data_2EZ6
# 
_entry.id   2EZ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2EZ6         pdb_00002ez6 10.2210/pdb2ez6/pdb 
NDB   PR0185       ?            ?                   
RCSB  RCSB035273   ?            ?                   
WWPDB D_1000035273 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JFZ 'Crystal structure of a MN(II)-complex of RNase III endonuclease domain from Aquifex aeolicus' unspecified 
PDB 1O0W 'The crystal structure of RNase III from Thermotoga maritima' unspecified 
PDB 1RC7 
;Crystal structure of RNase III mutant E110K from Aquifex aeolicus complexed with ds-RNA (5'-GGCGCGCGCC-3')
;
unspecified 
PDB 1YZ9 
;Crystal structure of RNase III mutant E110Q from Aquifex aeolicus complexed with ds-RNA (5'-CGAACUUCGCG-3') at 2.1-Angstrom Resolution
;
unspecified 
PDB 1YYO 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-CGCGAAUUCGCG-3') at 2.5-Angstrom Resolution
;
unspecified 
PDB 1YYW 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-AAAUAUAUAUUU-3') at 2.8-Angstrom Resolution
;
unspecified 
PDB 1RC5 'The crystal structure of MG(II)-complex of RNase III endonuclease domain from Aquifex aeolicus' unspecified 
PDB 1YYK 
;Crystal structure of RNase III (E110K) from Aquifex aeolicus complexed with ds-RNA (5'-CGCGAAUUCGCG-3') at 2.9-Angstrom Resolution
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EZ6 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gan, J.'      1 
'Tropea, J.E.' 2 
'Austin, B.P.' 3 
'Court, D.L.'  4 
'Waugh, D.S.'  5 
'Ji, X.'       6 
# 
_citation.id                        primary 
_citation.title                     'Structural Insight into the Mechanism of Double-Stranded RNA Processing by Ribonuclease III.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            124 
_citation.page_first                355 
_citation.page_last                 366 
_citation.year                      2006 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16439209 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2005.11.034 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gan, J.'      1 ? 
primary 'Tropea, J.E.' 2 ? 
primary 'Austin, B.P.' 3 ? 
primary 'Court, D.L.'  4 ? 
primary 'Waugh, D.S.'  5 ? 
primary 'Ji, X.'       6 ? 
# 
_cell.entry_id           2EZ6 
_cell.length_a           63.839 
_cell.length_b           50.976 
_cell.length_c           113.746 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.47 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2EZ6 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 28-MER             8980.364  2   ?        ?    ? ? 
2 polymer     man 'Ribonuclease III' 26146.396 2   3.1.26.3 D44N ? ? 
3 non-polymer syn 'MAGNESIUM ION'    24.305    2   ?        ?    ? ? 
4 water       nat water              18.015    298 ?        ?    ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'RNase III' 
# 
_entity_name_sys.entity_id   2 
_entity_name_sys.name        E.C.3.1.26.3 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no AAAGGUCAUUCGCAAGAGUGGCCUUUAU AAAGGUCAUUCGCAAGAGUGGCCUUUAU C,D ? 
2 'polypeptide(L)'   no no 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   A   n 
1 2   A   n 
1 3   A   n 
1 4   G   n 
1 5   G   n 
1 6   U   n 
1 7   C   n 
1 8   A   n 
1 9   U   n 
1 10  U   n 
1 11  C   n 
1 12  G   n 
1 13  C   n 
1 14  A   n 
1 15  A   n 
1 16  G   n 
1 17  A   n 
1 18  G   n 
1 19  U   n 
1 20  G   n 
1 21  G   n 
1 22  C   n 
1 23  C   n 
1 24  U   n 
1 25  U   n 
1 26  U   n 
1 27  A   n 
1 28  U   n 
2 1   MET n 
2 2   LYS n 
2 3   MET n 
2 4   LEU n 
2 5   GLU n 
2 6   GLN n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  LYS n 
2 11  LEU n 
2 12  GLY n 
2 13  TYR n 
2 14  THR n 
2 15  PHE n 
2 16  LYS n 
2 17  ASP n 
2 18  LYS n 
2 19  SER n 
2 20  LEU n 
2 21  LEU n 
2 22  GLU n 
2 23  LYS n 
2 24  ALA n 
2 25  LEU n 
2 26  THR n 
2 27  HIS n 
2 28  VAL n 
2 29  SER n 
2 30  TYR n 
2 31  SER n 
2 32  LYS n 
2 33  LYS n 
2 34  GLU n 
2 35  HIS n 
2 36  TYR n 
2 37  GLU n 
2 38  THR n 
2 39  LEU n 
2 40  GLU n 
2 41  PHE n 
2 42  LEU n 
2 43  GLY n 
2 44  ASN n 
2 45  ALA n 
2 46  LEU n 
2 47  VAL n 
2 48  ASN n 
2 49  PHE n 
2 50  PHE n 
2 51  ILE n 
2 52  VAL n 
2 53  ASP n 
2 54  LEU n 
2 55  LEU n 
2 56  VAL n 
2 57  GLN n 
2 58  TYR n 
2 59  SER n 
2 60  PRO n 
2 61  ASN n 
2 62  LYS n 
2 63  ARG n 
2 64  GLU n 
2 65  GLY n 
2 66  PHE n 
2 67  LEU n 
2 68  SER n 
2 69  PRO n 
2 70  LEU n 
2 71  LYS n 
2 72  ALA n 
2 73  TYR n 
2 74  LEU n 
2 75  ILE n 
2 76  SER n 
2 77  GLU n 
2 78  GLU n 
2 79  PHE n 
2 80  PHE n 
2 81  ASN n 
2 82  LEU n 
2 83  LEU n 
2 84  ALA n 
2 85  GLN n 
2 86  LYS n 
2 87  LEU n 
2 88  GLU n 
2 89  LEU n 
2 90  HIS n 
2 91  LYS n 
2 92  PHE n 
2 93  ILE n 
2 94  ARG n 
2 95  ILE n 
2 96  LYS n 
2 97  ARG n 
2 98  GLY n 
2 99  LYS n 
2 100 ILE n 
2 101 ASN n 
2 102 GLU n 
2 103 THR n 
2 104 ILE n 
2 105 ILE n 
2 106 GLY n 
2 107 ASP n 
2 108 VAL n 
2 109 PHE n 
2 110 GLU n 
2 111 ALA n 
2 112 LEU n 
2 113 TRP n 
2 114 ALA n 
2 115 ALA n 
2 116 VAL n 
2 117 TYR n 
2 118 ILE n 
2 119 ASP n 
2 120 SER n 
2 121 GLY n 
2 122 ARG n 
2 123 ASP n 
2 124 ALA n 
2 125 ASN n 
2 126 PHE n 
2 127 THR n 
2 128 ARG n 
2 129 GLU n 
2 130 LEU n 
2 131 PHE n 
2 132 TYR n 
2 133 LYS n 
2 134 LEU n 
2 135 PHE n 
2 136 LYS n 
2 137 GLU n 
2 138 ASP n 
2 139 ILE n 
2 140 LEU n 
2 141 SER n 
2 142 ALA n 
2 143 ILE n 
2 144 LYS n 
2 145 GLU n 
2 146 GLY n 
2 147 ARG n 
2 148 VAL n 
2 149 LYS n 
2 150 LYS n 
2 151 ASP n 
2 152 TYR n 
2 153 LYS n 
2 154 THR n 
2 155 ILE n 
2 156 LEU n 
2 157 GLN n 
2 158 GLU n 
2 159 ILE n 
2 160 THR n 
2 161 GLN n 
2 162 LYS n 
2 163 ARG n 
2 164 TRP n 
2 165 LYS n 
2 166 GLU n 
2 167 ARG n 
2 168 PRO n 
2 169 GLU n 
2 170 TYR n 
2 171 ARG n 
2 172 LEU n 
2 173 ILE n 
2 174 SER n 
2 175 VAL n 
2 176 GLU n 
2 177 GLY n 
2 178 PRO n 
2 179 HIS n 
2 180 HIS n 
2 181 LYS n 
2 182 LYS n 
2 183 LYS n 
2 184 PHE n 
2 185 ILE n 
2 186 VAL n 
2 187 GLU n 
2 188 ALA n 
2 189 LYS n 
2 190 ILE n 
2 191 LYS n 
2 192 GLU n 
2 193 TYR n 
2 194 ARG n 
2 195 THR n 
2 196 LEU n 
2 197 GLY n 
2 198 GLU n 
2 199 GLY n 
2 200 LYS n 
2 201 SER n 
2 202 LYS n 
2 203 LYS n 
2 204 GLU n 
2 205 ALA n 
2 206 GLU n 
2 207 GLN n 
2 208 ARG n 
2 209 ALA n 
2 210 ALA n 
2 211 GLU n 
2 212 GLU n 
2 213 LEU n 
2 214 ILE n 
2 215 LYS n 
2 216 LEU n 
2 217 LEU n 
2 218 GLU n 
2 219 GLU n 
2 220 SER n 
2 221 GLU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 rnc 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHPK1409 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RNC_AQUAE O67082 2 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
1 ? 
2 PDB 2EZ6      2EZ6   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2EZ6 A 1 ? 221 ? O67082 1 ? 221 ? 1 221 
2 1 2EZ6 B 1 ? 221 ? O67082 1 ? 221 ? 1 221 
3 2 2EZ6 C 1 ? 28  ? 2EZ6   1 ? 28  ? 1 28  
4 2 2EZ6 D 1 ? 28  ? 2EZ6   1 ? 28  ? 1 28  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EZ6 ASN A 44 ? UNP O67082 ASP 44 'engineered mutation' 44 1 
2 2EZ6 ASN B 44 ? UNP O67082 ASP 44 'engineered mutation' 44 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2EZ6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'0.2 M ammonium sulfate, 25% w/v PEG 3350 in 0.1 M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate' ? ? ? 
1 2 1 'PEG 3350'         ? ? ? 
1 3 1 HEPES              ? ? ? 
1 4 1 H2O                ? ? ? 
1 5 2 'ammonium sulfate' ? ? ? 
1 6 2 'PEG 3350'         ? ? ? 
1 7 2 HEPES              ? ? ? 
1 8 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRUKER PROTEUM 300' 
_diffrn_detector.pdbx_collection_date   2005-07-02 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2EZ6 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   40208 
_reflns.number_all                   40208 
_reflns.percent_possible_obs         90.6 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.3 
_reflns.B_iso_Wilson_estimate        43.0 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.percent_possible_all   55.2 
_reflns_shell.Rmerge_I_obs           0.411 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2408 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2EZ6 
_refine.ls_number_reflns_obs                     38707 
_refine.ls_number_reflns_all                     38707 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               232333.04 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.84 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    86.8 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_R_factor_all                          0.215 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.258 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1932 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               48.8 
_refine.aniso_B[1][1]                            0.68 
_refine.aniso_B[2][2]                            2.01 
_refine.aniso_B[3][3]                            -2.70 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            8.27 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.410216 
_refine.solvent_model_param_bsol                 69.1207 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entries 1RC7, 1YZ9, 1YYW, 1YYO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2EZ6 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           30.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3640 
_refine_hist.pdbx_number_atoms_nucleic_acid   1196 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             298 
_refine_hist.number_atoms_total               5136 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        29.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.1   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      16.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.97  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.66  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.68  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             5.13  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            6.61  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.18 
_refine_ls_shell.number_reflns_R_work             3663 
_refine_ls_shell.R_factor_R_work                  0.352 
_refine_ls_shell.percent_reflns_obs               51.9 
_refine_ls_shell.R_factor_R_free                  0.4 
_refine_ls_shell.R_factor_R_free_error            0.029 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                3851 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2EZ6 
_struct.title                     
'Crystal structure of Aquifex aeolicus RNase III (D44N) complexed with product of double-stranded RNA processing' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EZ6 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA 
_struct_keywords.text            'Ribonuclease III, dsRNA, RNA processing, RNA interference, HYDROLASE-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET C 3   ? GLY C 12  ? MET A 3   GLY A 12  1 ? 10 
HELX_P HELX_P2  2  ASP C 17  ? THR C 26  ? ASP A 17  THR A 26  1 ? 10 
HELX_P HELX_P3  3  TYR C 36  ? SER C 59  ? TYR A 36  SER A 59  1 ? 24 
HELX_P HELX_P4  4  ARG C 63  ? ILE C 75  ? ARG A 63  ILE A 75  1 ? 13 
HELX_P HELX_P5  5  SER C 76  ? GLN C 85  ? SER A 76  GLN A 85  1 ? 10 
HELX_P HELX_P6  6  LYS C 86  ? PHE C 92  ? LYS A 86  PHE A 92  5 ? 7  
HELX_P HELX_P7  7  ASN C 101 ? SER C 120 ? ASN A 101 SER A 120 1 ? 20 
HELX_P HELX_P8  8  ASP C 123 ? GLU C 145 ? ASP A 123 GLU A 145 1 ? 23 
HELX_P HELX_P9  9  ASP C 151 ? TRP C 164 ? ASP A 151 TRP A 164 1 ? 14 
HELX_P HELX_P10 10 SER C 201 ? GLU C 219 ? SER A 201 GLU A 219 1 ? 19 
HELX_P HELX_P11 11 MET D 3   ? GLY D 12  ? MET B 3   GLY B 12  1 ? 10 
HELX_P HELX_P12 12 ASP D 17  ? THR D 26  ? ASP B 17  THR B 26  1 ? 10 
HELX_P HELX_P13 13 TYR D 36  ? SER D 59  ? TYR B 36  SER B 59  1 ? 24 
HELX_P HELX_P14 14 ARG D 63  ? ILE D 75  ? ARG B 63  ILE B 75  1 ? 13 
HELX_P HELX_P15 15 SER D 76  ? GLN D 85  ? SER B 76  GLN B 85  1 ? 10 
HELX_P HELX_P16 16 LYS D 86  ? PHE D 92  ? LYS B 86  PHE B 92  5 ? 7  
HELX_P HELX_P17 17 ASN D 101 ? SER D 120 ? ASN B 101 SER B 120 1 ? 20 
HELX_P HELX_P18 18 ASP D 123 ? GLU D 145 ? ASP B 123 GLU B 145 1 ? 23 
HELX_P HELX_P19 19 ASP D 151 ? TRP D 164 ? ASP B 151 TRP B 164 1 ? 14 
HELX_P HELX_P20 20 PRO D 178 ? LYS D 182 ? PRO B 178 LYS B 182 5 ? 5  
HELX_P HELX_P21 21 SER D 201 ? GLU D 219 ? SER B 201 GLU B 219 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? G HOH .   O   ? ? ? 1_555 E MG  .  MG ? ? C HOH 29  A MG  501 1_555 ? ? ? ? ? ? ?             2.292 ? ? 
metalc2  metalc ? ? H HOH .   O   ? ? ? 1_555 F MG  .  MG ? ? D HOH 29  B MG  502 1_555 ? ? ? ? ? ? ?             2.224 ? ? 
metalc3  metalc ? ? H HOH .   O   ? ? ? 1_555 F MG  .  MG ? ? D HOH 30  B MG  502 1_555 ? ? ? ? ? ? ?             2.239 ? ? 
metalc4  metalc ? ? C GLU 40  OE2 ? ? ? 1_555 E MG  .  MG ? ? A GLU 40  A MG  501 1_555 ? ? ? ? ? ? ?             2.194 ? ? 
metalc5  metalc ? ? C ASP 107 OD1 ? ? ? 1_555 E MG  .  MG ? ? A ASP 107 A MG  501 1_555 ? ? ? ? ? ? ?             2.308 ? ? 
metalc6  metalc ? ? C GLU 110 OE1 ? ? ? 1_555 E MG  .  MG ? ? A GLU 110 A MG  501 1_555 ? ? ? ? ? ? ?             2.336 ? ? 
metalc7  metalc ? ? E MG  .   MG  ? ? ? 1_555 I HOH .  O  ? ? A MG  501 A HOH 502 1_555 ? ? ? ? ? ? ?             2.301 ? ? 
metalc8  metalc ? ? E MG  .   MG  ? ? ? 1_555 I HOH .  O  ? ? A MG  501 A HOH 503 1_555 ? ? ? ? ? ? ?             2.170 ? ? 
metalc9  metalc ? ? D GLU 40  OE2 ? ? ? 1_555 F MG  .  MG ? ? B GLU 40  B MG  502 1_555 ? ? ? ? ? ? ?             2.273 ? ? 
metalc10 metalc ? ? D ASP 107 OD1 ? ? ? 1_555 F MG  .  MG ? ? B ASP 107 B MG  502 1_555 ? ? ? ? ? ? ?             2.077 ? ? 
metalc11 metalc ? ? D GLU 110 OE1 ? ? ? 1_555 F MG  .  MG ? ? B GLU 110 B MG  502 1_555 ? ? ? ? ? ? ?             2.330 ? ? 
metalc12 metalc ? ? F MG  .   MG  ? ? ? 1_555 J HOH .  O  ? ? B MG  502 B HOH 503 1_555 ? ? ? ? ? ? ?             2.089 ? ? 
hydrog1  hydrog ? ? A A   1   N1  ? ? ? 1_555 A U   26 N3 ? ? C A   1   C U   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog2  hydrog ? ? A A   1   N6  ? ? ? 1_555 A U   26 O4 ? ? C A   1   C U   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog3  hydrog ? ? A A   2   N1  ? ? ? 1_555 A U   25 N3 ? ? C A   2   C U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog4  hydrog ? ? A A   2   N6  ? ? ? 1_555 A U   25 O4 ? ? C A   2   C U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog5  hydrog ? ? A A   3   N1  ? ? ? 1_555 A U   24 N3 ? ? C A   3   C U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog6  hydrog ? ? A A   3   N6  ? ? ? 1_555 A U   24 O4 ? ? C A   3   C U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog7  hydrog ? ? A G   4   N1  ? ? ? 1_555 A C   23 N3 ? ? C G   4   C C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog8  hydrog ? ? A G   4   N2  ? ? ? 1_555 A C   23 O2 ? ? C G   4   C C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog9  hydrog ? ? A G   4   O6  ? ? ? 1_555 A C   23 N4 ? ? C G   4   C C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog10 hydrog ? ? A G   5   N1  ? ? ? 1_555 A C   22 N3 ? ? C G   5   C C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog11 hydrog ? ? A G   5   N2  ? ? ? 1_555 A C   22 O2 ? ? C G   5   C C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog12 hydrog ? ? A G   5   O6  ? ? ? 1_555 A C   22 N4 ? ? C G   5   C C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog13 hydrog ? ? A U   6   N3  ? ? ? 1_555 A G   21 O6 ? ? C U   6   C G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog14 hydrog ? ? A U   6   O2  ? ? ? 1_555 A G   21 N1 ? ? C U   6   C G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog15 hydrog ? ? A C   7   N3  ? ? ? 1_555 A G   20 N1 ? ? C C   7   C G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog16 hydrog ? ? A C   7   N4  ? ? ? 1_555 A G   20 O6 ? ? C C   7   C G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog17 hydrog ? ? A C   7   O2  ? ? ? 1_555 A G   20 N2 ? ? C C   7   C G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog18 hydrog ? ? A A   8   N1  ? ? ? 1_555 A U   19 N3 ? ? C A   8   C U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog19 hydrog ? ? A A   8   N6  ? ? ? 1_555 A U   19 O4 ? ? C A   8   C U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog20 hydrog ? ? A U   9   N3  ? ? ? 1_555 A G   18 O6 ? ? C U   9   C G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog21 hydrog ? ? A U   9   O2  ? ? ? 1_555 A G   18 N1 ? ? C U   9   C G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog22 hydrog ? ? A U   10  N3  ? ? ? 1_555 A A   17 N1 ? ? C U   10  C A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog23 hydrog ? ? A U   10  O4  ? ? ? 1_555 A A   17 N6 ? ? C U   10  C A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog24 hydrog ? ? A C   11  N3  ? ? ? 1_555 A G   16 N1 ? ? C C   11  C G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog25 hydrog ? ? A C   11  N4  ? ? ? 1_555 A G   16 O6 ? ? C C   11  C G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog26 hydrog ? ? A C   11  O2  ? ? ? 1_555 A G   16 N2 ? ? C C   11  C G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog27 hydrog ? ? A G   12  N2  ? ? ? 1_555 A A   15 N7 ? ? C G   12  C A   15  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ?     ? ? 
hydrog28 hydrog ? ? A A   27  N1  ? ? ? 1_555 B U   28 N3 ? ? C A   27  D U   28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog29 hydrog ? ? A A   27  N6  ? ? ? 1_555 B U   28 O4 ? ? C A   27  D U   28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog30 hydrog ? ? A U   28  N3  ? ? ? 1_555 B A   27 N1 ? ? C U   28  D A   27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog31 hydrog ? ? A U   28  O4  ? ? ? 1_555 B A   27 N6 ? ? C U   28  D A   27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog32 hydrog ? ? B A   1   N1  ? ? ? 1_555 B U   26 N3 ? ? D A   1   D U   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog33 hydrog ? ? B A   1   N6  ? ? ? 1_555 B U   26 O4 ? ? D A   1   D U   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog34 hydrog ? ? B A   2   N1  ? ? ? 1_555 B U   25 N3 ? ? D A   2   D U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog35 hydrog ? ? B A   2   N6  ? ? ? 1_555 B U   25 O4 ? ? D A   2   D U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog36 hydrog ? ? B A   3   N1  ? ? ? 1_555 B U   24 N3 ? ? D A   3   D U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog37 hydrog ? ? B A   3   N6  ? ? ? 1_555 B U   24 O4 ? ? D A   3   D U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog38 hydrog ? ? B G   4   N1  ? ? ? 1_555 B C   23 N3 ? ? D G   4   D C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog39 hydrog ? ? B G   4   N2  ? ? ? 1_555 B C   23 O2 ? ? D G   4   D C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog40 hydrog ? ? B G   4   O6  ? ? ? 1_555 B C   23 N4 ? ? D G   4   D C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog41 hydrog ? ? B G   5   N1  ? ? ? 1_555 B C   22 N3 ? ? D G   5   D C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog42 hydrog ? ? B G   5   N2  ? ? ? 1_555 B C   22 O2 ? ? D G   5   D C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog43 hydrog ? ? B G   5   O6  ? ? ? 1_555 B C   22 N4 ? ? D G   5   D C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog44 hydrog ? ? B U   6   N3  ? ? ? 1_555 B G   21 O6 ? ? D U   6   D G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog45 hydrog ? ? B U   6   O2  ? ? ? 1_555 B G   21 N1 ? ? D U   6   D G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog46 hydrog ? ? B C   7   N3  ? ? ? 1_555 B G   20 N1 ? ? D C   7   D G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog47 hydrog ? ? B C   7   N4  ? ? ? 1_555 B G   20 O6 ? ? D C   7   D G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog48 hydrog ? ? B C   7   O2  ? ? ? 1_555 B G   20 N2 ? ? D C   7   D G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog49 hydrog ? ? B A   8   N1  ? ? ? 1_555 B U   19 N3 ? ? D A   8   D U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog50 hydrog ? ? B A   8   N6  ? ? ? 1_555 B U   19 O4 ? ? D A   8   D U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog51 hydrog ? ? B U   9   N3  ? ? ? 1_555 B G   18 O6 ? ? D U   9   D G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog52 hydrog ? ? B U   9   O2  ? ? ? 1_555 B G   18 N1 ? ? D U   9   D G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog53 hydrog ? ? B U   10  N3  ? ? ? 1_555 B A   17 N1 ? ? D U   10  D A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog54 hydrog ? ? B U   10  O4  ? ? ? 1_555 B A   17 N6 ? ? D U   10  D A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog55 hydrog ? ? B C   11  N3  ? ? ? 1_555 B G   16 N1 ? ? D C   11  D G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog56 hydrog ? ? B C   11  N4  ? ? ? 1_555 B G   16 O6 ? ? D C   11  D G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog57 hydrog ? ? B C   11  O2  ? ? ? 1_555 B G   16 N2 ? ? D C   11  D G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog58 hydrog ? ? B G   12  N2  ? ? ? 1_555 B A   15 N7 ? ? D G   12  D A   15  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 169 ? GLU C 176 ? GLU A 169 GLU A 176 
A 2 LYS C 183 ? ILE C 190 ? LYS A 183 ILE A 190 
A 3 TYR C 193 ? GLY C 199 ? TYR A 193 GLY A 199 
B 1 GLU D 169 ? GLU D 176 ? GLU B 169 GLU B 176 
B 2 LYS D 183 ? ILE D 190 ? LYS B 183 ILE B 190 
B 3 TYR D 193 ? GLY D 199 ? TYR B 193 GLY B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE C 173 ? N ILE A 173 O ILE C 185 ? O ILE A 185 
A 2 3 N VAL C 186 ? N VAL A 186 O GLY C 197 ? O GLY A 197 
B 1 2 N ARG D 171 ? N ARG B 171 O GLU D 187 ? O GLU B 187 
B 2 3 N VAL D 186 ? N VAL B 186 O GLY D 197 ? O GLY B 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 501 ? 6 'BINDING SITE FOR RESIDUE MG A 501' 
AC2 Software B MG 502 ? 6 'BINDING SITE FOR RESIDUE MG B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLU C 40  ? GLU A 40  . ? 1_555 ? 
2  AC1 6 ASP C 107 ? ASP A 107 . ? 1_555 ? 
3  AC1 6 GLU C 110 ? GLU A 110 . ? 1_555 ? 
4  AC1 6 HOH I .   ? HOH A 502 . ? 1_555 ? 
5  AC1 6 HOH I .   ? HOH A 503 . ? 1_555 ? 
6  AC1 6 HOH G .   ? HOH C 29  . ? 1_555 ? 
7  AC2 6 GLU D 40  ? GLU B 40  . ? 1_555 ? 
8  AC2 6 ASP D 107 ? ASP B 107 . ? 1_555 ? 
9  AC2 6 GLU D 110 ? GLU B 110 . ? 1_555 ? 
10 AC2 6 HOH J .   ? HOH B 503 . ? 1_555 ? 
11 AC2 6 HOH H .   ? HOH D 29  . ? 1_555 ? 
12 AC2 6 HOH H .   ? HOH D 30  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EZ6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EZ6 
_atom_sites.fract_transf_matrix[1][1]   0.015664 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004041 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019617 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009079 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  OP3   . A   A 1 1   ? -16.765 13.785  -30.128 1.00 76.38 ? 1   A   C OP3   1 
ATOM   2    P  P     . A   A 1 1   ? -17.666 13.313  -31.258 1.00 74.39 ? 1   A   C P     1 
ATOM   3    O  OP1   . A   A 1 1   ? -19.114 13.735  -31.072 1.00 71.02 ? 1   A   C OP1   1 
ATOM   4    O  OP2   . A   A 1 1   ? -17.121 13.667  -32.632 1.00 77.57 ? 1   A   C OP2   1 
ATOM   5    O  "O5'" . A   A 1 1   ? -17.662 11.685  -31.182 1.00 72.12 ? 1   A   C "O5'" 1 
ATOM   6    C  "C5'" . A   A 1 1   ? -16.429 10.952  -31.185 1.00 65.79 ? 1   A   C "C5'" 1 
ATOM   7    C  "C4'" . A   A 1 1   ? -16.609 9.660   -31.931 1.00 67.42 ? 1   A   C "C4'" 1 
ATOM   8    O  "O4'" . A   A 1 1   ? -17.514 8.800   -31.179 1.00 65.90 ? 1   A   C "O4'" 1 
ATOM   9    C  "C3'" . A   A 1 1   ? -17.295 9.776   -33.281 1.00 66.11 ? 1   A   C "C3'" 1 
ATOM   10   O  "O3'" . A   A 1 1   ? -16.434 10.216  -34.328 1.00 65.22 ? 1   A   C "O3'" 1 
ATOM   11   C  "C2'" . A   A 1 1   ? -17.771 8.348   -33.477 1.00 57.85 ? 1   A   C "C2'" 1 
ATOM   12   O  "O2'" . A   A 1 1   ? -16.677 7.492   -33.724 1.00 64.57 ? 1   A   C "O2'" 1 
ATOM   13   C  "C1'" . A   A 1 1   ? -18.310 8.042   -32.082 1.00 64.09 ? 1   A   C "C1'" 1 
ATOM   14   N  N9    . A   A 1 1   ? -19.715 8.435   -31.918 1.00 56.34 ? 1   A   C N9    1 
ATOM   15   C  C8    . A   A 1 1   ? -20.224 9.602   -31.407 1.00 53.58 ? 1   A   C C8    1 
ATOM   16   N  N7    . A   A 1 1   ? -21.535 9.650   -31.396 1.00 43.85 ? 1   A   C N7    1 
ATOM   17   C  C5    . A   A 1 1   ? -21.915 8.431   -31.932 1.00 48.46 ? 1   A   C C5    1 
ATOM   18   C  C6    . A   A 1 1   ? -23.172 7.856   -32.171 1.00 44.84 ? 1   A   C C6    1 
ATOM   19   N  N6    . A   A 1 1   ? -24.327 8.451   -31.877 1.00 38.84 ? 1   A   C N6    1 
ATOM   20   N  N1    . A   A 1 1   ? -23.204 6.623   -32.721 1.00 48.38 ? 1   A   C N1    1 
ATOM   21   C  C2    . A   A 1 1   ? -22.045 6.013   -32.994 1.00 52.24 ? 1   A   C C2    1 
ATOM   22   N  N3    . A   A 1 1   ? -20.801 6.444   -32.803 1.00 53.73 ? 1   A   C N3    1 
ATOM   23   C  C4    . A   A 1 1   ? -20.805 7.674   -32.263 1.00 53.91 ? 1   A   C C4    1 
ATOM   24   P  P     . A   A 1 2   ? -17.070 10.988  -35.592 1.00 72.88 ? 2   A   C P     1 
ATOM   25   O  OP1   . A   A 1 2   ? -15.984 11.712  -36.294 1.00 74.75 ? 2   A   C OP1   1 
ATOM   26   O  OP2   . A   A 1 2   ? -18.260 11.741  -35.116 1.00 75.26 ? 2   A   C OP2   1 
ATOM   27   O  "O5'" . A   A 1 2   ? -17.610 9.821   -36.538 1.00 67.64 ? 2   A   C "O5'" 1 
ATOM   28   C  "C5'" . A   A 1 2   ? -16.756 8.767   -36.969 1.00 46.17 ? 2   A   C "C5'" 1 
ATOM   29   C  "C4'" . A   A 1 2   ? -17.570 7.571   -37.412 1.00 46.72 ? 2   A   C "C4'" 1 
ATOM   30   O  "O4'" . A   A 1 2   ? -18.375 7.087   -36.297 1.00 44.90 ? 2   A   C "O4'" 1 
ATOM   31   C  "C3'" . A   A 1 2   ? -18.605 7.794   -38.505 1.00 43.15 ? 2   A   C "C3'" 1 
ATOM   32   O  "O3'" . A   A 1 2   ? -18.024 7.798   -39.799 1.00 43.23 ? 2   A   C "O3'" 1 
ATOM   33   C  "C2'" . A   A 1 2   ? -19.494 6.573   -38.313 1.00 43.77 ? 2   A   C "C2'" 1 
ATOM   34   O  "O2'" . A   A 1 2   ? -18.883 5.390   -38.787 1.00 39.09 ? 2   A   C "O2'" 1 
ATOM   35   C  "C1'" . A   A 1 2   ? -19.580 6.519   -36.788 1.00 41.36 ? 2   A   C "C1'" 1 
ATOM   36   N  N9    . A   A 1 2   ? -20.699 7.320   -36.297 1.00 47.07 ? 2   A   C N9    1 
ATOM   37   C  C8    . A   A 1 2   ? -20.652 8.556   -35.707 1.00 39.60 ? 2   A   C C8    1 
ATOM   38   N  N7    . A   A 1 2   ? -21.831 9.043   -35.404 1.00 40.42 ? 2   A   C N7    1 
ATOM   39   C  C5    . A   A 1 2   ? -22.715 8.056   -35.813 1.00 33.46 ? 2   A   C C5    1 
ATOM   40   C  C6    . A   A 1 2   ? -24.112 7.966   -35.770 1.00 31.97 ? 2   A   C C6    1 
ATOM   41   N  N6    . A   A 1 2   ? -24.897 8.919   -35.265 1.00 34.13 ? 2   A   C N6    1 
ATOM   42   N  N1    . A   A 1 2   ? -24.687 6.847   -36.266 1.00 34.93 ? 2   A   C N1    1 
ATOM   43   C  C2    . A   A 1 2   ? -23.896 5.890   -36.764 1.00 35.24 ? 2   A   C C2    1 
ATOM   44   N  N3    . A   A 1 2   ? -22.570 5.858   -36.857 1.00 35.65 ? 2   A   C N3    1 
ATOM   45   C  C4    . A   A 1 2   ? -22.032 6.985   -36.359 1.00 40.61 ? 2   A   C C4    1 
ATOM   46   P  P     . A   A 1 3   ? -18.775 8.554   -41.008 1.00 41.22 ? 3   A   C P     1 
ATOM   47   O  OP1   . A   A 1 3   ? -17.868 8.480   -42.176 1.00 42.67 ? 3   A   C OP1   1 
ATOM   48   O  OP2   . A   A 1 3   ? -19.221 9.866   -40.504 1.00 45.67 ? 3   A   C OP2   1 
ATOM   49   O  "O5'" . A   A 1 3   ? -20.065 7.671   -41.314 1.00 38.66 ? 3   A   C "O5'" 1 
ATOM   50   C  "C5'" . A   A 1 3   ? -19.939 6.378   -41.897 1.00 44.28 ? 3   A   C "C5'" 1 
ATOM   51   C  "C4'" . A   A 1 3   ? -21.304 5.791   -42.178 1.00 43.09 ? 3   A   C "C4'" 1 
ATOM   52   O  "O4'" . A   A 1 3   ? -22.019 5.568   -40.933 1.00 46.68 ? 3   A   C "O4'" 1 
ATOM   53   C  "C3'" . A   A 1 3   ? -22.245 6.662   -42.987 1.00 39.04 ? 3   A   C "C3'" 1 
ATOM   54   O  "O3'" . A   A 1 3   ? -21.970 6.530   -44.371 1.00 43.28 ? 3   A   C "O3'" 1 
ATOM   55   C  "C2'" . A   A 1 3   ? -23.594 6.062   -42.620 1.00 49.08 ? 3   A   C "C2'" 1 
ATOM   56   O  "O2'" . A   A 1 3   ? -23.851 4.833   -43.276 1.00 49.33 ? 3   A   C "O2'" 1 
ATOM   57   C  "C1'" . A   A 1 3   ? -23.402 5.817   -41.123 1.00 43.05 ? 3   A   C "C1'" 1 
ATOM   58   N  N9    . A   A 1 3   ? -23.762 6.997   -40.334 1.00 47.67 ? 3   A   C N9    1 
ATOM   59   C  C8    . A   A 1 3   ? -22.915 7.897   -39.734 1.00 34.49 ? 3   A   C C8    1 
ATOM   60   N  N7    . A   A 1 3   ? -23.535 8.867   -39.110 1.00 39.37 ? 3   A   C N7    1 
ATOM   61   C  C5    . A   A 1 3   ? -24.882 8.588   -39.310 1.00 43.35 ? 3   A   C C5    1 
ATOM   62   C  C6    . A   A 1 3   ? -26.061 9.244   -38.898 1.00 41.59 ? 3   A   C C6    1 
ATOM   63   N  N6    . A   A 1 3   ? -26.073 10.354  -38.156 1.00 43.01 ? 3   A   C N6    1 
ATOM   64   N  N1    . A   A 1 3   ? -27.242 8.710   -39.273 1.00 41.23 ? 3   A   C N1    1 
ATOM   65   C  C2    . A   A 1 3   ? -27.233 7.591   -40.003 1.00 36.37 ? 3   A   C C2    1 
ATOM   66   N  N3    . A   A 1 3   ? -26.198 6.881   -40.444 1.00 45.61 ? 3   A   C N3    1 
ATOM   67   C  C4    . A   A 1 3   ? -25.036 7.439   -40.059 1.00 39.08 ? 3   A   C C4    1 
ATOM   68   P  P     . G   A 1 4   ? -22.270 7.752   -45.362 1.00 44.49 ? 4   G   C P     1 
ATOM   69   O  OP1   . G   A 1 4   ? -21.622 7.432   -46.652 1.00 44.62 ? 4   G   C OP1   1 
ATOM   70   O  OP2   . G   A 1 4   ? -21.941 9.016   -44.671 1.00 42.71 ? 4   G   C OP2   1 
ATOM   71   O  "O5'" . G   A 1 4   ? -23.850 7.702   -45.567 1.00 43.18 ? 4   G   C "O5'" 1 
ATOM   72   C  "C5'" . G   A 1 4   ? -24.454 6.646   -46.303 1.00 41.73 ? 4   G   C "C5'" 1 
ATOM   73   C  "C4'" . G   A 1 4   ? -25.960 6.740   -46.222 1.00 42.48 ? 4   G   C "C4'" 1 
ATOM   74   O  "O4'" . G   A 1 4   ? -26.372 6.648   -44.831 1.00 38.12 ? 4   G   C "O4'" 1 
ATOM   75   C  "C3'" . G   A 1 4   ? -26.581 8.052   -46.664 1.00 41.61 ? 4   G   C "C3'" 1 
ATOM   76   O  "O3'" . G   A 1 4   ? -26.691 8.182   -48.075 1.00 49.36 ? 4   G   C "O3'" 1 
ATOM   77   C  "C2'" . G   A 1 4   ? -27.941 7.968   -45.995 1.00 42.64 ? 4   G   C "C2'" 1 
ATOM   78   O  "O2'" . G   A 1 4   ? -28.803 7.045   -46.629 1.00 44.88 ? 4   G   C "O2'" 1 
ATOM   79   C  "C1'" . G   A 1 4   ? -27.541 7.428   -44.627 1.00 41.44 ? 4   G   C "C1'" 1 
ATOM   80   N  N9    . G   A 1 4   ? -27.218 8.521   -43.714 1.00 40.67 ? 4   G   C N9    1 
ATOM   81   C  C8    . G   A 1 4   ? -25.971 9.015   -43.408 1.00 36.42 ? 4   G   C C8    1 
ATOM   82   N  N7    . G   A 1 4   ? -26.010 10.015  -42.572 1.00 36.14 ? 4   G   C N7    1 
ATOM   83   C  C5    . G   A 1 4   ? -27.364 10.187  -42.303 1.00 37.56 ? 4   G   C C5    1 
ATOM   84   C  C6    . G   A 1 4   ? -28.028 11.124  -41.459 1.00 40.29 ? 4   G   C C6    1 
ATOM   85   O  O6    . G   A 1 4   ? -27.536 12.001  -40.738 1.00 41.33 ? 4   G   C O6    1 
ATOM   86   N  N1    . G   A 1 4   ? -29.406 10.961  -41.500 1.00 38.02 ? 4   G   C N1    1 
ATOM   87   C  C2    . G   A 1 4   ? -30.070 10.014  -42.239 1.00 44.24 ? 4   G   C C2    1 
ATOM   88   N  N2    . G   A 1 4   ? -31.417 10.033  -42.151 1.00 36.99 ? 4   G   C N2    1 
ATOM   89   N  N3    . G   A 1 4   ? -29.463 9.121   -43.011 1.00 32.67 ? 4   G   C N3    1 
ATOM   90   C  C4    . G   A 1 4   ? -28.121 9.271   -42.998 1.00 35.59 ? 4   G   C C4    1 
ATOM   91   P  P     . G   A 1 5   ? -26.768 9.653   -48.725 1.00 48.32 ? 5   G   C P     1 
ATOM   92   O  OP1   . G   A 1 5   ? -26.727 9.481   -50.199 1.00 51.66 ? 5   G   C OP1   1 
ATOM   93   O  OP2   . G   A 1 5   ? -25.769 10.523  -48.055 1.00 48.24 ? 5   G   C OP2   1 
ATOM   94   O  "O5'" . G   A 1 5   ? -28.209 10.186  -48.322 1.00 43.93 ? 5   G   C "O5'" 1 
ATOM   95   C  "C5'" . G   A 1 5   ? -29.383 9.517   -48.760 1.00 45.16 ? 5   G   C "C5'" 1 
ATOM   96   C  "C4'" . G   A 1 5   ? -30.606 10.221  -48.229 1.00 49.23 ? 5   G   C "C4'" 1 
ATOM   97   O  "O4'" . G   A 1 5   ? -30.643 10.114  -46.775 1.00 42.24 ? 5   G   C "O4'" 1 
ATOM   98   C  "C3'" . G   A 1 5   ? -30.653 11.719  -48.479 1.00 48.62 ? 5   G   C "C3'" 1 
ATOM   99   O  "O3'" . G   A 1 5   ? -31.108 12.026  -49.795 1.00 53.09 ? 5   G   C "O3'" 1 
ATOM   100  C  "C2'" . G   A 1 5   ? -31.640 12.164  -47.409 1.00 49.83 ? 5   G   C "C2'" 1 
ATOM   101  O  "O2'" . G   A 1 5   ? -32.976 11.852  -47.758 1.00 56.96 ? 5   G   C "O2'" 1 
ATOM   102  C  "C1'" . G   A 1 5   ? -31.201 11.296  -46.228 1.00 41.03 ? 5   G   C "C1'" 1 
ATOM   103  N  N9    . G   A 1 5   ? -30.173 11.967  -45.440 1.00 44.53 ? 5   G   C N9    1 
ATOM   104  C  C8    . G   A 1 5   ? -28.813 11.770  -45.505 1.00 39.53 ? 5   G   C C8    1 
ATOM   105  N  N7    . G   A 1 5   ? -28.145 12.559  -44.707 1.00 37.80 ? 5   G   C N7    1 
ATOM   106  C  C5    . G   A 1 5   ? -29.120 13.309  -44.066 1.00 39.58 ? 5   G   C C5    1 
ATOM   107  C  C6    . G   A 1 5   ? -29.000 14.333  -43.088 1.00 42.16 ? 5   G   C C6    1 
ATOM   108  O  O6    . G   A 1 5   ? -27.973 14.773  -42.554 1.00 41.59 ? 5   G   C O6    1 
ATOM   109  N  N1    . G   A 1 5   ? -30.242 14.846  -42.728 1.00 42.27 ? 5   G   C N1    1 
ATOM   110  C  C2    . G   A 1 5   ? -31.449 14.408  -43.220 1.00 48.78 ? 5   G   C C2    1 
ATOM   111  N  N2    . G   A 1 5   ? -32.540 15.005  -42.727 1.00 40.91 ? 5   G   C N2    1 
ATOM   112  N  N3    . G   A 1 5   ? -31.575 13.449  -44.124 1.00 43.65 ? 5   G   C N3    1 
ATOM   113  C  C4    . G   A 1 5   ? -30.378 12.951  -44.503 1.00 41.38 ? 5   G   C C4    1 
ATOM   114  P  P     . U   A 1 6   ? -30.560 13.345  -50.542 1.00 51.53 ? 6   U   C P     1 
ATOM   115  O  OP1   . U   A 1 6   ? -31.077 13.297  -51.929 1.00 59.40 ? 6   U   C OP1   1 
ATOM   116  O  OP2   . U   A 1 6   ? -29.096 13.458  -50.313 1.00 53.89 ? 6   U   C OP2   1 
ATOM   117  O  "O5'" . U   A 1 6   ? -31.271 14.543  -49.774 1.00 37.77 ? 6   U   C "O5'" 1 
ATOM   118  C  "C5'" . U   A 1 6   ? -32.682 14.535  -49.561 1.00 43.35 ? 6   U   C "C5'" 1 
ATOM   119  C  "C4'" . U   A 1 6   ? -33.065 15.566  -48.527 1.00 44.81 ? 6   U   C "C4'" 1 
ATOM   120  O  "O4'" . U   A 1 6   ? -32.527 15.184  -47.237 1.00 48.57 ? 6   U   C "O4'" 1 
ATOM   121  C  "C3'" . U   A 1 6   ? -32.526 16.967  -48.761 1.00 46.79 ? 6   U   C "C3'" 1 
ATOM   122  O  "O3'" . U   A 1 6   ? -33.369 17.707  -49.631 1.00 51.48 ? 6   U   C "O3'" 1 
ATOM   123  C  "C2'" . U   A 1 6   ? -32.536 17.565  -47.361 1.00 47.91 ? 6   U   C "C2'" 1 
