A HA   1 
ATOM 3086 H HB   . VAL A 1 197 ? 479.329 1.526   -22.114 1.00 0.00 ? 197 VAL A HB   1 
ATOM 3087 H HG11 . VAL A 1 197 ? 477.167 2.362   -21.310 1.00 0.00 ? 197 VAL A HG11 1 
ATOM 3088 H HG12 . VAL A 1 197 ? 477.284 2.396   -23.070 1.00 0.00 ? 197 VAL A HG12 1 
ATOM 3089 H HG13 . VAL A 1 197 ? 477.459 3.888   -22.147 1.00 0.00 ? 197 VAL A HG13 1 
ATOM 3090 H HG21 . VAL A 1 197 ? 479.660 4.308   -23.233 1.00 0.00 ? 197 VAL A HG21 1 
ATOM 3091 H HG22 . VAL A 1 197 ? 479.576 2.802   -24.146 1.00 0.00 ? 197 VAL A HG22 1 
ATOM 3092 H HG23 . VAL A 1 197 ? 480.955 3.119   -23.094 1.00 0.00 ? 197 VAL A HG23 1 
ATOM 3093 N N    . SER A 1 198 ? 478.579 5.235   -20.501 1.00 0.00 ? 198 SER A N    1 
ATOM 3094 C CA   . SER A 1 198 ? 478.487 6.692   -20.466 1.00 0.00 ? 198 SER A CA   1 
ATOM 3095 C C    . SER A 1 198 ? 479.064 7.309   -21.738 1.00 0.00 ? 198 SER A C    1 
ATOM 3096 O O    . SER A 1 198 ? 479.309 6.611   -22.722 1.00 0.00 ? 198 SER A O    1 
ATOM 3097 C CB   . SER A 1 198 ? 479.221 7.239   -19.240 1.00 0.00 ? 198 SER A CB   1 
ATOM 3098 O OG   . SER A 1 198 ? 478.525 8.336   -18.676 1.00 0.00 ? 198 SER A OG   1 
ATOM 3099 H H    . SER A 1 198 ? 477.766 4.703   -20.381 1.00 0.00 ? 198 SER A H    1 
ATOM 3100 H HA   . SER A 1 198 ? 477.442 6.955   -20.395 1.00 0.00 ? 198 SER A HA   1 
ATOM 3101 H HB2  . SER A 1 198 ? 479.304 6.461   -18.496 1.00 0.00 ? 198 SER A HB2  1 
ATOM 3102 H HB3  . SER A 1 198 ? 480.209 7.565   -19.531 1.00 0.00 ? 198 SER A HB3  1 
ATOM 3103 H HG   . SER A 1 198 ? 479.133 8.870   -18.159 1.00 0.00 ? 198 SER A HG   1 
ATOM 3104 N N    . ALA A 1 199 ? 479.280 8.620   -21.709 1.00 0.00 ? 199 ALA A N    1 
ATOM 3105 C CA   . ALA A 1 199 ? 479.828 9.330   -22.859 1.00 0.00 ? 199 ALA A CA   1 
ATOM 3106 C C    . ALA A 1 199 ? 481.353 9.342   -22.821 1.00 0.00 ? 199 ALA A C    1 
ATOM 3107 O O    . ALA A 1 199 ? 482.007 8.577   -23.531 1.00 0.00 ? 199 ALA A O    1 
ATOM 3108 C CB   . ALA A 1 199 ? 479.287 10.751  -22.908 1.00 0.00 ? 199 ALA A CB   1 
ATOM 3109 H H    . ALA A 1 199 ? 479.065 9.123   -20.895 1.00 0.00 ? 199 ALA A H    1 
ATOM 3110 H HA   . ALA A 1 199 ? 479.504 8.816   -23.752 1.00 0.00 ? 199 ALA A HA   1 
ATOM 3111 H HB1  . ALA A 1 199 ? 478.356 10.764  -23.456 1.00 0.00 ? 199 ALA A HB1  1 
ATOM 3112 H HB2  . ALA A 1 199 ? 480.003 11.393  -23.400 1.00 0.00 ? 199 ALA A HB2  1 
ATOM 3113 H HB3  . ALA A 1 199 ? 479.117 11.107  -21.902 1.00 0.00 ? 199 ALA A HB3  1 
ATOM 3114 N N    . LEU A 1 200 ? 481.914 10.214  -21.989 1.00 0.00 ? 200 LEU A N    1 
ATOM 3115 C CA   . LEU A 1 200 ? 483.363 10.323  -21.859 1.00 0.00 ? 200 LEU A CA   1 
ATOM 3116 C C    . LEU A 1 200 ? 483.740 11.344  -20.794 1.00 0.00 ? 200 LEU A C    1 
ATOM 3117 O O    . LEU A 1 200 ? 484.415 11.020  -19.817 1.00 0.00 ? 200 LEU A O    1 
ATOM 3118 C CB   . LEU A 1 200 ? 483.989 10.714  -23.200 1.00 0.00 ? 200 LEU A CB   1 
ATOM 3119 C CG   . LEU A 1 200 ? 485.439 10.267  -23.392 1.00 0.00 ? 200 LEU A CG   1 
ATOM 3120 C CD1  . LEU A 1 200 ? 485.492 8.848   -23.939 1.00 0.00 ? 200 LEU A CD1  1 
ATOM 3121 C CD2  . LEU A 1 200 ? 486.173 11.225  -24.318 1.00 0.00 ? 200 LEU A CD2  1 
ATOM 3122 H H    . LEU A 1 200 ? 481.341 10.797  -21.449 1.00 0.00 ? 200 LEU A H    1 
ATOM 3123 H HA   . LEU A 1 200 ? 483.742 9.362   -21.564 1.00 0.00 ? 200 LEU A HA   1 
ATOM 3124 H HB2  . LEU A 1 200 ? 483.393 10.283  -23.991 1.00 0.00 ? 200 LEU A HB2  1 
ATOM 3125 H HB3  . LEU A 1 200 ? 483.954 11.789  -23.290 1.00 0.00 ? 200 LEU A HB3  1 
ATOM 3126 H HG   . LEU A 1 200 ? 485.941 10.274  -22.435 1.00 0.00 ? 200 LEU A HG   1 
ATOM 3127 H HD11 . LEU A 1 200 ? 484.688 8.268   -23.511 1.00 0.00 ? 200 LEU A HD11 1 
ATOM 3128 H HD12 . LEU A 1 200 ? 486.438 8.398   -23.680 1.00 0.00 ? 200 LEU A HD12 1 
ATOM 3129 H HD13 . LEU A 1 200 ? 485.386 8.873   -25.013 1.00 0.00 ? 200 LEU A HD13 1 
ATOM 3130 H HD21 . LEU A 1 200 ? 485.831 11.078  -25.332 1.00 0.00 ? 200 LEU A HD21 1 
ATOM 3131 H HD22 . LEU A 1 200 ? 487.235 11.033  -24.266 1.00 0.00 ? 200 LEU A HD22 1 
ATOM 3132 H HD23 . LEU A 1 200 ? 485.975 12.242  -24.014 1.00 0.00 ? 200 LEU A HD23 1 
ATOM 3133 N N    . ILE A 1 201 ? 483.296 12.575  -20.994 1.00 0.00 ? 201 ILE A N    1 
ATOM 3134 C CA   . ILE A 1 201 ? 483.577 13.660  -20.059 1.00 0.00 ? 201 ILE A CA   1 
ATOM 3135 C C    . ILE A 1 201 ? 485.056 14.032  -20.075 1.00 0.00 ? 201 ILE A C    1 
ATOM 3136 O O    . ILE A 1 201 ? 485.427 15.118  -20.519 1.00 0.00 ? 201 ILE A O    1 
ATOM 3137 C CB   . ILE A 1 201 ? 483.165 13.288  -18.620 1.00 0.00 ? 201 ILE A CB   1 
ATOM 3138 C CG1  . ILE A 1 201 ? 481.729 12.760  -18.595 1.00 0.00 ? 201 ILE A CG1  1 
ATOM 3139 C CG2  . ILE A 1 201 ? 483.308 14.491  -17.699 1.00 0.00 ? 201 ILE A CG2  1 
ATOM 3140 C CD1  . ILE A 1 201 ? 481.458 11.799  -17.458 1.00 0.00 ? 201 ILE A CD1  1 
ATOM 3141 H H    . ILE A 1 201 ? 482.764 12.759  -21.794 1.00 0.00 ? 201 ILE A H    1 
ATOM 3142 H HA   . ILE A 1 201 ? 482.998 14.519  -20.364 1.00 0.00 ? 201 ILE A HA   1 
ATOM 3143 H HB   . ILE A 1 201 ? 483.831 12.515  -18.267 1.00 0.00 ? 201 ILE A HB   1 
ATOM 3144 H HG12 . ILE A 1 201 ? 481.049 13.592  -18.493 1.00 0.00 ? 201 ILE A HG12 1 
ATOM 3145 H HG13 . ILE A 1 201 ? 481.525 12.245  -19.522 1.00 0.00 ? 201 ILE A HG13 1 
ATOM 3146 H HG21 . ILE A 1 201 ? 482.952 15.376  -18.206 1.00 0.00 ? 201 ILE A HG21 1 
ATOM 3147 H HG22 . ILE A 1 201 ? 484.348 14.621  -17.436 1.00 0.00 ? 201 ILE A HG22 1 
ATOM 3148 H HG23 . ILE A 1 201 ? 482.727 14.330  -16.804 1.00 0.00 ? 201 ILE A HG23 1 
ATOM 3149 H HD11 . ILE A 1 201 ? 481.082 10.868  -17.856 1.00 0.00 ? 201 ILE A HD11 1 
ATOM 3150 H HD12 . ILE A 1 201 ? 480.725 12.227  -16.791 1.00 0.00 ? 201 ILE A HD12 1 
ATOM 3151 H HD13 . ILE A 1 201 ? 482.374 11.615  -16.916 1.00 0.00 ? 201 ILE A HD13 1 
ATOM 3152 N N    . GLY A 1 202 ? 485.897 13.125  -19.588 1.00 0.00 ? 202 GLY A N    1 
ATOM 3153 C CA   . GLY A 1 202 ? 487.325 13.380  -19.556 1.00 0.00 ? 202 GLY A CA   1 
ATOM 3154 C C    . GLY A 1 202 ? 487.727 14.301  -18.421 1.00 0.00 ? 202 GLY A C    1 
ATOM 3155 O O    . GLY A 1 202 ? 486.917 14.608  -17.546 1.00 0.00 ? 202 GLY A O    1 
ATOM 3156 H H    . GLY A 1 202 ? 485.545 12.277  -19.247 1.00 0.00 ? 202 GLY A H    1 
ATOM 3157 H HA2  . GLY A 1 202 ? 487.845 12.439  -19.443 1.00 0.00 ? 202 GLY A HA2  1 
ATOM 3158 H HA3  . GLY A 1 202 ? 487.620 13.830  -20.493 1.00 0.00 ? 202 GLY A HA3  1 
ATOM 3159 N N    . GLY A 1 203 ? 488.980 14.745  -18.436 1.00 0.00 ? 203 GLY A N    1 
ATOM 3160 C CA   . GLY A 1 203 ? 489.466 15.632  -17.396 1.00 0.00 ? 203 GLY A CA   1 
ATOM 3161 C C    . GLY A 1 203 ? 490.076 16.903  -17.955 1.00 0.00 ? 203 GLY A C    1 
ATOM 3162 O O    . GLY A 1 203 ? 489.977 17.172  -19.152 1.00 0.00 ? 203 GLY A O    1 
ATOM 3163 H H    . GLY A 1 203 ? 489.579 14.467  -19.160 1.00 0.00 ? 203 GLY A H    1 
ATOM 3164 H HA2  . GLY A 1 203 ? 488.642 15.897  -16.749 1.00 0.00 ? 203 GLY A HA2  1 
ATOM 3165 H HA3  . GLY A 1 203 ? 490.214 15.113  -16.815 1.00 0.00 ? 203 GLY A HA3  1 
ATOM 3166 N N    . ASN A 1 204 ? 490.709 17.685  -17.087 1.00 0.00 ? 204 ASN A N    1 
ATOM 3167 C CA   . ASN A 1 204 ? 491.337 18.935  -17.500 1.00 0.00 ? 204 ASN A CA   1 
ATOM 3168 C C    . ASN A 1 204 ? 492.593 19.211  -16.680 1.00 0.00 ? 204 ASN A C    1 
ATOM 3169 O O    . ASN A 1 204 ? 493.686 19.351  -17.228 1.00 0.00 ? 204 ASN A O    1 
ATOM 3170 C CB   . ASN A 1 204 ? 490.353 20.097  -17.356 1.00 0.00 ? 204 ASN A CB   1 
ATOM 3171 C CG   . ASN A 1 204 ? 490.599 21.192  -18.376 1.00 0.00 ? 204 ASN A CG   1 
ATOM 3172 O OD1  . ASN A 1 204 ? 490.868 22.339  -18.019 1.00 0.00 ? 204 ASN A OD1  1 
ATOM 3173 N ND2  . ASN A 1 204 ? 490.506 20.842  -19.653 1.00 0.00 ? 204 ASN A ND2  1 
ATOM 3174 H H    . ASN A 1 204 ? 490.754 17.417  -16.145 1.00 0.00 ? 204 ASN A H    1 
ATOM 3175 H HA   . ASN A 1 204 ? 491.615 18.837  -18.539 1.00 0.00 ? 204 ASN A HA   1 
ATOM 3176 H HB2  . ASN A 1 204 ? 489.347 19.728  -17.487 1.00 0.00 ? 204 ASN A HB2  1 
ATOM 3177 H HB3  . ASN A 1 204 ? 490.451 20.522  -16.367 1.00 0.00 ? 204 ASN A HB3  1 
ATOM 3178 H HD21 . ASN A 1 204 ? 490.288 19.910  -19.863 1.00 0.00 ? 204 ASN A HD21 1 
ATOM 3179 H HD22 . ASN A 1 204 ? 490.660 21.531  -20.334 1.00 0.00 ? 204 ASN A HD22 1 
ATOM 3180 N N    . GLN A 1 205 ? 492.428 19.290  -15.364 1.00 0.00 ? 205 GLN A N    1 
ATOM 3181 C CA   . GLN A 1 205 ? 493.549 19.551  -14.468 1.00 0.00 ? 205 GLN A CA   1 
ATOM 3182 C C    . GLN A 1 205 ? 493.457 18.688  -13.214 1.00 0.00 ? 205 GLN A C    1 
ATOM 3183 O O    . GLN A 1 205 ? 492.823 19.070  -12.230 1.00 0.00 ? 205 GLN A O    1 
ATOM 3184 C CB   . GLN A 1 205 ? 493.585 21.031  -14.081 1.00 0.00 ? 205 GLN A CB   1 
ATOM 3185 C CG   . GLN A 1 205 ? 492.236 21.579  -13.645 1.00 0.00 ? 205 GLN A CG   1 
ATOM 3186 C CD   . GLN A 1 205 ? 492.363 22.800  -12.755 1.00 0.00 ? 205 GLN A CD   1 
ATOM 3187 O OE1  . GLN A 1 205 ? 492.344 23.935  -13.232 1.00 0.00 ? 205 GLN A OE1  1 
ATOM 3188 N NE2  . GLN A 1 205 ? 492.494 22.572  -11.453 1.00 0.00 ? 205 GLN A NE2  1 
ATOM 3189 H H    . GLN A 1 205 ? 491.532 19.171  -14.986 1.00 0.00 ? 205 GLN A H    1 
ATOM 3190 H HA   . GLN A 1 205 ? 494.458 19.304  -14.995 1.00 0.00 ? 205 GLN A HA   1 
ATOM 3191 H HB2  . GLN A 1 205 ? 494.283 21.161  -13.267 1.00 0.00 ? 205 GLN A HB2  1 
ATOM 3192 H HB3  . GLN A 1 205 ? 493.925 21.604  -14.931 1.00 0.00 ? 205 GLN A HB3  1 
ATOM 3193 H HG2  . GLN A 1 205 ? 491.671 21.851  -14.524 1.00 0.00 ? 205 GLN A HG2  1 
ATOM 3194 H HG3  . GLN A 1 205 ? 491.707 20.809  -13.103 1.00 0.00 ? 205 GLN A HG3  1 
ATOM 3195 H HE21 . GLN A 1 205 ? 492.502 21.642  -11.145 1.00 0.00 ? 205 GLN A HE21 1 
ATOM 3196 H HE22 . GLN A 1 205 ? 492.578 23.344  -10.855 1.00 0.00 ? 205 GLN A HE22 1 
ATOM 3197 N N    . GLU A 1 206 ? 494.093 17.522  -13.257 1.00 0.00 ? 206 GLU A N    1 
ATOM 3198 C CA   . GLU A 1 206 ? 494.083 16.603  -12.124 1.00 0.00 ? 206 GLU A CA   1 
ATOM 3199 C C    . GLU A 1 206 ? 495.504 16.210  -11.731 1.00 0.00 ? 206 GLU A C    1 
ATOM 3200 O O    . GLU A 1 206 ? 496.475 16.679  -12.324 1.00 0.00 ? 206 GLU A O    1 
ATOM 3201 C CB   . GLU A 1 206 ? 493.270 15.352  -12.461 1.00 0.00 ? 206 GLU A CB   1 
ATOM 3202 C CG   . GLU A 1 206 ? 493.606 14.757  -13.819 1.00 0.00 ? 206 GLU A CG   1 
ATOM 3203 C CD   . GLU A 1 206 ? 492.904 13.436  -14.066 1.00 0.00 ? 206 GLU A CD   1 
ATOM 3204 O OE1  . GLU A 1 206 ? 493.421 12.395  -13.611 1.00 0.00 ? 206 GLU A OE1  1 
ATOM 3205 O OE2  . GLU A 1 206 ? 491.836 13.443  -14.715 1.00 0.00 ? 206 GLU A OE2  1 
ATOM 3206 H H    . GLU A 1 206 ? 494.581 17.273  -14.069 1.00 0.00 ? 206 GLU A H    1 
ATOM 3207 H HA   . GLU A 1 206 ? 493.619 17.109  -11.290 1.00 0.00 ? 206 GLU A HA   1 
ATOM 3208 H HB2  . GLU A 1 206 ? 493.456 14.602  -11.708 1.00 0.00 ? 206 GLU A HB2  1 
ATOM 3209 H HB3  . GLU A 1 206 ? 492.221 15.606  -12.453 1.00 0.00 ? 206 GLU A HB3  1 
ATOM 3210 H HG2  . GLU A 1 206 ? 493.307 15.455  -14.588 1.00 0.00 ? 206 GLU A HG2  1 
ATOM 3211 H HG3  . GLU A 1 206 ? 494.673 14.597  -13.874 1.00 0.00 ? 206 GLU A HG3  1 
ATOM 3212 N N    . GLY A 1 207 ? 495.617 15.346  -10.727 1.00 0.00 ? 207 GLY A N    1 
ATOM 3213 C CA   . GLY A 1 207 ? 496.923 14.905  -10.273 1.00 0.00 ? 207 GLY A CA   1 
ATOM 3214 C C    . GLY A 1 207 ? 496.834 13.825  -9.213  1.00 0.00 ? 207 GLY A C    1 
ATOM 3215 O O    . GLY A 1 207 ? 497.546 12.823  -9.277  1.00 0.00 ? 207 GLY A O    1 
ATOM 3216 H H    . GLY A 1 207 ? 494.808 15.005  -10.292 1.00 0.00 ? 207 GLY A H    1 
ATOM 3217 H HA2  . GLY A 1 207 ? 497.474 14.520  -11.118 1.00 0.00 ? 207 GLY A HA2  1 
ATOM 3218 H HA3  . GLY A 1 207 ? 497.455 15.751  -9.865  1.00 0.00 ? 207 GLY A HA3  1 
ATOM 3219 N N    . SER A 1 208 ? 495.958 14.029  -8.234  1.00 0.00 ? 208 SER A N    1 
ATOM 3220 C CA   . SER A 1 208 ? 495.779 13.065  -7.154  1.00 0.00 ? 208 SER A CA   1 
ATOM 3221 C C    . SER A 1 208 ? 494.352 12.527  -7.136  1.00 0.00 ? 208 SER A C    1 
ATOM 3222 O O    . SER A 1 208 ? 493.458 13.086  -7.772  1.00 0.00 ? 208 SER A O    1 
ATOM 3223 C CB   . SER A 1 208 ? 496.110 13.710  -5.807  1.00 0.00 ? 208 SER A CB   1 
ATOM 3224 O OG   . SER A 1 208 ? 495.316 14.862  -5.584  1.00 0.00 ? 208 SER A OG   1 
ATOM 3225 H H    . SER A 1 208 ? 495.419 14.848  -8.238  1.00 0.00 ? 208 SER A H    1 
ATOM 3226 H HA   . SER A 1 208 ? 496.458 12.244  -7.327  1.00 0.00 ? 208 SER A HA   1 
ATOM 3227 H HB2  . SER A 1 208 ? 495.923 13.001  -5.015  1.00 0.00 ? 208 SER A HB2  1 
ATOM 3228 H HB3  . SER A 1 208 ? 497.152 13.997  -5.795  1.00 0.00 ? 208 SER A HB3  1 
ATOM 3229 H HG   . SER A 1 208 ? 495.211 15.001  -4.640  1.00 0.00 ? 208 SER A HG   1 
ATOM 3230 N N    . HIS A 1 209 ? 494.145 11.438  -6.403  1.00 0.00 ? 209 HIS A N    1 
ATOM 3231 C CA   . HIS A 1 209 ? 492.827 10.823  -6.301  1.00 0.00 ? 209 HIS A CA   1 
ATOM 3232 C C    . HIS A 1 209 ? 491.896 11.673  -5.435  1.00 0.00 ? 209 HIS A C    1 
ATOM 3233 O O    . HIS A 1 209 ? 492.110 11.805  -4.230  1.00 0.00 ? 209 HIS A O    1 
ATOM 3234 C CB   . HIS A 1 209 ? 492.944 9.415   -5.714  1.00 0.00 ? 209 HIS A CB   1 
ATOM 3235 C CG   . HIS A 1 209 ? 492.079 8.406   -6.403  1.00 0.00 ? 209 HIS A CG   1 
ATOM 3236 N ND1  . HIS A 1 209 ? 490.982 7.821   -5.806  1.00 0.00 ? 209 HIS A ND1  1 
ATOM 3237 C CD2  . HIS A 1 209 ? 492.153 7.878   -7.648  1.00 0.00 ? 209 HIS A CD2  1 
ATOM 3238 C CE1  . HIS A 1 209 ? 490.420 6.976   -6.653  1.00 0.00 ? 209 HIS A CE1  1 
ATOM 3239 N NE2  . HIS A 1 209 ? 491.111 6.993   -7.778  1.00 0.00 ? 209 HIS A NE2  1 
ATOM 3240 H H    . HIS A 1 209 ? 494.898 11.038  -5.918  1.00 0.00 ? 209 HIS A H    1 
ATOM 3241 H HA   . HIS A 1 209 ? 492.417 10.755  -7.296  1.00 0.00 ? 209 HIS A HA   1 
ATOM 3242 H HB2  . HIS A 1 209 ? 493.968 9.083   -5.794  1.00 0.00 ? 209 HIS A HB2  1 
ATOM 3243 H HB3  . HIS A 1 209 ? 492.660 9.441   -4.672  1.00 0.00 ? 209 HIS A HB3  1 
ATOM 3244 H HD1  . HIS A 1 209 ? 490.663 7.997   -4.896  1.00 0.00 ? 209 HIS A HD1  1 
ATOM 3245 H HD2  . HIS A 1 209 ? 492.895 8.110   -8.400  1.00 0.00 ? 209 HIS A HD2  1 
ATOM 3246 H HE1  . HIS A 1 209 ? 489.544 6.375   -6.459  1.00 0.00 ? 209 HIS A HE1  1 
ATOM 3247 H HE2  . HIS A 1 209 ? 490.860 6.526   -8.602  1.00 0.00 ? 209 HIS A HE2  1 
ATOM 3248 N N    . PRO A 1 210 ? 490.847 12.265  -6.036  1.00 0.00 ? 210 PRO A N    1 
ATOM 3249 C CA   . PRO A 1 210 ? 489.890 13.102  -5.304  1.00 0.00 ? 210 PRO A CA   1 
ATOM 3250 C C    . PRO A 1 210 ? 489.033 12.291  -4.337  1.00 0.00 ? 210 PRO A C    1 
ATOM 3251 O O    . PRO A 1 210 ? 489.071 11.061  -4.340  1.00 0.00 ? 210 PRO A O    1 
ATOM 3252 C CB   . PRO A 1 210 ? 489.021 13.705  -6.410  1.00 0.00 ? 210 PRO A CB   1 
ATOM 3253 C CG   . PRO A 1 210 ? 489.122 12.741  -7.540  1.00 0.00 ? 210 PRO A CG   1 
ATOM 3254 C CD   . PRO A 1 210 ? 490.509 12.166  -7.469  1.00 0.00 ? 210 PRO A CD   1 
ATOM 3255 H HA   . PRO A 1 210 ? 490.390 13.892  -4.763  1.00 0.00 ? 210 PRO A HA   1 
ATOM 3256 H HB2  . PRO A 1 210 ? 488.004 13.801  -6.061  1.00 0.00 ? 210 PRO A HB2  1 
ATOM 3257 H HB3  . PRO A 1 210 ? 489.407 14.676  -6.685  1.00 0.00 ? 210 PRO A HB3  1 
ATOM 3258 H HG2  . PRO A 1 210 ? 488.386 11.960  -7.424  1.00 0.00 ? 210 PRO A HG2  1 
ATOM 3259 H HG3  . PRO A 1 210 ? 488.979 13.257  -8.478  1.00 0.00 ? 210 PRO A HG3  1 
ATOM 3260 H HD2  . PRO A 1 210 ? 490.508 11.136  -7.795  1.00 0.00 ? 210 PRO A HD2  1 
ATOM 3261 H HD3  . PRO A 1 210 ? 491.192 12.752  -8.067  1.00 0.00 ? 210 PRO A HD3  1 
ATOM 3262 N N    . GLN A 1 211 ? 488.261 12.989  -3.511  1.00 0.00 ? 211 GLN A N    1 
ATOM 3263 C CA   . GLN A 1 211 ? 487.394 12.334  -2.538  1.00 0.00 ? 211 GLN A CA   1 
ATOM 3264 C C    . GLN A 1 211 ? 486.012 12.071  -3.130  1.00 0.00 ? 211 GLN A C    1 
ATOM 3265 O O    . GLN A 1 211 ? 485.588 12.751  -4.064  1.00 0.00 ? 211 GLN A O    1 
ATOM 3266 C CB   . GLN A 1 211 ? 487.267 13.193  -1.278  1.00 0.00 ? 211 GLN A CB   1 
ATOM 3267 C CG   . GLN A 1 211 ? 488.564 13.323  -0.497  1.00 0.00 ? 211 GLN A CG   1 
ATOM 3268 C CD   . GLN A 1 211 ? 488.919 12.056  0.257   1.00 0.00 ? 211 GLN A CD   1 
ATOM 3269 O OE1  . GLN A 1 211 ? 488.096 11.503  0.986   1.00 0.00 ? 211 GLN A OE1  1 
ATOM 3270 N NE2  . GLN A 1 211 ? 490.151 11.591  0.085   1.00 0.00 ? 211 GLN A NE2  1 
ATOM 3271 H H    . GLN A 1 211 ? 488.275 13.968  -3.556  1.00 0.00 ? 211 GLN A H    1 
ATOM 3272 H HA   . GLN A 1 211 ? 487.846 11.390  -2.275  1.00 0.00 ? 211 GLN A HA   1 
ATOM 3273 H HB2  . GLN A 1 211 ? 486.942 14.183  -1.563  1.00 0.00 ? 211 GLN A HB2  1 
ATOM 3274 H HB3  . GLN A 1 211 ? 486.523 12.753  -0.630  1.00 0.00 ? 211 GLN A HB3  1 
ATOM 3275 H HG2  . GLN A 1 211 ? 489.363 13.549  -1.186  1.00 0.00 ? 211 GLN A HG2  1 
ATOM 3276 H HG3  . GLN A 1 211 ? 488.462 14.131  0.213   1.00 0.00 ? 211 GLN A HG3  1 
ATOM 3277 H HE21 . GLN A 1 211 ? 490.753 12.084  -0.511  1.00 0.00 ? 211 GLN A HE21 1 
ATOM 3278 H HE22 . GLN A 1 211 ? 490.408 10.774  0.560   1.00 0.00 ? 211 GLN A HE22 1 
ATOM 3279 N N    . PRO A 1 212 ? 485.288 11.074  -2.592  1.00 0.00 ? 212 PRO A N    1 
ATOM 3280 C CA   . PRO A 1 212 ? 483.948 10.723  -3.072  1.00 0.00 ? 212 PRO A CA   1 
ATOM 3281 C C    . PRO A 1 212 ? 482.912 11.789  -2.729  1.00 0.00 ? 212 PRO A C    1 
ATOM 3282 O O    . PRO A 1 212 ? 481.975 11.539  -1.969  1.00 0.00 ? 212 PRO A O    1 
ATOM 3283 C CB   . PRO A 1 212 ? 483.638 9.417   -2.337  1.00 0.00 ? 212 PRO A CB   1 
ATOM 3284 C CG   . PRO A 1 212 ? 484.465 9.473   -1.100  1.00 0.00 ? 212 PRO A CG   1 
ATOM 3285 C CD   . PRO A 1 212 ? 485.719 10.213  -1.474  1.00 0.00 ? 212 PRO A CD   1 
ATOM 3286 H HA   . PRO A 1 212 ? 483.943 10.549  -4.138  1.00 0.00 ? 212 PRO A HA   1 
ATOM 3287 H HB2  . PRO A 1 212 ? 482.583 9.372   -2.107  1.00 0.00 ? 212 PRO A HB2  1 
ATOM 3288 H HB3  . PRO A 1 212 ? 483.913 8.577   -2.957  1.00 0.00 ? 212 PRO A HB3  1 
ATOM 3289 H HG2  . PRO A 1 212 ? 483.932 10.006  -0.326  1.00 0.00 ? 212 PRO A HG2  1 
ATOM 3290 H HG3  . PRO A 1 212 ? 484.704 8.473   -0.772  1.00 0.00 ? 212 PRO A HG3  1 
ATOM 3291 H HD2  . PRO A 1 212 ? 486.069 10.807  -0.643  1.00 0.00 ? 212 PRO A HD2  1 
ATOM 3292 H HD3  . PRO A 1 212 ? 486.484 9.521   -1.794  1.00 0.00 ? 212 PRO A HD3  1 
ATOM 3293 N N    . LEU A 1 213 ? 483.087 12.980  -3.293  1.00 0.00 ? 213 LEU A N    1 
ATOM 3294 C CA   . LEU A 1 213 ? 482.167 14.084  -3.048  1.00 0.00 ? 213 LEU A CA   1 