ATOM   124  O  "O2'" . U   A 1 6   ? -33.784 18.093  -46.972 1.00 46.89 ? 6   U   C "O2'" 1 
ATOM   125  C  "C1'" . U   A 1 6   ? -32.177 16.349  -46.504 1.00 50.15 ? 6   U   C "C1'" 1 
ATOM   126  N  N1    . U   A 1 6   ? -30.737 16.305  -46.221 1.00 39.37 ? 6   U   C N1    1 
ATOM   127  C  C2    . U   A 1 6   ? -30.254 17.162  -45.251 1.00 41.64 ? 6   U   C C2    1 
ATOM   128  O  O2    . U   A 1 6   ? -30.972 17.926  -44.618 1.00 42.08 ? 6   U   C O2    1 
ATOM   129  N  N3    . U   A 1 6   ? -28.901 17.094  -45.046 1.00 36.96 ? 6   U   C N3    1 
ATOM   130  C  C4    . U   A 1 6   ? -28.006 16.275  -45.695 1.00 40.93 ? 6   U   C C4    1 
ATOM   131  O  O4    . U   A 1 6   ? -26.819 16.342  -45.403 1.00 39.46 ? 6   U   C O4    1 
ATOM   132  C  C5    . U   A 1 6   ? -28.583 15.411  -46.680 1.00 38.53 ? 6   U   C C5    1 
ATOM   133  C  C6    . U   A 1 6   ? -29.898 15.454  -46.902 1.00 33.93 ? 6   U   C C6    1 
ATOM   134  P  P     . C   A 1 7   ? -32.736 18.847  -50.563 1.00 49.63 ? 7   C   C P     1 
ATOM   135  O  OP1   . C   A 1 7   ? -33.717 19.098  -51.643 1.00 58.00 ? 7   C   C OP1   1 
ATOM   136  O  OP2   . C   A 1 7   ? -31.351 18.441  -50.904 1.00 46.57 ? 7   C   C OP2   1 
ATOM   137  O  "O5'" . C   A 1 7   ? -32.681 20.134  -49.634 1.00 45.20 ? 7   C   C "O5'" 1 
ATOM   138  C  "C5'" . C   A 1 7   ? -33.874 20.775  -49.231 1.00 44.89 ? 7   C   C "C5'" 1 
ATOM   139  C  "C4'" . C   A 1 7   ? -33.571 21.849  -48.220 1.00 51.24 ? 7   C   C "C4'" 1 
ATOM   140  O  "O4'" . C   A 1 7   ? -33.028 21.245  -47.014 1.00 48.59 ? 7   C   C "O4'" 1 
ATOM   141  C  "C3'" . C   A 1 7   ? -32.498 22.850  -48.611 1.00 52.30 ? 7   C   C "C3'" 1 
ATOM   142  O  "O3'" . C   A 1 7   ? -32.995 23.848  -49.492 1.00 53.33 ? 7   C   C "O3'" 1 
ATOM   143  C  "C2'" . C   A 1 7   ? -32.118 23.421  -47.251 1.00 48.27 ? 7   C   C "C2'" 1 
ATOM   144  O  "O2'" . C   A 1 7   ? -33.080 24.324  -46.744 1.00 42.31 ? 7   C   C "O2'" 1 
ATOM   145  C  "C1'" . C   A 1 7   ? -32.129 22.155  -46.395 1.00 44.67 ? 7   C   C "C1'" 1 
ATOM   146  N  N1    . C   A 1 7   ? -30.801 21.532  -46.331 1.00 38.41 ? 7   C   C N1    1 
ATOM   147  C  C2    . C   A 1 7   ? -29.883 22.021  -45.407 1.00 37.50 ? 7   C   C C2    1 
ATOM   148  O  O2    . C   A 1 7   ? -30.213 22.977  -44.688 1.00 41.41 ? 7   C   C O2    1 
ATOM   149  N  N3    . C   A 1 7   ? -28.659 21.449  -45.322 1.00 39.24 ? 7   C   C N3    1 
ATOM   150  C  C4    . C   A 1 7   ? -28.341 20.435  -46.127 1.00 39.06 ? 7   C   C C4    1 
ATOM   151  N  N4    . C   A 1 7   ? -27.126 19.902  -46.008 1.00 43.32 ? 7   C   C N4    1 
ATOM   152  C  C5    . C   A 1 7   ? -29.257 19.924  -47.091 1.00 42.23 ? 7   C   C C5    1 
ATOM   153  C  C6    . C   A 1 7   ? -30.465 20.496  -47.157 1.00 41.80 ? 7   C   C C6    1 
ATOM   154  P  P     . A   A 1 8   ? -31.988 24.580  -50.504 1.00 49.29 ? 8   A   C P     1 
ATOM   155  O  OP1   . A   A 1 8   ? -32.768 25.480  -51.397 1.00 56.82 ? 8   A   C OP1   1 
ATOM   156  O  OP2   . A   A 1 8   ? -31.122 23.532  -51.097 1.00 53.87 ? 8   A   C OP2   1 
ATOM   157  O  "O5'" . A   A 1 8   ? -31.100 25.497  -49.557 1.00 47.01 ? 8   A   C "O5'" 1 
ATOM   158  C  "C5'" . A   A 1 8   ? -31.701 26.509  -48.758 1.00 43.18 ? 8   A   C "C5'" 1 
ATOM   159  C  "C4'" . A   A 1 8   ? -30.674 27.110  -47.831 1.00 45.37 ? 8   A   C "C4'" 1 
ATOM   160  O  "O4'" . A   A 1 8   ? -30.218 26.104  -46.887 1.00 47.49 ? 8   A   C "O4'" 1 
ATOM   161  C  "C3'" . A   A 1 8   ? -29.392 27.556  -48.510 1.00 51.38 ? 8   A   C "C3'" 1 
ATOM   162  O  "O3'" . A   A 1 8   ? -29.546 28.834  -49.111 1.00 50.89 ? 8   A   C "O3'" 1 
ATOM   163  C  "C2'" . A   A 1 8   ? -28.413 27.581  -47.345 1.00 42.27 ? 8   A   C "C2'" 1 
ATOM   164  O  "O2'" . A   A 1 8   ? -28.537 28.734  -46.538 1.00 42.52 ? 8   A   C "O2'" 1 
ATOM   165  C  "C1'" . A   A 1 8   ? -28.860 26.350  -46.556 1.00 43.56 ? 8   A   C "C1'" 1 
ATOM   166  N  N9    . A   A 1 8   ? -28.072 25.166  -46.895 1.00 43.95 ? 8   A   C N9    1 
ATOM   167  C  C8    . A   A 1 8   ? -28.393 24.133  -47.734 1.00 36.02 ? 8   A   C C8    1 
ATOM   168  N  N7    . A   A 1 8   ? -27.458 23.218  -47.827 1.00 40.87 ? 8   A   C N7    1 
ATOM   169  C  C5    . A   A 1 8   ? -26.455 23.680  -46.985 1.00 37.65 ? 8   A   C C5    1 
ATOM   170  C  C6    . A   A 1 8   ? -25.196 23.158  -46.630 1.00 35.59 ? 8   A   C C6    1 
ATOM   171  N  N6    . A   A 1 8   ? -24.720 21.985  -47.067 1.00 31.49 ? 8   A   C N6    1 
ATOM   172  N  N1    . A   A 1 8   ? -24.434 23.886  -45.786 1.00 40.97 ? 8   A   C N1    1 
ATOM   173  C  C2    . A   A 1 8   ? -24.918 25.043  -45.318 1.00 35.71 ? 8   A   C C2    1 
ATOM   174  N  N3    . A   A 1 8   ? -26.090 25.623  -45.558 1.00 39.70 ? 8   A   C N3    1 
ATOM   175  C  C4    . A   A 1 8   ? -26.817 24.883  -46.412 1.00 38.12 ? 8   A   C C4    1 
ATOM   176  P  P     . U   A 1 9   ? -28.752 29.177  -50.464 1.00 52.45 ? 9   U   C P     1 
ATOM   177  O  OP1   . U   A 1 9   ? -29.283 30.464  -50.983 1.00 53.04 ? 9   U   C OP1   1 
ATOM   178  O  OP2   . U   A 1 9   ? -28.777 27.969  -51.324 1.00 42.72 ? 9   U   C OP2   1 
ATOM   179  O  "O5'" . U   A 1 9   ? -27.245 29.396  -49.991 1.00 48.01 ? 9   U   C "O5'" 1 
ATOM   180  C  "C5'" . U   A 1 9   ? -26.919 30.333  -48.966 1.00 41.01 ? 9   U   C "C5'" 1 
ATOM   181  C  "C4'" . U   A 1 9   ? -25.539 30.045  -48.410 1.00 44.12 ? 9   U   C "C4'" 1 
ATOM   182  O  "O4'" . U   A 1 9   ? -25.544 28.759  -47.732 1.00 49.02 ? 9   U   C "O4'" 1 
ATOM   183  C  "C3'" . U   A 1 9   ? -24.421 29.890  -49.428 1.00 49.37 ? 9   U   C "C3'" 1 
ATOM   184  O  "O3'" . U   A 1 9   ? -23.899 31.141  -49.836 1.00 49.89 ? 9   U   C "O3'" 1 
ATOM   185  C  "C2'" . U   A 1 9   ? -23.378 29.132  -48.629 1.00 44.67 ? 9   U   C "C2'" 1 
ATOM   186  O  "O2'" . U   A 1 9   ? -22.663 29.993  -47.765 1.00 47.42 ? 9   U   C "O2'" 1 
ATOM   187  C  "C1'" . U   A 1 9   ? -24.258 28.172  -47.825 1.00 44.26 ? 9   U   C "C1'" 1 
ATOM   188  N  N1    . U   A 1 9   ? -24.380 26.869  -48.490 1.00 44.37 ? 9   U   C N1    1 
ATOM   189  C  C2    . U   A 1 9   ? -23.324 25.983  -48.351 1.00 39.62 ? 9   U   C C2    1 
ATOM   190  O  O2    . U   A 1 9   ? -22.325 26.240  -47.696 1.00 44.89 ? 9   U   C O2    1 
ATOM   191  N  N3    . U   A 1 9   ? -23.476 24.789  -49.011 1.00 35.66 ? 9   U   C N3    1 
ATOM   192  C  C4    . U   A 1 9   ? -24.548 24.399  -49.781 1.00 37.89 ? 9   U   C C4    1 
ATOM   193  O  O4    . U   A 1 9   ? -24.517 23.306  -50.342 1.00 41.30 ? 9   U   C O4    1 
ATOM   194  C  C5    . U   A 1 9   ? -25.604 25.364  -49.872 1.00 38.15 ? 9   U   C C5    1 
ATOM   195  C  C6    . U   A 1 9   ? -25.487 26.539  -49.234 1.00 40.61 ? 9   U   C C6    1 
ATOM   196  P  P     . U   A 1 10  ? -23.118 31.252  -51.231 1.00 59.24 ? 10  U   C P     1 
ATOM   197  O  OP1   . U   A 1 10  ? -22.928 32.708  -51.485 1.00 59.38 ? 10  U   C OP1   1 
ATOM   198  O  OP2   . U   A 1 10  ? -23.816 30.409  -52.240 1.00 52.66 ? 10  U   C OP2   1 
ATOM   199  O  "O5'" . U   A 1 10  ? -21.693 30.598  -50.938 1.00 53.29 ? 10  U   C "O5'" 1 
ATOM   200  C  "C5'" . U   A 1 10  ? -20.756 31.247  -50.086 1.00 49.78 ? 10  U   C "C5'" 1 
ATOM   201  C  "C4'" . U   A 1 10  ? -19.522 30.395  -49.922 1.00 53.81 ? 10  U   C "C4'" 1 
ATOM   202  O  "O4'" . U   A 1 10  ? -19.880 29.135  -49.288 1.00 56.31 ? 10  U   C "O4'" 1 
ATOM   203  C  "C3'" . U   A 1 10  ? -18.849 29.953  -51.209 1.00 55.71 ? 10  U   C "C3'" 1 
ATOM   204  O  "O3'" . U   A 1 10  ? -18.014 30.971  -51.744 1.00 57.43 ? 10  U   C "O3'" 1 
ATOM   205  C  "C2'" . U   A 1 10  ? -18.039 28.755  -50.734 1.00 55.41 ? 10  U   C "C2'" 1 
ATOM   206  O  "O2'" . U   A 1 10  ? -16.869 29.143  -50.042 1.00 45.58 ? 10  U   C "O2'" 1 
ATOM   207  C  "C1'" . U   A 1 10  ? -19.015 28.111  -49.749 1.00 52.54 ? 10  U   C "C1'" 1 
ATOM   208  N  N1    . U   A 1 10  ? -19.822 27.043  -50.357 1.00 49.93 ? 10  U   C N1    1 
ATOM   209  C  C2    . U   A 1 10  ? -19.249 25.785  -50.441 1.00 42.06 ? 10  U   C C2    1 
ATOM   210  O  O2    . U   A 1 10  ? -18.124 25.543  -50.048 1.00 46.18 ? 10  U   C O2    1 
ATOM   211  N  N3    . U   A 1 10  ? -20.040 24.822  -51.007 1.00 44.07 ? 10  U   C N3    1 
ATOM   212  C  C4    . U   A 1 10  ? -21.316 24.976  -51.497 1.00 48.68 ? 10  U   C C4    1 
ATOM   213  O  O4    . U   A 1 10  ? -21.894 24.004  -51.984 1.00 49.94 ? 10  U   C O4    1 
ATOM   214  C  C5    . U   A 1 10  ? -21.842 26.305  -51.384 1.00 49.22 ? 10  U   C C5    1 
ATOM   215  C  C6    . U   A 1 10  ? -21.092 27.272  -50.829 1.00 52.59 ? 10  U   C C6    1 
ATOM   216  P  P     . C   A 1 11  ? -17.614 30.928  -53.298 1.00 61.65 ? 11  C   C P     1 
ATOM   217  O  OP1   . C   A 1 11  ? -16.876 32.174  -53.607 1.00 61.29 ? 11  C   C OP1   1 
ATOM   218  O  OP2   . C   A 1 11  ? -18.833 30.584  -54.071 1.00 65.50 ? 11  C   C OP2   1 
ATOM   219  O  "O5'" . C   A 1 11  ? -16.627 29.680  -53.414 1.00 56.24 ? 11  C   C "O5'" 1 
ATOM   220  C  "C5'" . C   A 1 11  ? -15.338 29.710  -52.809 1.00 55.50 ? 11  C   C "C5'" 1 
ATOM   221  C  "C4'" . C   A 1 11  ? -14.601 28.416  -53.070 1.00 49.46 ? 11  C   C "C4'" 1 
ATOM   222  O  "O4'" . C   A 1 11  ? -15.263 27.315  -52.393 1.00 53.17 ? 11  C   C "O4'" 1 
ATOM   223  C  "C3'" . C   A 1 11  ? -14.571 27.946  -54.510 1.00 53.35 ? 11  C   C "C3'" 1 
ATOM   224  O  "O3'" . C   A 1 11  ? -13.609 28.657  -55.264 1.00 52.53 ? 11  C   C "O3'" 1 
ATOM   225  C  "C2'" . C   A 1 11  ? -14.209 26.475  -54.347 1.00 48.33 ? 11  C   C "C2'" 1 
ATOM   226  O  "O2'" . C   A 1 11  ? -12.834 26.259  -54.092 1.00 56.21 ? 11  C   C "O2'" 1 
ATOM   227  C  "C1'" . C   A 1 11  ? -15.018 26.109  -53.103 1.00 47.14 ? 11  C   C "C1'" 1 
ATOM   228  N  N1    . C   A 1 11  ? -16.303 25.481  -53.449 1.00 40.51 ? 11  C   C N1    1 
ATOM   229  C  C2    . C   A 1 11  ? -16.316 24.111  -53.727 1.00 39.80 ? 11  C   C C2    1 
ATOM   230  O  O2    . C   A 1 11  ? -15.259 23.471  -53.618 1.00 40.53 ? 11  C   C O2    1 
ATOM   231  N  N3    . C   A 1 11  ? -17.476 23.519  -54.101 1.00 40.82 ? 11  C   C N3    1 
ATOM   232  C  C4    . C   A 1 11  ? -18.595 24.242  -54.187 1.00 39.19 ? 11  C   C C4    1 
ATOM   233  N  N4    . C   A 1 11  ? -19.716 23.619  -54.582 1.00 41.17 ? 11  C   C N4    1 
ATOM   234  C  C5    . C   A 1 11  ? -18.617 25.637  -53.879 1.00 36.30 ? 11  C   C C5    1 
ATOM   235  C  C6    . C   A 1 11  ? -17.458 26.211  -53.518 1.00 35.69 ? 11  C   C C6    1 
ATOM   236  P  P     . G   A 1 12  ? -13.841 28.877  -56.836 1.00 54.33 ? 12  G   C P     1 
ATOM   237  O  OP1   . G   A 1 12  ? -12.589 29.473  -57.360 1.00 59.23 ? 12  G   C OP1   1 
ATOM   238  O  OP2   . G   A 1 12  ? -15.132 29.581  -57.031 1.00 48.58 ? 12  G   C OP2   1 
ATOM   239  O  "O5'" . G   A 1 12  ? -13.979 27.402  -57.425 1.00 54.12 ? 12  G   C "O5'" 1 
ATOM   240  C  "C5'" . G   A 1 12  ? -12.830 26.583  -57.599 1.00 52.39 ? 12  G   C "C5'" 1 
ATOM   241  C  "C4'" . G   A 1 12  ? -13.225 25.190  -58.035 1.00 58.81 ? 12  G   C "C4'" 1 
ATOM   242  O  "O4'" . G   A 1 12  ? -14.111 24.604  -57.041 1.00 57.21 ? 12  G   C "O4'" 1 
ATOM   243  C  "C3'" . G   A 1 12  ? -14.038 25.053  -59.313 1.00 60.34 ? 12  G   C "C3'" 1 
ATOM   244  O  "O3'" . G   A 1 12  ? -13.248 25.147  -60.495 1.00 65.03 ? 12  G   C "O3'" 1 
ATOM   245  C  "C2'" . G   A 1 12  ? -14.580 23.639  -59.152 1.00 56.24 ? 12  G   C "C2'" 1 
ATOM   246  O  "O2'" . G   A 1 12  ? -13.626 22.636  -59.422 1.00 54.22 ? 12  G   C "O2'" 1 
ATOM   247  C  "C1'" . G   A 1 12  ? -14.931 23.625  -57.666 1.00 55.43 ? 12  G   C "C1'" 1 
ATOM   248  N  N9    . G   A 1 12  ? -16.333 23.999  -57.539 1.00 45.03 ? 12  G   C N9    1 
ATOM   249  C  C8    . G   A 1 12  ? -16.868 25.219  -57.196 1.00 49.58 ? 12  G   C C8    1 
ATOM   250  N  N7    . G   A 1 12  ? -18.170 25.254  -57.310 1.00 44.44 ? 12  G   C N7    1 
ATOM   251  C  C5    . G   A 1 12  ? -18.510 23.973  -57.729 1.00 48.03 ? 12  G   C C5    1 
ATOM   252  C  C6    . G   A 1 12  ? -19.775 23.410  -58.057 1.00 46.44 ? 12  G   C C6    1 
ATOM   253  O  O6    . G   A 1 12  ? -20.885 23.954  -58.066 1.00 50.78 ? 12  G   C O6    1 
ATOM   254  N  N1    . G   A 1 12  ? -19.660 22.071  -58.415 1.00 46.82 ? 12  G   C N1    1 
ATOM   255  C  C2    . G   A 1 12  ? -18.487 21.363  -58.462 1.00 49.16 ? 12  G   C C2    1 
ATOM   256  N  N2    . G   A 1 12  ? -18.591 20.066  -58.801 1.00 51.94 ? 12  G   C N2    1 
ATOM   257  N  N3    . G   A 1 12  ? -17.301 21.880  -58.188 1.00 48.92 ? 12  G   C N3    1 
ATOM   258  C  C4    . G   A 1 12  ? -17.389 23.180  -57.833 1.00 44.80 ? 12  G   C C4    1 
ATOM   259  P  P     . C   A 1 13  ? -13.402 26.423  -61.468 1.00 68.51 ? 13  C   C P     1 
ATOM   260  O  OP1   . C   A 1 13  ? -12.362 26.301  -62.521 1.00 69.08 ? 13  C   C OP1   1 
ATOM   261  O  OP2   . C   A 1 13  ? -13.463 27.647  -60.629 1.00 71.86 ? 13  C   C OP2   1 
ATOM   262  O  "O5'" . C   A 1 13  ? -14.812 26.270  -62.187 1.00 58.95 ? 13  C   C "O5'" 1 
ATOM   263  C  "C5'" . C   A 1 13  ? -15.506 25.040  -62.184 1.00 65.70 ? 13  C   C "C5'" 1 
ATOM   264  C  "C4'" . C   A 1 13  ? -15.968 24.695  -63.576 1.00 63.59 ? 13  C   C "C4'" 1 
ATOM   265  O  "O4'" . C   A 1 13  ? -14.822 24.607  -64.462 1.00 67.43 ? 13  C   C "O4'" 1 
ATOM   266  C  "C3'" . C   A 1 13  ? -16.641 23.336  -63.631 1.00 66.77 ? 13  C   C "C3'" 1 
ATOM   267  O  "O3'" . C   A 1 13  ? -18.038 23.511  -63.456 1.00 64.18 ? 13  C   C "O3'" 1 
ATOM   268  C  "C2'" . C   A 1 13  ? -16.287 22.835  -65.020 1.00 63.74 ? 13  C   C "C2'" 1 
ATOM   269  O  "O2'" . C   A 1 13  ? -17.141 23.374  -66.003 1.00 72.48 ? 13  C   C "O2'" 1 
ATOM   270  C  "C1'" . C   A 1 13  ? -14.872 23.395  -65.188 1.00 64.60 ? 13  C   C "C1'" 1 
ATOM   271  N  N1    . C   A 1 13  ? -13.806 22.527  -64.663 1.00 65.78 ? 13  C   C N1    1 
ATOM   272  C  C2    . C   A 1 13  ? -13.658 21.236  -65.179 1.00 67.29 ? 13  C   C C2    1 
ATOM   273  O  O2    . C   A 1 13  ? -14.432 20.851  -66.068 1.00 67.86 ? 13  C   C O2    1 
ATOM   274  N  N3    . C   A 1 13  ? -12.675 20.441  -64.696 1.00 69.26 ? 13  C   C N3    1 
ATOM   275  C  C4    . C   A 1 13  ? -11.861 20.893  -63.737 1.00 69.64 ? 13  C   C C4    1 
ATOM   276  N  N4    . C   A 1 13  ? -10.905 20.074  -63.291 1.00 74.89 ? 13  C   C N4    1 
ATOM   277  C  C5    . C   A 1 13  ? -11.990 22.204  -63.194 1.00 71.12 ? 13  C   C C5    1 
ATOM   278  C  C6    . C   A 1 13  ? -12.967 22.978  -63.681 1.00 68.78 ? 13  C   C C6    1 
ATOM   279  P  P     . A   A 1 14  ? -18.722 23.060  -62.081 1.00 68.16 ? 14  A   C P     1 
ATOM   280  O  OP1   . A   A 1 14  ? -20.124 23.552  -62.077 1.00 71.98 ? 14  A   C OP1   1 
ATOM   281  O  OP2   . A   A 1 14  ? -17.802 23.456  -60.984 1.00 70.83 ? 14  A   C OP2   1 
ATOM   282  O  "O5'" . A   A 1 14  ? -18.739 21.470  -62.181 1.00 73.29 ? 14  A   C "O5'" 1 
ATOM   283  C  "C5'" . A   A 1 14  ? -19.395 20.819  -63.265 1.00 72.29 ? 14  A   C "C5'" 1 
ATOM   284  C  "C4'" . A   A 1 14  ? -18.779 19.466  -63.514 1.00 72.66 ? 14  A   C "C4'" 1 
ATOM   285  O  "O4'" . A   A 1 14  ? -17.375 19.635  -63.828 1.00 74.26 ? 14  A   C "O4'" 1 
ATOM   286  C  "C3'" . A   A 1 14  ? -18.795 18.511  -62.334 1.00 74.73 ? 14  A   C "C3'" 1 
ATOM   287  O  "O3'" . A   A 1 14  ? -20.021 17.791  -62.310 1.00 78.68 ? 14  A   C "O3'" 1 
ATOM   288  C  "C2'" . A   A 1 14  ? -17.626 17.587  -62.648 1.00 78.16 ? 14  A   C "C2'" 1 
ATOM   289  O  "O2'" . A   A 1 14  ? -17.979 16.581  -63.576 1.00 78.83 ? 14  A   C "O2'" 1 
ATOM   290  C  "C1'" . A   A 1 14  ? -16.631 18.556  -63.291 1.00 74.65 ? 14  A   C "C1'" 1 
ATOM   291  N  N9    . A   A 1 14  ? -15.644 19.113  -62.369 1.00 73.55 ? 14  A   C N9    1 
ATOM   292  C  C8    . A   A 1 14  ? -15.706 20.320  -61.718 1.00 72.97 ? 14  A   C C8    1 
ATOM   293  N  N7    . A   A 1 14  ? -14.650 20.583  -60.988 1.00 70.98 ? 14  A   C N7    1 
ATOM   294  C  C5    . A   A 1 14  ? -13.843 19.467  -61.158 1.00 70.85 ? 14  A   C C5    1 
ATOM   295  C  C6    . A   A 1 14  ? -12.575 19.133  -60.650 1.00 67.00 ? 14  A   C C6    1 
ATOM   296  N  N6    . A   A 1 14  ? -11.874 19.927  -59.837 1.00 59.61 ? 14  A   C N6    1 
ATOM   297  N  N1    . A   A 1 14  ? -12.046 17.943  -61.013 1.00 61.66 ? 14  A   C N1    1 
ATOM   298  C  C2    . A   A 1 14  ? -12.754 17.151  -61.830 1.00 63.42 ? 14  A   C C2    1 
ATOM   299  N  N3    . A   A 1 14  ? -13.955 17.355  -62.373 1.00 70.22 ? 14  A   C N3    1 
ATOM   300  C  C4    . A   A 1 14  ? -14.449 18.547  -61.996 1.00 71.45 ? 14  A   C C4    1 
ATOM   301  P  P     . A   A 1 15  ? -20.554 17.172  -60.928 1.00 88.55 ? 15  A   C P     1 
ATOM   302  O  OP1   . A   A 1 15  ? -21.787 16.399  -61.233 1.00 88.15 ? 15  A   C OP1   1 
ATOM   303  O  OP2   . A   A 1 15  ? -20.604 18.259  -59.916 1.00 90.75 ? 15  A   C OP2   1 
ATOM   304  O  "O5'" . A   A 1 15  ? -19.409 16.145  -60.510 1.00 85.76 ? 15  A   C "O5'" 1 
ATOM   305  C  "C5'" . A   A 1 15  ? -19.174 14.963  -61.271 1.00 78.57 ? 15  A   C "C5'" 1 
ATOM   306  C  "C4'" . A   A 1 15  ? -17.937 14.256  -60.769 1.00 76.06 ? 15  A   C "C4'" 1 
ATOM   307  O  "O4'" . A   A 1 15  ? -16.762 15.065  -61.046 1.00 72.89 ? 15  A   C "O4'" 1 
ATOM   308  C  "C3'" . A   A 1 15  ? -17.891 14.022  -59.270 1.00 76.18 ? 15  A   C "C3'" 1 
ATOM   309  O  "O3'" . A   A 1 15  ? -18.583 12.830  -58.926 1.00 81.00 ? 15  A   C "O3'" 1 
ATOM   310  C  "C2'" . A   A 1 15  ? -16.396 13.893  -59.018 1.00 74.51 ? 15  A   C "C2'" 1 
ATOM   311  O  "O2'" . A   A 1 15  ? -15.909 12.613  -59.364 1.00 73.99 ? 15  A   C "O2'" 1 
ATOM   312  C  "C1'" . A   A 1 15  ? -15.836 14.944  -59.979 1.00 70.17 ? 15  A   C "C1'" 1 
ATOM   313  N  N9    . A   A 1 15  ? -15.694 16.261  -59.362 1.00 64.08 ? 15  A   C N9    1 
ATOM   314  C  C8    . A   A 1 15  ? -16.622 17.269  -59.338 1.00 61.29 ? 15  A   C C8    1 
ATOM   315  N  N7    . A   A 1 15  ? -16.219 18.344  -58.708 1.00 59.11 ? 15  A   C N7    1 
ATOM   316  C  C5    . A   A 1 15  ? -14.938 18.023  -58.288 1.00 54.00 ? 15  A   C C5    1 
ATOM   317  C  C6    . A   A 1 15  ? -13.974 18.745  -57.560 1.00 59.73 ? 15  A   C C6    1 
ATOM   318  N  N6    . A   A 1 15  ? -14.164 19.989  -57.116 1.00 55.53 ? 15  A   C N6    1 
ATOM   319  N  N1    . A   A 1 15  ? -12.792 18.137  -57.304 1.00 51.57 ? 15  A   C N1    1 
ATOM   320  C  C2    . A   A 1 15  ? -12.606 16.892  -57.758 1.00 54.17 ? 15  A   C C2    1 
ATOM   321  N  N3    . A   A 1 15  ? -13.438 16.110  -58.453 1.00 58.50 ? 15  A   C N3    1 
ATOM   322  C  C4    . A   A 1 15  ? -14.600 16.744  -58.685 1.00 57.20 ? 15  A   C C4    1 
ATOM   323  P  P     . G   A 1 16  ? -19.600 12.831  -57.682 1.00 86.46 ? 16  G   C P     1 
ATOM   324  O  OP1   . G   A 1 16  ? -19.924 11.410  -57.387 1.00 90.95 ? 16  G   C OP1   1 
ATOM   325  O  OP2   . G   A 1 16  ? -20.698 13.787  -57.978 1.00 88.26 ? 16  G   C OP2   1 
ATOM   326  O  "O5'" . G   A 1 16  ? -18.736 13.405  -56.471 1.00 85.57 ? 16  G   C "O5'" 1 
ATOM   327  C  "C5'" . G   A 1 16  ? -17.567 12.723  -56.025 1.00 77.65 ? 16  G   C "C5'" 1 
ATOM   328  C  "C4'" . G   A 1 16  ? -16.609 13.688  -55.363 1.00 76.11 ? 16  G   C "C4'" 1 
ATOM   329  O  "O4'" . G   A 1 16  ? -16.411 14.828  -56.245 1.00 76.24 ? 16  G   C "O4'" 1 
ATOM   330  C  "C3'" . G   A 1 16  ? -17.053 14.344  -54.063 1.00 71.77 ? 16  G   C "C3'" 1 
ATOM   331  O  "O3'" . G   A 1 16  ? -16.846 13.502  -52.937 1.00 69.41 ? 16  G   C "O3'" 1 
ATOM   332  C  "C2'" . G   A 1 16  ? -16.121 15.544  -54.007 1.00 73.69 ? 16  G   C "C2'" 1 
ATOM   333  O  "O2'" . G   A 1 16  ? -14.804 15.198  -53.623 1.00 72.83 ? 16  G   C "O2'" 1 
ATOM   334  C  "C1'" . G   A 1 16  ? -16.132 15.986  -55.470 1.00 71.67 ? 16  G   C "C1'" 1 
ATOM   335  N  N9    . G   A 1 16  ? -17.186 16.969  -55.688 1.00 67.22 ? 16  G   C N9    1 
ATOM   336  C  C8    . G   A 1 16  ? -18.417 16.771  -56.264 1.00 63.12 ? 16  G   C C8    1 
ATOM   337  N  N7    . G   A 1 16  ? -19.162 17.843  -56.256 1.00 67.57 ? 16  G   C N7    1 
ATOM   338  C  C5    . G   A 1 16  ? -18.369 18.809  -55.648 1.00 62.93 ? 16  G   C C5    1 
ATOM   339  C  C6    . G   A 1 16  ? -18.639 20.173  -55.346 1.00 59.73 ? 16  G   C C6    1 
ATOM   340  O  O6    . G   A 1 16  ? -19.675 20.819  -55.549 1.00 58.70 ? 16  G   C O6    1 
ATOM   341  N  N1    . G   A 1 16  ? -17.549 20.787  -54.740 1.00 51.08 ? 16  G   C N1    1 
ATOM   342  C  C2    . G   A 1 16  ? -16.357 20.170  -54.452 1.00 58.30 ? 16  G   C C2    1 
ATOM   343  N  N2    . G   A 1 16  ? -15.420 20.928  -53.869 1.00 54.28 ? 16  G   C N2    1 
ATOM   344  N  N3    . G   A 1 16  ? -16.099 18.902  -54.717 1.00 58.22 ? 16  G   C N3    1 
ATOM   345  C  C4    . G   A 1 16  ? -17.141 18.287  -55.310 1.00 61.56 ? 16  G   C C4    1 
ATOM   346  P  P     . A   A 1 17  ? -17.648 13.788  -51.570 1.00 69.93 ? 17  A   C P     1 
ATOM   347  O  OP1   . A   A 1 17  ? -17.456 12.602  -50.693 1.00 77.61 ? 17  A   C OP1   1 
ATOM   348  O  OP2   . A   A 1 17  ? -19.021 14.244  -51.904 1.00 67.13 ? 17  A   C OP2   1 
ATOM   349  O  "O5'" . A   A 1 17  ? -16.886 15.016  -50.903 1.00 60.31 ? 17  A   C "O5'" 1 
ATOM   350  C  "C5'" . A   A 1 17  ? -15.486 14.963  -50.662 1.00 47.16 ? 17  A   C "C5'" 1 
ATOM   351  C  "C4'" . A   A 1 17  ? -14.966 16.332  -50.293 1.00 49.21 ? 17  A   C "C4'" 1 
ATOM   352  O  "O4'" . A   A 1 17  ? -15.238 17.267  -51.377 1.00 52.03 ? 17  A   C "O4'" 1 
ATOM   353  C  "C3'" . A   A 1 17  ? -15.625 17.001  -49.101 1.00 45.48 ? 17  A   C "C3'" 1 
ATOM   354  O  "O3'" . A   A 1 17  ? -15.116 16.518  -47.864 1.00 49.27 ? 17  A   C "O3'" 1 
ATOM   355  C  "C2'" . A   A 1 17  ? -15.232 18.450  -49.329 1.00 44.91 ? 17  A   C "C2'" 1 
ATOM   356  O  "O2'" . A   A 1 17  ? -13.872 18.664  -49.011 1.00 53.48 ? 17  A   C "O2'" 1 
ATOM   357  C  "C1'" . A   A 1 17  ? -15.435 18.570  -50.842 1.00 50.05 ? 17  A   C "C1'" 1 
ATOM   358  N  N9    . A   A 1 17  ? -16.789 19.023  -51.177 1.00 45.70 ? 17  A   C N9    1 
ATOM   359  C  C8    . A   A 1 17  ? -17.864 18.277  -51.594 1.00 38.42 ? 17  A   C C8    1 
ATOM   360  N  N7    . A   A 1 17  ? -18.958 18.981  -51.775 1.00 47.96 ? 17  A   C N7    1 
ATOM   361  C  C5    . A   A 1 17  ? -18.577 20.280  -51.463 1.00 45.99 ? 17  A   C C5    1 
ATOM   362  C  C6    . A   A 1 17  ? -19.281 21.508  -51.451 1.00 48.05 ? 17  A   C C6    1 
ATOM   363  N  N6    . A   A 1 17  ? -20.575 21.635  -51.756 1.00 49.19 ? 17  A   C N6    1 
ATOM   364  N  N1    . A   A 1 17  ? -18.597 22.617  -51.104 1.00 46.26 ? 17  A   C N1    1 
ATOM   365  C  C2    . A   A 1 17  ? -17.303 22.500  -50.785 1.00 46.58 ? 17  A   C C2    1 
ATOM   366  N  N3    . A   A 1 17  ? -16.536 21.411  -50.752 1.00 48.09 ? 17  A   C N3    1 
ATOM   367  C  C4    . A   A 1 17  ? -17.241 20.321  -51.105 1.00 45.43 ? 17  A   C C4    1 
ATOM   368  P  P     . G   A 1 18  ? -15.977 16.716  -46.519 1.00 49.55 ? 18  G   C P     1 
ATOM   369  O  OP1   . G   A 1 18  ? -15.310 15.923  -45.457 1.00 56.93 ? 18  G   C OP1   1 
ATOM   370  O  OP2   . G   A 1 18  ? -17.414 16.477  -46.824 1.00 45.04 ? 18  G   C OP2   1 
ATOM   371  O  "O5'" . G   A 1 18  ? -15.809 18.264  -46.174 1.00 46.30 ? 18  G   C "O5'" 1 
ATOM   372  C  "C5'" . G   A 1 18  ? -14.525 18.825  -45.958 1.00 33.87 ? 18  G   C "C5'" 1 
ATOM   373  C  "C4'" . G   A 1 18  ? -14.636 20.307  -45.702 1.00 43.52 ? 18  G   C "C4'" 1 
ATOM   374  O  "O4'" . G   A 1 18  ? -15.107 20.974  -46.901 1.00 43.83 ? 18  G   C "O4'" 1 
ATOM   375  C  "C3'" . G   A 1 18  ? -15.632 20.737  -44.634 1.00 45.64 ? 18  G   C "C3'" 1 
ATOM   376  O  "O3'" . G   A 1 18  ? -15.068 20.621  -43.332 1.00 41.99 ? 18  G   C "O3'" 1 
ATOM   377  C  "C2'" . G   A 1 18  ? -15.869 22.195  -45.012 1.00 42.02 ? 18  G   C "C2'" 1 
ATOM   378  O  "O2'" . G   A 1 18  ? -14.802 23.026  -44.608 1.00 42.00 ? 18  G   C "O2'" 1 
ATOM   379  C  "C1'" . G   A 1 18  ? -15.878 22.112  -46.542 1.00 45.04 ? 18  G   C "C1'" 1 
ATOM   380  N  N9    . G   A 1 18  ? -17.217 21.959  -47.106 1.00 42.09 ? 18  G   C N9    1 
ATOM   381  C  C8    . G   A 1 18  ? -17.770 20.806  -47.609 1.00 39.54 ? 18  G   C C8    1 
ATOM   382  N  N7    . G   A 1 18  ? -19.001 20.962  -48.012 1.00 41.53 ? 18  G   C N7    1 
ATOM   383  C  C5    . G   A 1 18  ? -19.277 22.303  -47.769 1.00 39.30 ? 18  G   C C5    1 
ATOM   384  C  C6    . G   A 1 18  ? -20.461 23.054  -48.000 1.00 42.65 ? 18  G   C C6    1 
ATOM   385  O  O6    . G   A 1 18  ? -21.541 22.667  -48.461 1.00 42.83 ? 18  G   C O6    1 
ATOM   386  N  N1    . G   A 1 18  ? -20.302 24.386  -47.628 1.00 37.84 ? 18  G   C N1    1 
ATOM   387  C  C2    . G   A 1 18  ? -19.156 24.925  -47.100 1.00 42.24 ? 18  G   C C2    1 
ATOM   388  N  N2    . G   A 1 18  ? -19.197 26.236  -46.821 1.00 41.67 ? 18  G   C N2    1 
ATOM   389  N  N3    . G   A 1 18  ? -18.053 24.233  -46.869 1.00 39.98 ? 18  G   C N3    1 
ATOM   390  C  C4    . G   A 1 18  ? -18.184 22.937  -47.225 1.00 32.92 ? 18  G   C C4    1 
ATOM   391  P  P     . U   A 1 19  ? -16.018 20.314  -42.073 1.00 48.50 ? 19  U   C P     1 
ATOM   392  O  OP1   . U   A 1 19  ? -15.146 20.271  -40.867 1.00 36.74 ? 19  U   C OP1   1 
ATOM   393  O  OP2   . U   A 1 19  ? -16.876 19.151  -42.402 1.00 43.54 ? 19  U   C OP2   1 
ATOM   394  O  "O5'" . U   A 1 19  ? -16.939 21.606  -41.955 1.00 38.33 ? 19  U   C "O5'" 1 
ATOM   395  C  "C5'" . U   A 1 19  ? -16.394 22.852  -41.523 1.00 41.15 ? 19  U   C "C5'" 1 
ATOM   396  C  "C4'" . U   A 1 19  ? -17.434 23.936  -41.612 1.00 38.52 ? 19  U   C "C4'" 1 
ATOM   397  O  "O4'" . U   A 1 19  ? -17.833 24.111  -42.999 1.00 40.00 ? 19  U   C "O4'" 1 
ATOM   398  C  "C3'" . U   A 1 19  ? -18.757 23.646  -40.928 1.00 43.17 ? 19  U   C "C3'" 1 
ATOM   399  O  "O3'" . U   A 1 19  ? -18.684 23.847  -39.522 1.00 46.54 ? 19  U   C "O3'" 1 
ATOM   400  C  "C2'" . U   A 1 19  ? -19.662 24.664  -41.606 1.00 37.13 ? 19  U   C "C2'" 1 
ATOM   401  O  "O2'" . U   A 1 19  ? -19.426 25.970  -41.132 1.00 44.18 ? 19  U   C "O2'" 1 
ATOM   402  C  "C1'" . U   A 1 19  ? -19.178 24.570  -43.053 1.00 36.04 ? 19  U   C "C1'" 1 
ATOM   403  N  N1    . U   A 1 19  ? -19.981 23.613  -43.826 1.00 39.47 ? 19  U   C N1    1 
ATOM   404  C  C2    . U   A 1 19  ? -21.201 24.049  -44.318 1.00 34.32 ? 19  U   C C2    1 
ATOM   405  O  O2    . U   A 1 19  ? -21.603 25.182  -44.178 1.00 40.79 ? 19  U   C O2    1 
ATOM   406  N  N3    . U   A 1 19  ? -21.936 23.098  -44.977 1.00 34.92 ? 19  U   C N3    1 
ATOM   407  C  C4    . U   A 1 19  ? -21.585 21.789  -45.194 1.00 35.93 ? 19  U   C C4    1 
ATOM   408  O  O4    . U   A 1 19  ? -22.380 21.039  -45.758 1.00 38.43 ? 19  U   C O4    1 
ATOM   409  C  C5    . U   A 1 19  ? -20.294 21.421  -44.681 1.00 28.27 ? 19  U   C C5    1 
ATOM   410  C  C6    . U   A 1 19  ? -19.557 22.323  -44.036 1.00 37.30 ? 19  U   C C6    1 
ATOM   411  P  P     . G   A 1 20  ? -19.570 22.928  -38.540 1.00 45.53 ? 20  G   C P     1 
ATOM   412  O  OP1   . G   A 1 20  ? -19.013 23.112  -37.176 1.00 47.31 ? 20  G   C OP1   1 
ATOM   413  O  OP2   . G   A 1 20  ? -19.691 21.560  -39.107 1.00 38.21 ? 20  G   C OP2   1 
ATOM   414  O  "O5'" . G   A 1 20  ? -21.009 23.600  -38.597 1.00 41.42 ? 20  G   C "O5'" 1 
ATOM   415  C  "C5'" . G   A 1 20  ? -21.193 24.941  -38.165 1.00 42.27 ? 20  G   C "C5'" 1 
ATOM   416  C  "C4'" . G   A 1 20  ? -22.553 25.439  -38.573 1.00 45.01 ? 20  G   C "C4'" 1 
ATOM   417  O  "O4'" . G   A 1 20  ? -22.616 25.550  -40.023 1.00 47.85 ? 20  G   C "O4'" 1 
ATOM   418  C  "C3'" . G   A 1 20  ? -23.732 24.530  -38.263 1.00 45.22 ? 20  G   C "C3'" 1 
ATOM   419  O  "O3'" . G   A 1 20  ? -24.141 24.591  -36.907 1.00 48.19 ? 20  G   C "O3'" 1 
ATOM   420  C  "C2'" . G   A 1 20  ? -24.784 25.119  -39.184 1.00 44.60 ? 20  G   C "C2'" 1 
ATOM   421  O  "O2'" . G   A 1 20  ? -25.245 26.373  -38.722 1.00 36.48 ? 20  G   C "O2'" 1 
ATOM   422  C  "C1'" . G   A 1 20  ? -23.954 25.332  -40.446 1.00 39.81 ? 20  G   C "C1'" 1 
ATOM   423  N  N9    . G   A 1 20  ? -23.997 24.144  -41.287 1.00 35.40 ? 20  G   C N9    1 
ATOM   424  C  C8    . G   A 1 20  ? -23.019 23.197  -41.466 1.00 35.42 ? 20  G   C C8    1 
ATOM   425  N  N7    . G   A 1 20  ? -23.378 22.239  -42.281 1.00 40.75 ? 20  G   C N7    1 
ATOM   426  C  C5    . G   A 1 20  ? -24.670 22.582  -42.663 1.00 34.02 ? 20  G   C C5    1 
ATOM   427  C  C6    . G   A 1 20  ? -25.578 21.924  -43.524 1.00 39.32 ? 20  G   C C6    1 
ATOM   428  O  O6    . G   A 1 20  ? -25.421 20.868  -44.144 1.00 40.61 ? 20  G   C O6    1 
ATOM   429  N  N1    . G   A 1 20  ? -26.783 22.616  -43.623 1.00 42.37 ? 20  G   C N1    1 
ATOM   430  C  C2    . G   A 1 20  ? -27.081 23.789  -42.970 1.00 42.58 ? 20  G   C C2    1 
ATOM   431  N  N2    . G   A 1 20  ? -28.308 24.303  -43.176 1.00 36.13 ? 20  G   C N2    1 
ATOM   432  N  N3    . G   A 1 20  ? -26.239 24.410  -42.166 1.00 39.31 ? 20  G   C N3    1 
ATOM   433  C  C4    . G   A 1 20  ? -25.063 23.755  -42.059 1.00 38.28 ? 20  G   C C4    1 
ATOM   434  P  P     . G   A 1 21  ? -24.909 23.340  -36.258 1.00 52.32 ? 21  G   C P     1 
ATOM   435  O  OP1   . G   A 1 21  ? -25.021 23.636  -34.810 1.00 56.60 ? 21  G   C OP1   1 
ATOM   436  O  OP2   . G   A 1 21  ? -24.311 22.057  -36.697 1.00 47.03 ? 21  G   C OP2   1 
ATOM   437  O  "O5'" . G   A 1 21  ? -26.347 23.394  -36.929 1.00 48.32 ? 21  G   C "O5'" 1 
ATOM   438  C  "C5'" . G   A 1 21  ? -27.243 24.443  -36.637 1.00 39.18 ? 21  G   C "C5'" 1 
ATOM   439  C  "C4'" . G   A 1 21  ? -28.558 24.192  -37.321 1.00 49.41 ? 21  G   C "C4'" 1 
ATOM   440  O  "O4'" . G   A 1 21  ? -28.376 24.237  -38.766 1.00 45.73 ? 21  G   C "O4'" 1 
ATOM   441  C  "C3'" . G   A 1 21  ? -29.161 22.811  -37.120 1.00 46.95 ? 21  G   C "C3'" 1 
ATOM   442  O  "O3'" . G   A 1 21  ? -29.771 22.646  -35.845 1.00 42.62 ? 21  G   C "O3'" 1 
ATOM   443  C  "C2'" . G   A 1 21  ? -30.176 22.778  -38.255 1.00 44.77 ? 21  G   C "C2'" 1 
ATOM   444  O  "O2'" . G   A 1 21  ? -31.303 23.579  -37.989 1.00 43.33 ? 21  G   C "O2'" 1 
ATOM   445  C  "C1'" . G   A 1 21  ? -29.371 23.423  -39.382 1.00 48.16 ? 21  G   C "C1'" 1 
ATOM   446  N  N9    . G   A 1 21  ? -28.727 22.387  -40.180 1.00 42.13 ? 21  G   C N9    1 
ATOM   447  C  C8    . G   A 1 21  ? -27.415 21.986  -40.152 1.00 37.07 ? 21  G   C C8    1 
ATOM   448  N  N7    . G   A 1 21  ? -27.168 20.992  -40.964 1.00 40.10 ? 21  G   C N7    1 
ATOM   449  C  C5    . G   A 1 21  ? -28.389 20.735  -41.573 1.00 35.28 ? 21  G   C C5    1 
ATOM   450  C  C6    . G   A 1 21  ? -28.747 19.767  -42.544 1.00 39.78 ? 21  G   C C6    1 
ATOM   451  O  O6    . G   A 1 21  ? -28.030 18.918  -43.091 1.00 39.25 ? 21  G   C O6    1 
ATOM   452  N  N1    . G   A 1 21  ? -30.099 19.847  -42.871 1.00 37.01 ? 21  G   C N1    1 
ATOM   453  C  C2    . G   A 1 21  ? -30.990 20.744  -42.338 1.00 42.30 ? 21  G   C C2    1 
ATOM   454  N  N2    . G   A 1 21  ? -32.252 20.661  -42.783 1.00 39.07 ? 21  G   C N2    1 
ATOM   455  N  N3    . G   A 1 21  ? -30.667 21.654  -41.434 1.00 41.01 ? 21  G   C N3    1 
ATOM   456  C  C4    . G   A 1 21  ? -29.359 21.591  -41.102 1.00 43.36 ? 21  G   C C4    1 
ATOM   457  P  P     . C   A 1 22  ? -29.961 21.162  -35.245 1.00 40.40 ? 22  C   C P     1 
ATOM   458  O  OP1   . C   A 1 22  ? -30.561 21.340  -33.896 1.00 42.36 ? 22  C   C OP1   1 
ATOM   459  O  OP2   . C   A 1 22  ? -28.685 20.424  -35.393 1.00 44.72 ? 22  C   C OP2   1 
ATOM   460  O  "O5'" . C   A 1 22  ? -31.041 20.481  -36.202 1.00 42.62 ? 22  C   C "O5'" 1 
ATOM   461  C  "C5'" . C   A 1 22  ? -32.348 21.036  -36.345 1.00 32.12 ? 22  C   C "C5'" 1 
ATOM   462  C  "C4'" . C   A 1 22  ? -33.154 20.242  -37.346 1.00 40.51 ? 22  C   C "C4'" 1 
ATOM   463  O  "O4'" . C   A 1 22  ? -32.559 20.352  -38.668 1.00 40.34 ? 22  C   C "O4'" 1 
ATOM   464  C  "C3'" . C   A 1 22  ? -33.222 18.741  -37.118 1.00 40.28 ? 22  C   C "C3'" 1 
ATOM   465  O  "O3'" . C   A 1 22  ? -34.188 18.399  -36.136 1.00 38.85 ? 22  C   C "O3'" 1 
ATOM   466  C  "C2'" . C   A 1 22  ? -33.616 18.240  -38.502 1.00 38.32 ? 22  C   C "C2'" 1 
ATOM   467  O  "O2'" . C   A 1 22  ? -34.985 18.441  -38.788 1.00 38.10 ? 22  C   C "O2'" 1 
ATOM   468  C  "C1'" . C   A 1 22  ? -32.767 19.147  -39.389 1.00 36.32 ? 22  C   C "C1'" 1 
ATOM   469  N  N1    . C   A 1 22  ? -31.460 18.536  -39.652 1.00 41.57 ? 22  C   C N1    1 
ATOM   470  C  C2    . C   A 1 22  ? -31.380 17.515  -40.596 1.00 41.23 ? 22  C   C C2    1 
ATOM   471  O  O2    . C   A 1 22  ? -32.409 17.185  -41.202 1.00 47.54 ? 22  C   C O2    1 
ATOM   472  N  N3    . C   A 1 22  ? -30.186 16.914  -40.825 1.00 38.94 ? 22  C   C N3    1 
ATOM   473  C  C4    . C   A 1 22  ? -29.102 17.312  -40.155 1.00 36.50 ? 22  C   C C4    1 
ATOM   474  N  N4    . C   A 1 22  ? -27.946 16.694  -40.409 1.00 35.10 ? 22  C   C N4    1 
ATOM   475  C  C5    . C   A 1 22  ? -29.155 18.362  -39.194 1.00 41.99 ? 22  C   C C5    1 
ATOM   476  C  C6    . C   A 1 22  ? -30.343 18.943  -38.976 1.00 42.77 ? 22  C   C C6    1 
ATOM   477  P  P     . C   A 1 23  ? -34.049 17.010  -35.342 1.00 39.19 ? 23  C   C P     1 
ATOM   478  O  OP1   . C   A 1 23  ? -35.053 17.036  -34.245 1.00 39.95 ? 23  C   C OP1   1 
ATOM   479  O  OP2   . C   A 1 23  ? -32.612 16.795  -35.017 1.00 39.09 ? 23  C   C OP2   1 
ATOM   480  O  "O5'" . C   A 1 23  ? -34.454 15.904  -36.413 1.00 42.17 ? 23  C   C "O5'" 1 
ATOM   481  C  "C5'" . C   A 1 23  ? -35.752 15.871  -36.986 1.00 41.50 ? 23  C   C "C5'" 1 
ATOM   482  C  "C4'" . C   A 1 23  ? -35.844 14.747  -37.990 1.00 37.59 ? 23  C   C "C4'" 1 
ATOM   483  O  "O4'" . C   A 1 23  ? -34.966 15.037  -39.110 1.00 38.30 ? 23  C   C "O4'" 1 
ATOM   484  C  "C3'" . C   A 1 23  ? -35.374 13.386  -37.504 1.00 39.36 ? 23  C   C "C3'" 1 
ATOM   485  O  "O3'" . C   A 1 23  ? -36.370 12.700  -36.758 1.00 37.81 ? 23  C   C "O3'" 1 
ATOM   486  C  "C2'" . C   A 1 23  ? -35.053 12.691  -38.819 1.00 42.91 ? 23  C   C "C2'" 1 
ATOM   487  O  "O2'" . C   A 1 23  ? -36.214 12.297  -39.511 1.00 45.43 ? 23  C   C "O2'" 1 
ATOM   488  C  "C1'" . C   A 1 23  ? -34.394 13.829  -39.595 1.00 39.03 ? 23  C   C "C1'" 1 
ATOM   489  N  N1    . C   A 1 23  ? -32.934 13.890  -39.401 1.00 36.45 ? 23  C   C N1    1 
ATOM   490  C  C2    . C   A 1 23  ? -32.119 13.016  -40.134 1.00 43.44 ? 23  C   C C2    1 
ATOM   491  O  O2    . C   A 1 23  ? -32.649 12.210  -40.913 1.00 43.03 ? 23  C   C O2    1 
ATOM   492  N  N3    . C   A 1 23  ? -30.773 13.069  -39.971 1.00 39.58 ? 23  C   C N3    1 
ATOM   493  C  C4    . C   A 1 23  ? -30.239 13.938  -39.111 1.00 42.12 ? 23  C   C C4    1 
ATOM   494  N  N4    . C   A 1 23  ? -28.909 13.935  -38.965 1.00 34.45 ? 23  C   C N4    1 
ATOM   495  C  C5    . C   A 1 23  ? -31.045 14.841  -38.355 1.00 37.80 ? 23  C   C C5    1 
ATOM   496  C  C6    . C   A 1 23  ? -32.377 14.780  -38.528 1.00 37.07 ? 23  C   C C6    1 
ATOM   497  P  P     . U   A 1 24  ? -35.934 11.779  -35.503 1.00 41.00 ? 24  U   C P     1 
ATOM   498  O  OP1   . U   A 1 24  ? -37.181 11.418  -34.787 1.00 40.89 ? 24  U   C OP1   1 
ATOM   499  O  OP2   . U   A 1 24  ? -34.840 12.460  -34.776 1.00 39.42 ? 24  U   C OP2   1 
ATOM   500  O  "O5'" . U   A 1 24  ? -35.324 10.463  -36.159 1.00 37.67 ? 24  U   C "O5'" 1 
ATOM   501  C  "C5'" . U   A 1 24  ? -36.090 9.681   -37.066 1.00 38.01 ? 24  U   C "C5'" 1 
ATOM   502  C  "C4'" . U   A 1 24  ? -35.196 8.730   -37.829 1.00 40.87 ? 24  U   C "C4'" 1 
ATOM   503  O  "O4'" . U   A 1 24  ? -34.236 9.475   -38.624 1.00 39.18 ? 24  U   C "O4'" 1 
ATOM   504  C  "C3'" . U   A 1 24  ? -34.307 7.820   -37.004 1.00 39.32 ? 24  U   C "C3'" 1 
ATOM   505  O  "O3'" . U   A 1 24  ? -35.042 6.719   -36.499 1.00 44.82 ? 24  U   C "O3'" 1 
ATOM   506  C  "C2'" . U   A 1 24  ? -33.287 7.382   -38.047 1.00 41.05 ? 24  U   C "C2'" 1 
ATOM   507  O  "O2'" . U   A 1 24  ? -33.810 6.418   -38.941 1.00 39.31 ? 24  U   C "O2'" 1 
ATOM   508  C  "C1'" . U   A 1 24  ? -33.075 8.689   -38.815 1.00 35.47 ? 24  U   C "C1'" 1 
ATOM   509  N  N1    . U   A 1 24  ? -31.912 9.442   -38.333 1.00 34.70 ? 24  U   C N1    1 
ATOM   510  C  C2    . U   A 1 24  ? -30.662 9.017   -38.749 1.00 42.05 ? 24  U   C C2    1 
ATOM   511  O  O2    . U   A 1 24  ? -30.500 8.023   -39.441 1.00 37.21 ? 24  U   C O2    1 
ATOM   512  N  N3    . U   A 1 24  ? -29.611 9.786   -38.309 1.00 33.45 ? 24  U   C N3    1 
ATOM   513  C  C4    . U   A 1 24  ? -29.684 10.890  -37.491 1.00 35.07 ? 24  U   C C4    1 
ATOM   514  O  O4    . U   A 1 24  ? -28.646 11.443  -37.129 1.00 41.04 ? 24  U   C O4    1 
ATOM   515  C  C5    . U   A 1 24  ? -31.011 11.246  -37.082 1.00 32.25 ? 24  U   C C5    1 
ATOM   516  C  C6    . U   A 1 24  ? -32.052 10.529  -37.509 1.00 30.06 ? 24  U   C C6    1 
ATOM   517  P  P     . U   A 1 25  ? -34.398 5.792   -35.362 1.00 42.78 ? 25  U   C P     1 
ATOM   518  O  OP1   . U   A 1 25  ? -35.414 4.769   -35.009 1.00 48.59 ? 25  U   C OP1   1 
ATOM   519  O  OP2   . U   A 1 25  ? -33.831 6.660   -34.304 1.00 45.51 ? 25  U   C OP2   1 
ATOM   520  O  "O5'" . U   A 1 25  ? -33.190 5.070   -36.098 1.00 46.37 ? 25  U   C "O5'" 1 
ATOM   521  C  "C5'" . U   A 1 25  ? -33.431 4.041   -37.044 1.00 36.90 ? 25  U   C "C5'" 1 
ATOM   522  C  "C4'" . U   A 1 25  ? -32.126 3.433   -37.492 1.00 41.61 ? 25  U   C "C4'" 1 
ATOM   523  O  "O4'" . U   A 1 25  ? -31.330 4.444   -38.168 1.00 43.73 ? 25  U   C "O4'" 1 
ATOM   524  C  "C3'" . U   A 1 25  ? -31.197 2.972   -36.388 1.00 43.31 ? 25  U   C "C3'" 1 
ATOM   525  O  "O3'" . U   A 1 25  ? -31.548 1.721   -35.833 1.00 43.45 ? 25  U   C "O3'" 1 
ATOM   526  C  "C2'" . U   A 1 25  ? -29.867 2.916   -37.114 1.00 44.03 ? 25  U   C "C2'" 1 
ATOM   527  O  "O2'" . U   A 1 25  ? -29.760 1.787   -37.954 1.00 44.48 ? 25  U   C "O2'" 1 
ATOM   528  C  "C1'" . U   A 1 25  ? -29.952 4.194   -37.946 1.00 43.51 ? 25  U   C "C1'" 1 
ATOM   529  N  N1    . U   A 1 25  ? -29.386 5.342   -37.224 1.00 46.23 ? 25  U   C N1    1 
ATOM   530  C  C2    . U   A 1 25  ? -28.018 5.509   -37.274 1.00 38.98 ? 25  U   C C2    1 
ATOM   531  O  O2    . U   A 1 25  ? -27.291 4.756   -37.890 1.00 44.93 ? 25  U   C O2    1 
ATOM   532  N  N3    . U   A 1 25  ? -27.536 6.589   -36.581 1.00 38.58 ? 25  U   C N3    1 
ATOM   533  C  C4    . U   A 1 25  ? -28.271 7.508   -35.866 1.00 46.85 ? 25  U   C C4    1 
ATOM   534  O  O4    . U   A 1 25  ? -27.700 8.475   -35.349 1.00 40.86 ? 25  U   C O4    1 
ATOM   535  C  C5    . U   A 1 25  ? -29.685 7.263   -35.860 1.00 39.42 ? 25  U   C C5    1 
ATOM   536  C  C6    . U   A 1 25  ? -30.180 6.213   -36.523 1.00 39.10 ? 25  U   C C6    1 
ATOM   537  P  P     . U   A 1 26  ? -31.081 1.381   -34.334 1.00 38.62 ? 26  U   C P     1 
ATOM   538  O  OP1   . U   A 1 26  ? -31.741 0.116   -33.941 1.00 34.32 ? 26  U   C OP1   1 
ATOM   539  O  OP2   . U   A 1 26  ? -31.281 2.607   -33.524 1.00 38.05 ? 26  U   C OP2   1 
ATOM   540  O  "O5'" . U   A 1 26  ? -29.514 1.152   -34.468 1.00 30.63 ? 26  U   C "O5'" 1 
ATOM   541  C  "C5'" . U   A 1 26  ? -29.009 0.111   -35.278 1.00 36.04 ? 26  U   C "C5'" 1 
ATOM   542  C  "C4'" . U   A 1 26  ? -27.514 0.174   -35.308 1.00 39.74 ? 26  U   C "C4'" 1 
ATOM   543  O  "O4'" . U   A 1 26  ? -27.103 1.466   -35.832 1.00 36.95 ? 26  U   C "O4'" 1 
ATOM   544  C  "C3'" . U   A 1 26  ? -26.863 0.135   -33.940 1.00 37.24 ? 26  U   C "C3'" 1 
ATOM   545  O  "O3'" . U   A 1 26  ? -26.763 -1.197  -33.470 1.00 37.92 ? 26  U   C "O3'" 1 
ATOM   546  C  "C2'" . U   A 1 26  ? -25.503 0.743   -34.241 1.00 38.97 ? 26  U   C "C2'" 1 
ATOM   547  O  "O2'" . U   A 1 26  ? -24.664 -0.154  -34.932 1.00 39.41 ? 26  U   C "O2'" 1 
ATOM   548  C  "C1'" . U   A 1 26  ? -25.897 1.867   -35.197 1.00 39.38 ? 26  U   C "C1'" 1 
ATOM   549  N  N1    . U   A 1 26  ? -26.133 3.135   -34.496 1.00 39.58 ? 26  U   C N1    1 
ATOM   550  C  C2    . U   A 1 26  ? -25.024 3.833   -34.066 1.00 35.40 ? 26  U   C C2    1 
ATOM   551  O  O2    . U   A 1 26  ? -23.891 3.415   -34.208 1.00 38.73 ? 26  U   C O2    1 
ATOM   552  N  N3    . U   A 1 26  ? -25.295 5.034   -33.457 1.00 44.84 ? 26  U   C N3    1 
ATOM   553  C  C4    . U   A 1 26  ? -26.541 5.584   -33.225 1.00 42.86 ? 26  U   C C4    1 
ATOM   554  O  O4    . U   A 1 26  ? -26.625 6.681   -32.675 1.00 54.69 ? 26  U   C O4    1 
ATOM   555  C  C5    . U   A 1 26  ? -27.639 4.787   -33.677 1.00 43.79 ? 26  U   C C5    1 
ATOM   556  C  C6    . U   A 1 26  ? -27.405 3.618   -34.281 1.00 35.39 ? 26  U   C C6    1 
ATOM   557  P  P     . A   A 1 27  ? -26.741 -1.485  -31.891 1.00 38.39 ? 27  A   C P     1 
ATOM   558  O  OP1   . A   A 1 27  ? -26.837 -2.961  -31.733 1.00 49.03 ? 27  A   C OP1   1 
ATOM   559  O  OP2   . A   A 1 27  ? -27.746 -0.617  -31.234 1.00 33.75 ? 27  A   C OP2   1 
ATOM   560  O  "O5'" . A   A 1 27  ? -25.285 -1.022  -31.435 1.00 38.70 ? 27  A   C "O5'" 1 
ATOM   561  C  "C5'" . A   A 1 27  ? -24.116 -1.641  -31.981 1.00 32.81 ? 27  A   C "C5'" 1 
ATOM   562  C  "C4'" . A   A 1 27  ? -22.879 -0.867  -31.593 1.00 36.64 ? 27  A   C "C4'" 1 
ATOM   563  O  "O4'" . A   A 1 27  ? -22.973 0.478   -32.127 1.00 41.76 ? 27  A   C "O4'" 1 
ATOM   564  C  "C3'" . A   A 1 27  ? -22.672 -0.655  -30.101 1.00 41.26 ? 27  A   C "C3'" 1 
ATOM   565  O  "O3'" . A   A 1 27  ? -22.023 -1.776  -29.517 1.00 45.46 ? 27  A   C "O3'" 1 
ATOM   566  C  "C2'" . A   A 1 27  ? -21.792 0.587   -30.069 1.00 37.93 ? 27  A   C "C2'" 1 
ATOM   567  O  "O2'" . A   A 1 27  ? -20.441 0.303   -30.362 1.00 35.36 ? 27  A   C "O2'" 1 
ATOM   568  C  "C1'" . A   A 1 27  ? -22.375 1.396   -31.226 1.00 37.91 ? 27  A   C "C1'" 1 
ATOM   569  N  N9    . A   A 1 27  ? -23.396 2.356   -30.823 1.00 34.55 ? 27  A   C N9    1 
ATOM   570  C  C8    . A   A 1 27  ? -24.758 2.235   -30.956 1.00 34.80 ? 27  A   C C8    1 
ATOM   571  N  N7    . A   A 1 27  ? -25.423 3.292   -30.554 1.00 35.08 ? 27  A   C N7    1 
ATOM   572  C  C5    . A   A 1 27  ? -24.433 4.160   -30.114 1.00 37.19 ? 27  A   C C5    1 
ATOM   573  C  C6    . A   A 1 27  ? -24.485 5.455   -29.576 1.00 40.66 ? 27  A   C C6    1 
ATOM   574  N  N6    . A   A 1 27  ? -25.618 6.132   -29.394 1.00 29.29 ? 27  A   C N6    1 
ATOM   575  N  N1    . A   A 1 27  ? -23.317 6.039   -29.230 1.00 38.49 ? 27  A   C N1    1 
ATOM   576  C  C2    . A   A 1 27  ? -22.181 5.359   -29.418 1.00 41.33 ? 27  A   C C2    1 
ATOM   577  N  N3    . A   A 1 27  ? -22.002 4.139   -29.921 1.00 41.84 ? 27  A   C N3    1 
ATOM   578  C  C4    . A   A 1 27  ? -23.181 3.588   -30.256 1.00 39.97 ? 27  A   C C4    1 
ATOM   579  P  P     . U   A 1 28  ? -22.446 -2.253  -28.045 1.00 45.96 ? 28  U   C P     1 
ATOM   580  O  OP1   . U   A 1 28  ? -21.798 -3.567  -27.805 1.00 51.52 ? 28  U   C OP1   1 
ATOM   581  O  OP2   . U   A 1 28  ? -23.919 -2.116  -27.911 1.00 46.15 ? 28  U   C OP2   1 
ATOM   582  O  "O5'" . U   A 1 28  ? -21.777 -1.179  -27.086 1.00 44.89 ? 28  U   C "O5'" 1 
ATOM   583  C  "C5'" . U   A 1 28  ? -20.368 -1.103  -26.970 1.00 46.49 ? 28  U   C "C5'" 1 
ATOM   584  C  "C4'" . U   A 1 28  ? -19.981 0.134   -26.209 1.00 51.17 ? 28  U   C "C4'" 1 
ATOM   585  O  "O4'" . U   A 1 28  ? -20.429 1.305   -26.936 1.00 51.96 ? 28  U   C "O4'" 1 
ATOM   586  C  "C3'" . U   A 1 28  ? -20.632 0.305   -24.849 1.00 52.16 ? 28  U   C "C3'" 1 
ATOM   587  O  "O3'" . U   A 1 28  ? -20.082 -0.527  -23.826 1.00 56.21 ? 28  U   C "O3'" 1 
ATOM   588  C  "C2'" . U   A 1 28  ? -20.446 1.794   -24.612 1.00 47.94 ? 28  U   C "C2'" 1 
ATOM   589  O  "O2'" . U   A 1 28  ? -19.129 2.111   -24.215 1.00 50.47 ? 28  U   C "O2'" 1 
ATOM   590  C  "C1'" . U   A 1 28  ? -20.702 2.346   -26.016 1.00 46.10 ? 28  U   C "C1'" 1 
ATOM   591  N  N1    . U   A 1 28  ? -22.089 2.785   -26.207 1.00 41.10 ? 28  U   C N1    1 
ATOM   592  C  C2    . U   A 1 28  ? -22.391 4.075   -25.829 1.00 42.52 ? 28  U   C C2    1 
ATOM   593  O  O2    . U   A 1 28  ? -21.568 4.817   -25.335 1.00 42.06 ? 28  U   C O2    1 
ATOM   594  N  N3    . U   A 1 28  ? -23.690 4.457   -26.045 1.00 36.87 ? 28  U   C N3    1 
ATOM   595  C  C4    . U   A 1 28  ? -24.701 3.688   -26.582 1.00 43.18 ? 28  U   C C4    1 
ATOM   596  O  O4    . U   A 1 28  ? -25.823 4.175   -26.712 1.00 38.00 ? 28  U   C O4    1 
ATOM   597  C  C5    . U   A 1 28  ? -24.314 2.349   -26.938 1.00 36.26 ? 28  U   C C5    1 
ATOM   598  C  C6    . U   A 1 28  ? -23.048 1.955   -26.742 1.00 40.87 ? 28  U   C C6    1 
ATOM   599  O  OP3   . A   B 1 1   ? -21.224 -0.567  -21.531 1.00 81.06 ? 1   A   D OP3   1 
ATOM   600  P  P     . A   B 1 1   ? -19.923 -0.128  -20.879 1.00 81.27 ? 1   A   D P     1 
ATOM   601  O  OP1   . A   B 1 1   ? -19.875 -0.441  -19.393 1.00 83.74 ? 1   A   D OP1   1 
ATOM   602  O  OP2   . A   B 1 1   ? -18.691 -0.610  -21.627 1.00 79.45 ? 1   A   D OP2   1 
ATOM   603  O  "O5'" . A   B 1 1   ? -19.894 1.497   -20.988 1.00 74.19 ? 1   A   D "O5'" 1 
ATOM   604  C  "C5'" . A   B 1 1   ? -18.780 2.250   -20.485 1.00 69.92 ? 1   A   D "C5'" 1 
ATOM   605  C  "C4'" . A   B 1 1   ? -19.267 3.547   -19.892 1.00 70.63 ? 1   A   D "C4'" 1 
ATOM   606  O  "O4'" . A   B 1 1   ? -19.751 4.407   -20.962 1.00 65.02 ? 1   A   D "O4'" 1 
ATOM   607  C  "C3'" . A   B 1 1   ? -20.457 3.421   -18.951 1.00 68.24 ? 1   A   D "C3'" 1 
ATOM   608  O  "O3'" . A   B 1 1   ? -20.053 3.096   -17.623 1.00 68.97 ? 1   A   D "O3'" 1 
ATOM   609  C  "C2'" . A   B 1 1   ? -21.042 4.821   -19.026 1.00 62.18 ? 1   A   D "C2'" 1 
ATOM   610  O  "O2'" . A   B 1 1   ? -20.260 5.733   -18.279 1.00 57.82 ? 1   A   D "O2'" 1 
ATOM   611  C  "C1'" . A   B 1 1   ? -20.893 5.118   -20.519 1.00 60.17 ? 1   A   D "C1'" 1 
ATOM   612  N  N9    . A   B 1 1   ? -22.042 4.672   -21.311 1.00 55.76 ? 1   A   D N9    1 
ATOM   613  C  C8    . A   B 1 1   ? -22.186 3.502   -22.011 1.00 50.52 ? 1   A   D C8    1 
ATOM   614  N  N7    . A   B 1 1   ? -23.347 3.384   -22.612 1.00 46.39 ? 1   A   D N7    1 
ATOM   615  C  C5    . A   B 1 1   ? -24.009 4.558   -22.292 1.00 54.87 ? 1   A   D C5    1 
ATOM   616  C  C6    . A   B 1 1   ? -25.285 5.051   -22.628 1.00 54.02 ? 1   A   D C6    1 
ATOM   617  N  N6    . A   B 1 1   ? -26.160 4.394   -23.393 1.00 51.08 ? 1   A   D N6    1 
ATOM   618  N  N1    . A   B 1 1   ? -25.633 6.264   -22.149 1.00 48.17 ? 1   A   D N1    1 
ATOM   619  C  C2    . A   B 1 1   ? -24.760 6.929   -21.391 1.00 44.26 ? 1   A   D C2    1 
ATOM   620  N  N3    . A   B 1 1   ? -23.534 6.574   -21.007 1.00 57.80 ? 1   A   D N3    1 
ATOM   621  C  C4    . A   B 1 1   ? -23.216 5.364   -21.495 1.00 55.72 ? 1   A   D C4    1 
ATOM   622  P  P     . A   B 1 2   ? -21.044 2.258   -16.668 1.00 72.12 ? 2   A   D P     1 
ATOM   623  O  OP1   . A   B 1 2   ? -20.228 1.829   -15.503 1.00 72.60 ? 2   A   D OP1   1 
ATOM   624  O  OP2   . A   B 1 2   ? -21.749 1.241   -17.482 1.00 70.88 ? 2   A   D OP2   1 
ATOM   625  O  "O5'" . A   B 1 2   ? -22.123 3.324   -16.172 1.00 62.24 ? 2   A   D "O5'" 1 
ATOM   626  C  "C5'" . A   B 1 2   ? -21.739 4.382   -15.301 1.00 45.19 ? 2   A   D "C5'" 1 
ATOM   627  C  "C4'" . A   B 1 2   ? -22.733 5.523   -15.363 1.00 41.91 ? 2   A   D "C4'" 1 
ATOM   628  O  "O4'" . A   B 1 2   ? -22.907 5.948   -16.744 1.00 41.85 ? 2   A   D "O4'" 1 
ATOM   629  C  "C3'" . A   B 1 2   ? -24.159 5.266   -14.906 1.00 38.84 ? 2   A   D "C3'" 1 
ATOM   630  O  "O3'" . A   B 1 2   ? -24.273 5.301   -13.488 1.00 40.59 ? 2   A   D "O3'" 1 
ATOM   631  C  "C2'" . A   B 1 2   ? -24.870 6.456   -15.534 1.00 37.51 ? 2   A   D "C2'" 1 
ATOM   632  O  "O2'" . A   B 1 2   ? -24.558 7.655   -14.865 1.00 37.66 ? 2   A   D "O2'" 1 
ATOM   633  C  "C1'" . A   B 1 2   ? -24.205 6.502   -16.908 1.00 38.18 ? 2   A   D "C1'" 1 
ATOM   634  N  N9    . A   B 1 2   ? -24.944 5.681   -17.865 1.00 40.92 ? 2   A   D N9    1 
ATOM   635  C  C8    . A   B 1 2   ? -24.605 4.449   -18.368 1.00 37.66 ? 2   A   D C8    1 
ATOM   636  N  N7    . A   B 1 2   ? -25.508 3.942   -19.171 1.00 41.39 ? 2   A   D N7    1 
ATOM   637  C  C5    . A   B 1 2   ? -26.501 4.910   -19.210 1.00 41.51 ? 2   A   D C5    1 
ATOM   638  C  C6    . A   B 1 2   ? -27.733 4.974   -19.883 1.00 35.68 ? 2   A   D C6    1 
ATOM   639  N  N6    . A   B 1 2   ? -28.186 4.009   -20.679 1.00 39.16 ? 2   A   D N6    1 
ATOM   640  N  N1    . A   B 1 2   ? -28.489 6.077   -19.708 1.00 40.13 ? 2   A   D N1    1 
ATOM   641  C  C2    . A   B 1 2   ? -28.030 7.048   -18.912 1.00 31.13 ? 2   A   D C2    1 
ATOM   642  N  N3    . A   B 1 2   ? -26.889 7.105   -18.229 1.00 39.74 ? 2   A   D N3    1 
ATOM   643  C  C4    . A   B 1 2   ? -26.163 5.991   -18.421 1.00 39.78 ? 2   A   D C4    1 
ATOM   644  P  P     . A   B 1 3   ? -25.404 4.420   -12.759 1.00 40.46 ? 3   A   D P     1 
ATOM   645  O  OP1   . A   B 1 3   ? -25.097 4.385   -11.306 1.00 38.99 ? 3   A   D OP1   1 
ATOM   646  O  OP2   . A   B 1 3   ? -25.526 3.148   -13.510 1.00 46.10 ? 3   A   D OP2   1 
ATOM   647  O  "O5'" . A   B 1 3   ? -26.743 5.250   -12.975 1.00 39.60 ? 3   A   D "O5'" 1 
ATOM   648  C  "C5'" . A   B 1 3   ? -26.829 6.603   -12.552 1.00 42.92 ? 3   A   D "C5'" 1 
ATOM   649  C  "C4'" . A   B 1 3   ? -28.164 7.192   -12.944 1.00 40.93 ? 3   A   D "C4'" 1 
ATOM   650  O  "O4'" . A   B 1 3   ? -28.222 7.387   -14.386 1.00 42.72 ? 3   A   D "O4'" 1 
ATOM   651  C  "C3'" . A   B 1 3   ? -29.385 6.337   -12.640 1.00 39.73 ? 3   A   D "C3'" 1 
ATOM   652  O  "O3'" . A   B 1 3   ? -29.779 6.452   -11.279 1.00 32.76 ? 3   A   D "O3'" 1 
ATOM   653  C  "C2'" . A   B 1 3   ? -30.400 6.955   -13.589 1.00 37.28 ? 3   A   D "C2'" 1 
ATOM   654  O  "O2'" . A   B 1 3   ? -30.779 8.243   -13.141 1.00 43.17 ? 3   A   D "O2'" 1 
ATOM   655  C  "C1'" . A   B 1 3   ? -29.544 7.127   -14.847 1.00 42.08 ? 3   A   D "C1'" 1 
ATOM   656  N  N9    . A   B 1 3   ? -29.510 5.923   -15.687 1.00 40.28 ? 3   A   D N9    1 
ATOM   657  C  C8    . A   B 1 3   ? -28.507 4.989   -15.759 1.00 36.27 ? 3   A   D C8    1 
ATOM   658  N  N7    . A   B 1 3   ? -28.742 4.023   -16.610 1.00 42.31 ? 3   A   D N7    1 
ATOM   659  C  C5    . A   B 1 3   ? -29.990 4.332   -17.130 1.00 35.40 ? 3   A   D C5    1 
ATOM   660  C  C6    . A   B 1 3   ? -30.806 3.684   -18.077 1.00 40.11 ? 3   A   D C6    1 
ATOM   661  N  N6    . A   B 1 3   ? -30.472 2.540   -18.686 1.00 37.63 ? 3   A   D N6    1 
ATOM   662  N  N1    . A   B 1 3   ? -31.996 4.254   -18.375 1.00 36.76 ? 3   A   D N1    1 
ATOM   663  C  C2    . A   B 1 3   ? -32.338 5.385   -17.748 1.00 37.61 ? 3   A   D C2    1 
ATOM   664  N  N3    . A   B 1 3   ? -31.662 6.082   -16.832 1.00 35.86 ? 3   A   D N3    1 
ATOM   665  C  C4    . A   B 1 3   ? -30.479 5.497   -16.568 1.00 38.80 ? 3   A   D C4    1 
ATOM   666  P  P     . G   B 1 4   ? -30.446 5.195   -10.534 1.00 41.01 ? 4   G   D P     1 
ATOM   667  O  OP1   . G   B 1 4   ? -30.458 5.498   -9.081  1.00 47.53 ? 4   G   D OP1   1 
ATOM   668  O  OP2   . G   B 1 4   ? -29.818 3.943   -11.011 1.00 42.37 ? 4   G   D OP2   1 
ATOM   669  O  "O5'" . G   B 1 4   ? -31.955 5.208   -11.039 1.00 41.52 ? 4   G   D "O5'" 1 
ATOM   670  C  "C5'" . G   B 1 4   ? -32.811 6.296   -10.723 1.00 44.59 ? 4   G   D "C5'" 1 
ATOM   671  C  "C4'" . G   B 1 4   ? -34.097 6.190   -11.501 1.00 42.38 ? 4   G   D "C4'" 1 
ATOM   672  O  "O4'" . G   B 1 4   ? -33.806 6.294   -12.924 1.00 38.56 ? 4   G   D "O4'" 1 
ATOM   673  C  "C3'" . G   B 1 4   ? -34.828 4.861   -11.393 1.00 36.81 ? 4   G   D "C3'" 1 
ATOM   674  O  "O3'" . G   B 1 4   ? -35.588 4.737   -10.194 1.00 38.22 ? 4   G   D "O3'" 1 
ATOM   675  C  "C2'" . G   B 1 4   ? -35.711 4.919   -12.630 1.00 41.11 ? 4   G   D "C2'" 1 
ATOM   676  O  "O2'" . G   B 1 4   ? -36.805 5.805   -12.481 1.00 37.76 ? 4   G   D "O2'" 1 
ATOM   677  C  "C1'" . G   B 1 4   ? -34.726 5.491   -13.649 1.00 38.79 ? 4   G   D "C1'" 1 
ATOM   678  N  N9    . G   B 1 4   ? -33.998 4.415   -14.311 1.00 37.42 ? 4   G   D N9    1 
ATOM   679  C  C8    . G   B 1 4   ? -32.726 3.963   -14.047 1.00 30.82 ? 4   G   D C8    1 
ATOM   680  N  N7    . G   B 1 4   ? -32.373 2.960   -14.807 1.00 33.08 ? 4   G   D N7    1 
ATOM   681  C  C5    . G   B 1 4   ? -33.478 2.743   -15.624 1.00 41.10 ? 4   G   D C5    1 
ATOM   682  C  C6    . G   B 1 4   ? -33.692 1.792   -16.661 1.00 41.59 ? 4   G   D C6    1 
ATOM   683  O  O6    . G   B 1 4   ? -32.918 0.932   -17.092 1.00 34.71 ? 4   G   D O6    1 
ATOM   684  N  N1    . G   B 1 4   ? -34.959 1.923   -17.221 1.00 35.38 ? 4   G   D N1    1 
ATOM   685  C  C2    . G   B 1 4   ? -35.891 2.859   -16.856 1.00 38.98 ? 4   G   D C2    1 
ATOM   686  N  N2    . G   B 1 4   ? -37.047 2.840   -17.533 1.00 34.98 ? 4   G   D N2    1 
ATOM   687  N  N3    . G   B 1 4   ? -35.703 3.753   -15.900 1.00 40.71 ? 4   G   D N3    1 
ATOM   688  C  C4    . G   B 1 4   ? -34.485 3.636   -15.331 1.00 38.54 ? 4   G   D C4    1 
ATOM   689  P  P     . G   B 1 5   ? -35.903 3.268   -9.597  1.00 39.47 ? 5   G   D P     1 
ATOM   690  O  OP1   . G   B 1 5   ? -36.482 3.468   -8.250  1.00 39.52 ? 5   G   D OP1   1 
ATOM   691  O  OP2   . G   B 1 5   ? -34.700 2.407   -9.752  1.00 39.91 ? 5   G   D OP2   1 
ATOM   692  O  "O5'" . G   B 1 5   ? -37.039 2.694   -10.562 1.00 36.70 ? 5   G   D "O5'" 1 
ATOM   693  C  "C5'" . G   B 1 5   ? -38.309 3.327   -10.643 1.00 37.04 ? 5   G   D "C5'" 1 
ATOM   694  C  "C4'" . G   B 1 5   ? -39.160 2.674   -11.704 1.00 41.82 ? 5   G   D "C4'" 1 
ATOM   695  O  "O4'" . G   B 1 5   ? -38.546 2.851   -13.012 1.00 41.32 ? 5   G   D "O4'" 1 
ATOM   696  C  "C3'" . G   B 1 5   ? -39.343 1.169   -11.601 1.00 39.62 ? 5   G   D "C3'" 1 
ATOM   697  O  "O3'" . G   B 1 5   ? -40.346 0.827   -10.654 1.00 42.46 ? 5   G   D "O3'" 1 
ATOM   698  C  "C2'" . G   B 1 5   ? -39.765 0.827   -13.026 1.00 42.40 ? 5   G   D "C2'" 1 
ATOM   699  O  "O2'" . G   B 1 5   ? -41.090 1.230   -13.311 1.00 41.28 ? 5   G   D "O2'" 1 
ATOM   700  C  "C1'" . G   B 1 5   ? -38.814 1.714   -13.824 1.00 36.27 ? 5   G   D "C1'" 1 
ATOM   701  N  N9    . G   B 1 5   ? -37.553 1.031   -14.088 1.00 39.34 ? 5   G   D N9    1 
ATOM   702  C  C8    . G   B 1 5   ? -36.350 1.233   -13.454 1.00 40.42 ? 5   G   D C8    1 
ATOM   703  N  N7    . G   B 1 5   ? -35.401 0.459   -13.903 1.00 36.04 ? 5   G   D N7    1 
ATOM   704  C  C5    . G   B 1 5   ? -36.011 -0.299  -14.891 1.00 37.95 ? 5   G   D C5    1 
ATOM   705  C  C6    . G   B 1 5   ? -35.481 -1.317  -15.729 1.00 41.94 ? 5   G   D C6    1 
ATOM   706  O  O6    . G   B 1 5   ? -34.319 -1.754  -15.778 1.00 35.41 ? 5   G   D O6    1 
ATOM   707  N  N1    . G   B 1 5   ? -36.457 -1.835  -16.579 1.00 35.50 ? 5   G   D N1    1 
ATOM   708  C  C2    . G   B 1 5   ? -37.767 -1.419  -16.623 1.00 38.32 ? 5   G   D C2    1 
ATOM   709  N  N2    . G   B 1 5   ? -38.564 -2.041  -17.501 1.00 37.39 ? 5   G   D N2    1 
ATOM   710  N  N3    . G   B 1 5   ? -38.263 -0.466  -15.859 1.00 44.09 ? 5   G   D N3    1 
ATOM   711  C  C4    . G   B 1 5   ? -37.339 0.043   -15.020 1.00 36.29 ? 5   G   D C4    1 
ATOM   712  P  P     . U   B 1 6   ? -40.269 -0.586  -9.885  1.00 42.74 ? 6   U   D P     1 
ATOM   713  O  OP1   . U   B 1 6   ? -41.409 -0.602  -8.935  1.00 48.11 ? 6   U   D OP1   1 
ATOM   714  O  OP2   . U   B 1 6   ? -38.884 -0.801  -9.382  1.00 49.67 ? 6   U   D OP2   1 
ATOM   715  O  "O5'" . U   B 1 6   ? -40.543 -1.670  -11.018 1.00 44.02 ? 6   U   D "O5'" 1 
ATOM   716  C  "C5'" . U   B 1 6   ? -41.746 -1.653  -11.777 1.00 36.06 ? 6   U   D "C5'" 1 
ATOM   717  C  "C4'" . U   B 1 6   ? -41.666 -2.682  -12.872 1.00 45.43 ? 6   U   D "C4'" 1 
ATOM   718  O  "O4'" . U   B 1 6   ? -40.609 -2.303  -13.790 1.00 43.28 ? 6   U   D "O4'" 1 
ATOM   719  C  "C3'" . U   B 1 6   ? -41.264 -4.067  -12.392 1.00 49.11 ? 6   U   D "C3'" 1 
ATOM   720  O  "O3'" . U   B 1 6   ? -42.387 -4.802  -11.923 1.00 45.22 ? 6   U   D "O3'" 1 
ATOM   721  C  "C2'" . U   B 1 6   ? -40.634 -4.675  -13.636 1.00 47.95 ? 6   U   D "C2'" 1 
ATOM   722  O  "O2'" . U   B 1 6   ? -41.578 -5.170  -14.561 1.00 57.26 ? 6   U   D "O2'" 1 
ATOM   723  C  "C1'" . U   B 1 6   ? -39.914 -3.462  -14.225 1.00 49.71 ? 6   U   D "C1'" 1 
ATOM   724  N  N1    . U   B 1 6   ? -38.519 -3.365  -13.773 1.00 42.05 ? 6   U   D N1    1 
ATOM   725  C  C2    . U   B 1 6   ? -37.587 -4.151  -14.420 1.00 39.07 ? 6   U   D C2    1 
ATOM   726  O  O2    . U   B 1 6   ? -37.877 -4.896  -15.338 1.00 41.19 ? 6   U   D O2    1 
ATOM   727  N  N3    . U   B 1 6   ? -36.300 -4.032  -13.951 1.00 43.50 ? 6   U   D N3    1 
ATOM   728  C  C4    . U   B 1 6   ? -35.866 -3.221  -12.924 1.00 43.69 ? 6   U   D C4    1 
ATOM   729  O  O4    . U   B 1 6   ? -34.670 -3.203  -12.636 1.00 46.19 ? 6   U   D O4    1 
ATOM   730  C  C5    . U   B 1 6   ? -36.892 -2.438  -12.304 1.00 39.16 ? 6   U   D C5    1 
ATOM   731  C  C6    . U   B 1 6   ? -38.152 -2.531  -12.742 1.00 37.55 ? 6   U   D C6    1 
ATOM   732  P  P     . C   B 1 7   ? -42.179 -5.964  -10.833 1.00 48.62 ? 7   C   D P     1 
ATOM   733  O  OP1   . C   B 1 7   ? -43.531 -6.309  -10.338 1.00 62.92 ? 7   C   D OP1   1 
ATOM   734  O  OP2   . C   B 1 7   ? -41.120 -5.583  -9.863  1.00 47.46 ? 7   C   D OP2   1 
ATOM   735  O  "O5'" . C   B 1 7   ? -41.637 -7.198  -11.681 1.00 52.90 ? 7   C   D "O5'" 1 
ATOM   736  C  "C5'" . C   B 1 7   ? -42.496 -7.890  -12.577 1.00 49.33 ? 7   C   D "C5'" 1 
ATOM   737  C  "C4'" . C   B 1 7   ? -41.746 -8.994  -13.270 1.00 51.78 ? 7   C   D "C4'" 1 
ATOM   738  O  "O4'" . C   B 1 7   ? -40.714 -8.420  -14.116 1.00 51.63 ? 7   C   D "O4'" 1 
ATOM   739  C  "C3'" . C   B 1 7   ? -40.977 -9.944  -12.370 1.00 48.51 ? 7   C   D "C3'" 1 
ATOM   740  O  "O3'" . C   B 1 7   ? -41.825 -10.934 -11.804 1.00 48.94 ? 7   C   D "O3'" 1 
ATOM   741  C  "C2'" . C   B 1 7   ? -39.975 -10.535 -13.353 1.00 52.45 ? 7   C   D "C2'" 1 
ATOM   742  O  "O2'" . C   B 1 7   ? -40.554 -11.494 -14.219 1.00 49.97 ? 7   C   D "O2'" 1 
ATOM   743  C  "C1'" . C   B 1 7   ? -39.594 -9.291  -14.159 1.00 49.79 ? 7   C   D "C1'" 1 
ATOM   744  N  N1    . C   B 1 7   ? -38.437 -8.589  -13.581 1.00 45.30 ? 7   C   D N1    1 
ATOM   745  C  C2    . C   B 1 7   ? -37.160 -8.994  -13.954 1.00 39.87 ? 7   C   D C2    1 
ATOM   746  O  O2    . C   B 1 7   ? -37.043 -9.930  -14.757 1.00 49.55 ? 7   C   D O2    1 
ATOM   747  N  N3    . C   B 1 7   ? -36.084 -8.360  -13.433 1.00 44.03 ? 7   C   D N3    1 
ATOM   748  C  C4    . C   B 1 7   ? -36.254 -7.356  -12.572 1.00 41.64 ? 7   C   D C4    1 
ATOM   749  N  N4    . C   B 1 7   ? -35.163 -6.747  -12.097 1.00 40.84 ? 7   C   D N4    1 
ATOM   750  C  C5    . C   B 1 7   ? -37.549 -6.926  -12.166 1.00 42.33 ? 7   C   D C5    1 
ATOM   751  C  C6    . C   B 1 7   ? -38.604 -7.562  -12.693 1.00 45.21 ? 7   C   D C6    1 
ATOM   752  P  P     . A   B 1 8   ? -41.396 -11.668 -10.438 1.00 45.03 ? 8   A   D P     1 
ATOM   753  O  OP1   . A   B 1 8   ? -42.498 -12.586 -10.062 1.00 63.03 ? 8   A   D OP1   1 
ATOM   754  O  OP2   . A   B 1 8   ? -40.936 -10.652 -9.467  1.00 53.98 ? 8   A   D OP2   1 
ATOM   755  O  "O5'" . A   B 1 8   ? -40.157 -12.566 -10.869 1.00 47.26 ? 8   A   D "O5'" 1 
ATOM   756  C  "C5'" . A   B 1 8   ? -40.320 -13.636 -11.793 1.00 41.84 ? 8   A   D "C5'" 1 
ATOM   757  C  "C4'" . A   B 1 8   ? -38.977 -14.217 -12.143 1.00 50.41 ? 8   A   D "C4'" 1 
ATOM   758  O  "O4'" . A   B 1 8   ? -38.178 -13.194 -12.795 1.00 49.49 ? 8   A   D "O4'" 1 
ATOM   759  C  "C3'" . A   B 1 8   ? -38.130 -14.639 -10.953 1.00 47.44 ? 8   A   D "C3'" 1 
ATOM   760  O  "O3'" . A   B 1 8   ? -38.481 -15.948 -10.518 1.00 54.62 ? 8   A   D "O3'" 1 
ATOM   761  C  "C2'" . A   B 1 8   ? -36.720 -14.589 -11.530 1.00 49.84 ? 8   A   D "C2'" 1 
ATOM   762  O  "O2'" . A   B 1 8   ? -36.368 -15.739 -12.271 1.00 60.65 ? 8   A   D "O2'" 1 
ATOM   763  C  "C1'" . A   B 1 8   ? -36.811 -13.377 -12.461 1.00 50.29 ? 8   A   D "C1'" 1 
ATOM   764  N  N9    . A   B 1 8   ? -36.322 -12.159 -11.821 1.00 41.13 ? 8   A   D N9    1 
ATOM   765  C  C8    . A   B 1 8   ? -37.042 -11.137 -11.258 1.00 35.69 ? 8   A   D C8    1 
ATOM   766  N  N7    . A   B 1 8   ? -36.297 -10.186 -10.747 1.00 43.29 ? 8   A   D N7    1 
ATOM   767  C  C5    . A   B 1 8   ? -34.997 -10.608 -11.001 1.00 41.38 ? 8   A   D C5    1 
ATOM   768  C  C6    . A   B 1 8   ? -33.737 -10.041 -10.716 1.00 35.46 ? 8   A   D C6    1 
ATOM   769  N  N6    . A   B 1 8   ? -33.569 -8.857  -10.117 1.00 29.59 ? 8   A   D N6    1 
ATOM   770  N  N1    . A   B 1 8   ? -32.638 -10.737 -11.082 1.00 40.06 ? 8   A   D N1    1 
ATOM   771  C  C2    . A   B 1 8   ? -32.802 -11.911 -11.709 1.00 44.31 ? 8   A   D C2    1 
ATOM   772  N  N3    . A   B 1 8   ? -33.928 -12.535 -12.048 1.00 38.54 ? 8   A   D N3    1 
ATOM   773  C  C4    . A   B 1 8   ? -35.000 -11.824 -11.658 1.00 39.85 ? 8   A   D C4    1 
ATOM   774  P  P     . U   B 1 9   ? -38.335 -16.345 -8.965  1.00 60.39 ? 9   U   D P     1 
ATOM   775  O  OP1   . U   B 1 9   ? -38.875 -17.724 -8.823  1.00 64.55 ? 9   U   D OP1   1 
ATOM   776  O  OP2   . U   B 1 9   ? -38.882 -15.254 -8.125  1.00 50.44 ? 9   U   D OP2   1 
ATOM   777  O  "O5'" . U   B 1 9   ? -36.762 -16.419 -8.730  1.00 51.12 ? 9   U   D "O5'" 1 
ATOM   778  C  "C5'" . U   B 1 9   ? -35.974 -17.360 -9.444  1.00 44.79 ? 9   U   D "C5'" 1 
ATOM   779  C  "C4'" . U   B 1 9   ? -34.510 -17.036 -9.297  1.00 49.43 ? 9   U   D "C4'" 1 
ATOM   780  O  "O4'" . U   B 1 9   ? -34.228 -15.758 -9.923  1.00 52.80 ? 9   U   D "O4'" 1 
ATOM   781  C  "C3'" . U   B 1 9   ? -34.019 -16.847 -7.874  1.00 51.99 ? 9   U   D "C3'" 1 
ATOM   782  O  "O3'" . U   B 1 9   ? -33.775 -18.099 -7.249  1.00 50.80 ? 9   U   D "O3'" 1 
ATOM   783  C  "C2'" . U   B 1 9   ? -32.742 -16.049 -8.096  1.00 48.63 ? 9   U   D "C2'" 1 
ATOM   784  O  "O2'" . U   B 1 9   ? -31.659 -16.843 -8.544  1.00 46.85 ? 9   U   D "O2'" 1 
ATOM   785  C  "C1'" . U   B 1 9   ? -33.173 -15.115 -9.227  1.00 48.69 ? 9   U   D "C1'" 1 
ATOM   786  N  N1    . U   B 1 9   ? -33.665 -13.826 -8.731  1.00 45.30 ? 9   U   D N1    1 
ATOM   787  C  C2    . U   B 1 9   ? -32.727 -12.896 -8.326  1.00 45.03 ? 9   U   D C2    1 
ATOM   788  O  O2    . U   B 1 9   ? -31.522 -13.107 -8.365  1.00 43.77 ? 9   U   D O2    1 
ATOM   789  N  N3    . U   B 1 9   ? -33.251 -11.712 -7.872  1.00 41.76 ? 9   U   D N3    1 
ATOM   790  C  C4    . U   B 1 9   ? -34.587 -11.374 -7.783  1.00 38.44 ? 9   U   D C4    1 
ATOM   791  O  O4    . U   B 1 9   ? -34.905 -10.270 -7.346  1.00 41.11 ? 9   U   D O4    1 
ATOM   792  C  C5    . U   B 1 9   ? -35.490 -12.392 -8.218  1.00 46.37 ? 9   U   D C5    1 
ATOM   793  C  C6    . U   B 1 9   ? -35.010 -13.555 -8.666  1.00 44.45 ? 9   U   D C6    1 
ATOM   794  P  P     . U   B 1 10  ? -33.827 -18.211 -5.649  1.00 54.69 ? 10  U   D P     1 
ATOM   795  O  OP1   . U   B 1 10  ? -33.869 -19.660 -5.323  1.00 56.97 ? 10  U   D OP1   1 
ATOM   796  O  OP2   . U   B 1 10  ? -34.887 -17.310 -5.130  1.00 53.33 ? 10  U   D OP2   1 
ATOM   797  O  "O5'" . U   B 1 10  ? -32.421 -17.628 -5.187  1.00 45.61 ? 10  U   D "O5'" 1 
ATOM   798  C  "C5'" . U   B 1 10  ? -31.206 -18.259 -5.579  1.00 44.81 ? 10  U   D "C5'" 1 
ATOM   799  C  "C4'" . U   B 1 10  ? -30.028 -17.422 -5.144  1.00 52.16 ? 10  U   D "C4'" 1 
ATOM   800  O  "O4'" . U   B 1 10  ? -30.007 -16.173 -5.891  1.00 52.31 ? 10  U   D "O4'" 1 
ATOM   801  C  "C3'" . U   B 1 10  ? -30.070 -16.957 -3.700  1.00 53.54 ? 10  U   D "C3'" 1 
ATOM   802  O  "O3'" . U   B 1 10  ? -29.626 -17.961 -2.803  1.00 53.42 ? 10  U   D "O3'" 1 
ATOM   803  C  "C2'" . U   B 1 10  ? -29.125 -15.766 -3.730  1.00 52.89 ? 10  U   D "C2'" 1 
ATOM   804  O  "O2'" . U   B 1 10  ? -27.770 -16.162 -3.774  1.00 54.82 ? 10  U   D "O2'" 1 
ATOM   805  C  "C1'" . U   B 1 10  ? -29.500 -15.134 -5.067  1.00 50.30 ? 10  U   D "C1'" 1 
ATOM   806  N  N1    . U   B 1 10  ? -30.529 -14.092 -4.938  1.00 50.81 ? 10  U   D N1    1 
ATOM   807  C  C2    . U   B 1 10  ? -30.092 -12.798 -4.716  1.00 47.08 ? 10  U   D C2    1 
ATOM   808  O  O2    . U   B 1 10  ? -28.914 -12.514 -4.576  1.00 47.55 ? 10  U   D O2    1 
ATOM   809  N  N3    . U   B 1 10  ? -31.085 -11.853 -4.652  1.00 41.63 ? 10  U   D N3    1 
ATOM   810  C  C4    . U   B 1 10  ? -32.442 -12.066 -4.763  1.00 48.14 ? 10  U   D C4    1 
ATOM   811  O  O4    . U   B 1 10  ? -33.210 -11.108 -4.678  1.00 43.40 ? 10  U   D O4    1 
ATOM   812  C  C5    . U   B 1 10  ? -32.819 -13.436 -4.965  1.00 49.64 ? 10  U   D C5    1 
ATOM   813  C  C6    . U   B 1 10  ? -31.871 -14.380 -5.045  1.00 46.22 ? 10  U   D C6    1 
ATOM   814  P  P     . C   B 1 11  ? -30.125 -17.924 -1.280  1.00 54.28 ? 11  C   D P     1 
ATOM   815  O  OP1   . C   B 1 11  ? -29.544 -19.104 -0.588  1.00 53.78 ? 11  C   D OP1   1 
ATOM   816  O  OP2   . C   B 1 11  ? -31.595 -17.720 -1.284  1.00 51.87 ? 11  C   D OP2   1 
ATOM   817  O  "O5'" . C   B 1 11  ? -29.447 -16.613 -0.687  1.00 47.88 ? 11  C   D "O5'" 1 
ATOM   818  C  "C5'" . C   B 1 11  ? -28.045 -16.569 -0.467  1.00 48.56 ? 11  C   D "C5'" 1 
ATOM   819  C  "C4'" . C   B 1 11  ? -27.646 -15.246 0.139   1.00 47.93 ? 11  C   D "C4'" 1 
ATOM   820  O  "O4'" . C   B 1 11  ? -27.879 -14.179 -0.816  1.00 46.91 ? 11  C   D "O4'" 1 
ATOM   821  C  "C3'" . C   B 1 11  ? -28.438 -14.784 1.345   1.00 47.60 ? 11  C   D "C3'" 1 
ATOM   822  O  "O3'" . C   B 1 11  ? -28.058 -15.441 2.548   1.00 43.20 ? 11  C   D "O3'" 1 
ATOM   823  C  "C2'" . C   B 1 11  ? -28.098 -13.301 1.378   1.00 44.97 ? 11  C   D "C2'" 1 
ATOM   824  O  "O2'" . C   B 1 11  ? -26.823 -13.043 1.932   1.00 52.65 ? 11  C   D "O2'" 1 
ATOM   825  C  "C1'" . C   B 1 11  ? -28.100 -12.964 -0.115  1.00 47.00 ? 11  C   D "C1'" 1 
ATOM   826  N  N1    . C   B 1 11  ? -29.389 -12.397 -0.537  1.00 39.28 ? 11  C   D N1    1 
ATOM   827  C  C2    . C   B 1 11  ? -29.589 -11.025 -0.378  1.00 37.90 ? 11  C   D C2    1 
ATOM   828  O  O2    . C   B 1 11  ? -28.669 -10.341 0.097   1.00 36.66 ? 11  C   D O2    1 
ATOM   829  N  N3    . C   B 1 11  ? -30.773 -10.481 -0.732  1.00 35.39 ? 11  C   D N3    1 
ATOM   830  C  C4    . C   B 1 11  ? -31.742 -11.256 -1.216  1.00 40.91 ? 11  C   D C4    1 
ATOM   831  N  N4    . C   B 1 11  ? -32.908 -10.678 -1.518  1.00 49.15 ? 11  C   D N4    1 
ATOM   832  C  C5    . C   B 1 11  ? -31.564 -12.661 -1.401  1.00 39.81 ? 11  C   D C5    1 
ATOM   833  C  C6    . C   B 1 11  ? -30.378 -13.184 -1.055  1.00 39.48 ? 11  C   D C6    1 
ATOM   834  P  P     . G   B 1 12  ? -29.144 -15.613 3.719   1.00 46.05 ? 12  G   D P     1 
ATOM   835  O  OP1   . G   B 1 12  ? -28.453 -16.208 4.890   1.00 52.03 ? 12  G   D OP1   1 
ATOM   836  O  OP2   . G   B 1 12  ? -30.350 -16.275 3.148   1.00 42.13 ? 12  G   D OP2   1 
ATOM   837  O  "O5'" . G   B 1 12  ? -29.575 -14.122 4.087   1.00 42.94 ? 12  G   D "O5'" 1 
ATOM   838  C  "C5'" . G   B 1 12  ? -28.703 -13.269 4.807   1.00 45.67 ? 12  G   D "C5'" 1 
ATOM   839  C  "C4'" . G   B 1 12  ? -29.342 -11.917 5.008   1.00 47.17 ? 12  G   D "C4'" 1 
ATOM   840  O  "O4'" . G   B 1 12  ? -29.559 -11.289 3.716   1.00 48.24 ? 12  G   D "O4'" 1 
ATOM   841  C  "C3'" . G   B 1 12  ? -30.731 -11.894 5.631   1.00 48.73 ? 12  G   D "C3'" 1 
ATOM   842  O  "O3'" . G   B 1 12  ? -30.697 -12.029 7.051   1.00 51.36 ? 12  G   D "O3'" 1 
ATOM   843  C  "C2'" . G   B 1 12  ? -31.211 -10.505 5.232   1.00 41.09 ? 12  G   D "C2'" 1 
ATOM   844  O  "O2'" . G   B 1 12  ? -30.676 -9.481  6.042   1.00 40.80 ? 12  G   D "O2'" 1 
ATOM   845  C  "C1'" . G   B 1 12  ? -30.657 -10.394 3.811   1.00 44.91 ? 12  G   D "C1'" 1 
ATOM   846  N  N9    . G   B 1 12  ? -31.697 -10.810 2.884   1.00 43.18 ? 12  G   D N9    1 
ATOM   847  C  C8    . G   B 1 12  ? -31.862 -12.036 2.294   1.00 41.12 ? 12  G   D C8    1 
ATOM   848  N  N7    . G   B 1 12  ? -32.976 -12.130 1.621   1.00 42.31 ? 12  G   D N7    1 
ATOM   849  C  C5    . G   B 1 12  ? -33.565 -10.881 1.756   1.00 44.10 ? 12  G   D C5    1 
ATOM   850  C  C6    . G   B 1 12  ? -34.801 -10.392 1.273   1.00 51.13 ? 12  G   D C6    1 
ATOM   851  O  O6    . G   B 1 12  ? -35.669 -11.001 0.641   1.00 50.57 ? 12  G   D O6    1 
ATOM   852  N  N1    . G   B 1 12  ? -34.991 -9.051  1.613   1.00 44.63 ? 12  G   D N1    1 
ATOM   853  C  C2    . G   B 1 12  ? -34.107 -8.288  2.340   1.00 52.71 ? 12  G   D C2    1 
ATOM   854  N  N2    . G   B 1 12  ? -34.440 -7.002  2.537   1.00 49.97 ? 12  G   D N2    1 
ATOM   855  N  N3    . G   B 1 12  ? -32.971 -8.748  2.829   1.00 50.08 ? 12  G   D N3    1 
ATOM   856  C  C4    . G   B 1 12  ? -32.765 -10.044 2.497   1.00 49.16 ? 12  G   D C4    1 
ATOM   857  P  P     . C   B 1 13  ? -31.802 -12.937 7.790   1.00 52.34 ? 13  C   D P     1 
ATOM   858  O  OP1   . C   B 1 13  ? -31.655 -12.741 9.254   1.00 57.18 ? 13  C   D OP1   1 
ATOM   859  O  OP2   . C   B 1 13  ? -31.706 -14.305 7.223   1.00 42.25 ? 13  C   D OP2   1 
ATOM   860  O  "O5'" . C   B 1 13  ? -33.188 -12.281 7.357   1.00 53.49 ? 13  C   D "O5'" 1 