ATOM 3295 C C    . LEU A 1 213 ? 481.126 14.183  -4.158  1.00 0.00 ? 213 LEU A C    1 
ATOM 3296 O O    . LEU A 1 213 ? 481.303 13.623  -5.240  1.00 0.00 ? 213 LEU A O    1 
ATOM 3297 C CB   . LEU A 1 213 ? 482.938 15.402  -2.935  1.00 0.00 ? 213 LEU A CB   1 
ATOM 3298 C CG   . LEU A 1 213 ? 483.457 15.733  -1.537  1.00 0.00 ? 213 LEU A CG   1 
ATOM 3299 C CD1  . LEU A 1 213 ? 482.305 16.125  -0.627  1.00 0.00 ? 213 LEU A CD1  1 
ATOM 3300 C CD2  . LEU A 1 213 ? 484.224 14.554  -0.959  1.00 0.00 ? 213 LEU A CD2  1 
ATOM 3301 H H    . LEU A 1 213 ? 483.852 13.118  -3.890  1.00 0.00 ? 213 LEU A H    1 
ATOM 3302 H HA   . LEU A 1 213 ? 481.662 13.893  -2.113  1.00 0.00 ? 213 LEU A HA   1 
ATOM 3303 H HB2  . LEU A 1 213 ? 483.781 15.361  -3.609  1.00 0.00 ? 213 LEU A HB2  1 
ATOM 3304 H HB3  . LEU A 1 213 ? 482.285 16.203  -3.248  1.00 0.00 ? 213 LEU A HB3  1 
ATOM 3305 H HG   . LEU A 1 213 ? 484.132 16.575  -1.600  1.00 0.00 ? 213 LEU A HG   1 
ATOM 3306 H HD11 . LEU A 1 213 ? 482.625 16.910  0.042   1.00 0.00 ? 213 LEU A HD11 1 
ATOM 3307 H HD12 . LEU A 1 213 ? 481.992 15.266  -0.052  1.00 0.00 ? 213 LEU A HD12 1 
ATOM 3308 H HD13 . LEU A 1 213 ? 481.480 16.477  -1.228  1.00 0.00 ? 213 LEU A HD13 1 
ATOM 3309 H HD21 . LEU A 1 213 ? 483.550 13.930  -0.390  1.00 0.00 ? 213 LEU A HD21 1 
ATOM 3310 H HD22 . LEU A 1 213 ? 485.011 14.916  -0.314  1.00 0.00 ? 213 LEU A HD22 1 
ATOM 3311 H HD23 . LEU A 1 213 ? 484.655 13.978  -1.765  1.00 0.00 ? 213 LEU A HD23 1 
ATOM 3312 N N    . GLY A 1 214 ? 480.041 14.899  -3.883  1.00 0.00 ? 214 GLY A N    1 
ATOM 3313 C CA   . GLY A 1 214 ? 478.987 15.056  -4.868  1.00 0.00 ? 214 GLY A CA   1 
ATOM 3314 C C    . GLY A 1 214 ? 478.048 13.867  -4.907  1.00 0.00 ? 214 GLY A C    1 
ATOM 3315 O O    . GLY A 1 214 ? 476.844 14.010  -4.693  1.00 0.00 ? 214 GLY A O    1 
ATOM 3316 H H    . GLY A 1 214 ? 479.954 15.322  -3.003  1.00 0.00 ? 214 GLY A H    1 
ATOM 3317 H HA2  . GLY A 1 214 ? 478.418 15.943  -4.631  1.00 0.00 ? 214 GLY A HA2  1 
ATOM 3318 H HA3  . GLY A 1 214 ? 479.436 15.179  -5.843  1.00 0.00 ? 214 GLY A HA3  1 
ATOM 3319 N N    . GLY A 1 215 ? 478.600 12.689  -5.181  1.00 0.00 ? 215 GLY A N    1 
ATOM 3320 C CA   . GLY A 1 215 ? 477.791 11.486  -5.241  1.00 0.00 ? 215 GLY A CA   1 
ATOM 3321 C C    . GLY A 1 215 ? 477.768 10.872  -6.630  1.00 0.00 ? 215 GLY A C    1 
ATOM 3322 O O    . GLY A 1 215 ? 477.566 11.580  -7.616  1.00 0.00 ? 215 GLY A O    1 
ATOM 3323 H H    . GLY A 1 215 ? 479.565 12.636  -5.341  1.00 0.00 ? 215 GLY A H    1 
ATOM 3324 H HA2  . GLY A 1 215 ? 478.189 10.765  -4.545  1.00 0.00 ? 215 GLY A HA2  1 
ATOM 3325 H HA3  . GLY A 1 215 ? 476.780 11.729  -4.951  1.00 0.00 ? 215 GLY A HA3  1 
ATOM 3326 N N    . PRO A 1 216 ? 477.970 9.546   -6.744  1.00 0.00 ? 216 PRO A N    1 
ATOM 3327 C CA   . PRO A 1 216 ? 477.967 8.855   -8.035  1.00 0.00 ? 216 PRO A CA   1 
ATOM 3328 C C    . PRO A 1 216 ? 476.576 8.806   -8.655  1.00 0.00 ? 216 PRO A C    1 
ATOM 3329 O O    . PRO A 1 216 ? 475.569 8.948   -7.962  1.00 0.00 ? 216 PRO A O    1 
ATOM 3330 C CB   . PRO A 1 216 ? 478.451 7.435   -7.698  1.00 0.00 ? 216 PRO A CB   1 
ATOM 3331 C CG   . PRO A 1 216 ? 478.983 7.514   -6.306  1.00 0.00 ? 216 PRO A CG   1 
ATOM 3332 C CD   . PRO A 1 216 ? 478.217 8.614   -5.638  1.00 0.00 ? 216 PRO A CD   1 
ATOM 3333 H HA   . PRO A 1 216 ? 478.653 9.316   -8.731  1.00 0.00 ? 216 PRO A HA   1 
ATOM 3334 H HB2  . PRO A 1 216 ? 477.622 6.747   -7.762  1.00 0.00 ? 216 PRO A HB2  1 
ATOM 3335 H HB3  . PRO A 1 216 ? 479.221 7.142   -8.396  1.00 0.00 ? 216 PRO A HB3  1 
ATOM 3336 H HG2  . PRO A 1 216 ? 478.818 6.578   -5.795  1.00 0.00 ? 216 PRO A HG2  1 
ATOM 3337 H HG3  . PRO A 1 216 ? 480.036 7.751   -6.328  1.00 0.00 ? 216 PRO A HG3  1 
ATOM 3338 H HD2  . PRO A 1 216 ? 477.289 8.239   -5.234  1.00 0.00 ? 216 PRO A HD2  1 
ATOM 3339 H HD3  . PRO A 1 216 ? 478.813 9.076   -4.867  1.00 0.00 ? 216 PRO A HD3  1 
ATOM 3340 N N    . GLU A 1 217 ? 476.531 8.603   -9.965  1.00 0.00 ? 217 GLU A N    1 
ATOM 3341 C CA   . GLU A 1 217 ? 475.268 8.532   -10.686 1.00 0.00 ? 217 GLU A CA   1 
ATOM 3342 C C    . GLU A 1 217 ? 474.550 7.216   -10.397 1.00 0.00 ? 217 GLU A C    1 
ATOM 3343 O O    . GLU A 1 217 ? 475.189 6.185   -10.186 1.00 0.00 ? 217 GLU A O    1 
ATOM 3344 C CB   . GLU A 1 217 ? 475.506 8.676   -12.190 1.00 0.00 ? 217 GLU A CB   1 
ATOM 3345 C CG   . GLU A 1 217 ? 476.051 10.037  -12.592 1.00 0.00 ? 217 GLU A CG   1 
ATOM 3346 C CD   . GLU A 1 217 ? 474.954 11.033  -12.913 1.00 0.00 ? 217 GLU A CD   1 
ATOM 3347 O OE1  . GLU A 1 217 ? 474.176 10.776  -13.856 1.00 0.00 ? 217 GLU A OE1  1 
ATOM 3348 O OE2  . GLU A 1 217 ? 474.872 12.069  -12.221 1.00 0.00 ? 217 GLU A OE2  1 
ATOM 3349 H H    . GLU A 1 217 ? 477.367 8.496   -10.458 1.00 0.00 ? 217 GLU A H    1 
ATOM 3350 H HA   . GLU A 1 217 ? 474.649 9.350   -10.349 1.00 0.00 ? 217 GLU A HA   1 
ATOM 3351 H HB2  . GLU A 1 217 ? 476.213 7.922   -12.505 1.00 0.00 ? 217 GLU A HB2  1 
ATOM 3352 H HB3  . GLU A 1 217 ? 474.572 8.520   -12.708 1.00 0.00 ? 217 GLU A HB3  1 
ATOM 3353 H HG2  . GLU A 1 217 ? 476.644 10.428  -11.779 1.00 0.00 ? 217 GLU A HG2  1 
ATOM 3354 H HG3  . GLU A 1 217 ? 476.675 9.917   -13.466 1.00 0.00 ? 217 GLU A HG3  1 
ATOM 3355 N N    . PRO A 1 218 ? 473.207 7.233   -10.386 1.00 0.00 ? 218 PRO A N    1 
ATOM 3356 C CA   . PRO A 1 218 ? 472.404 6.034   -10.123 1.00 0.00 ? 218 PRO A CA   1 
ATOM 3357 C C    . PRO A 1 218 ? 472.667 4.933   -11.142 1.00 0.00 ? 218 PRO A C    1 
ATOM 3358 O O    . PRO A 1 218 ? 472.733 5.191   -12.344 1.00 0.00 ? 218 PRO A O    1 
ATOM 3359 C CB   . PRO A 1 218 ? 470.957 6.525   -10.238 1.00 0.00 ? 218 PRO A CB   1 
ATOM 3360 C CG   . PRO A 1 218 ? 471.031 8.006   -10.082 1.00 0.00 ? 218 PRO A CG   1 
ATOM 3361 C CD   . PRO A 1 218 ? 472.368 8.417   -10.629 1.00 0.00 ? 218 PRO A CD   1 
ATOM 3362 H HA   . PRO A 1 218 ? 472.581 5.651   -9.128  1.00 0.00 ? 218 PRO A HA   1 
ATOM 3363 H HB2  . PRO A 1 218 ? 470.559 6.247   -11.203 1.00 0.00 ? 218 PRO A HB2  1 
ATOM 3364 H HB3  . PRO A 1 218 ? 470.362 6.077   -9.456  1.00 0.00 ? 218 PRO A HB3  1 
ATOM 3365 H HG2  . PRO A 1 218 ? 470.236 8.474   -10.645 1.00 0.00 ? 218 PRO A HG2  1 
ATOM 3366 H HG3  . PRO A 1 218 ? 470.957 8.269   -9.037  1.00 0.00 ? 218 PRO A HG3  1 
ATOM 3367 H HD2  . PRO A 1 218 ? 472.296 8.629   -11.686 1.00 0.00 ? 218 PRO A HD2  1 
ATOM 3368 H HD3  . PRO A 1 218 ? 472.748 9.274   -10.095 1.00 0.00 ? 218 PRO A HD3  1 
ATOM 3369 N N    . GLY A 1 219 ? 472.816 3.706   -10.658 1.00 0.00 ? 219 GLY A N    1 
ATOM 3370 C CA   . GLY A 1 219 ? 473.069 2.590   -11.542 1.00 0.00 ? 219 GLY A CA   1 
ATOM 3371 C C    . GLY A 1 219 ? 473.738 1.428   -10.834 1.00 0.00 ? 219 GLY A C    1 
ATOM 3372 O O    . GLY A 1 219 ? 473.578 1.255   -9.625  1.00 0.00 ? 219 GLY A O    1 
ATOM 3373 H H    . GLY A 1 219 ? 472.756 3.558   -9.694  1.00 0.00 ? 219 GLY A H    1 
ATOM 3374 H HA2  . GLY A 1 219 ? 472.133 2.254   -11.960 1.00 0.00 ? 219 GLY A HA2  1 
ATOM 3375 H HA3  . GLY A 1 219 ? 473.708 2.924   -12.345 1.00 0.00 ? 219 GLY A HA3  1 
ATOM 3376 N N    . PRO A 1 220 ? 474.503 0.612   -11.571 1.00 0.00 ? 220 PRO A N    1 
ATOM 3377 C CA   . PRO A 1 220 ? 475.208 -0.545  -11.010 1.00 0.00 ? 220 PRO A CA   1 
ATOM 3378 C C    . PRO A 1 220 ? 476.282 -0.134  -10.009 1.00 0.00 ? 220 PRO A C    1 
ATOM 3379 O O    . PRO A 1 220 ? 476.594 -0.876  -9.077  1.00 0.00 ? 220 PRO A O    1 
ATOM 3380 C CB   . PRO A 1 220 ? 475.847 -1.208  -12.236 1.00 0.00 ? 220 PRO A CB   1 
ATOM 3381 C CG   . PRO A 1 220 ? 475.927 -0.128  -13.259 1.00 0.00 ? 220 PRO A CG   1 
ATOM 3382 C CD   . PRO A 1 220 ? 474.741 0.761   -13.013 1.00 0.00 ? 220 PRO A CD   1 
ATOM 3383 H HA   . PRO A 1 220 ? 474.524 -1.235  -10.539 1.00 0.00 ? 220 PRO A HA   1 
ATOM 3384 H HB2  . PRO A 1 220 ? 476.828 -1.579  -11.976 1.00 0.00 ? 220 PRO A HB2  1 
ATOM 3385 H HB3  . PRO A 1 220 ? 475.225 -2.024  -12.572 1.00 0.00 ? 220 PRO A HB3  1 
ATOM 3386 H HG2  . PRO A 1 220 ? 476.844 0.429   -13.135 1.00 0.00 ? 220 PRO A HG2  1 
ATOM 3387 H HG3  . PRO A 1 220 ? 475.876 -0.555  -14.250 1.00 0.00 ? 220 PRO A HG3  1 
ATOM 3388 H HD2  . PRO A 1 220 ? 474.977 1.786   -13.258 1.00 0.00 ? 220 PRO A HD2  1 
ATOM 3389 H HD3  . PRO A 1 220 ? 473.886 0.424   -13.579 1.00 0.00 ? 220 PRO A HD3  1 
ATOM 3390 N N    . TYR A 1 221 ? 476.843 1.053   -10.208 1.00 0.00 ? 221 TYR A N    1 
ATOM 3391 C CA   . TYR A 1 221 ? 477.881 1.568   -9.324  1.00 0.00 ? 221 TYR A CA   1 
ATOM 3392 C C    . TYR A 1 221 ? 477.303 1.929   -7.959  1.00 0.00 ? 221 TYR A C    1 
ATOM 3393 O O    . TYR A 1 221 ? 477.994 1.861   -6.942  1.00 0.00 ? 221 TYR A O    1 
ATOM 3394 C CB   . TYR A 1 221 ? 478.549 2.792   -9.951  1.00 0.00 ? 221 TYR A CB   1 
ATOM 3395 C CG   . TYR A 1 221 ? 479.442 2.461   -11.125 1.00 0.00 ? 221 TYR A CG   1 
ATOM 3396 C CD1  . TYR A 1 221 ? 478.902 2.060   -12.340 1.00 0.00 ? 221 TYR A CD1  1 
ATOM 3397 C CD2  . TYR A 1 221 ? 480.824 2.548   -11.019 1.00 0.00 ? 221 TYR A CD2  1 
ATOM 3398 C CE1  . TYR A 1 221 ? 479.713 1.755   -13.416 1.00 0.00 ? 221 TYR A CE1  1 
ATOM 3399 C CE2  . TYR A 1 221 ? 481.643 2.245   -12.091 1.00 0.00 ? 221 TYR A CE2  1 
ATOM 3400 C CZ   . TYR A 1 221 ? 481.082 1.849   -13.287 1.00 0.00 ? 221 TYR A CZ   1 
ATOM 3401 O OH   . TYR A 1 221 ? 481.893 1.547   -14.356 1.00 0.00 ? 221 TYR A OH   1 
ATOM 3402 H H    . TYR A 1 221 ? 476.550 1.598   -10.968 1.00 0.00 ? 221 TYR A H    1 
ATOM 3403 H HA   . TYR A 1 221 ? 478.621 0.792   -9.194  1.00 0.00 ? 221 TYR A HA   1 
ATOM 3404 H HB2  . TYR A 1 221 ? 477.784 3.470   -10.299 1.00 0.00 ? 221 TYR A HB2  1 
ATOM 3405 H HB3  . TYR A 1 221 ? 479.151 3.288   -9.204  1.00 0.00 ? 221 TYR A HB3  1 
ATOM 3406 H HD1  . TYR A 1 221 ? 477.829 1.988   -12.439 1.00 0.00 ? 221 TYR A HD1  1 
ATOM 3407 H HD2  . TYR A 1 221 ? 481.260 2.858   -10.080 1.00 0.00 ? 221 TYR A HD2  1 
ATOM 3408 H HE1  . TYR A 1 221 ? 479.273 1.444   -14.352 1.00 0.00 ? 221 TYR A HE1  1 
ATOM 3409 H HE2  . TYR A 1 221 ? 482.715 2.320   -11.989 1.00 0.00 ? 221 TYR A HE2  1 
ATOM 3410 H HH   . TYR A 1 221 ? 482.017 2.332   -14.896 1.00 0.00 ? 221 TYR A HH   1 
ATOM 3411 N N    . ALA A 1 222 ? 476.030 2.314   -7.944  1.00 0.00 ? 222 ALA A N    1 
ATOM 3412 C CA   . ALA A 1 222 ? 475.356 2.685   -6.706  1.00 0.00 ? 222 ALA A CA   1 
ATOM 3413 C C    . ALA A 1 222 ? 473.841 2.643   -6.876  1.00 0.00 ? 222 ALA A C    1 
ATOM 3414 O O    . ALA A 1 222 ? 473.250 3.534   -7.486  1.00 0.00 ? 222 ALA A O    1 
ATOM 3415 C CB   . ALA A 1 222 ? 475.800 4.070   -6.258  1.00 0.00 ? 222 ALA A CB   1 
ATOM 3416 H H    . ALA A 1 222 ? 475.532 2.347   -8.787  1.00 0.00 ? 222 ALA A H    1 
ATOM 3417 H HA   . ALA A 1 222 ? 475.643 1.976   -5.943  1.00 0.00 ? 222 ALA A HA   1 
ATOM 3418 H HB1  . ALA A 1 222 ? 475.706 4.762   -7.082  1.00 0.00 ? 222 ALA A HB1  1 
ATOM 3419 H HB2  . ALA A 1 222 ? 476.830 4.031   -5.936  1.00 0.00 ? 222 ALA A HB2  1 
ATOM 3420 H HB3  . ALA A 1 222 ? 475.179 4.400   -5.439  1.00 0.00 ? 222 ALA A HB3  1 
ATOM 3421 N N    . GLN A 1 223 ? 473.216 1.601   -6.334  1.00 0.00 ? 223 GLN A N    1 
ATOM 3422 C CA   . GLN A 1 223 ? 471.771 1.445   -6.428  1.00 0.00 ? 223 GLN A CA   1 
ATOM 3423 C C    . GLN A 1 223 ? 471.120 1.533   -5.048  1.00 0.00 ? 223 GLN A C    1 
ATOM 3424 O O    . GLN A 1 223 ? 471.728 1.178   -4.038  1.00 0.00 ? 223 GLN A O    1 
ATOM 3425 C CB   . GLN A 1 223 ? 471.420 0.113   -7.092  1.00 0.00 ? 223 GLN A CB   1 
ATOM 3426 C CG   . GLN A 1 223 ? 471.931 -1.101  -6.334  1.00 0.00 ? 223 GLN A CG   1 
ATOM 3427 C CD   . GLN A 1 223 ? 472.565 -2.133  -7.245  1.00 0.00 ? 223 GLN A CD   1 
ATOM 3428 O OE1  . GLN A 1 223 ? 473.617 -1.892  -7.839  1.00 0.00 ? 223 GLN A OE1  1 
ATOM 3429 N NE2  . GLN A 1 223 ? 471.927 -3.292  -7.362  1.00 0.00 ? 223 GLN A NE2  1 
ATOM 3430 H H    . GLN A 1 223 ? 473.737 0.924   -5.861  1.00 0.00 ? 223 GLN A H    1 
ATOM 3431 H HA   . GLN A 1 223 ? 471.394 2.250   -7.040  1.00 0.00 ? 223 GLN A HA   1 
ATOM 3432 H HB2  . GLN A 1 223 ? 470.346 0.035   -7.170  1.00 0.00 ? 223 GLN A HB2  1 
ATOM 3433 H HB3  . GLN A 1 223 ? 471.846 0.096   -8.084  1.00 0.00 ? 223 GLN A HB3  1 
ATOM 3434 H HG2  . GLN A 1 223 ? 472.669 -0.776  -5.615  1.00 0.00 ? 223 GLN A HG2  1 
ATOM 3435 H HG3  . GLN A 1 223 ? 471.102 -1.560  -5.816  1.00 0.00 ? 223 GLN A HG3  1 
ATOM 3436 H HE21 . GLN A 1 223 ? 471.094 -3.414  -6.861  1.00 0.00 ? 223 GLN A HE21 1 
ATOM 3437 H HE22 . GLN A 1 223 ? 472.314 -3.977  -7.946  1.00 0.00 ? 223 GLN A HE22 1 
ATOM 3438 N N    . PRO A 1 224 ? 469.871 2.024   -4.994  1.00 0.00 ? 224 PRO A N    1 
ATOM 3439 C CA   . PRO A 1 224 ? 469.120 2.182   -3.739  1.00 0.00 ? 224 PRO A CA   1 
ATOM 3440 C C    . PRO A 1 224 ? 469.067 0.908   -2.896  1.00 0.00 ? 224 PRO A C    1 
ATOM 3441 O O    . PRO A 1 224 ? 469.794 -0.052  -3.148  1.00 0.00 ? 224 PRO A O    1 
ATOM 3442 C CB   . PRO A 1 224 ? 467.720 2.567   -4.218  1.00 0.00 ? 224 PRO A CB   1 
ATOM 3443 C CG   . PRO A 1 224 ? 467.950 3.229   -5.530  1.00 0.00 ? 224 PRO A CG   1 
ATOM 3444 C CD   . PRO A 1 224 ? 469.093 2.485   -6.158  1.00 0.00 ? 224 PRO A CD   1 
ATOM 3445 H HA   . PRO A 1 224 ? 469.525 2.983   -3.141  1.00 0.00 ? 224 PRO A HA   1 
ATOM 3446 H HB2  . PRO A 1 224 ? 467.113 1.679   -4.320  1.00 0.00 ? 224 PRO A HB2  1 
ATOM 3447 H HB3  . PRO A 1 224 ? 467.267 3.242   -3.509  1.00 0.00 ? 224 PRO A HB3  1 
ATOM 3448 H HG2  . PRO A 1 224 ? 467.065 3.153   -6.144  1.00 0.00 ? 224 PRO A HG2  1 
ATOM 3449 H HG3  . PRO A 1 224 ? 468.215 4.265   -5.379  1.00 0.00 ? 224 PRO A HG3  1 
ATOM 3450 H HD2  . PRO A 1 224 ? 468.730 1.647   -6.735  1.00 0.00 ? 224 PRO A HD2  1 
ATOM 3451 H HD3  . PRO A 1 224 ? 469.682 3.145   -6.777  1.00 0.00 ? 224 PRO A HD3  1 
ATOM 3452 N N    . SER A 1 225 ? 468.201 0.926   -1.884  1.00 0.00 ? 225 SER A N    1 
ATOM 3453 C CA   . SER A 1 225 ? 468.035 -0.205  -0.972  1.00 0.00 ? 225 SER A CA   1 
ATOM 3454 C C    . SER A 1 225 ? 467.731 -1.503  -1.714  1.00 0.00 ? 225 SER A C    1 
ATOM 3455 O O    . SER A 1 225 ? 466.572 -1.893  -1.850  1.00 0.00 ? 225 SER A O    1 
ATOM 3456 C CB   . SER A 1 225 ? 466.918 0.088   0.026   1.00 0.00 ? 225 SER A CB   1 
ATOM 3457 O OG   . SER A 1 225 ? 465.646 0.025   -0.594  1.00 0.00 ? 225 SER A OG   1 
ATOM 3458 H H    . SER A 1 225 ? 467.661 1.731   -1.739  1.00 0.00 ? 225 SER A H    1 
ATOM 3459 H HA   . SER A 1 225 ? 468.957 -0.330  -0.425  1.00 0.00 ? 225 SER A HA   1 
ATOM 3460 H HB2  . SER A 1 225 ? 466.954 -0.642  0.821   1.00 0.00 ? 225 SER A HB2  1 
ATOM 3461 H HB3  . SER A 1 225 ? 467.056 1.076   0.439   1.00 0.00 ? 225 SER A HB3  1 
ATOM 3462 H HG   . SER A 1 225 ? 465.677 0.484   -1.437  1.00 0.00 ? 225 SER A HG   1 
ATOM 3463 N N    . VAL A 1 226 ? 468.780 -2.181  -2.168  1.00 0.00 ? 226 VAL A N    1 
ATOM 3464 C CA   . VAL A 1 226 ? 468.629 -3.449  -2.872  1.00 0.00 ? 226 VAL A CA   1 
ATOM 3465 C C    . VAL A 1 226 ? 469.075 -4.599  -1.981  1.00 0.00 ? 226 VAL A C    1 
ATOM 3466 O O    . VAL A 1 226 ? 468.497 -5.686  -2.007  1.00 0.00 ? 226 VAL A O    1 
ATOM 3467 C CB   . VAL A 1 226 ? 469.445 -3.479  -4.176  1.00 0.00 ? 226 VAL A CB   1 
ATOM 3468 C CG1  . VAL A 1 226 ? 468.836 -2.548  -5.212  1.00 0.00 ? 226 VAL A CG1  1 
ATOM 3469 C CG2  . VAL A 1 226 ? 470.896 -3.111  -3.906  1.00 0.00 ? 226 VAL A CG2  1 
ATOM 3470 H H    . VAL A 1 226 ? 469.680 -1.827  -2.011  1.00 0.00 ? 226 VAL A H    1 
ATOM 3471 H HA   . VAL A 1 226 ? 467.585 -3.577  -3.116  1.00 0.00 ? 226 VAL A HA   1 
ATOM 3472 H HB   . VAL A 1 226 ? 469.419 -4.484  -4.570  1.00 0.00 ? 226 VAL A HB   1 
ATOM 3473 H HG11 . VAL A 1 226 ? 469.020 -1.523  -4.927  1.00 0.00 ? 226 VAL A HG11 1 
ATOM 3474 H HG12 . VAL A 1 226 ? 467.772 -2.719  -5.270  1.00 0.00 ? 226 VAL A HG12 1 
ATOM 3475 H HG13 . VAL A 1 226 ? 469.284 -2.739  -6.176  1.00 0.00 ? 226 VAL A HG13 1 
ATOM 3476 H HG21 . VAL A 1 226 ? 470.956 -2.074  -3.611  1.00 0.00 ? 226 VAL A HG21 1 
ATOM 3477 H HG22 . VAL A 1 226 ? 471.479 -3.264  -4.803  1.00 0.00 ? 226 VAL A HG22 1 
ATOM 3478 H HG23 . VAL A 1 226 ? 471.285 -3.734  -3.114  1.00 0.00 ? 226 VAL A HG23 1 
ATOM 3479 N N    . ASN A 1 227 ? 470.107 -4.341  -1.187  1.00 0.00 ? 227 ASN A N    1 
ATOM 3480 C CA   . ASN A 1 227 ? 470.643 -5.338  -0.272  1.00 0.00 ? 227 ASN A CA   1 
ATOM 3481 C C    . ASN A 1 227 ? 470.784 -4.766  1.139   1.00 0.00 ? 227 ASN A C    1 
ATOM 3482 O O    . ASN A 1 227 ? 471.335 -5.416  2.027   1.00 0.00 ? 227 ASN A O    1 
ATOM 3483 C CB   . ASN A 1 227 ? 471.999 -5.837  -0.772  1.00 0.00 ? 227 ASN A CB   1 
ATOM 3484 C CG   . ASN A 1 227 ? 472.323 -7.232  -0.273  1.00 0.00 ? 227 ASN A CG   1 
ATOM 3485 O OD1  . ASN A 1 227 ? 472.448 -7.460  0.930   1.00 0.00 ? 227 ASN A OD1  1 
ATOM 3486 N ND2  . ASN A 1 227 ? 472.463 -8.174  -1.199  1.00 0.00 ? 227 ASN A ND2  1 
ATOM 3487 H H    . ASN A 1 227 ? 470.517 -3.451  -1.213  1.00 0.00 ? 227 ASN A H    1 
ATOM 3488 H HA   . ASN A 1 227 ? 469.952 -6.168  -0.244  1.00 0.00 ? 227 ASN A HA   1 
ATOM 3489 H HB2  . ASN A 1 227 ? 471.992 -5.854  -1.852  1.00 0.00 ? 227 ASN A HB2  1 
ATOM 3490 H HB3  . ASN A 1 227 ? 472.771 -5.164  -0.431  1.00 0.00 ? 227 ASN A HB3  1 
ATOM 3491 H HD21 . ASN A 1 227 ? 472.350 -7.920  -2.139  1.00 0.00 ? 227 ASN A HD21 1 
ATOM 3492 H HD22 . ASN A 1 227 ? 472.674 -9.085  -0.904  1.00 0.00 ? 227 ASN A HD22 1 
ATOM 3493 N N    . THR A 1 228 ? 470.279 -3.548  1.342   1.00 0.00 ? 228 THR A N    1 
ATOM 3494 C CA   . THR A 1 228 ? 470.349 -2.902  2.647   1.00 0.00 ? 228 THR A CA   1 
ATOM 3495 C C    . THR A 1 228 ? 468.969 -2.862  3.299   1.00 0.00 ? 228 THR A C    1 
ATOM 3496 O O    . THR A 1 228 ? 468.111 -2.072  2.904   1.00 0.00 ? 228 THR A O    1 
ATOM 3497 C CB   . THR A 1 228 ? 470.907 -1.481  2.509   1.00 0.00 ? 228 THR A CB   1 
ATOM 3498 O OG1  . THR A 1 228 ? 470.946 -1.086  1.148   1.00 0.00 ? 228 THR A OG1  1 
ATOM 3499 C CG2  . THR A 1 228 ? 472.305 -1.338  3.069   1.00 0.00 ? 228 THR A CG2  1 
ATOM 3500 H H    . THR A 1 228 ? 469.846 -3.077  0.601   1.00 0.00 ? 228 THR A H    1 
ATOM 3501 H HA   . THR A 1 228 ? 471.015 -3.481  3.268   1.00 0.00 ? 228 THR A HA   1 
ATOM 3502 H HB   . THR A 1 228 ? 470.265 -0.790  3.044   1.00 0.00 ? 228 THR A HB   1 
ATOM 3503 H HG1  . THR A 1 228 ? 471.360 -0.224  1.076   1.00 0.00 ? 228 THR A HG1  1 
ATOM 3504 H HG21 . THR A 1 228 ? 472.412 -0.366  3.527   1.00 0.00 ? 228 THR A HG21 1 
ATOM 3505 H HG22 . THR A 1 228 ? 473.025 -1.440  2.270   1.00 0.00 ? 228 THR A HG22 1 
ATOM 3506 H HG23 . THR A 1 228 ? 472.476 -2.106  3.808   1.00 0.00 ? 228 THR A HG23 1 
ATOM 3507 N N    . PRO A 1 229 ? 468.732 -3.719  4.308   1.00 0.00 ? 229 PRO A N    1 
ATOM 3508 C CA   . PRO A 1 229 ? 467.447 -3.778  5.009   1.00 0.00 ? 229 PRO A CA   1 
ATOM 3509 C C    . PRO A 1 229 ? 467.205 -2.538  5.863   1.00 0.00 ? 229 PRO A C    1 
ATOM 3510 O O    . PRO A 1 229 ? 466.075 -2.068  5.990   1.00 0.00 ? 229 PRO A O    1 
ATOM 3511 C CB   . PRO A 1 229 ? 467.565 -5.027  5.899   1.00 0.00 ? 229 PRO A CB   1 
ATOM 3512 C CG   . PRO A 1 229 ? 468.782 -5.749  5.420   1.00 0.00 ? 229 PRO A CG   1 
ATOM 3513 C CD   . PRO A 1 229 ? 469.685 -4.701  4.842   1.00 0.00 ? 229 PRO A CD   1 
ATOM 3514 H HA   . PRO A 1 229 ? 466.626 -3.901  4.317   1.00 0.00 ? 229 PRO A HA   1 
ATOM 3515 H HB2  . PRO A 1 229 ? 467.668 -4.726  6.931   1.00 0.00 ? 229 PRO A HB2  1 
ATOM 3516 H HB3  . PRO A 1 229 ? 466.679 -5.634  5.785   1.00 0.00 ? 229 PRO A HB3  1 
ATOM 3517 H HG2  . PRO A 1 229 ? 469.265 -6.245  6.249   1.00 0.00 ? 229 PRO A HG2  1 
ATOM 3518 H HG3  . PRO A 1 229 ? 468.508 -6.467  4.661   1.00 0.00 ? 229 PRO A HG3  1 
ATOM 3519 H HD2  . PRO A 1 229 ? 470.304 -4.264  5.612   1.00 0.00 ? 229 PRO A HD2  1 
ATOM 3520 H HD3  . PRO A 1 229 ? 470.294 -5.117  4.053   1.00 0.00 ? 229 PRO A HD3  1 
ATOM 3521 N N    . LEU A 1 230 ? 468.274 -2.018  6.453   1.00 0.00 ? 230 LEU A N    1 
ATOM 3522 C CA   . LEU A 1 230 ? 468.181 -0.837  7.300   1.00 0.00 ? 230 LEU A CA   1 
ATOM 3523 C C    . LEU A 1 230 ? 469.056 0.306   6.762   1.00 0.00 ? 230 LEU A C    1 
ATOM 3524 O O    . LEU A 1 230 ? 468.530 1.332   6.331   1.00 0.00 ? 230 LEU A O    1 
ATOM 3525 C CB   . LEU A 1 230 ? 468.551 -1.203  8.745   1.00 0.00 ? 230 LEU A CB   1 
ATOM 3526 C CG   . LEU A 1 230 ? 468.219 -0.168  9.832   1.00 0.00 ? 230 LEU A CG   1 
ATOM 3527 C CD1  . LEU A 1 230 ? 468.119 1.246   9.271   1.00 0.00 ? 230 LEU A CD1  1 
ATOM 3528 C CD2  . LEU A 1 230 ? 466.932 -0.547  10.549  1.00 0.00 ? 230 LEU A CD2  1 
ATOM 3529 H H    . LEU A 1 230 ? 469.145 -2.442  6.319   1.00 0.00 ? 230 LEU A H    1 
ATOM 3530 H HA   . LEU A 1 230 ? 467.152 -0.509  7.282   1.00 0.00 ? 230 LEU A HA   1 
ATOM 3531 H HB2  . LEU A 1 230 ? 468.032 -2.117  8.993   1.00 0.00 ? 230 LEU A HB2  1 
ATOM 3532 H HB3  . LEU A 1 230 ? 469.605 -1.401  8.785   1.00 0.00 ? 230 LEU A HB3  1 
ATOM 3533 H HG   . LEU A 1 230 ? 469.016 -0.175  10.558  1.00 0.00 ? 230 LEU A HG   1 
ATOM 3534 H HD11 . LEU A 1 230 ? 469.104 1.595   8.996   1.00 0.00 ? 230 LEU A HD11 1 
ATOM 3535 H HD12 . LEU A 1 230 ? 467.704 1.901   10.023  1.00 0.00 ? 230 LEU A HD12 1 
ATOM 3536 H HD13 . LEU A 1 230 ? 467.479 1.247   8.402   1.00 0.00 ? 230 LEU A HD13 1 
ATOM 3537 H HD21 . LEU A 1 230 ? 466.089 -0.358  9.900   1.00 0.00 ? 230 LEU A HD21 1 
ATOM 3538 H HD22 . LEU A 1 230 ? 466.833 0.044   11.447  1.00 0.00 ? 230 LEU A HD22 1 
ATOM 3539 H HD23 . LEU A 1 230 ? 466.959 -1.595  10.808  1.00 0.00 ? 230 LEU A HD23 1 
ATOM 3540 N N    . PRO A 1 231 ? 470.400 0.169   6.786   1.00 0.00 ? 231 PRO A N    1 
ATOM 3541 C CA   . PRO A 1 231 ? 471.301 1.216   6.306   1.00 0.00 ? 231 PRO A CA   1 
ATOM 3542 C C    . PRO A 1 231 ? 470.857 1.806   4.973   1.00 0.00 ? 231 PRO A C    1 
ATOM 3543 O O    . PRO A 1 231 ? 470.414 1.090   4.076   1.00 0.00 ? 231 PRO A O    1 
ATOM 3544 C CB   . PRO A 1 231 ? 472.663 0.521   6.165   1.00 0.00 ? 231 PRO A CB   1 
ATOM 3545 C CG   . PRO A 1 231 ? 472.465 -0.903  6.581   1.00 0.00 ? 231 PRO A CG   1 
ATOM 3546 C CD   . PRO A 1 231 ? 471.145 -0.987  7.292   1.00 0.00 ? 231 PRO A CD   1 
ATOM 3547 H HA   . PRO A 1 231 ? 471.382 2.016   7.029   1.00 0.00 ? 231 PRO A HA   1 
ATOM 3548 H HB2  . PRO A 1 231 ? 472.993 0.584   5.139   1.00 0.00 ? 231 PRO A HB2  1 
ATOM 3549 H HB3  . PRO A 1 231 ? 473.381 1.016   6.802   1.00 0.00 ? 231 PRO A HB3  1 
ATOM 3550 H HG2  . PRO A 1 231 ? 472.458 -1.540  5.710   1.00 0.00 ? 231 PRO A HG2  1 
ATOM 3551 H HG3  . PRO A 1 231 ? 473.262 -1.195  7.251   1.00 0.00 ? 231 PRO A HG3  1 
ATOM 3552 H HD2  . PRO A 1 231 ? 470.644 -1.908  7.046   1.00 0.00 ? 231 PRO A HD2  1 
ATOM 3553 H HD3  . PRO A 1 231 ? 471.292 -0.910  8.356   1.00 0.00 ? 231 PRO A HD3  1 
ATOM 3554 N N    . ASN A 1 232 ? 470.970 3.121   4.863   1.00 0.00 ? 232 ASN A N    1 
ATOM 3555 C CA   . ASN A 1 232 ? 470.578 3.838   3.659   1.00 0.00 ? 232 ASN A CA   1 
ATOM 3556 C C    . ASN A 1 232 ? 471.722 3.902   2.652   1.00 0.00 ? 232 ASN A C    1 
ATOM 3557 O O    . ASN A 1 232 ? 472.850 3.509   2.950   1.00 0.00 ? 232 ASN A O    1 
ATOM 3558 C CB   . ASN A 1 232 ? 470.139 5.249   4.035   1.00 0.00 ? 232 ASN A CB   1 
ATOM 3559 C CG   . ASN A 1 232 ? 469.234 5.878   2.994   1.00 0.00 ? 232 ASN A CG   1 
ATOM 3560 O OD1  . ASN A 1 232 ? 468.471 5.186   2.320   1.00 0.00 ? 232 ASN A OD1  1 
ATOM 3561 N ND2  . ASN A 1 232 ? 469.316 7.196   2.856   1.00 0.00 ? 232 ASN A ND2  1 
ATOM 3562 H H    . ASN A 1 232 ? 471.321 3.629   5.622   1.00 0.00 ? 232 ASN A H    1 
ATOM 3563 H HA   . ASN A 1 232 ? 469.745 3.316   3.214   1.00 0.00 ? 232 ASN A HA   1 
ATOM 3564 H HB2  . ASN A 1 232 ? 469.604 5.207   4.971   1.00 0.00 ? 232 ASN A HB2  1 
ATOM 3565 H HB3  . ASN A 1 232 ? 471.017 5.870   4.153   1.00 0.00 ? 232 ASN A HB3  1 
ATOM 3566 H HD21 . ASN A 1 232 ? 469.947 7.683   3.426   1.00 0.00 ? 232 ASN A HD21 1 
ATOM 3567 H HD22 . ASN A 1 232 ? 468.742 7.628   2.189   1.00 0.00 ? 232 ASN A HD22 1 
ATOM 3568 N N    . LEU A 1 233 ? 471.421 4.404   1.457   1.00 0.00 ? 233 LEU A N    1 
ATOM 3569 C CA   . LEU A 1 233 ? 472.419 4.526   0.402   1.00 0.00 ? 233 LEU A CA   1 
ATOM 3570 C C    . LEU A 1 233 ? 471.840 5.248   -0.811  1.00 0.00 ? 233 LEU A C    1 
ATOM 3571 O O    . LEU A 1 233 ? 472.074 4.853   -1.954  1.00 0.00 ? 233 LEU A O    1 
ATOM 3572 C CB   . LEU A 1 233 ? 472.937 3.143   -0.004  1.00 0.00 ? 233 LEU A CB   1 
ATOM 3573 C CG   . LEU A 1 233 ? 471.917 2.247   -0.712  1.00 0.00 ? 233 LEU A CG   1 
ATOM 3574 C CD1  . LEU A 1 233 ? 472.557 0.930   -1.121  1.00 0.00 ? 233 LEU A CD1  1 
ATOM 3575 C CD2  . LEU A 1 233 ? 470.711 2.000   0.182   1.00 0.00 ? 233 LEU A CD2  1 
ATOM 3576 H H    . LEU A 1 233 ? 470.505 4.701   1.281   1.00 0.00 ? 233 LEU A H    1 
ATOM 3577 H HA   . LEU A 1 233 ? 473.240 5.107   0.792   1.00 0.00 ? 233 LEU A HA   1 
ATOM 3578 H HB2  . LEU A 1 233 ? 473.783 3.278   -0.661  1.00 0.00 ? 233 LEU A HB2  1 
ATOM 3579 H HB3  . LEU A 1 233 ? 473.273 2.632   0.887   1.00 0.00 ? 233 LEU A HB3  1 
ATOM 3580 H HG   . LEU A 1 233 ? 471.574 2.742   -1.608  1.00 0.00 ? 233 LEU A HG   1 
ATOM 3581 H HD11 . LEU A 1 233 ? 473.016 1.039   -2.093  1.00 0.00 ? 233 LEU A HD11 1 
ATOM 3582 H HD12 . LEU A 1 233 ? 471.801 0.160   -1.164  1.00 0.00 ? 233 LEU A HD12 1 
ATOM 3583 H HD13 . LEU A 1 233 ? 473.310 0.654   -0.397  1.00 0.00 ? 233 LEU A HD13 1 
ATOM 3584 H HD21 . LEU A 1 233 ? 469.982 2.781   0.027   1.00 0.00 ? 233 LEU A HD21 1 
ATOM 3585 H HD22 . LEU A 1 233 ? 471.023 1.999   1.216   1.00 0.00 ? 233 LEU A HD22 1 
ATOM 3586 H HD23 . LEU A 1 233 ? 470.273 1.045   -0.062  1.00 0.00 ? 233 LEU A HD23 1 
ATOM 3587 N N    . GLN A 1 234 ? 471.082 6.310   -0.554  1.00 0.00 ? 234 GLN A N    1 
ATOM 3588 C CA   . GLN A 1 234 ? 470.463 7.091   -1.622  1.00 0.00 ? 234 GLN A CA   1 
ATOM 3589 C C    . GLN A 1 234 ? 471.485 7.495   -2.677  1.00 0.00 ? 234 GLN A C    1 
ATOM 3590 O O    . GLN A 1 234 ? 471.250 7.353   -3.877  1.00 0.00 ? 234 GLN A O    1 
ATOM 3591 C CB   . GLN A 1 234 ? 469.812 8.345   -1.043  1.00 0.00 ? 234 GLN A CB   1 
ATOM 3592 C CG   . GLN A 1 234 ? 470.701 9.100   -0.067  1.00 0.00 ? 234 GLN A CG   1 
ATOM 3593 C CD   . GLN A 1 234 ? 469.944 9.587   1.153   1.00 0.00 ? 234 GLN A CD   1 
ATOM 3594 O OE1  . GLN A 1 234 ? 468.738 9.829   1.094   1.00 0.00 ? 234 GLN A OE1  1 
ATOM 3595 N NE2  . GLN A 1 234 ? 470.650 9.732   2.267   1.00 0.00 ? 234 GLN A NE2  1 
ATOM 3596 H H    . GLN A 1 234 ? 470.932 6.573   0.378   1.00 0.00 ? 234 GLN A H    1 
ATOM 3597 H HA   . GLN A 1 234 ? 469.703 6.481   -2.085  1.00 0.00 ? 234 GLN A HA   1 
ATOM 3598 H HB2  . GLN A 1 234 ? 469.564 9.010   -1.853  1.00 0.00 ? 234 GLN A HB2  1 
ATOM 3599 H HB3  . GLN A 1 234 ? 468.908 8.061   -0.527  1.00 0.00 ? 234 GLN A HB3  1 
ATOM 3600 H HG2  . GLN A 1 234 ? 471.496 8.447   0.259   1.00 0.00 ? 234 GLN A HG2  1 
ATOM 3601 H HG3  . GLN A 1 234 ? 471.124 9.955   -0.574  1.00 0.00 ? 234 GLN A HG3  1 
ATOM 3602 H HE21 . GLN A 1 234 ? 471.607 9.521   2.240   1.00 0.00 ? 234 GLN A HE21 1 
ATOM 3603 H HE22 . GLN A 1 234 ? 470.186 10.046  3.072   1.00 0.00 ? 234 GLN A HE22 1 
ATOM 3604 N N    . ASN A 1 235 ? 472.621 7.996   -2.215  1.00 0.00 ? 235 ASN A N    1 
ATOM 3605 C CA   . ASN A 1 235 ? 473.692 8.423   -3.107  1.00 0.00 ? 235 ASN A CA   1 
ATOM 3606 C C    . ASN A 1 235 ? 475.028 7.835   -2.664  1.00 0.00 ? 235 ASN A C    1 
ATOM 3607 O O    . ASN A 1 235 ? 475.971 7.751   -3.451  1.00 0.00 ? 235 ASN A O    1 
ATOM 3608 C CB   . ASN A 1 235 ? 473.778 9.950   -3.144  1.00 0.00 ? 235 ASN A CB   1 
ATOM 3609 C CG   . ASN A 1 235 ? 474.006 10.551  -1.771  1.00 0.00 ? 235 ASN A CG   1 
ATOM 3610 O OD1  . ASN A 1 235 ? 475.015 10.278  -1.121  1.00 0.00 ? 235 ASN A OD1  1 
ATOM 3611 N ND2  . ASN A 1 235 ? 473.067 11.376  -1.323  1.00 0.00 ? 235 ASN A ND2  1 
ATOM 3612 H H    . ASN A 1 235 ? 472.742 8.082   -1.248  1.00 0.00 ? 235 ASN A H    1 
ATOM 3613 H HA   . ASN A 1 235 ? 473.463 8.059   -4.097  1.00 0.00 ? 235 ASN A HA   1 
ATOM 3614 H HB2  . ASN A 1 235 ? 474.596 10.242  -3.785  1.00 0.00 ? 235 ASN A HB2  1 
ATOM 3615 H HB3  . ASN A 1 235 ? 472.855 10.346  -3.542  1.00 0.00 ? 235 ASN A HB3  1 
ATOM 3616 H HD21 . ASN A 1 235 ? 472.290 11.548  -1.895  1.00 0.00 ? 235 ASN A HD21 1 
ATOM 3617 H HD22 . ASN A 1 235 ? 473.189 11.780  -0.438  1.00 0.00 ? 235 ASN A HD22 1 
ATOM 3618 N N    . GLY A 1 236 ? 475.101 7.425   -1.399  1.00 0.00 ? 236 GLY A N    1 
ATOM 3619 C CA   . GLY A 1 236 ? 476.327 6.847   -0.882  1.00 0.00 ? 236 GLY A CA   1 
ATOM 3620 C C    . GLY A 1 236 ? 476.701 7.387   0.489   1.00 0.00 ? 236 GLY A C    1 
ATOM 3621 O O    . GLY A 1 236 ? 477.117 8.539   0.607   1.00 0.00 ? 236 GLY A O    1 
ATOM 3622 H H    . GLY A 1 236 ? 474.316 7.513   -0.816  1.00 0.00 ? 236 GLY A H    1 
ATOM 3623 H HA2  . GLY A 1 236 ? 476.205 5.777   -0.816  1.00 0.00 ? 236 GLY A HA2  1 
ATOM 3624 H HA3  . GLY A 1 236 ? 477.130 7.063   -1.571  1.00 0.00 ? 236 GLY A HA3  1 
ATOM 3625 N N    . PRO A 1 237 ? 476.563 6.570   1.552   1.00 0.00 ? 237 PRO A N    1 
ATOM 3626 C CA   . PRO A 1 237 ? 476.899 6.981   2.923   1.00 0.00 ? 237 PRO A CA   1 
ATOM 3627 C C    . PRO A 1 237 ? 478.312 7.547   3.031   1.00 0.00 ? 237 PRO A C    1 
ATOM 3628 O O    . PRO A 1 237 ? 478.926 7.910   2.028   1.00 0.00 ? 237 PRO A O    1 
ATOM 3629 C CB   . PRO A 1 237 ? 476.793 5.677   3.720   1.00 0.00 ? 237 PRO A CB   1 
ATOM 3630 C CG   . PRO A 1 237 ? 475.838 4.838   2.946   1.00 0.00 ? 237 PRO A CG   1 
ATOM 3631 C CD   . PRO A 1 237 ? 476.068 5.181   1.501   1.00 0.00 ? 237 PRO A CD   1 
ATOM 3632 H HA   . PRO A 1 237 ? 476.193 7.703   3.307   1.00 0.00 ? 237 PRO A HA   1 
ATOM 3633 H HB2  . PRO A 1 237 ? 477.766 5.211   3.782   1.00 0.00 ? 237 PRO A HB2  1 
ATOM 3634 H HB3  . PRO A 1 237 ? 476.423 5.883   4.712   1.00 0.00 ? 237 PRO A HB3  1 
ATOM 3635 H HG2  . PRO A 1 237 ? 476.042 3.792   3.122   1.00 0.00 ? 237 PRO A HG2  1 
ATOM 3636 H HG3  . PRO A 1 237 ? 474.824 5.077   3.232   1.00 0.00 ? 237 PRO A HG3  1 
ATOM 3637 H HD2  . PRO A 1 237 ? 476.806 4.524   1.069   1.00 0.00 ? 237 PRO A HD2  1 
ATOM 3638 H HD3  . PRO A 1 237 ? 475.143 5.124   0.948   1.00 0.00 ? 237 PRO A HD3  1 
ATOM 3639 N N    . ILE A 1 238 ? 478.831 7.608   4.253   1.00 0.00 ? 238 ILE A N    1 
ATOM 3640 C CA   . ILE A 1 238 ? 480.176 8.120   4.481   1.00 0.00 ? 238 ILE A CA   1 
ATOM 3641 C C    . ILE A 1 238 ? 481.208 7.021   4.274   1.00 0.00 ? 238 ILE A C    1 
ATOM 3642 O O    . ILE A 1 238 ? 481.307 6.093   5.077   1.00 0.00 ? 238 ILE A O    1 
ATOM 3643 C CB   . ILE A 1 238 ? 480.347 8.681   5.906   1.00 0.00 ? 238 ILE A CB   1 
ATOM 3644 C CG1  . ILE A 1 238 ? 479.251 9.691   6.238   1.00 0.00 ? 238 ILE A CG1  1 
ATOM 3645 C CG2  . ILE A 1 238 ? 481.717 9.324   6.061   1.00 0.00 ? 238 ILE A CG2  1 
ATOM 3646 C CD1  . ILE A 1 238 ? 479.081 10.767  5.189   1.00 0.00 ? 238 ILE A CD1  1 
ATOM 3647 H H    . ILE A 1 238 ? 478.300 7.296   5.016   1.00 0.00 ? 238 ILE A H    1 
ATOM 3648 H HA   . ILE A 1 238 ? 480.359 8.916   3.774   1.00 0.00 ? 238 ILE A HA   1 
ATOM 3649 H HB   . ILE A 1 238 ? 480.285 7.856   6.597   1.00 0.00 ? 238 ILE A HB   1 
ATOM 3650 H HG12 . ILE A 1 238 ? 478.309 9.173   6.339   1.00 0.00 ? 238 ILE A HG12 1 
ATOM 3651 H HG13 . ILE A 1 238 ? 479.496 10.174  7.176   1.00 0.00 ? 238 ILE A HG13 1 
ATOM 3652 H HG21 . ILE A 1 238 ? 482.447 8.565   6.299   1.00 0.00 ? 238 ILE A HG21 1 
ATOM 3653 H HG22 . ILE A 1 238 ? 481.683 10.054  6.855   1.00 0.00 ? 238 ILE A HG22 1 
ATOM 3654 H HG23 . ILE A 1 238 ? 481.991 9.811   5.137   1.00 0.00 ? 238 ILE A HG23 1 
ATOM 3655 H HD11 . ILE A 1 238 ? 478.378 10.432  4.441   1.00 0.00 ? 238 ILE A HD11 1 
ATOM 3656 H HD12 . ILE A 1 238 ? 480.035 10.967  4.724   1.00 0.00 ? 238 ILE A HD12 1 
ATOM 3657 H HD13 . ILE A 1 238 ? 478.711 11.668  5.655   1.00 0.00 ? 238 ILE A HD13 1 
ATOM 3658 N N    . TYR A 1 239 ? 481.978 7.129   3.199   1.00 0.00 ? 239 TYR A N    1 
ATOM 3659 C CA   . TYR A 1 239 ? 483.000 6.136   2.906   1.00 0.00 ? 239 TYR A CA   1 
ATOM 3660 C C    . TYR A 1 239 ? 484.356 6.790   2.684   1.00 0.00 ? 239 TYR A C    1 
ATOM 3661 O O    . TYR A 1 239 ? 484.616 7.369   1.629   1.00 0.00 ? 239 TYR A O    1 
ATOM 3662 C CB   . TYR A 1 239 ? 482.608 5.311   1.681   1.00 0.00 ? 239 TYR A CB   1 
ATOM 3663 C CG   . TYR A 1 239 ? 481.557 4.268   1.978   1.00 0.00 ? 239 TYR A CG   1 
ATOM 3664 C CD1  . TYR A 1 239 ? 481.837 3.181   2.797   1.00 0.00 ? 239 TYR A CD1  1 
ATOM 3665 C CD2  . TYR A 1 239 ? 480.280 4.374   1.443   1.00 0.00 ? 239 TYR A CD2  1 
ATOM 3666 C CE1  . TYR A 1 239 ? 480.873 2.233   3.072   1.00 0.00 ? 239 TYR A CE1  1 
ATOM 3667 C CE2  . TYR A 1 239 ? 479.311 3.428   1.716   1.00 0.00 ? 239 TYR A CE2  1 
ATOM 3668 C CZ   . TYR A 1 239 ? 479.613 2.361   2.531   1.00 0.00 ? 239 TYR A CZ   1 
ATOM 3669 O OH   . TYR A 1 239 ? 478.650 1.416   2.804   1.00 0.00 ? 239 TYR A OH   1 
ATOM 3670 H H    . TYR A 1 239 ? 481.858 7.890   2.594   1.00 0.00 ? 239 TYR A H    1 
ATOM 3671 H HA   . TYR A 1 239 ? 483.068 5.480   3.759   1.00 0.00 ? 239 TYR A HA   1 
ATOM 3672 H HB2  . TYR A 1 239 ? 482.218 5.970   0.920   1.00 0.00 ? 239 TYR A HB2  1 
ATOM 3673 H HB3  . TYR A 1 239 ? 483.483 4.804   1.301   1.00 0.00 ? 239 TYR A HB3  1 
ATOM 3674 H HD1  . TYR A 1 239 ? 482.827 3.077   3.223   1.00 0.00 ? 239 TYR A HD1  1 
ATOM 3675 H HD2  . TYR A 1 239 ? 480.046 5.213   0.805   1.00 0.00 ? 239 TYR A HD2  1 
ATOM 3676 H HE1  . TYR A 1 239 ? 481.109 1.401   3.710   1.00 0.00 ? 239 TYR A HE1  1 
ATOM 3677 H HE2  . TYR A 1 239 ? 478.325 3.528   1.292   1.00 0.00 ? 239 TYR A HE2  1 
ATOM 3678 H HH   . TYR A 1 239 ? 478.399 0.971   1.992   1.00 0.00 ? 239 TYR A HH   1 
ATOM 3679 N N    . ALA A 1 240 ? 485.219 6.687   3.687   1.00 0.00 ? 240 ALA A N    1 
ATOM 3680 C CA   . ALA A 1 240 ? 486.552 7.259   3.609   1.00 0.00 ? 240 ALA A CA   1 
ATOM 3681 C C    . ALA A 1 240 ? 487.462 6.667   4.686   1.00 0.00 ? 240 ALA A C    1 
ATOM 3682 O O    . ALA A 1 240 ? 488.045 5.602   4.493   1.00 0.00 ? 240 ALA A O    1 
ATOM 3683 C CB   . ALA A 1 240 ? 486.485 8.777   3.718   1.00 0.00 ? 240 ALA A CB   1 
ATOM 3684 H H    . ALA A 1 240 ? 484.951 6.211   4.500   1.00 0.00 ? 240 ALA A H    1 
ATOM 3685 H HA   . ALA A 1 240 ? 486.960 7.012   2.639   1.00 0.00 ? 240 ALA A HA   1 
ATOM 3686 H HB1  . ALA A 1 240 ? 486.358 9.204   2.734   1.00 0.00 ? 240 ALA A HB1  1 
ATOM 3687 H HB2  . ALA A 1 240 ? 487.400 9.148   4.156   1.00 0.00 ? 240 ALA A HB2  1 
ATOM 3688 H HB3  . ALA A 1 240 ? 485.648 9.056   4.342   1.00 0.00 ? 240 ALA A HB3  1 
ATOM 3689 N N    . ARG A 1 241 ? 487.591 7.361   5.814   1.00 0.00 ? 241 ARG A N    1 
ATOM 3690 C CA   . ARG A 1 241 ? 488.438 6.892   6.903   1.00 0.00 ? 241 ARG A CA   1 
ATOM 3691 C C    . ARG A 1 241 ? 487.753 7.085   8.258   1.00 0.00 ? 241 ARG A C    1 
ATOM 3692 O O    . ARG A 1 241 ? 487.208 8.154   8.533   1.00 0.00 ? 241 ARG A O    1 
ATOM 3693 C CB   . ARG A 1 241 ? 489.781 7.639   6.853   1.00 0.00 ? 241 ARG A CB   1 
ATOM 3694 C CG   . ARG A 1 241 ? 490.444 7.859   8.205   1.00 0.00 ? 241 ARG A CG   1 
ATOM 3695 C CD   . ARG A 1 241 ? 490.037 9.190   8.818   1.00 0.00 ? 241 ARG A CD   1 
ATOM 3696 N NE   . ARG A 1 241 ? 490.756 10.314  8.222   1.00 0.00 ? 241 ARG A NE   1 
ATOM 3697 C CZ   . ARG A 1 241 ? 491.978 10.694  8.591   1.00 0.00 ? 241 ARG A CZ   1 
ATOM 3698 N NH1  . ARG A 1 241 ? 492.627 10.037  9.545   1.00 0.00 ? 241 ARG A NH1  1 
ATOM 3699 N NH2  . ARG A 1 241 ? 492.554 11.734  8.003   1.00 0.00 ? 241 ARG A NH2  1 
ATOM 3700 H H    . ARG A 1 241 ? 487.109 8.207   5.916   1.00 0.00 ? 241 ARG A H    1 
ATOM 3701 H HA   . ARG A 1 241 ? 488.619 5.840   6.752   1.00 0.00 ? 241 ARG A HA   1 
ATOM 3702 H HB2  . ARG A 1 241 ? 490.465 7.077   6.236   1.00 0.00 ? 241 ARG A HB2  1 
ATOM 3703 H HB3  . ARG A 1 241 ? 489.619 8.606   6.398   1.00 0.00 ? 241 ARG A HB3  1 
ATOM 3704 H HG2  . ARG A 1 241 ? 490.155 7.062   8.874   1.00 0.00 ? 241 ARG A HG2  1 
ATOM 3705 H HG3  . ARG A 1 241 ? 491.515 7.850   8.072   1.00 0.00 ? 241 ARG A HG3  1 
ATOM 3706 H HD2  . ARG A 1 241 ? 488.979 9.333   8.663   1.00 0.00 ? 241 ARG A HD2  1 
ATOM 3707 H HD3  . ARG A 1 241 ? 490.244 9.162   9.877   1.00 0.00 ? 241 ARG A HD3  1 
ATOM 3708 H HE   . ARG A 1 241 ? 490.303 10.815  7.513   1.00 0.00 ? 241 ARG A HE   1 
ATOM 3709 H HH11 . ARG A 1 241 ? 492.201 9.252   9.992   1.00 0.00 ? 241 ARG A HH11 1 
ATOM 3710 H HH12 . ARG A 1 241 ? 493.545 10.329  9.816   1.00 0.00 ? 241 ARG A HH12 1 
ATOM 3711 H HH21 . ARG A 1 241 ? 492.070 12.232  7.283   1.00 0.00 ? 241 ARG A HH21 1 
ATOM 3712 H HH22 . ARG A 1 241 ? 493.471 12.020  8.279   1.00 0.00 ? 241 ARG A HH22 1 
ATOM 3713 N N    . VAL A 1 242 ? 487.803 6.061   9.118   1.00 0.00 ? 242 VAL A N    1 