ATOM   861  C  "C5'" . C   B 1 13  ? -34.434 -12.836 7.770   1.00 46.16 ? 13  C   D "C5'" 1 
ATOM   862  C  "C4'" . C   B 1 13  ? -35.265 -11.783 8.472   1.00 46.73 ? 13  C   D "C4'" 1 
ATOM   863  O  "O4'" . C   B 1 13  ? -34.587 -11.394 9.696   1.00 40.85 ? 13  C   D "O4'" 1 
ATOM   864  C  "C3'" . C   B 1 13  ? -35.466 -10.473 7.717   1.00 46.19 ? 13  C   D "C3'" 1 
ATOM   865  O  "O3'" . C   B 1 13  ? -36.570 -10.552 6.817   1.00 42.73 ? 13  C   D "O3'" 1 
ATOM   866  C  "C2'" . C   B 1 13  ? -35.740 -9.486  8.846   1.00 44.77 ? 13  C   D "C2'" 1 
ATOM   867  O  "O2'" . C   B 1 13  ? -37.079 -9.481  9.295   1.00 49.76 ? 13  C   D "O2'" 1 
ATOM   868  C  "C1'" . C   B 1 13  ? -34.833 -10.024 9.957   1.00 47.07 ? 13  C   D "C1'" 1 
ATOM   869  N  N1    . C   B 1 13  ? -33.547 -9.325  10.014  1.00 47.57 ? 13  C   D N1    1 
ATOM   870  C  C2    . C   B 1 13  ? -33.480 -8.121  10.705  1.00 42.06 ? 13  C   D C2    1 
ATOM   871  O  O2    . C   B 1 13  ? -34.497 -7.710  11.274  1.00 45.56 ? 13  C   D O2    1 
ATOM   872  N  N3    . C   B 1 13  ? -32.307 -7.441  10.742  1.00 49.18 ? 13  C   D N3    1 
ATOM   873  C  C4    . C   B 1 13  ? -31.227 -7.943  10.132  1.00 49.38 ? 13  C   D C4    1 
ATOM   874  N  N4    . C   B 1 13  ? -30.088 -7.250  10.195  1.00 52.85 ? 13  C   D N4    1 
ATOM   875  C  C5    . C   B 1 13  ? -31.267 -9.183  9.432   1.00 50.90 ? 13  C   D C5    1 
ATOM   876  C  C6    . C   B 1 13  ? -32.438 -9.834  9.397   1.00 53.87 ? 13  C   D C6    1 
ATOM   877  P  P     . A   B 1 14  ? -36.414 -10.014 5.306   1.00 48.97 ? 14  A   D P     1 
ATOM   878  O  OP1   . A   B 1 14  ? -37.628 -10.404 4.543   1.00 47.41 ? 14  A   D OP1   1 
ATOM   879  O  OP2   . A   B 1 14  ? -35.074 -10.446 4.827   1.00 48.30 ? 14  A   D OP2   1 
ATOM   880  O  "O5'" . A   B 1 14  ? -36.402 -8.425  5.443   1.00 50.28 ? 14  A   D "O5'" 1 
ATOM   881  C  "C5'" . A   B 1 14  ? -37.543 -7.723  5.927   1.00 50.18 ? 14  A   D "C5'" 1 
ATOM   882  C  "C4'" . A   B 1 14  ? -37.132 -6.381  6.481   1.00 53.75 ? 14  A   D "C4'" 1 
ATOM   883  O  "O4'" . A   B 1 14  ? -36.111 -6.596  7.485   1.00 52.67 ? 14  A   D "O4'" 1 
ATOM   884  C  "C3'" . A   B 1 14  ? -36.496 -5.415  5.492   1.00 54.39 ? 14  A   D "C3'" 1 
ATOM   885  O  "O3'" . A   B 1 14  ? -37.501 -4.657  4.828   1.00 58.93 ? 14  A   D "O3'" 1 
ATOM   886  C  "C2'" . A   B 1 14  ? -35.653 -4.529  6.401   1.00 57.75 ? 14  A   D "C2'" 1 
ATOM   887  O  "O2'" . A   B 1 14  ? -36.404 -3.511  7.033   1.00 53.98 ? 14  A   D "O2'" 1 
ATOM   888  C  "C1'" . A   B 1 14  ? -35.169 -5.540  7.443   1.00 50.14 ? 14  A   D "C1'" 1 
ATOM   889  N  N9    . A   B 1 14  ? -33.863 -6.120  7.140   1.00 52.24 ? 14  A   D N9    1 
ATOM   890  C  C8    . A   B 1 14  ? -33.603 -7.339  6.562   1.00 46.11 ? 14  A   D C8    1 
ATOM   891  N  N7    . A   B 1 14  ? -32.326 -7.597  6.429   1.00 53.08 ? 14  A   D N7    1 
ATOM   892  C  C5    . A   B 1 14  ? -31.701 -6.473  6.951   1.00 51.45 ? 14  A   D C5    1 
ATOM   893  C  C6    . A   B 1 14  ? -30.348 -6.126  7.098   1.00 51.64 ? 14  A   D C6    1 
ATOM   894  N  N6    . A   B 1 14  ? -29.339 -6.912  6.720   1.00 52.47 ? 14  A   D N6    1 
ATOM   895  N  N1    . A   B 1 14  ? -30.063 -4.928  7.653   1.00 52.38 ? 14  A   D N1    1 
ATOM   896  C  C2    . A   B 1 14  ? -31.076 -4.141  8.031   1.00 48.28 ? 14  A   D C2    1 
ATOM   897  N  N3    . A   B 1 14  ? -32.388 -4.356  7.946   1.00 51.50 ? 14  A   D N3    1 
ATOM   898  C  C4    . A   B 1 14  ? -32.636 -5.553  7.390   1.00 52.37 ? 14  A   D C4    1 
ATOM   899  P  P     . A   B 1 15  ? -37.267 -4.164  3.313   1.00 65.02 ? 15  A   D P     1 
ATOM   900  O  OP1   . A   B 1 15  ? -38.519 -3.484  2.893   1.00 69.32 ? 15  A   D OP1   1 
ATOM   901  O  OP2   . A   B 1 15  ? -36.738 -5.288  2.501   1.00 57.87 ? 15  A   D OP2   1 
ATOM   902  O  "O5'" . A   B 1 15  ? -36.133 -3.054  3.437   1.00 63.35 ? 15  A   D "O5'" 1 
ATOM   903  C  "C5'" . A   B 1 15  ? -36.418 -1.781  4.010   1.00 62.60 ? 15  A   D "C5'" 1 
ATOM   904  C  "C4'" . A   B 1 15  ? -35.135 -1.029  4.269   1.00 57.00 ? 15  A   D "C4'" 1 
ATOM   905  O  "O4'" . A   B 1 15  ? -34.326 -1.793  5.204   1.00 56.83 ? 15  A   D "O4'" 1 
ATOM   906  C  "C3'" . A   B 1 15  ? -34.228 -0.842  3.063   1.00 61.20 ? 15  A   D "C3'" 1 
ATOM   907  O  "O3'" . A   B 1 15  ? -34.606 0.298   2.299   1.00 60.60 ? 15  A   D "O3'" 1 
ATOM   908  C  "C2'" . A   B 1 15  ? -32.873 -0.653  3.730   1.00 62.31 ? 15  A   D "C2'" 1 
ATOM   909  O  "O2'" . A   B 1 15  ? -32.718 0.630   4.305   1.00 63.11 ? 15  A   D "O2'" 1 
ATOM   910  C  "C1'" . A   B 1 15  ? -32.956 -1.686  4.851   1.00 56.30 ? 15  A   D "C1'" 1 
ATOM   911  N  N9    . A   B 1 15  ? -32.491 -3.005  4.427   1.00 53.54 ? 15  A   D N9    1 
ATOM   912  C  C8    . A   B 1 15  ? -33.247 -4.043  3.937   1.00 51.52 ? 15  A   D C8    1 
ATOM   913  N  N7    . A   B 1 15  ? -32.550 -5.114  3.646   1.00 46.18 ? 15  A   D N7    1 
ATOM   914  C  C5    . A   B 1 15  ? -31.246 -4.758  3.963   1.00 46.11 ? 15  A   D C5    1 
ATOM   915  C  C6    . A   B 1 15  ? -30.027 -5.457  3.879   1.00 47.43 ? 15  A   D C6    1 
ATOM   916  N  N6    . A   B 1 15  ? -29.924 -6.712  3.440   1.00 48.23 ? 15  A   D N6    1 
ATOM   917  N  N1    . A   B 1 15  ? -28.904 -4.812  4.270   1.00 50.63 ? 15  A   D N1    1 
ATOM   918  C  C2    . A   B 1 15  ? -29.010 -3.552  4.715   1.00 51.02 ? 15  A   D C2    1 
ATOM   919  N  N3    . A   B 1 15  ? -30.099 -2.789  4.842   1.00 56.03 ? 15  A   D N3    1 
ATOM   920  C  C4    . A   B 1 15  ? -31.195 -3.459  4.443   1.00 50.62 ? 15  A   D C4    1 
ATOM   921  P  P     . G   B 1 16  ? -34.757 0.178   0.703   1.00 70.54 ? 16  G   D P     1 
ATOM   922  O  OP1   . G   B 1 16  ? -34.973 1.559   0.201   1.00 75.13 ? 16  G   D OP1   1 
ATOM   923  O  OP2   . G   B 1 16  ? -35.752 -0.879  0.391   1.00 70.04 ? 16  G   D OP2   1 
ATOM   924  O  "O5'" . G   B 1 16  ? -33.329 -0.322  0.201   1.00 67.70 ? 16  G   D "O5'" 1 
ATOM   925  C  "C5'" . G   B 1 16  ? -32.148 0.401   0.527   1.00 64.76 ? 16  G   D "C5'" 1 
ATOM   926  C  "C4'" . G   B 1 16  ? -30.943 -0.517  0.525   1.00 67.04 ? 16  G   D "C4'" 1 
ATOM   927  O  "O4'" . G   B 1 16  ? -31.193 -1.646  1.414   1.00 68.00 ? 16  G   D "O4'" 1 
ATOM   928  C  "C3'" . G   B 1 16  ? -30.581 -1.194  -0.788  1.00 63.16 ? 16  G   D "C3'" 1 
ATOM   929  O  "O3'" . G   B 1 16  ? -29.859 -0.327  -1.660  1.00 61.05 ? 16  G   D "O3'" 1 
ATOM   930  C  "C2'" . G   B 1 16  ? -29.706 -2.339  -0.294  1.00 57.68 ? 16  G   D "C2'" 1 
ATOM   931  O  "O2'" . G   B 1 16  ? -28.416 -1.912  0.089   1.00 54.26 ? 16  G   D "O2'" 1 
ATOM   932  C  "C1'" . G   B 1 16  ? -30.480 -2.784  0.947   1.00 60.84 ? 16  G   D "C1'" 1 
ATOM   933  N  N9    . G   B 1 16  ? -31.431 -3.840  0.611   1.00 55.04 ? 16  G   D N9    1 
ATOM   934  C  C8    . G   B 1 16  ? -32.790 -3.728  0.434   1.00 53.71 ? 16  G   D C8    1 
ATOM   935  N  N7    . G   B 1 16  ? -33.355 -4.855  0.082   1.00 58.63 ? 16  G   D N7    1 
ATOM   936  C  C5    . G   B 1 16  ? -32.304 -5.767  0.032   1.00 49.79 ? 16  G   D C5    1 
ATOM   937  C  C6    . G   B 1 16  ? -32.292 -7.154  -0.305  1.00 50.55 ? 16  G   D C6    1 
ATOM   938  O  O6    . G   B 1 16  ? -33.237 -7.875  -0.655  1.00 52.73 ? 16  G   D O6    1 
ATOM   939  N  N1    . G   B 1 16  ? -31.010 -7.693  -0.209  1.00 46.39 ? 16  G   D N1    1 
ATOM   940  C  C2    . G   B 1 16  ? -29.885 -6.995  0.152   1.00 46.11 ? 16  G   D C2    1 
ATOM   941  N  N2    . G   B 1 16  ? -28.739 -7.691  0.190   1.00 37.86 ? 16  G   D N2    1 
ATOM   942  N  N3    . G   B 1 16  ? -29.880 -5.707  0.455   1.00 45.14 ? 16  G   D N3    1 
ATOM   943  C  C4    . G   B 1 16  ? -31.115 -5.161  0.374   1.00 53.24 ? 16  G   D C4    1 
ATOM   944  P  P     . A   B 1 17  ? -29.765 -0.671  -3.233  1.00 57.14 ? 17  A   D P     1 
ATOM   945  O  OP1   . A   B 1 17  ? -29.131 0.502   -3.888  1.00 62.38 ? 17  A   D OP1   1 
ATOM   946  O  OP2   . A   B 1 17  ? -31.087 -1.148  -3.705  1.00 52.44 ? 17  A   D OP2   1 
ATOM   947  O  "O5'" . A   B 1 17  ? -28.743 -1.894  -3.315  1.00 51.13 ? 17  A   D "O5'" 1 
ATOM   948  C  "C5'" . A   B 1 17  ? -27.389 -1.745  -2.893  1.00 47.68 ? 17  A   D "C5'" 1 
ATOM   949  C  "C4'" . A   B 1 17  ? -26.691 -3.086  -2.877  1.00 51.99 ? 17  A   D "C4'" 1 
ATOM   950  O  "O4'" . A   B 1 17  ? -27.419 -4.002  -2.007  1.00 52.96 ? 17  A   D "O4'" 1 
ATOM   951  C  "C3'" . A   B 1 17  ? -26.639 -3.825  -4.203  1.00 45.49 ? 17  A   D "C3'" 1 
ATOM   952  O  "O3'" . A   B 1 17  ? -25.567 -3.369  -5.021  1.00 48.90 ? 17  A   D "O3'" 1 
ATOM   953  C  "C2'" . A   B 1 17  ? -26.410 -5.258  -3.744  1.00 50.25 ? 17  A   D "C2'" 1 
ATOM   954  O  "O2'" . A   B 1 17  ? -25.070 -5.487  -3.343  1.00 43.95 ? 17  A   D "O2'" 1 
ATOM   955  C  "C1'" . A   B 1 17  ? -27.335 -5.323  -2.529  1.00 47.01 ? 17  A   D "C1'" 1 
ATOM   956  N  N9    . A   B 1 17  ? -28.683 -5.766  -2.892  1.00 48.52 ? 17  A   D N9    1 
ATOM   957  C  C8    . A   B 1 17  ? -29.828 -5.012  -2.990  1.00 41.94 ? 17  A   D C8    1 
ATOM   958  N  N7    . A   B 1 17  ? -30.887 -5.702  -3.342  1.00 43.35 ? 17  A   D N7    1 
ATOM   959  C  C5    . A   B 1 17  ? -30.412 -6.999  -3.480  1.00 44.09 ? 17  A   D C5    1 
ATOM   960  C  C6    . A   B 1 17  ? -31.045 -8.212  -3.823  1.00 39.79 ? 17  A   D C6    1 
ATOM   961  N  N6    . A   B 1 17  ? -32.345 -8.321  -4.085  1.00 48.38 ? 17  A   D N6    1 
ATOM   962  N  N1    . A   B 1 17  ? -30.282 -9.325  -3.878  1.00 42.46 ? 17  A   D N1    1 
ATOM   963  C  C2    . A   B 1 17  ? -28.974 -9.219  -3.596  1.00 46.06 ? 17  A   D C2    1 
ATOM   964  N  N3    . A   B 1 17  ? -28.267 -8.142  -3.256  1.00 38.65 ? 17  A   D N3    1 
ATOM   965  C  C4    . A   B 1 17  ? -29.053 -7.052  -3.213  1.00 43.89 ? 17  A   D C4    1 
ATOM   966  P  P     . G   B 1 18  ? -25.671 -3.516  -6.618  1.00 54.39 ? 18  G   D P     1 
ATOM   967  O  OP1   . G   B 1 18  ? -24.654 -2.625  -7.232  1.00 58.96 ? 18  G   D OP1   1 
ATOM   968  O  OP2   . G   B 1 18  ? -27.098 -3.379  -7.001  1.00 46.99 ? 18  G   D OP2   1 
ATOM   969  O  "O5'" . G   B 1 18  ? -25.257 -5.026  -6.907  1.00 43.60 ? 18  G   D "O5'" 1 
ATOM   970  C  "C5'" . G   B 1 18  ? -24.040 -5.561  -6.421  1.00 39.18 ? 18  G   D "C5'" 1 
ATOM   971  C  "C4'" . G   B 1 18  ? -24.014 -7.055  -6.637  1.00 48.88 ? 18  G   D "C4'" 1 
ATOM   972  O  "O4'" . G   B 1 18  ? -25.018 -7.683  -5.796  1.00 45.24 ? 18  G   D "O4'" 1 
ATOM   973  C  "C3'" . G   B 1 18  ? -24.390 -7.523  -8.034  1.00 46.17 ? 18  G   D "C3'" 1 
ATOM   974  O  "O3'" . G   B 1 18  ? -23.291 -7.432  -8.932  1.00 48.54 ? 18  G   D "O3'" 1 
ATOM   975  C  "C2'" . G   B 1 18  ? -24.797 -8.971  -7.783  1.00 47.10 ? 18  G   D "C2'" 1 
ATOM   976  O  "O2'" . G   B 1 18  ? -23.708 -9.863  -7.676  1.00 40.20 ? 18  G   D "O2'" 1 
ATOM   977  C  "C1'" . G   B 1 18  ? -25.502 -8.854  -6.432  1.00 45.56 ? 18  G   D "C1'" 1 
ATOM   978  N  N9    . G   B 1 18  ? -26.950 -8.748  -6.576  1.00 42.90 ? 18  G   D N9    1 
ATOM   979  C  C8    . G   B 1 18  ? -27.734 -7.635  -6.394  1.00 42.37 ? 18  G   D C8    1 
ATOM   980  N  N7    . G   B 1 18  ? -28.999 -7.861  -6.621  1.00 41.96 ? 18  G   D N7    1 
ATOM   981  C  C5    . G   B 1 18  ? -29.050 -9.205  -6.974  1.00 44.61 ? 18  G   D C5    1 
ATOM   982  C  C6    . G   B 1 18  ? -30.158 -10.025 -7.345  1.00 38.89 ? 18  G   D C6    1 
ATOM   983  O  O6    . G   B 1 18  ? -31.348 -9.710  -7.448  1.00 47.02 ? 18  G   D O6    1 
ATOM   984  N  N1    . G   B 1 18  ? -29.758 -11.333 -7.616  1.00 39.77 ? 18  G   D N1    1 
ATOM   985  C  C2    . G   B 1 18  ? -28.459 -11.792 -7.547  1.00 42.94 ? 18  G   D C2    1 
ATOM   986  N  N2    . G   B 1 18  ? -28.264 -13.081 -7.855  1.00 38.56 ? 18  G   D N2    1 
ATOM   987  N  N3    . G   B 1 18  ? -27.426 -11.039 -7.206  1.00 40.29 ? 18  G   D N3    1 
ATOM   988  C  C4    . G   B 1 18  ? -27.793 -9.766  -6.938  1.00 38.59 ? 18  G   D C4    1 
ATOM   989  P  P     . U   B 1 19  ? -23.560 -7.120  -10.488 1.00 44.30 ? 19  U   D P     1 
ATOM   990  O  OP1   . U   B 1 19  ? -22.220 -7.013  -11.115 1.00 42.00 ? 19  U   D OP1   1 
ATOM   991  O  OP2   . U   B 1 19  ? -24.519 -6.000  -10.600 1.00 42.57 ? 19  U   D OP2   1 
ATOM   992  O  "O5'" . U   B 1 19  ? -24.262 -8.442  -11.034 1.00 43.39 ? 19  U   D "O5'" 1 
ATOM   993  C  "C5'" . U   B 1 19  ? -23.521 -9.648  -11.177 1.00 47.89 ? 19  U   D "C5'" 1 
ATOM   994  C  "C4'" . U   B 1 19  ? -24.428 -10.770 -11.608 1.00 43.04 ? 19  U   D "C4'" 1 
ATOM   995  O  "O4'" . U   B 1 19  ? -25.423 -10.999 -10.578 1.00 46.12 ? 19  U   D "O4'" 1 
ATOM   996  C  "C3'" . U   B 1 19  ? -25.267 -10.511 -12.846 1.00 49.33 ? 19  U   D "C3'" 1 
ATOM   997  O  "O3'" . U   B 1 19  ? -24.531 -10.712 -14.052 1.00 48.62 ? 19  U   D "O3'" 1 
ATOM   998  C  "C2'" . U   B 1 19  ? -26.368 -11.547 -12.673 1.00 41.79 ? 19  U   D "C2'" 1 
ATOM   999  O  "O2'" . U   B 1 19  ? -25.891 -12.839 -12.956 1.00 49.15 ? 19  U   D "O2'" 1 
ATOM   1000 C  "C1'" . U   B 1 19  ? -26.633 -11.444 -11.173 1.00 45.00 ? 19  U   D "C1'" 1 
ATOM   1001 N  N1    . U   B 1 19  ? -27.699 -10.477 -10.870 1.00 41.90 ? 19  U   D N1    1 
ATOM   1002 C  C2    . U   B 1 19  ? -29.008 -10.909 -10.999 1.00 42.75 ? 19  U   D C2    1 
ATOM   1003 O  O2    . U   B 1 19  ? -29.297 -12.041 -11.317 1.00 50.77 ? 19  U   D O2    1 
ATOM   1004 N  N3    . U   B 1 19  ? -29.965 -9.962  -10.746 1.00 42.83 ? 19  U   D N3    1 
ATOM   1005 C  C4    . U   B 1 19  ? -29.755 -8.653  -10.381 1.00 37.23 ? 19  U   D C4    1 
ATOM   1006 O  O4    . U   B 1 19  ? -30.724 -7.923  -10.187 1.00 39.08 ? 19  U   D O4    1 
ATOM   1007 C  C5    . U   B 1 19  ? -28.375 -8.282  -10.249 1.00 34.99 ? 19  U   D C5    1 
ATOM   1008 C  C6    . U   B 1 19  ? -27.417 -9.187  -10.488 1.00 34.95 ? 19  U   D C6    1 
ATOM   1009 P  P     . G   B 1 20  ? -24.946 -9.898  -15.382 1.00 48.49 ? 20  G   D P     1 
ATOM   1010 O  OP1   . G   B 1 20  ? -23.894 -10.150 -16.397 1.00 55.02 ? 20  G   D OP1   1 
ATOM   1011 O  OP2   . G   B 1 20  ? -25.290 -8.508  -15.013 1.00 39.43 ? 20  G   D OP2   1 
ATOM   1012 O  "O5'" . G   B 1 20  ? -26.278 -10.614 -15.871 1.00 46.17 ? 20  G   D "O5'" 1 
ATOM   1013 C  "C5'" . G   B 1 20  ? -26.232 -11.941 -16.376 1.00 45.33 ? 20  G   D "C5'" 1 
ATOM   1014 C  "C4'" . G   B 1 20  ? -27.625 -12.440 -16.661 1.00 48.76 ? 20  G   D "C4'" 1 
ATOM   1015 O  "O4'" . G   B 1 20  ? -28.364 -12.512 -15.411 1.00 43.07 ? 20  G   D "O4'" 1 
ATOM   1016 C  "C3'" . G   B 1 20  ? -28.511 -11.545 -17.512 1.00 45.10 ? 20  G   D "C3'" 1 
ATOM   1017 O  "O3'" . G   B 1 20  ? -28.232 -11.614 -18.903 1.00 48.86 ? 20  G   D "O3'" 1 
ATOM   1018 C  "C2'" . G   B 1 20  ? -29.886 -12.099 -17.174 1.00 49.54 ? 20  G   D "C2'" 1 
ATOM   1019 O  "O2'" . G   B 1 20  ? -30.138 -13.343 -17.797 1.00 51.37 ? 20  G   D "O2'" 1 
ATOM   1020 C  "C1'" . G   B 1 20  ? -29.743 -12.298 -15.665 1.00 40.14 ? 20  G   D "C1'" 1 
ATOM   1021 N  N9    . G   B 1 20  ? -30.160 -11.098 -14.951 1.00 42.40 ? 20  G   D N9    1 
ATOM   1022 C  C8    . G   B 1 20  ? -29.361 -10.144 -14.370 1.00 36.10 ? 20  G   D C8    1 
ATOM   1023 N  N7    . G   B 1 20  ? -30.041 -9.165  -13.837 1.00 43.60 ? 20  G   D N7    1 
ATOM   1024 C  C5    . G   B 1 20  ? -31.368 -9.497  -14.079 1.00 38.59 ? 20  G   D C5    1 
ATOM   1025 C  C6    . G   B 1 20  ? -32.565 -8.815  -13.746 1.00 38.36 ? 20  G   D C6    1 
ATOM   1026 O  O6    . G   B 1 20  ? -32.700 -7.736  -13.158 1.00 42.80 ? 20  G   D O6    1 
ATOM   1027 N  N1    . G   B 1 20  ? -33.687 -9.515  -14.177 1.00 41.13 ? 20  G   D N1    1 
ATOM   1028 C  C2    . G   B 1 20  ? -33.662 -10.713 -14.854 1.00 39.21 ? 20  G   D C2    1 
ATOM   1029 N  N2    . G   B 1 20  ? -34.853 -11.238 -15.201 1.00 40.80 ? 20  G   D N2    1 
ATOM   1030 N  N3    . G   B 1 20  ? -32.555 -11.352 -15.173 1.00 38.75 ? 20  G   D N3    1 
ATOM   1031 C  C4    . G   B 1 20  ? -31.455 -10.693 -14.757 1.00 39.40 ? 20  G   D C4    1 
ATOM   1032 P  P     . G   B 1 21  ? -28.621 -10.368 -19.846 1.00 54.35 ? 21  G   D P     1 
ATOM   1033 O  OP1   . G   B 1 21  ? -28.079 -10.657 -21.198 1.00 61.25 ? 21  G   D OP1   1 
ATOM   1034 O  OP2   . G   B 1 21  ? -28.253 -9.101  -19.163 1.00 53.03 ? 21  G   D OP2   1 
ATOM   1035 O  "O5'" . G   B 1 21  ? -30.211 -10.407 -19.894 1.00 53.23 ? 21  G   D "O5'" 1 
ATOM   1036 C  "C5'" . G   B 1 21  ? -30.890 -11.515 -20.458 1.00 47.46 ? 21  G   D "C5'" 1 
ATOM   1037 C  "C4'" . G   B 1 21  ? -32.372 -11.252 -20.492 1.00 50.47 ? 21  G   D "C4'" 1 
ATOM   1038 O  "O4'" . G   B 1 21  ? -32.899 -11.236 -19.136 1.00 49.16 ? 21  G   D "O4'" 1 
ATOM   1039 C  "C3'" . G   B 1 21  ? -32.808 -9.897  -21.023 1.00 49.09 ? 21  G   D "C3'" 1 
ATOM   1040 O  "O3'" . G   B 1 21  ? -32.738 -9.765  -22.439 1.00 47.00 ? 21  G   D "O3'" 1 
ATOM   1041 C  "C2'" . G   B 1 21  ? -34.234 -9.825  -20.495 1.00 49.09 ? 21  G   D "C2'" 1 
ATOM   1042 O  "O2'" . G   B 1 21  ? -35.142 -10.628 -21.225 1.00 42.80 ? 21  G   D "O2'" 1 
ATOM   1043 C  "C1'" . G   B 1 21  ? -34.044 -10.392 -19.086 1.00 47.25 ? 21  G   D "C1'" 1 
ATOM   1044 N  N9    . G   B 1 21  ? -33.807 -9.322  -18.119 1.00 42.21 ? 21  G   D N9    1 
ATOM   1045 C  C8    . G   B 1 21  ? -32.604 -8.908  -17.598 1.00 40.54 ? 21  G   D C8    1 
ATOM   1046 N  N7    . G   B 1 21  ? -32.725 -7.912  -16.760 1.00 45.98 ? 21  G   D N7    1 
ATOM   1047 C  C5    . G   B 1 21  ? -34.091 -7.654  -16.726 1.00 40.45 ? 21  G   D C5    1 
ATOM   1048 C  C6    . G   B 1 21  ? -34.832 -6.683  -15.998 1.00 44.75 ? 21  G   D C6    1 
ATOM   1049 O  O6    . G   B 1 21  ? -34.420 -5.827  -15.203 1.00 45.71 ? 21  G   D O6    1 
ATOM   1050 N  N1    . G   B 1 21  ? -36.192 -6.770  -16.271 1.00 43.32 ? 21  G   D N1    1 
ATOM   1051 C  C2    . G   B 1 21  ? -36.771 -7.675  -17.128 1.00 44.10 ? 21  G   D C2    1 
ATOM   1052 N  N2    . G   B 1 21  ? -38.103 -7.602  -17.257 1.00 45.88 ? 21  G   D N2    1 
ATOM   1053 N  N3    . G   B 1 21  ? -36.096 -8.581  -17.807 1.00 41.26 ? 21  G   D N3    1 
ATOM   1054 C  C4    . G   B 1 21  ? -34.771 -8.515  -17.560 1.00 41.48 ? 21  G   D C4    1 
ATOM   1055 P  P     . C   B 1 22  ? -32.604 -8.291  -23.087 1.00 42.93 ? 22  C   D P     1 
ATOM   1056 O  OP1   . C   B 1 22  ? -32.462 -8.453  -24.558 1.00 48.88 ? 22  C   D OP1   1 
ATOM   1057 O  OP2   . C   B 1 22  ? -31.562 -7.562  -22.330 1.00 47.09 ? 22  C   D OP2   1 
ATOM   1058 O  "O5'" . C   B 1 22  ? -34.006 -7.590  -22.781 1.00 37.49 ? 22  C   D "O5'" 1 
ATOM   1059 C  "C5'" . C   B 1 22  ? -35.227 -8.125  -23.285 1.00 41.35 ? 22  C   D "C5'" 1 
ATOM   1060 C  "C4'" . C   B 1 22  ? -36.407 -7.329  -22.772 1.00 39.35 ? 22  C   D "C4'" 1 
ATOM   1061 O  "O4'" . C   B 1 22  ? -36.478 -7.429  -21.321 1.00 46.52 ? 22  C   D "O4'" 1 
ATOM   1062 C  "C3'" . C   B 1 22  ? -36.358 -5.830  -23.016 1.00 40.76 ? 22  C   D "C3'" 1 
ATOM   1063 O  "O3'" . C   B 1 22  ? -36.761 -5.487  -24.336 1.00 43.69 ? 22  C   D "O3'" 1 
ATOM   1064 C  "C2'" . C   B 1 22  ? -37.331 -5.311  -21.963 1.00 43.37 ? 22  C   D "C2'" 1 
ATOM   1065 O  "O2'" . C   B 1 22  ? -38.691 -5.473  -22.309 1.00 51.36 ? 22  C   D "O2'" 1 
ATOM   1066 C  "C1'" . C   B 1 22  ? -37.002 -6.223  -20.782 1.00 41.93 ? 22  C   D "C1'" 1 
ATOM   1067 N  N1    . C   B 1 22  ? -35.983 -5.611  -19.916 1.00 40.06 ? 22  C   D N1    1 
ATOM   1068 C  C2    . C   B 1 22  ? -36.374 -4.602  -19.035 1.00 37.83 ? 22  C   D C2    1 
ATOM   1069 O  O2    . C   B 1 22  ? -37.562 -4.250  -19.018 1.00 35.51 ? 22  C   D O2    1 
ATOM   1070 N  N3    . C   B 1 22  ? -35.449 -4.029  -18.232 1.00 39.99 ? 22  C   D N3    1 
ATOM   1071 C  C4    . C   B 1 22  ? -34.175 -4.424  -18.296 1.00 35.43 ? 22  C   D C4    1 
ATOM   1072 N  N4    . C   B 1 22  ? -33.296 -3.832  -17.489 1.00 38.71 ? 22  C   D N4    1 
ATOM   1073 C  C5    . C   B 1 22  ? -33.747 -5.447  -19.191 1.00 40.79 ? 22  C   D C5    1 
ATOM   1074 C  C6    . C   B 1 22  ? -34.677 -6.011  -19.972 1.00 37.48 ? 22  C   D C6    1 
ATOM   1075 P  P     . C   B 1 23  ? -36.316 -4.074  -24.955 1.00 37.83 ? 23  C   D P     1 
ATOM   1076 O  OP1   . C   B 1 23  ? -36.753 -4.027  -26.372 1.00 38.34 ? 23  C   D OP1   1 
ATOM   1077 O  OP2   . C   B 1 23  ? -34.885 -3.881  -24.626 1.00 40.57 ? 23  C   D OP2   1 
ATOM   1078 O  "O5'" . C   B 1 23  ? -37.168 -3.024  -24.121 1.00 40.70 ? 23  C   D "O5'" 1 
ATOM   1079 C  "C5'" . C   B 1 23  ? -38.584 -2.971  -24.242 1.00 35.86 ? 23  C   D "C5'" 1 
ATOM   1080 C  "C4'" . C   B 1 23  ? -39.131 -1.837  -23.411 1.00 37.87 ? 23  C   D "C4'" 1 
ATOM   1081 O  "O4'" . C   B 1 23  ? -38.870 -2.102  -22.002 1.00 38.89 ? 23  C   D "O4'" 1 
ATOM   1082 C  "C3'" . C   B 1 23  ? -38.477 -0.482  -23.643 1.00 42.91 ? 23  C   D "C3'" 1 
ATOM   1083 O  "O3'" . C   B 1 23  ? -39.014 0.185   -24.779 1.00 41.80 ? 23  C   D "O3'" 1 
ATOM   1084 C  "C2'" . C   B 1 23  ? -38.823 0.239   -22.351 1.00 35.99 ? 23  C   D "C2'" 1 
ATOM   1085 O  "O2'" . C   B 1 23  ? -40.175 0.638   -22.316 1.00 36.18 ? 23  C   D "O2'" 1 
ATOM   1086 C  "C1'" . C   B 1 23  ? -38.608 -0.879  -21.329 1.00 38.24 ? 23  C   D "C1'" 1 
ATOM   1087 N  N1    . C   B 1 23  ? -37.223 -0.905  -20.826 1.00 33.62 ? 23  C   D N1    1 
ATOM   1088 C  C2    . C   B 1 23  ? -36.874 -0.050  -19.777 1.00 35.50 ? 23  C   D C2    1 
ATOM   1089 O  O2    . C   B 1 23  ? -37.731 0.716   -19.318 1.00 39.33 ? 23  C   D O2    1 
ATOM   1090 N  N3    . C   B 1 23  ? -35.611 -0.073  -19.293 1.00 41.14 ? 23  C   D N3    1 
ATOM   1091 C  C4    . C   B 1 23  ? -34.708 -0.894  -19.824 1.00 43.61 ? 23  C   D C4    1 
ATOM   1092 N  N4    . C   B 1 23  ? -33.473 -0.875  -19.313 1.00 40.98 ? 23  C   D N4    1 
ATOM   1093 C  C5    . C   B 1 23  ? -35.030 -1.770  -20.905 1.00 36.46 ? 23  C   D C5    1 
ATOM   1094 C  C6    . C   B 1 23  ? -36.291 -1.743  -21.369 1.00 35.94 ? 23  C   D C6    1 
ATOM   1095 P  P     . U   B 1 24  ? -38.069 1.141   -25.664 1.00 38.34 ? 24  U   D P     1 
ATOM   1096 O  OP1   . U   B 1 24  ? -38.902 1.576   -26.822 1.00 43.63 ? 24  U   D OP1   1 
ATOM   1097 O  OP2   . U   B 1 24  ? -36.766 0.468   -25.899 1.00 45.67 ? 24  U   D OP2   1 
ATOM   1098 O  "O5'" . U   B 1 24  ? -37.787 2.407   -24.740 1.00 35.92 ? 24  U   D "O5'" 1 
ATOM   1099 C  "C5'" . U   B 1 24  ? -38.848 3.252   -24.337 1.00 36.63 ? 24  U   D "C5'" 1 
ATOM   1100 C  "C4'" . U   B 1 24  ? -38.403 4.161   -23.218 1.00 44.24 ? 24  U   D "C4'" 1 
ATOM   1101 O  "O4'" . U   B 1 24  ? -37.934 3.373   -22.090 1.00 36.39 ? 24  U   D "O4'" 1 
ATOM   1102 C  "C3'" . U   B 1 24  ? -37.225 5.077   -23.495 1.00 40.68 ? 24  U   D "C3'" 1 
ATOM   1103 O  "O3'" . U   B 1 24  ? -37.639 6.196   -24.264 1.00 42.78 ? 24  U   D "O3'" 1 
ATOM   1104 C  "C2'" . U   B 1 24  ? -36.839 5.474   -22.073 1.00 40.62 ? 24  U   D "C2'" 1 
ATOM   1105 O  "O2'" . U   B 1 24  ? -37.759 6.387   -21.506 1.00 37.25 ? 24  U   D "O2'" 1 
ATOM   1106 C  "C1'" . U   B 1 24  ? -36.999 4.137   -21.346 1.00 38.62 ? 24  U   D "C1'" 1 
ATOM   1107 N  N1    . U   B 1 24  ? -35.734 3.393   -21.253 1.00 35.55 ? 24  U   D N1    1 
ATOM   1108 C  C2    . U   B 1 24  ? -34.819 3.825   -20.310 1.00 39.38 ? 24  U   D C2    1 
ATOM   1109 O  O2    . U   B 1 24  ? -35.029 4.769   -19.569 1.00 39.81 ? 24  U   D O2    1 
ATOM   1110 N  N3    . U   B 1 24  ? -33.648 3.115   -20.269 1.00 43.84 ? 24  U   D N3    1 
ATOM   1111 C  C4    . U   B 1 24  ? -33.299 2.044   -21.060 1.00 41.57 ? 24  U   D C4    1 
ATOM   1112 O  O4    . U   B 1 24  ? -32.167 1.568   -20.959 1.00 39.48 ? 24  U   D O4    1 
ATOM   1113 C  C5    . U   B 1 24  ? -34.304 1.646   -22.008 1.00 33.66 ? 24  U   D C5    1 
ATOM   1114 C  C6    . U   B 1 24  ? -35.459 2.319   -22.068 1.00 33.05 ? 24  U   D C6    1 
ATOM   1115 P  P     . U   B 1 25  ? -36.546 7.112   -24.996 1.00 39.69 ? 25  U   D P     1 
ATOM   1116 O  OP1   . U   B 1 25  ? -37.316 8.092   -25.799 1.00 49.13 ? 25  U   D OP1   1 
ATOM   1117 O  OP2   . U   B 1 25  ? -35.515 6.276   -25.657 1.00 41.91 ? 25  U   D OP2   1 
ATOM   1118 O  "O5'" . U   B 1 25  ? -35.844 7.898   -23.800 1.00 36.42 ? 25  U   D "O5'" 1 
ATOM   1119 C  "C5'" . U   B 1 25  ? -36.545 8.908   -23.096 1.00 34.77 ? 25  U   D "C5'" 1 
ATOM   1120 C  "C4'" . U   B 1 25  ? -35.641 9.554   -22.077 1.00 45.51 ? 25  U   D "C4'" 1 
ATOM   1121 O  "O4'" . U   B 1 25  ? -35.253 8.572   -21.077 1.00 40.51 ? 25  U   D "O4'" 1 
ATOM   1122 C  "C3'" . U   B 1 25  ? -34.307 10.062  -22.598 1.00 42.87 ? 25  U   D "C3'" 1 
ATOM   1123 O  "O3'" . U   B 1 25  ? -34.428 11.325  -23.229 1.00 40.14 ? 25  U   D "O3'" 1 
ATOM   1124 C  "C2'" . U   B 1 25  ? -33.508 10.150  -21.311 1.00 40.45 ? 25  U   D "C2'" 1 
ATOM   1125 O  "O2'" . U   B 1 25  ? -33.933 11.247  -20.533 1.00 36.14 ? 25  U   D "O2'" 1 
ATOM   1126 C  "C1'" . U   B 1 25  ? -33.932 8.849   -20.631 1.00 40.56 ? 25  U   D "C1'" 1 
ATOM   1127 N  N1    . U   B 1 25  ? -33.080 7.713   -21.011 1.00 42.31 ? 25  U   D N1    1 
ATOM   1128 C  C2    . U   B 1 25  ? -31.862 7.575   -20.373 1.00 40.72 ? 25  U   D C2    1 
ATOM   1129 O  O2    . U   B 1 25  ? -31.466 8.357   -19.529 1.00 43.68 ? 25  U   D O2    1 
ATOM   1130 N  N3    . U   B 1 25  ? -31.130 6.484   -20.756 1.00 38.54 ? 25  U   D N3    1 
ATOM   1131 C  C4    . U   B 1 25  ? -31.488 5.531   -21.686 1.00 40.29 ? 25  U   D C4    1 
ATOM   1132 O  O4    . U   B 1 25  ? -30.774 4.544   -21.845 1.00 32.68 ? 25  U   D O4    1 
ATOM   1133 C  C5    . U   B 1 25  ? -32.753 5.756   -22.311 1.00 35.67 ? 25  U   D C5    1 
ATOM   1134 C  C6    . U   B 1 25  ? -33.484 6.814   -21.962 1.00 36.51 ? 25  U   D C6    1 
ATOM   1135 P  P     . U   B 1 26  ? -33.442 11.697  -24.435 1.00 37.58 ? 26  U   D P     1 
ATOM   1136 O  OP1   . U   B 1 26  ? -33.951 12.938  -25.074 1.00 37.91 ? 26  U   D OP1   1 
ATOM   1137 O  OP2   . U   B 1 26  ? -33.223 10.486  -25.250 1.00 31.57 ? 26  U   D OP2   1 
ATOM   1138 O  "O5'" . U   B 1 26  ? -32.062 12.038  -23.722 1.00 40.36 ? 26  U   D "O5'" 1 
ATOM   1139 C  "C5'" . U   B 1 26  ? -32.013 12.970  -22.653 1.00 38.90 ? 26  U   D "C5'" 1 
ATOM   1140 C  "C4'" . U   B 1 26  ? -30.706 12.847  -21.919 1.00 37.21 ? 26  U   D "C4'" 1 
ATOM   1141 O  "O4'" . U   B 1 26  ? -30.618 11.539  -21.289 1.00 36.11 ? 26  U   D "O4'" 1 
ATOM   1142 C  "C3'" . U   B 1 26  ? -29.454 12.907  -22.781 1.00 32.36 ? 26  U   D "C3'" 1 
ATOM   1143 O  "O3'" . U   B 1 26  ? -29.110 14.249  -23.077 1.00 31.77 ? 26  U   D "O3'" 1 
ATOM   1144 C  "C2'" . U   B 1 26  ? -28.433 12.272  -21.854 1.00 34.10 ? 26  U   D "C2'" 1 
ATOM   1145 O  "O2'" . U   B 1 26  ? -28.089 13.178  -20.822 1.00 30.37 ? 26  U   D "O2'" 1 
ATOM   1146 C  "C1'" . U   B 1 26  ? -29.260 11.130  -21.255 1.00 29.40 ? 26  U   D "C1'" 1 
ATOM   1147 N  N1    . U   B 1 26  ? -29.134 9.869   -22.000 1.00 37.89 ? 26  U   D N1    1 
ATOM   1148 C  C2    . U   B 1 26  ? -27.982 9.144   -21.806 1.00 36.07 ? 26  U   D C2    1 
ATOM   1149 O  O2    . U   B 1 26  ? -27.077 9.535   -21.106 1.00 37.02 ? 26  U   D O2    1 
ATOM   1150 N  N3    . U   B 1 26  ? -27.928 7.945   -22.468 1.00 34.89 ? 26  U   D N3    1 
ATOM   1151 C  C4    . U   B 1 26  ? -28.886 7.417   -23.300 1.00 35.73 ? 26  U   D C4    1 
ATOM   1152 O  O4    . U   B 1 26  ? -28.707 6.300   -23.787 1.00 40.86 ? 26  U   D O4    1 
ATOM   1153 C  C5    . U   B 1 26  ? -30.041 8.243   -23.480 1.00 33.35 ? 26  U   D C5    1 
ATOM   1154 C  C6    . U   B 1 26  ? -30.124 9.413   -22.841 1.00 32.15 ? 26  U   D C6    1 
ATOM   1155 P  P     . A   B 1 27  ? -28.465 14.609  -24.502 1.00 36.64 ? 27  A   D P     1 
ATOM   1156 O  OP1   . A   B 1 27  ? -28.568 16.083  -24.686 1.00 36.99 ? 27  A   D OP1   1 
ATOM   1157 O  OP2   . A   B 1 27  ? -29.040 13.701  -25.516 1.00 35.05 ? 27  A   D OP2   1 
ATOM   1158 O  "O5'" . A   B 1 27  ? -26.925 14.234  -24.332 1.00 35.43 ? 27  A   D "O5'" 1 
ATOM   1159 C  "C5'" . A   B 1 27  ? -26.162 14.770  -23.263 1.00 32.20 ? 27  A   D "C5'" 1 
ATOM   1160 C  "C4'" . A   B 1 27  ? -24.921 13.943  -23.049 1.00 38.15 ? 27  A   D "C4'" 1 
ATOM   1161 O  "O4'" . A   B 1 27  ? -25.293 12.605  -22.624 1.00 32.19 ? 27  A   D "O4'" 1 
ATOM   1162 C  "C3'" . A   B 1 27  ? -24.086 13.698  -24.293 1.00 39.43 ? 27  A   D "C3'" 1 
ATOM   1163 O  "O3'" . A   B 1 27  ? -23.233 14.793  -24.570 1.00 41.85 ? 27  A   D "O3'" 1 
ATOM   1164 C  "C2'" . A   B 1 27  ? -23.299 12.458  -23.910 1.00 32.34 ? 27  A   D "C2'" 1 
ATOM   1165 O  "O2'" . A   B 1 27  ? -22.221 12.748  -23.054 1.00 37.87 ? 27  A   D "O2'" 1 
ATOM   1166 C  "C1'" . A   B 1 27  ? -24.351 11.669  -23.137 1.00 37.39 ? 27  A   D "C1'" 1 
ATOM   1167 N  N9    . A   B 1 27  ? -25.059 10.717  -23.988 1.00 37.88 ? 27  A   D N9    1 
ATOM   1168 C  C8    . A   B 1 27  ? -26.308 10.842  -24.546 1.00 28.65 ? 27  A   D C8    1 
ATOM   1169 N  N7    . A   B 1 27  ? -26.701 9.774   -25.201 1.00 38.92 ? 27  A   D N7    1 
ATOM   1170 C  C5    . A   B 1 27  ? -25.634 8.897   -25.081 1.00 40.46 ? 27  A   D C5    1 
ATOM   1171 C  C6    . A   B 1 27  ? -25.432 7.585   -25.538 1.00 39.93 ? 27  A   D C6    1 
ATOM   1172 N  N6    . A   B 1 27  ? -26.344 6.892   -26.223 1.00 37.44 ? 27  A   D N6    1 
ATOM   1173 N  N1    . A   B 1 27  ? -24.242 6.998   -25.263 1.00 46.02 ? 27  A   D N1    1 
ATOM   1174 C  C2    . A   B 1 27  ? -23.328 7.696   -24.575 1.00 38.01 ? 27  A   D C2    1 
ATOM   1175 N  N3    . A   B 1 27  ? -23.407 8.932   -24.081 1.00 41.44 ? 27  A   D N3    1 
ATOM   1176 C  C4    . A   B 1 27  ? -24.601 9.479   -24.364 1.00 39.54 ? 27  A   D C4    1 
ATOM   1177 P  P     . U   B 1 28  ? -23.043 15.267  -26.085 1.00 41.88 ? 28  U   D P     1 
ATOM   1178 O  OP1   . U   B 1 28  ? -22.554 16.669  -26.076 1.00 51.98 ? 28  U   D OP1   1 
ATOM   1179 O  OP2   . U   B 1 28  ? -24.288 14.927  -26.824 1.00 51.90 ? 28  U   D OP2   1 
ATOM   1180 O  "O5'" . U   B 1 28  ? -21.888 14.332  -26.639 1.00 43.36 ? 28  U   D "O5'" 1 
ATOM   1181 C  "C5'" . U   B 1 28  ? -20.629 14.260  -25.988 1.00 39.38 ? 28  U   D "C5'" 1 
ATOM   1182 C  "C4'" . U   B 1 28  ? -19.913 13.008  -26.418 1.00 49.79 ? 28  U   D "C4'" 1 
ATOM   1183 O  "O4'" . U   B 1 28  ? -20.704 11.856  -26.027 1.00 49.67 ? 28  U   D "O4'" 1 
ATOM   1184 C  "C3'" . U   B 1 28  ? -19.776 12.832  -27.922 1.00 53.36 ? 28  U   D "C3'" 1 
ATOM   1185 O  "O3'" . U   B 1 28  ? -18.753 13.642  -28.510 1.00 60.32 ? 28  U   D "O3'" 1 
ATOM   1186 C  "C2'" . U   B 1 28  ? -19.560 11.331  -28.049 1.00 43.67 ? 28  U   D "C2'" 1 
ATOM   1187 O  "O2'" . U   B 1 28  ? -18.235 10.947  -27.752 1.00 43.61 ? 28  U   D "O2'" 1 
ATOM   1188 C  "C1'" . U   B 1 28  ? -20.487 10.803  -26.953 1.00 42.54 ? 28  U   D "C1'" 1 
ATOM   1189 N  N1    . U   B 1 28  ? -21.786 10.336  -27.449 1.00 42.92 ? 28  U   D N1    1 
ATOM   1190 C  C2    . U   B 1 28  ? -21.854 9.033   -27.902 1.00 41.04 ? 28  U   D C2    1 
ATOM   1191 O  O2    . U   B 1 28  ? -20.885 8.294   -27.915 1.00 48.15 ? 28  U   D O2    1 
ATOM   1192 N  N3    . U   B 1 28  ? -23.094 8.630   -28.332 1.00 42.39 ? 28  U   D N3    1 
ATOM   1193 C  C4    . U   B 1 28  ? -24.253 9.386   -28.348 1.00 47.09 ? 28  U   D C4    1 
ATOM   1194 O  O4    . U   B 1 28  ? -25.316 8.860   -28.681 1.00 39.19 ? 28  U   D O4    1 
ATOM   1195 C  C5    . U   B 1 28  ? -24.094 10.732  -27.876 1.00 39.80 ? 28  U   D C5    1 
ATOM   1196 C  C6    . U   B 1 28  ? -22.891 11.149  -27.454 1.00 40.04 ? 28  U   D C6    1 
ATOM   1197 N  N     . MET C 2 3   ? 6.086   31.926  -36.022 1.00 64.92 ? 3   MET A N     1 
ATOM   1198 C  CA    . MET C 2 3   ? 4.713   31.823  -35.449 1.00 61.64 ? 3   MET A CA    1 
ATOM   1199 C  C     . MET C 2 3   ? 4.565   30.518  -34.665 1.00 57.99 ? 3   MET A C     1 
ATOM   1200 O  O     . MET C 2 3   ? 4.071   30.521  -33.537 1.00 57.84 ? 3   MET A O     1 
ATOM   1201 C  CB    . MET C 2 3   ? 3.670   31.881  -36.569 1.00 68.27 ? 3   MET A CB    1 
ATOM   1202 C  CG    . MET C 2 3   ? 2.271   32.305  -36.117 1.00 77.42 ? 3   MET A CG    1 
ATOM   1203 S  SD    . MET C 2 3   ? 2.194   34.021  -35.517 1.00 85.06 ? 3   MET A SD    1 
ATOM   1204 C  CE    . MET C 2 3   ? 1.560   33.806  -33.848 1.00 78.49 ? 3   MET A CE    1 
ATOM   1205 N  N     . LEU C 2 4   ? 4.994   29.406  -35.261 1.00 50.26 ? 4   LEU A N     1 
ATOM   1206 C  CA    . LEU C 2 4   ? 4.918   28.111  -34.587 1.00 50.30 ? 4   LEU A CA    1 
ATOM   1207 C  C     . LEU C 2 4   ? 5.702   28.161  -33.287 1.00 48.15 ? 4   LEU A C     1 
ATOM   1208 O  O     . LEU C 2 4   ? 5.305   27.553  -32.294 1.00 49.54 ? 4   LEU A O     1 
ATOM   1209 C  CB    . LEU C 2 4   ? 5.502   26.990  -35.450 1.00 45.34 ? 4   LEU A CB    1 
ATOM   1210 C  CG    . LEU C 2 4   ? 4.803   26.527  -36.727 1.00 50.86 ? 4   LEU A CG    1 
ATOM   1211 C  CD1   . LEU C 2 4   ? 5.527   25.292  -37.256 1.00 41.74 ? 4   LEU A CD1   1 
ATOM   1212 C  CD2   . LEU C 2 4   ? 3.345   26.204  -36.445 1.00 50.64 ? 4   LEU A CD2   1 
ATOM   1213 N  N     . GLU C 2 5   ? 6.826   28.876  -33.306 1.00 48.59 ? 5   GLU A N     1 
ATOM   1214 C  CA    . GLU C 2 5   ? 7.668   29.006  -32.124 1.00 49.92 ? 5   GLU A CA    1 
ATOM   1215 C  C     . GLU C 2 5   ? 6.867   29.597  -30.970 1.00 45.40 ? 5   GLU A C     1 
ATOM   1216 O  O     . GLU C 2 5   ? 7.130   29.294  -29.813 1.00 42.61 ? 5   GLU A O     1 
ATOM   1217 C  CB    . GLU C 2 5   ? 8.882   29.895  -32.414 1.00 59.31 ? 5   GLU A CB    1 
ATOM   1218 C  CG    . GLU C 2 5   ? 9.777   29.406  -33.545 1.00 77.58 ? 5   GLU A CG    1 
ATOM   1219 C  CD    . GLU C 2 5   ? 11.036  30.256  -33.710 1.00 87.33 ? 5   GLU A CD    1 
ATOM   1220 O  OE1   . GLU C 2 5   ? 10.910  31.486  -33.896 1.00 89.66 ? 5   GLU A OE1   1 
ATOM   1221 O  OE2   . GLU C 2 5   ? 12.152  29.695  -33.656 1.00 93.03 ? 5   GLU A OE2   1 
ATOM   1222 N  N     . GLN C 2 6   ? 5.892   30.446  -31.282 1.00 42.09 ? 6   GLN A N     1 
ATOM   1223 C  CA    . GLN C 2 6   ? 5.065   31.050  -30.240 1.00 41.83 ? 6   GLN A CA    1 
ATOM   1224 C  C     . GLN C 2 6   ? 4.173   30.008  -29.571 1.00 39.33 ? 6   GLN A C     1 
ATOM   1225 O  O     . GLN C 2 6   ? 3.963   30.034  -28.349 1.00 37.67 ? 6   GLN A O     1 
ATOM   1226 C  CB    . GLN C 2 6   ? 4.191   32.165  -30.818 1.00 41.27 ? 6   GLN A CB    1 
ATOM   1227 C  CG    . GLN C 2 6   ? 4.950   33.428  -31.189 1.00 51.89 ? 6   GLN A CG    1 
ATOM   1228 C  CD    . GLN C 2 6   ? 4.026   34.553  -31.628 1.00 58.68 ? 6   GLN A CD    1 
ATOM   1229 O  OE1   . GLN C 2 6   ? 3.147   34.982  -30.876 1.00 59.50 ? 6   GLN A OE1   1 