ATOM 3714 C CA   . VAL A 1 242 ? 487.210 6.155   10.454  1.00 0.00 ? 242 VAL A CA   1 
ATOM 3715 C C    . VAL A 1 242 ? 487.654 7.459   11.123  1.00 0.00 ? 242 VAL A C    1 
ATOM 3716 O O    . VAL A 1 242 ? 488.804 7.871   10.976  1.00 0.00 ? 242 VAL A O    1 
ATOM 3717 C CB   . VAL A 1 242 ? 487.646 4.954   11.327  1.00 0.00 ? 242 VAL A CB   1 
ATOM 3718 C CG1  . VAL A 1 242 ? 487.294 5.173   12.789  1.00 0.00 ? 242 VAL A CG1  1 
ATOM 3719 C CG2  . VAL A 1 242 ? 487.026 3.663   10.820  1.00 0.00 ? 242 VAL A CG2  1 
ATOM 3720 H H    . VAL A 1 242 ? 488.262 5.229   8.870   1.00 0.00 ? 242 VAL A H    1 
ATOM 3721 H HA   . VAL A 1 242 ? 486.130 6.144   10.364  1.00 0.00 ? 242 VAL A HA   1 
ATOM 3722 H HB   . VAL A 1 242 ? 488.717 4.857   11.254  1.00 0.00 ? 242 VAL A HB   1 
ATOM 3723 H HG11 . VAL A 1 242 ? 487.658 6.137   13.108  1.00 0.00 ? 242 VAL A HG11 1 
ATOM 3724 H HG12 . VAL A 1 242 ? 487.757 4.402   13.385  1.00 0.00 ? 242 VAL A HG12 1 
ATOM 3725 H HG13 . VAL A 1 242 ? 486.222 5.133   12.912  1.00 0.00 ? 242 VAL A HG13 1 
ATOM 3726 H HG21 . VAL A 1 242 ? 487.468 3.402   9.869   1.00 0.00 ? 242 VAL A HG21 1 
ATOM 3727 H HG22 . VAL A 1 242 ? 485.960 3.796   10.701  1.00 0.00 ? 242 VAL A HG22 1 
ATOM 3728 H HG23 . VAL A 1 242 ? 487.215 2.872   11.533  1.00 0.00 ? 242 VAL A HG23 1 
ATOM 3729 N N    . ILE A 1 243 ? 486.746 8.118   11.837  1.00 0.00 ? 243 ILE A N    1 
ATOM 3730 C CA   . ILE A 1 243 ? 487.084 9.381   12.489  1.00 0.00 ? 243 ILE A CA   1 
ATOM 3731 C C    . ILE A 1 243 ? 487.713 9.169   13.873  1.00 0.00 ? 243 ILE A C    1 
ATOM 3732 O O    . ILE A 1 243 ? 488.522 9.985   14.316  1.00 0.00 ? 243 ILE A O    1 
ATOM 3733 C CB   . ILE A 1 243 ? 485.866 10.348  12.581  1.00 0.00 ? 243 ILE A CB   1 
ATOM 3734 C CG1  . ILE A 1 243 ? 484.973 10.042  13.790  1.00 0.00 ? 243 ILE A CG1  1 
ATOM 3735 C CG2  . ILE A 1 243 ? 485.045 10.308  11.294  1.00 0.00 ? 243 ILE A CG2  1 
ATOM 3736 C CD1  . ILE A 1 243 ? 484.146 8.794   13.633  1.00 0.00 ? 243 ILE A CD1  1 
ATOM 3737 H H    . ILE A 1 243 ? 485.837 7.762   11.913  1.00 0.00 ? 243 ILE A H    1 
ATOM 3738 H HA   . ILE A 1 243 ? 487.826 9.860   11.864  1.00 0.00 ? 243 ILE A HA   1 
ATOM 3739 H HB   . ILE A 1 243 ? 486.254 11.350  12.685  1.00 0.00 ? 243 ILE A HB   1 
ATOM 3740 H HG12 . ILE A 1 243 ? 485.585 9.923   14.669  1.00 0.00 ? 243 ILE A HG12 1 
ATOM 3741 H HG13 . ILE A 1 243 ? 484.294 10.867  13.939  1.00 0.00 ? 243 ILE A HG13 1 
ATOM 3742 H HG21 . ILE A 1 243 ? 485.207 9.368   10.789  1.00 0.00 ? 243 ILE A HG21 1 
ATOM 3743 H HG22 . ILE A 1 243 ? 485.350 11.119  10.648  1.00 0.00 ? 243 ILE A HG22 1 
ATOM 3744 H HG23 . ILE A 1 243 ? 483.993 10.413  11.530  1.00 0.00 ? 243 ILE A HG23 1 
ATOM 3745 H HD11 . ILE A 1 243 ? 483.649 8.573   14.566  1.00 0.00 ? 243 ILE A HD11 1 
ATOM 3746 H HD12 . ILE A 1 243 ? 484.790 7.973   13.364  1.00 0.00 ? 243 ILE A HD12 1 
ATOM 3747 H HD13 . ILE A 1 243 ? 483.410 8.944   12.858  1.00 0.00 ? 243 ILE A HD13 1 
ATOM 3748 N N    . GLN A 1 244 ? 487.344 8.085   14.560  1.00 0.00 ? 244 GLN A N    1 
ATOM 3749 C CA   . GLN A 1 244 ? 487.887 7.804   15.892  1.00 0.00 ? 244 GLN A CA   1 
ATOM 3750 C C    . GLN A 1 244 ? 488.291 6.333   16.026  1.00 0.00 ? 244 GLN A C    1 
ATOM 3751 O O    . GLN A 1 244 ? 487.717 5.463   15.374  1.00 0.00 ? 244 GLN A O    1 
ATOM 3752 C CB   . GLN A 1 244 ? 486.857 8.178   16.956  1.00 0.00 ? 244 GLN A CB   1 
ATOM 3753 C CG   . GLN A 1 244 ? 487.318 7.928   18.381  1.00 0.00 ? 244 GLN A CG   1 
ATOM 3754 C CD   . GLN A 1 244 ? 488.108 9.089   18.951  1.00 0.00 ? 244 GLN A CD   1 
ATOM 3755 O OE1  . GLN A 1 244 ? 489.336 9.114   18.880  1.00 0.00 ? 244 GLN A OE1  1 
ATOM 3756 N NE2  . GLN A 1 244 ? 487.404 10.059  19.523  1.00 0.00 ? 244 GLN A NE2  1 
ATOM 3757 H H    . GLN A 1 244 ? 486.688 7.465   14.178  1.00 0.00 ? 244 GLN A H    1 
ATOM 3758 H HA   . GLN A 1 244 ? 488.766 8.417   16.025  1.00 0.00 ? 244 GLN A HA   1 
ATOM 3759 H HB2  . GLN A 1 244 ? 486.625 9.227   16.857  1.00 0.00 ? 244 GLN A HB2  1 
ATOM 3760 H HB3  . GLN A 1 244 ? 485.961 7.605   16.785  1.00 0.00 ? 244 GLN A HB3  1 
ATOM 3761 H HG2  . GLN A 1 244 ? 486.450 7.766   19.001  1.00 0.00 ? 244 GLN A HG2  1 
ATOM 3762 H HG3  . GLN A 1 244 ? 487.940 7.047   18.395  1.00 0.00 ? 244 GLN A HG3  1 
ATOM 3763 H HE21 . GLN A 1 244 ? 486.428 9.972   19.544  1.00 0.00 ? 244 GLN A HE21 1 
ATOM 3764 H HE22 . GLN A 1 244 ? 487.888 10.823  19.900  1.00 0.00 ? 244 GLN A HE22 1 
ATOM 3765 N N    . LYS A 1 245 ? 489.299 6.061   16.858  1.00 0.00 ? 245 LYS A N    1 
ATOM 3766 C CA   . LYS A 1 245 ? 489.792 4.694   17.044  1.00 0.00 ? 245 LYS A CA   1 
ATOM 3767 C C    . LYS A 1 245 ? 489.121 3.972   18.206  1.00 0.00 ? 245 LYS A C    1 
ATOM 3768 O O    . LYS A 1 245 ? 489.233 4.382   19.361  1.00 0.00 ? 245 LYS A O    1 
ATOM 3769 C CB   . LYS A 1 245 ? 491.310 4.701   17.250  1.00 0.00 ? 245 LYS A CB   1 
ATOM 3770 C CG   . LYS A 1 245 ? 491.892 3.331   17.565  1.00 0.00 ? 245 LYS A CG   1 
ATOM 3771 C CD   . LYS A 1 245 ? 493.375 3.416   17.881  1.00 0.00 ? 245 LYS A CD   1 
ATOM 3772 C CE   . LYS A 1 245 ? 493.942 2.058   18.264  1.00 0.00 ? 245 LYS A CE   1 
ATOM 3773 N NZ   . LYS A 1 245 ? 494.336 2.008   19.700  1.00 0.00 ? 245 LYS A NZ   1 
ATOM 3774 H H    . LYS A 1 245 ? 489.733 6.795   17.340  1.00 0.00 ? 245 LYS A H    1 
ATOM 3775 H HA   . LYS A 1 245 ? 489.573 4.150   16.142  1.00 0.00 ? 245 LYS A HA   1 
ATOM 3776 H HB2  . LYS A 1 245 ? 491.782 5.066   16.352  1.00 0.00 ? 245 LYS A HB2  1 
ATOM 3777 H HB3  . LYS A 1 245 ? 491.548 5.365   18.068  1.00 0.00 ? 245 LYS A HB3  1 
ATOM 3778 H HG2  . LYS A 1 245 ? 491.375 2.918   18.418  1.00 0.00 ? 245 LYS A HG2  1 
ATOM 3779 H HG3  . LYS A 1 245 ? 491.751 2.686   16.710  1.00 0.00 ? 245 LYS A HG3  1 
ATOM 3780 H HD2  . LYS A 1 245 ? 493.898 3.780   17.009  1.00 0.00 ? 245 LYS A HD2  1 
ATOM 3781 H HD3  . LYS A 1 245 ? 493.518 4.101   18.702  1.00 0.00 ? 245 LYS A HD3  1 
ATOM 3782 H HE2  . LYS A 1 245 ? 493.193 1.303   18.079  1.00 0.00 ? 245 LYS A HE2  1 
ATOM 3783 H HE3  . LYS A 1 245 ? 494.811 1.860   17.654  1.00 0.00 ? 245 LYS A HE3  1 
ATOM 3784 H HZ1  . LYS A 1 245 ? 495.114 1.330   19.833  1.00 0.00 ? 245 LYS A HZ1  1 
ATOM 3785 H HZ2  . LYS A 1 245 ? 493.528 1.709   20.282  1.00 0.00 ? 245 LYS A HZ2  1 
ATOM 3786 H HZ3  . LYS A 1 245 ? 494.650 2.947   20.017  1.00 0.00 ? 245 LYS A HZ3  1 
ATOM 3787 N N    . ARG A 1 246 ? 488.444 2.874   17.882  1.00 0.00 ? 246 ARG A N    1 
ATOM 3788 C CA   . ARG A 1 246 ? 487.767 2.061   18.893  1.00 0.00 ? 246 ARG A CA   1 
ATOM 3789 C C    . ARG A 1 246 ? 488.059 0.574   18.702  1.00 0.00 ? 246 ARG A C    1 
ATOM 3790 O O    . ARG A 1 246 ? 487.539 -0.056  17.781  1.00 0.00 ? 246 ARG A O    1 
ATOM 3791 C CB   . ARG A 1 246 ? 486.260 2.294   18.853  1.00 0.00 ? 246 ARG A CB   1 
ATOM 3792 C CG   . ARG A 1 246 ? 485.619 2.308   20.231  1.00 0.00 ? 246 ARG A CG   1 
ATOM 3793 C CD   . ARG A 1 246 ? 485.745 0.954   20.910  1.00 0.00 ? 246 ARG A CD   1 
ATOM 3794 N NE   . ARG A 1 246 ? 485.172 0.955   22.255  1.00 0.00 ? 246 ARG A NE   1 
ATOM 3795 C CZ   . ARG A 1 246 ? 484.836 -0.151  22.916  1.00 0.00 ? 246 ARG A CZ   1 
ATOM 3796 N NH1  . ARG A 1 246 ? 485.022 -1.345  22.365  1.00 0.00 ? 246 ARG A NH1  1 
ATOM 3797 N NH2  . ARG A 1 246 ? 484.314 -0.064  24.132  1.00 0.00 ? 246 ARG A NH2  1 
ATOM 3798 H H    . ARG A 1 246 ? 488.411 2.601   16.935  1.00 0.00 ? 246 ARG A H    1 
ATOM 3799 H HA   . ARG A 1 246 ? 488.140 2.364   19.860  1.00 0.00 ? 246 ARG A HA   1 
ATOM 3800 H HB2  . ARG A 1 246 ? 486.068 3.238   18.375  1.00 0.00 ? 246 ARG A HB2  1 
ATOM 3801 H HB3  . ARG A 1 246 ? 485.800 1.507   18.274  1.00 0.00 ? 246 ARG A HB3  1 
ATOM 3802 H HG2  . ARG A 1 246 ? 486.112 3.052   20.839  1.00 0.00 ? 246 ARG A HG2  1 
ATOM 3803 H HG3  . ARG A 1 246 ? 484.574 2.558   20.130  1.00 0.00 ? 246 ARG A HG3  1 
ATOM 3804 H HD2  . ARG A 1 246 ? 485.230 0.217   20.312  1.00 0.00 ? 246 ARG A HD2  1 
ATOM 3805 H HD3  . ARG A 1 246 ? 486.791 0.695   20.976  1.00 0.00 ? 246 ARG A HD3  1 
ATOM 3806 H HE   . ARG A 1 246 ? 485.028 1.823   22.685  1.00 0.00 ? 246 ARG A HE   1 
ATOM 3807 H HH11 . ARG A 1 246 ? 485.416 -1.418  21.449  1.00 0.00 ? 246 ARG A HH11 1 
ATOM 3808 H HH12 . ARG A 1 246 ? 484.768 -2.171  22.867  1.00 0.00 ? 246 ARG A HH12 1 
ATOM 3809 H HH21 . ARG A 1 246 ? 484.171 0.833   24.552  1.00 0.00 ? 246 ARG A HH21 1 
ATOM 3810 H HH22 . ARG A 1 246 ? 484.060 -0.894  24.628  1.00 0.00 ? 246 ARG A HH22 1 
ATOM 3811 N N    . VAL A 1 247 ? 488.885 0.014   19.580  1.00 0.00 ? 247 VAL A N    1 
ATOM 3812 C CA   . VAL A 1 247 ? 489.237 -1.400  19.504  1.00 0.00 ? 247 VAL A CA   1 
ATOM 3813 C C    . VAL A 1 247 ? 488.225 -2.265  20.255  1.00 0.00 ? 247 VAL A C    1 
ATOM 3814 O O    . VAL A 1 247 ? 487.456 -1.763  21.074  1.00 0.00 ? 247 VAL A O    1 
ATOM 3815 C CB   . VAL A 1 247 ? 490.643 -1.661  20.075  1.00 0.00 ? 247 VAL A CB   1 
ATOM 3816 C CG1  . VAL A 1 247 ? 491.698 -0.943  19.246  1.00 0.00 ? 247 VAL A CG1  1 
ATOM 3817 C CG2  . VAL A 1 247 ? 490.717 -1.233  21.535  1.00 0.00 ? 247 VAL A CG2  1 
ATOM 3818 H H    . VAL A 1 247 ? 489.264 0.564   20.297  1.00 0.00 ? 247 VAL A H    1 
ATOM 3819 H HA   . VAL A 1 247 ? 489.236 -1.686  18.462  1.00 0.00 ? 247 VAL A HA   1 
ATOM 3820 H HB   . VAL A 1 247 ? 490.840 -2.722  20.024  1.00 0.00 ? 247 VAL A HB   1 
ATOM 3821 H HG11 . VAL A 1 247 ? 491.828 -1.458  18.305  1.00 0.00 ? 247 VAL A HG11 1 
ATOM 3822 H HG12 . VAL A 1 247 ? 492.635 -0.935  19.784  1.00 0.00 ? 247 VAL A HG12 1 
ATOM 3823 H HG13 . VAL A 1 247 ? 491.380 0.072   19.060  1.00 0.00 ? 247 VAL A HG13 1 
ATOM 3824 H HG21 . VAL A 1 247 ? 489.868 -0.609  21.771  1.00 0.00 ? 247 VAL A HG21 1 
ATOM 3825 H HG22 . VAL A 1 247 ? 491.629 -0.679  21.703  1.00 0.00 ? 247 VAL A HG22 1 
ATOM 3826 H HG23 . VAL A 1 247 ? 490.707 -2.109  22.167  1.00 0.00 ? 247 VAL A HG23 1 
ATOM 3827 N N    . PRO A 1 248 ? 488.214 -3.585  19.987  1.00 0.00 ? 248 PRO A N    1 
ATOM 3828 C CA   . PRO A 1 248 ? 487.303 -4.521  20.635  1.00 0.00 ? 248 PRO A CA   1 
ATOM 3829 C C    . PRO A 1 248 ? 487.847 -5.017  21.970  1.00 0.00 ? 248 PRO A C    1 
ATOM 3830 O O    . PRO A 1 248 ? 489.054 -4.985  22.207  1.00 0.00 ? 248 PRO A O    1 
ATOM 3831 C CB   . PRO A 1 248 ? 487.203 -5.684  19.634  1.00 0.00 ? 248 PRO A CB   1 
ATOM 3832 C CG   . PRO A 1 248 ? 488.232 -5.426  18.571  1.00 0.00 ? 248 PRO A CG   1 
ATOM 3833 C CD   . PRO A 1 248 ? 489.087 -4.276  19.038  1.00 0.00 ? 248 PRO A CD   1 
ATOM 3834 H HA   . PRO A 1 248 ? 486.326 -4.085  20.784  1.00 0.00 ? 248 PRO A HA   1 
ATOM 3835 H HB2  . PRO A 1 248 ? 487.398 -6.615  20.146  1.00 0.00 ? 248 PRO A HB2  1 
ATOM 3836 H HB3  . PRO A 1 248 ? 486.208 -5.707  19.214  1.00 0.00 ? 248 PRO A HB3  1 
ATOM 3837 H HG2  . PRO A 1 248 ? 488.842 -6.307  18.437  1.00 0.00 ? 248 PRO A HG2  1 
ATOM 3838 H HG3  . PRO A 1 248 ? 487.739 -5.173  17.645  1.00 0.00 ? 248 PRO A HG3  1 
ATOM 3839 H HD2  . PRO A 1 248 ? 489.978 -4.641  19.527  1.00 0.00 ? 248 PRO A HD2  1 
ATOM 3840 H HD3  . PRO A 1 248 ? 489.343 -3.634  18.209  1.00 0.00 ? 248 PRO A HD3  1 
ATOM 3841 N N    . ASN A 1 249 ? 486.953 -5.475  22.841  1.00 0.00 ? 249 ASN A N    1 
ATOM 3842 C CA   . ASN A 1 249 ? 487.347 -5.976  24.151  1.00 0.00 ? 249 ASN A CA   1 
ATOM 3843 C C    . ASN A 1 249 ? 488.145 -7.270  24.029  1.00 0.00 ? 249 ASN A C    1 
ATOM 3844 O O    . ASN A 1 249 ? 487.980 -8.027  23.073  1.00 0.00 ? 249 ASN A O    1 
ATOM 3845 C CB   . ASN A 1 249 ? 486.108 -6.212  25.015  1.00 0.00 ? 249 ASN A CB   1 
ATOM 3846 C CG   . ASN A 1 249 ? 485.688 -4.971  25.777  1.00 0.00 ? 249 ASN A CG   1 
ATOM 3847 O OD1  . ASN A 1 249 ? 486.227 -4.670  26.842  1.00 0.00 ? 249 ASN A OD1  1 
ATOM 3848 N ND2  . ASN A 1 249 ? 484.720 -4.242  25.234  1.00 0.00 ? 249 ASN A ND2  1 
ATOM 3849 H H    . ASN A 1 249 ? 486.001 -5.482  22.608  1.00 0.00 ? 249 ASN A H    1 
ATOM 3850 H HA   . ASN A 1 249 ? 487.966 -5.227  24.622  1.00 0.00 ? 249 ASN A HA   1 
ATOM 3851 H HB2  . ASN A 1 249 ? 485.288 -6.516  24.379  1.00 0.00 ? 249 ASN A HB2  1 
ATOM 3852 H HB3  . ASN A 1 249 ? 486.316 -6.997  25.726  1.00 0.00 ? 249 ASN A HB3  1 
ATOM 3853 H HD21 . ASN A 1 249 ? 484.336 -4.542  24.384  1.00 0.00 ? 249 ASN A HD21 1 
ATOM 3854 H HD22 . ASN A 1 249 ? 484.429 -3.433  25.706  1.00 0.00 ? 249 ASN A HD22 1 
ATOM 3855 N N    . ALA A 1 250 ? 489.011 -7.517  25.006  1.00 0.00 ? 250 ALA A N    1 
ATOM 3856 C CA   . ALA A 1 250 ? 489.834 -8.719  25.012  1.00 0.00 ? 250 ALA A CA   1 
ATOM 3857 C C    . ALA A 1 250 ? 488.979 -9.972  25.177  1.00 0.00 ? 250 ALA A C    1 
ATOM 3858 O O    . ALA A 1 250 ? 489.306 -11.033 24.645  1.00 0.00 ? 250 ALA A O    1 
ATOM 3859 C CB   . ALA A 1 250 ? 490.867 -8.640  26.124  1.00 0.00 ? 250 ALA A CB   1 
ATOM 3860 H H    . ALA A 1 250 ? 489.097 -6.876  25.742  1.00 0.00 ? 250 ALA A H    1 
ATOM 3861 H HA   . ALA A 1 250 ? 490.357 -8.772  24.069  1.00 0.00 ? 250 ALA A HA   1 
ATOM 3862 H HB1  . ALA A 1 250 ? 490.364 -8.604  27.080  1.00 0.00 ? 250 ALA A HB1  1 
ATOM 3863 H HB2  . ALA A 1 250 ? 491.465 -7.749  25.998  1.00 0.00 ? 250 ALA A HB2  1 
ATOM 3864 H HB3  . ALA A 1 250 ? 491.505 -9.510  26.086  1.00 0.00 ? 250 ALA A HB3  1 
ATOM 3865 N N    . TYR A 1 251 ? 487.885 -9.842  25.921  1.00 0.00 ? 251 TYR A N    1 
ATOM 3866 C CA   . TYR A 1 251 ? 486.985 -10.966 26.161  1.00 0.00 ? 251 TYR A CA   1 
ATOM 3867 C C    . TYR A 1 251 ? 486.056 -11.208 24.972  1.00 0.00 ? 251 TYR A C    1 
ATOM 3868 O O    . TYR A 1 251 ? 485.272 -12.157 24.974  1.00 0.00 ? 251 TYR A O    1 
ATOM 3869 C CB   . TYR A 1 251 ? 486.157 -10.719 27.424  1.00 0.00 ? 251 TYR A CB   1 
ATOM 3870 C CG   . TYR A 1 251 ? 485.427 -9.394  27.423  1.00 0.00 ? 251 TYR A CG   1 
ATOM 3871 C CD1  . TYR A 1 251 ? 484.172 -9.271  26.841  1.00 0.00 ? 251 TYR A CD1  1 
ATOM 3872 C CD2  . TYR A 1 251 ? 485.994 -8.267  28.005  1.00 0.00 ? 251 TYR A CD2  1 
ATOM 3873 C CE1  . TYR A 1 251 ? 483.502 -8.062  26.839  1.00 0.00 ? 251 TYR A CE1  1 
ATOM 3874 C CE2  . TYR A 1 251 ? 485.329 -7.055  28.007  1.00 0.00 ? 251 TYR A CE2  1 
ATOM 3875 C CZ   . TYR A 1 251 ? 484.084 -6.958  27.423  1.00 0.00 ? 251 TYR A CZ   1 
ATOM 3876 O OH   . TYR A 1 251 ? 483.420 -5.753  27.423  1.00 0.00 ? 251 TYR A OH   1 
ATOM 3877 H H    . TYR A 1 251 ? 487.680 -8.972  26.321  1.00 0.00 ? 251 TYR A H    1 
ATOM 3878 H HA   . TYR A 1 251 ? 487.591 -11.846 26.310  1.00 0.00 ? 251 TYR A HA   1 
ATOM 3879 H HB2  . TYR A 1 251 ? 485.420 -11.502 27.521  1.00 0.00 ? 251 TYR A HB2  1 
ATOM 3880 H HB3  . TYR A 1 251 ? 486.811 -10.738 28.283  1.00 0.00 ? 251 TYR A HB3  1 
ATOM 3881 H HD1  . TYR A 1 251 ? 483.718 -10.138 26.384  1.00 0.00 ? 251 TYR A HD1  1 
ATOM 3882 H HD2  . TYR A 1 251 ? 486.970 -8.346  28.461  1.00 0.00 ? 251 TYR A HD2  1 
ATOM 3883 H HE1  . TYR A 1 251 ? 482.526 -7.987  26.381  1.00 0.00 ? 251 TYR A HE1  1 
ATOM 3884 H HE2  . TYR A 1 251 ? 485.786 -6.190  28.465  1.00 0.00 ? 251 TYR A HE2  1 
ATOM 3885 H HH   . TYR A 1 251 ? 483.391 -5.403  28.316  1.00 0.00 ? 251 TYR A HH   1 
ATOM 3886 N N    . ASP A 1 252 ? 486.143 -10.351 23.958  1.00 0.00 ? 252 ASP A N    1 
ATOM 3887 C CA   . ASP A 1 252 ? 485.304 -10.490 22.772  1.00 0.00 ? 252 ASP A CA   1 
ATOM 3888 C C    . ASP A 1 252 ? 485.834 -11.594 21.861  1.00 0.00 ? 252 ASP A C    1 
ATOM 3889 O O    . ASP A 1 252 ? 486.920 -12.127 22.086  1.00 0.00 ? 252 ASP A O    1 
ATOM 3890 C CB   . ASP A 1 252 ? 485.234 -9.163  22.012  1.00 0.00 ? 252 ASP A CB   1 
ATOM 3891 C CG   . ASP A 1 252 ? 483.849 -8.547  22.053  1.00 0.00 ? 252 ASP A CG   1 
ATOM 3892 O OD1  . ASP A 1 252 ? 482.898 -9.191  21.562  1.00 0.00 ? 252 ASP A OD1  1 
ATOM 3893 O OD2  . ASP A 1 252 ? 483.715 -7.421  22.576  1.00 0.00 ? 252 ASP A OD2  1 
ATOM 3894 H H    . ASP A 1 252 ? 486.785 -9.613  24.006  1.00 0.00 ? 252 ASP A H    1 
ATOM 3895 H HA   . ASP A 1 252 ? 484.311 -10.758 23.101  1.00 0.00 ? 252 ASP A HA   1 
ATOM 3896 H HB2  . ASP A 1 252 ? 485.929 -8.466  22.454  1.00 0.00 ? 252 ASP A HB2  1 
ATOM 3897 H HB3  . ASP A 1 252 ? 485.505 -9.330  20.980  1.00 0.00 ? 252 ASP A HB3  1 
ATOM 3898 N N    . LYS A 1 253 ? 485.057 -11.940 20.839  1.00 0.00 ? 253 LYS A N    1 
ATOM 3899 C CA   . LYS A 1 253 ? 485.450 -12.989 19.904  1.00 0.00 ? 253 LYS A CA   1 
ATOM 3900 C C    . LYS A 1 253 ? 485.170 -12.573 18.463  1.00 0.00 ? 253 LYS A C    1 
ATOM 3901 O O    . LYS A 1 253 ? 486.094 -12.342 17.683  1.00 0.00 ? 253 LYS A O    1 
ATOM 3902 C CB   . LYS A 1 253 ? 484.715 -14.297 20.223  1.00 0.00 ? 253 LYS A CB   1 
ATOM 3903 C CG   . LYS A 1 253 ? 483.754 -14.196 21.398  1.00 0.00 ? 253 LYS A CG   1 
ATOM 3904 C CD   . LYS A 1 253 ? 483.362 -15.570 21.917  1.00 0.00 ? 253 LYS A CD   1 
ATOM 3905 C CE   . LYS A 1 253 ? 482.583 -16.357 20.875  1.00 0.00 ? 253 LYS A CE   1 
ATOM 3906 N NZ   . LYS A 1 253 ? 481.163 -15.918 20.793  1.00 0.00 ? 253 LYS A NZ   1 
ATOM 3907 H H    . LYS A 1 253 ? 484.198 -11.486 20.714  1.00 0.00 ? 253 LYS A H    1 
ATOM 3908 H HA   . LYS A 1 253 ? 486.511 -13.148 20.017  1.00 0.00 ? 253 LYS A HA   1 
ATOM 3909 H HB2  . LYS A 1 253 ? 484.152 -14.600 19.354  1.00 0.00 ? 253 LYS A HB2  1 
ATOM 3910 H HB3  . LYS A 1 253 ? 485.446 -15.059 20.450  1.00 0.00 ? 253 LYS A HB3  1 
ATOM 3911 H HG2  . LYS A 1 253 ? 484.232 -13.644 22.195  1.00 0.00 ? 253 LYS A HG2  1 
ATOM 3912 H HG3  . LYS A 1 253 ? 482.865 -13.672 21.079  1.00 0.00 ? 253 LYS A HG3  1 
ATOM 3913 H HD2  . LYS A 1 253 ? 484.258 -16.117 22.170  1.00 0.00 ? 253 LYS A HD2  1 
ATOM 3914 H HD3  . LYS A 1 253 ? 482.749 -15.450 22.798  1.00 0.00 ? 253 LYS A HD3  1 
ATOM 3915 H HE2  . LYS A 1 253 ? 483.050 -16.215 19.912  1.00 0.00 ? 253 LYS A HE2  1 
ATOM 3916 H HE3  . LYS A 1 253 ? 482.613 -17.404 21.138  1.00 0.00 ? 253 LYS A HE3  1 
ATOM 3917 H HZ1  . LYS A 1 253 ? 480.546 -16.734 20.607  1.00 0.00 ? 253 LYS A HZ1  1 
ATOM 3918 H HZ2  . LYS A 1 253 ? 481.045 -15.227 20.025  1.00 0.00 ? 253 LYS A HZ2  1 
ATOM 3919 H HZ3  . LYS A 1 253 ? 480.874 -15.475 21.689  1.00 0.00 ? 253 LYS A HZ3  1 
ATOM 3920 N N    . THR A 1 254 ? 483.889 -12.479 18.117  1.00 0.00 ? 254 THR A N    1 
ATOM 3921 C CA   . THR A 1 254 ? 483.488 -12.088 16.769  1.00 0.00 ? 254 THR A CA   1 
ATOM 3922 C C    . THR A 1 254 ? 483.300 -10.577 16.673  1.00 0.00 ? 254 THR A C    1 
ATOM 3923 O O    . THR A 1 254 ? 482.516 -10.089 15.859  1.00 0.00 ? 254 THR A O    1 
ATOM 3924 C CB   . THR A 1 254 ? 482.194 -12.800 16.373  1.00 0.00 ? 254 THR A CB   1 
ATOM 3925 O OG1  . THR A 1 254 ? 481.751 -12.365 15.100  1.00 0.00 ? 254 THR A OG1  1 
ATOM 3926 C CG2  . THR A 1 254 ? 481.065 -12.572 17.354  1.00 0.00 ? 254 THR A CG2  1 
ATOM 3927 H H    . THR A 1 254 ? 483.198 -12.675 18.783  1.00 0.00 ? 254 THR A H    1 
ATOM 3928 H HA   . THR A 1 254 ? 484.272 -12.385 16.091  1.00 0.00 ? 254 THR A HA   1 
ATOM 3929 H HB   . THR A 1 254 ? 482.380 -13.863 16.323  1.00 0.00 ? 254 THR A HB   1 
ATOM 3930 H HG1  . THR A 1 254 ? 480.937 -12.819 14.871  1.00 0.00 ? 254 THR A HG1  1 
ATOM 3931 H HG21 . THR A 1 254 ? 480.709 -13.524 17.719  1.00 0.00 ? 254 THR A HG21 1 
ATOM 3932 H HG22 . THR A 1 254 ? 480.259 -12.050 16.860  1.00 0.00 ? 254 THR A HG22 1 
ATOM 3933 H HG23 . THR A 1 254 ? 481.424 -11.980 18.182  1.00 0.00 ? 254 THR A HG23 1 
ATOM 3934 N N    . ALA A 1 255 ? 484.024 -9.843  17.511  1.00 0.00 ? 255 ALA A N    1 
ATOM 3935 C CA   . ALA A 1 255 ? 483.941 -8.391  17.528  1.00 0.00 ? 255 ALA A CA   1 
ATOM 3936 C C    . ALA A 1 255 ? 484.835 -7.777  16.456  1.00 0.00 ? 255 ALA A C    1 
ATOM 3937 O O    . ALA A 1 255 ? 485.790 -8.401  15.995  1.00 0.00 ? 255 ALA A O    1 
ATOM 3938 C CB   . ALA A 1 255 ? 484.323 -7.867  18.904  1.00 0.00 ? 255 ALA A CB   1 
ATOM 3939 H H    . ALA A 1 255 ? 484.628 -10.288 18.136  1.00 0.00 ? 255 ALA A H    1 
ATOM 3940 H HA   . ALA A 1 255 ? 482.916 -8.111  17.333  1.00 0.00 ? 255 ALA A HA   1 
ATOM 3941 H HB1  . ALA A 1 255 ? 485.327 -7.467  18.873  1.00 0.00 ? 255 ALA A HB1  1 
ATOM 3942 H HB2  . ALA A 1 255 ? 484.281 -8.676  19.619  1.00 0.00 ? 255 ALA A HB2  1 
ATOM 3943 H HB3  . ALA A 1 255 ? 483.634 -7.090  19.198  1.00 0.00 ? 255 ALA A HB3  1 
ATOM 3944 N N    . LEU A 1 256 ? 484.516 -6.548  16.067  1.00 0.00 ? 256 LEU A N    1 
ATOM 3945 C CA   . LEU A 1 256 ? 485.288 -5.844  15.051  1.00 0.00 ? 256 LEU A CA   1 
ATOM 3946 C C    . LEU A 1 256 ? 486.234 -4.841  15.687  1.00 0.00 ? 256 LEU A C    1 
ATOM 3947 O O    . LEU A 1 256 ? 485.882 -4.166  16.655  1.00 0.00 ? 256 LEU A O    1 
ATOM 3948 C CB   . LEU A 1 256 ? 484.358 -5.122  14.076  1.00 0.00 ? 256 LEU A CB   1 
ATOM 3949 C CG   . LEU A 1 256 ? 484.450 -5.589  12.625  1.00 0.00 ? 256 LEU A CG   1 
ATOM 3950 C CD1  . LEU A 1 256 ? 483.556 -4.743  11.748  1.00 0.00 ? 256 LEU A CD1  1 
ATOM 3951 C CD2  . LEU A 1 256 ? 485.876 -5.527  12.114  1.00 0.00 ? 256 LEU A CD2  1 
ATOM 3952 H H    . LEU A 1 256 ? 483.743 -6.108  16.477  1.00 0.00 ? 256 LEU A H    1 
ATOM 3953 H HA   . LEU A 1 256 ? 485.869 -6.573  14.508  1.00 0.00 ? 256 LEU A HA   1 
ATOM 3954 H HB2  . LEU A 1 256 ? 483.342 -5.263  14.413  1.00 0.00 ? 256 LEU A HB2  1 
ATOM 3955 H HB3  . LEU A 1 256 ? 484.584 -4.064  14.104  1.00 0.00 ? 256 LEU A HB3  1 
ATOM 3956 H HG   . LEU A 1 256 ? 484.115 -6.612  12.560  1.00 0.00 ? 256 LEU A HG   1 
ATOM 3957 H HD11 . LEU A 1 256 ? 482.599 -4.620  12.231  1.00 0.00 ? 256 LEU A HD11 1 
ATOM 3958 H HD12 . LEU A 1 256 ? 483.422 -5.236  10.796  1.00 0.00 ? 256 LEU A HD12 1 
ATOM 3959 H HD13 . LEU A 1 256 ? 484.010 -3.776  11.595  1.00 0.00 ? 256 LEU A HD13 1 
ATOM 3960 H HD21 . LEU A 1 256 ? 486.494 -6.205  12.681  1.00 0.00 ? 256 LEU A HD21 1 
ATOM 3961 H HD22 . LEU A 1 256 ? 486.250 -4.520  12.220  1.00 0.00 ? 256 LEU A HD22 1 
ATOM 3962 H HD23 . LEU A 1 256 ? 485.888 -5.810  11.068  1.00 0.00 ? 256 LEU A HD23 1 
ATOM 3963 N N    . ALA A 1 257 ? 487.429 -4.733  15.127  1.00 0.00 ? 257 ALA A N    1 
ATOM 3964 C CA   . ALA A 1 257 ? 488.412 -3.794  15.633  1.00 0.00 ? 257 ALA A CA   1 
ATOM 3965 C C    . ALA A 1 257 ? 488.395 -2.528  14.793  1.00 0.00 ? 257 ALA A C    1 
ATOM 3966 O O    . ALA A 1 257 ? 488.845 -2.526  13.647  1.00 0.00 ? 257 ALA A O    1 
ATOM 3967 C CB   . ALA A 1 257 ? 489.786 -4.437  15.603  1.00 0.00 ? 257 ALA A CB   1 
ATOM 3968 H H    . ALA A 1 257 ? 487.647 -5.287  14.349  1.00 0.00 ? 257 ALA A H    1 
ATOM 3969 H HA   . ALA A 1 257 ? 488.164 -3.552  16.655  1.00 0.00 ? 257 ALA A HA   1 
ATOM 3970 H HB1  . ALA A 1 257 ? 489.786 -5.239  14.878  1.00 0.00 ? 257 ALA A HB1  1 
ATOM 3971 H HB2  . ALA A 1 257 ? 490.020 -4.833  16.580  1.00 0.00 ? 257 ALA A HB2  1 
ATOM 3972 H HB3  . ALA A 1 257 ? 490.524 -3.700  15.325  1.00 0.00 ? 257 ALA A HB3  1 
ATOM 3973 N N    . LEU A 1 258 ? 487.834 -1.463  15.350  1.00 0.00 ? 258 LEU A N    1 
ATOM 3974 C CA   . LEU A 1 258 ? 487.707 -0.200  14.642  1.00 0.00 ? 258 LEU A CA   1 
ATOM 3975 C C    . LEU A 1 258 ? 488.793 0.793   15.053  1.00 0.00 ? 258 LEU A C    1 
ATOM 3976 O O    . LEU A 1 258 ? 488.997 1.043   16.237  1.00 0.00 ? 258 LEU A O    1 
ATOM 3977 C CB   . LEU A 1 258 ? 486.320 0.375   14.952  1.00 0.00 ? 258 LEU A CB   1 
ATOM 3978 C CG   . LEU A 1 258 ? 485.676 1.224   13.860  1.00 0.00 ? 258 LEU A CG   1 
ATOM 3979 C CD1  . LEU A 1 258 ? 486.170 2.654   13.957  1.00 0.00 ? 258 LEU A CD1  1 
ATOM 3980 C CD2  . LEU A 1 258 ? 485.946 0.638   12.479  1.00 0.00 ? 258 LEU A CD2  1 
ATOM 3981 H H    . LEU A 1 258 ? 487.437 -1.521  16.244  1.00 0.00 ? 258 LEU A H    1 
ATOM 3982 H HA   . LEU A 1 258 ? 487.784 -0.395  13.585  1.00 0.00 ? 258 LEU A HA   1 
ATOM 3983 H HB2  . LEU A 1 258 ? 485.657 -0.449  15.166  1.00 0.00 ? 258 LEU A HB2  1 
ATOM 3984 H HB3  . LEU A 1 258 ? 486.403 0.983   15.841  1.00 0.00 ? 258 LEU A HB3  1 
ATOM 3985 H HG   . LEU A 1 258 ? 484.606 1.236   14.013  1.00 0.00 ? 258 LEU A HG   1 
ATOM 3986 H HD11 . LEU A 1 258 ? 486.002 3.155   13.020  1.00 0.00 ? 258 LEU A HD11 1 
ATOM 3987 H HD12 . LEU A 1 258 ? 487.224 2.655   14.185  1.00 0.00 ? 258 LEU A HD12 1 
ATOM 3988 H HD13 . LEU A 1 258 ? 485.630 3.167   14.743  1.00 0.00 ? 258 LEU A HD13 1 
ATOM 3989 H HD21 . LEU A 1 258 ? 485.303 1.114   11.753  1.00 0.00 ? 258 LEU A HD21 1 
ATOM 3990 H HD22 . LEU A 1 258 ? 485.745 -0.426  12.495  1.00 0.00 ? 258 LEU A HD22 1 
ATOM 3991 H HD23 . LEU A 1 258 ? 486.978 0.806   12.212  1.00 0.00 ? 258 LEU A HD23 1 
ATOM 3992 N N    . GLU A 1 259 ? 489.489 1.362   14.073  1.00 0.00 ? 259 GLU A N    1 
ATOM 3993 C CA   . GLU A 1 259 ? 490.545 2.328   14.363  1.00 0.00 ? 259 GLU A CA   1 
ATOM 3994 C C    . GLU A 1 259 ? 490.544 3.468   13.346  1.00 0.00 ? 259 GLU A C    1 
ATOM 3995 O O    . GLU A 1 259 ? 490.545 3.231   12.138  1.00 0.00 ? 259 GLU A O    1 
ATOM 3996 C CB   . GLU A 1 259 ? 491.909 1.634   14.382  1.00 0.00 ? 259 GLU A CB   1 
ATOM 3997 C CG   . GLU A 1 259 ? 492.495 1.412   13.000  1.00 0.00 ? 259 GLU A CG   1 
ATOM 3998 C CD   . GLU A 1 259 ? 493.837 0.707   13.039  1.00 0.00 ? 259 GLU A CD   1 
ATOM 3999 O OE1  . GLU A 1 259 ? 493.866 -0.498  13.365  1.00 0.00 ? 259 GLU A OE1  1 
ATOM 4000 O OE2  . GLU A 1 259 ? 494.859 1.361   12.743  1.00 0.00 ? 259 GLU A OE2  1 
ATOM 4001 H H    . GLU A 1 259 ? 489.293 1.124   13.138  1.00 0.00 ? 259 GLU A H    1 
ATOM 4002 H HA   . GLU A 1 259 ? 490.351 2.737   15.341  1.00 0.00 ? 259 GLU A HA   1 
ATOM 4003 H HB2  . GLU A 1 259 ? 492.600 2.239   14.950  1.00 0.00 ? 259 GLU A HB2  1 
ATOM 4004 H HB3  . GLU A 1 259 ? 491.805 0.673   14.864  1.00 0.00 ? 259 GLU A HB3  1 
ATOM 4005 H HG2  . GLU A 1 259 ? 491.806 0.812   12.426  1.00 0.00 ? 259 GLU A HG2  1 
ATOM 4006 H HG3  . GLU A 1 259 ? 492.620 2.372   12.523  1.00 0.00 ? 259 GLU A HG3  1 
ATOM 4007 N N    . VAL A 1 260 ? 490.539 4.708   13.839  1.00 0.00 ? 260 VAL A N    1 
ATOM 4008 C CA   . VAL A 1 260 ? 490.533 5.881   12.972  1.00 0.00 ? 260 VAL A CA   1 
ATOM 4009 C C    . VAL A 1 260 ? 491.603 5.767   11.895  1.00 0.00 ? 260 VAL A C    1 
ATOM 4010 O O    . VAL A 1 260 ? 492.801 5.753   12.179  1.00 0.00 ? 260 VAL A O    1 
ATOM 4011 C CB   . VAL A 1 260 ? 490.712 7.190   13.777  1.00 0.00 ? 260 VAL A CB   1 
ATOM 4012 C CG1  . VAL A 1 260 ? 491.715 7.002   14.899  1.00 0.00 ? 260 VAL A CG1  1 
ATOM 4013 C CG2  . VAL A 1 260 ? 491.115 8.348   12.873  1.00 0.00 ? 260 VAL A CG2  1 
ATOM 4014 H H    . VAL A 1 260 ? 490.531 4.844   14.802  1.00 0.00 ? 260 VAL A H    1 
ATOM 4015 H HA   . VAL A 1 260 ? 489.572 5.922   12.490  1.00 0.00 ? 260 VAL A HA   1 
ATOM 4016 H HB   . VAL A 1 260 ? 489.759 7.436   14.226  1.00 0.00 ? 260 VAL A HB   1 
ATOM 4017 H HG11 . VAL A 1 260 ? 491.185 6.866   15.830  1.00 0.00 ? 260 VAL A HG11 1 
ATOM 4018 H HG12 . VAL A 1 260 ? 492.349 7.873   14.968  1.00 0.00 ? 260 VAL A HG12 1 
ATOM 4019 H HG13 . VAL A 1 260 ? 492.318 6.130   14.698  1.00 0.00 ? 260 VAL A HG13 1 
ATOM 4020 H HG21 . VAL A 1 260 ? 490.619 9.250   13.201  1.00 0.00 ? 260 VAL A HG21 1 
ATOM 4021 H HG22 . VAL A 1 260 ? 490.828 8.128   11.856  1.00 0.00 ? 260 VAL A HG22 1 
ATOM 4022 H HG23 . VAL A 1 260 ? 492.185 8.488   12.923  1.00 0.00 ? 260 VAL A HG23 1 
ATOM 4023 N N    . GLY A 1 261 ? 491.144 5.667   10.658  1.00 0.00 ? 261 GLY A N    1 
ATOM 4024 C CA   . GLY A 1 261 ? 492.038 5.531   9.533   1.00 0.00 ? 261 GLY A CA   1 
ATOM 4025 C C    . GLY A 1 261 ? 491.426 4.678   8.444   1.00 0.00 ? 261 GLY A C    1 
ATOM 4026 O O    . GLY A 1 261 ? 491.263 5.125   7.309   1.00 0.00 ? 261 GLY A O    1 
ATOM 4027 H H    . GLY A 1 261 ? 490.177 5.672   10.509  1.00 0.00 ? 261 GLY A H    1 
ATOM 4028 H HA2  . GLY A 1 261 ? 492.261 6.510   9.138   1.00 0.00 ? 261 GLY A HA2  1 
ATOM 4029 H HA3  . GLY A 1 261 ? 492.954 5.068   9.867   1.00 0.00 ? 261 GLY A HA3  1 
ATOM 4030 N N    . GLU A 1 262 ? 491.100 3.435   8.791   1.00 0.00 ? 262 GLU A N    1 
ATOM 4031 C CA   . GLU A 1 262 ? 490.517 2.490   7.843   1.00 0.00 ? 262 GLU A CA   1 
ATOM 4032 C C    . GLU A 1 262 ? 489.123 2.920   7.403   1.00 0.00 ? 262 GLU A C    1 
ATOM 4033 O O    . GLU A 1 262 ? 488.581 3.913   7.889   1.00 0.00 ? 262 GLU A O    1 
ATOM 4034 C CB   . GLU A 1 262 ? 490.438 1.095   8.473   1.00 0.00 ? 262 GLU A CB   1 
ATOM 4035 C CG   . GLU A 1 262 ? 491.587 0.778   9.417   1.00 0.00 ? 262 GLU A CG   1 
ATOM 4036 C CD   . GLU A 1 262 ? 492.172 -0.602  9.186   1.00 0.00 ? 262 GLU A CD   1 
ATOM 4037 O OE1  . GLU A 1 262 ? 492.732 -0.834  8.094   1.00 0.00 ? 262 GLU A OE1  1 
ATOM 4038 O OE2  . GLU A 1 262 ? 492.071 -1.449  10.098  1.00 0.00 ? 262 GLU A OE2  1 
ATOM 4039 H H    . GLU A 1 262 ? 491.274 3.123   9.704   1.00 0.00 ? 262 GLU A H    1 
ATOM 4040 H HA   . GLU A 1 262 ? 491.159 2.447   6.977   1.00 0.00 ? 262 GLU A HA   1 
ATOM 4041 H HB2  . GLU A 1 262 ? 489.515 1.018   9.033   1.00 0.00 ? 262 GLU A HB2  1 
ATOM 4042 H HB3  . GLU A 1 262 ? 490.432 0.356   7.685   1.00 0.00 ? 262 GLU A HB3  1 
ATOM 4043 H HG2  . GLU A 1 262 ? 492.365 1.512   9.272   1.00 0.00 ? 262 GLU A HG2  1 
ATOM 4044 H HG3  . GLU A 1 262 ? 491.223 0.836   10.434  1.00 0.00 ? 262 GLU A HG3  1 
ATOM 4045 N N    . LEU A 1 263 ? 488.546 2.148   6.488   1.00 0.00 ? 263 LEU A N    1 
ATOM 4046 C CA   . LEU A 1 263 ? 487.208 2.423   5.983   1.00 0.00 ? 263 LEU A CA   1 
ATOM 4047 C C    . LEU A 1 263 ? 486.268 1.276   6.323   1.00 0.00 ? 263 LEU A C    1 
ATOM 4048 O O    . LEU A 1 263 ? 486.551 0.119   6.015   1.00 0.00 ? 263 LEU A O    1 
ATOM 4049 C CB   . LEU A 1 263 ? 487.229 2.631   4.466   1.00 0.00 ? 263 LEU A CB   1 
ATOM 4050 C CG   . LEU A 1 263 ? 485.861 2.869   3.824   1.00 0.00 ? 263 LEU A CG   1 
ATOM 4051 C CD1  . LEU A 1 263 ? 485.162 1.547   3.550   1.00 0.00 ? 263 LEU A CD1  1 
ATOM 4052 C CD2  . LEU A 1 263 ? 485.000 3.754   4.712   1.00 0.00 ? 263 LEU A CD2  1 
ATOM 4053 H H    . LEU A 1 263 ? 489.030 1.365   6.151   1.00 0.00 ? 263 LEU A H    1 
ATOM 4054 H HA   . LEU A 1 263 ? 486.850 3.323   6.459   1.00 0.00 ? 263 LEU A HA   1 
ATOM 4055 H HB2  . LEU A 1 263 ? 487.857 3.478   4.247   1.00 0.00 ? 263 LEU A HB2  1 
ATOM 4056 H HB3  . LEU A 1 263 ? 487.662 1.755   4.010   1.00 0.00 ? 263 LEU A HB3  1 
ATOM 4057 H HG   . LEU A 1 263 ? 485.998 3.375   2.879   1.00 0.00 ? 263 LEU A HG   1 
ATOM 4058 H HD11 . LEU A 1 263 ? 484.626 1.234   4.434   1.00 0.00 ? 263 LEU A HD11 1 
ATOM 4059 H HD12 . LEU A 1 263 ? 485.895 0.799   3.289   1.00 0.00 ? 263 LEU A HD12 1 
ATOM 4060 H HD13 . LEU A 1 263 ? 484.466 1.671   2.733   1.00 0.00 ? 263 LEU A HD13 1 
ATOM 4061 H HD21 . LEU A 1 263 ? 485.636 4.379   5.323   1.00 0.00 ? 263 LEU A HD21 1 
ATOM 4062 H HD22 . LEU A 1 263 ? 484.385 3.135   5.349   1.00 0.00 ? 263 LEU A HD22 1 
ATOM 4063 H HD23 . LEU A 1 263 ? 484.371 4.373   4.096   1.00 0.00 ? 263 LEU A HD23 1 
ATOM 4064 N N    . VAL A 1 264 ? 485.148 1.599   6.955   1.00 0.00 ? 264 VAL A N    1 
ATOM 4065 C CA   . VAL A 1 264 ? 484.175 0.584   7.326   1.00 0.00 ? 264 VAL A CA   1 
ATOM 4066 C C    . VAL A 1 264 ? 482.786 0.932   6.815   1.00 0.00 ? 264 VAL A C    1 
ATOM 4067 O O    . VAL A 1 264 ? 482.357 2.085   6.876   1.00 0.00 ? 264 VAL A O    1 
ATOM 4068 C CB   . VAL A 1 264 ? 484.104 0.388   8.853   1.00 0.00 ? 264 VAL A CB   1 
ATOM 4069 C CG1  . VAL A 1 264 ? 483.718 1.688   9.541   1.00 0.00 ? 264 VAL A CG1  1 
ATOM 4070 C CG2  . VAL A 1 264 ? 483.119 -0.723  9.202   1.00 0.00 ? 264 VAL A CG2  1 
ATOM 4071 H H    . VAL A 1 264 ? 484.972 2.537   7.174   1.00 0.00 ? 264 VAL A H    1 
ATOM 4072 H HA   . VAL A 1 264 ? 484.485 -0.349  6.881   1.00 0.00 ? 264 VAL A HA   1 
ATOM 4073 H HB   . VAL A 1 264 ? 485.082 0.096   9.205   1.00 0.00 ? 264 VAL A HB   1 
ATOM 4074 H HG11 . VAL A 1 264 ? 483.696 1.537   10.610  1.00 0.00 ? 264 VAL A HG11 1 
ATOM 4075 H HG12 . VAL A 1 264 ? 482.740 1.999   9.201   1.00 0.00 ? 264 VAL A HG12 1 
ATOM 4076 H HG13 . VAL A 1 264 ? 484.443 2.452   9.300   1.00 0.00 ? 264 VAL A HG13 1 
ATOM 4077 H HG21 . VAL A 1 264 ? 483.149 -1.484  8.437   1.00 0.00 ? 264 VAL A HG21 1 
ATOM 4078 H HG22 . VAL A 1 264 ? 482.119 -0.313  9.262   1.00 0.00 ? 264 VAL A HG22 1 
ATOM 4079 H HG23 . VAL A 1 264 ? 483.388 -1.158  10.153  1.00 0.00 ? 264 VAL A HG23 1 
ATOM 4080 N N    . LYS A 1 265 ? 482.078 -0.083  6.343   1.00 0.00 ? 265 LYS A N    1 
ATOM 4081 C CA   . LYS A 1 265 ? 480.722 0.096   5.855   1.00 0.00 ? 265 LYS A CA   1 
ATOM 4082 C C    . LYS A 1 265 ? 479.748 -0.393  6.913   1.00 0.00 ? 265 LYS A C    1 
ATOM 4083 O O    . LYS A 1 265 ? 480.091 -1.254  7.714   1.00 0.00 ? 265 LYS A O    1 
ATOM 4084 C CB   . LYS A 1 265 ? 480.497 -0.662  4.547   1.00 0.00 ? 265 LYS A CB   1 
ATOM 4085 C CG   . LYS A 1 265 ? 481.749 -0.819  3.696   1.00 0.00 ? 265 LYS A CG   1 
ATOM 4086 C CD   . LYS A 1 265 ? 482.248 -2.248  3.710   1.00 0.00 ? 265 LYS A CD   1 
ATOM 4087 C CE   . LYS A 1 265 ? 481.195 -3.207  3.176   1.00 0.00 ? 265 LYS A CE   1 
ATOM 4088 N NZ   . LYS A 1 265 ? 481.712 -4.031  2.048   1.00 0.00 ? 265 LYS A NZ   1 
ATOM 4089 H H    . LYS A 1 265 ? 482.469 -0.981  6.349   1.00 0.00 ? 265 LYS A H    1 
ATOM 4090 H HA   . LYS A 1 265 ? 480.562 1.151   5.688   1.00 0.00 ? 265 LYS A HA   1 
ATOM 4091 H HB2  . LYS A 1 265 ? 480.118 -1.646  4.780   1.00 0.00 ? 265 LYS A HB2  1 
ATOM 4092 H HB3  . LYS A 1 265 ? 479.761 -0.129  3.964   1.00 0.00 ? 265 LYS A HB3  1 
ATOM 4093 H HG2  . LYS A 1 265 ? 481.518 -0.539  2.679   1.00 0.00 ? 265 LYS A HG2  1 
ATOM 4094 H HG3  . LYS A 1 265 ? 482.521 -0.171  4.083   1.00 0.00 ? 265 LYS A HG3  1 
ATOM 4095 H HD2  . LYS A 1 265 ? 483.133 -2.318  3.096   1.00 0.00 ? 265 LYS A HD2  1 
ATOM 4096 H HD3  . LYS A 1 265 ? 482.487 -2.517  4.726   1.00 0.00 ? 265 LYS A HD3  1 
ATOM 4097 H HE2  . LYS A 1 265 ? 480.882 -3.862  3.976   1.00 0.00 ? 265 LYS A HE2  1 
ATOM 4098 H HE3  . LYS A 1 265 ? 480.347 -2.632  2.832   1.00 0.00 ? 265 LYS A HE3  1 
ATOM 4099 H HZ1  . LYS A 1 265 ? 481.973 -4.978  2.388   1.00 0.00 ? 265 LYS A HZ1  1 
ATOM 4100 H HZ2  . LYS A 1 265 ? 482.551 -3.581  1.630   1.00 0.00 ? 265 LYS A HZ2  1 
ATOM 4101 H HZ3  . LYS A 1 265 ? 480.982 -4.127  1.313   1.00 0.00 ? 265 LYS A HZ3  1 
ATOM 4102 N N    . VAL A 1 266 ? 478.551 0.167   6.936   1.00 0.00 ? 266 VAL A N    1 
ATOM 4103 C CA   . VAL A 1 266 ? 477.561 -0.221  7.932   1.00 0.00 ? 266 VAL A CA   1 
ATOM 4104 C C    . VAL A 1 266 ? 476.753 -1.446  7.504   1.00 0.00 ? 266 VAL A C    1 
ATOM 4105 O O    . VAL A 1 266 ? 475.660 -1.319  6.952   1.00 0.00 ? 266 VAL A O    1 
ATOM 4106 C CB   . VAL A 1 266 ? 476.598 0.938   8.232   1.00 0.00 ? 266 VAL A CB   1 
ATOM 4107 C CG1  . VAL A 1 266 ? 475.679 0.575   9.388   1.00 0.00 ? 266 VAL A CG1  1 
ATOM 4108 C CG2  . VAL A 1 266 ? 477.379 2.211   8.529   1.00 0.00 ? 266 VAL A CG2  1 
ATOM 4109 H H    . VAL A 1 266 ? 478.334 0.865   6.285   1.00 0.00 ? 266 VAL A H    1 
ATOM 4110 H HA   . VAL A 1 266 ? 478.092 -0.458  8.843   1.00 0.00 ? 266 VAL A HA   1 
ATOM 4111 H HB   . VAL A 1 266 ? 475.988 1.109   7.357   1.00 0.00 ? 266 VAL A HB   1 
ATOM 4112 H HG11 . VAL A 1 266 ? 475.108 -0.305  9.132   1.00 0.00 ? 266 VAL A HG11 1 
ATOM 4113 H HG12 . VAL A 1 266 ? 475.007 1.395   9.585   1.00 0.00 ? 266 VAL A HG12 1 
ATOM 4114 H HG13 . VAL A 1 266 ? 476.270 0.375   10.269  1.00 0.00 ? 266 VAL A HG13 1 
ATOM 4115 H HG21 . VAL A 1 266 ? 478.427 1.973   8.646   1.00 0.00 ? 266 VAL A HG21 1 
ATOM 4116 H HG22 . VAL A 1 266 ? 477.008 2.659   9.439   1.00 0.00 ? 266 VAL A HG22 1 
ATOM 4117 H HG23 . VAL A 1 266 ? 477.258 2.906   7.710   1.00 0.00 ? 266 VAL A HG23 1 
ATOM 4118 N N    . THR A 1 267 ? 477.296 -2.631  7.772   1.00 0.00 ? 267 THR A N    1 
ATOM 4119 C CA   . THR A 1 267 ? 476.623 -3.880  7.425   1.00 0.00 ? 267 THR A CA   1 
ATOM 4120 C C    . THR A 1 267 ? 475.842 -4.442  8.617   1.00 0.00 ? 267 THR A C    1 
ATOM 4121 O O    . THR A 1 267 ? 476.421 -4.959  9.573   1.00 0.00 ? 267 THR A O    1 
ATOM 4122 C CB   . THR A 1 267 ? 477.628 -4.915  6.913   1.00 0.00 ? 267 THR A CB   1 
ATOM 4123 O OG1  . THR A 1 267 ? 477.080 -6.220  6.972   1.00 0.00 ? 267 THR A OG1  1 
ATOM 4124 C CG2  . THR A 1 267 ? 478.925 -4.926  7.687   1.00 0.00 ? 267 THR A CG2  1 
ATOM 4125 H H    . THR A 1 267 ? 478.170 -2.662  8.213   1.00 0.00 ? 267 THR A H    1 
ATOM 4126 H HA   . THR A 1 267 ? 475.924 -3.660  6.634   1.00 0.00 ? 267 THR A HA   1 
ATOM 4127 H HB   . THR A 1 267 ? 477.861 -4.693  5.882   1.00 0.00 ? 267 THR A HB   1 
ATOM 4128 H HG1  . THR A 1 267 ? 477.021 -6.504  7.888   1.00 0.00 ? 267 THR A HG1  1 
ATOM 4129 H HG21 . THR A 1 267 ? 479.292 -5.938  7.760   1.00 0.00 ? 267 THR A HG21 1 
ATOM 4130 H HG22 . THR A 1 267 ? 478.753 -4.531  8.677   1.00 0.00 ? 267 THR A HG22 1 
ATOM 4131 H HG23 . THR A 1 267 ? 479.653 -4.314  7.175   1.00 0.00 ? 267 THR A HG23 1 
ATOM 4132 N N    . LYS A 1 268 ? 474.520 -4.327  8.531   1.00 0.00 ? 268 LYS A N    1 