ATOM   1230 N  NE2   . GLN C 2 6   ? 4.220   35.036  -32.851 1.00 59.02 ? 6   GLN A NE2   1 
ATOM   1231 N  N     . LEU C 2 7   ? 3.644   29.087  -30.366 1.00 32.57 ? 7   LEU A N     1 
ATOM   1232 C  CA    . LEU C 2 7   ? 2.778   28.066  -29.802 1.00 41.94 ? 7   LEU A CA    1 
ATOM   1233 C  C     . LEU C 2 7   ? 3.593   27.067  -29.001 1.00 38.44 ? 7   LEU A C     1 
ATOM   1234 O  O     . LEU C 2 7   ? 3.129   26.554  -27.984 1.00 41.80 ? 7   LEU A O     1 
ATOM   1235 C  CB    . LEU C 2 7   ? 2.002   27.343  -30.904 1.00 45.31 ? 7   LEU A CB    1 
ATOM   1236 C  CG    . LEU C 2 7   ? 1.120   26.183  -30.427 1.00 37.95 ? 7   LEU A CG    1 
ATOM   1237 C  CD1   . LEU C 2 7   ? 0.173   26.664  -29.328 1.00 32.47 ? 7   LEU A CD1   1 
ATOM   1238 C  CD2   . LEU C 2 7   ? 0.359   25.610  -31.619 1.00 31.76 ? 7   LEU A CD2   1 
ATOM   1239 N  N     . GLU C 2 8   ? 4.811   26.792  -29.460 1.00 42.40 ? 8   GLU A N     1 
ATOM   1240 C  CA    . GLU C 2 8   ? 5.681   25.854  -28.766 1.00 39.21 ? 8   GLU A CA    1 
ATOM   1241 C  C     . GLU C 2 8   ? 6.022   26.426  -27.396 1.00 41.40 ? 8   GLU A C     1 
ATOM   1242 O  O     . GLU C 2 8   ? 6.105   25.699  -26.405 1.00 37.62 ? 8   GLU A O     1 
ATOM   1243 C  CB    . GLU C 2 8   ? 6.944   25.596  -29.592 1.00 37.99 ? 8   GLU A CB    1 
ATOM   1244 C  CG    . GLU C 2 8   ? 6.663   24.838  -30.888 1.00 38.95 ? 8   GLU A CG    1 
ATOM   1245 C  CD    . GLU C 2 8   ? 7.892   24.645  -31.762 1.00 40.44 ? 8   GLU A CD    1 
ATOM   1246 O  OE1   . GLU C 2 8   ? 8.626   25.629  -31.979 1.00 49.07 ? 8   GLU A OE1   1 
ATOM   1247 O  OE2   . GLU C 2 8   ? 8.115   23.514  -32.247 1.00 44.68 ? 8   GLU A OE2   1 
ATOM   1248 N  N     . LYS C 2 9   ? 6.191   27.741  -27.331 1.00 37.81 ? 9   LYS A N     1 
ATOM   1249 C  CA    . LYS C 2 9   ? 6.497   28.370  -26.061 1.00 39.24 ? 9   LYS A CA    1 
ATOM   1250 C  C     . LYS C 2 9   ? 5.304   28.227  -25.115 1.00 42.73 ? 9   LYS A C     1 
ATOM   1251 O  O     . LYS C 2 9   ? 5.482   27.957  -23.928 1.00 39.45 ? 9   LYS A O     1 
ATOM   1252 C  CB    . LYS C 2 9   ? 6.848   29.849  -26.260 1.00 48.32 ? 9   LYS A CB    1 
ATOM   1253 C  CG    . LYS C 2 9   ? 7.409   30.501  -25.003 1.00 52.88 ? 9   LYS A CG    1 
ATOM   1254 C  CD    . LYS C 2 9   ? 7.984   31.875  -25.266 1.00 60.00 ? 9   LYS A CD    1 
ATOM   1255 C  CE    . LYS C 2 9   ? 8.565   32.455  -23.984 1.00 66.85 ? 9   LYS A CE    1 
ATOM   1256 N  NZ    . LYS C 2 9   ? 9.217   33.777  -24.198 1.00 71.01 ? 9   LYS A NZ    1 
ATOM   1257 N  N     . LYS C 2 10  ? 4.087   28.398  -25.632 1.00 41.02 ? 10  LYS A N     1 
ATOM   1258 C  CA    . LYS C 2 10  ? 2.899   28.265  -24.791 1.00 42.07 ? 10  LYS A CA    1 
ATOM   1259 C  C     . LYS C 2 10  ? 2.767   26.816  -24.332 1.00 46.09 ? 10  LYS A C     1 
ATOM   1260 O  O     . LYS C 2 10  ? 2.450   26.543  -23.174 1.00 48.24 ? 10  LYS A O     1 
ATOM   1261 C  CB    . LYS C 2 10  ? 1.630   28.659  -25.551 1.00 43.36 ? 10  LYS A CB    1 
ATOM   1262 C  CG    . LYS C 2 10  ? 1.684   30.028  -26.208 1.00 49.38 ? 10  LYS A CG    1 
ATOM   1263 C  CD    . LYS C 2 10  ? 0.349   30.396  -26.828 1.00 52.89 ? 10  LYS A CD    1 
ATOM   1264 C  CE    . LYS C 2 10  ? 0.487   31.613  -27.727 1.00 61.99 ? 10  LYS A CE    1 
ATOM   1265 N  NZ    . LYS C 2 10  ? 1.078   32.786  -27.024 1.00 66.77 ? 10  LYS A NZ    1 
ATOM   1266 N  N     . LEU C 2 11  ? 3.014   25.891  -25.252 1.00 36.01 ? 11  LEU A N     1 
ATOM   1267 C  CA    . LEU C 2 11  ? 2.925   24.470  -24.956 1.00 41.90 ? 11  LEU A CA    1 
ATOM   1268 C  C     . LEU C 2 11  ? 4.041   24.070  -24.002 1.00 42.36 ? 11  LEU A C     1 
ATOM   1269 O  O     . LEU C 2 11  ? 3.861   23.217  -23.139 1.00 47.10 ? 11  LEU A O     1 
ATOM   1270 C  CB    . LEU C 2 11  ? 3.050   23.679  -26.259 1.00 40.43 ? 11  LEU A CB    1 
ATOM   1271 C  CG    . LEU C 2 11  ? 1.931   22.725  -26.668 1.00 53.42 ? 11  LEU A CG    1 
ATOM   1272 C  CD1   . LEU C 2 11  ? 0.579   23.244  -26.221 1.00 53.90 ? 11  LEU A CD1   1 
ATOM   1273 C  CD2   . LEU C 2 11  ? 1.975   22.556  -28.177 1.00 50.38 ? 11  LEU A CD2   1 
ATOM   1274 N  N     . GLY C 2 12  ? 5.195   24.711  -24.162 1.00 45.70 ? 12  GLY A N     1 
ATOM   1275 C  CA    . GLY C 2 12  ? 6.344   24.392  -23.342 1.00 32.90 ? 12  GLY A CA    1 
ATOM   1276 C  C     . GLY C 2 12  ? 7.051   23.189  -23.945 1.00 38.26 ? 12  GLY A C     1 
ATOM   1277 O  O     . GLY C 2 12  ? 7.633   22.390  -23.223 1.00 39.95 ? 12  GLY A O     1 
ATOM   1278 N  N     . TYR C 2 13  ? 7.001   23.053  -25.273 1.00 31.86 ? 13  TYR A N     1 
ATOM   1279 C  CA    . TYR C 2 13  ? 7.645   21.933  -25.944 1.00 32.40 ? 13  TYR A CA    1 
ATOM   1280 C  C     . TYR C 2 13  ? 8.004   22.258  -27.382 1.00 36.87 ? 13  TYR A C     1 
ATOM   1281 O  O     . TYR C 2 13  ? 7.164   22.733  -28.144 1.00 33.79 ? 13  TYR A O     1 
ATOM   1282 C  CB    . TYR C 2 13  ? 6.731   20.709  -25.926 1.00 32.19 ? 13  TYR A CB    1 
ATOM   1283 C  CG    . TYR C 2 13  ? 7.231   19.556  -26.766 1.00 35.64 ? 13  TYR A CG    1 
ATOM   1284 C  CD1   . TYR C 2 13  ? 8.185   18.664  -26.271 1.00 25.28 ? 13  TYR A CD1   1 
ATOM   1285 C  CD2   . TYR C 2 13  ? 6.748   19.355  -28.066 1.00 34.25 ? 13  TYR A CD2   1 
ATOM   1286 C  CE1   . TYR C 2 13  ? 8.649   17.595  -27.048 1.00 33.01 ? 13  TYR A CE1   1 
ATOM   1287 C  CE2   . TYR C 2 13  ? 7.199   18.292  -28.849 1.00 29.51 ? 13  TYR A CE2   1 
ATOM   1288 C  CZ    . TYR C 2 13  ? 8.149   17.415  -28.337 1.00 39.60 ? 13  TYR A CZ    1 
ATOM   1289 O  OH    . TYR C 2 13  ? 8.589   16.362  -29.112 1.00 33.40 ? 13  TYR A OH    1 
ATOM   1290 N  N     . THR C 2 14  ? 9.250   21.967  -27.751 1.00 36.19 ? 14  THR A N     1 
ATOM   1291 C  CA    . THR C 2 14  ? 9.747   22.223  -29.096 1.00 35.42 ? 14  THR A CA    1 
ATOM   1292 C  C     . THR C 2 14  ? 9.727   20.958  -29.948 1.00 40.65 ? 14  THR A C     1 
ATOM   1293 O  O     . THR C 2 14  ? 10.303  19.929  -29.582 1.00 37.63 ? 14  THR A O     1 
ATOM   1294 C  CB    . THR C 2 14  ? 11.181  22.793  -29.049 1.00 38.51 ? 14  THR A CB    1 
ATOM   1295 O  OG1   . THR C 2 14  ? 11.180  24.002  -28.286 1.00 41.94 ? 14  THR A OG1   1 
ATOM   1296 C  CG2   . THR C 2 14  ? 11.682  23.105  -30.443 1.00 35.38 ? 14  THR A CG2   1 
ATOM   1297 N  N     . PHE C 2 15  ? 9.054   21.045  -31.092 1.00 36.48 ? 15  PHE A N     1 
ATOM   1298 C  CA    . PHE C 2 15  ? 8.926   19.911  -31.991 1.00 34.91 ? 15  PHE A CA    1 
ATOM   1299 C  C     . PHE C 2 15  ? 10.170  19.615  -32.798 1.00 39.01 ? 15  PHE A C     1 
ATOM   1300 O  O     . PHE C 2 15  ? 10.913  20.516  -33.171 1.00 40.95 ? 15  PHE A O     1 
ATOM   1301 C  CB    . PHE C 2 15  ? 7.772   20.135  -32.965 1.00 37.43 ? 15  PHE A CB    1 
ATOM   1302 C  CG    . PHE C 2 15  ? 6.431   19.741  -32.427 1.00 31.49 ? 15  PHE A CG    1 
ATOM   1303 C  CD1   . PHE C 2 15  ? 5.789   20.520  -31.478 1.00 31.52 ? 15  PHE A CD1   1 
ATOM   1304 C  CD2   . PHE C 2 15  ? 5.797   18.593  -32.894 1.00 34.89 ? 15  PHE A CD2   1 
ATOM   1305 C  CE1   . PHE C 2 15  ? 4.531   20.169  -31.004 1.00 35.23 ? 15  PHE A CE1   1 
ATOM   1306 C  CE2   . PHE C 2 15  ? 4.536   18.232  -32.421 1.00 38.14 ? 15  PHE A CE2   1 
ATOM   1307 C  CZ    . PHE C 2 15  ? 3.905   19.024  -31.476 1.00 25.78 ? 15  PHE A CZ    1 
ATOM   1308 N  N     . LYS C 2 16  ? 10.385  18.335  -33.065 1.00 39.35 ? 16  LYS A N     1 
ATOM   1309 C  CA    . LYS C 2 16  ? 11.507  17.899  -33.875 1.00 41.95 ? 16  LYS A CA    1 
ATOM   1310 C  C     . LYS C 2 16  ? 11.000  17.922  -35.317 1.00 45.28 ? 16  LYS A C     1 
ATOM   1311 O  O     . LYS C 2 16  ? 11.695  18.367  -36.231 1.00 46.64 ? 16  LYS A O     1 
ATOM   1312 C  CB    . LYS C 2 16  ? 11.920  16.481  -33.490 1.00 36.14 ? 16  LYS A CB    1 
ATOM   1313 C  CG    . LYS C 2 16  ? 13.003  15.892  -34.375 1.00 37.26 ? 16  LYS A CG    1 
ATOM   1314 C  CD    . LYS C 2 16  ? 13.350  14.473  -33.940 1.00 41.78 ? 16  LYS A CD    1 
ATOM   1315 C  CE    . LYS C 2 16  ? 14.185  13.772  -34.987 1.00 45.86 ? 16  LYS A CE    1 
ATOM   1316 N  NZ    . LYS C 2 16  ? 15.474  14.469  -35.257 1.00 50.83 ? 16  LYS A NZ    1 
ATOM   1317 N  N     . ASP C 2 17  ? 9.771   17.445  -35.502 1.00 42.42 ? 17  ASP A N     1 
ATOM   1318 C  CA    . ASP C 2 17  ? 9.135   17.409  -36.817 1.00 42.47 ? 17  ASP A CA    1 
ATOM   1319 C  C     . ASP C 2 17  ? 8.032   18.469  -36.859 1.00 44.01 ? 17  ASP A C     1 
ATOM   1320 O  O     . ASP C 2 17  ? 6.910   18.234  -36.402 1.00 40.22 ? 17  ASP A O     1 
ATOM   1321 C  CB    . ASP C 2 17  ? 8.541   16.028  -37.065 1.00 42.57 ? 17  ASP A CB    1 
ATOM   1322 C  CG    . ASP C 2 17  ? 7.909   15.903  -38.432 1.00 51.14 ? 17  ASP A CG    1 
ATOM   1323 O  OD1   . ASP C 2 17  ? 7.669   16.953  -39.072 1.00 51.06 ? 17  ASP A OD1   1 
ATOM   1324 O  OD2   . ASP C 2 17  ? 7.641   14.756  -38.860 1.00 48.44 ? 17  ASP A OD2   1 
ATOM   1325 N  N     . LYS C 2 18  ? 8.360   19.629  -37.418 1.00 40.53 ? 18  LYS A N     1 
ATOM   1326 C  CA    . LYS C 2 18  ? 7.424   20.747  -37.505 1.00 41.79 ? 18  LYS A CA    1 
ATOM   1327 C  C     . LYS C 2 18  ? 6.180   20.464  -38.337 1.00 43.15 ? 18  LYS A C     1 
ATOM   1328 O  O     . LYS C 2 18  ? 5.102   21.003  -38.065 1.00 42.75 ? 18  LYS A O     1 
ATOM   1329 C  CB    . LYS C 2 18  ? 8.137   21.972  -38.072 1.00 47.24 ? 18  LYS A CB    1 
ATOM   1330 C  CG    . LYS C 2 18  ? 9.436   22.321  -37.359 1.00 50.48 ? 18  LYS A CG    1 
ATOM   1331 C  CD    . LYS C 2 18  ? 9.213   22.645  -35.897 1.00 46.25 ? 18  LYS A CD    1 
ATOM   1332 C  CE    . LYS C 2 18  ? 10.522  23.018  -35.225 1.00 44.47 ? 18  LYS A CE    1 
ATOM   1333 N  NZ    . LYS C 2 18  ? 10.370  23.176  -33.753 1.00 48.27 ? 18  LYS A NZ    1 
ATOM   1334 N  N     . SER C 2 19  ? 6.329   19.635  -39.364 1.00 44.92 ? 19  SER A N     1 
ATOM   1335 C  CA    . SER C 2 19  ? 5.199   19.300  -40.213 1.00 42.46 ? 19  SER A CA    1 
ATOM   1336 C  C     . SER C 2 19  ? 4.138   18.588  -39.379 1.00 43.17 ? 19  SER A C     1 
ATOM   1337 O  O     . SER C 2 19  ? 2.946   18.643  -39.696 1.00 39.12 ? 19  SER A O     1 
ATOM   1338 C  CB    . SER C 2 19  ? 5.646   18.406  -41.370 1.00 37.58 ? 19  SER A CB    1 
ATOM   1339 O  OG    . SER C 2 19  ? 6.048   17.136  -40.897 1.00 53.25 ? 19  SER A OG    1 
ATOM   1340 N  N     . LEU C 2 20  ? 4.574   17.921  -38.312 1.00 42.62 ? 20  LEU A N     1 
ATOM   1341 C  CA    . LEU C 2 20  ? 3.643   17.222  -37.438 1.00 38.54 ? 20  LEU A CA    1 
ATOM   1342 C  C     . LEU C 2 20  ? 2.821   18.251  -36.661 1.00 40.77 ? 20  LEU A C     1 
ATOM   1343 O  O     . LEU C 2 20  ? 1.595   18.146  -36.563 1.00 39.17 ? 20  LEU A O     1 
ATOM   1344 C  CB    . LEU C 2 20  ? 4.391   16.327  -36.459 1.00 41.94 ? 20  LEU A CB    1 
ATOM   1345 C  CG    . LEU C 2 20  ? 3.810   14.923  -36.257 1.00 49.10 ? 20  LEU A CG    1 
ATOM   1346 C  CD1   . LEU C 2 20  ? 4.495   14.277  -35.061 1.00 44.97 ? 20  LEU A CD1   1 
ATOM   1347 C  CD2   . LEU C 2 20  ? 2.302   14.991  -36.033 1.00 44.74 ? 20  LEU A CD2   1 
ATOM   1348 N  N     . LEU C 2 21  ? 3.497   19.245  -36.096 1.00 36.13 ? 21  LEU A N     1 
ATOM   1349 C  CA    . LEU C 2 21  ? 2.797   20.284  -35.357 1.00 36.80 ? 21  LEU A CA    1 
ATOM   1350 C  C     . LEU C 2 21  ? 1.833   20.998  -36.318 1.00 35.52 ? 21  LEU A C     1 
ATOM   1351 O  O     . LEU C 2 21  ? 0.685   21.302  -35.964 1.00 33.21 ? 21  LEU A O     1 
ATOM   1352 C  CB    . LEU C 2 21  ? 3.805   21.276  -34.773 1.00 38.21 ? 21  LEU A CB    1 
ATOM   1353 C  CG    . LEU C 2 21  ? 3.253   22.554  -34.139 1.00 41.06 ? 21  LEU A CG    1 
ATOM   1354 C  CD1   . LEU C 2 21  ? 2.210   22.218  -33.073 1.00 40.75 ? 21  LEU A CD1   1 
ATOM   1355 C  CD2   . LEU C 2 21  ? 4.404   23.343  -33.551 1.00 35.17 ? 21  LEU A CD2   1 
ATOM   1356 N  N     . GLU C 2 22  ? 2.307   21.252  -37.536 1.00 36.45 ? 22  GLU A N     1 
ATOM   1357 C  CA    . GLU C 2 22  ? 1.504   21.917  -38.556 1.00 39.24 ? 22  GLU A CA    1 
ATOM   1358 C  C     . GLU C 2 22  ? 0.261   21.097  -38.877 1.00 38.58 ? 22  GLU A C     1 
ATOM   1359 O  O     . GLU C 2 22  ? -0.848  21.627  -38.915 1.00 37.89 ? 22  GLU A O     1 
ATOM   1360 C  CB    . GLU C 2 22  ? 2.312   22.107  -39.841 1.00 42.39 ? 22  GLU A CB    1 
ATOM   1361 C  CG    . GLU C 2 22  ? 3.548   22.979  -39.703 1.00 58.40 ? 22  GLU A CG    1 
ATOM   1362 C  CD    . GLU C 2 22  ? 4.356   23.044  -40.991 1.00 68.25 ? 22  GLU A CD    1 
ATOM   1363 O  OE1   . GLU C 2 22  ? 4.736   21.969  -41.505 1.00 70.05 ? 22  GLU A OE1   1 
ATOM   1364 O  OE2   . GLU C 2 22  ? 4.611   24.163  -41.491 1.00 69.03 ? 22  GLU A OE2   1 
ATOM   1365 N  N     . LYS C 2 23  ? 0.448   19.800  -39.104 1.00 36.11 ? 23  LYS A N     1 
ATOM   1366 C  CA    . LYS C 2 23  ? -0.674  18.941  -39.438 1.00 36.30 ? 23  LYS A CA    1 
ATOM   1367 C  C     . LYS C 2 23  ? -1.771  19.012  -38.378 1.00 31.59 ? 23  LYS A C     1 
ATOM   1368 O  O     . LYS C 2 23  ? -2.960  19.023  -38.710 1.00 38.42 ? 23  LYS A O     1 
ATOM   1369 C  CB    . LYS C 2 23  ? -0.221  17.486  -39.616 1.00 36.58 ? 23  LYS A CB    1 
ATOM   1370 C  CG    . LYS C 2 23  ? -1.325  16.608  -40.199 1.00 43.85 ? 23  LYS A CG    1 
ATOM   1371 C  CD    . LYS C 2 23  ? -1.202  15.146  -39.806 1.00 49.56 ? 23  LYS A CD    1 
ATOM   1372 C  CE    . LYS C 2 23  ? -0.150  14.420  -40.601 1.00 46.87 ? 23  LYS A CE    1 
ATOM   1373 N  NZ    . LYS C 2 23  ? -0.226  12.961  -40.332 1.00 55.39 ? 23  LYS A NZ    1 
ATOM   1374 N  N     . ALA C 2 24  ? -1.380  19.080  -37.109 1.00 30.95 ? 24  ALA A N     1 
ATOM   1375 C  CA    . ALA C 2 24  ? -2.356  19.150  -36.022 1.00 32.67 ? 24  ALA A CA    1 
ATOM   1376 C  C     . ALA C 2 24  ? -3.185  20.427  -36.090 1.00 41.71 ? 24  ALA A C     1 
ATOM   1377 O  O     . ALA C 2 24  ? -4.341  20.464  -35.656 1.00 33.19 ? 24  ALA A O     1 
ATOM   1378 C  CB    . ALA C 2 24  ? -1.652  19.075  -34.681 1.00 32.48 ? 24  ALA A CB    1 
ATOM   1379 N  N     . LEU C 2 25  ? -2.582  21.473  -36.644 1.00 41.57 ? 25  LEU A N     1 
ATOM   1380 C  CA    . LEU C 2 25  ? -3.229  22.775  -36.760 1.00 42.05 ? 25  LEU A CA    1 
ATOM   1381 C  C     . LEU C 2 25  ? -3.986  22.948  -38.065 1.00 39.77 ? 25  LEU A C     1 
ATOM   1382 O  O     . LEU C 2 25  ? -4.671  23.951  -38.256 1.00 43.31 ? 25  LEU A O     1 
ATOM   1383 C  CB    . LEU C 2 25  ? -2.166  23.879  -36.673 1.00 38.57 ? 25  LEU A CB    1 
ATOM   1384 C  CG    . LEU C 2 25  ? -1.295  23.902  -35.411 1.00 46.18 ? 25  LEU A CG    1 
ATOM   1385 C  CD1   . LEU C 2 25  ? -0.131  24.897  -35.571 1.00 37.01 ? 25  LEU A CD1   1 
ATOM   1386 C  CD2   . LEU C 2 25  ? -2.171  24.265  -34.210 1.00 34.39 ? 25  LEU A CD2   1 
ATOM   1387 N  N     . THR C 2 26  ? -3.866  21.971  -38.956 1.00 34.22 ? 26  THR A N     1 
ATOM   1388 C  CA    . THR C 2 26  ? -4.469  22.060  -40.281 1.00 35.53 ? 26  THR A CA    1 
ATOM   1389 C  C     . THR C 2 26  ? -5.778  21.325  -40.538 1.00 39.81 ? 26  THR A C     1 
ATOM   1390 O  O     . THR C 2 26  ? -5.866  20.100  -40.419 1.00 38.06 ? 26  THR A O     1 
ATOM   1391 C  CB    . THR C 2 26  ? -3.426  21.628  -41.333 1.00 36.12 ? 26  THR A CB    1 
ATOM   1392 O  OG1   . THR C 2 26  ? -2.253  22.428  -41.158 1.00 35.87 ? 26  THR A OG1   1 
ATOM   1393 C  CG2   . THR C 2 26  ? -3.946  21.821  -42.759 1.00 35.11 ? 26  THR A CG2   1 
ATOM   1394 N  N     . HIS C 2 27  ? -6.794  22.100  -40.907 1.00 40.28 ? 27  HIS A N     1 
ATOM   1395 C  CA    . HIS C 2 27  ? -8.121  21.574  -41.214 1.00 34.32 ? 27  HIS A CA    1 
ATOM   1396 C  C     . HIS C 2 27  ? -8.090  21.068  -42.655 1.00 34.90 ? 27  HIS A C     1 
ATOM   1397 O  O     . HIS C 2 27  ? -7.335  21.580  -43.478 1.00 41.03 ? 27  HIS A O     1 
ATOM   1398 C  CB    . HIS C 2 27  ? -9.155  22.684  -41.048 1.00 34.81 ? 27  HIS A CB    1 
ATOM   1399 C  CG    . HIS C 2 27  ? -10.565 22.251  -41.303 1.00 41.39 ? 27  HIS A CG    1 
ATOM   1400 N  ND1   . HIS C 2 27  ? -11.165 22.362  -42.539 1.00 41.03 ? 27  HIS A ND1   1 
ATOM   1401 C  CD2   . HIS C 2 27  ? -11.488 21.696  -40.483 1.00 37.76 ? 27  HIS A CD2   1 
ATOM   1402 C  CE1   . HIS C 2 27  ? -12.398 21.893  -42.468 1.00 43.13 ? 27  HIS A CE1   1 
ATOM   1403 N  NE2   . HIS C 2 27  ? -12.618 21.482  -41.232 1.00 49.59 ? 27  HIS A NE2   1 
ATOM   1404 N  N     . VAL C 2 28  ? -8.898  20.058  -42.954 1.00 33.03 ? 28  VAL A N     1 
ATOM   1405 C  CA    . VAL C 2 28  ? -8.933  19.469  -44.290 1.00 41.93 ? 28  VAL A CA    1 
ATOM   1406 C  C     . VAL C 2 28  ? -9.222  20.467  -45.420 1.00 45.94 ? 28  VAL A C     1 
ATOM   1407 O  O     . VAL C 2 28  ? -8.806  20.253  -46.556 1.00 45.10 ? 28  VAL A O     1 
ATOM   1408 C  CB    . VAL C 2 28  ? -9.964  18.324  -44.344 1.00 37.36 ? 28  VAL A CB    1 
ATOM   1409 C  CG1   . VAL C 2 28  ? -11.364 18.877  -44.130 1.00 39.63 ? 28  VAL A CG1   1 
ATOM   1410 C  CG2   . VAL C 2 28  ? -9.852  17.579  -45.659 1.00 42.71 ? 28  VAL A CG2   1 
ATOM   1411 N  N     . SER C 2 29  ? -9.916  21.557  -45.103 1.00 45.54 ? 29  SER A N     1 
ATOM   1412 C  CA    . SER C 2 29  ? -10.255 22.571  -46.104 1.00 46.77 ? 29  SER A CA    1 
ATOM   1413 C  C     . SER C 2 29  ? -9.015  23.272  -46.645 1.00 50.58 ? 29  SER A C     1 
ATOM   1414 O  O     . SER C 2 29  ? -8.990  23.690  -47.798 1.00 51.05 ? 29  SER A O     1 
ATOM   1415 C  CB    . SER C 2 29  ? -11.196 23.621  -45.509 1.00 45.61 ? 29  SER A CB    1 
ATOM   1416 O  OG    . SER C 2 29  ? -10.516 24.457  -44.583 1.00 46.15 ? 29  SER A OG    1 
ATOM   1417 N  N     . TYR C 2 30  ? -7.990  23.391  -45.804 1.00 50.51 ? 30  TYR A N     1 
ATOM   1418 C  CA    . TYR C 2 30  ? -6.734  24.040  -46.173 1.00 48.37 ? 30  TYR A CA    1 
ATOM   1419 C  C     . TYR C 2 30  ? -5.760  23.073  -46.838 1.00 49.06 ? 30  TYR A C     1 
ATOM   1420 O  O     . TYR C 2 30  ? -4.992  23.463  -47.715 1.00 54.19 ? 30  TYR A O     1 
ATOM   1421 C  CB    . TYR C 2 30  ? -6.097  24.643  -44.921 1.00 46.87 ? 30  TYR A CB    1 
ATOM   1422 C  CG    . TYR C 2 30  ? -4.825  25.431  -45.144 1.00 51.18 ? 30  TYR A CG    1 
ATOM   1423 C  CD1   . TYR C 2 30  ? -3.597  24.789  -45.322 1.00 49.98 ? 30  TYR A CD1   1 
ATOM   1424 C  CD2   . TYR C 2 30  ? -4.841  26.827  -45.126 1.00 51.20 ? 30  TYR A CD2   1 
ATOM   1425 C  CE1   . TYR C 2 30  ? -2.417  25.519  -45.468 1.00 48.18 ? 30  TYR A CE1   1 
ATOM   1426 C  CE2   . TYR C 2 30  ? -3.668  27.564  -45.273 1.00 54.90 ? 30  TYR A CE2   1 
ATOM   1427 C  CZ    . TYR C 2 30  ? -2.462  26.903  -45.440 1.00 51.20 ? 30  TYR A CZ    1 
ATOM   1428 O  OH    . TYR C 2 30  ? -1.307  27.634  -45.559 1.00 57.53 ? 30  TYR A OH    1 
ATOM   1429 N  N     . SER C 2 31  ? -5.796  21.813  -46.421 1.00 48.42 ? 31  SER A N     1 
ATOM   1430 C  CA    . SER C 2 31  ? -4.913  20.797  -46.977 1.00 43.75 ? 31  SER A CA    1 
ATOM   1431 C  C     . SER C 2 31  ? -5.614  19.446  -47.016 1.00 48.12 ? 31  SER A C     1 
ATOM   1432 O  O     . SER C 2 31  ? -5.845  18.816  -45.975 1.00 45.72 ? 31  SER A O     1 
ATOM   1433 C  CB    . SER C 2 31  ? -3.644  20.696  -46.132 1.00 49.58 ? 31  SER A CB    1 
ATOM   1434 O  OG    . SER C 2 31  ? -2.858  19.591  -46.535 1.00 47.06 ? 31  SER A OG    1 
ATOM   1435 N  N     . LYS C 2 32  ? -5.943  18.994  -48.221 1.00 48.02 ? 32  LYS A N     1 
ATOM   1436 C  CA    . LYS C 2 32  ? -6.641  17.729  -48.380 1.00 51.21 ? 32  LYS A CA    1 
ATOM   1437 C  C     . LYS C 2 32  ? -5.797  16.521  -48.006 1.00 50.57 ? 32  LYS A C     1 
ATOM   1438 O  O     . LYS C 2 32  ? -6.335  15.479  -47.650 1.00 49.75 ? 32  LYS A O     1 
ATOM   1439 C  CB    . LYS C 2 32  ? -7.142  17.574  -49.822 1.00 58.00 ? 32  LYS A CB    1 
ATOM   1440 C  CG    . LYS C 2 32  ? -6.047  17.357  -50.859 1.00 70.95 ? 32  LYS A CG    1 
ATOM   1441 C  CD    . LYS C 2 32  ? -6.631  17.178  -52.251 1.00 82.91 ? 32  LYS A CD    1 
ATOM   1442 C  CE    . LYS C 2 32  ? -5.564  16.773  -53.266 1.00 89.62 ? 32  LYS A CE    1 
ATOM   1443 N  NZ    . LYS C 2 32  ? -4.487  17.794  -53.413 1.00 94.60 ? 32  LYS A NZ    1 
ATOM   1444 N  N     . LYS C 2 33  ? -4.478  16.654  -48.068 1.00 49.51 ? 33  LYS A N     1 
ATOM   1445 C  CA    . LYS C 2 33  ? -3.619  15.518  -47.756 1.00 58.46 ? 33  LYS A CA    1 
ATOM   1446 C  C     . LYS C 2 33  ? -3.032  15.476  -46.341 1.00 55.40 ? 33  LYS A C     1 
ATOM   1447 O  O     . LYS C 2 33  ? -2.905  14.399  -45.760 1.00 55.38 ? 33  LYS A O     1 
ATOM   1448 C  CB    . LYS C 2 33  ? -2.512  15.402  -48.810 1.00 61.99 ? 33  LYS A CB    1 
ATOM   1449 C  CG    . LYS C 2 33  ? -1.747  16.684  -49.077 1.00 73.97 ? 33  LYS A CG    1 
ATOM   1450 C  CD    . LYS C 2 33  ? -0.773  16.515  -50.241 1.00 84.00 ? 33  LYS A CD    1 
ATOM   1451 C  CE    . LYS C 2 33  ? 0.180   15.341  -50.021 1.00 93.75 ? 33  LYS A CE    1 
ATOM   1452 N  NZ    . LYS C 2 33  ? 0.966   15.460  -48.753 1.00 97.87 ? 33  LYS A NZ    1 
ATOM   1453 N  N     . GLU C 2 34  ? -2.685  16.628  -45.776 1.00 49.52 ? 34  GLU A N     1 
ATOM   1454 C  CA    . GLU C 2 34  ? -2.135  16.645  -44.425 1.00 47.14 ? 34  GLU A CA    1 
ATOM   1455 C  C     . GLU C 2 34  ? -2.986  17.481  -43.471 1.00 47.40 ? 34  GLU A C     1 
ATOM   1456 O  O     . GLU C 2 34  ? -2.752  18.679  -43.310 1.00 49.47 ? 34  GLU A O     1 
ATOM   1457 C  CB    . GLU C 2 34  ? -0.701  17.191  -44.427 1.00 52.63 ? 34  GLU A CB    1 
ATOM   1458 C  CG    . GLU C 2 34  ? 0.278   16.477  -45.354 1.00 57.19 ? 34  GLU A CG    1 
ATOM   1459 C  CD    . GLU C 2 34  ? 0.477   15.012  -45.009 1.00 67.82 ? 34  GLU A CD    1 
ATOM   1460 O  OE1   . GLU C 2 34  ? 0.746   14.703  -43.829 1.00 73.07 ? 34  GLU A OE1   1 
ATOM   1461 O  OE2   . GLU C 2 34  ? 0.376   14.166  -45.924 1.00 70.15 ? 34  GLU A OE2   1 
ATOM   1462 N  N     . HIS C 2 35  ? -3.979  16.859  -42.846 1.00 41.81 ? 35  HIS A N     1 
ATOM   1463 C  CA    . HIS C 2 35  ? -4.820  17.578  -41.898 1.00 45.41 ? 35  HIS A CA    1 
ATOM   1464 C  C     . HIS C 2 35  ? -4.935  16.806  -40.585 1.00 41.93 ? 35  HIS A C     1 
ATOM   1465 O  O     . HIS C 2 35  ? -4.449  15.673  -40.486 1.00 39.61 ? 35  HIS A O     1 
ATOM   1466 C  CB    . HIS C 2 35  ? -6.162  17.918  -42.503 1.00 41.72 ? 35  HIS A CB    1 
ATOM   1467 C  CG    . HIS C 2 35  ? -6.963  16.675  -42.913 1.00 46.89 ? 35  HIS A CG    1 
ATOM   1468 N  ND1   . HIS C 2 35  ? -7.731  15.949  -42.028 1.00 41.65 ? 35  HIS A ND1   1 
ATOM   1469 C  CD2   . HIS C 2 35  ? -7.096  16.071  -44.117 1.00 39.13 ? 35  HIS A CD2   1 
ATOM   1470 C  CE1   . HIS C 2 35  ? -8.309  14.952  -42.674 1.00 47.61 ? 35  HIS A CE1   1 
ATOM   1471 N  NE2   . HIS C 2 35  ? -7.940  15.002  -43.942 1.00 37.35 ? 35  HIS A NE2   1 
ATOM   1472 N  N     . TYR C 2 36  ? -5.560  17.417  -39.586 1.00 37.03 ? 36  TYR A N     1 
ATOM   1473 C  CA    . TYR C 2 36  ? -5.608  16.827  -38.222 1.00 42.08 ? 36  TYR A CA    1 
ATOM   1474 C  C     . TYR C 2 36  ? -6.627  15.711  -37.901 1.00 36.46 ? 36  TYR A C     1 
ATOM   1475 O  O     . TYR C 2 36  ? -6.743  15.316  -36.748 1.00 38.32 ? 36  TYR A O     1 
ATOM   1476 C  CB    . TYR C 2 36  ? -5.820  17.965  -37.222 1.00 29.11 ? 36  TYR A CB    1 
ATOM   1477 C  CG    . TYR C 2 36  ? -7.165  18.653  -37.332 1.00 38.24 ? 36  TYR A CG    1 
ATOM   1478 C  CD1   . TYR C 2 36  ? -8.346  17.963  -37.035 1.00 32.59 ? 36  TYR A CD1   1 
ATOM   1479 C  CD2   . TYR C 2 36  ? -7.258  20.007  -37.684 1.00 33.01 ? 36  TYR A CD2   1 
ATOM   1480 C  CE1   . TYR C 2 36  ? -9.586  18.599  -37.084 1.00 36.06 ? 36  TYR A CE1   1 
ATOM   1481 C  CE2   . TYR C 2 36  ? -8.483  20.649  -37.732 1.00 36.08 ? 36  TYR A CE2   1 
ATOM   1482 C  CZ    . TYR C 2 36  ? -9.640  19.944  -37.433 1.00 43.44 ? 36  TYR A CZ    1 
ATOM   1483 O  OH    . TYR C 2 36  ? -10.847 20.592  -37.479 1.00 36.72 ? 36  TYR A OH    1 
ATOM   1484 N  N     . GLU C 2 37  ? -7.361  15.189  -38.867 1.00 37.26 ? 37  GLU A N     1 
ATOM   1485 C  CA    . GLU C 2 37  ? -8.390  14.181  -38.549 1.00 41.20 ? 37  GLU A CA    1 
ATOM   1486 C  C     . GLU C 2 37  ? -7.873  12.974  -37.757 1.00 34.48 ? 37  GLU A C     1 
ATOM   1487 O  O     . GLU C 2 37  ? -8.447  12.635  -36.724 1.00 36.36 ? 37  GLU A O     1 
ATOM   1488 C  CB    . GLU C 2 37  ? -9.054  13.702  -39.825 1.00 40.81 ? 37  GLU A CB    1 
ATOM   1489 C  CG    . GLU C 2 37  ? -10.280 12.836  -39.565 1.00 54.13 ? 37  GLU A CG    1 
ATOM   1490 C  CD    . GLU C 2 37  ? -10.826 12.196  -40.831 1.00 57.31 ? 37  GLU A CD    1 
ATOM   1491 O  OE1   . GLU C 2 37  ? -11.224 12.938  -41.753 1.00 57.03 ? 37  GLU A OE1   1 
ATOM   1492 O  OE2   . GLU C 2 37  ? -10.852 10.950  -40.904 1.00 60.54 ? 37  GLU A OE2   1 
ATOM   1493 N  N     . THR C 2 38  ? -6.820  12.325  -38.233 1.00 42.07 ? 38  THR A N     1 
ATOM   1494 C  CA    . THR C 2 38  ? -6.316  11.131  -37.565 1.00 43.20 ? 38  THR A CA    1 
ATOM   1495 C  C     . THR C 2 38  ? -5.695  11.420  -36.212 1.00 41.81 ? 38  THR A C     1 
ATOM   1496 O  O     . THR C 2 38  ? -5.859  10.650  -35.264 1.00 39.51 ? 38  THR A O     1 
ATOM   1497 C  CB    . THR C 2 38  ? -5.301  10.401  -38.438 1.00 42.59 ? 38  THR A CB    1 
ATOM   1498 O  OG1   . THR C 2 38  ? -5.898  10.144  -39.711 1.00 45.84 ? 38  THR A OG1   1 
ATOM   1499 C  CG2   . THR C 2 38  ? -4.888  9.090   -37.775 1.00 49.07 ? 38  THR A CG2   1 
ATOM   1500 N  N     . LEU C 2 39  ? -4.979  12.532  -36.132 1.00 35.92 ? 39  LEU A N     1 
ATOM   1501 C  CA    . LEU C 2 39  ? -4.350  12.935  -34.892 1.00 33.60 ? 39  LEU A CA    1 
ATOM   1502 C  C     . LEU C 2 39  ? -5.452  13.165  -33.867 1.00 36.08 ? 39  LEU A C     1 
ATOM   1503 O  O     . LEU C 2 39  ? -5.309  12.795  -32.697 1.00 38.28 ? 39  LEU A O     1 
ATOM   1504 C  CB    . LEU C 2 39  ? -3.535  14.218  -35.100 1.00 33.39 ? 39  LEU A CB    1 
ATOM   1505 C  CG    . LEU C 2 39  ? -2.252  14.133  -35.947 1.00 39.17 ? 39  LEU A CG    1 
ATOM   1506 C  CD1   . LEU C 2 39  ? -1.618  15.522  -36.101 1.00 34.83 ? 39  LEU A CD1   1 
ATOM   1507 C  CD2   . LEU C 2 39  ? -1.266  13.192  -35.294 1.00 32.21 ? 39  LEU A CD2   1 
ATOM   1508 N  N     . GLU C 2 40  ? -6.566  13.746  -34.310 1.00 36.50 ? 40  GLU A N     1 
ATOM   1509 C  CA    . GLU C 2 40  ? -7.670  14.021  -33.405 1.00 32.02 ? 40  GLU A CA    1 
ATOM   1510 C  C     . GLU C 2 40  ? -8.187  12.721  -32.810 1.00 29.12 ? 40  GLU A C     1 
ATOM   1511 O  O     . GLU C 2 40  ? -8.500  12.652  -31.622 1.00 29.91 ? 40  GLU A O     1 
ATOM   1512 C  CB    . GLU C 2 40  ? -8.808  14.721  -34.132 1.00 42.22 ? 40  GLU A CB    1 
ATOM   1513 C  CG    . GLU C 2 40  ? -9.889  15.224  -33.196 1.00 40.08 ? 40  GLU A CG    1 
ATOM   1514 C  CD    . GLU C 2 40  ? -11.283 14.986  -33.741 1.00 58.99 ? 40  GLU A CD    1 
ATOM   1515 O  OE1   . GLU C 2 40  ? -11.490 15.203  -34.960 1.00 65.88 ? 40  GLU A OE1   1 
ATOM   1516 O  OE2   . GLU C 2 40  ? -12.171 14.592  -32.949 1.00 60.19 ? 40  GLU A OE2   1 
ATOM   1517 N  N     . PHE C 2 41  ? -8.290  11.692  -33.647 1.00 27.92 ? 41  PHE A N     1 
ATOM   1518 C  CA    . PHE C 2 41  ? -8.756  10.376  -33.211 1.00 34.28 ? 41  PHE A CA    1 
ATOM   1519 C  C     . PHE C 2 41  ? -7.891  9.930   -32.024 1.00 27.41 ? 41  PHE A C     1 
ATOM   1520 O  O     . PHE C 2 41  ? -8.402  9.642   -30.943 1.00 32.05 ? 41  PHE A O     1 
ATOM   1521 C  CB    . PHE C 2 41  ? -8.638  9.375   -34.370 1.00 35.37 ? 41  PHE A CB    1 
ATOM   1522 C  CG    . PHE C 2 41  ? -9.286  8.037   -34.102 1.00 33.07 ? 41  PHE A CG    1 
ATOM   1523 C  CD1   . PHE C 2 41  ? -10.670 7.929   -33.971 1.00 42.90 ? 41  PHE A CD1   1 
ATOM   1524 C  CD2   . PHE C 2 41  ? -8.516  6.882   -33.995 1.00 38.18 ? 41  PHE A CD2   1 
ATOM   1525 C  CE1   . PHE C 2 41  ? -11.280 6.690   -33.737 1.00 40.13 ? 41  PHE A CE1   1 
ATOM   1526 C  CE2   . PHE C 2 41  ? -9.115  5.631   -33.759 1.00 38.36 ? 41  PHE A CE2   1 
ATOM   1527 C  CZ    . PHE C 2 41  ? -10.501 5.541   -33.630 1.00 38.42 ? 41  PHE A CZ    1 
ATOM   1528 N  N     . LEU C 2 42  ? -6.577  9.925   -32.227 1.00 30.39 ? 42  LEU A N     1 
ATOM   1529 C  CA    . LEU C 2 42  ? -5.633  9.533   -31.193 1.00 24.54 ? 42  LEU A CA    1 
ATOM   1530 C  C     . LEU C 2 42  ? -5.615  10.476  -29.977 1.00 32.22 ? 42  LEU A C     1 
ATOM   1531 O  O     . LEU C 2 42  ? -5.576  10.020  -28.823 1.00 30.70 ? 42  LEU A O     1 
ATOM   1532 C  CB    . LEU C 2 42  ? -4.235  9.436   -31.802 1.00 26.84 ? 42  LEU A CB    1 
ATOM   1533 C  CG    . LEU C 2 42  ? -3.062  9.250   -30.829 1.00 31.02 ? 42  LEU A CG    1 
ATOM   1534 C  CD1   . LEU C 2 42  ? -3.270  7.983   -29.999 1.00 36.01 ? 42  LEU A CD1   1 
ATOM   1535 C  CD2   . LEU C 2 42  ? -1.741  9.173   -31.608 1.00 25.79 ? 42  LEU A CD2   1 
ATOM   1536 N  N     . GLY C 2 43  ? -5.650  11.787  -30.228 1.00 29.22 ? 43  GLY A N     1 
ATOM   1537 C  CA    . GLY C 2 43  ? -5.632  12.749  -29.133 1.00 21.27 ? 43  GLY A CA    1 
ATOM   1538 C  C     . GLY C 2 43  ? -6.790  12.570  -28.184 1.00 29.84 ? 43  GLY A C     1 
ATOM   1539 O  O     . GLY C 2 43  ? -6.649  12.687  -26.957 1.00 28.53 ? 43  GLY A O     1 
ATOM   1540 N  N     . ASN C 2 44  ? -7.954  12.280  -28.750 1.00 28.18 ? 44  ASN A N     1 
ATOM   1541 C  CA    . ASN C 2 44  ? -9.139  12.074  -27.936 1.00 34.73 ? 44  ASN A CA    1 
ATOM   1542 C  C     . ASN C 2 44  ? -8.883  10.916  -26.951 1.00 36.14 ? 44  ASN A C     1 
ATOM   1543 O  O     . ASN C 2 44  ? -9.202  11.008  -25.767 1.00 33.57 ? 44  ASN A O     1 
ATOM   1544 C  CB    . ASN C 2 44  ? -10.334 11.758  -28.845 1.00 39.75 ? 44  ASN A CB    1 
ATOM   1545 C  CG    . ASN C 2 44  ? -11.646 11.700  -28.090 1.00 43.15 ? 44  ASN A CG    1 
ATOM   1546 O  OD1   . ASN C 2 44  ? -12.663 11.289  -28.636 1.00 60.39 ? 44  ASN A OD1   1 
ATOM   1547 N  ND2   . ASN C 2 44  ? -11.632 12.122  -26.833 1.00 51.59 ? 44  ASN A ND2   1 
ATOM   1548 N  N     . ALA C 2 45  ? -8.299  9.831   -27.442 1.00 33.47 ? 45  ALA A N     1 
ATOM   1549 C  CA    . ALA C 2 45  ? -8.008  8.683   -26.584 1.00 38.43 ? 45  ALA A CA    1 
ATOM   1550 C  C     . ALA C 2 45  ? -6.958  9.031   -25.533 1.00 30.46 ? 45  ALA A C     1 
ATOM   1551 O  O     . ALA C 2 45  ? -7.083  8.673   -24.363 1.00 36.29 ? 45  ALA A O     1 
ATOM   1552 C  CB    . ALA C 2 45  ? -7.513  7.495   -27.434 1.00 34.93 ? 45  ALA A CB    1 
ATOM   1553 N  N     . LEU C 2 46  ? -5.916  9.726   -25.960 1.00 30.55 ? 46  LEU A N     1 
ATOM   1554 C  CA    . LEU C 2 46  ? -4.842  10.100  -25.056 1.00 31.50 ? 46  LEU A CA    1 
ATOM   1555 C  C     . LEU C 2 46  ? -5.326  11.033  -23.932 1.00 35.56 ? 46  LEU A C     1 
ATOM   1556 O  O     . LEU C 2 46  ? -5.096  10.770  -22.745 1.00 24.22 ? 46  LEU A O     1 
ATOM   1557 C  CB    . LEU C 2 46  ? -3.731  10.758  -25.870 1.00 34.90 ? 46  LEU A CB    1 
ATOM   1558 C  CG    . LEU C 2 46  ? -2.367  11.074  -25.267 1.00 47.78 ? 46  LEU A CG    1 
ATOM   1559 C  CD1   . LEU C 2 46  ? -1.629  9.810   -24.877 1.00 37.10 ? 46  LEU A CD1   1 
ATOM   1560 C  CD2   . LEU C 2 46  ? -1.571  11.831  -26.312 1.00 54.59 ? 46  LEU A CD2   1 
ATOM   1561 N  N     . VAL C 2 47  ? -6.004  12.118  -24.307 1.00 32.67 ? 47  VAL A N     1 
ATOM   1562 C  CA    . VAL C 2 47  ? -6.508  13.084  -23.333 1.00 31.50 ? 47  VAL A CA    1 
ATOM   1563 C  C     . VAL C 2 47  ? -7.553  12.452  -22.417 1.00 32.84 ? 47  VAL A C     1 
ATOM   1564 O  O     . VAL C 2 47  ? -7.595  12.743  -21.217 1.00 31.34 ? 47  VAL A O     1 
ATOM   1565 C  CB    . VAL C 2 47  ? -7.107  14.320  -24.041 1.00 32.07 ? 47  VAL A CB    1 
ATOM   1566 C  CG1   . VAL C 2 47  ? -7.766  15.228  -23.036 1.00 31.21 ? 47  VAL A CG1   1 
ATOM   1567 C  CG2   . VAL C 2 47  ? -6.008  15.070  -24.770 1.00 25.88 ? 47  VAL A CG2   1 
ATOM   1568 N  N     . ASN C 2 48  ? -8.393  11.587  -22.982 1.00 27.30 ? 48  ASN A N     1 
ATOM   1569 C  CA    . ASN C 2 48  ? -9.410  10.895  -22.190 1.00 29.45 ? 48  ASN A CA    1 
ATOM   1570 C  C     . ASN C 2 48  ? -8.720  10.190  -21.031 1.00 29.27 ? 48  ASN A C     1 
ATOM   1571 O  O     . ASN C 2 48  ? -9.205  10.192  -19.898 1.00 32.86 ? 48  ASN A O     1 
ATOM   1572 C  CB    . ASN C 2 48  ? -10.127 9.843   -23.028 1.00 23.67 ? 48  ASN A CB    1 
ATOM   1573 C  CG    . ASN C 2 48  ? -11.199 9.118   -22.243 1.00 32.65 ? 48  ASN A CG    1 
ATOM   1574 O  OD1   . ASN C 2 48  ? -12.149 9.731   -21.766 1.00 30.93 ? 48  ASN A OD1   1 
ATOM   1575 N  ND2   . ASN C 2 48  ? -11.047 7.799   -22.098 1.00 34.09 ? 48  ASN A ND2   1 
ATOM   1576 N  N     . PHE C 2 49  ? -7.584  9.573   -21.335 1.00 30.84 ? 49  PHE A N     1 
ATOM   1577 C  CA    . PHE C 2 49  ? -6.811  8.867   -20.330 1.00 31.49 ? 49  PHE A CA    1 
ATOM   1578 C  C     . PHE C 2 49  ? -6.220  9.854   -19.317 1.00 28.47 ? 49  PHE A C     1 
ATOM   1579 O  O     . PHE C 2 49  ? -6.259  9.605   -18.115 1.00 28.60 ? 49  PHE A O     1 
ATOM   1580 C  CB    . PHE C 2 49  ? -5.713  8.037   -21.008 1.00 32.72 ? 49  PHE A CB    1 
ATOM   1581 C  CG    . PHE C 2 49  ? -4.584  7.656   -20.094 1.00 35.05 ? 49  PHE A CG    1 
ATOM   1582 C  CD1   . PHE C 2 49  ? -4.834  7.005   -18.887 1.00 41.09 ? 49  PHE A CD1   1 
ATOM   1583 C  CD2   . PHE C 2 49  ? -3.273  7.984   -20.422 1.00 35.94 ? 49  PHE A CD2   1 
ATOM   1584 C  CE1   . PHE C 2 49  ? -3.794  6.692   -18.017 1.00 39.22 ? 49  PHE A CE1   1 
ATOM   1585 C  CE2   . PHE C 2 49  ? -2.223  7.674   -19.564 1.00 37.90 ? 49  PHE A CE2   1 
ATOM   1586 C  CZ    . PHE C 2 49  ? -2.484  7.028   -18.357 1.00 43.46 ? 49  PHE A CZ    1 
ATOM   1587 N  N     . PHE C 2 50  ? -5.686  10.976  -19.787 1.00 29.49 ? 50  PHE A N     1 
ATOM   1588 C  CA    . PHE C 2 50  ? -5.126  11.958  -18.853 1.00 33.81 ? 50  PHE A CA    1 
ATOM   1589 C  C     . PHE C 2 50  ? -6.210  12.400  -17.878 1.00 28.00 ? 50  PHE A C     1 
ATOM   1590 O  O     . PHE C 2 50  ? -6.023  12.372  -16.663 1.00 33.03 ? 50  PHE A O     1 
ATOM   1591 C  CB    . PHE C 2 50  ? -4.585  13.194  -19.585 1.00 34.66 ? 50  PHE A CB    1 
ATOM   1592 C  CG    . PHE C 2 50  ? -3.454  12.906  -20.534 1.00 31.37 ? 50  PHE A CG    1 
ATOM   1593 C  CD1   . PHE C 2 50  ? -2.640  11.786  -20.361 1.00 32.33 ? 50  PHE A CD1   1 
ATOM   1594 C  CD2   . PHE C 2 50  ? -3.179  13.783  -21.585 1.00 30.61 ? 50  PHE A CD2   1 
ATOM   1595 C  CE1   . PHE C 2 50  ? -1.566  11.540  -21.219 1.00 35.77 ? 50  PHE A CE1   1 
ATOM   1596 C  CE2   . PHE C 2 50  ? -2.116  13.554  -22.445 1.00 38.49 ? 50  PHE A CE2   1 
ATOM   1597 C  CZ    . PHE C 2 50  ? -1.303  12.427  -22.266 1.00 43.28 ? 50  PHE A CZ    1 
ATOM   1598 N  N     . ILE C 2 51  ? -7.358  12.791  -18.426 1.00 37.45 ? 51  ILE A N     1 
ATOM   1599 C  CA    . ILE C 2 51  ? -8.488  13.254  -17.625 1.00 34.80 ? 51  ILE A CA    1 
ATOM   1600 C  C     . ILE C 2 51  ? -8.962  12.201  -16.628 1.00 32.65 ? 51  ILE A C     1 
ATOM   1601 O  O     . ILE C 2 51  ? -9.097  12.471  -15.442 1.00 34.29 ? 51  ILE A O     1 
ATOM   1602 C  CB    . ILE C 2 51  ? -9.678  13.657  -18.536 1.00 36.56 ? 51  ILE A CB    1 
ATOM   1603 C  CG1   . ILE C 2 51  ? -9.294  14.866  -19.399 1.00 43.41 ? 51  ILE A CG1   1 
ATOM   1604 C  CG2   . ILE C 2 51  ? -10.902 13.973  -17.693 1.00 35.85 ? 51  ILE A CG2   1 
ATOM   1605 C  CD1   . ILE C 2 51  ? -8.956  16.101  -18.609 1.00 44.17 ? 51  ILE A CD1   1 
ATOM   1606 N  N     . VAL C 2 52  ? -9.211  10.996  -17.114 1.00 31.33 ? 52  VAL A N     1 
ATOM   1607 C  CA    . VAL C 2 52  ? -9.684  9.926   -16.246 1.00 24.94 ? 52  VAL A CA    1 
ATOM   1608 C  C     . VAL C 2 52  ? -8.753  9.620   -15.069 1.00 26.47 ? 52  VAL A C     1 
ATOM   1609 O  O     . VAL C 2 52  ? -9.209  9.370   -13.951 1.00 27.67 ? 52  VAL A O     1 
ATOM   1610 C  CB    . VAL C 2 52  ? -9.897  8.635   -17.060 1.00 29.84 ? 52  VAL A CB    1 
ATOM   1611 C  CG1   . VAL C 2 52  ? -10.106 7.438   -16.122 1.00 22.57 ? 52  VAL A CG1   1 
ATOM   1612 C  CG2   . VAL C 2 52  ? -11.093 8.815   -17.992 1.00 29.40 ? 52  VAL A CG2   1 
ATOM   1613 N  N     . ASP C 2 53  ? -7.450  9.630   -15.328 1.00 30.54 ? 53  ASP A N     1 
ATOM   1614 C  CA    . ASP C 2 53  ? -6.473  9.312   -14.294 1.00 27.56 ? 53  ASP A CA    1 
ATOM   1615 C  C     . ASP C 2 53  ? -6.558  10.328  -13.163 1.00 28.50 ? 53  ASP A C     1 
ATOM   1616 O  O     . ASP C 2 53  ? -6.527  9.973   -11.991 1.00 31.02 ? 53  ASP A O     1 
ATOM   1617 C  CB    . ASP C 2 53  ? -5.075  9.279   -14.911 1.00 33.72 ? 53  ASP A CB    1 
ATOM   1618 C  CG    . ASP C 2 53  ? -4.057  8.586   -14.024 1.00 33.12 ? 53  ASP A CG    1 
ATOM   1619 O  OD1   . ASP C 2 53  ? -4.466  7.784   -13.154 1.00 40.54 ? 53  ASP A OD1   1 
ATOM   1620 O  OD2   . ASP C 2 53  ? -2.849  8.828   -14.215 1.00 40.47 ? 53  ASP A OD2   1 
ATOM   1621 N  N     . LEU C 2 54  ? -6.693  11.595  -13.530 1.00 24.95 ? 54  LEU A N     1 
ATOM   1622 C  CA    . LEU C 2 54  ? -6.811  12.675  -12.563 1.00 32.17 ? 54  LEU A CA    1 
ATOM   1623 C  C     . LEU C 2 54  ? -8.142  12.512  -11.830 1.00 38.20 ? 54  LEU A C     1 
ATOM   1624 O  O     . LEU C 2 54  ? -8.226  12.659  -10.603 1.00 37.51 ? 54  LEU A O     1 
ATOM   1625 C  CB    . LEU C 2 54  ? -6.792  14.016  -13.309 1.00 31.57 ? 54  LEU A CB    1 
ATOM   1626 C  CG    . LEU C 2 54  ? -5.750  15.099  -13.022 1.00 45.41 ? 54  LEU A CG    1 
ATOM   1627 C  CD1   . LEU C 2 54  ? -4.355  14.517  -12.898 1.00 34.22 ? 54  LEU A CD1   1 
ATOM   1628 C  CD2   . LEU C 2 54  ? -5.807  16.128  -14.145 1.00 38.83 ? 54  LEU A CD2   1 
ATOM   1629 N  N     . LEU C 2 55  ? -9.180  12.178  -12.590 1.00 32.34 ? 55  LEU A N     1 
ATOM   1630 C  CA    . LEU C 2 55  ? -10.512 12.036  -12.023 1.00 37.59 ? 55  LEU A CA    1 
ATOM   1631 C  C     . LEU C 2 55  ? -10.621 10.937  -10.969 1.00 39.02 ? 55  LEU A C     1 
ATOM   1632 O  O     . LEU C 2 55  ? -11.256 11.140  -9.936  1.00 41.18 ? 55  LEU A O     1 
ATOM   1633 C  CB    . LEU C 2 55  ? -11.540 11.809  -13.142 1.00 33.41 ? 55  LEU A CB    1 
ATOM   1634 C  CG    . LEU C 2 55  ? -13.016 11.796  -12.730 1.00 35.08 ? 55  LEU A CG    1 
ATOM   1635 C  CD1   . LEU C 2 55  ? -13.418 13.175  -12.238 1.00 31.96 ? 55  LEU A CD1   1 
ATOM   1636 C  CD2   . LEU C 2 55  ? -13.886 11.393  -13.916 1.00 36.75 ? 55  LEU A CD2   1 
ATOM   1637 N  N     . VAL C 2 56  ? -9.995  9.786   -11.206 1.00 37.30 ? 56  VAL A N     1 
ATOM   1638 C  CA    . VAL C 2 56  ? -10.075 8.702   -10.235 1.00 43.75 ? 56  VAL A CA    1 
ATOM   1639 C  C     . VAL C 2 56  ? -9.247  8.996   -8.991  1.00 47.31 ? 56  VAL A C     1 
ATOM   1640 O  O     . VAL C 2 56  ? -9.475  8.413   -7.935  1.00 47.43 ? 56  VAL A O     1 
ATOM   1641 C  CB    . VAL C 2 56  ? -9.618  7.332   -10.836 1.00 42.23 ? 56  VAL A CB    1 
ATOM   1642 C  CG1   . VAL C 2 56  ? -10.473 6.984   -12.046 1.00 40.99 ? 56  VAL A CG1   1 
ATOM   1643 C  CG2   . VAL C 2 56  ? -8.149  7.374   -11.209 1.00 39.01 ? 56  VAL A CG2   1 
ATOM   1644 N  N     . GLN C 2 57  ? -8.291  9.907   -9.104  1.00 46.16 ? 57  GLN A N     1 
ATOM   1645 C  CA    . GLN C 2 57  ? -7.465  10.223  -7.950  1.00 47.97 ? 57  GLN A CA    1 
ATOM   1646 C  C     . GLN C 2 57  ? -8.013  11.353  -7.100  1.00 48.21 ? 57  GLN A C     1 
ATOM   1647 O  O     . GLN C 2 57  ? -7.881  11.335  -5.880  1.00 49.51 ? 57  GLN A O     1 
ATOM   1648 C  CB    . GLN C 2 57  ? -6.059  10.612  -8.383  1.00 45.70 ? 57  GLN A CB    1 
ATOM   1649 C  CG    . GLN C 2 57  ? -5.375  9.623   -9.270  1.00 50.17 ? 57  GLN A CG    1 
ATOM   1650 C  CD    . GLN C 2 57  ? -3.984  10.080  -9.620  1.00 54.70 ? 57  GLN A CD    1 
ATOM   1651 O  OE1   . GLN C 2 57  ? -3.143  10.262  -8.739  1.00 53.65 ? 57  GLN A OE1   1 
ATOM   1652 N  NE2   . GLN C 2 57  ? -3.730  10.279  -10.910 1.00 57.78 ? 57  GLN A NE2   1 
ATOM   1653 N  N     . TYR C 2 58  ? -8.645  12.326  -7.744  1.00 43.95 ? 58  TYR A N     1 
ATOM   1654 C  CA    . TYR C 2 58  ? -9.132  13.495  -7.031  1.00 39.86 ? 58  TYR A CA    1 
ATOM   1655 C  C     . TYR C 2 58  ? -10.630 13.701  -6.875  1.00 41.49 ? 58  TYR A C     1 
ATOM   1656 O  O     . TYR C 2 58  ? -11.040 14.643  -6.197  1.00 43.49 ? 58  TYR A O     1 
ATOM   1657 C  CB    . TYR C 2 58  ? -8.532  14.741  -7.679  1.00 39.75 ? 58  TYR A CB    1 
ATOM   1658 C  CG    . TYR C 2 58  ? -7.024  14.795  -7.604  1.00 34.69 ? 58  TYR A CG    1 
ATOM   1659 C  CD1   . TYR C 2 58  ? -6.376  15.248  -6.453  1.00 45.15 ? 58  TYR A CD1   1 
ATOM   1660 C  CD2   . TYR C 2 58  ? -6.242  14.408  -8.690  1.00 32.73 ? 58  TYR A CD2   1 
ATOM   1661 C  CE1   . TYR C 2 58  ? -4.975  15.320  -6.390  1.00 49.18 ? 58  TYR A CE1   1 
ATOM   1662 C  CE2   . TYR C 2 58  ? -4.848  14.470  -8.644  1.00 41.77 ? 58  TYR A CE2   1 
ATOM   1663 C  CZ    . TYR C 2 58  ? -4.219  14.931  -7.493  1.00 50.41 ? 58  TYR A CZ    1 
ATOM   1664 O  OH    . TYR C 2 58  ? -2.844  15.034  -7.464  1.00 53.51 ? 58  TYR A OH    1 
ATOM   1665 N  N     . SER C 2 59  ? -11.452 12.849  -7.479  1.00 35.36 ? 59  SER A N     1 
ATOM   1666 C  CA    . SER C 2 59  ? -12.891 13.043  -7.363  1.00 40.05 ? 59  SER A CA    1 
ATOM   1667 C  C     . SER C 2 59  ? -13.434 12.920  -5.941  1.00 47.68 ? 59  SER A C     1 
ATOM   1668 O  O     . SER C 2 59  ? -13.034 12.038  -5.183  1.00 45.78 ? 59  SER A O     1 
ATOM   1669 C  CB    . SER C 2 59  ? -13.643 12.071  -8.257  1.00 40.87 ? 59  SER A CB    1 
ATOM   1670 O  OG    . SER C 2 59  ? -15.034 12.288  -8.123  1.00 38.06 ? 59  SER A OG    1 
ATOM   1671 N  N     . PRO C 2 60  ? -14.376 13.805  -5.570  1.00 51.37 ? 60  PRO A N     1 
ATOM   1672 C  CA    . PRO C 2 60  ? -14.972 13.785  -4.229  1.00 53.49 ? 60  PRO A CA    1 
ATOM   1673 C  C     . PRO C 2 60  ? -15.784 12.508  -4.040  1.00 54.08 ? 60  PRO A C     1 
ATOM   1674 O  O     . PRO C 2 60  ? -15.811 11.920  -2.961  1.00 58.35 ? 60  PRO A O     1 
ATOM   1675 C  CB    . PRO C 2 60  ? -15.880 15.021  -4.223  1.00 52.81 ? 60  PRO A CB    1 
ATOM   1676 C  CG    . PRO C 2 60  ? -15.409 15.853  -5.391  1.00 55.00 ? 60  PRO A CG    1 
ATOM   1677 C  CD    . PRO C 2 60  ? -15.020 14.828  -6.411  1.00 51.09 ? 60  PRO A CD    1 
ATOM   1678 N  N     . ASN C 2 61  ? -16.433 12.094  -5.123  1.00 50.86 ? 61  ASN A N     1 
ATOM   1679 C  CA    . ASN C 2 61  ? -17.298 10.918  -5.157  1.00 47.15 ? 61  ASN A CA    1 
ATOM   1680 C  C     . ASN C 2 61  ? -16.734 9.918   -6.174  1.00 44.73 ? 61  ASN A C     1 
ATOM   1681 O  O     . ASN C 2 61  ? -16.367 10.300  -7.279  1.00 43.66 ? 61  ASN A O     1 
ATOM   1682 C  CB    . ASN C 2 61  ? -18.702 11.379  -5.577  1.00 47.50 ? 61  ASN A CB    1 
ATOM   1683 C  CG    . ASN C 2 61  ? -19.709 10.259  -5.615  1.00 50.46 ? 61  ASN A CG    1 
ATOM   1684 O  OD1   . ASN C 2 61  ? -19.367 9.111   -5.868  1.00 53.93 ? 61  ASN A OD1   1 
ATOM   1685 N  ND2   . ASN C 2 61  ? -20.972 10.595  -5.386  1.00 51.99 ? 61  ASN A ND2   1 
ATOM   1686 N  N     . LYS C 2 62  ? -16.666 8.641   -5.808  1.00 46.51 ? 62  LYS A N     1 
ATOM   1687 C  CA    . LYS C 2 62  ? -16.141 7.623   -6.720  1.00 46.70 ? 62  LYS A CA    1 
ATOM   1688 C  C     . LYS C 2 62  ? -17.250 6.780   -7.357  1.00 44.41 ? 62  LYS A C     1 
ATOM   1689 O  O     . LYS C 2 62  ? -16.973 5.816   -8.068  1.00 44.48 ? 62  LYS A O     1 
ATOM   1690 C  CB    . LYS C 2 62  ? -15.186 6.687   -5.981  1.00 47.32 ? 62  LYS A CB    1 
ATOM   1691 C  CG    . LYS C 2 62  ? -14.127 7.370   -5.146  1.00 53.12 ? 62  LYS A CG    1 
ATOM   1692 C  CD    . LYS C 2 62  ? -13.001 7.934   -5.979  1.00 56.13 ? 62  LYS A CD    1 
ATOM   1693 C  CE    . LYS C 2 62  ? -11.921 8.488   -5.064  1.00 58.07 ? 62  LYS A CE    1 
ATOM   1694 N  NZ    . LYS C 2 62  ? -10.776 9.066   -5.810  1.00 73.36 ? 62  LYS A NZ    1 
ATOM   1695 N  N     . ARG C 2 63  ? -18.503 7.136   -7.094  1.00 40.74 ? 63  ARG A N     1 
ATOM   1696 C  CA    . ARG C 2 63  ? -19.634 6.403   -7.645  1.00 49.64 ? 63  ARG A CA    1 
ATOM   1697 C  C     . ARG C 2 63  ? -19.706 6.541   -9.169  1.00 47.73 ? 63  ARG A C     1 
ATOM   1698 O  O     . ARG C 2 63  ? -19.424 7.614   -9.723  1.00 46.75 ? 63  ARG A O     1 
ATOM   1699 C  CB    . ARG C 2 63  ? -20.928 6.904   -6.998  1.00 55.61 ? 63  ARG A CB    1 
ATOM   1700 C  CG    . ARG C 2 63  ? -20.974 6.648   -5.500  1.00 67.87 ? 63  ARG A CG    1 
ATOM   1701 C  CD    . ARG C 2 63  ? -22.152 7.326   -4.816  1.00 76.88 ? 63  ARG A CD    1 
ATOM   1702 N  NE    . ARG C 2 63  ? -22.150 7.038   -3.382  1.00 89.22 ? 63  ARG A NE    1 
ATOM   1703 C  CZ    . ARG C 2 63  ? -23.049 7.498   -2.516  1.00 95.44 ? 63  ARG A CZ    1 
ATOM   1704 N  NH1   . ARG C 2 63  ? -24.039 8.281   -2.928  1.00 99.84 ? 63  ARG A NH1   1 
ATOM   1705 N  NH2   . ARG C 2 63  ? -22.961 7.166   -1.234  1.00 99.19 ? 63  ARG A NH2   1 
ATOM   1706 N  N     . GLU C 2 64  ? -20.073 5.450   -9.838  1.00 40.53 ? 64  GLU A N     1 
ATOM   1707 C  CA    . GLU C 2 64  ? -20.182 5.425   -11.300 1.00 45.05 ? 64  GLU A CA    1 
ATOM   1708 C  C     . GLU C 2 64  ? -21.112 6.505   -11.808 1.00 38.32 ? 64  GLU A C     1 
ATOM   1709 O  O     . GLU C 2 64  ? -20.832 7.149   -12.814 1.00 42.64 ? 64  GLU A O     1 
ATOM   1710 C  CB    . GLU C 2 64  ? -20.729 4.087   -11.788 1.00 49.64 ? 64  GLU A CB    1 
ATOM   1711 C  CG    . GLU C 2 64  ? -19.901 2.878   -11.441 1.00 56.31 ? 64  GLU A CG    1 
ATOM   1712 C  CD    . GLU C 2 64  ? -20.530 1.604   -11.970 1.00 58.64 ? 64  GLU A CD    1 
ATOM   1713 O  OE1   . GLU C 2 64  ? -21.727 1.380   -11.687 1.00 60.16 ? 64  GLU A OE1   1 
ATOM   1714 O  OE2   . GLU C 2 64  ? -19.833 0.832   -12.666 1.00 66.13 ? 64  GLU A OE2   1 
ATOM   1715 N  N     . GLY C 2 65  ? -22.230 6.673   -11.106 1.00 43.38 ? 65  GLY A N     1 
ATOM   1716 C  CA    . GLY C 2 65  ? -23.228 7.660   -11.478 1.00 40.64 ? 65  GLY A CA    1 
ATOM   1717 C  C     . GLY C 2 65  ? -22.755 9.092   -11.337 1.00 43.88 ? 65  GLY A C     1 
ATOM   1718 O  O     . GLY C 2 65  ? -23.410 10.014  -11.823 1.00 43.54 ? 65  GLY A O     1 
ATOM   1719 N  N     . PHE C 2 66  ? -21.629 9.285   -10.658 1.00 41.84 ? 66  PHE A N     1 
ATOM   1720 C  CA    . PHE C 2 66  ? -21.077 10.625  -10.479 1.00 40.76 ? 66  PHE A CA    1 
ATOM   1721 C  C     . PHE C 2 66  ? -19.914 10.811  -11.454 1.00 38.70 ? 66  PHE A C     1 
ATOM   1722 O  O     . PHE C 2 66  ? -19.869 11.778  -12.216 1.00 31.42 ? 66  PHE A O     1 
ATOM   1723 C  CB    . PHE C 2 66  ? -20.573 10.818  -9.044  1.00 38.88 ? 66  PHE A CB    1 
ATOM   1724 C  CG    . PHE C 2 66  ? -20.003 12.185  -8.786  1.00 41.63 ? 66  PHE A CG    1 
ATOM   1725 C  CD1   . PHE C 2 66  ? -20.834 13.248  -8.428  1.00 43.97 ? 66  PHE A CD1   1 
ATOM   1726 C  CD2   . PHE C 2 66  ? -18.642 12.424  -8.943  1.00 43.91 ? 66  PHE A CD2   1 
ATOM   1727 C  CE1   . PHE C 2 66  ? -20.317 14.527  -8.232  1.00 44.28 ? 66  PHE A CE1   1 
ATOM   1728 C  CE2   . PHE C 2 66  ? -18.111 13.703  -8.751  1.00 48.68 ? 66  PHE A CE2   1 
ATOM   1729 C  CZ    . PHE C 2 66  ? -18.948 14.755  -8.396  1.00 46.96 ? 66  PHE A CZ    1 
ATOM   1730 N  N     . LEU C 2 67  ? -18.984 9.861   -11.422 1.00 37.90 ? 67  LEU A N     1 
ATOM   1731 C  CA    . LEU C 2 67  ? -17.807 9.881   -12.280 1.00 34.57 ? 67  LEU A CA    1 
ATOM   1732 C  C     . LEU C 2 67  ? -18.133 9.940   -13.771 1.00 38.78 ? 67  LEU A C     1 
ATOM   1733 O  O     . LEU C 2 67  ? -17.500 10.687  -14.508 1.00 40.67 ? 67  LEU A O     1 
ATOM   1734 C  CB    . LEU C 2 67  ? -16.946 8.647   -12.007 1.00 36.98 ? 67  LEU A CB    1 
ATOM   1735 C  CG    . LEU C 2 67  ? -16.343 8.495   -10.603 1.00 42.26 ? 67  LEU A CG    1 
ATOM   1736 C  CD1   . LEU C 2 67  ? -15.657 7.133   -10.506 1.00 36.76 ? 67  LEU A CD1   1 
ATOM   1737 C  CD2   . LEU C 2 67  ? -15.351 9.632   -10.318 1.00 31.82 ? 67  LEU A CD2   1 
ATOM   1738 N  N     . SER C 2 68  ? -19.113 9.157   -14.218 1.00 41.81 ? 68  SER A N     1 
ATOM   1739 C  CA    . SER C 2 68  ? -19.478 9.144   -15.634 1.00 39.76 ? 68  SER A CA    1 
ATOM   1740 C  C     . SER C 2 68  ? -19.954 10.487  -16.164 1.00 32.36 ? 68  SER A C     1 
ATOM   1741 O  O     . SER C 2 68  ? -19.403 10.998  -17.129 1.00 32.31 ? 68  SER A O     1 
ATOM   1742 C  CB    . SER C 2 68  ? -20.558 8.094   -15.925 1.00 36.34 ? 68  SER A CB    1 
ATOM   1743 O  OG    . SER C 2 68  ? -19.994 6.811   -16.092 1.00 50.25 ? 68  SER A OG    1 
ATOM   1744 N  N     . PRO C 2 69  ? -21.005 11.057  -15.564 1.00 35.82 ? 69  PRO A N     1 
ATOM   1745 C  CA    . PRO C 2 69  ? -21.475 12.352  -16.069 1.00 38.12 ? 69  PRO A CA    1 
ATOM   1746 C  C     . PRO C 2 69  ? -20.357 13.390  -16.050 1.00 35.13 ? 69  PRO A C     1 
ATOM   1747 O  O     . PRO C 2 69  ? -20.153 14.118  -17.016 1.00 40.08 ? 69  PRO A O     1 
ATOM   1748 C  CB    . PRO C 2 69  ? -22.616 12.701  -15.112 1.00 43.15 ? 69  PRO A CB    1 
ATOM   1749 C  CG    . PRO C 2 69  ? -23.154 11.348  -14.722 1.00 41.98 ? 69  PRO A CG    1 
ATOM   1750 C  CD    . PRO C 2 69  ? -21.889 10.547  -14.498 1.00 33.28 ? 69  PRO A CD    1 
ATOM   1751 N  N     . LEU C 2 70  ? -19.622 13.432  -14.947 1.00 34.43 ? 70  LEU A N     1 
ATOM   1752 C  CA    . LEU C 2 70  ? -18.528 14.377  -14.792 1.00 37.21 ? 70  LEU A CA    1 
ATOM   1753 C  C     . LEU C 2 70  ? -17.409 14.171  -15.814 1.00 33.84 ? 70  LEU A C     1 
ATOM   1754 O  O     . LEU C 2 70  ? -16.838 15.136  -16.324 1.00 37.90 ? 70  LEU A O     1 
ATOM   1755 C  CB    . LEU C 2 70  ? -17.969 14.300  -13.365 1.00 34.33 ? 70  LEU A CB    1 
ATOM   1756 C  CG    . LEU C 2 70  ? -16.882 15.305  -12.965 1.00 38.39 ? 70  LEU A CG    1 
ATOM   1757 C  CD1   . LEU C 2 70  ? -17.310 16.734  -13.296 1.00 29.42 ? 70  LEU A CD1   1 
ATOM   1758 C  CD2   . LEU C 2 70  ? -16.603 15.165  -11.478 1.00 37.67 ? 70  LEU A CD2   1 
ATOM   1759 N  N     . LYS C 2 71  ? -17.099 12.921  -16.130 1.00 30.21 ? 71  LYS A N     1 
ATOM   1760 C  CA    . LYS C 2 71  ? -16.040 12.661  -17.093 1.00 29.45 ? 71  LYS A CA    1 
ATOM   1761 C  C     . LYS C 2 71  ? -16.465 13.194  -18.454 1.00 35.55 ? 71  LYS A C     1 
ATOM   1762 O  O     . LYS C 2 71  ? -15.663 13.772  -19.193 1.00 32.45 ? 71  LYS A O     1 
ATOM   1763 C  CB    . LYS C 2 71  ? -15.752 11.161  -17.216 1.00 34.31 ? 71  LYS A CB    1 
ATOM   1764 C  CG    . LYS C 2 71  ? -14.379 10.897  -17.831 1.00 29.78 ? 71  LYS A CG    1 
ATOM   1765 C  CD    . LYS C 2 71  ? -14.308 9.572   -18.546 1.00 48.33 ? 71  LYS A CD    1 
ATOM   1766 C  CE    . LYS C 2 71  ? -15.013 9.651   -19.871 1.00 46.36 ? 71  LYS A CE    1 
ATOM   1767 N  NZ    . LYS C 2 71  ? -14.573 8.559   -20.759 1.00 32.09 ? 71  LYS A NZ    1 
ATOM   1768 N  N     . ALA C 2 72  ? -17.738 12.972  -18.772 1.00 34.78 ? 72  ALA A N     1 
ATOM   1769 C  CA    . ALA C 2 72  ? -18.332 13.416  -20.024 1.00 36.07 ? 72  ALA A CA    1 
ATOM   1770 C  C     . ALA C 2 72  ? -18.094 14.904  -20.209 1.00 31.98 ? 72  ALA A C     1 
ATOM   1771 O  O     . ALA C 2 72  ? -17.703 15.350  -21.284 1.00 37.64 ? 72  ALA A O     1 
ATOM   1772 C  CB    . ALA C 2 72  ? -19.841 13.124  -20.022 1.00 26.67 ? 72  ALA A CB    1 
ATOM   1773 N  N     . TYR C 2 73  ? -18.343 15.681  -19.163 1.00 36.58 ? 73  TYR A N     1 
ATOM   1774 C  CA    . TYR C 2 73  ? -18.132 17.115  -19.261 1.00 36.17 ? 73  TYR A CA    1 
ATOM   1775 C  C     . TYR C 2 73  ? -16.643 17.438  -19.370 1.00 36.13 ? 73  TYR A C     1 
ATOM   1776 O  O     . TYR C 2 73  ? -16.254 18.342  -20.110 1.00 38.07 ? 73  TYR A O     1 
ATOM   1777 C  CB    . TYR C 2 73  ? -18.716 17.842  -18.045 1.00 38.53 ? 73  TYR A CB    1 
ATOM   1778 C  CG    . TYR C 2 73  ? -18.256 19.285  -17.958 1.00 39.68 ? 73  TYR A CG    1 
ATOM   1779 C  CD1   . TYR C 2 73  ? -18.752 20.255  -18.834 1.00 38.40 ? 73  TYR A CD1   1 
ATOM   1780 C  CD2   . TYR C 2 73  ? -17.266 19.661  -17.053 1.00 40.35 ? 73  TYR A CD2   1 
ATOM   1781 C  CE1   . TYR C 2 73  ? -18.267 21.566  -18.813 1.00 39.93 ? 73  TYR A CE1   1 
ATOM   1782 C  CE2   . TYR C 2 73  ? -16.772 20.960  -17.023 1.00 45.24 ? 73  TYR A CE2   1 
ATOM   1783 C  CZ    . TYR C 2 73  ? -17.274 21.907  -17.904 1.00 49.05 ? 73  TYR A CZ    1 
ATOM   1784 O  OH    . TYR C 2 73  ? -16.774 23.187  -17.868 1.00 51.71 ? 73  TYR A OH    1 
ATOM   1785 N  N     . LEU C 2 74  ? -15.809 16.694  -18.647 1.00 35.39 ? 74  LEU A N     1 
ATOM   1786 C  CA    . LEU C 2 74  ? -14.371 16.958  -18.674 1.00 35.89 ? 74  LEU A CA    1 
ATOM   1787 C  C     . LEU C 2 74  ? -13.668 16.679  -19.998 1.00 33.50 ? 74  LEU A C     1 
ATOM   1788 O  O     . LEU C 2 74  ? -12.544 17.126  -20.201 1.00 40.74 ? 74  LEU A O     1 
ATOM   1789 C  CB    . LEU C 2 74  ? -13.668 16.216  -17.530 1.00 34.28 ? 74  LEU A CB    1 
ATOM   1790 C  CG    . LEU C 2 74  ? -14.000 16.770  -16.140 1.00 40.13 ? 74  LEU A CG    1 
ATOM   1791 C  CD1   . LEU C 2 74  ? -13.279 15.960  -15.085 1.00 35.02 ? 74  LEU A CD1   1 
ATOM   1792 C  CD2   . LEU C 2 74  ? -13.606 18.254  -16.053 1.00 38.94 ? 74  LEU A CD2   1 
ATOM   1793 N  N     . ILE C 2 75  ? -14.309 15.943  -20.901 1.00 36.77 ? 75  ILE A N     1 
ATOM   1794 C  CA    . ILE C 2 75  ? -13.697 15.689  -22.210 1.00 34.40 ? 75  ILE A CA    1 
ATOM   1795 C  C     . ILE C 2 75  ? -14.604 16.279  -23.276 1.00 33.48 ? 75  ILE A C     1 
ATOM   1796 O  O     . ILE C 2 75  ? -14.489 15.951  -24.453 1.00 30.45 ? 75  ILE A O     1 
ATOM   1797 C  CB    . ILE C 2 75  ? -13.521 14.177  -22.527 1.00 30.59 ? 75  ILE A CB    1 
ATOM   1798 C  CG1   . ILE C 2 75  ? -14.895 13.503  -22.594 1.00 29.17 ? 75  ILE A CG1   1 
ATOM   1799 C  CG2   . ILE C 2 75  ? -12.591 13.526  -21.494 1.00 31.37 ? 75  ILE A CG2   1 
ATOM   1800 C  CD1   . ILE C 2 75  ? -14.864 12.043  -22.998 1.00 30.90 ? 75  ILE A CD1   1 
ATOM   1801 N  N     . SER C 2 76  ? -15.513 17.153  -22.865 1.00 32.43 ? 76  SER A N     1 
ATOM   1802 C  CA    . SER C 2 76  ? -16.429 17.753  -23.821 1.00 38.33 ? 76  SER A CA    1 
ATOM   1803 C  C     . SER C 2 76  ? -15.768 18.893  -24.570 1.00 39.55 ? 76  SER A C     1 
ATOM   1804 O  O     . SER C 2 76  ? -14.789 19.482  -24.116 1.00 36.55 ? 76  SER A O     1 
ATOM   1805 C  CB    . SER C 2 76  ? -17.684 18.278  -23.125 1.00 36.98 ? 76  SER A CB    1 
ATOM   1806 O  OG    . SER C 2 76  ? -17.396 19.471  -22.417 1.00 38.32 ? 76  SER A OG    1 
ATOM   1807 N  N     . GLU C 2 77  ? -16.322 19.185  -25.737 1.00 40.75 ? 77  GLU A N     1 
ATOM   1808 C  CA    . GLU C 2 77  ? -15.842 20.263  -26.580 1.00 43.67 ? 77  GLU A CA    1 
ATOM   1809 C  C     . GLU C 2 77  ? -15.821 21.558  -25.763 1.00 38.32 ? 77  GLU A C     1 
ATOM   1810 O  O     . GLU C 2 77  ? -14.862 22.322  -25.811 1.00 37.73 ? 77  GLU A O     1 
ATOM   1811 C  CB    . GLU C 2 77  ? -16.782 20.405  -27.769 1.00 44.08 ? 77  GLU A CB    1 
ATOM   1812 C  CG    . GLU C 2 77  ? -16.451 21.532  -28.700 1.00 54.17 ? 77  GLU A CG    1 
ATOM   1813 C  CD    . GLU C 2 77  ? -17.365 21.541  -29.897 1.00 60.84 ? 77  GLU A CD    1 
ATOM   1814 O  OE1   . GLU C 2 77  ? -17.407 20.511  -30.610 1.00 55.38 ? 77  GLU A OE1   1 
ATOM   1815 O  OE2   . GLU C 2 77  ? -18.038 22.572  -30.117 1.00 61.12 ? 77  GLU A OE2   1 
ATOM   1816 N  N     . GLU C 2 78  ? -16.893 21.784  -25.013 1.00 38.85 ? 78  GLU A N     1 
ATOM   1817 C  CA    . GLU C 2 78  ? -17.026 22.963  -24.173 1.00 38.07 ? 78  GLU A CA    1 
ATOM   1818 C  C     . GLU C 2 78  ? -15.803 23.145  -23.268 1.00 37.07 ? 78  GLU A C     1 
ATOM   1819 O  O     . GLU C 2 78  ? -15.194 24.215  -23.245 1.00 35.54 ? 78  GLU A O     1 
ATOM   1820 C  CB    . GLU C 2 78  ? -18.283 22.845  -23.302 1.00 42.10 ? 78  GLU A CB    1 
ATOM   1821 C  CG    . GLU C 2 78  ? -18.677 24.139  -22.607 1.00 40.58 ? 78  GLU A CG    1 
ATOM   1822 C  CD    . GLU C 2 78  ? -19.764 23.952  -21.551 1.00 56.97 ? 78  GLU A CD    1 
ATOM   1823 O  OE1   . GLU C 2 78  ? -20.754 23.242  -21.822 1.00 56.30 ? 78  GLU A OE1   1 
ATOM   1824 O  OE2   . GLU C 2 78  ? -19.634 24.528  -20.448 1.00 61.48 ? 78  GLU A OE2   1 
ATOM   1825 N  N     . PHE C 2 79  ? -15.451 22.097  -22.526 1.00 34.04 ? 79  PHE A N     1 
ATOM   1826 C  CA    . PHE C 2 79  ? -14.319 22.156  -21.605 1.00 35.76 ? 79  PHE A CA    1 
ATOM   1827 C  C     . PHE C 2 79  ? -12.975 22.320  -22.306 1.00 36.12 ? 79  PHE A C     1 
ATOM   1828 O  O     . PHE C 2 79  ? -12.118 23.054  -21.833 1.00 39.90 ? 79  PHE A O     1 
ATOM   1829 C  CB    . PHE C 2 79  ? -14.278 20.909  -20.726 1.00 33.86 ? 79  PHE A CB    1 
ATOM   1830 C  CG    . PHE C 2 79  ? -13.378 21.047  -19.534 1.00 34.20 ? 79  PHE A CG    1 
ATOM   1831 C  CD1   . PHE C 2 79  ? -13.676 21.957  -18.525 1.00 34.88 ? 79  PHE A CD1   1 
ATOM   1832 C  CD2   . PHE C 2 79  ? -12.225 20.279  -19.424 1.00 35.41 ? 79  PHE A CD2   1 
ATOM   1833 C  CE1   . PHE C 2 79  ? -12.840 22.105  -17.423 1.00 34.45 ? 79  PHE A CE1   1 
ATOM   1834 C  CE2   . PHE C 2 79  ? -11.368 20.416  -18.316 1.00 37.48 ? 79  PHE A CE2   1 
ATOM   1835 C  CZ    . PHE C 2 79  ? -11.677 21.330  -17.317 1.00 38.50 ? 79  PHE A CZ    1 
ATOM   1836 N  N     . PHE C 2 80  ? -12.790 21.639  -23.430 1.00 35.76 ? 80  PHE A N     1 
ATOM   1837 C  CA    . PHE C 2 80  ? -11.546 21.748  -24.169 1.00 36.00 ? 80  PHE A CA    1 
ATOM   1838 C  C     . PHE C 2 80  ? -11.360 23.168  -24.685 1.00 36.94 ? 80  PHE A C     1 
ATOM   1839 O  O     . PHE C 2 80  ? -10.244 23.680  -24.728 1.00 41.23 ? 80  PHE A O     1 
ATOM   1840 C  CB    . PHE C 2 80  ? -11.520 20.744  -25.328 1.00 34.87 ? 80  PHE A CB    1 
ATOM   1841 C  CG    . PHE C 2 80  ? -11.281 19.319  -24.890 1.00 36.23 ? 80  PHE A CG    1 
ATOM   1842 C  CD1   . PHE C 2 80  ? -11.049 19.015  -23.547 1.00 31.84 ? 80  PHE A CD1   1 
ATOM   1843 C  CD2   . PHE C 2 80  ? -11.280 18.282  -25.818 1.00 34.13 ? 80  PHE A CD2   1 
ATOM   1844 C  CE1   . PHE C 2 80  ? -10.819 17.695  -23.139 1.00 36.81 ? 80  PHE A CE1   1 
ATOM   1845 C  CE2   . PHE C 2 80  ? -11.050 16.962  -25.419 1.00 30.38 ? 80  PHE A CE2   1 
ATOM   1846 C  CZ    . PHE C 2 80  ? -10.819 16.671  -24.079 1.00 36.27 ? 80  PHE A CZ    1 
ATOM   1847 N  N     . ASN C 2 81  ? -12.446 23.812  -25.082 1.00 33.08 ? 81  ASN A N     1 
ATOM   1848 C  CA    . ASN C 2 81  ? -12.328 25.194  -25.547 1.00 43.24 ? 81  ASN A CA    1 
ATOM   1849 C  C     . ASN C 2 81  ? -11.871 26.027  -24.353 1.00 37.08 ? 81  ASN A C     1 
ATOM   1850 O  O     . ASN C 2 81  ? -11.072 26.945  -24.493 1.00 44.57 ? 81  ASN A O     1 
ATOM   1851 C  CB    . ASN C 2 81  ? -13.666 25.705  -26.096 1.00 32.67 ? 81  ASN A CB    1 
ATOM   1852 C  CG    . ASN C 2 81  ? -13.867 25.357  -27.576 1.00 37.77 ? 81  ASN A CG    1 
ATOM   1853 O  OD1   . ASN C 2 81  ? -13.437 26.094  -28.464 1.00 38.24 ? 81  ASN A OD1   1 
ATOM   1854 N  ND2   . ASN C 2 81  ? -14.514 24.226  -27.840 1.00 41.54 ? 81  ASN A ND2   1 
ATOM   1855 N  N     . LEU C 2 82  ? -12.357 25.678  -23.170 1.00 41.33 ? 82  LEU A N     1 
ATOM   1856 C  CA    . LEU C 2 82  ? -11.965 26.388  -21.962 1.00 40.33 ? 82  LEU A CA    1 
ATOM   1857 C  C     . LEU C 2 82  ? -10.454 26.254  -21.745 1.00 44.10 ? 82  LEU A C     1 
ATOM   1858 O  O     . LEU C 2 82  ? -9.755  27.251  -21.560 1.00 41.41 ? 82  LEU A O     1 
ATOM   1859 C  CB    . LEU C 2 82  ? -12.695 25.814  -20.759 1.00 44.54 ? 82  LEU A CB    1 
ATOM   1860 C  CG    . LEU C 2 82  ? -13.433 26.801  -19.863 1.00 57.58 ? 82  LEU A CG    1 
ATOM   1861 C  CD1   . LEU C 2 82  ? -12.445 27.825  -19.319 1.00 64.58 ? 82  LEU A CD1   1 
ATOM   1862 C  CD2   . LEU C 2 82  ? -14.556 27.471  -20.658 1.00 55.54 ? 82  LEU A CD2   1 
ATOM   1863 N  N     . LEU C 2 83  ? -9.949  25.021  -21.784 1.00 38.18 ? 83  LEU A N     1 
ATOM   1864 C  CA    . LEU C 2 83  ? -8.521  24.772  -21.571 1.00 36.35 ? 83  LEU A CA    1 
ATOM   1865 C  C     . LEU C 2 83  ? -7.656  25.334  -22.701 1.00 34.76 ? 83  LEU A C     1 
ATOM   1866 O  O     . LEU C 2 83  ? -6.516  25.749  -22.485 1.00 36.38 ? 83  LEU A O     1 
ATOM   1867 C  CB    . LEU C 2 83  ? -8.256  23.268  -21.466 1.00 33.45 ? 83  LEU A CB    1 
ATOM   1868 C  CG    . LEU C 2 83  ? -9.051  22.447  -20.456 1.00 37.57 ? 83  LEU A CG    1 
ATOM   1869 C  CD1   . LEU C 2 83  ? -8.662  20.986  -20.616 1.00 31.03 ? 83  LEU A CD1   1 
ATOM   1870 C  CD2   . LEU C 2 83  ? -8.760  22.928  -19.035 1.00 36.03 ? 83  LEU A CD2   1 
ATOM   1871 N  N     . ALA C 2 84  ? -8.201  25.322  -23.910 1.00 30.23 ? 84  ALA A N     1 
ATOM   1872 C  CA    . ALA C 2 84  ? -7.479  25.794  -25.076 1.00 34.04 ? 84  ALA A CA    1 
ATOM   1873 C  C     . ALA C 2 84  ? -7.328  27.326  -25.162 1.00 37.66 ? 84  ALA A C     1 
ATOM   1874 O  O     . ALA C 2 84  ? -6.451  27.821  -25.873 1.00 38.04 ? 84  ALA A O     1 
ATOM   1875 C  CB    . ALA C 2 84  ? -8.150  25.253  -26.336 1.00 24.43 ? 84  ALA A CB    1 
ATOM   1876 N  N     . GLN C 2 85  ? -8.167  28.067  -24.442 1.00 39.11 ? 85  GLN A N     1 
ATOM   1877 C  CA    . GLN C 2 85  ? -8.099  29.535  -24.470 1.00 47.95 ? 85  GLN A CA    1 
ATOM   1878 C  C     . GLN C 2 85  ? -6.666  29.995  -24.277 1.00 47.37 ? 85  GLN A C     1 
ATOM   1879 O  O     . GLN C 2 85  ? -6.104  30.713  -25.103 1.00 55.03 ? 85  GLN A O     1 
ATOM   1880 C  CB    . GLN C 2 85  ? -8.956  30.142  -23.363 1.00 47.89 ? 85  GLN A CB    1 
ATOM   1881 C  CG    . GLN C 2 85  ? -10.440 29.932  -23.523 1.00 59.22 ? 85  GLN A CG    1 
ATOM   1882 C  CD    . GLN C 2 85  ? -11.228 30.602  -22.418 1.00 68.93 ? 85  GLN A CD    1 
ATOM   1883 O  OE1   . GLN C 2 85  ? -12.460 30.584  -22.421 1.00 78.84 ? 85  GLN A OE1   1 
ATOM   1884 N  NE2   . GLN C 2 85  ? -10.519 31.201  -21.462 1.00 64.44 ? 85  GLN A NE2   1 
ATOM   1885 N  N     . LYS C 2 86  ? -6.095  29.577  -23.159 1.00 47.14 ? 86  LYS A N     1 
ATOM   1886 C  CA    . LYS C 2 86  ? -4.723  29.885  -22.801 1.00 52.37 ? 86  LYS A CA    1 
ATOM   1887 C  C     . LYS C 2 86  ? -3.761  29.706  -23.981 1.00 53.35 ? 86  LYS A C     1 
ATOM   1888 O  O     . LYS C 2 86  ? -2.774  30.428  -24.099 1.00 56.58 ? 86  LYS A O     1 
ATOM   1889 C  CB    . LYS C 2 86  ? -4.311  28.971  -21.642 1.00 59.51 ? 86  LYS A CB    1 
ATOM   1890 C  CG    . LYS C 2 86  ? -2.828  28.702  -21.537 1.00 65.67 ? 86  LYS A CG    1 
ATOM   1891 C  CD    . LYS C 2 86  ? -2.532  27.531  -20.602 1.00 64.02 ? 86  LYS A CD    1 
ATOM   1892 C  CE    . LYS C 2 86  ? -2.992  27.811  -19.184 1.00 66.30 ? 86  LYS A CE    1 
ATOM   1893 N  NZ    . LYS C 2 86  ? -2.378  26.878  -18.200 1.00 57.81 ? 86  LYS A NZ    1 
ATOM   1894 N  N     . LEU C 2 87  ? -4.049  28.745  -24.854 1.00 51.01 ? 87  LEU A N     1 
ATOM   1895 C  CA    . LEU C 2 87  ? -3.185  28.475  -26.003 1.00 48.41 ? 87  LEU A CA    1 
ATOM   1896 C  C     . LEU C 2 87  ? -3.400  29.408  -27.205 1.00 48.06 ? 87  LEU A C     1 
ATOM   1897 O  O     . LEU C 2 87  ? -2.535  29.513  -28.075 1.00 45.18 ? 87  LEU A O     1 
ATOM   1898 C  CB    . LEU C 2 87  ? -3.358  27.018  -26.448 1.00 47.77 ? 87  LEU A CB    1 
ATOM   1899 C  CG    . LEU C 2 87  ? -2.935  25.940  -25.440 1.00 50.81 ? 87  LEU A CG    1 
ATOM   1900 C  CD1   . LEU C 2 87  ? -3.350  24.575  -25.937 1.00 49.23 ? 87  LEU A CD1   1 
ATOM   1901 C  CD2   . LEU C 2 87  ? -1.432  25.988  -25.233 1.00 55.06 ? 87  LEU A CD2   1 
ATOM   1902 N  N     . GLU C 2 88  ? -4.542  30.086  -27.253 1.00 41.63 ? 88  GLU A N     1 
ATOM   1903 C  CA    . GLU C 2 88  ? -4.836  30.982  -28.365 1.00 48.61 ? 88  GLU A CA    1 
ATOM   1904 C  C     . GLU C 2 88  ? -4.704  30.247  -29.701 1.00 47.62 ? 88  GLU A C     1 
ATOM   1905 O  O     . GLU C 2 88  ? -4.141  30.789  -30.655 1.00 46.30 ? 88  GLU A O     1 
ATOM   1906 C  CB    . GLU C 2 88  ? -3.880  32.189  -28.352 1.00 49.73 ? 88  GLU A CB    1 
ATOM   1907 C  CG    . GLU C 2 88  ? -4.036  33.115  -27.149 1.00 55.88 ? 88  GLU A CG    1 
ATOM   1908 C  CD    . GLU C 2 88  ? -3.169  34.370  -27.237 1.00 57.26 ? 88  GLU A CD    1 
ATOM   1909 O  OE1   . GLU C 2 88  ? -1.928  34.258  -27.145 1.00 53.58 ? 88  GLU A OE1   1 
ATOM   1910 O  OE2   . GLU C 2 88  ? -3.735  35.474  -27.403 1.00 59.81 ? 88  GLU A OE2   1 
ATOM   1911 N  N     . LEU C 2 89  ? -5.224  29.021  -29.770 1.00 46.86 ? 89  LEU A N     1 
ATOM   1912 C  CA    . LEU C 2 89  ? -5.140  28.219  -30.993 1.00 45.25 ? 89  LEU A CA    1 
ATOM   1913 C  C     . LEU C 2 89  ? -5.793  28.891  -32.194 1.00 51.43 ? 89  LEU A C     1 
ATOM   1914 O  O     . LEU C 2 89  ? -5.436  28.616  -33.341 1.00 53.99 ? 89  LEU A O     1 
ATOM   1915 C  CB    . LEU C 2 89  ? -5.774  26.840  -30.779 1.00 46.49 ? 89  LEU A CB    1 
ATOM   1916 C  CG    . LEU C 2 89  ? -5.162  25.915  -29.714 1.00 37.90 ? 89  LEU A CG    1 
ATOM   1917 C  CD1   . LEU C 2 89  ? -5.963  24.614  -29.631 1.00 34.26 ? 89  LEU A CD1   1 
ATOM   1918 C  CD2   . LEU C 2 89  ? -3.705  25.611  -30.067 1.00 38.81 ? 89  LEU A CD2   1 
ATOM   1919 N  N     . HIS C 2 90  ? -6.748  29.776  -31.931 1.00 54.64 ? 90  HIS A N     1 
ATOM   1920 C  CA    . HIS C 2 90  ? -7.439  30.479  -33.002 1.00 54.41 ? 90  HIS A CA    1 
ATOM   1921 C  C     . HIS C 2 90  ? -6.442  31.204  -33.904 1.00 51.61 ? 90  HIS A C     1 
ATOM   1922 O  O     . HIS C 2 90  ? -6.656  31.320  -35.107 1.00 56.08 ? 90  HIS A O     1 
ATOM   1923 C  CB    . HIS C 2 90  ? -8.433  31.493  -32.429 1.00 55.93 ? 90  HIS A CB    1 
ATOM   1924 C  CG    . HIS C 2 90  ? -7.780  32.673  -31.783 1.00 61.80 ? 90  HIS A CG    1 
ATOM   1925 N  ND1   . HIS C 2 90  ? -7.190  32.608  -30.539 1.00 69.19 ? 90  HIS A ND1   1 
ATOM   1926 C  CD2   . HIS C 2 90  ? -7.567  33.931  -32.235 1.00 61.22 ? 90  HIS A CD2   1 
ATOM   1927 C  CE1   . HIS C 2 90  ? -6.639  33.774  -30.253 1.00 70.08 ? 90  HIS A CE1   1 
ATOM   1928 N  NE2   . HIS C 2 90  ? -6.854  34.595  -31.266 1.00 69.17 ? 90  HIS A NE2   1 
ATOM   1929 N  N     . LYS C 2 91  ? -5.345  31.684  -33.334 1.00 46.28 ? 91  LYS A N     1 
ATOM   1930 C  CA    . LYS C 2 91  ? -4.359  32.394  -34.138 1.00 51.12 ? 91  LYS A CA    1 
ATOM   1931 C  C     . LYS C 2 91  ? -3.337  31.488  -34.826 1.00 45.12 ? 91  LYS A C     1 
ATOM   1932 O  O     . LYS C 2 91  ? -2.471  31.972  -35.541 1.00 49.60 ? 91  LYS A O     1 
ATOM   1933 C  CB    . LYS C 2 91  ? -3.622  33.435  -33.283 1.00 51.10 ? 91  LYS A CB    1 
ATOM   1934 C  CG    . LYS C 2 91  ? -2.428  32.893  -32.518 1.00 57.95 ? 91  LYS A CG    1 
ATOM   1935 C  CD    . LYS C 2 91  ? -1.649  34.006  -31.806 1.00 59.96 ? 91  LYS A CD    1 
ATOM   1936 C  CE    . LYS C 2 91  ? -2.484  34.689  -30.733 1.00 60.95 ? 91  LYS A CE    1 
ATOM   1937 N  NZ    . LYS C 2 91  ? -1.668  35.616  -29.903 1.00 65.32 ? 91  LYS A NZ    1 
ATOM   1938 N  N     . PHE C 2 92  ? -3.444  30.179  -34.622 1.00 47.70 ? 92  PHE A N     1 
ATOM   1939 C  CA    . PHE C 2 92  ? -2.500  29.228  -35.214 1.00 40.65 ? 92  PHE A CA    1 
ATOM   1940 C  C     . PHE C 2 92  ? -3.150  28.233  -36.188 1.00 40.92 ? 92  PHE A C     1 
ATOM   1941 O  O     . PHE C 2 92  ? -2.470  27.656  -37.041 1.00 35.88 ? 92  PHE A O     1 
ATOM   1942 C  CB    . PHE C 2 92  ? -1.795  28.431  -34.105 1.00 44.57 ? 92  PHE A CB    1 
ATOM   1943 C  CG    . PHE C 2 92  ? -0.964  29.271  -33.167 1.00 43.71 ? 92  PHE A CG    1 
ATOM   1944 C  CD1   . PHE C 2 92  ? 0.235   29.841  -33.591 1.00 42.99 ? 92  PHE A CD1   1 
ATOM   1945 C  CD2   . PHE C 2 92  ? -1.368  29.470  -31.848 1.00 41.82 ? 92  PHE A CD2   1 
ATOM   1946 C  CE1   . PHE C 2 92  ? 1.021   30.594  -32.709 1.00 45.01 ? 92  PHE A CE1   1 
ATOM   1947 C  CE2   . PHE C 2 92  ? -0.585  30.226  -30.957 1.00 38.46 ? 92  PHE A CE2   1 
ATOM   1948 C  CZ    . PHE C 2 92  ? 0.609   30.787  -31.387 1.00 34.68 ? 92  PHE A CZ    1 
ATOM   1949 N  N     . ILE C 2 93  ? -4.458  28.032  -36.054 1.00 32.08 ? 93  ILE A N     1 
ATOM   1950 C  CA    . ILE C 2 93  ? -5.187  27.092  -36.899 1.00 32.25 ? 93  ILE A CA    1 
ATOM   1951 C  C     . ILE C 2 93  ? -5.281  27.531  -38.362 1.00 43.21 ? 93  ILE A C     1 
ATOM   1952 O  O     . ILE C 2 93  ? -5.573  28.690  -38.647 1.00 43.04 ? 93  ILE A O     1 
ATOM   1953 C  CB    . ILE C 2 93  ? -6.609  26.869  -36.343 1.00 39.93 ? 93  ILE A CB    1 
ATOM   1954 C  CG1   . ILE C 2 93  ? -6.531  26.050  -35.052 1.00 34.88 ? 93  ILE A CG1   1 
ATOM   1955 C  CG2   . ILE C 2 93  ? -7.474  26.171  -37.372 1.00 40.84 ? 93  ILE A CG2   1 
ATOM   1956 C  CD1   . ILE C 2 93  ? -7.808  26.041  -34.260 1.00 31.39 ? 93  ILE A CD1   1 
ATOM   1957 N  N     . ARG C 2 94  ? -5.033  26.594  -39.277 1.00 39.70 ? 94  ARG A N     1 
ATOM   1958 C  CA    . ARG C 2 94  ? -5.084  26.865  -40.713 1.00 40.97 ? 94  ARG A CA    1 
ATOM   1959 C  C     . ARG C 2 94  ? -6.358  26.276  -41.315 1.00 45.10 ? 94  ARG A C     1 
ATOM   1960 O  O     . ARG C 2 94  ? -6.607  25.072  -41.206 1.00 41.96 ? 94  ARG A O     1 
ATOM   1961 C  CB    . ARG C 2 94  ? -3.854  26.265  -41.417 1.00 37.12 ? 94  ARG A CB    1 
ATOM   1962 C  CG    . ARG C 2 94  ? -2.519  26.739  -40.837 1.00 49.57 ? 94  ARG A CG    1 
ATOM   1963 C  CD    . ARG C 2 94  ? -1.334  26.456  -41.759 1.00 42.86 ? 94  ARG A CD    1 
ATOM   1964 N  NE    . ARG C 2 94  ? -1.155  25.033  -42.021 1.00 47.20 ? 94  ARG A NE    1 
ATOM   1965 C  CZ    . ARG C 2 94  ? -0.162  24.520  -42.743 1.00 45.66 ? 94  ARG A CZ    1 
ATOM   1966 N  NH1   . ARG C 2 94  ? 0.753   25.317  -43.279 1.00 51.55 ? 94  ARG A NH1   1 