ATOM 4133 C CA   . LYS A 1 268 ? 473.592 -4.798  9.556   1.00 0.00 ? 268 LYS A CA   1 
ATOM 4134 C C    . LYS A 1 268 ? 473.434 -3.761  10.664  1.00 0.00 ? 268 LYS A C    1 
ATOM 4135 O O    . LYS A 1 268 ? 474.288 -3.628  11.540  1.00 0.00 ? 268 LYS A O    1 
ATOM 4136 C CB   . LYS A 1 268 ? 474.024 -6.149  10.127  1.00 0.00 ? 268 LYS A CB   1 
ATOM 4137 C CG   . LYS A 1 268 ? 472.994 -7.248  9.925   1.00 0.00 ? 268 LYS A CG   1 
ATOM 4138 C CD   . LYS A 1 268 ? 472.966 -7.728  8.483   1.00 0.00 ? 268 LYS A CD   1 
ATOM 4139 C CE   . LYS A 1 268 ? 472.361 -9.118  8.370   1.00 0.00 ? 268 LYS A CE   1 
ATOM 4140 N NZ   . LYS A 1 268 ? 470.876 -9.086  8.470   1.00 0.00 ? 268 LYS A NZ   1 
ATOM 4141 H H    . LYS A 1 268 ? 474.153 -3.905  7.748   1.00 0.00 ? 268 LYS A H    1 
ATOM 4142 H HA   . LYS A 1 268 ? 472.630 -4.922  9.078   1.00 0.00 ? 268 LYS A HA   1 
ATOM 4143 H HB2  . LYS A 1 268 ? 474.941 -6.455  9.650   1.00 0.00 ? 268 LYS A HB2  1 
ATOM 4144 H HB3  . LYS A 1 268 ? 474.194 -6.040  11.183  1.00 0.00 ? 268 LYS A HB3  1 
ATOM 4145 H HG2  . LYS A 1 268 ? 473.240 -8.082  10.566  1.00 0.00 ? 268 LYS A HG2  1 
ATOM 4146 H HG3  . LYS A 1 268 ? 472.019 -6.866  10.187  1.00 0.00 ? 268 LYS A HG3  1 
ATOM 4147 H HD2  . LYS A 1 268 ? 472.376 -7.041  7.896   1.00 0.00 ? 268 LYS A HD2  1 
ATOM 4148 H HD3  . LYS A 1 268 ? 473.977 -7.753  8.102   1.00 0.00 ? 268 LYS A HD3  1 
ATOM 4149 H HE2  . LYS A 1 268 ? 472.639 -9.542  7.417   1.00 0.00 ? 268 LYS A HE2  1 
ATOM 4150 H HE3  . LYS A 1 268 ? 472.754 -9.733  9.166   1.00 0.00 ? 268 LYS A HE3  1 
ATOM 4151 H HZ1  . LYS A 1 268 ? 470.474 -8.561  7.667   1.00 0.00 ? 268 LYS A HZ1  1 
ATOM 4152 H HZ2  . LYS A 1 268 ? 470.586 -8.621  9.354   1.00 0.00 ? 268 LYS A HZ2  1 
ATOM 4153 H HZ3  . LYS A 1 268 ? 470.496 -10.055 8.462   1.00 0.00 ? 268 LYS A HZ3  1 
ATOM 4154 N N    . ILE A 1 269 ? 472.332 -3.021  10.601  1.00 0.00 ? 269 ILE A N    1 
ATOM 4155 C CA   . ILE A 1 269 ? 472.041 -1.980  11.579  1.00 0.00 ? 269 ILE A CA   1 
ATOM 4156 C C    . ILE A 1 269 ? 470.938 -2.417  12.540  1.00 0.00 ? 269 ILE A C    1 
ATOM 4157 O O    . ILE A 1 269 ? 469.790 -2.607  12.137  1.00 0.00 ? 269 ILE A O    1 
ATOM 4158 C CB   . ILE A 1 269 ? 471.618 -0.673  10.876  1.00 0.00 ? 269 ILE A CB   1 
ATOM 4159 C CG1  . ILE A 1 269 ? 472.777 -0.127  10.041  1.00 0.00 ? 269 ILE A CG1  1 
ATOM 4160 C CG2  . ILE A 1 269 ? 471.161 0.362   11.888  1.00 0.00 ? 269 ILE A CG2  1 
ATOM 4161 C CD1  . ILE A 1 269 ? 472.457 1.172   9.333   1.00 0.00 ? 269 ILE A CD1  1 
ATOM 4162 H H    . ILE A 1 269 ? 471.698 -3.175  9.870   1.00 0.00 ? 269 ILE A H    1 
ATOM 4163 H HA   . ILE A 1 269 ? 472.942 -1.783  12.142  1.00 0.00 ? 269 ILE A HA   1 
ATOM 4164 H HB   . ILE A 1 269 ? 470.788 -0.893  10.225  1.00 0.00 ? 269 ILE A HB   1 
ATOM 4165 H HG12 . ILE A 1 269 ? 473.623 0.047   10.686  1.00 0.00 ? 269 ILE A HG12 1 
ATOM 4166 H HG13 . ILE A 1 269 ? 473.042 -0.857  9.293   1.00 0.00 ? 269 ILE A HG13 1 
ATOM 4167 H HG21 . ILE A 1 269 ? 471.637 1.307   11.673  1.00 0.00 ? 269 ILE A HG21 1 
ATOM 4168 H HG22 . ILE A 1 269 ? 471.435 0.037   12.879  1.00 0.00 ? 269 ILE A HG22 1 
ATOM 4169 H HG23 . ILE A 1 269 ? 470.092 0.477   11.831  1.00 0.00 ? 269 ILE A HG23 1 
ATOM 4170 H HD11 . ILE A 1 269 ? 473.285 1.450   8.696   1.00 0.00 ? 269 ILE A HD11 1 
ATOM 4171 H HD12 . ILE A 1 269 ? 472.288 1.949   10.063  1.00 0.00 ? 269 ILE A HD12 1 
ATOM 4172 H HD13 . ILE A 1 269 ? 471.570 1.042   8.733   1.00 0.00 ? 269 ILE A HD13 1 
ATOM 4173 N N    . ASN A 1 270 ? 471.292 -2.562  13.813  1.00 0.00 ? 270 ASN A N    1 
ATOM 4174 C CA   . ASN A 1 270 ? 470.329 -2.963  14.831  1.00 0.00 ? 270 ASN A CA   1 
ATOM 4175 C C    . ASN A 1 270 ? 469.505 -1.768  15.285  1.00 0.00 ? 270 ASN A C    1 
ATOM 4176 O O    . ASN A 1 270 ? 469.783 -0.629  14.909  1.00 0.00 ? 270 ASN A O    1 
ATOM 4177 C CB   . ASN A 1 270 ? 471.033 -3.597  16.030  1.00 0.00 ? 270 ASN A CB   1 
ATOM 4178 C CG   . ASN A 1 270 ? 470.668 -5.057  16.211  1.00 0.00 ? 270 ASN A CG   1 
ATOM 4179 O OD1  . ASN A 1 270 ? 471.362 -5.947  15.719  1.00 0.00 ? 270 ASN A OD1  1 
ATOM 4180 N ND2  . ASN A 1 270 ? 469.574 -5.311  16.918  1.00 0.00 ? 270 ASN A ND2  1 
ATOM 4181 H H    . ASN A 1 270 ? 472.220 -2.388  14.074  1.00 0.00 ? 270 ASN A H    1 
ATOM 4182 H HA   . ASN A 1 270 ? 469.666 -3.692  14.388  1.00 0.00 ? 270 ASN A HA   1 
ATOM 4183 H HB2  . ASN A 1 270 ? 472.094 -3.526  15.889  1.00 0.00 ? 270 ASN A HB2  1 
ATOM 4184 H HB3  . ASN A 1 270 ? 470.757 -3.062  16.928  1.00 0.00 ? 270 ASN A HB3  1 
ATOM 4185 H HD21 . ASN A 1 270 ? 469.070 -4.552  17.280  1.00 0.00 ? 270 ASN A HD21 1 
ATOM 4186 H HD22 . ASN A 1 270 ? 469.314 -6.247  17.050  1.00 0.00 ? 270 ASN A HD22 1 
ATOM 4187 N N    . VAL A 1 271 ? 468.483 -2.037  16.082  1.00 0.00 ? 271 VAL A N    1 
ATOM 4188 C CA   . VAL A 1 271 ? 467.607 -0.986  16.572  1.00 0.00 ? 271 VAL A CA   1 
ATOM 4189 C C    . VAL A 1 271 ? 468.259 -0.147  17.672  1.00 0.00 ? 271 VAL A C    1 
ATOM 4190 O O    . VAL A 1 271 ? 468.174 1.081   17.644  1.00 0.00 ? 271 VAL A O    1 
ATOM 4191 C CB   . VAL A 1 271 ? 466.280 -1.567  17.099  1.00 0.00 ? 271 VAL A CB   1 
ATOM 4192 C CG1  . VAL A 1 271 ? 466.527 -2.473  18.294  1.00 0.00 ? 271 VAL A CG1  1 
ATOM 4193 C CG2  . VAL A 1 271 ? 465.308 -0.450  17.458  1.00 0.00 ? 271 VAL A CG2  1 
ATOM 4194 H H    . VAL A 1 271 ? 468.306 -2.966  16.337  1.00 0.00 ? 271 VAL A H    1 
ATOM 4195 H HA   . VAL A 1 271 ? 467.377 -0.340  15.741  1.00 0.00 ? 271 VAL A HA   1 
ATOM 4196 H HB   . VAL A 1 271 ? 465.835 -2.161  16.314  1.00 0.00 ? 271 VAL A HB   1 
ATOM 4197 H HG11 . VAL A 1 271 ? 465.692 -3.147  18.414  1.00 0.00 ? 271 VAL A HG11 1 
ATOM 4198 H HG12 . VAL A 1 271 ? 466.638 -1.872  19.184  1.00 0.00 ? 271 VAL A HG12 1 
ATOM 4199 H HG13 . VAL A 1 271 ? 467.429 -3.044  18.130  1.00 0.00 ? 271 VAL A HG13 1 
ATOM 4200 H HG21 . VAL A 1 271 ? 464.590 -0.329  16.660  1.00 0.00 ? 271 VAL A HG21 1 
ATOM 4201 H HG22 . VAL A 1 271 ? 465.853 0.472   17.595  1.00 0.00 ? 271 VAL A HG22 1 
ATOM 4202 H HG23 . VAL A 1 271 ? 464.791 -0.702  18.372  1.00 0.00 ? 271 VAL A HG23 1 
ATOM 4203 N N    . SER A 1 272 ? 468.856 -0.797  18.672  1.00 0.00 ? 272 SER A N    1 
ATOM 4204 C CA   . SER A 1 272 ? 469.448 -0.083  19.802  1.00 0.00 ? 272 SER A CA   1 
ATOM 4205 C C    . SER A 1 272 ? 470.828 0.532   19.532  1.00 0.00 ? 272 SER A C    1 
ATOM 4206 O O    . SER A 1 272 ? 471.609 0.699   20.470  1.00 0.00 ? 272 SER A O    1 
ATOM 4207 C CB   . SER A 1 272 ? 469.542 -1.019  21.007  1.00 0.00 ? 272 SER A CB   1 
ATOM 4208 O OG   . SER A 1 272 ? 469.685 -0.287  22.213  1.00 0.00 ? 272 SER A OG   1 
ATOM 4209 H H    . SER A 1 272 ? 468.861 -1.776  18.704  1.00 0.00 ? 272 SER A H    1 
ATOM 4210 H HA   . SER A 1 272 ? 468.773 0.718   20.058  1.00 0.00 ? 272 SER A HA   1 
ATOM 4211 H HB2  . SER A 1 272 ? 468.644 -1.615  21.068  1.00 0.00 ? 272 SER A HB2  1 
ATOM 4212 H HB3  . SER A 1 272 ? 470.398 -1.668  20.891  1.00 0.00 ? 272 SER A HB3  1 
ATOM 4213 H HG   . SER A 1 272 ? 468.991 -0.541  22.826  1.00 0.00 ? 272 SER A HG   1 
ATOM 4214 N N    . GLY A 1 273 ? 471.122 0.931   18.297  1.00 0.00 ? 273 GLY A N    1 
ATOM 4215 C CA   . GLY A 1 273 ? 472.398 1.586   18.036  1.00 0.00 ? 273 GLY A CA   1 
ATOM 4216 C C    . GLY A 1 273 ? 473.546 0.671   17.636  1.00 0.00 ? 273 GLY A C    1 
ATOM 4217 O O    . GLY A 1 273 ? 474.408 1.083   16.859  1.00 0.00 ? 273 GLY A O    1 
ATOM 4218 H H    . GLY A 1 273 ? 470.470 0.846   17.571  1.00 0.00 ? 273 GLY A H    1 
ATOM 4219 H HA2  . GLY A 1 273 ? 472.254 2.306   17.246  1.00 0.00 ? 273 GLY A HA2  1 
ATOM 4220 H HA3  . GLY A 1 273 ? 472.686 2.122   18.929  1.00 0.00 ? 273 GLY A HA3  1 
ATOM 4221 N N    . GLN A 1 274 ? 473.607 -0.543  18.176  1.00 0.00 ? 274 GLN A N    1 
ATOM 4222 C CA   . GLN A 1 274 ? 474.717 -1.442  17.859  1.00 0.00 ? 274 GLN A CA   1 
ATOM 4223 C C    . GLN A 1 274 ? 474.562 -2.055  16.475  1.00 0.00 ? 274 GLN A C    1 
ATOM 4224 O O    . GLN A 1 274 ? 473.778 -2.975  16.271  1.00 0.00 ? 274 GLN A O    1 
ATOM 4225 C CB   . GLN A 1 274 ? 474.817 -2.549  18.910  1.00 0.00 ? 274 GLN A CB   1 
ATOM 4226 C CG   . GLN A 1 274 ? 476.220 -2.738  19.464  1.00 0.00 ? 274 GLN A CG   1 
ATOM 4227 C CD   . GLN A 1 274 ? 476.425 -4.110  20.075  1.00 0.00 ? 274 GLN A CD   1 
ATOM 4228 O OE1  . GLN A 1 274 ? 476.660 -4.239  21.277  1.00 0.00 ? 274 GLN A OE1  1 
ATOM 4229 N NE2  . GLN A 1 274 ? 476.337 -5.146  19.248  1.00 0.00 ? 274 GLN A NE2  1 
ATOM 4230 H H    . GLN A 1 274 ? 472.931 -0.833  18.824  1.00 0.00 ? 274 GLN A H    1 
ATOM 4231 H HA   . GLN A 1 274 ? 475.627 -0.861  17.879  1.00 0.00 ? 274 GLN A HA   1 
ATOM 4232 H HB2  . GLN A 1 274 ? 474.160 -2.307  19.730  1.00 0.00 ? 274 GLN A HB2  1 
ATOM 4233 H HB3  . GLN A 1 274 ? 474.499 -3.481  18.468  1.00 0.00 ? 274 GLN A HB3  1 
ATOM 4234 H HG2  . GLN A 1 274 ? 476.931 -2.609  18.661  1.00 0.00 ? 274 GLN A HG2  1 
ATOM 4235 H HG3  . GLN A 1 274 ? 476.398 -1.991  20.224  1.00 0.00 ? 274 GLN A HG3  1 
ATOM 4236 H HE21 . GLN A 1 274 ? 476.148 -4.968  18.303  1.00 0.00 ? 274 GLN A HE21 1 
ATOM 4237 H HE22 . GLN A 1 274 ? 476.465 -6.045  19.617  1.00 0.00 ? 274 GLN A HE22 1 
ATOM 4238 N N    . TRP A 1 275 ? 475.339 -1.536  15.532  1.00 0.00 ? 275 TRP A N    1 
ATOM 4239 C CA   . TRP A 1 275 ? 475.324 -2.012  14.151  1.00 0.00 ? 275 TRP A CA   1 
ATOM 4240 C C    . TRP A 1 275 ? 476.648 -2.715  13.834  1.00 0.00 ? 275 TRP A C    1 
ATOM 4241 O O    . TRP A 1 275 ? 477.591 -2.647  14.623  1.00 0.00 ? 275 TRP A O    1 
ATOM 4242 C CB   . TRP A 1 275 ? 475.077 -0.841  13.186  1.00 0.00 ? 275 TRP A CB   1 
ATOM 4243 C CG   . TRP A 1 275 ? 474.003 0.113   13.647  1.00 0.00 ? 275 TRP A CG   1 
ATOM 4244 C CD1  . TRP A 1 275 ? 473.120 -0.074  14.674  1.00 0.00 ? 275 TRP A CD1  1 
ATOM 4245 C CD2  . TRP A 1 275 ? 473.692 1.403   13.092  1.00 0.00 ? 275 TRP A CD2  1 
ATOM 4246 N NE1  . TRP A 1 275 ? 472.300 1.018   14.803  1.00 0.00 ? 275 TRP A NE1  1 
ATOM 4247 C CE2  . TRP A 1 275 ? 472.629 1.938   13.845  1.00 0.00 ? 275 TRP A CE2  1 
ATOM 4248 C CE3  . TRP A 1 275 ? 474.212 2.159   12.039  1.00 0.00 ? 275 TRP A CE3  1 
ATOM 4249 C CZ2  . TRP A 1 275 ? 472.080 3.190   13.576  1.00 0.00 ? 275 TRP A CZ2  1 
ATOM 4250 C CZ3  . TRP A 1 275 ? 473.667 3.398   11.771  1.00 0.00 ? 275 TRP A CZ3  1 
ATOM 4251 C CH2  . TRP A 1 275 ? 472.611 3.905   12.538  1.00 0.00 ? 275 TRP A CH2  1 
ATOM 4252 H H    . TRP A 1 275 ? 475.959 -0.819  15.778  1.00 0.00 ? 275 TRP A H    1 
ATOM 4253 H HA   . TRP A 1 275 ? 474.518 -2.726  14.051  1.00 0.00 ? 275 TRP A HA   1 
ATOM 4254 H HB2  . TRP A 1 275 ? 475.991 -0.283  13.078  1.00 0.00 ? 275 TRP A HB2  1 
ATOM 4255 H HB3  . TRP A 1 275 ? 474.786 -1.233  12.223  1.00 0.00 ? 275 TRP A HB3  1 
ATOM 4256 H HD1  . TRP A 1 275 ? 473.084 -0.956  15.290  1.00 0.00 ? 275 TRP A HD1  1 
ATOM 4257 H HE1  . TRP A 1 275 ? 471.593 1.120   15.471  1.00 0.00 ? 275 TRP A HE1  1 
ATOM 4258 H HE3  . TRP A 1 275 ? 475.021 1.790   11.435  1.00 0.00 ? 275 TRP A HE3  1 
ATOM 4259 H HZ2  . TRP A 1 275 ? 471.265 3.594   14.158  1.00 0.00 ? 275 TRP A HZ2  1 
ATOM 4260 H HZ3  . TRP A 1 275 ? 474.060 3.991   10.958  1.00 0.00 ? 275 TRP A HZ3  1 
ATOM 4261 H HH2  . TRP A 1 275 ? 472.214 4.879   12.292  1.00 0.00 ? 275 TRP A HH2  1 
ATOM 4262 N N    . GLU A 1 276 ? 476.723 -3.391  12.689  1.00 0.00 ? 276 GLU A N    1 
ATOM 4263 C CA   . GLU A 1 276 ? 477.949 -4.100  12.303  1.00 0.00 ? 276 GLU A CA   1 
ATOM 4264 C C    . GLU A 1 276 ? 478.508 -3.532  11.009  1.00 0.00 ? 276 GLU A C    1 
ATOM 4265 O O    . GLU A 1 276 ? 477.754 -3.056  10.165  1.00 0.00 ? 276 GLU A O    1 
ATOM 4266 C CB   . GLU A 1 276 ? 477.694 -5.604  12.128  1.00 0.00 ? 276 GLU A CB   1 
ATOM 4267 C CG   . GLU A 1 276 ? 476.265 -6.030  12.406  1.00 0.00 ? 276 GLU A CG   1 
ATOM 4268 C CD   . GLU A 1 276 ? 475.980 -6.200  13.886  1.00 0.00 ? 276 GLU A CD   1 
ATOM 4269 O OE1  . GLU A 1 276 ? 475.785 -5.177  14.575  1.00 0.00 ? 276 GLU A OE1  1 
ATOM 4270 O OE2  . GLU A 1 276 ? 475.950 -7.356  14.356  1.00 0.00 ? 276 GLU A OE2  1 
ATOM 4271 H H    . GLU A 1 276 ? 475.946 -3.409  12.087  1.00 0.00 ? 276 GLU A H    1 
ATOM 4272 H HA   . GLU A 1 276 ? 478.677 -3.956  13.088  1.00 0.00 ? 276 GLU A HA   1 
ATOM 4273 H HB2  . GLU A 1 276 ? 477.928 -5.879  11.109  1.00 0.00 ? 276 GLU A HB2  1 
ATOM 4274 H HB3  . GLU A 1 276 ? 478.345 -6.147  12.795  1.00 0.00 ? 276 GLU A HB3  1 
ATOM 4275 H HG2  . GLU A 1 276 ? 475.602 -5.281  12.009  1.00 0.00 ? 276 GLU A HG2  1 
ATOM 4276 H HG3  . GLU A 1 276 ? 476.083 -6.970  11.908  1.00 0.00 ? 276 GLU A HG3  1 
ATOM 4277 N N    . GLY A 1 277 ? 479.831 -3.543  10.861  1.00 0.00 ? 277 GLY A N    1 
ATOM 4278 C CA   . GLY A 1 277 ? 480.449 -2.992  9.677   1.00 0.00 ? 277 GLY A CA   1 
ATOM 4279 C C    . GLY A 1 277 ? 481.506 -3.907  9.087   1.00 0.00 ? 277 GLY A C    1 
ATOM 4280 O O    . GLY A 1 277 ? 481.836 -4.941  9.659   1.00 0.00 ? 277 GLY A O    1 
ATOM 4281 H H    . GLY A 1 277 ? 480.428 -3.883  11.561  1.00 0.00 ? 277 GLY A H    1 
ATOM 4282 H HA2  . GLY A 1 277 ? 479.681 -2.831  8.936   1.00 0.00 ? 277 GLY A HA2  1 
ATOM 4283 H HA3  . GLY A 1 277 ? 480.902 -2.043  9.919   1.00 0.00 ? 277 GLY A HA3  1 
ATOM 4284 N N    . GLU A 1 278 ? 482.044 -3.502  7.946   1.00 0.00 ? 278 GLU A N    1 
ATOM 4285 C CA   . GLU A 1 278 ? 483.096 -4.267  7.279   1.00 0.00 ? 278 GLU A CA   1 
ATOM 4286 C C    . GLU A 1 278 ? 484.417 -3.500  7.297   1.00 0.00 ? 278 GLU A C    1 
ATOM 4287 O O    . GLU A 1 278 ? 484.565 -2.479  6.627   1.00 0.00 ? 278 GLU A O    1 
ATOM 4288 C CB   . GLU A 1 278 ? 482.703 -4.619  5.843   1.00 0.00 ? 278 GLU A CB   1 
ATOM 4289 C CG   . GLU A 1 278 ? 482.732 -6.112  5.556   1.00 0.00 ? 278 GLU A CG   1 
ATOM 4290 C CD   . GLU A 1 278 ? 483.024 -6.421  4.100   1.00 0.00 ? 278 GLU A CD   1 
ATOM 4291 O OE1  . GLU A 1 278 ? 482.077 -6.392  3.286   1.00 0.00 ? 278 GLU A OE1  1 
ATOM 4292 O OE2  . GLU A 1 278 ? 484.199 -6.693  3.775   1.00 0.00 ? 278 GLU A OE2  1 
ATOM 4293 H H    . GLU A 1 278 ? 481.743 -2.638  7.598   1.00 0.00 ? 278 GLU A H    1 
ATOM 4294 H HA   . GLU A 1 278 ? 483.232 -5.183  7.837   1.00 0.00 ? 278 GLU A HA   1 
ATOM 4295 H HB2  . GLU A 1 278 ? 481.704 -4.256  5.657   1.00 0.00 ? 278 GLU A HB2  1 
ATOM 4296 H HB3  . GLU A 1 278 ? 483.388 -4.133  5.165   1.00 0.00 ? 278 GLU A HB3  1 
ATOM 4297 H HG2  . GLU A 1 278 ? 483.499 -6.570  6.164   1.00 0.00 ? 278 GLU A HG2  1 
ATOM 4298 H HG3  . GLU A 1 278 ? 481.771 -6.533  5.812   1.00 0.00 ? 278 GLU A HG3  1 
ATOM 4299 N N    . CYS A 1 279 ? 485.374 -4.010  8.067   1.00 0.00 ? 279 CYS A N    1 
ATOM 4300 C CA   . CYS A 1 279 ? 486.687 -3.386  8.179   1.00 0.00 ? 279 CYS A CA   1 
ATOM 4301 C C    . CYS A 1 279 ? 487.781 -4.404  7.894   1.00 0.00 ? 279 CYS A C    1 
ATOM 4302 O O    . CYS A 1 279 ? 487.898 -5.412  8.590   1.00 0.00 ? 279 CYS A O    1 
ATOM 4303 C CB   . CYS A 1 279 ? 486.878 -2.786  9.574   1.00 0.00 ? 279 CYS A CB   1 
ATOM 4304 S SG   . CYS A 1 279 ? 487.928 -1.314  9.606   1.00 0.00 ? 279 CYS A SG   1 
ATOM 4305 H H    . CYS A 1 279 ? 485.188 -4.835  8.564   1.00 0.00 ? 279 CYS A H    1 
ATOM 4306 H HA   . CYS A 1 279 ? 486.744 -2.596  7.444   1.00 0.00 ? 279 CYS A HA   1 
ATOM 4307 H HB2  . CYS A 1 279 ? 485.915 -2.508  9.975   1.00 0.00 ? 279 CYS A HB2  1 
ATOM 4308 H HB3  . CYS A 1 279 ? 487.331 -3.526  10.217  1.00 0.00 ? 279 CYS A HB3  1 
ATOM 4309 H HG   . CYS A 1 279 ? 487.374 -0.559  9.814   1.00 0.00 ? 279 CYS A HG   1 
ATOM 4310 N N    . ASN A 1 280 ? 488.573 -4.147  6.858   1.00 0.00 ? 280 ASN A N    1 
ATOM 4311 C CA   . ASN A 1 280 ? 489.643 -5.062  6.484   1.00 0.00 ? 280 ASN A CA   1 
ATOM 4312 C C    . ASN A 1 280 ? 489.055 -6.424  6.138   1.00 0.00 ? 280 ASN A C    1 
ATOM 4313 O O    . ASN A 1 280 ? 489.659 -7.464  6.402   1.00 0.00 ? 280 ASN A O    1 
ATOM 4314 C CB   . ASN A 1 280 ? 490.647 -5.197  7.630   1.00 0.00 ? 280 ASN A CB   1 
ATOM 4315 C CG   . ASN A 1 280 ? 491.869 -4.321  7.435   1.00 0.00 ? 280 ASN A CG   1 
ATOM 4316 O OD1  . ASN A 1 280 ? 491.878 -3.153  7.825   1.00 0.00 ? 280 ASN A OD1  1 
ATOM 4317 N ND2  . ASN A 1 280 ? 492.910 -4.882  6.830   1.00 0.00 ? 280 ASN A ND2  1 
ATOM 4318 H H    . ASN A 1 280 ? 488.428 -3.335  6.330   1.00 0.00 ? 280 ASN A H    1 
ATOM 4319 H HA   . ASN A 1 280 ? 490.142 -4.660  5.615   1.00 0.00 ? 280 ASN A HA   1 
ATOM 4320 H HB2  . ASN A 1 280 ? 490.167 -4.913  8.555   1.00 0.00 ? 280 ASN A HB2  1 
ATOM 4321 H HB3  . ASN A 1 280 ? 490.971 -6.225  7.700   1.00 0.00 ? 280 ASN A HB3  1 
ATOM 4322 H HD21 . ASN A 1 280 ? 492.832 -5.817  6.547   1.00 0.00 ? 280 ASN A HD21 1 
ATOM 4323 H HD22 . ASN A 1 280 ? 493.713 -4.337  6.691   1.00 0.00 ? 280 ASN A HD22 1 
ATOM 4324 N N    . GLY A 1 281 ? 487.863 -6.403  5.550   1.00 0.00 ? 281 GLY A N    1 
ATOM 4325 C CA   . GLY A 1 281 ? 487.191 -7.631  5.179   1.00 0.00 ? 281 GLY A CA   1 
ATOM 4326 C C    . GLY A 1 281 ? 486.560 -8.329  6.369   1.00 0.00 ? 281 GLY A C    1 
ATOM 4327 O O    . GLY A 1 281 ? 485.970 -9.399  6.225   1.00 0.00 ? 281 GLY A O    1 
ATOM 4328 H H    . GLY A 1 281 ? 487.435 -5.541  5.367   1.00 0.00 ? 281 GLY A H    1 
ATOM 4329 H HA2  . GLY A 1 281 ? 486.416 -7.401  4.461   1.00 0.00 ? 281 GLY A HA2  1 
ATOM 4330 H HA3  . GLY A 1 281 ? 487.906 -8.298  4.721   1.00 0.00 ? 281 GLY A HA3  1 
ATOM 4331 N N    . LYS A 1 282 ? 486.687 -7.727  7.551   1.00 0.00 ? 282 LYS A N    1 
ATOM 4332 C CA   . LYS A 1 282 ? 486.130 -8.303  8.763   1.00 0.00 ? 282 LYS A CA   1 
ATOM 4333 C C    . LYS A 1 282 ? 484.775 -7.695  9.074   1.00 0.00 ? 282 LYS A C    1 
ATOM 4334 O O    . LYS A 1 282 ? 484.570 -6.493  8.912   1.00 0.00 ? 282 LYS A O    1 
ATOM 4335 C CB   . LYS A 1 282 ? 487.080 -8.069  9.935   1.00 0.00 ? 282 LYS A CB   1 
ATOM 4336 C CG   . LYS A 1 282 ? 488.434 -8.724  9.748   1.00 0.00 ? 282 LYS A CG   1 
ATOM 4337 C CD   . LYS A 1 282 ? 489.489 -8.090  10.640  1.00 0.00 ? 282 LYS A CD   1 
ATOM 4338 C CE   . LYS A 1 282 ? 489.157 -8.264  12.114  1.00 0.00 ? 282 LYS A CE   1 
ATOM 4339 N NZ   . LYS A 1 282 ? 489.089 -6.958  12.826  1.00 0.00 ? 282 LYS A NZ   1 
ATOM 4340 H H    . LYS A 1 282 ? 487.171 -6.879  7.616   1.00 0.00 ? 282 LYS A H    1 
ATOM 4341 H HA   . LYS A 1 282 ? 486.014 -9.364  8.608   1.00 0.00 ? 282 LYS A HA   1 