ATOM   1967 N  NH2   . ARG C 2 94  ? -0.086  23.207  -42.932 1.00 39.61 ? 94  ARG A NH2   1 
ATOM   1968 N  N     . ILE C 2 95  ? -7.165  27.122  -41.947 1.00 43.60 ? 95  ILE A N     1 
ATOM   1969 C  CA    . ILE C 2 95  ? -8.409  26.660  -42.554 1.00 54.02 ? 95  ILE A CA    1 
ATOM   1970 C  C     . ILE C 2 95  ? -8.875  27.589  -43.684 1.00 61.01 ? 95  ILE A C     1 
ATOM   1971 O  O     . ILE C 2 95  ? -8.491  28.760  -43.728 1.00 61.42 ? 95  ILE A O     1 
ATOM   1972 C  CB    . ILE C 2 95  ? -9.522  26.531  -41.476 1.00 48.95 ? 95  ILE A CB    1 
ATOM   1973 C  CG1   . ILE C 2 95  ? -10.809 25.998  -42.107 1.00 54.43 ? 95  ILE A CG1   1 
ATOM   1974 C  CG2   . ILE C 2 95  ? -9.765  27.871  -40.806 1.00 51.53 ? 95  ILE A CG2   1 
ATOM   1975 C  CD1   . ILE C 2 95  ? -11.914 25.729  -41.109 1.00 56.73 ? 95  ILE A CD1   1 
ATOM   1976 N  N     . LYS C 2 96  ? -9.690  27.058  -44.598 1.00 65.05 ? 96  LYS A N     1 
ATOM   1977 C  CA    . LYS C 2 96  ? -10.217 27.832  -45.727 1.00 69.63 ? 96  LYS A CA    1 
ATOM   1978 C  C     . LYS C 2 96  ? -11.738 27.971  -45.662 1.00 73.15 ? 96  LYS A C     1 
ATOM   1979 O  O     . LYS C 2 96  ? -12.266 29.057  -45.414 1.00 73.25 ? 96  LYS A O     1 
ATOM   1980 C  CB    . LYS C 2 96  ? -9.852  27.165  -47.058 1.00 69.37 ? 96  LYS A CB    1 
ATOM   1981 C  CG    . LYS C 2 96  ? -8.369  27.062  -47.342 1.00 69.02 ? 96  LYS A CG    1 
ATOM   1982 C  CD    . LYS C 2 96  ? -7.754  28.414  -47.643 1.00 71.94 ? 96  LYS A CD    1 
ATOM   1983 C  CE    . LYS C 2 96  ? -6.247  28.290  -47.843 1.00 76.77 ? 96  LYS A CE    1 
ATOM   1984 N  NZ    . LYS C 2 96  ? -5.879  27.308  -48.909 1.00 76.72 ? 96  LYS A NZ    1 
ATOM   1985 N  N     . ARG C 2 97  ? -12.431 26.857  -45.891 1.00 79.42 ? 97  ARG A N     1 
ATOM   1986 C  CA    . ARG C 2 97  ? -13.894 26.822  -45.893 1.00 86.31 ? 97  ARG A CA    1 
ATOM   1987 C  C     . ARG C 2 97  ? -14.547 27.014  -44.530 1.00 89.70 ? 97  ARG A C     1 
ATOM   1988 O  O     . ARG C 2 97  ? -14.925 26.040  -43.875 1.00 90.65 ? 97  ARG A O     1 
ATOM   1989 C  CB    . ARG C 2 97  ? -14.390 25.503  -46.500 1.00 87.35 ? 97  ARG A CB    1 
ATOM   1990 C  CG    . ARG C 2 97  ? -14.019 25.311  -47.962 1.00 89.61 ? 97  ARG A CG    1 
ATOM   1991 C  CD    . ARG C 2 97  ? -14.707 26.337  -48.844 1.00 89.52 ? 97  ARG A CD    1 
ATOM   1992 N  NE    . ARG C 2 97  ? -14.046 26.462  -50.138 1.00 95.84 ? 97  ARG A NE    1 
ATOM   1993 C  CZ    . ARG C 2 97  ? -12.793 26.879  -50.300 1.00 97.76 ? 97  ARG A CZ    1 
ATOM   1994 N  NH1   . ARG C 2 97  ? -12.061 27.214  -49.246 1.00 99.84 ? 97  ARG A NH1   1 
ATOM   1995 N  NH2   . ARG C 2 97  ? -12.267 26.960  -51.516 1.00 99.51 ? 97  ARG A NH2   1 
ATOM   1996 N  N     . GLY C 2 98  ? -14.685 28.271  -44.111 1.00 91.12 ? 98  GLY A N     1 
ATOM   1997 C  CA    . GLY C 2 98  ? -15.318 28.552  -42.835 1.00 91.04 ? 98  GLY A CA    1 
ATOM   1998 C  C     . GLY C 2 98  ? -14.526 29.403  -41.860 1.00 87.06 ? 98  GLY A C     1 
ATOM   1999 O  O     . GLY C 2 98  ? -13.578 30.097  -42.230 1.00 88.32 ? 98  GLY A O     1 
ATOM   2000 N  N     . LYS C 2 99  ? -14.938 29.350  -40.600 1.00 83.07 ? 99  LYS A N     1 
ATOM   2001 C  CA    . LYS C 2 99  ? -14.290 30.102  -39.537 1.00 79.72 ? 99  LYS A CA    1 
ATOM   2002 C  C     . LYS C 2 99  ? -13.994 29.158  -38.379 1.00 72.71 ? 99  LYS A C     1 
ATOM   2003 O  O     . LYS C 2 99  ? -14.690 28.164  -38.183 1.00 72.82 ? 99  LYS A O     1 
ATOM   2004 C  CB    . LYS C 2 99  ? -15.200 31.234  -39.055 1.00 85.27 ? 99  LYS A CB    1 
ATOM   2005 C  CG    . LYS C 2 99  ? -15.657 32.195  -40.150 1.00 93.92 ? 99  LYS A CG    1 
ATOM   2006 C  CD    . LYS C 2 99  ? -14.502 32.992  -40.753 1.00 97.09 ? 99  LYS A CD    1 
ATOM   2007 C  CE    . LYS C 2 99  ? -15.014 34.007  -41.772 1.00 99.58 ? 99  LYS A CE    1 
ATOM   2008 N  NZ    . LYS C 2 99  ? -13.929 34.843  -42.354 1.00 99.84 ? 99  LYS A NZ    1 
ATOM   2009 N  N     . ILE C 2 100 ? -12.962 29.482  -37.612 1.00 63.40 ? 100 ILE A N     1 
ATOM   2010 C  CA    . ILE C 2 100 ? -12.552 28.670  -36.475 1.00 57.64 ? 100 ILE A CA    1 
ATOM   2011 C  C     . ILE C 2 100 ? -13.580 28.658  -35.350 1.00 57.04 ? 100 ILE A C     1 
ATOM   2012 O  O     . ILE C 2 100 ? -13.555 29.523  -34.478 1.00 63.17 ? 100 ILE A O     1 
ATOM   2013 C  CB    . ILE C 2 100 ? -11.219 29.180  -35.916 1.00 53.78 ? 100 ILE A CB    1 
ATOM   2014 C  CG1   . ILE C 2 100 ? -10.163 29.142  -37.023 1.00 55.77 ? 100 ILE A CG1   1 
ATOM   2015 C  CG2   . ILE C 2 100 ? -10.790 28.340  -34.724 1.00 49.85 ? 100 ILE A CG2   1 
ATOM   2016 C  CD1   . ILE C 2 100 ? -8.826  29.710  -36.629 1.00 52.92 ? 100 ILE A CD1   1 
ATOM   2017 N  N     . ASN C 2 101 ? -14.477 27.678  -35.357 1.00 45.62 ? 101 ASN A N     1 
ATOM   2018 C  CA    . ASN C 2 101 ? -15.493 27.596  -34.309 1.00 48.08 ? 101 ASN A CA    1 
ATOM   2019 C  C     . ASN C 2 101 ? -15.049 26.680  -33.167 1.00 45.50 ? 101 ASN A C     1 
ATOM   2020 O  O     . ASN C 2 101 ? -13.946 26.135  -33.193 1.00 45.16 ? 101 ASN A O     1 
ATOM   2021 C  CB    . ASN C 2 101 ? -16.832 27.115  -34.887 1.00 47.53 ? 101 ASN A CB    1 
ATOM   2022 C  CG    . ASN C 2 101 ? -16.732 25.756  -35.551 1.00 54.42 ? 101 ASN A CG    1 
ATOM   2023 O  OD1   . ASN C 2 101 ? -16.341 24.770  -34.927 1.00 57.30 ? 101 ASN A OD1   1 
ATOM   2024 N  ND2   . ASN C 2 101 ? -17.095 25.697  -36.828 1.00 62.53 ? 101 ASN A ND2   1 
ATOM   2025 N  N     . GLU C 2 102 ? -15.905 26.515  -32.165 1.00 41.64 ? 102 GLU A N     1 
ATOM   2026 C  CA    . GLU C 2 102 ? -15.563 25.678  -31.019 1.00 48.73 ? 102 GLU A CA    1 
ATOM   2027 C  C     . GLU C 2 102 ? -15.344 24.197  -31.348 1.00 42.31 ? 102 GLU A C     1 
ATOM   2028 O  O     . GLU C 2 102 ? -14.614 23.508  -30.648 1.00 41.87 ? 102 GLU A O     1 
ATOM   2029 C  CB    . GLU C 2 102 ? -16.612 25.847  -29.907 1.00 49.60 ? 102 GLU A CB    1 
ATOM   2030 C  CG    . GLU C 2 102 ? -16.405 27.131  -29.098 1.00 57.16 ? 102 GLU A CG    1 
ATOM   2031 C  CD    . GLU C 2 102 ? -17.255 27.219  -27.832 1.00 63.14 ? 102 GLU A CD    1 
ATOM   2032 O  OE1   . GLU C 2 102 ? -17.335 26.223  -27.078 1.00 63.28 ? 102 GLU A OE1   1 
ATOM   2033 O  OE2   . GLU C 2 102 ? -17.827 28.302  -27.582 1.00 71.72 ? 102 GLU A OE2   1 
ATOM   2034 N  N     . THR C 2 103 ? -15.957 23.711  -32.420 1.00 40.83 ? 103 THR A N     1 
ATOM   2035 C  CA    . THR C 2 103 ? -15.780 22.318  -32.812 1.00 43.19 ? 103 THR A CA    1 
ATOM   2036 C  C     . THR C 2 103 ? -14.385 22.149  -33.414 1.00 44.33 ? 103 THR A C     1 
ATOM   2037 O  O     . THR C 2 103 ? -13.752 21.099  -33.270 1.00 40.46 ? 103 THR A O     1 
ATOM   2038 C  CB    . THR C 2 103 ? -16.839 21.884  -33.847 1.00 46.09 ? 103 THR A CB    1 
ATOM   2039 O  OG1   . THR C 2 103 ? -18.149 21.968  -33.260 1.00 48.06 ? 103 THR A OG1   1 
ATOM   2040 C  CG2   . THR C 2 103 ? -16.585 20.458  -34.300 1.00 38.07 ? 103 THR A CG2   1 
ATOM   2041 N  N     . ILE C 2 104 ? -13.908 23.190  -34.089 1.00 34.17 ? 104 ILE A N     1 
ATOM   2042 C  CA    . ILE C 2 104 ? -12.586 23.150  -34.690 1.00 34.95 ? 104 ILE A CA    1 
ATOM   2043 C  C     . ILE C 2 104 ? -11.541 23.205  -33.572 1.00 35.99 ? 104 ILE A C     1 
ATOM   2044 O  O     . ILE C 2 104 ? -10.647 22.362  -33.505 1.00 34.95 ? 104 ILE A O     1 
ATOM   2045 C  CB    . ILE C 2 104 ? -12.363 24.337  -35.653 1.00 37.03 ? 104 ILE A CB    1 
ATOM   2046 C  CG1   . ILE C 2 104 ? -13.296 24.214  -36.858 1.00 41.33 ? 104 ILE A CG1   1 
ATOM   2047 C  CG2   . ILE C 2 104 ? -10.909 24.382  -36.102 1.00 36.06 ? 104 ILE A CG2   1 
ATOM   2048 C  CD1   . ILE C 2 104 ? -13.186 22.899  -37.600 1.00 43.18 ? 104 ILE A CD1   1 
ATOM   2049 N  N     . ILE C 2 105 ? -11.671 24.201  -32.700 1.00 31.38 ? 105 ILE A N     1 
ATOM   2050 C  CA    . ILE C 2 105 ? -10.762 24.383  -31.573 1.00 39.62 ? 105 ILE A CA    1 
ATOM   2051 C  C     . ILE C 2 105 ? -10.648 23.108  -30.743 1.00 37.20 ? 105 ILE A C     1 
ATOM   2052 O  O     . ILE C 2 105 ? -9.547  22.667  -30.408 1.00 41.43 ? 105 ILE A O     1 
ATOM   2053 C  CB    . ILE C 2 105 ? -11.246 25.534  -30.684 1.00 37.43 ? 105 ILE A CB    1 
ATOM   2054 C  CG1   . ILE C 2 105 ? -11.159 26.841  -31.467 1.00 40.49 ? 105 ILE A CG1   1 
ATOM   2055 C  CG2   . ILE C 2 105 ? -10.433 25.605  -29.410 1.00 34.91 ? 105 ILE A CG2   1 
ATOM   2056 C  CD1   . ILE C 2 105 ? -11.993 27.958  -30.869 1.00 45.43 ? 105 ILE A CD1   1 
ATOM   2057 N  N     . GLY C 2 106 ? -11.790 22.512  -30.426 1.00 34.30 ? 106 GLY A N     1 
ATOM   2058 C  CA    . GLY C 2 106 ? -11.785 21.285  -29.651 1.00 36.45 ? 106 GLY A CA    1 
ATOM   2059 C  C     . GLY C 2 106 ? -11.059 20.139  -30.342 1.00 33.66 ? 106 GLY A C     1 
ATOM   2060 O  O     . GLY C 2 106 ? -10.370 19.347  -29.691 1.00 33.77 ? 106 GLY A O     1 
ATOM   2061 N  N     . ASP C 2 107 ? -11.209 20.039  -31.660 1.00 34.25 ? 107 ASP A N     1 
ATOM   2062 C  CA    . ASP C 2 107 ? -10.548 18.974  -32.397 1.00 27.65 ? 107 ASP A CA    1 
ATOM   2063 C  C     . ASP C 2 107 ? -9.058  19.212  -32.541 1.00 33.90 ? 107 ASP A C     1 
ATOM   2064 O  O     . ASP C 2 107 ? -8.279  18.260  -32.526 1.00 29.71 ? 107 ASP A O     1 
ATOM   2065 C  CB    . ASP C 2 107 ? -11.168 18.800  -33.776 1.00 40.93 ? 107 ASP A CB    1 
ATOM   2066 C  CG    . ASP C 2 107 ? -12.510 18.119  -33.714 1.00 40.93 ? 107 ASP A CG    1 
ATOM   2067 O  OD1   . ASP C 2 107 ? -12.772 17.429  -32.704 1.00 46.44 ? 107 ASP A OD1   1 
ATOM   2068 O  OD2   . ASP C 2 107 ? -13.292 18.259  -34.674 1.00 47.47 ? 107 ASP A OD2   1 
ATOM   2069 N  N     . VAL C 2 108 ? -8.664  20.472  -32.691 1.00 27.52 ? 108 VAL A N     1 
ATOM   2070 C  CA    . VAL C 2 108 ? -7.251  20.811  -32.824 1.00 30.53 ? 108 VAL A CA    1 
ATOM   2071 C  C     . VAL C 2 108 ? -6.566  20.618  -31.471 1.00 30.55 ? 108 VAL A C     1 
ATOM   2072 O  O     . VAL C 2 108 ? -5.404  20.216  -31.405 1.00 33.78 ? 108 VAL A O     1 
ATOM   2073 C  CB    . VAL C 2 108 ? -7.049  22.275  -33.298 1.00 36.52 ? 108 VAL A CB    1 
ATOM   2074 C  CG1   . VAL C 2 108 ? -5.565  22.655  -33.210 1.00 27.11 ? 108 VAL A CG1   1 
ATOM   2075 C  CG2   . VAL C 2 108 ? -7.543  22.427  -34.738 1.00 28.75 ? 108 VAL A CG2   1 
ATOM   2076 N  N     . PHE C 2 109 ? -7.283  20.909  -30.393 1.00 28.80 ? 109 PHE A N     1 
ATOM   2077 C  CA    . PHE C 2 109 ? -6.723  20.719  -29.057 1.00 30.81 ? 109 PHE A CA    1 
ATOM   2078 C  C     . PHE C 2 109 ? -6.333  19.237  -28.936 1.00 35.17 ? 109 PHE A C     1 
ATOM   2079 O  O     . PHE C 2 109 ? -5.210  18.912  -28.561 1.00 34.63 ? 109 PHE A O     1 
ATOM   2080 C  CB    . PHE C 2 109 ? -7.770  21.050  -28.009 1.00 29.79 ? 109 PHE A CB    1 
ATOM   2081 C  CG    . PHE C 2 109 ? -7.302  20.868  -26.601 1.00 31.59 ? 109 PHE A CG    1 
ATOM   2082 C  CD1   . PHE C 2 109 ? -6.508  21.839  -25.986 1.00 33.53 ? 109 PHE A CD1   1 
ATOM   2083 C  CD2   . PHE C 2 109 ? -7.708  19.757  -25.860 1.00 25.74 ? 109 PHE A CD2   1 
ATOM   2084 C  CE1   . PHE C 2 109 ? -6.130  21.715  -24.638 1.00 29.09 ? 109 PHE A CE1   1 
ATOM   2085 C  CE2   . PHE C 2 109 ? -7.338  19.618  -24.515 1.00 33.25 ? 109 PHE A CE2   1 
ATOM   2086 C  CZ    . PHE C 2 109 ? -6.548  20.604  -23.903 1.00 32.19 ? 109 PHE A CZ    1 
ATOM   2087 N  N     . GLU C 2 110 ? -7.267  18.344  -29.265 1.00 31.10 ? 110 GLU A N     1 
ATOM   2088 C  CA    . GLU C 2 110 ? -6.993  16.912  -29.197 1.00 40.38 ? 110 GLU A CA    1 
ATOM   2089 C  C     . GLU C 2 110 ? -5.829  16.510  -30.098 1.00 37.77 ? 110 GLU A C     1 
ATOM   2090 O  O     . GLU C 2 110 ? -4.902  15.839  -29.652 1.00 41.03 ? 110 GLU A O     1 
ATOM   2091 C  CB    . GLU C 2 110 ? -8.235  16.112  -29.587 1.00 29.14 ? 110 GLU A CB    1 
ATOM   2092 C  CG    . GLU C 2 110 ? -9.419  16.356  -28.672 1.00 32.68 ? 110 GLU A CG    1 
ATOM   2093 C  CD    . GLU C 2 110 ? -10.690 15.673  -29.167 1.00 42.29 ? 110 GLU A CD    1 
ATOM   2094 O  OE1   . GLU C 2 110 ? -11.046 15.852  -30.355 1.00 38.36 ? 110 GLU A OE1   1 
ATOM   2095 O  OE2   . GLU C 2 110 ? -11.332 14.961  -28.367 1.00 49.97 ? 110 GLU A OE2   1 
ATOM   2096 N  N     . ALA C 2 111 ? -5.875  16.929  -31.361 1.00 35.69 ? 111 ALA A N     1 
ATOM   2097 C  CA    . ALA C 2 111 ? -4.837  16.590  -32.336 1.00 36.14 ? 111 ALA A CA    1 
ATOM   2098 C  C     . ALA C 2 111 ? -3.444  17.034  -31.903 1.00 34.90 ? 111 ALA A C     1 
ATOM   2099 O  O     . ALA C 2 111 ? -2.454  16.329  -32.120 1.00 31.80 ? 111 ALA A O     1 
ATOM   2100 C  CB    . ALA C 2 111 ? -5.178  17.199  -33.698 1.00 29.82 ? 111 ALA A CB    1 
ATOM   2101 N  N     . LEU C 2 112 ? -3.391  18.209  -31.289 1.00 32.13 ? 112 LEU A N     1 
ATOM   2102 C  CA    . LEU C 2 112 ? -2.157  18.803  -30.804 1.00 37.24 ? 112 LEU A CA    1 
ATOM   2103 C  C     . LEU C 2 112 ? -1.474  17.888  -29.785 1.00 33.36 ? 112 LEU A C     1 
ATOM   2104 O  O     . LEU C 2 112 ? -0.258  17.673  -29.842 1.00 29.52 ? 112 LEU A O     1 
ATOM   2105 C  CB    . LEU C 2 112 ? -2.463  20.166  -30.197 1.00 39.94 ? 112 LEU A CB    1 
ATOM   2106 C  CG    . LEU C 2 112 ? -1.264  21.026  -29.779 1.00 52.78 ? 112 LEU A CG    1 
ATOM   2107 C  CD1   . LEU C 2 112 ? -0.389  21.383  -30.979 1.00 58.16 ? 112 LEU A CD1   1 
ATOM   2108 C  CD2   . LEU C 2 112 ? -1.737  22.282  -29.071 1.00 54.72 ? 112 LEU A CD2   1 
ATOM   2109 N  N     . TRP C 2 113 ? -2.256  17.355  -28.852 1.00 29.12 ? 113 TRP A N     1 
ATOM   2110 C  CA    . TRP C 2 113 ? -1.688  16.462  -27.852 1.00 32.95 ? 113 TRP A CA    1 
ATOM   2111 C  C     . TRP C 2 113 ? -1.247  15.147  -28.471 1.00 33.97 ? 113 TRP A C     1 
ATOM   2112 O  O     . TRP C 2 113 ? -0.303  14.503  -27.993 1.00 26.66 ? 113 TRP A O     1 
ATOM   2113 C  CB    . TRP C 2 113 ? -2.669  16.269  -26.693 1.00 30.27 ? 113 TRP A CB    1 
ATOM   2114 C  CG    . TRP C 2 113 ? -2.634  17.574  -25.979 1.00 34.42 ? 113 TRP A CG    1 
ATOM   2115 C  CD1   . TRP C 2 113 ? -3.582  18.558  -25.971 1.00 39.71 ? 113 TRP A CD1   1 
ATOM   2116 C  CD2   . TRP C 2 113 ? -1.533  18.045  -25.180 1.00 39.41 ? 113 TRP A CD2   1 
ATOM   2117 N  NE1   . TRP C 2 113 ? -3.132  19.618  -25.228 1.00 31.99 ? 113 TRP A NE1   1 
ATOM   2118 C  CE2   . TRP C 2 113 ? -1.877  19.348  -24.752 1.00 40.04 ? 113 TRP A CE2   1 
ATOM   2119 C  CE3   . TRP C 2 113 ? -0.282  17.522  -24.819 1.00 38.51 ? 113 TRP A CE3   1 
ATOM   2120 C  CZ2   . TRP C 2 113 ? -1.013  20.138  -23.983 1.00 29.73 ? 113 TRP A CZ2   1 
ATOM   2121 C  CZ3   . TRP C 2 113 ? 0.577   18.308  -24.052 1.00 40.75 ? 113 TRP A CZ3   1 
ATOM   2122 C  CH2   . TRP C 2 113 ? 0.205   19.603  -23.644 1.00 41.68 ? 113 TRP A CH2   1 
ATOM   2123 N  N     . ALA C 2 114 ? -1.939  14.733  -29.528 1.00 28.37 ? 114 ALA A N     1 
ATOM   2124 C  CA    . ALA C 2 114 ? -1.561  13.521  -30.228 1.00 29.46 ? 114 ALA A CA    1 
ATOM   2125 C  C     . ALA C 2 114 ? -0.212  13.815  -30.913 1.00 35.48 ? 114 ALA A C     1 
ATOM   2126 O  O     . ALA C 2 114 ? 0.694   12.970  -30.934 1.00 32.93 ? 114 ALA A O     1 
ATOM   2127 C  CB    . ALA C 2 114 ? -2.623  13.092  -31.238 1.00 31.62 ? 114 ALA A CB    1 
ATOM   2128 N  N     . ALA C 2 115 ? -0.084  15.025  -31.455 1.00 32.15 ? 115 ALA A N     1 
ATOM   2129 C  CA    . ALA C 2 115 ? 1.139   15.437  -32.134 1.00 30.14 ? 115 ALA A CA    1 
ATOM   2130 C  C     . ALA C 2 115 ? 2.296   15.437  -31.158 1.00 26.92 ? 115 ALA A C     1 
ATOM   2131 O  O     . ALA C 2 115 ? 3.354   14.894  -31.452 1.00 31.08 ? 115 ALA A O     1 
ATOM   2132 C  CB    . ALA C 2 115 ? 0.971   16.827  -32.733 1.00 30.85 ? 115 ALA A CB    1 
ATOM   2133 N  N     . VAL C 2 116 ? 2.097   16.063  -30.001 1.00 29.60 ? 116 VAL A N     1 
ATOM   2134 C  CA    . VAL C 2 116 ? 3.145   16.110  -28.987 1.00 30.13 ? 116 VAL A CA    1 
ATOM   2135 C  C     . VAL C 2 116 ? 3.518   14.671  -28.621 1.00 35.55 ? 116 VAL A C     1 
ATOM   2136 O  O     . VAL C 2 116 ? 4.697   14.307  -28.578 1.00 35.50 ? 116 VAL A O     1 
ATOM   2137 C  CB    . VAL C 2 116 ? 2.682   16.874  -27.721 1.00 29.34 ? 116 VAL A CB    1 
ATOM   2138 C  CG1   . VAL C 2 116 ? 3.734   16.738  -26.614 1.00 29.76 ? 116 VAL A CG1   1 
ATOM   2139 C  CG2   . VAL C 2 116 ? 2.468   18.368  -28.049 1.00 27.27 ? 116 VAL A CG2   1 
ATOM   2140 N  N     . TYR C 2 117 ? 2.508   13.840  -28.393 1.00 30.85 ? 117 TYR A N     1 
ATOM   2141 C  CA    . TYR C 2 117 ? 2.763   12.454  -28.040 1.00 32.54 ? 117 TYR A CA    1 
ATOM   2142 C  C     . TYR C 2 117 ? 3.647   11.750  -29.072 1.00 37.07 ? 117 TYR A C     1 
ATOM   2143 O  O     . TYR C 2 117 ? 4.662   11.160  -28.722 1.00 32.69 ? 117 TYR A O     1 
ATOM   2144 C  CB    . TYR C 2 117 ? 1.445   11.710  -27.876 1.00 27.23 ? 117 TYR A CB    1 
ATOM   2145 C  CG    . TYR C 2 117 ? 1.591   10.215  -27.703 1.00 32.47 ? 117 TYR A CG    1 
ATOM   2146 C  CD1   . TYR C 2 117 ? 2.114   9.667   -26.529 1.00 29.90 ? 117 TYR A CD1   1 
ATOM   2147 C  CD2   . TYR C 2 117 ? 1.166   9.349   -28.700 1.00 34.35 ? 117 TYR A CD2   1 
ATOM   2148 C  CE1   . TYR C 2 117 ? 2.193   8.291   -26.354 1.00 25.63 ? 117 TYR A CE1   1 
ATOM   2149 C  CE2   . TYR C 2 117 ? 1.245   7.971   -28.541 1.00 35.43 ? 117 TYR A CE2   1 
ATOM   2150 C  CZ    . TYR C 2 117 ? 1.751   7.450   -27.376 1.00 33.75 ? 117 TYR A CZ    1 
ATOM   2151 O  OH    . TYR C 2 117 ? 1.792   6.090   -27.246 1.00 31.66 ? 117 TYR A OH    1 
ATOM   2152 N  N     . ILE C 2 118 ? 3.275   11.834  -30.346 1.00 36.75 ? 118 ILE A N     1 
ATOM   2153 C  CA    . ILE C 2 118 ? 4.048   11.191  -31.408 1.00 30.25 ? 118 ILE A CA    1 
ATOM   2154 C  C     . ILE C 2 118 ? 5.440   11.791  -31.617 1.00 38.15 ? 118 ILE A C     1 
ATOM   2155 O  O     . ILE C 2 118 ? 6.420   11.055  -31.759 1.00 31.34 ? 118 ILE A O     1 
ATOM   2156 C  CB    . ILE C 2 118 ? 3.276   11.239  -32.755 1.00 35.05 ? 118 ILE A CB    1 
ATOM   2157 C  CG1   . ILE C 2 118 ? 2.059   10.312  -32.679 1.00 31.22 ? 118 ILE A CG1   1 
ATOM   2158 C  CG2   . ILE C 2 118 ? 4.190   10.852  -33.916 1.00 26.83 ? 118 ILE A CG2   1 
ATOM   2159 C  CD1   . ILE C 2 118 ? 1.163   10.388  -33.886 1.00 39.43 ? 118 ILE A CD1   1 
ATOM   2160 N  N     . ASP C 2 119 ? 5.531   13.121  -31.636 1.00 34.97 ? 119 ASP A N     1 
ATOM   2161 C  CA    . ASP C 2 119 ? 6.815   13.780  -31.854 1.00 35.23 ? 119 ASP A CA    1 
ATOM   2162 C  C     . ASP C 2 119 ? 7.832   13.507  -30.747 1.00 37.41 ? 119 ASP A C     1 
ATOM   2163 O  O     . ASP C 2 119 ? 9.037   13.537  -30.987 1.00 33.09 ? 119 ASP A O     1 
ATOM   2164 C  CB    . ASP C 2 119 ? 6.645   15.293  -31.987 1.00 31.79 ? 119 ASP A CB    1 
ATOM   2165 C  CG    . ASP C 2 119 ? 7.930   15.972  -32.407 1.00 34.83 ? 119 ASP A CG    1 
ATOM   2166 O  OD1   . ASP C 2 119 ? 8.282   15.872  -33.600 1.00 36.96 ? 119 ASP A OD1   1 
ATOM   2167 O  OD2   . ASP C 2 119 ? 8.595   16.592  -31.547 1.00 35.89 ? 119 ASP A OD2   1 
ATOM   2168 N  N     . SER C 2 120 ? 7.341   13.267  -29.537 1.00 32.94 ? 120 SER A N     1 
ATOM   2169 C  CA    . SER C 2 120 ? 8.215   12.986  -28.415 1.00 38.44 ? 120 SER A CA    1 
ATOM   2170 C  C     . SER C 2 120 ? 8.614   11.514  -28.445 1.00 40.89 ? 120 SER A C     1 
ATOM   2171 O  O     . SER C 2 120 ? 9.230   11.012  -27.505 1.00 41.09 ? 120 SER A O     1 
ATOM   2172 C  CB    . SER C 2 120 ? 7.511   13.300  -27.093 1.00 34.96 ? 120 SER A CB    1 
ATOM   2173 O  OG    . SER C 2 120 ? 6.463   12.380  -26.844 1.00 40.28 ? 120 SER A OG    1 
ATOM   2174 N  N     . GLY C 2 121 ? 8.264   10.831  -29.533 1.00 39.19 ? 121 GLY A N     1 
ATOM   2175 C  CA    . GLY C 2 121 ? 8.601   9.422   -29.668 1.00 36.50 ? 121 GLY A CA    1 
ATOM   2176 C  C     . GLY C 2 121 ? 7.645   8.525   -28.908 1.00 36.22 ? 121 GLY A C     1 
ATOM   2177 O  O     . GLY C 2 121 ? 8.039   7.489   -28.384 1.00 35.14 ? 121 GLY A O     1 
ATOM   2178 N  N     . ARG C 2 122 ? 6.378   8.929   -28.860 1.00 39.50 ? 122 ARG A N     1 
ATOM   2179 C  CA    . ARG C 2 122 ? 5.332   8.185   -28.165 1.00 34.29 ? 122 ARG A CA    1 
ATOM   2180 C  C     . ARG C 2 122 ? 5.620   8.014   -26.683 1.00 34.82 ? 122 ARG A C     1 
ATOM   2181 O  O     . ARG C 2 122 ? 5.477   6.929   -26.119 1.00 36.06 ? 122 ARG A O     1 
ATOM   2182 C  CB    . ARG C 2 122 ? 5.102   6.829   -28.846 1.00 38.01 ? 122 ARG A CB    1 
ATOM   2183 C  CG    . ARG C 2 122 ? 4.442   6.985   -30.220 1.00 43.89 ? 122 ARG A CG    1 
ATOM   2184 C  CD    . ARG C 2 122 ? 3.695   5.735   -30.654 1.00 39.57 ? 122 ARG A CD    1 
ATOM   2185 N  NE    . ARG C 2 122 ? 2.602   6.025   -31.581 1.00 42.73 ? 122 ARG A NE    1 
ATOM   2186 C  CZ    . ARG C 2 122 ? 2.755   6.552   -32.794 1.00 49.09 ? 122 ARG A CZ    1 
ATOM   2187 N  NH1   . ARG C 2 122 ? 3.966   6.857   -33.240 1.00 53.10 ? 122 ARG A NH1   1 
ATOM   2188 N  NH2   . ARG C 2 122 ? 1.695   6.763   -33.569 1.00 45.39 ? 122 ARG A NH2   1 
ATOM   2189 N  N     . ASP C 2 123 ? 6.029   9.111   -26.059 1.00 35.41 ? 123 ASP A N     1 
ATOM   2190 C  CA    . ASP C 2 123 ? 6.332   9.138   -24.634 1.00 36.92 ? 123 ASP A CA    1 
ATOM   2191 C  C     . ASP C 2 123 ? 5.056   9.551   -23.903 1.00 36.52 ? 123 ASP A C     1 
ATOM   2192 O  O     . ASP C 2 123 ? 4.760   10.747  -23.773 1.00 32.03 ? 123 ASP A O     1 
ATOM   2193 C  CB    . ASP C 2 123 ? 7.431   10.166  -24.354 1.00 37.46 ? 123 ASP A CB    1 
ATOM   2194 C  CG    . ASP C 2 123 ? 7.987   10.057  -22.951 1.00 35.18 ? 123 ASP A CG    1 
ATOM   2195 O  OD1   . ASP C 2 123 ? 7.238   9.653   -22.041 1.00 38.18 ? 123 ASP A OD1   1 
ATOM   2196 O  OD2   . ASP C 2 123 ? 9.169   10.393  -22.757 1.00 43.87 ? 123 ASP A OD2   1 
ATOM   2197 N  N     . ALA C 2 124 ? 4.303   8.572   -23.414 1.00 35.74 ? 124 ALA A N     1 
ATOM   2198 C  CA    . ALA C 2 124 ? 3.053   8.877   -22.729 1.00 37.92 ? 124 ALA A CA    1 
ATOM   2199 C  C     . ALA C 2 124 ? 3.242   9.613   -21.401 1.00 39.41 ? 124 ALA A C     1 
ATOM   2200 O  O     . ALA C 2 124 ? 2.503   10.552  -21.110 1.00 36.46 ? 124 ALA A O     1 
ATOM   2201 C  CB    . ALA C 2 124 ? 2.237   7.598   -22.515 1.00 30.79 ? 124 ALA A CB    1 
ATOM   2202 N  N     . ASN C 2 125 ? 4.228   9.200   -20.605 1.00 40.74 ? 125 ASN A N     1 
ATOM   2203 C  CA    . ASN C 2 125 ? 4.455   9.844   -19.311 1.00 37.66 ? 125 ASN A CA    1 
ATOM   2204 C  C     . ASN C 2 125 ? 4.789   11.315  -19.509 1.00 37.03 ? 125 ASN A C     1 
ATOM   2205 O  O     . ASN C 2 125 ? 4.250   12.187  -18.830 1.00 32.63 ? 125 ASN A O     1 
ATOM   2206 C  CB    . ASN C 2 125 ? 5.608   9.181   -18.543 1.00 38.85 ? 125 ASN A CB    1 
ATOM   2207 C  CG    . ASN C 2 125 ? 5.415   7.679   -18.346 1.00 42.21 ? 125 ASN A CG    1 
ATOM   2208 O  OD1   . ASN C 2 125 ? 4.306   7.196   -18.123 1.00 45.63 ? 125 ASN A OD1   1 
ATOM   2209 N  ND2   . ASN C 2 125 ? 6.512   6.940   -18.405 1.00 37.38 ? 125 ASN A ND2   1 
ATOM   2210 N  N     . PHE C 2 126 ? 5.690   11.581  -20.447 1.00 38.78 ? 126 PHE A N     1 
ATOM   2211 C  CA    . PHE C 2 126 ? 6.104   12.946  -20.724 1.00 36.81 ? 126 PHE A CA    1 
ATOM   2212 C  C     . PHE C 2 126 ? 4.910   13.809  -21.121 1.00 37.34 ? 126 PHE A C     1 
ATOM   2213 O  O     . PHE C 2 126 ? 4.665   14.852  -20.524 1.00 39.00 ? 126 PHE A O     1 
ATOM   2214 C  CB    . PHE C 2 126 ? 7.142   12.964  -21.845 1.00 31.96 ? 126 PHE A CB    1 
ATOM   2215 C  CG    . PHE C 2 126 ? 7.519   14.344  -22.292 1.00 38.16 ? 126 PHE A CG    1 
ATOM   2216 C  CD1   . PHE C 2 126 ? 8.270   15.180  -21.464 1.00 38.06 ? 126 PHE A CD1   1 
ATOM   2217 C  CD2   . PHE C 2 126 ? 7.102   14.822  -23.526 1.00 34.83 ? 126 PHE A CD2   1 
ATOM   2218 C  CE1   . PHE C 2 126 ? 8.601   16.473  -21.861 1.00 41.21 ? 126 PHE A CE1   1 
ATOM   2219 C  CE2   . PHE C 2 126 ? 7.426   16.114  -23.934 1.00 44.30 ? 126 PHE A CE2   1 
ATOM   2220 C  CZ    . PHE C 2 126 ? 8.177   16.943  -23.100 1.00 34.22 ? 126 PHE A CZ    1 
ATOM   2221 N  N     . THR C 2 127 ? 4.167   13.359  -22.126 1.00 30.34 ? 127 THR A N     1 
ATOM   2222 C  CA    . THR C 2 127 ? 3.018   14.105  -22.611 1.00 37.55 ? 127 THR A CA    1 
ATOM   2223 C  C     . THR C 2 127 ? 1.989   14.356  -21.512 1.00 31.26 ? 127 THR A C     1 
ATOM   2224 O  O     . THR C 2 127 ? 1.428   15.441  -21.417 1.00 29.92 ? 127 THR A O     1 
ATOM   2225 C  CB    . THR C 2 127 ? 2.366   13.378  -23.810 1.00 37.80 ? 127 THR A CB    1 
ATOM   2226 O  OG1   . THR C 2 127 ? 3.360   13.147  -24.823 1.00 37.39 ? 127 THR A OG1   1 
ATOM   2227 C  CG2   . THR C 2 127 ? 1.248   14.223  -24.401 1.00 29.12 ? 127 THR A CG2   1 
ATOM   2228 N  N     . ARG C 2 128 ? 1.759   13.353  -20.675 1.00 30.83 ? 128 ARG A N     1 
ATOM   2229 C  CA    . ARG C 2 128 ? 0.819   13.475  -19.573 1.00 28.09 ? 128 ARG A CA    1 
ATOM   2230 C  C     . ARG C 2 128 ? 1.246   14.606  -18.637 1.00 33.18 ? 128 ARG A C     1 
ATOM   2231 O  O     . ARG C 2 128 ? 0.427   15.441  -18.237 1.00 28.53 ? 128 ARG A O     1 
ATOM   2232 C  CB    . ARG C 2 128 ? 0.768   12.164  -18.779 1.00 35.46 ? 128 ARG A CB    1 
ATOM   2233 C  CG    . ARG C 2 128 ? -0.223  12.157  -17.614 1.00 29.84 ? 128 ARG A CG    1 
ATOM   2234 C  CD    . ARG C 2 128 ? 0.034   10.948  -16.710 1.00 30.32 ? 128 ARG A CD    1 
ATOM   2235 N  NE    . ARG C 2 128 ? 1.397   10.996  -16.187 1.00 39.10 ? 128 ARG A NE    1 
ATOM   2236 C  CZ    . ARG C 2 128 ? 2.051   9.961   -15.666 1.00 42.34 ? 128 ARG A CZ    1 
ATOM   2237 N  NH1   . ARG C 2 128 ? 1.476   8.767   -15.583 1.00 38.41 ? 128 ARG A NH1   1 
ATOM   2238 N  NH2   . ARG C 2 128 ? 3.300   10.119  -15.253 1.00 45.27 ? 128 ARG A NH2   1 
ATOM   2239 N  N     . GLU C 2 129 ? 2.530   14.630  -18.287 1.00 33.47 ? 129 GLU A N     1 
ATOM   2240 C  CA    . GLU C 2 129 ? 3.045   15.653  -17.376 1.00 36.03 ? 129 GLU A CA    1 
ATOM   2241 C  C     . GLU C 2 129 ? 3.007   17.047  -17.992 1.00 37.65 ? 129 GLU A C     1 
ATOM   2242 O  O     . GLU C 2 129 ? 2.734   18.033  -17.305 1.00 38.49 ? 129 GLU A O     1 
ATOM   2243 C  CB    . GLU C 2 129 ? 4.463   15.294  -16.926 1.00 35.61 ? 129 GLU A CB    1 
ATOM   2244 C  CG    . GLU C 2 129 ? 4.505   14.027  -16.087 1.00 40.23 ? 129 GLU A CG    1 
ATOM   2245 C  CD    . GLU C 2 129 ? 3.614   14.131  -14.863 1.00 46.97 ? 129 GLU A CD    1 
ATOM   2246 O  OE1   . GLU C 2 129 ? 3.861   15.039  -14.042 1.00 43.86 ? 129 GLU A OE1   1 
ATOM   2247 O  OE2   . GLU C 2 129 ? 2.671   13.316  -14.723 1.00 40.61 ? 129 GLU A OE2   1 
ATOM   2248 N  N     . LEU C 2 130 ? 3.284   17.126  -19.288 1.00 34.23 ? 130 LEU A N     1 
ATOM   2249 C  CA    . LEU C 2 130 ? 3.231   18.398  -19.993 1.00 34.78 ? 130 LEU A CA    1 
ATOM   2250 C  C     . LEU C 2 130 ? 1.771   18.866  -19.917 1.00 37.75 ? 130 LEU A C     1 
ATOM   2251 O  O     . LEU C 2 130 ? 1.480   20.027  -19.623 1.00 30.99 ? 130 LEU A O     1 
ATOM   2252 C  CB    . LEU C 2 130 ? 3.618   18.211  -21.463 1.00 33.85 ? 130 LEU A CB    1 
ATOM   2253 C  CG    . LEU C 2 130 ? 4.795   18.998  -22.033 1.00 51.50 ? 130 LEU A CG    1 
ATOM   2254 C  CD1   . LEU C 2 130 ? 4.771   18.865  -23.549 1.00 49.23 ? 130 LEU A CD1   1 
ATOM   2255 C  CD2   . LEU C 2 130 ? 4.714   20.459  -21.623 1.00 51.23 ? 130 LEU A CD2   1 
ATOM   2256 N  N     . PHE C 2 131 ? 0.857   17.943  -20.192 1.00 27.32 ? 131 PHE A N     1 
ATOM   2257 C  CA    . PHE C 2 131 ? -0.567  18.248  -20.153 1.00 28.09 ? 131 PHE A CA    1 
ATOM   2258 C  C     . PHE C 2 131 ? -0.944  18.785  -18.776 1.00 31.00 ? 131 PHE A C     1 
ATOM   2259 O  O     . PHE C 2 131 ? -1.552  19.853  -18.649 1.00 32.92 ? 131 PHE A O     1 
ATOM   2260 C  CB    . PHE C 2 131 ? -1.368  16.987  -20.451 1.00 26.58 ? 131 PHE A CB    1 
ATOM   2261 C  CG    . PHE C 2 131 ? -2.846  17.209  -20.553 1.00 26.70 ? 131 PHE A CG    1 
ATOM   2262 C  CD1   . PHE C 2 131 ? -3.419  17.676  -21.747 1.00 26.41 ? 131 PHE A CD1   1 
ATOM   2263 C  CD2   . PHE C 2 131 ? -3.677  16.926  -19.471 1.00 20.49 ? 131 PHE A CD2   1 
ATOM   2264 C  CE1   . PHE C 2 131 ? -4.799  17.854  -21.853 1.00 25.32 ? 131 PHE A CE1   1 
ATOM   2265 C  CE2   . PHE C 2 131 ? -5.063  17.100  -19.570 1.00 31.17 ? 131 PHE A CE2   1 
ATOM   2266 C  CZ    . PHE C 2 131 ? -5.621  17.567  -20.771 1.00 23.96 ? 131 PHE A CZ    1 
ATOM   2267 N  N     . TYR C 2 132 ? -0.580  18.037  -17.741 1.00 26.91 ? 132 TYR A N     1 
ATOM   2268 C  CA    . TYR C 2 132 ? -0.892  18.444  -16.382 1.00 29.11 ? 132 TYR A CA    1 
ATOM   2269 C  C     . TYR C 2 132 ? -0.255  19.772  -16.017 1.00 38.17 ? 132 TYR A C     1 
ATOM   2270 O  O     . TYR C 2 132 ? -0.871  20.594  -15.335 1.00 40.02 ? 132 TYR A O     1 
ATOM   2271 C  CB    . TYR C 2 132 ? -0.428  17.395  -15.374 1.00 26.16 ? 132 TYR A CB    1 
ATOM   2272 C  CG    . TYR C 2 132 ? -1.196  16.091  -15.428 1.00 44.49 ? 132 TYR A CG    1 
ATOM   2273 C  CD1   . TYR C 2 132 ? -2.389  15.981  -16.150 1.00 37.53 ? 132 TYR A CD1   1 
ATOM   2274 C  CD2   . TYR C 2 132 ? -0.738  14.968  -14.743 1.00 39.10 ? 132 TYR A CD2   1 
ATOM   2275 C  CE1   . TYR C 2 132 ? -3.099  14.788  -16.190 1.00 37.79 ? 132 TYR A CE1   1 
ATOM   2276 C  CE2   . TYR C 2 132 ? -1.445  13.773  -14.774 1.00 46.18 ? 132 TYR A CE2   1 
ATOM   2277 C  CZ    . TYR C 2 132 ? -2.622  13.686  -15.499 1.00 40.41 ? 132 TYR A CZ    1 
ATOM   2278 O  OH    . TYR C 2 132 ? -3.314  12.495  -15.537 1.00 37.45 ? 132 TYR A OH    1 
ATOM   2279 N  N     . LYS C 2 133 ? 0.987   19.972  -16.446 1.00 38.83 ? 133 LYS A N     1 
ATOM   2280 C  CA    . LYS C 2 133 ? 1.690   21.206  -16.127 1.00 38.83 ? 133 LYS A CA    1 
ATOM   2281 C  C     . LYS C 2 133 ? 0.824   22.395  -16.541 1.00 40.66 ? 133 LYS A C     1 
ATOM   2282 O  O     . LYS C 2 133 ? 0.757   23.402  -15.840 1.00 43.60 ? 133 LYS A O     1 
ATOM   2283 C  CB    . LYS C 2 133 ? 3.046   21.243  -16.839 1.00 44.04 ? 133 LYS A CB    1 
ATOM   2284 C  CG    . LYS C 2 133 ? 3.911   22.412  -16.414 1.00 54.64 ? 133 LYS A CG    1 
ATOM   2285 C  CD    . LYS C 2 133 ? 5.297   22.392  -17.057 1.00 63.24 ? 133 LYS A CD    1 
ATOM   2286 C  CE    . LYS C 2 133 ? 6.106   23.620  -16.626 1.00 64.79 ? 133 LYS A CE    1 
ATOM   2287 N  NZ    . LYS C 2 133 ? 7.465   23.676  -17.242 1.00 68.85 ? 133 LYS A NZ    1 
ATOM   2288 N  N     . LEU C 2 134 ? 0.128   22.248  -17.663 1.00 36.20 ? 134 LEU A N     1 
ATOM   2289 C  CA    . LEU C 2 134 ? -0.737  23.296  -18.183 1.00 38.30 ? 134 LEU A CA    1 
ATOM   2290 C  C     . LEU C 2 134 ? -2.164  23.292  -17.638 1.00 44.22 ? 134 LEU A C     1 
ATOM   2291 O  O     . LEU C 2 134 ? -2.722  24.355  -17.346 1.00 35.06 ? 134 LEU A O     1 
ATOM   2292 C  CB    . LEU C 2 134 ? -0.832  23.196  -19.712 1.00 35.64 ? 134 LEU A CB    1 
ATOM   2293 C  CG    . LEU C 2 134 ? 0.377   23.510  -20.596 1.00 42.04 ? 134 LEU A CG    1 
ATOM   2294 C  CD1   . LEU C 2 134 ? 0.026   23.197  -22.039 1.00 40.21 ? 134 LEU A CD1   1 
ATOM   2295 C  CD2   . LEU C 2 134 ? 0.761   24.975  -20.467 1.00 39.27 ? 134 LEU A CD2   1 
ATOM   2296 N  N     . PHE C 2 135 ? -2.749  22.106  -17.482 1.00 39.74 ? 135 PHE A N     1 
ATOM   2297 C  CA    . PHE C 2 135 ? -4.148  22.029  -17.074 1.00 36.53 ? 135 PHE A CA    1 
ATOM   2298 C  C     . PHE C 2 135 ? -4.557  21.276  -15.805 1.00 35.24 ? 135 PHE A C     1 
ATOM   2299 O  O     . PHE C 2 135 ? -5.751  21.215  -15.492 1.00 33.59 ? 135 PHE A O     1 
ATOM   2300 C  CB    . PHE C 2 135 ? -4.956  21.474  -18.250 1.00 26.70 ? 135 PHE A CB    1 
ATOM   2301 C  CG    . PHE C 2 135 ? -4.560  22.046  -19.584 1.00 32.51 ? 135 PHE A CG    1 
ATOM   2302 C  CD1   . PHE C 2 135 ? -4.714  23.404  -19.851 1.00 34.89 ? 135 PHE A CD1   1 
ATOM   2303 C  CD2   . PHE C 2 135 ? -4.056  21.226  -20.584 1.00 29.83 ? 135 PHE A CD2   1 
ATOM   2304 C  CE1   . PHE C 2 135 ? -4.377  23.931  -21.088 1.00 32.39 ? 135 PHE A CE1   1 
ATOM   2305 C  CE2   . PHE C 2 135 ? -3.714  21.745  -21.827 1.00 31.54 ? 135 PHE A CE2   1 
ATOM   2306 C  CZ    . PHE C 2 135 ? -3.877  23.102  -22.081 1.00 34.40 ? 135 PHE A CZ    1 
ATOM   2307 N  N     . LYS C 2 136 ? -3.615  20.697  -15.071 1.00 32.98 ? 136 LYS A N     1 
ATOM   2308 C  CA    . LYS C 2 136 ? -4.013  19.981  -13.863 1.00 32.28 ? 136 LYS A CA    1 
ATOM   2309 C  C     . LYS C 2 136 ? -4.842  20.852  -12.910 1.00 35.31 ? 136 LYS A C     1 
ATOM   2310 O  O     . LYS C 2 136 ? -5.849  20.406  -12.353 1.00 36.41 ? 136 LYS A O     1 
ATOM   2311 C  CB    . LYS C 2 136 ? -2.802  19.433  -13.118 1.00 37.40 ? 136 LYS A CB    1 
ATOM   2312 C  CG    . LYS C 2 136 ? -3.210  18.602  -11.898 1.00 36.38 ? 136 LYS A CG    1 
ATOM   2313 C  CD    . LYS C 2 136 ? -2.036  17.890  -11.247 1.00 49.61 ? 136 LYS A CD    1 
ATOM   2314 C  CE    . LYS C 2 136 ? -2.472  17.252  -9.929  1.00 49.86 ? 136 LYS A CE    1 
ATOM   2315 N  NZ    . LYS C 2 136 ? -1.372  16.543  -9.222  1.00 56.29 ? 136 LYS A NZ    1 
ATOM   2316 N  N     . GLU C 2 137 ? -4.419  22.097  -12.734 1.00 42.39 ? 137 GLU A N     1 
ATOM   2317 C  CA    . GLU C 2 137 ? -5.112  23.029  -11.857 1.00 43.01 ? 137 GLU A CA    1 
ATOM   2318 C  C     . GLU C 2 137 ? -6.567  23.228  -12.273 1.00 45.60 ? 137 GLU A C     1 
ATOM   2319 O  O     . GLU C 2 137 ? -7.476  23.085  -11.449 1.00 35.63 ? 137 GLU A O     1 
ATOM   2320 C  CB    . GLU C 2 137 ? -4.385  24.375  -11.857 1.00 54.87 ? 137 GLU A CB    1 
ATOM   2321 C  CG    . GLU C 2 137 ? -5.123  25.482  -11.130 1.00 71.63 ? 137 GLU A CG    1 
ATOM   2322 C  CD    . GLU C 2 137 ? -4.379  26.802  -11.179 1.00 80.19 ? 137 GLU A CD    1 
ATOM   2323 O  OE1   . GLU C 2 137 ? -3.243  26.867  -10.660 1.00 83.25 ? 137 GLU A OE1   1 
ATOM   2324 O  OE2   . GLU C 2 137 ? -4.932  27.773  -11.737 1.00 87.42 ? 137 GLU A OE2   1 
ATOM   2325 N  N     . ASP C 2 138 ? -6.785  23.556  -13.548 1.00 42.86 ? 138 ASP A N     1 
ATOM   2326 C  CA    . ASP C 2 138 ? -8.137  23.777  -14.064 1.00 45.09 ? 138 ASP A CA    1 
ATOM   2327 C  C     . ASP C 2 138 ? -9.016  22.544  -13.913 1.00 42.98 ? 138 ASP A C     1 
ATOM   2328 O  O     . ASP C 2 138 ? -10.201 22.647  -13.586 1.00 40.69 ? 138 ASP A O     1 
ATOM   2329 C  CB    . ASP C 2 138 ? -8.102  24.165  -15.548 1.00 51.83 ? 138 ASP A CB    1 
ATOM   2330 C  CG    . ASP C 2 138 ? -7.394  25.481  -15.795 1.00 63.95 ? 138 ASP A CG    1 
ATOM   2331 O  OD1   . ASP C 2 138 ? -7.742  26.475  -15.125 1.00 70.88 ? 138 ASP A OD1   1 
ATOM   2332 O  OD2   . ASP C 2 138 ? -6.498  25.523  -16.667 1.00 61.86 ? 138 ASP A OD2   1 
ATOM   2333 N  N     . ILE C 2 139 ? -8.439  21.376  -14.170 1.00 39.02 ? 139 ILE A N     1 
ATOM   2334 C  CA    . ILE C 2 139 ? -9.195  20.137  -14.070 1.00 36.94 ? 139 ILE A CA    1 