ATOM 4342 H HB2  . LYS A 1 282 ? 487.231 -7.006  10.053  1.00 0.00 ? 282 LYS A HB2  1 
ATOM 4343 H HB3  . LYS A 1 282 ? 486.632 -8.465  10.834  1.00 0.00 ? 282 LYS A HB3  1 
ATOM 4344 H HG2  . LYS A 1 282 ? 488.350 -9.772  9.991   1.00 0.00 ? 282 LYS A HG2  1 
ATOM 4345 H HG3  . LYS A 1 282 ? 488.732 -8.613  8.716   1.00 0.00 ? 282 LYS A HG3  1 
ATOM 4346 H HD2  . LYS A 1 282 ? 490.443 -8.556  10.440  1.00 0.00 ? 282 LYS A HD2  1 
ATOM 4347 H HD3  . LYS A 1 282 ? 489.549 -7.035  10.416  1.00 0.00 ? 282 LYS A HD3  1 
ATOM 4348 H HE2  . LYS A 1 282 ? 488.201 -8.760  12.200  1.00 0.00 ? 282 LYS A HE2  1 
ATOM 4349 H HE3  . LYS A 1 282 ? 489.921 -8.875  12.573  1.00 0.00 ? 282 LYS A HE3  1 
ATOM 4350 H HZ1  . LYS A 1 282 ? 488.459 -6.305  12.317  1.00 0.00 ? 282 LYS A HZ1  1 
ATOM 4351 H HZ2  . LYS A 1 282 ? 490.036 -6.532  12.885  1.00 0.00 ? 282 LYS A HZ2  1 
ATOM 4352 H HZ3  . LYS A 1 282 ? 488.723 -7.094  13.791  1.00 0.00 ? 282 LYS A HZ3  1 
ATOM 4353 N N    . ARG A 1 283 ? 483.854 -8.529  9.532   1.00 0.00 ? 283 ARG A N    1 
ATOM 4354 C CA   . ARG A 1 283 ? 482.520 -8.065  9.874   1.00 0.00 ? 283 ARG A CA   1 
ATOM 4355 C C    . ARG A 1 283 ? 482.216 -8.319  11.341  1.00 0.00 ? 283 ARG A C    1 
ATOM 4356 O O    . ARG A 1 283 ? 482.159 -9.463  11.792  1.00 0.00 ? 283 ARG A O    1 
ATOM 4357 C CB   . ARG A 1 283 ? 481.475 -8.739  8.995   1.00 0.00 ? 283 ARG A CB   1 
ATOM 4358 C CG   . ARG A 1 283 ? 481.387 -8.133  7.608   1.00 0.00 ? 283 ARG A CG   1 
ATOM 4359 C CD   . ARG A 1 283 ? 480.788 -9.111  6.609   1.00 0.00 ? 283 ARG A CD   1 
ATOM 4360 N NE   . ARG A 1 283 ? 479.327 -9.069  6.607   1.00 0.00 ? 283 ARG A NE   1 
ATOM 4361 C CZ   . ARG A 1 283 ? 478.595 -8.463  5.672   1.00 0.00 ? 283 ARG A CZ   1 
ATOM 4362 N NH1  . ARG A 1 283 ? 479.178 -7.828  4.661   1.00 0.00 ? 283 ARG A NH1  1 
ATOM 4363 N NH2  . ARG A 1 283 ? 477.272 -8.490  5.750   1.00 0.00 ? 283 ARG A NH2  1 
ATOM 4364 H H    . ARG A 1 283 ? 484.080 -9.474  9.649   1.00 0.00 ? 283 ARG A H    1 
ATOM 4365 H HA   . ARG A 1 283 ? 482.488 -7.001  9.696   1.00 0.00 ? 283 ARG A HA   1 
ATOM 4366 H HB2  . ARG A 1 283 ? 481.722 -9.785  8.896   1.00 0.00 ? 283 ARG A HB2  1 
ATOM 4367 H HB3  . ARG A 1 283 ? 480.510 -8.645  9.468   1.00 0.00 ? 283 ARG A HB3  1 
ATOM 4368 H HG2  . ARG A 1 283 ? 480.768 -7.249  7.653   1.00 0.00 ? 283 ARG A HG2  1 
ATOM 4369 H HG3  . ARG A 1 283 ? 482.382 -7.862  7.285   1.00 0.00 ? 283 ARG A HG3  1 
ATOM 4370 H HD2  . ARG A 1 283 ? 481.150 -8.867  5.623   1.00 0.00 ? 283 ARG A HD2  1 
ATOM 4371 H HD3  . ARG A 1 283 ? 481.108 -10.110 6.869   1.00 0.00 ? 283 ARG A HD3  1 
ATOM 4372 H HE   . ARG A 1 283 ? 478.863 -9.521  7.343   1.00 0.00 ? 283 ARG A HE   1 
ATOM 4373 H HH11 . ARG A 1 283 ? 480.174 -7.798  4.594   1.00 0.00 ? 283 ARG A HH11 1 
ATOM 4374 H HH12 . ARG A 1 283 ? 478.618 -7.380  3.965   1.00 0.00 ? 283 ARG A HH12 1 
ATOM 4375 H HH21 . ARG A 1 283 ? 476.825 -8.963  6.509   1.00 0.00 ? 283 ARG A HH21 1 
ATOM 4376 H HH22 . ARG A 1 283 ? 476.721 -8.037  5.049   1.00 0.00 ? 283 ARG A HH22 1 
ATOM 4377 N N    . GLY A 1 284 ? 482.034 -7.236  12.078  1.00 0.00 ? 284 GLY A N    1 
ATOM 4378 C CA   . GLY A 1 284 ? 481.750 -7.335  13.492  1.00 0.00 ? 284 GLY A CA   1 
ATOM 4379 C C    . GLY A 1 284 ? 481.030 -6.113  14.025  1.00 0.00 ? 284 GLY A C    1 
ATOM 4380 O O    . GLY A 1 284 ? 480.868 -5.116  13.323  1.00 0.00 ? 284 GLY A O    1 
ATOM 4381 H H    . GLY A 1 284 ? 482.102 -6.358  11.658  1.00 0.00 ? 284 GLY A H    1 
ATOM 4382 H HA2  . GLY A 1 284 ? 481.134 -8.206  13.664  1.00 0.00 ? 284 GLY A HA2  1 
ATOM 4383 H HA3  . GLY A 1 284 ? 482.680 -7.453  14.028  1.00 0.00 ? 284 GLY A HA3  1 
ATOM 4384 N N    . HIS A 1 285 ? 480.574 -6.209  15.262  1.00 0.00 ? 285 HIS A N    1 
ATOM 4385 C CA   . HIS A 1 285 ? 479.839 -5.119  15.890  1.00 0.00 ? 285 HIS A CA   1 
ATOM 4386 C C    . HIS A 1 285 ? 480.718 -4.291  16.823  1.00 0.00 ? 285 HIS A C    1 
ATOM 4387 O O    . HIS A 1 285 ? 481.203 -4.784  17.841  1.00 0.00 ? 285 HIS A O    1 
ATOM 4388 C CB   . HIS A 1 285 ? 478.635 -5.664  16.662  1.00 0.00 ? 285 HIS A CB   1 
ATOM 4389 C CG   . HIS A 1 285 ? 478.934 -6.900  17.454  1.00 0.00 ? 285 HIS A CG   1 
ATOM 4390 N ND1  . HIS A 1 285 ? 479.925 -6.960  18.411  1.00 0.00 ? 285 HIS A ND1  1 
ATOM 4391 C CD2  . HIS A 1 285 ? 478.365 -8.129  17.427  1.00 0.00 ? 285 HIS A CD2  1 
ATOM 4392 C CE1  . HIS A 1 285 ? 479.953 -8.172  18.938  1.00 0.00 ? 285 HIS A CE1  1 
ATOM 4393 N NE2  . HIS A 1 285 ? 479.016 -8.899  18.359  1.00 0.00 ? 285 HIS A NE2  1 
ATOM 4394 H H    . HIS A 1 285 ? 480.715 -7.048  15.743  1.00 0.00 ? 285 HIS A H    1 
ATOM 4395 H HA   . HIS A 1 285 ? 479.477 -4.476  15.102  1.00 0.00 ? 285 HIS A HA   1 
ATOM 4396 H HB2  . HIS A 1 285 ? 478.286 -4.908  17.349  1.00 0.00 ? 285 HIS A HB2  1 
ATOM 4397 H HB3  . HIS A 1 285 ? 477.846 -5.899  15.963  1.00 0.00 ? 285 HIS A HB3  1 
ATOM 4398 H HD1  . HIS A 1 285 ? 480.521 -6.225  18.665  1.00 0.00 ? 285 HIS A HD1  1 
ATOM 4399 H HD2  . HIS A 1 285 ? 477.550 -8.445  16.791  1.00 0.00 ? 285 HIS A HD2  1 
ATOM 4400 H HE1  . HIS A 1 285 ? 480.627 -8.508  19.712  1.00 0.00 ? 285 HIS A HE1  1 
ATOM 4401 H HE2  . HIS A 1 285 ? 478.757 -9.805  18.629  1.00 0.00 ? 285 HIS A HE2  1 
ATOM 4402 N N    . PHE A 1 286 ? 480.885 -3.015  16.482  1.00 0.00 ? 286 PHE A N    1 
ATOM 4403 C CA   . PHE A 1 286 ? 481.665 -2.093  17.301  1.00 0.00 ? 286 PHE A CA   1 
ATOM 4404 C C    . PHE A 1 286 ? 480.738 -1.023  17.866  1.00 0.00 ? 286 PHE A C    1 
ATOM 4405 O O    . PHE A 1 286 ? 479.682 -0.753  17.294  1.00 0.00 ? 286 PHE A O    1 
ATOM 4406 C CB   . PHE A 1 286 ? 482.806 -1.427  16.505  1.00 0.00 ? 286 PHE A CB   1 
ATOM 4407 C CG   . PHE A 1 286 ? 482.536 -1.225  15.041  1.00 0.00 ? 286 PHE A CG   1 
ATOM 4408 C CD1  . PHE A 1 286 ? 482.327 -2.302  14.191  1.00 0.00 ? 286 PHE A CD1  1 
ATOM 4409 C CD2  . PHE A 1 286 ? 482.516 0.052   14.512  1.00 0.00 ? 286 PHE A CD2  1 
ATOM 4410 C CE1  . PHE A 1 286 ? 482.099 -2.099  12.844  1.00 0.00 ? 286 PHE A CE1  1 
ATOM 4411 C CE2  . PHE A 1 286 ? 482.290 0.256   13.168  1.00 0.00 ? 286 PHE A CE2  1 
ATOM 4412 C CZ   . PHE A 1 286 ? 482.081 -0.820  12.333  1.00 0.00 ? 286 PHE A CZ   1 
ATOM 4413 H H    . PHE A 1 286 ? 480.445 -2.679  15.674  1.00 0.00 ? 286 PHE A H    1 
ATOM 4414 H HA   . PHE A 1 286 ? 482.086 -2.656  18.122  1.00 0.00 ? 286 PHE A HA   1 
ATOM 4415 H HB2  . PHE A 1 286 ? 482.999 -0.454  16.930  1.00 0.00 ? 286 PHE A HB2  1 
ATOM 4416 H HB3  . PHE A 1 286 ? 483.700 -2.022  16.592  1.00 0.00 ? 286 PHE A HB3  1 
ATOM 4417 H HD1  . PHE A 1 286 ? 482.340 -3.306  14.588  1.00 0.00 ? 286 PHE A HD1  1 
ATOM 4418 H HD2  . PHE A 1 286 ? 482.676 0.898   15.165  1.00 0.00 ? 286 PHE A HD2  1 
ATOM 4419 H HE1  . PHE A 1 286 ? 481.937 -2.940  12.191  1.00 0.00 ? 286 PHE A HE1  1 
ATOM 4420 H HE2  . PHE A 1 286 ? 482.277 1.258   12.769  1.00 0.00 ? 286 PHE A HE2  1 
ATOM 4421 H HZ   . PHE A 1 286 ? 481.900 -0.660  11.283  1.00 0.00 ? 286 PHE A HZ   1 
ATOM 4422 N N    . PRO A 1 287 ? 481.111 -0.389  18.992  1.00 0.00 ? 287 PRO A N    1 
ATOM 4423 C CA   . PRO A 1 287 ? 480.299 0.657   19.612  1.00 0.00 ? 287 PRO A CA   1 
ATOM 4424 C C    . PRO A 1 287 ? 479.732 1.614   18.572  1.00 0.00 ? 287 PRO A C    1 
ATOM 4425 O O    . PRO A 1 287 ? 478.637 2.154   18.732  1.00 0.00 ? 287 PRO A O    1 
ATOM 4426 C CB   . PRO A 1 287 ? 481.281 1.383   20.547  1.00 0.00 ? 287 PRO A CB   1 
ATOM 4427 C CG   . PRO A 1 287 ? 482.613 0.730   20.339  1.00 0.00 ? 287 PRO A CG   1 
ATOM 4428 C CD   . PRO A 1 287 ? 482.343 -0.623  19.745  1.00 0.00 ? 287 PRO A CD   1 
ATOM 4429 H HA   . PRO A 1 287 ? 479.489 0.237   20.189  1.00 0.00 ? 287 PRO A HA   1 
ATOM 4430 H HB2  . PRO A 1 287 ? 481.314 2.431   20.288  1.00 0.00 ? 287 PRO A HB2  1 
ATOM 4431 H HB3  . PRO A 1 287 ? 480.948 1.275   21.569  1.00 0.00 ? 287 PRO A HB3  1 
ATOM 4432 H HG2  . PRO A 1 287 ? 483.206 1.321   19.659  1.00 0.00 ? 287 PRO A HG2  1 
ATOM 4433 H HG3  . PRO A 1 287 ? 483.120 0.627   21.286  1.00 0.00 ? 287 PRO A HG3  1 
ATOM 4434 H HD2  . PRO A 1 287 ? 483.149 -0.920  19.091  1.00 0.00 ? 287 PRO A HD2  1 
ATOM 4435 H HD3  . PRO A 1 287 ? 482.189 -1.356  20.522  1.00 0.00 ? 287 PRO A HD3  1 
ATOM 4436 N N    . PHE A 1 288 ? 480.487 1.799   17.495  1.00 0.00 ? 288 PHE A N    1 
ATOM 4437 C CA   . PHE A 1 288 ? 480.078 2.667   16.398  1.00 0.00 ? 288 PHE A CA   1 
ATOM 4438 C C    . PHE A 1 288 ? 480.053 4.138   16.810  1.00 0.00 ? 288 PHE A C    1 
ATOM 4439 O O    . PHE A 1 288 ? 479.671 5.001   16.020  1.00 0.00 ? 288 PHE A O    1 
ATOM 4440 C CB   . PHE A 1 288 ? 478.701 2.238   15.881  1.00 0.00 ? 288 PHE A CB   1 
ATOM 4441 C CG   . PHE A 1 288 ? 478.642 1.898   14.410  1.00 0.00 ? 288 PHE A CG   1 
ATOM 4442 C CD1  . PHE A 1 288 ? 479.793 1.700   13.662  1.00 0.00 ? 288 PHE A CD1  1 
ATOM 4443 C CD2  . PHE A 1 288 ? 477.420 1.774   13.774  1.00 0.00 ? 288 PHE A CD2  1 
ATOM 4444 C CE1  . PHE A 1 288 ? 479.723 1.387   12.316  1.00 0.00 ? 288 PHE A CE1  1 
ATOM 4445 C CE2  . PHE A 1 288 ? 477.349 1.461   12.431  1.00 0.00 ? 288 PHE A CE2  1 
ATOM 4446 C CZ   . PHE A 1 288 ? 478.499 1.267   11.703  1.00 0.00 ? 288 PHE A CZ   1 
ATOM 4447 H H    . PHE A 1 288 ? 481.341 1.325   17.431  1.00 0.00 ? 288 PHE A H    1 
ATOM 4448 H HA   . PHE A 1 288 ? 480.800 2.550   15.611  1.00 0.00 ? 288 PHE A HA   1 
ATOM 4449 H HB2  . PHE A 1 288 ? 478.389 1.363   16.427  1.00 0.00 ? 288 PHE A HB2  1 
ATOM 4450 H HB3  . PHE A 1 288 ? 477.998 3.036   16.065  1.00 0.00 ? 288 PHE A HB3  1 
ATOM 4451 H HD1  . PHE A 1 288 ? 480.755 1.790   14.139  1.00 0.00 ? 288 PHE A HD1  1 
ATOM 4452 H HD2  . PHE A 1 288 ? 476.512 1.926   14.339  1.00 0.00 ? 288 PHE A HD2  1 
ATOM 4453 H HE1  . PHE A 1 288 ? 480.626 1.238   11.746  1.00 0.00 ? 288 PHE A HE1  1 
ATOM 4454 H HE2  . PHE A 1 288 ? 476.395 1.362   11.954  1.00 0.00 ? 288 PHE A HE2  1 
ATOM 4455 H HZ   . PHE A 1 288 ? 478.440 1.022   10.653  1.00 0.00 ? 288 PHE A HZ   1 
ATOM 4456 N N    . THR A 1 289 ? 480.477 4.428   18.036  1.00 0.00 ? 289 THR A N    1 
ATOM 4457 C CA   . THR A 1 289 ? 480.513 5.801   18.516  1.00 0.00 ? 289 THR A CA   1 
ATOM 4458 C C    . THR A 1 289 ? 481.799 6.485   18.059  1.00 0.00 ? 289 THR A C    1 
ATOM 4459 O O    . THR A 1 289 ? 481.965 7.694   18.224  1.00 0.00 ? 289 THR A O    1 
ATOM 4460 C CB   . THR A 1 289 ? 480.413 5.836   20.043  1.00 0.00 ? 289 THR A CB   1 
ATOM 4461 O OG1  . THR A 1 289 ? 481.588 5.310   20.635  1.00 0.00 ? 289 THR A OG1  1 
ATOM 4462 C CG2  . THR A 1 289 ? 479.236 5.054   20.584  1.00 0.00 ? 289 THR A CG2  1 
ATOM 4463 H H    . THR A 1 289 ? 480.788 3.710   18.623  1.00 0.00 ? 289 THR A H    1 
ATOM 4464 H HA   . THR A 1 289 ? 479.668 6.324   18.094  1.00 0.00 ? 289 THR A HA   1 
ATOM 4465 H HB   . THR A 1 289 ? 480.304 6.863   20.362  1.00 0.00 ? 289 THR A HB   1 
ATOM 4466 H HG1  . THR A 1 289 ? 481.627 4.364   20.481  1.00 0.00 ? 289 THR A HG1  1 
ATOM 4467 H HG21 . THR A 1 289 ? 479.212 5.137   21.660  1.00 0.00 ? 289 THR A HG21 1 
ATOM 4468 H HG22 . THR A 1 289 ? 479.335 4.016   20.305  1.00 0.00 ? 289 THR A HG22 1 
ATOM 4469 H HG23 . THR A 1 289 ? 478.320 5.452   20.172  1.00 0.00 ? 289 THR A HG23 1 
ATOM 4470 N N    . HIS A 1 290 ? 482.710 5.697   17.488  1.00 0.00 ? 290 HIS A N    1 
ATOM 4471 C CA   . HIS A 1 290 ? 483.984 6.218   17.012  1.00 0.00 ? 290 HIS A CA   1 
ATOM 4472 C C    . HIS A 1 290 ? 484.010 6.325   15.487  1.00 0.00 ? 290 HIS A C    1 
ATOM 4473 O O    . HIS A 1 290 ? 485.056 6.581   14.893  1.00 0.00 ? 290 HIS A O    1 
ATOM 4474 C CB   . HIS A 1 290 ? 485.126 5.331   17.505  1.00 0.00 ? 290 HIS A CB   1 
ATOM 4475 C CG   . HIS A 1 290 ? 485.271 5.327   18.999  1.00 0.00 ? 290 HIS A CG   1 
ATOM 4476 N ND1  . HIS A 1 290 ? 484.203 5.190   19.862  1.00 0.00 ? 290 HIS A ND1  1 
ATOM 4477 C CD2  . HIS A 1 290 ? 486.371 5.436   19.782  1.00 0.00 ? 290 HIS A CD2  1 
ATOM 4478 C CE1  . HIS A 1 290 ? 484.640 5.218   21.109  1.00 0.00 ? 290 HIS A CE1  1 
ATOM 4479 N NE2  . HIS A 1 290 ? 485.951 5.366   21.087  1.00 0.00 ? 290 HIS A NE2  1 
ATOM 4480 H H    . HIS A 1 290 ? 482.522 4.739   17.392  1.00 0.00 ? 290 HIS A H    1 
ATOM 4481 H HA   . HIS A 1 290 ? 484.111 7.204   17.424  1.00 0.00 ? 290 HIS A HA   1 
ATOM 4482 H HB2  . HIS A 1 290 ? 484.947 4.315   17.186  1.00 0.00 ? 290 HIS A HB2  1 
ATOM 4483 H HB3  . HIS A 1 290 ? 486.055 5.679   17.080  1.00 0.00 ? 290 HIS A HB3  1 
ATOM 4484 H HD1  . HIS A 1 290 ? 483.265 5.086   19.601  1.00 0.00 ? 290 HIS A HD1  1 
ATOM 4485 H HD2  . HIS A 1 290 ? 487.389 5.554   19.443  1.00 0.00 ? 290 HIS A HD2  1 
ATOM 4486 H HE1  . HIS A 1 290 ? 484.029 5.132   21.995  1.00 0.00 ? 290 HIS A HE1  1 
ATOM 4487 H HE2  . HIS A 1 290 ? 486.535 5.345   21.873  1.00 0.00 ? 290 HIS A HE2  1 
ATOM 4488 N N    . VAL A 1 291 ? 482.849 6.123   14.867  1.00 0.00 ? 291 VAL A N    1 
ATOM 4489 C CA   . VAL A 1 291 ? 482.717 6.195   13.418  1.00 0.00 ? 291 VAL A CA   1 
ATOM 4490 C C    . VAL A 1 291 ? 481.556 7.102   13.025  1.00 0.00 ? 291 VAL A C    1 
ATOM 4491 O O    . VAL A 1 291 ? 480.617 7.293   13.799  1.00 0.00 ? 291 VAL A O    1 
ATOM 4492 C CB   . VAL A 1 291 ? 482.492 4.803   12.803  1.00 0.00 ? 291 VAL A CB   1 
ATOM 4493 C CG1  . VAL A 1 291 ? 483.632 3.873   13.174  1.00 0.00 ? 291 VAL A CG1  1 
ATOM 4494 C CG2  . VAL A 1 291 ? 481.159 4.225   13.248  1.00 0.00 ? 291 VAL A CG2  1 
ATOM 4495 H H    . VAL A 1 291 ? 482.066 5.910   15.404  1.00 0.00 ? 291 VAL A H    1 
ATOM 4496 H HA   . VAL A 1 291 ? 483.632 6.596   13.014  1.00 0.00 ? 291 VAL A HA   1 
ATOM 4497 H HB   . VAL A 1 291 ? 482.478 4.904   11.728  1.00 0.00 ? 291 VAL A HB   1 
ATOM 4498 H HG11 . VAL A 1 291 ? 483.271 2.856   13.223  1.00 0.00 ? 291 VAL A HG11 1 
ATOM 4499 H HG12 . VAL A 1 291 ? 484.030 4.159   14.137  1.00 0.00 ? 291 VAL A HG12 1 
ATOM 4500 H HG13 . VAL A 1 291 ? 484.408 3.946   12.426  1.00 0.00 ? 291 VAL A HG13 1 
ATOM 4501 H HG21 . VAL A 1 291 ? 480.749 3.621   12.454  1.00 0.00 ? 291 VAL A HG21 1 
ATOM 4502 H HG22 . VAL A 1 291 ? 480.474 5.027   13.480  1.00 0.00 ? 291 VAL A HG22 1 
ATOM 4503 H HG23 . VAL A 1 291 ? 481.309 3.616   14.124  1.00 0.00 ? 291 VAL A HG23 1 
ATOM 4504 N N    . ARG A 1 292 ? 481.613 7.645   11.817  1.00 0.00 ? 292 ARG A N    1 
ATOM 4505 C CA   . ARG A 1 292 ? 480.546 8.516   11.331  1.00 0.00 ? 292 ARG A CA   1 
ATOM 4506 C C    . ARG A 1 292 ? 479.392 7.682   10.768  1.00 0.00 ? 292 ARG A C    1 
ATOM 4507 O O    . ARG A 1 292 ? 479.489 7.111   9.683   1.00 0.00 ? 292 ARG A O    1 
ATOM 4508 C CB   . ARG A 1 292 ? 481.063 9.508   10.277  1.00 0.00 ? 292 ARG A CB   1 
ATOM 4509 C CG   . ARG A 1 292 ? 482.235 9.010   9.445   1.00 0.00 ? 292 ARG A CG   1 
ATOM 4510 C CD   . ARG A 1 292 ? 481.974 7.639   8.842   1.00 0.00 ? 292 ARG A CD   1 
ATOM 4511 N NE   . ARG A 1 292 ? 483.145 7.119   8.142   1.00 0.00 ? 292 ARG A NE   1 
ATOM 4512 C CZ   . ARG A 1 292 ? 483.341 5.829   7.878   1.00 0.00 ? 292 ARG A CZ   1 
ATOM 4513 N NH1  . ARG A 1 292 ? 482.446 4.924   8.253   1.00 0.00 ? 292 ARG A NH1  1 
ATOM 4514 N NH2  . ARG A 1 292 ? 484.435 5.443   7.237   1.00 0.00 ? 292 ARG A NH2  1 
ATOM 4515 H H    . ARG A 1 292 ? 482.381 7.448   11.243  1.00 0.00 ? 292 ARG A H    1 
ATOM 4516 H HA   . ARG A 1 292 ? 480.176 9.075   12.179  1.00 0.00 ? 292 ARG A HA   1 
ATOM 4517 H HB2  . ARG A 1 292 ? 480.255 9.751   9.604   1.00 0.00 ? 292 ARG A HB2  1 
ATOM 4518 H HB3  . ARG A 1 292 ? 481.377 10.411  10.784  1.00 0.00 ? 292 ARG A HB3  1 
ATOM 4519 H HG2  . ARG A 1 292 ? 482.406 9.712   8.642   1.00 0.00 ? 292 ARG A HG2  1 
ATOM 4520 H HG3  . ARG A 1 292 ? 483.113 8.959   10.076  1.00 0.00 ? 292 ARG A HG3  1 
ATOM 4521 H HD2  . ARG A 1 292 ? 481.705 6.954   9.630   1.00 0.00 ? 292 ARG A HD2  1 
ATOM 4522 H HD3  . ARG A 1 292 ? 481.156 7.718   8.145   1.00 0.00 ? 292 ARG A HD3  1 
ATOM 4523 H HE   . ARG A 1 292 ? 483.823 7.765   7.853   1.00 0.00 ? 292 ARG A HE   1 
ATOM 4524 H HH11 . ARG A 1 292 ? 481.618 5.207   8.736   1.00 0.00 ? 292 ARG A HH11 1 
ATOM 4525 H HH12 . ARG A 1 292 ? 482.599 3.956   8.051   1.00 0.00 ? 292 ARG A HH12 1 
ATOM 4526 H HH21 . ARG A 1 292 ? 485.113 6.121   6.952   1.00 0.00 ? 292 ARG A HH21 1 
ATOM 4527 H HH22 . ARG A 1 292 ? 484.583 4.475   7.041   1.00 0.00 ? 292 ARG A HH22 1 
ATOM 4528 N N    . LEU A 1 293 ? 478.309 7.604   11.536  1.00 0.00 ? 293 LEU A N    1 
ATOM 4529 C CA   . LEU A 1 293 ? 477.133 6.826   11.152  1.00 0.00 ? 293 LEU A CA   1 
ATOM 4530 C C    . LEU A 1 293 ? 476.552 7.277   9.812   1.00 0.00 ? 293 LEU A C    1 
ATOM 4531 O O    . LEU A 1 293 ? 476.988 8.272   9.232   1.00 0.00 ? 293 LEU A O    1 
ATOM 4532 C CB   . LEU A 1 293 ? 476.067 6.922   12.257  1.00 0.00 ? 293 LEU A CB   1 
ATOM 4533 C CG   . LEU A 1 293 ? 475.068 8.089   12.151  1.00 0.00 ? 293 LEU A CG   1 
ATOM 4534 C CD1  . LEU A 1 293 ? 475.745 9.358   11.649  1.00 0.00 ? 293 LEU A CD1  1 
ATOM 4535 C CD2  . LEU A 1 293 ? 473.906 7.713   11.247  1.00 0.00 ? 293 LEU A CD2  1 
ATOM 4536 H H    . LEU A 1 293 ? 478.304 8.071   12.397  1.00 0.00 ? 293 LEU A H    1 
ATOM 4537 H HA   . LEU A 1 293 ? 477.441 5.796   11.061  1.00 0.00 ? 293 LEU A HA   1 
ATOM 4538 H HB2  . LEU A 1 293 ? 475.504 6.001   12.259  1.00 0.00 ? 293 LEU A HB2  1 
ATOM 4539 H HB3  . LEU A 1 293 ? 476.578 7.008   13.205  1.00 0.00 ? 293 LEU A HB3  1 
ATOM 4540 H HG   . LEU A 1 293 ? 474.669 8.296   13.133  1.00 0.00 ? 293 LEU A HG   1 
ATOM 4541 H HD11 . LEU A 1 293 ? 475.268 10.219  12.091  1.00 0.00 ? 293 LEU A HD11 1 
ATOM 4542 H HD12 . LEU A 1 293 ? 475.654 9.413   10.574  1.00 0.00 ? 293 LEU A HD12 1 
ATOM 4543 H HD13 . LEU A 1 293 ? 476.789 9.343   11.923  1.00 0.00 ? 293 LEU A HD13 1 
ATOM 4544 H HD21 . LEU A 1 293 ? 474.071 8.122   10.261  1.00 0.00 ? 293 LEU A HD21 1 
ATOM 4545 H HD22 . LEU A 1 293 ? 472.989 8.113   11.654  1.00 0.00 ? 293 LEU A HD22 1 
ATOM 4546 H HD23 . LEU A 1 293 ? 473.833 6.638   11.183  1.00 0.00 ? 293 LEU A HD23 1 
ATOM 4547 N N    . LEU A 1 294 ? 475.548 6.540   9.344   1.00 0.00 ? 294 LEU A N    1 
ATOM 4548 C CA   . LEU A 1 294 ? 474.875 6.855   8.092   1.00 0.00 ? 294 LEU A CA   1 
ATOM 4549 C C    . LEU A 1 294 ? 473.367 6.745   8.264   1.00 0.00 ? 294 LEU A C    1 
ATOM 4550 O O    . LEU A 1 294 ? 472.888 6.040   9.151   1.00 0.00 ? 294 LEU A O    1 
ATOM 4551 C CB   . LEU A 1 294 ? 475.341 5.923   6.970   1.00 0.00 ? 294 LEU A CB   1 
ATOM 4552 C CG   . LEU A 1 294 ? 474.834 4.482   7.040   1.00 0.00 ? 294 LEU A CG   1 
ATOM 4553 C CD1  . LEU A 1 294 ? 474.979 3.915   8.440   1.00 0.00 ? 294 LEU A CD1  1 
ATOM 4554 C CD2  . LEU A 1 294 ? 473.390 4.400   6.579   1.00 0.00 ? 294 LEU A CD2  1 
ATOM 4555 H H    . LEU A 1 294 ? 475.242 5.770   9.864   1.00 0.00 ? 294 LEU A H    1 
ATOM 4556 H HA   . LEU A 1 294 ? 475.121 7.872   7.830   1.00 0.00 ? 294 LEU A HA   1 
ATOM 4557 H HB2  . LEU A 1 294 ? 475.012 6.342   6.030   1.00 0.00 ? 294 LEU A HB2  1 
ATOM 4558 H HB3  . LEU A 1 294 ? 476.418 5.899   6.980   1.00 0.00 ? 294 LEU A HB3  1 
ATOM 4559 H HG   . LEU A 1 294 ? 475.427 3.877   6.378   1.00 0.00 ? 294 LEU A HG   1 
ATOM 4560 H HD11 . LEU A 1 294 ? 474.952 2.838   8.395   1.00 0.00 ? 294 LEU A HD11 1 
ATOM 4561 H HD12 . LEU A 1 294 ? 474.168 4.270   9.057   1.00 0.00 ? 294 LEU A HD12 1 
ATOM 4562 H HD13 . LEU A 1 294 ? 475.920 4.235   8.863   1.00 0.00 ? 294 LEU A HD13 1 
ATOM 4563 H HD21 . LEU A 1 294 ? 473.226 3.460   6.075   1.00 0.00 ? 294 LEU A HD21 1 
ATOM 4564 H HD22 . LEU A 1 294 ? 473.182 5.215   5.902   1.00 0.00 ? 294 LEU A HD22 1 
ATOM 4565 H HD23 . LEU A 1 294 ? 472.736 4.468   7.436   1.00 0.00 ? 294 LEU A HD23 1 
ATOM 4566 N N    . ASP A 1 295 ? 472.624 7.439   7.408   1.00 0.00 ? 295 ASP A N    1 
ATOM 4567 C CA   . ASP A 1 295 ? 471.164 7.413   7.461   1.00 0.00 ? 295 ASP A CA   1 
ATOM 4568 C C    . ASP A 1 295 ? 470.560 8.561   6.653   1.00 0.00 ? 295 ASP A C    1 
ATOM 4569 O O    . ASP A 1 295 ? 470.149 8.376   5.507   1.00 0.00 ? 295 ASP A O    1 
ATOM 4570 C CB   . ASP A 1 295 ? 470.681 7.482   8.912   1.00 0.00 ? 295 ASP A CB   1 
ATOM 4571 C CG   . ASP A 1 295 ? 470.176 6.144   9.415   1.00 0.00 ? 295 ASP A CG   1 
ATOM 4572 O OD1  . ASP A 1 295 ? 469.685 5.346   8.589   1.00 0.00 ? 295 ASP A OD1  1 
ATOM 4573 O OD2  . ASP A 1 295 ? 470.271 5.894   10.636  1.00 0.00 ? 295 ASP A OD2  1 
ATOM 4574 H H    . ASP A 1 295 ? 473.068 7.977   6.722   1.00 0.00 ? 295 ASP A H    1 
ATOM 4575 H HA   . ASP A 1 295 ? 470.837 6.479   7.030   1.00 0.00 ? 295 ASP A HA   1 
ATOM 4576 H HB2  . ASP A 1 295 ? 471.501 7.796   9.542   1.00 0.00 ? 295 ASP A HB2  1 
ATOM 4577 H HB3  . ASP A 1 295 ? 469.882 8.202   8.986   1.00 0.00 ? 295 ASP A HB3  1 
ATOM 4578 N N    . GLN A 1 296 ? 470.502 9.744   7.259   1.00 0.00 ? 296 GLN A N    1 
ATOM 4579 C CA   . GLN A 1 296 ? 469.940 10.917  6.597   1.00 0.00 ? 296 GLN A CA   1 
ATOM 4580 C C    . GLN A 1 296 ? 470.716 12.176  6.972   1.00 0.00 ? 296 GLN A C    1 
ATOM 4581 O O    . GLN A 1 296 ? 470.136 13.171  7.407   1.00 0.00 ? 296 GLN A O    1 
ATOM 4582 C CB   . GLN A 1 296 ? 468.469 11.081  6.980   1.00 0.00 ? 296 GLN A CB   1 
ATOM 4583 C CG   . GLN A 1 296 ? 468.251 11.263  8.473   1.00 0.00 ? 296 GLN A CG   1 
ATOM 4584 C CD   . GLN A 1 296 ? 467.634 12.606  8.816   1.00 0.00 ? 296 GLN A CD   1 
ATOM 4585 O OE1  . GLN A 1 296 ? 468.272 13.455  9.437   1.00 0.00 ? 296 GLN A OE1  1 
ATOM 4586 N NE2  . GLN A 1 296 ? 466.384 12.804  8.411   1.00 0.00 ? 296 GLN A NE2  1 
ATOM 4587 H H    . GLN A 1 296 ? 470.840 9.830   8.174   1.00 0.00 ? 296 GLN A H    1 
ATOM 4588 H HA   . GLN A 1 296 ? 470.011 10.764  5.530   1.00 0.00 ? 296 GLN A HA   1 
ATOM 4589 H HB2  . GLN A 1 296 ? 468.071 11.946  6.470   1.00 0.00 ? 296 GLN A HB2  1 
ATOM 4590 H HB3  . GLN A 1 296 ? 467.926 10.204  6.663   1.00 0.00 ? 296 GLN A HB3  1 
ATOM 4591 H HG2  . GLN A 1 296 ? 467.594 10.483  8.826   1.00 0.00 ? 296 GLN A HG2  1 
ATOM 4592 H HG3  . GLN A 1 296 ? 469.205 11.183  8.974   1.00 0.00 ? 296 GLN A HG3  1 
ATOM 4593 H HE21 . GLN A 1 296 ? 465.937 12.083  7.921   1.00 0.00 ? 296 GLN A HE21 1 
ATOM 4594 H HE22 . GLN A 1 296 ? 465.961 13.663  8.619   1.00 0.00 ? 296 GLN A HE22 1 
ATOM 4595 N N    . GLN A 1 297 ? 472.032 12.124  6.806   1.00 0.00 ? 297 GLN A N    1 
ATOM 4596 C CA   . GLN A 1 297 ? 472.889 13.258  7.132   1.00 0.00 ? 297 GLN A CA   1 
ATOM 4597 C C    . GLN A 1 297 ? 473.576 13.804  5.884   1.00 0.00 ? 297 GLN A C    1 
ATOM 4598 O O    . GLN A 1 297 ? 474.407 13.129  5.275   1.00 0.00 ? 297 GLN A O    1 
ATOM 4599 C CB   . GLN A 1 297 ? 473.938 12.847  8.167   1.00 0.00 ? 297 GLN A CB   1 
ATOM 4600 C CG   . GLN A 1 297 ? 474.749 11.627  7.759   1.00 0.00 ? 297 GLN A CG   1 
ATOM 4601 C CD   . GLN A 1 297 ? 476.239 11.905  7.711   1.00 0.00 ? 297 GLN A CD   1 
ATOM 4602 O OE1  . GLN A 1 297 ? 476.731 12.558  6.792   1.00 0.00 ? 297 GLN A OE1  1 
ATOM 4603 N NE2  . GLN A 1 297 ? 476.965 11.408  8.706   1.00 0.00 ? 297 GLN A NE2  1 
ATOM 4604 H H    . GLN A 1 297 ? 472.438 11.303  6.459   1.00 0.00 ? 297 GLN A H    1 
ATOM 4605 H HA   . GLN A 1 297 ? 472.267 14.033  7.553   1.00 0.00 ? 297 GLN A HA   1 
ATOM 4606 H HB2  . GLN A 1 297 ? 474.618 13.672  8.321   1.00 0.00 ? 297 GLN A HB2  1 
ATOM 4607 H HB3  . GLN A 1 297 ? 473.438 12.625  9.099   1.00 0.00 ? 297 GLN A HB3  1 
ATOM 4608 H HG2  . GLN A 1 297 ? 474.569 10.836  8.472   1.00 0.00 ? 297 GLN A HG2  1 
ATOM 4609 H HG3  . GLN A 1 297 ? 474.425 11.308  6.779   1.00 0.00 ? 297 GLN A HG3  1 
ATOM 4610 H HE21 . GLN A 1 297 ? 476.505 10.897  9.405   1.00 0.00 ? 297 GLN A HE21 1 
ATOM 4611 H HE22 . GLN A 1 297 ? 477.931 11.572  8.700   1.00 0.00 ? 297 GLN A HE22 1 
ATOM 4612 N N    . ASN A 1 298 ? 473.227 15.031  5.512   1.00 0.00 ? 298 ASN A N    1 
ATOM 4613 C CA   . ASN A 1 298 ? 473.810 15.672  4.343   1.00 0.00 ? 298 ASN A CA   1 
ATOM 4614 C C    . ASN A 1 298 ? 474.354 17.055  4.701   1.00 0.00 ? 298 ASN A C    1 
ATOM 4615 O O    . ASN A 1 298 ? 473.640 17.890  5.255   1.00 0.00 ? 298 ASN A O    1 
ATOM 4616 C CB   . ASN A 1 298 ? 472.771 15.789  3.225   1.00 0.00 ? 298 ASN A CB   1 
ATOM 4617 C CG   . ASN A 1 298 ? 473.339 16.420  1.968   1.00 0.00 ? 298 ASN A CG   1 
ATOM 4618 O OD1  . ASN A 1 298 ? 473.963 17.480  2.019   1.00 0.00 ? 298 ASN A OD1  1 
ATOM 4619 N ND2  . ASN A 1 298 ? 473.124 15.769  0.830   1.00 0.00 ? 298 ASN A ND2  1 
ATOM 4620 H H    . ASN A 1 298 ? 472.564 15.519  6.040   1.00 0.00 ? 298 ASN A H    1 
ATOM 4621 H HA   . ASN A 1 298 ? 474.626 15.054  4.000   1.00 0.00 ? 298 ASN A HA   1 
ATOM 4622 H HB2  . ASN A 1 298 ? 472.407 14.803  2.976   1.00 0.00 ? 298 ASN A HB2  1 
ATOM 4623 H HB3  . ASN A 1 298 ? 471.948 16.395  3.569   1.00 0.00 ? 298 ASN A HB3  1 
ATOM 4624 H HD21 . ASN A 1 298 ? 472.619 14.930  0.865   1.00 0.00 ? 298 ASN A HD21 1 
ATOM 4625 H HD22 . ASN A 1 298 ? 473.480 16.155  0.002   1.00 0.00 ? 298 ASN A HD22 1 
ATOM 4626 N N    . PRO A 1 299 ? 475.634 17.311  4.390   1.00 0.00 ? 299 PRO A N    1 
ATOM 4627 C CA   . PRO A 1 299 ? 476.282 18.592  4.679   1.00 0.00 ? 299 PRO A CA   1 
ATOM 4628 C C    . PRO A 1 299 ? 475.401 19.791  4.337   1.00 0.00 ? 299 PRO A C    1 
ATOM 4629 O O    . PRO A 1 299 ? 475.192 20.678  5.164   1.00 0.00 ? 299 PRO A O    1 
ATOM 4630 C CB   . PRO A 1 299 ? 477.512 18.570  3.775   1.00 0.00 ? 299 PRO A CB   1 
ATOM 4631 C CG   . PRO A 1 299 ? 477.843 17.126  3.608   1.00 0.00 ? 299 PRO A CG   1 
ATOM 4632 C CD   . PRO A 1 299 ? 476.551 16.364  3.732   1.00 0.00 ? 299 PRO A CD   1 
ATOM 4633 H HA   . PRO A 1 299 ? 476.592 18.656  5.712   1.00 0.00 ? 299 PRO A HA   1 
ATOM 4634 H HB2  . PRO A 1 299 ? 477.273 19.033  2.828   1.00 0.00 ? 299 PRO A HB2  1 
ATOM 4635 H HB3  . PRO A 1 299 ? 478.320 19.106  4.250   1.00 0.00 ? 299 PRO A HB3  1 
ATOM 4636 H HG2  . PRO A 1 299 ? 478.277 16.963  2.634   1.00 0.00 ? 299 PRO A HG2  1 
ATOM 4637 H HG3  . PRO A 1 299 ? 478.532 16.818  4.380   1.00 0.00 ? 299 PRO A HG3  1 
ATOM 4638 H HD2  . PRO A 1 299 ? 476.177 16.091  2.757   1.00 0.00 ? 299 PRO A HD2  1 
ATOM 4639 H HD3  . PRO A 1 299 ? 476.692 15.483  4.340   1.00 0.00 ? 299 PRO A HD3  1 
ATOM 4640 N N    . GLU A 1 300 ? 474.899 19.816  3.107   1.00 0.00 ? 300 GLU A N    1 
ATOM 4641 C CA   . GLU A 1 300 ? 474.054 20.909  2.642   1.00 0.00 ? 300 GLU A CA   1 
ATOM 4642 C C    . GLU A 1 300 ? 472.577 20.571  2.786   1.00 0.00 ? 300 GLU A C    1 
ATOM 4643 O O    . GLU A 1 300 ? 471.729 21.137  2.094   1.00 0.00 ? 300 GLU A O    1 
ATOM 4644 C CB   . GLU A 1 300 ? 474.380 21.214  1.186   1.00 0.00 ? 300 GLU A CB   1 
ATOM 4645 C CG   . GLU A 1 300 ? 475.870 21.276  0.916   1.00 0.00 ? 300 GLU A CG   1 
ATOM 4646 C CD   . GLU A 1 300 ? 476.337 22.662  0.515   1.00 0.00 ? 300 GLU A CD   1 
ATOM 4647 O OE1  . GLU A 1 300 ? 476.330 22.964  -0.697  1.00 0.00 ? 300 GLU A OE1  1 
ATOM 4648 O OE2  . GLU A 1 300 ? 476.709 23.446  1.414   1.00 0.00 ? 300 GLU A OE2  1 
ATOM 4649 H H    . GLU A 1 300 ? 475.111 19.085  2.488   1.00 0.00 ? 300 GLU A H    1 
ATOM 4650 H HA   . GLU A 1 300 ? 474.275 21.779  3.241   1.00 0.00 ? 300 GLU A HA   1 
ATOM 4651 H HB2  . GLU A 1 300 ? 473.956 20.436  0.569   1.00 0.00 ? 300 GLU A HB2  1 
ATOM 4652 H HB3  . GLU A 1 300 ? 473.941 22.162  0.916   1.00 0.00 ? 300 GLU A HB3  1 
ATOM 4653 H HG2  . GLU A 1 300 ? 476.391 20.981  1.815   1.00 0.00 ? 300 GLU A HG2  1 
ATOM 4654 H HG3  . GLU A 1 300 ? 476.106 20.585  0.121   1.00 0.00 ? 300 GLU A HG3  1 
ATOM 4655 N N    . GLU A 1 301 ? 472.275 19.647  3.687   1.00 0.00 ? 301 GLU A N    1 
ATOM 4656 C CA   . GLU A 1 301 ? 470.904 19.226  3.931   1.00 0.00 ? 301 GLU A CA   1 
ATOM 4657 C C    . GLU A 1 301 ? 469.969 20.426  4.065   1.00 0.00 ? 301 GLU A C    1 
ATOM 4658 O O    . GLU A 1 301 ? 468.932 20.493  3.406   1.00 0.00 ? 301 GLU A O    1 
ATOM 4659 C CB   . GLU A 1 301 ? 470.841 18.376  5.198   1.00 0.00 ? 301 GLU A CB   1 
ATOM 4660 C CG   . GLU A 1 301 ? 469.453 17.861  5.498   1.00 0.00 ? 301 GLU A CG   1 
ATOM 4661 C CD   . GLU A 1 301 ? 469.458 16.668  6.433   1.00 0.00 ? 301 GLU A CD   1 
ATOM 4662 O OE1  . GLU A 1 301 ? 470.127 16.740  7.485   1.00 0.00 ? 301 GLU A OE1  1 
ATOM 4663 O OE2  . GLU A 1 301 ? 468.794 15.660  6.112   1.00 0.00 ? 301 GLU A OE2  1 
ATOM 4664 H H    . GLU A 1 301 ? 472.994 19.235  4.203   1.00 0.00 ? 301 GLU A H    1 
ATOM 4665 H HA   . GLU A 1 301 ? 470.586 18.628  3.092   1.00 0.00 ? 301 GLU A HA   1 
ATOM 4666 H HB2  . GLU A 1 301 ? 471.499 17.529  5.085   1.00 0.00 ? 301 GLU A HB2  1 
ATOM 4667 H HB3  . GLU A 1 301 ? 471.171 18.971  6.036   1.00 0.00 ? 301 GLU A HB3  1 
ATOM 4668 H HG2  . GLU A 1 301 ? 468.886 18.656  5.954   1.00 0.00 ? 301 GLU A HG2  1 
ATOM 4669 H HG3  . GLU A 1 301 ? 468.988 17.574  4.569   1.00 0.00 ? 301 GLU A HG3  1 
ATOM 4670 N N    . ASP A 1 302 ? 470.345 21.372  4.921   1.00 0.00 ? 302 ASP A N    1 
ATOM 4671 C CA   . ASP A 1 302 ? 469.541 22.570  5.139   1.00 0.00 ? 302 ASP A CA   1 
ATOM 4672 C C    . ASP A 1 302 ? 468.225 22.232  5.834   1.00 0.00 ? 302 ASP A C    1 
ATOM 4673 O O    . ASP A 1 302 ? 467.251 22.978  5.737   1.00 0.00 ? 302 ASP A O    1 
ATOM 4674 C CB   . ASP A 1 302 ? 469.259 23.267  3.808   1.00 0.00 ? 302 ASP A CB   1 
ATOM 4675 C CG   . ASP A 1 302 ? 469.480 24.765  3.879   1.00 0.00 ? 302 ASP A CG   1 
ATOM 4676 O OD1  . ASP A 1 302 ? 470.639 25.203  3.715   1.00 0.00 ? 302 ASP A OD1  1 
ATOM 4677 O OD2  . ASP A 1 302 ? 468.495 25.501  4.099   1.00 0.00 ? 302 ASP A OD2  1 
ATOM 4678 H H    . ASP A 1 302 ? 471.183 21.262  5.416   1.00 0.00 ? 302 ASP A H    1 
ATOM 4679 H HA   . ASP A 1 302 ? 470.106 23.238  5.772   1.00 0.00 ? 302 ASP A HA   1 
ATOM 4680 H HB2  . ASP A 1 302 ? 469.913 22.860  3.052   1.00 0.00 ? 302 ASP A HB2  1 
ATOM 4681 H HB3  . ASP A 1 302 ? 468.233 23.085  3.525   1.00 0.00 ? 302 ASP A HB3  1 
ATOM 4682 N N    . PHE A 1 303 ? 468.201 21.102  6.534   1.00 0.00 ? 303 PHE A N    1 
ATOM 4683 C CA   . PHE A 1 303 ? 467.002 20.665  7.244   1.00 0.00 ? 303 PHE A CA   1 
ATOM 4684 C C    . PHE A 1 303 ? 466.474 21.766  8.159   1.00 0.00 ? 303 PHE A C    1 
ATOM 4685 O O    . PHE A 1 303 ? 465.264 21.962  8.275   1.00 0.00 ? 303 PHE A O    1 
ATOM 4686 C CB   . PHE A 1 303 ? 467.297 19.407  8.064   1.00 0.00 ? 303 PHE A CB   1 
ATOM 4687 C CG   . PHE A 1 303 ? 468.435 19.572  9.030   1.00 0.00 ? 303 PHE A CG   1 
ATOM 4688 C CD1  . PHE A 1 303 ? 469.741 19.355  8.623   1.00 0.00 ? 303 PHE A CD1  1 
ATOM 4689 C CD2  . PHE A 1 303 ? 468.198 19.943  10.343  1.00 0.00 ? 303 PHE A CD2  1 
ATOM 4690 C CE1  . PHE A 1 303 ? 470.791 19.505  9.508   1.00 0.00 ? 303 PHE A CE1  1 
ATOM 4691 C CE2  . PHE A 1 303 ? 469.245 20.096  11.234  1.00 0.00 ? 303 PHE A CE2  1 
ATOM 4692 C CZ   . PHE A 1 303 ? 470.543 19.876  10.816  1.00 0.00 ? 303 PHE A CZ   1 
ATOM 4693 H H    . PHE A 1 303 ? 469.007 20.549  6.573   1.00 0.00 ? 303 PHE A H    1 
ATOM 4694 H HA   . PHE A 1 303 ? 466.249 20.433  6.507   1.00 0.00 ? 303 PHE A HA   1 
ATOM 4695 H HB2  . PHE A 1 303 ? 466.417 19.142  8.631   1.00 0.00 ? 303 PHE A HB2  1 
ATOM 4696 H HB3  . PHE A 1 303 ? 467.543 18.598  7.393   1.00 0.00 ? 303 PHE A HB3  1 
ATOM 4697 H HD1  . PHE A 1 303 ? 469.937 19.066  7.602   1.00 0.00 ? 303 PHE A HD1  1 
ATOM 4698 H HD2  . PHE A 1 303 ? 467.184 20.115  10.671  1.00 0.00 ? 303 PHE A HD2  1 
ATOM 4699 H HE1  . PHE A 1 303 ? 471.804 19.332  9.178   1.00 0.00 ? 303 PHE A HE1  1 
ATOM 4700 H HE2  . PHE A 1 303 ? 469.047 20.385  12.255  1.00 0.00 ? 303 PHE A HE2  1 
ATOM 4701 H HZ   . PHE A 1 303 ? 471.362 19.994  11.509  1.00 0.00 ? 303 PHE A HZ   1 
ATOM 4702 N N    . SER A 1 304 ? 467.388 22.481  8.805   1.00 0.00 ? 304 SER A N    1 
ATOM 4703 C CA   . SER A 1 304 ? 467.015 23.562  9.709   1.00 0.00 ? 304 SER A CA   1 
ATOM 4704 C C    . SER A 1 304 ? 467.854 24.808  9.445   1.00 0.00 ? 304 SER A C    1 
ATOM 4705 O O    . SER A 1 304 ? 469.092 24.729  9.589   1.00 0.00 ? 304 SER A O    1 
ATOM 4706 C CB   . SER A 1 304 ? 467.182 23.120  11.164  1.00 0.00 ? 304 SER A CB   1 
ATOM 4707 O OG   . SER A 1 304 ? 466.155 23.653  11.981  1.00 0.00 ? 304 SER A OG   1 
ATOM 4708 O OXT  . SER A 1 304 ? 467.266 25.853  9.094   1.00 0.00 ? 304 SER A OXT  1 
ATOM 4709 H H    . SER A 1 304 ? 468.338 22.277  8.671   1.00 0.00 ? 304 SER A H    1 
ATOM 4710 H HA   . SER A 1 304 ? 465.976 23.798  9.532   1.00 0.00 ? 304 SER A HA   1 
ATOM 4711 H HB2  . SER A 1 304 ? 467.143 22.042  11.217  1.00 0.00 ? 304 SER A HB2  1 
ATOM 4712 H HB3  . SER A 1 304 ? 468.136 23.464  11.535  1.00 0.00 ? 304 SER A HB3  1 
ATOM 4713 H HG   . SER A 1 304 ? 466.031 24.583  11.775  1.00 0.00 ? 304 SER A HG   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   ASN 4   4   4   ASN ASN A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  TRP 13  13  13  TRP TRP A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 TRP 170 170 170 TRP TRP A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 TYR 186 186 186 TYR TYR A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 PRO 218 218 218 PRO PRO A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 ARG 241 241 241 ARG ARG A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 TYR 251 251 251 TYR TYR A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 GLN 274 274 274 GLN GLN A . n 
A 1 275 TRP 275 275 275 TRP TRP A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 GLY 277 277 277 GLY GLY A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 CYS 279 279 279 CYS CYS A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 PRO 287 287 287 PRO PRO A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 HIS 290 290 290 HIS HIS A . n 
A 1 291 VAL 291 291 291 VAL VAL A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLN 296 296 296 GLN GLN A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 PRO 299 299 299 PRO PRO A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PHE 303 303 303 PHE PHE A . n 
A 1 304 SER 304 304 304 SER SER A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLN 21  ? ? H   A ALA 25  ? ? 1.43 
2 1 O A GLN 28  ? ? H   A GLN 30  ? ? 1.50 
3 1 O A THR 111 ? ? HG1 A THR 112 ? ? 1.53 
4 1 O A VAL 137 ? ? H   A LEU 159 ? ? 1.58 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 2   ? ? -76.68  -167.49 
2  1 ASN A 4   ? ? -164.88 -49.08  
3  1 PHE A 5   ? ? 49.72   174.60  
4  1 SER A 7   ? ? -146.53 -68.67  
5  1 GLU A 8   ? ? -132.01 -88.72  
6  1 GLU A 9   ? ? 48.34   -69.41  
7  1 ARG A 10  ? ? -93.03  51.01   
8  1 SER A 11  ? ? -108.59 -72.66  
9  1 SER A 12  ? ? -158.70 -146.14 
10 1 TYR A 14  ? ? 176.41  -33.51  
11 1 TRP A 15  ? ? 59.16   164.14  
12 1 ARG A 17  ? ? -55.04  86.88   
13 1 ARG A 20  ? ? -170.27 -41.92  
14 1 GLN A 28  ? ? -59.17  -120.97 
15 1 ARG A 31  ? ? -51.74  171.00  
16 1 SER A 40  ? ? -166.04 61.61   
17 1 THR A 42  ? ? -66.77  -176.05 
18 1 SER A 43  ? ? 78.59   -175.74 
19 1 GLU A 53  ? ? -169.79 -59.12  
20 1 ASN A 54  ? ? -160.57 -57.89  
21 1 ARG A 56  ? ? 49.30   167.22  
22 1 PRO A 67  ? ? -42.91  167.26  
23 1 ALA A 76  ? ? -110.89 -73.76  
24 1 SER A 83  ? ? 174.42  166.88  
25 1 SER A 85  ? ? -54.30  -109.32 
26 1 ARG A 86  ? ? 61.59   135.26  
27 1 ILE A 89  ? ? 148.85  137.93  
28 1 ASP A 91  ? ? 48.00   29.01   
29 1 PHE A 94  ? ? -99.39  -113.82 
30 1 ASP A 95  ? ? -168.53 -35.78  
31 1 GLU A 102 ? ? -80.25  44.40   
32 1 ILE A 106 ? ? -107.66 -60.20  
33 1 HIS A 107 ? ? -166.22 104.73  
34 1 TYR A 108 ? ? 43.46   -169.78 
35 1 THR A 112 ? ? 99.04   -172.55 
36 1 LEU A 114 ? ? 60.01   93.08   
37 1 SER A 119 ? ? -61.66  -145.79 
38 1 ARG A 120 ? ? -98.74  -67.40  
39 1 SER A 121 ? ? 46.94   -153.74 
40 1 ARG A 122 ? ? 45.54   21.33   
41 1 GLN A 123 ? ? 65.22   89.93   
42 1 LEU A 129 ? ? -165.31 58.38   
43 1 ALA A 134 ? ? -175.95 -151.35 
44 1 ASN A 144 ? ? 169.01  135.69  
45 1 ASN A 146 ? ? -156.33 -42.42  
46 1 LYS A 155 ? ? -38.80  136.33  
47 1 ASP A 163 ? ? 172.82  157.93  
48 1 PRO A 192 ? ? -74.78  -78.55  
49 1 ALA A 193 ? ? -174.99 -47.51  
50 1 ALA A 195 ? ? -140.65 -39.96  
51 1 VAL A 197 ? ? -144.18 -45.21  
52 1 SER A 198 ? ? 55.74   -167.00 
53 1 ALA A 199 ? ? -88.72  -77.94  
54 1 LEU A 200 ? ? -177.18 -59.01  
55 1 ILE A 201 ? ? 68.62   -68.17  
56 1 ASN A 204 ? ? -146.43 -58.29  
57 1 PRO A 212 ? ? -69.96  64.03   
58 1 ALA A 222 ? ? -161.55 104.21  
59 1 PRO A 224 ? ? -52.31  -168.06 
60 1 SER A 225 ? ? -54.46  84.80   
61 1 LEU A 230 ? ? -120.61 -67.53  
62 1 LEU A 233 ? ? -174.73 42.38   
63 1 PRO A 237 ? ? -52.68  -162.54 
64 1 ALA A 240 ? ? -163.48 -96.04  
65 1 LYS A 253 ? ? -136.20 -68.83  
66 1 LYS A 268 ? ? 83.77   100.99  
67 1 SER A 272 ? ? -79.08  30.21   
68 1 LEU A 293 ? ? -57.79  174.54  
69 1 ASP A 295 ? ? 164.30  -81.96  
70 1 GLN A 296 ? ? -143.17 52.24   
#