ATOM   2335 C  C     . ILE C 2 139 ? -9.609  19.845  -12.629 1.00 34.18 ? 139 ILE A C     1 
ATOM   2336 O  O     . ILE C 2 139 ? -10.776 19.554  -12.355 1.00 35.32 ? 139 ILE A O     1 
ATOM   2337 C  CB    . ILE C 2 139 ? -8.375  18.965  -14.644 1.00 36.82 ? 139 ILE A CB    1 
ATOM   2338 C  CG1   . ILE C 2 139 ? -8.087  19.234  -16.126 1.00 38.45 ? 139 ILE A CG1   1 
ATOM   2339 C  CG2   . ILE C 2 139 ? -9.132  17.655  -14.466 1.00 28.29 ? 139 ILE A CG2   1 
ATOM   2340 C  CD1   . ILE C 2 139 ? -7.121  18.271  -16.763 1.00 43.04 ? 139 ILE A CD1   1 
ATOM   2341 N  N     . LEU C 2 140 ? -8.655  19.937  -11.710 1.00 31.83 ? 140 LEU A N     1 
ATOM   2342 C  CA    . LEU C 2 140 ? -8.937  19.681  -10.298 1.00 39.03 ? 140 LEU A CA    1 
ATOM   2343 C  C     . LEU C 2 140 ? -10.024 20.621  -9.807  1.00 44.33 ? 140 LEU A C     1 
ATOM   2344 O  O     . LEU C 2 140 ? -10.897 20.240  -9.021  1.00 39.60 ? 140 LEU A O     1 
ATOM   2345 C  CB    . LEU C 2 140 ? -7.672  19.876  -9.452  1.00 37.39 ? 140 LEU A CB    1 
ATOM   2346 C  CG    . LEU C 2 140 ? -6.968  18.603  -8.963  1.00 43.25 ? 140 LEU A CG    1 
ATOM   2347 C  CD1   . LEU C 2 140 ? -6.850  17.594  -10.096 1.00 44.00 ? 140 LEU A CD1   1 
ATOM   2348 C  CD2   . LEU C 2 140 ? -5.601  18.963  -8.416  1.00 38.36 ? 140 LEU A CD2   1 
ATOM   2349 N  N     . SER C 2 141 ? -9.966  21.855  -10.288 1.00 36.66 ? 141 SER A N     1 
ATOM   2350 C  CA    . SER C 2 141 ? -10.930 22.854  -9.900  1.00 36.95 ? 141 SER A CA    1 
ATOM   2351 C  C     . SER C 2 141 ? -12.327 22.446  -10.363 1.00 39.23 ? 141 SER A C     1 
ATOM   2352 O  O     . SER C 2 141 ? -13.283 22.459  -9.577  1.00 36.94 ? 141 SER A O     1 
ATOM   2353 C  CB    . SER C 2 141 ? -10.536 24.203  -10.505 1.00 38.91 ? 141 SER A CB    1 
ATOM   2354 O  OG    . SER C 2 141 ? -11.202 25.242  -9.834  1.00 43.08 ? 141 SER A OG    1 
ATOM   2355 N  N     . ALA C 2 142 ? -12.438 22.075  -11.637 1.00 36.32 ? 142 ALA A N     1 
ATOM   2356 C  CA    . ALA C 2 142 ? -13.723 21.661  -12.202 1.00 33.40 ? 142 ALA A CA    1 
ATOM   2357 C  C     . ALA C 2 142 ? -14.211 20.402  -11.493 1.00 36.16 ? 142 ALA A C     1 
ATOM   2358 O  O     . ALA C 2 142 ? -15.407 20.235  -11.279 1.00 38.63 ? 142 ALA A O     1 
ATOM   2359 C  CB    . ALA C 2 142 ? -13.591 21.408  -13.703 1.00 30.29 ? 142 ALA A CB    1 
ATOM   2360 N  N     . ILE C 2 143 ? -13.282 19.526  -11.119 1.00 37.60 ? 143 ILE A N     1 
ATOM   2361 C  CA    . ILE C 2 143 ? -13.637 18.291  -10.422 1.00 42.29 ? 143 ILE A CA    1 
ATOM   2362 C  C     . ILE C 2 143 ? -14.167 18.612  -9.027  1.00 45.92 ? 143 ILE A C     1 
ATOM   2363 O  O     . ILE C 2 143 ? -15.104 17.970  -8.543  1.00 39.45 ? 143 ILE A O     1 
ATOM   2364 C  CB    . ILE C 2 143 ? -12.421 17.343  -10.305 1.00 40.51 ? 143 ILE A CB    1 
ATOM   2365 C  CG1   . ILE C 2 143 ? -12.157 16.668  -11.655 1.00 38.23 ? 143 ILE A CG1   1 
ATOM   2366 C  CG2   . ILE C 2 143 ? -12.662 16.292  -9.230  1.00 33.51 ? 143 ILE A CG2   1 
ATOM   2367 C  CD1   . ILE C 2 143 ? -10.894 15.813  -11.657 1.00 43.60 ? 143 ILE A CD1   1 
ATOM   2368 N  N     . LYS C 2 144 ? -13.569 19.618  -8.394  1.00 50.10 ? 144 LYS A N     1 
ATOM   2369 C  CA    . LYS C 2 144 ? -13.988 20.033  -7.065  1.00 53.42 ? 144 LYS A CA    1 
ATOM   2370 C  C     . LYS C 2 144 ? -15.423 20.568  -7.105  1.00 50.20 ? 144 LYS A C     1 
ATOM   2371 O  O     . LYS C 2 144 ? -16.200 20.319  -6.188  1.00 47.09 ? 144 LYS A O     1 
ATOM   2372 C  CB    . LYS C 2 144 ? -13.038 21.105  -6.515  1.00 59.80 ? 144 LYS A CB    1 
ATOM   2373 C  CG    . LYS C 2 144 ? -13.259 21.421  -5.042  1.00 66.97 ? 144 LYS A CG    1 
ATOM   2374 C  CD    . LYS C 2 144 ? -12.169 22.317  -4.482  1.00 74.68 ? 144 LYS A CD    1 
ATOM   2375 C  CE    . LYS C 2 144 ? -12.387 22.559  -2.995  1.00 84.27 ? 144 LYS A CE    1 
ATOM   2376 N  NZ    . LYS C 2 144 ? -11.337 23.427  -2.384  1.00 92.01 ? 144 LYS A NZ    1 
ATOM   2377 N  N     . GLU C 2 145 ? -15.762 21.301  -8.165  1.00 49.71 ? 145 GLU A N     1 
ATOM   2378 C  CA    . GLU C 2 145 ? -17.107 21.855  -8.336  1.00 56.69 ? 145 GLU A CA    1 
ATOM   2379 C  C     . GLU C 2 145 ? -17.997 20.791  -8.965  1.00 57.07 ? 145 GLU A C     1 
ATOM   2380 O  O     . GLU C 2 145 ? -19.203 20.982  -9.107  1.00 58.96 ? 145 GLU A O     1 
ATOM   2381 C  CB    . GLU C 2 145 ? -17.107 23.047  -9.293  1.00 58.04 ? 145 GLU A CB    1 
ATOM   2382 C  CG    . GLU C 2 145 ? -16.073 24.117  -9.053  1.00 75.55 ? 145 GLU A CG    1 
ATOM   2383 C  CD    . GLU C 2 145 ? -16.083 25.162  -10.164 1.00 82.20 ? 145 GLU A CD    1 
ATOM   2384 O  OE1   . GLU C 2 145 ? -17.139 25.801  -10.369 1.00 82.77 ? 145 GLU A OE1   1 
ATOM   2385 O  OE2   . GLU C 2 145 ? -15.040 25.339  -10.835 1.00 87.58 ? 145 GLU A OE2   1 
ATOM   2386 N  N     . GLY C 2 146 ? -17.379 19.687  -9.374  1.00 59.96 ? 146 GLY A N     1 
ATOM   2387 C  CA    . GLY C 2 146 ? -18.106 18.604  -10.011 1.00 57.21 ? 146 GLY A CA    1 
ATOM   2388 C  C     . GLY C 2 146 ? -19.517 18.396  -9.503  1.00 55.23 ? 146 GLY A C     1 
ATOM   2389 O  O     . GLY C 2 146 ? -19.748 18.252  -8.306  1.00 55.98 ? 146 GLY A O     1 
ATOM   2390 N  N     . ARG C 2 147 ? -20.468 18.374  -10.425 1.00 55.43 ? 147 ARG A N     1 
ATOM   2391 C  CA    . ARG C 2 147 ? -21.864 18.183  -10.068 1.00 58.76 ? 147 ARG A CA    1 
ATOM   2392 C  C     . ARG C 2 147 ? -22.635 17.627  -11.262 1.00 56.96 ? 147 ARG A C     1 
ATOM   2393 O  O     . ARG C 2 147 ? -22.500 18.119  -12.385 1.00 53.41 ? 147 ARG A O     1 
ATOM   2394 C  CB    . ARG C 2 147 ? -22.472 19.519  -9.624  1.00 67.16 ? 147 ARG A CB    1 
ATOM   2395 C  CG    . ARG C 2 147 ? -23.769 19.386  -8.843  1.00 73.01 ? 147 ARG A CG    1 
ATOM   2396 C  CD    . ARG C 2 147 ? -24.997 19.384  -9.735  1.00 75.44 ? 147 ARG A CD    1 
ATOM   2397 N  NE    . ARG C 2 147 ? -25.384 20.734  -10.134 1.00 75.10 ? 147 ARG A NE    1 
ATOM   2398 C  CZ    . ARG C 2 147 ? -26.572 21.043  -10.644 1.00 72.59 ? 147 ARG A CZ    1 
ATOM   2399 N  NH1   . ARG C 2 147 ? -27.484 20.098  -10.817 1.00 70.54 ? 147 ARG A NH1   1 
ATOM   2400 N  NH2   . ARG C 2 147 ? -26.853 22.297  -10.969 1.00 71.65 ? 147 ARG A NH2   1 
ATOM   2401 N  N     . VAL C 2 148 ? -23.425 16.586  -11.024 1.00 52.55 ? 148 VAL A N     1 
ATOM   2402 C  CA    . VAL C 2 148 ? -24.218 16.008  -12.096 1.00 49.94 ? 148 VAL A CA    1 
ATOM   2403 C  C     . VAL C 2 148 ? -25.456 16.883  -12.324 1.00 45.80 ? 148 VAL A C     1 
ATOM   2404 O  O     . VAL C 2 148 ? -26.209 17.165  -11.393 1.00 41.90 ? 148 VAL A O     1 
ATOM   2405 C  CB    . VAL C 2 148 ? -24.683 14.573  -11.755 1.00 51.47 ? 148 VAL A CB    1 
ATOM   2406 C  CG1   . VAL C 2 148 ? -25.445 13.979  -12.941 1.00 46.45 ? 148 VAL A CG1   1 
ATOM   2407 C  CG2   . VAL C 2 148 ? -23.490 13.704  -11.403 1.00 51.64 ? 148 VAL A CG2   1 
ATOM   2408 N  N     . LYS C 2 149 ? -25.648 17.328  -13.558 1.00 44.47 ? 149 LYS A N     1 
ATOM   2409 C  CA    . LYS C 2 149 ? -26.809 18.142  -13.896 1.00 50.57 ? 149 LYS A CA    1 
ATOM   2410 C  C     . LYS C 2 149 ? -27.761 17.269  -14.714 1.00 48.86 ? 149 LYS A C     1 
ATOM   2411 O  O     . LYS C 2 149 ? -27.446 16.896  -15.844 1.00 48.48 ? 149 LYS A O     1 
ATOM   2412 C  CB    . LYS C 2 149 ? -26.392 19.349  -14.738 1.00 56.61 ? 149 LYS A CB    1 
ATOM   2413 C  CG    . LYS C 2 149 ? -25.350 20.251  -14.111 1.00 67.64 ? 149 LYS A CG    1 
ATOM   2414 C  CD    . LYS C 2 149 ? -25.105 21.459  -15.007 1.00 74.78 ? 149 LYS A CD    1 
ATOM   2415 C  CE    . LYS C 2 149 ? -24.094 22.417  -14.401 1.00 82.84 ? 149 LYS A CE    1 
ATOM   2416 N  NZ    . LYS C 2 149 ? -23.916 23.623  -15.259 1.00 84.80 ? 149 LYS A NZ    1 
ATOM   2417 N  N     . LYS C 2 150 ? -28.914 16.920  -14.158 1.00 46.32 ? 150 LYS A N     1 
ATOM   2418 C  CA    . LYS C 2 150 ? -29.835 16.092  -14.924 1.00 43.41 ? 150 LYS A CA    1 
ATOM   2419 C  C     . LYS C 2 150 ? -30.686 16.947  -15.843 1.00 40.54 ? 150 LYS A C     1 
ATOM   2420 O  O     . LYS C 2 150 ? -31.010 18.086  -15.510 1.00 42.51 ? 150 LYS A O     1 
ATOM   2421 C  CB    . LYS C 2 150 ? -30.731 15.265  -14.001 1.00 39.57 ? 150 LYS A CB    1 
ATOM   2422 C  CG    . LYS C 2 150 ? -30.065 13.989  -13.507 1.00 47.56 ? 150 LYS A CG    1 
ATOM   2423 C  CD    . LYS C 2 150 ? -30.989 13.129  -12.648 1.00 40.32 ? 150 LYS A CD    1 
ATOM   2424 C  CE    . LYS C 2 150 ? -30.263 11.869  -12.217 1.00 42.66 ? 150 LYS A CE    1 
ATOM   2425 N  NZ    . LYS C 2 150 ? -31.053 11.056  -11.274 1.00 43.56 ? 150 LYS A NZ    1 
ATOM   2426 N  N     . ASP C 2 151 ? -31.027 16.406  -17.009 1.00 33.95 ? 151 ASP A N     1 
ATOM   2427 C  CA    . ASP C 2 151 ? -31.867 17.132  -17.952 1.00 32.73 ? 151 ASP A CA    1 
ATOM   2428 C  C     . ASP C 2 151 ? -33.334 16.885  -17.566 1.00 34.37 ? 151 ASP A C     1 
ATOM   2429 O  O     . ASP C 2 151 ? -33.652 15.926  -16.851 1.00 36.08 ? 151 ASP A O     1 
ATOM   2430 C  CB    . ASP C 2 151 ? -31.610 16.658  -19.380 1.00 38.22 ? 151 ASP A CB    1 
ATOM   2431 C  CG    . ASP C 2 151 ? -31.974 15.208  -19.580 1.00 38.08 ? 151 ASP A CG    1 
ATOM   2432 O  OD1   . ASP C 2 151 ? -31.228 14.335  -19.092 1.00 38.29 ? 151 ASP A OD1   1 
ATOM   2433 O  OD2   . ASP C 2 151 ? -33.016 14.947  -20.217 1.00 43.70 ? 151 ASP A OD2   1 
ATOM   2434 N  N     . TYR C 2 152 ? -34.219 17.752  -18.045 1.00 32.19 ? 152 TYR A N     1 
ATOM   2435 C  CA    . TYR C 2 152 ? -35.632 17.657  -17.725 1.00 32.06 ? 152 TYR A CA    1 
ATOM   2436 C  C     . TYR C 2 152 ? -36.319 16.346  -18.107 1.00 34.91 ? 152 TYR A C     1 
ATOM   2437 O  O     . TYR C 2 152 ? -37.079 15.807  -17.305 1.00 38.54 ? 152 TYR A O     1 
ATOM   2438 C  CB    . TYR C 2 152 ? -36.379 18.843  -18.336 1.00 37.08 ? 152 TYR A CB    1 
ATOM   2439 C  CG    . TYR C 2 152 ? -35.958 20.188  -17.777 1.00 36.77 ? 152 TYR A CG    1 
ATOM   2440 C  CD1   . TYR C 2 152 ? -36.011 20.447  -16.406 1.00 37.53 ? 152 TYR A CD1   1 
ATOM   2441 C  CD2   . TYR C 2 152 ? -35.520 21.205  -18.623 1.00 34.21 ? 152 TYR A CD2   1 
ATOM   2442 C  CE1   . TYR C 2 152 ? -35.635 21.693  -15.889 1.00 41.78 ? 152 TYR A CE1   1 
ATOM   2443 C  CE2   . TYR C 2 152 ? -35.140 22.456  -18.123 1.00 40.10 ? 152 TYR A CE2   1 
ATOM   2444 C  CZ    . TYR C 2 152 ? -35.200 22.691  -16.757 1.00 47.02 ? 152 TYR A CZ    1 
ATOM   2445 O  OH    . TYR C 2 152 ? -34.817 23.920  -16.271 1.00 54.49 ? 152 TYR A OH    1 
ATOM   2446 N  N     . LYS C 2 153 ? -36.061 15.822  -19.306 1.00 33.18 ? 153 LYS A N     1 
ATOM   2447 C  CA    . LYS C 2 153 ? -36.705 14.565  -19.713 1.00 32.88 ? 153 LYS A CA    1 
ATOM   2448 C  C     . LYS C 2 153 ? -36.328 13.435  -18.752 1.00 35.07 ? 153 LYS A C     1 
ATOM   2449 O  O     . LYS C 2 153 ? -37.170 12.619  -18.376 1.00 34.68 ? 153 LYS A O     1 
ATOM   2450 C  CB    . LYS C 2 153 ? -36.322 14.183  -21.146 1.00 25.69 ? 153 LYS A CB    1 
ATOM   2451 C  CG    . LYS C 2 153 ? -36.917 15.100  -22.209 1.00 32.90 ? 153 LYS A CG    1 
ATOM   2452 C  CD    . LYS C 2 153 ? -36.508 14.692  -23.628 1.00 36.18 ? 153 LYS A CD    1 
ATOM   2453 C  CE    . LYS C 2 153 ? -37.134 13.370  -24.044 1.00 28.29 ? 153 LYS A CE    1 
ATOM   2454 N  NZ    . LYS C 2 153 ? -36.651 12.951  -25.380 1.00 28.54 ? 153 LYS A NZ    1 
ATOM   2455 N  N     . THR C 2 154 ? -35.063 13.393  -18.354 1.00 32.16 ? 154 THR A N     1 
ATOM   2456 C  CA    . THR C 2 154 ? -34.609 12.380  -17.412 1.00 32.60 ? 154 THR A CA    1 
ATOM   2457 C  C     . THR C 2 154 ? -35.351 12.561  -16.080 1.00 34.07 ? 154 THR A C     1 
ATOM   2458 O  O     . THR C 2 154 ? -35.926 11.614  -15.542 1.00 33.92 ? 154 THR A O     1 
ATOM   2459 C  CB    . THR C 2 154 ? -33.077 12.493  -17.158 1.00 32.00 ? 154 THR A CB    1 
ATOM   2460 O  OG1   . THR C 2 154 ? -32.362 12.152  -18.353 1.00 35.91 ? 154 THR A OG1   1 
ATOM   2461 C  CG2   . THR C 2 154 ? -32.645 11.559  -16.019 1.00 32.92 ? 154 THR A CG2   1 
ATOM   2462 N  N     . ILE C 2 155 ? -35.334 13.786  -15.556 1.00 32.85 ? 155 ILE A N     1 
ATOM   2463 C  CA    . ILE C 2 155 ? -36.001 14.082  -14.299 1.00 36.85 ? 155 ILE A CA    1 
ATOM   2464 C  C     . ILE C 2 155 ? -37.490 13.757  -14.363 1.00 39.52 ? 155 ILE A C     1 
ATOM   2465 O  O     . ILE C 2 155 ? -38.050 13.219  -13.410 1.00 44.18 ? 155 ILE A O     1 
ATOM   2466 C  CB    . ILE C 2 155 ? -35.858 15.571  -13.914 1.00 39.57 ? 155 ILE A CB    1 
ATOM   2467 C  CG1   . ILE C 2 155 ? -34.385 15.910  -13.676 1.00 35.98 ? 155 ILE A CG1   1 
ATOM   2468 C  CG2   . ILE C 2 155 ? -36.689 15.866  -12.648 1.00 23.57 ? 155 ILE A CG2   1 
ATOM   2469 C  CD1   . ILE C 2 155 ? -34.122 17.398  -13.546 1.00 31.59 ? 155 ILE A CD1   1 
ATOM   2470 N  N     . LEU C 2 156 ? -38.134 14.080  -15.479 1.00 34.65 ? 156 LEU A N     1 
ATOM   2471 C  CA    . LEU C 2 156 ? -39.560 13.813  -15.586 1.00 36.03 ? 156 LEU A CA    1 
ATOM   2472 C  C     . LEU C 2 156 ? -39.892 12.335  -15.471 1.00 37.53 ? 156 LEU A C     1 
ATOM   2473 O  O     . LEU C 2 156 ? -40.748 11.967  -14.666 1.00 33.05 ? 156 LEU A O     1 
ATOM   2474 C  CB    . LEU C 2 156 ? -40.143 14.364  -16.896 1.00 38.01 ? 156 LEU A CB    1 
ATOM   2475 C  CG    . LEU C 2 156 ? -41.614 13.979  -17.154 1.00 40.59 ? 156 LEU A CG    1 
ATOM   2476 C  CD1   . LEU C 2 156 ? -42.505 14.513  -16.035 1.00 34.48 ? 156 LEU A CD1   1 
ATOM   2477 C  CD2   . LEU C 2 156 ? -42.070 14.520  -18.492 1.00 24.15 ? 156 LEU A CD2   1 
ATOM   2478 N  N     . GLN C 2 157 ? -39.216 11.480  -16.241 1.00 34.81 ? 157 GLN A N     1 
ATOM   2479 C  CA    . GLN C 2 157 ? -39.549 10.059  -16.179 1.00 36.74 ? 157 GLN A CA    1 
ATOM   2480 C  C     . GLN C 2 157 ? -39.176 9.415   -14.853 1.00 34.06 ? 157 GLN A C     1 
ATOM   2481 O  O     . GLN C 2 157 ? -39.768 8.418   -14.456 1.00 36.95 ? 157 GLN A O     1 
ATOM   2482 C  CB    . GLN C 2 157 ? -38.944 9.273   -17.356 1.00 36.07 ? 157 GLN A CB    1 
ATOM   2483 C  CG    . GLN C 2 157 ? -37.425 9.134   -17.415 1.00 36.33 ? 157 GLN A CG    1 
ATOM   2484 C  CD    . GLN C 2 157 ? -37.018 7.907   -18.226 1.00 37.22 ? 157 GLN A CD    1 
ATOM   2485 O  OE1   . GLN C 2 157 ? -37.734 7.505   -19.142 1.00 37.71 ? 157 GLN A OE1   1 
ATOM   2486 N  NE2   . GLN C 2 157 ? -35.869 7.315   -17.904 1.00 29.69 ? 157 GLN A NE2   1 
ATOM   2487 N  N     . GLU C 2 158 ? -38.206 9.988   -14.154 1.00 33.58 ? 158 GLU A N     1 
ATOM   2488 C  CA    . GLU C 2 158 ? -37.833 9.429   -12.866 1.00 39.44 ? 158 GLU A CA    1 
ATOM   2489 C  C     . GLU C 2 158 ? -38.924 9.807   -11.873 1.00 37.42 ? 158 GLU A C     1 
ATOM   2490 O  O     . GLU C 2 158 ? -39.238 9.055   -10.956 1.00 45.90 ? 158 GLU A O     1 
ATOM   2491 C  CB    . GLU C 2 158 ? -36.434 9.919   -12.456 1.00 30.16 ? 158 GLU A CB    1 
ATOM   2492 C  CG    . GLU C 2 158 ? -35.353 9.125   -13.208 1.00 35.92 ? 158 GLU A CG    1 
ATOM   2493 C  CD    . GLU C 2 158 ? -33.929 9.561   -12.931 1.00 41.09 ? 158 GLU A CD    1 
ATOM   2494 O  OE1   . GLU C 2 158 ? -33.644 10.063  -11.825 1.00 39.61 ? 158 GLU A OE1   1 
ATOM   2495 O  OE2   . GLU C 2 158 ? -33.083 9.373   -13.828 1.00 42.47 ? 158 GLU A OE2   1 
ATOM   2496 N  N     . ILE C 2 159 ? -39.535 10.962  -12.094 1.00 41.57 ? 159 ILE A N     1 
ATOM   2497 C  CA    . ILE C 2 159 ? -40.625 11.405  -11.247 1.00 36.52 ? 159 ILE A CA    1 
ATOM   2498 C  C     . ILE C 2 159 ? -41.864 10.546  -11.528 1.00 41.16 ? 159 ILE A C     1 
ATOM   2499 O  O     . ILE C 2 159 ? -42.468 9.999   -10.606 1.00 39.68 ? 159 ILE A O     1 
ATOM   2500 C  CB    . ILE C 2 159 ? -40.956 12.884  -11.506 1.00 37.34 ? 159 ILE A CB    1 
ATOM   2501 C  CG1   . ILE C 2 159 ? -39.881 13.772  -10.861 1.00 35.23 ? 159 ILE A CG1   1 
ATOM   2502 C  CG2   . ILE C 2 159 ? -42.350 13.211  -10.981 1.00 36.14 ? 159 ILE A CG2   1 
ATOM   2503 C  CD1   . ILE C 2 159 ? -40.117 15.266  -11.056 1.00 30.05 ? 159 ILE A CD1   1 
ATOM   2504 N  N     . THR C 2 160 ? -42.221 10.397  -12.803 1.00 39.51 ? 160 THR A N     1 
ATOM   2505 C  CA    . THR C 2 160 ? -43.399 9.617   -13.162 1.00 33.90 ? 160 THR A CA    1 
ATOM   2506 C  C     . THR C 2 160 ? -43.222 8.119   -12.902 1.00 40.15 ? 160 THR A C     1 
ATOM   2507 O  O     . THR C 2 160 ? -44.192 7.404   -12.626 1.00 33.90 ? 160 THR A O     1 
ATOM   2508 C  CB    . THR C 2 160 ? -43.792 9.865   -14.640 1.00 40.04 ? 160 THR A CB    1 
ATOM   2509 O  OG1   . THR C 2 160 ? -42.756 9.398   -15.515 1.00 33.46 ? 160 THR A OG1   1 
ATOM   2510 C  CG2   . THR C 2 160 ? -44.001 11.365  -14.880 1.00 33.69 ? 160 THR A CG2   1 
ATOM   2511 N  N     . GLN C 2 161 ? -41.985 7.640   -12.977 1.00 38.30 ? 161 GLN A N     1 
ATOM   2512 C  CA    . GLN C 2 161 ? -41.724 6.228   -12.734 1.00 35.26 ? 161 GLN A CA    1 
ATOM   2513 C  C     . GLN C 2 161 ? -41.747 5.904   -11.238 1.00 46.00 ? 161 GLN A C     1 
ATOM   2514 O  O     . GLN C 2 161 ? -42.110 4.793   -10.839 1.00 44.02 ? 161 GLN A O     1 
ATOM   2515 C  CB    . GLN C 2 161 ? -40.390 5.814   -13.356 1.00 38.34 ? 161 GLN A CB    1 
ATOM   2516 C  CG    . GLN C 2 161 ? -40.500 5.504   -14.848 1.00 39.59 ? 161 GLN A CG    1 
ATOM   2517 C  CD    . GLN C 2 161 ? -39.200 4.991   -15.449 1.00 39.76 ? 161 GLN A CD    1 
ATOM   2518 O  OE1   . GLN C 2 161 ? -39.208 4.136   -16.341 1.00 38.99 ? 161 GLN A OE1   1 
ATOM   2519 N  NE2   . GLN C 2 161 ? -38.076 5.517   -14.972 1.00 32.75 ? 161 GLN A NE2   1 
ATOM   2520 N  N     . LYS C 2 162 ? -41.369 6.872   -10.409 1.00 43.02 ? 162 LYS A N     1 
ATOM   2521 C  CA    . LYS C 2 162 ? -41.382 6.667   -8.965  1.00 48.77 ? 162 LYS A CA    1 
ATOM   2522 C  C     . LYS C 2 162 ? -42.835 6.664   -8.501  1.00 52.12 ? 162 LYS A C     1 
ATOM   2523 O  O     . LYS C 2 162 ? -43.275 5.778   -7.768  1.00 51.52 ? 162 LYS A O     1 
ATOM   2524 C  CB    . LYS C 2 162 ? -40.634 7.797   -8.253  1.00 46.12 ? 162 LYS A CB    1 
ATOM   2525 C  CG    . LYS C 2 162 ? -40.636 7.680   -6.734  1.00 52.56 ? 162 LYS A CG    1 
ATOM   2526 C  CD    . LYS C 2 162 ? -39.960 8.875   -6.067  1.00 55.73 ? 162 LYS A CD    1 
ATOM   2527 C  CE    . LYS C 2 162 ? -38.499 8.985   -6.480  1.00 64.53 ? 162 LYS A CE    1 
ATOM   2528 N  NZ    . LYS C 2 162 ? -37.791 10.100  -5.795  1.00 75.47 ? 162 LYS A NZ    1 
ATOM   2529 N  N     . ARG C 2 163 ? -43.573 7.667   -8.953  1.00 49.93 ? 163 ARG A N     1 
ATOM   2530 C  CA    . ARG C 2 163 ? -44.966 7.827   -8.595  1.00 49.90 ? 163 ARG A CA    1 
ATOM   2531 C  C     . ARG C 2 163 ? -45.933 6.843   -9.239  1.00 50.02 ? 163 ARG A C     1 
ATOM   2532 O  O     . ARG C 2 163 ? -46.770 6.265   -8.553  1.00 50.49 ? 163 ARG A O     1 
ATOM   2533 C  CB    . ARG C 2 163 ? -45.417 9.257   -8.917  1.00 50.00 ? 163 ARG A CB    1 
ATOM   2534 C  CG    . ARG C 2 163 ? -46.874 9.544   -8.596  1.00 58.27 ? 163 ARG A CG    1 
ATOM   2535 C  CD    . ARG C 2 163 ? -47.173 11.029  -8.699  1.00 63.81 ? 163 ARG A CD    1 
ATOM   2536 N  NE    . ARG C 2 163 ? -48.551 11.335  -8.325  1.00 77.14 ? 163 ARG A NE    1 
ATOM   2537 C  CZ    . ARG C 2 163 ? -49.059 12.564  -8.283  1.00 80.39 ? 163 ARG A CZ    1 
ATOM   2538 N  NH1   . ARG C 2 163 ? -48.302 13.608  -8.592  1.00 81.69 ? 163 ARG A NH1   1 
ATOM   2539 N  NH2   . ARG C 2 163 ? -50.325 12.751  -7.933  1.00 81.70 ? 163 ARG A NH2   1 
ATOM   2540 N  N     . TRP C 2 164 ? -45.824 6.640   -10.547 1.00 46.21 ? 164 TRP A N     1 
ATOM   2541 C  CA    . TRP C 2 164 ? -46.764 5.758   -11.222 1.00 45.44 ? 164 TRP A CA    1 
ATOM   2542 C  C     . TRP C 2 164 ? -46.208 4.536   -11.922 1.00 44.42 ? 164 TRP A C     1 
ATOM   2543 O  O     . TRP C 2 164 ? -46.977 3.740   -12.455 1.00 43.66 ? 164 TRP A O     1 
ATOM   2544 C  CB    . TRP C 2 164 ? -47.577 6.563   -12.233 1.00 45.94 ? 164 TRP A CB    1 
ATOM   2545 C  CG    . TRP C 2 164 ? -48.391 7.657   -11.621 1.00 53.12 ? 164 TRP A CG    1 
ATOM   2546 C  CD1   . TRP C 2 164 ? -49.354 7.525   -10.661 1.00 51.24 ? 164 TRP A CD1   1 
ATOM   2547 C  CD2   . TRP C 2 164 ? -48.340 9.052   -11.951 1.00 48.92 ? 164 TRP A CD2   1 
ATOM   2548 N  NE1   . TRP C 2 164 ? -49.907 8.748   -10.376 1.00 51.26 ? 164 TRP A NE1   1 
ATOM   2549 C  CE2   . TRP C 2 164 ? -49.306 9.703   -11.152 1.00 48.37 ? 164 TRP A CE2   1 
ATOM   2550 C  CE3   . TRP C 2 164 ? -47.572 9.814   -12.844 1.00 40.41 ? 164 TRP A CE3   1 
ATOM   2551 C  CZ2   . TRP C 2 164 ? -49.527 11.084  -11.220 1.00 45.37 ? 164 TRP A CZ2   1 
ATOM   2552 C  CZ3   . TRP C 2 164 ? -47.791 11.186  -12.911 1.00 35.87 ? 164 TRP A CZ3   1 
ATOM   2553 C  CH2   . TRP C 2 164 ? -48.761 11.806  -12.103 1.00 40.80 ? 164 TRP A CH2   1 
ATOM   2554 N  N     . LYS C 2 165 ? -44.888 4.386   -11.929 1.00 44.71 ? 165 LYS A N     1 
ATOM   2555 C  CA    . LYS C 2 165 ? -44.248 3.249   -12.594 1.00 46.98 ? 165 LYS A CA    1 
ATOM   2556 C  C     . LYS C 2 165 ? -44.481 3.334   -14.105 1.00 47.80 ? 165 LYS A C     1 
ATOM   2557 O  O     . LYS C 2 165 ? -44.493 2.315   -14.791 1.00 45.52 ? 165 LYS A O     1 
ATOM   2558 C  CB    . LYS C 2 165 ? -44.817 1.915   -12.091 1.00 51.79 ? 165 LYS A CB    1 
ATOM   2559 C  CG    . LYS C 2 165 ? -44.900 1.756   -10.579 1.00 56.02 ? 165 LYS A CG    1 
ATOM   2560 C  CD    . LYS C 2 165 ? -43.541 1.694   -9.923  1.00 66.11 ? 165 LYS A CD    1 
ATOM   2561 C  CE    . LYS C 2 165 ? -43.689 1.435   -8.433  1.00 69.58 ? 165 LYS A CE    1 
ATOM   2562 N  NZ    . LYS C 2 165 ? -44.453 0.179   -8.179  1.00 70.19 ? 165 LYS A NZ    1 
ATOM   2563 N  N     . GLU C 2 166 ? -44.682 4.547   -14.614 1.00 42.45 ? 166 GLU A N     1 
ATOM   2564 C  CA    . GLU C 2 166 ? -44.905 4.746   -16.042 1.00 41.60 ? 166 GLU A CA    1 
ATOM   2565 C  C     . GLU C 2 166 ? -44.086 5.926   -16.540 1.00 41.60 ? 166 GLU A C     1 
ATOM   2566 O  O     . GLU C 2 166 ? -43.729 6.819   -15.774 1.00 42.54 ? 166 GLU A O     1 
ATOM   2567 C  CB    . GLU C 2 166 ? -46.378 5.025   -16.330 1.00 42.17 ? 166 GLU A CB    1 
ATOM   2568 C  CG    . GLU C 2 166 ? -47.345 4.088   -15.640 1.00 51.40 ? 166 GLU A CG    1 
ATOM   2569 C  CD    . GLU C 2 166 ? -48.786 4.387   -16.009 1.00 56.70 ? 166 GLU A CD    1 
ATOM   2570 O  OE1   . GLU C 2 166 ? -49.205 5.555   -15.867 1.00 61.97 ? 166 GLU A OE1   1 
ATOM   2571 O  OE2   . GLU C 2 166 ? -49.497 3.456   -16.442 1.00 57.61 ? 166 GLU A OE2   1 
ATOM   2572 N  N     . ARG C 2 167 ? -43.807 5.925   -17.836 1.00 40.76 ? 167 ARG A N     1 
ATOM   2573 C  CA    . ARG C 2 167 ? -43.028 6.979   -18.458 1.00 41.95 ? 167 ARG A CA    1 
ATOM   2574 C  C     . ARG C 2 167 ? -43.885 7.919   -19.290 1.00 42.05 ? 167 ARG A C     1 
ATOM   2575 O  O     . ARG C 2 167 ? -44.911 7.525   -19.833 1.00 43.13 ? 167 ARG A O     1 
ATOM   2576 C  CB    . ARG C 2 167 ? -41.943 6.367   -19.343 1.00 37.82 ? 167 ARG A CB    1 
ATOM   2577 C  CG    . ARG C 2 167 ? -40.866 5.633   -18.573 1.00 40.58 ? 167 ARG A CG    1 
ATOM   2578 C  CD    . ARG C 2 167 ? -39.960 4.855   -19.502 1.00 53.26 ? 167 ARG A CD    1 
ATOM   2579 N  NE    . ARG C 2 167 ? -40.553 3.604   -19.976 1.00 51.69 ? 167 ARG A NE    1 
ATOM   2580 C  CZ    . ARG C 2 167 ? -40.777 2.543   -19.206 1.00 56.09 ? 167 ARG A CZ    1 
ATOM   2581 N  NH1   . ARG C 2 167 ? -40.465 2.575   -17.918 1.00 55.49 ? 167 ARG A NH1   1 
ATOM   2582 N  NH2   . ARG C 2 167 ? -41.290 1.438   -19.727 1.00 60.23 ? 167 ARG A NH2   1 
ATOM   2583 N  N     . PRO C 2 168 ? -43.477 9.191   -19.386 1.00 44.15 ? 168 PRO A N     1 
ATOM   2584 C  CA    . PRO C 2 168 ? -44.239 10.158  -20.177 1.00 42.39 ? 168 PRO A CA    1 
ATOM   2585 C  C     . PRO C 2 168 ? -44.111 9.843   -21.667 1.00 43.86 ? 168 PRO A C     1 
ATOM   2586 O  O     . PRO C 2 168 ? -43.254 9.055   -22.078 1.00 40.70 ? 168 PRO A O     1 
ATOM   2587 C  CB    . PRO C 2 168 ? -43.594 11.489  -19.803 1.00 40.58 ? 168 PRO A CB    1 
ATOM   2588 C  CG    . PRO C 2 168 ? -42.170 11.105  -19.548 1.00 45.50 ? 168 PRO A CG    1 
ATOM   2589 C  CD    . PRO C 2 168 ? -42.313 9.830   -18.747 1.00 38.85 ? 168 PRO A CD    1 
ATOM   2590 N  N     . GLU C 2 169 ? -44.974 10.448  -22.472 1.00 42.56 ? 169 GLU A N     1 
ATOM   2591 C  CA    . GLU C 2 169 ? -44.943 10.231  -23.908 1.00 42.51 ? 169 GLU A CA    1 
ATOM   2592 C  C     . GLU C 2 169 ? -44.932 11.554  -24.646 1.00 40.89 ? 169 GLU A C     1 
ATOM   2593 O  O     . GLU C 2 169 ? -45.535 12.535  -24.206 1.00 40.52 ? 169 GLU A O     1 
ATOM   2594 C  CB    . GLU C 2 169 ? -46.146 9.408   -24.359 1.00 43.79 ? 169 GLU A CB    1 
ATOM   2595 C  CG    . GLU C 2 169 ? -46.146 7.976   -23.853 1.00 52.39 ? 169 GLU A CG    1 
ATOM   2596 C  CD    . GLU C 2 169 ? -47.407 7.232   -24.262 1.00 60.82 ? 169 GLU A CD    1 
ATOM   2597 O  OE1   . GLU C 2 169 ? -47.633 7.061   -25.479 1.00 67.87 ? 169 GLU A OE1   1 
ATOM   2598 O  OE2   . GLU C 2 169 ? -48.177 6.824   -23.368 1.00 64.85 ? 169 GLU A OE2   1 
ATOM   2599 N  N     . TYR C 2 170 ? -44.248 11.564  -25.782 1.00 36.01 ? 170 TYR A N     1 
ATOM   2600 C  CA    . TYR C 2 170 ? -44.125 12.756  -26.596 1.00 35.74 ? 170 TYR A CA    1 
ATOM   2601 C  C     . TYR C 2 170 ? -44.669 12.501  -27.994 1.00 38.99 ? 170 TYR A C     1 
ATOM   2602 O  O     . TYR C 2 170 ? -44.734 11.365  -28.462 1.00 36.09 ? 170 TYR A O     1 
ATOM   2603 C  CB    . TYR C 2 170 ? -42.648 13.148  -26.707 1.00 33.82 ? 170 TYR A CB    1 
ATOM   2604 C  CG    . TYR C 2 170 ? -41.972 13.329  -25.371 1.00 36.73 ? 170 TYR A CG    1 
ATOM   2605 C  CD1   . TYR C 2 170 ? -41.980 14.564  -24.725 1.00 31.31 ? 170 TYR A CD1   1 
ATOM   2606 C  CD2   . TYR C 2 170 ? -41.365 12.251  -24.726 1.00 30.16 ? 170 TYR A CD2   1 
ATOM   2607 C  CE1   . TYR C 2 170 ? -41.399 14.721  -23.468 1.00 28.45 ? 170 TYR A CE1   1 
ATOM   2608 C  CE2   . TYR C 2 170 ? -40.787 12.397  -23.472 1.00 28.99 ? 170 TYR A CE2   1 
ATOM   2609 C  CZ    . TYR C 2 170 ? -40.802 13.631  -22.850 1.00 30.06 ? 170 TYR A CZ    1 
ATOM   2610 O  OH    . TYR C 2 170 ? -40.198 13.782  -21.621 1.00 39.08 ? 170 TYR A OH    1 
ATOM   2611 N  N     . ARG C 2 171 ? -45.076 13.571  -28.651 1.00 34.34 ? 171 ARG A N     1 
ATOM   2612 C  CA    . ARG C 2 171 ? -45.535 13.473  -30.016 1.00 36.77 ? 171 ARG A CA    1 
ATOM   2613 C  C     . ARG C 2 171 ? -45.361 14.873  -30.566 1.00 37.82 ? 171 ARG A C     1 
ATOM   2614 O  O     . ARG C 2 171 ? -45.403 15.855  -29.819 1.00 38.35 ? 171 ARG A O     1 
ATOM   2615 C  CB    . ARG C 2 171 ? -47.000 13.038  -30.092 1.00 40.38 ? 171 ARG A CB    1 
ATOM   2616 C  CG    . ARG C 2 171 ? -47.987 14.052  -29.560 1.00 35.37 ? 171 ARG A CG    1 
ATOM   2617 C  CD    . ARG C 2 171 ? -49.416 13.653  -29.889 1.00 35.85 ? 171 ARG A CD    1 
ATOM   2618 N  NE    . ARG C 2 171 ? -50.369 14.518  -29.209 1.00 32.63 ? 171 ARG A NE    1 
ATOM   2619 C  CZ    . ARG C 2 171 ? -51.652 14.622  -29.533 1.00 41.14 ? 171 ARG A CZ    1 
ATOM   2620 N  NH1   . ARG C 2 171 ? -52.144 13.915  -30.540 1.00 41.53 ? 171 ARG A NH1   1 
ATOM   2621 N  NH2   . ARG C 2 171 ? -52.443 15.424  -28.835 1.00 38.70 ? 171 ARG A NH2   1 
ATOM   2622 N  N     . LEU C 2 172 ? -45.128 14.952  -31.866 1.00 39.99 ? 172 LEU A N     1 
ATOM   2623 C  CA    . LEU C 2 172 ? -44.952 16.224  -32.543 1.00 41.69 ? 172 LEU A CA    1 
ATOM   2624 C  C     . LEU C 2 172 ? -46.325 16.829  -32.837 1.00 43.30 ? 172 LEU A C     1 
ATOM   2625 O  O     . LEU C 2 172 ? -47.232 16.130  -33.294 1.00 40.46 ? 172 LEU A O     1 
ATOM   2626 C  CB    . LEU C 2 172 ? -44.187 15.992  -33.850 1.00 41.14 ? 172 LEU A CB    1 
ATOM   2627 C  CG    . LEU C 2 172 ? -43.763 17.195  -34.691 1.00 51.60 ? 172 LEU A CG    1 
ATOM   2628 C  CD1   . LEU C 2 172 ? -42.793 18.058  -33.918 1.00 44.20 ? 172 LEU A CD1   1 
ATOM   2629 C  CD2   . LEU C 2 172 ? -43.125 16.696  -35.976 1.00 52.89 ? 172 LEU A CD2   1 
ATOM   2630 N  N     . ILE C 2 173 ? -46.475 18.121  -32.563 1.00 45.13 ? 173 ILE A N     1 
ATOM   2631 C  CA    . ILE C 2 173 ? -47.729 18.822  -32.821 1.00 45.12 ? 173 ILE A CA    1 
ATOM   2632 C  C     . ILE C 2 173 ? -47.645 19.509  -34.186 1.00 48.55 ? 173 ILE A C     1 
ATOM   2633 O  O     . ILE C 2 173 ? -48.540 19.352  -35.016 1.00 50.62 ? 173 ILE A O     1 
ATOM   2634 C  CB    . ILE C 2 173 ? -48.030 19.886  -31.728 1.00 45.31 ? 173 ILE A CB    1 
ATOM   2635 C  CG1   . ILE C 2 173 ? -48.249 19.207  -30.372 1.00 46.71 ? 173 ILE A CG1   1 
ATOM   2636 C  CG2   . ILE C 2 173 ? -49.248 20.701  -32.106 1.00 49.69 ? 173 ILE A CG2   1 
ATOM   2637 C  CD1   . ILE C 2 173 ? -49.271 18.081  -30.377 1.00 40.36 ? 173 ILE A CD1   1 
ATOM   2638 N  N     . SER C 2 174 ? -46.572 20.265  -34.416 1.00 45.81 ? 174 SER A N     1 
ATOM   2639 C  CA    . SER C 2 174 ? -46.383 20.954  -35.694 1.00 42.05 ? 174 SER A CA    1 
ATOM   2640 C  C     . SER C 2 174 ? -44.917 21.282  -35.952 1.00 42.29 ? 174 SER A C     1 
ATOM   2641 O  O     . SER C 2 174 ? -44.102 21.302  -35.028 1.00 40.64 ? 174 SER A O     1 
ATOM   2642 C  CB    . SER C 2 174 ? -47.199 22.250  -35.731 1.00 40.33 ? 174 SER A CB    1 
ATOM   2643 O  OG    . SER C 2 174 ? -46.670 23.226  -34.842 1.00 50.78 ? 174 SER A OG    1 
ATOM   2644 N  N     . VAL C 2 175 ? -44.593 21.535  -37.216 1.00 43.69 ? 175 VAL A N     1 
ATOM   2645 C  CA    . VAL C 2 175 ? -43.233 21.891  -37.631 1.00 49.01 ? 175 VAL A CA    1 
ATOM   2646 C  C     . VAL C 2 175 ? -43.341 23.085  -38.580 1.00 53.05 ? 175 VAL A C     1 
ATOM   2647 O  O     . VAL C 2 175 ? -44.039 23.006  -39.587 1.00 57.64 ? 175 VAL A O     1 
ATOM   2648 C  CB    . VAL C 2 175 ? -42.551 20.747  -38.390 1.00 48.73 ? 175 VAL A CB    1 
ATOM   2649 C  CG1   . VAL C 2 175 ? -41.082 21.064  -38.580 1.00 55.12 ? 175 VAL A CG1   1 
ATOM   2650 C  CG2   . VAL C 2 175 ? -42.722 19.450  -37.645 1.00 55.25 ? 175 VAL A CG2   1 
ATOM   2651 N  N     . GLU C 2 176 ? -42.655 24.182  -38.260 1.00 57.24 ? 176 GLU A N     1 
ATOM   2652 C  CA    . GLU C 2 176 ? -42.702 25.397  -39.078 1.00 60.93 ? 176 GLU A CA    1 
ATOM   2653 C  C     . GLU C 2 176 ? -41.335 25.788  -39.632 1.00 61.65 ? 176 GLU A C     1 
ATOM   2654 O  O     . GLU C 2 176 ? -40.309 25.263  -39.208 1.00 63.04 ? 176 GLU A O     1 
ATOM   2655 C  CB    . GLU C 2 176 ? -43.202 26.585  -38.248 1.00 64.77 ? 176 GLU A CB    1 
ATOM   2656 C  CG    . GLU C 2 176 ? -44.424 26.339  -37.377 1.00 77.80 ? 176 GLU A CG    1 
ATOM   2657 C  CD    . GLU C 2 176 ? -44.660 27.475  -36.380 1.00 80.42 ? 176 GLU A CD    1 
ATOM   2658 O  OE1   . GLU C 2 176 ? -44.892 28.623  -36.820 1.00 82.99 ? 176 GLU A OE1   1 
ATOM   2659 O  OE2   . GLU C 2 176 ? -44.606 27.223  -35.154 1.00 81.33 ? 176 GLU A OE2   1 
ATOM   2660 N  N     . GLY C 2 177 ? -41.342 26.735  -40.569 1.00 61.56 ? 177 GLY A N     1 
ATOM   2661 C  CA    . GLY C 2 177 ? -40.115 27.247  -41.155 1.00 56.27 ? 177 GLY A CA    1 
ATOM   2662 C  C     . GLY C 2 177 ? -39.448 26.433  -42.245 1.00 52.87 ? 177 GLY A C     1 
ATOM   2663 O  O     . GLY C 2 177 ? -39.919 25.353  -42.596 1.00 50.51 ? 177 GLY A O     1 
ATOM   2664 N  N     . PRO C 2 178 ? -38.327 26.939  -42.797 1.00 51.63 ? 178 PRO A N     1 
ATOM   2665 C  CA    . PRO C 2 178 ? -37.547 26.292  -43.860 1.00 53.74 ? 178 PRO A CA    1 
ATOM   2666 C  C     . PRO C 2 178 ? -36.859 25.047  -43.312 1.00 53.63 ? 178 PRO A C     1 
ATOM   2667 O  O     . PRO C 2 178 ? -36.741 24.883  -42.096 1.00 55.18 ? 178 PRO A O     1 
ATOM   2668 C  CB    . PRO C 2 178 ? -36.511 27.354  -44.252 1.00 49.12 ? 178 PRO A CB    1 
ATOM   2669 C  CG    . PRO C 2 178 ? -36.977 28.615  -43.604 1.00 54.12 ? 178 PRO A CG    1 
ATOM   2670 C  CD    . PRO C 2 178 ? -37.657 28.166  -42.346 1.00 53.34 ? 178 PRO A CD    1 
ATOM   2671 N  N     . HIS C 2 179 ? -36.386 24.189  -44.207 1.00 54.60 ? 179 HIS A N     1 
ATOM   2672 C  CA    . HIS C 2 179 ? -35.701 22.961  -43.807 1.00 59.04 ? 179 HIS A CA    1 
ATOM   2673 C  C     . HIS C 2 179 ? -34.409 23.187  -43.002 1.00 58.14 ? 179 HIS A C     1 
ATOM   2674 O  O     . HIS C 2 179 ? -34.047 22.364  -42.157 1.00 57.08 ? 179 HIS A O     1 
ATOM   2675 C  CB    . HIS C 2 179 ? -35.380 22.124  -45.041 1.00 58.36 ? 179 HIS A CB    1 
ATOM   2676 C  CG    . HIS C 2 179 ? -36.548 21.354  -45.570 1.00 68.45 ? 179 HIS A CG    1 
ATOM   2677 N  ND1   . HIS C 2 179 ? -37.105 21.605  -46.805 1.00 70.35 ? 179 HIS A ND1   1 
ATOM   2678 C  CD2   . HIS C 2 179 ? -37.277 20.352  -45.025 1.00 66.52 ? 179 HIS A CD2   1 
ATOM   2679 C  CE1   . HIS C 2 179 ? -38.129 20.791  -46.997 1.00 68.82 ? 179 HIS A CE1   1 
ATOM   2680 N  NE2   . HIS C 2 179 ? -38.253 20.021  -45.932 1.00 70.90 ? 179 HIS A NE2   1 
ATOM   2681 N  N     . HIS C 2 180 ? -33.723 24.297  -43.265 1.00 54.98 ? 180 HIS A N     1 
ATOM   2682 C  CA    . HIS C 2 180 ? -32.473 24.610  -42.578 1.00 52.58 ? 180 HIS A CA    1 
ATOM   2683 C  C     . HIS C 2 180 ? -32.684 25.455  -41.329 1.00 50.31 ? 180 HIS A C     1 
ATOM   2684 O  O     . HIS C 2 180 ? -31.728 25.979  -40.756 1.00 48.01 ? 180 HIS A O     1 
ATOM   2685 C  CB    . HIS C 2 180 ? -31.537 25.353  -43.519 1.00 51.42 ? 180 HIS A CB    1 
ATOM   2686 C  CG    . HIS C 2 180 ? -32.167 26.549  -44.159 1.00 51.82 ? 180 HIS A CG    1 
ATOM   2687 N  ND1   . HIS C 2 180 ? -33.083 26.446  -45.184 1.00 48.15 ? 180 HIS A ND1   1 
ATOM   2688 C  CD2   . HIS C 2 180 ? -32.036 27.871  -43.901 1.00 47.62 ? 180 HIS A CD2   1 
ATOM   2689 C  CE1   . HIS C 2 180 ? -33.490 27.654  -45.531 1.00 43.73 ? 180 HIS A CE1   1 
ATOM   2690 N  NE2   . HIS C 2 180 ? -32.871 28.536  -44.767 1.00 54.49 ? 180 HIS A NE2   1 
ATOM   2691 N  N     . LYS C 2 181 ? -33.937 25.598  -40.919 1.00 48.86 ? 181 LYS A N     1 
ATOM   2692 C  CA    . LYS C 2 181 ? -34.263 26.373  -39.735 1.00 49.75 ? 181 LYS A CA    1 
ATOM   2693 C  C     . LYS C 2 181 ? -35.726 26.115  -39.364 1.00 52.58 ? 181 LYS A C     1 
ATOM   2694 O  O     . LYS C 2 181 ? -36.601 26.956  -39.581 1.00 55.87 ? 181 LYS A O     1 
ATOM   2695 C  CB    . LYS C 2 181 ? -34.007 27.856  -40.013 1.00 52.15 ? 181 LYS A CB    1 
ATOM   2696 C  CG    . LYS C 2 181 ? -34.207 28.772  -38.823 1.00 56.38 ? 181 LYS A CG    1 
ATOM   2697 C  CD    . LYS C 2 181 ? -33.500 30.112  -39.038 1.00 68.92 ? 181 LYS A CD    1 
ATOM   2698 C  CE    . LYS C 2 181 ? -33.839 30.734  -40.395 1.00 74.17 ? 181 LYS A CE    1 
ATOM   2699 N  NZ    . LYS C 2 181 ? -33.128 32.025  -40.628 1.00 75.02 ? 181 LYS A NZ    1 
ATOM   2700 N  N     . LYS C 2 182 ? -35.973 24.934  -38.802 1.00 46.01 ? 182 LYS A N     1 
ATOM   2701 C  CA    . LYS C 2 182 ? -37.312 24.518  -38.410 1.00 43.19 ? 182 LYS A CA    1 
ATOM   2702 C  C     . LYS C 2 182 ? -37.675 24.851  -36.978 1.00 42.76 ? 182 LYS A C     1 
ATOM   2703 O  O     . LYS C 2 182 ? -36.809 25.037  -36.124 1.00 47.07 ? 182 LYS A O     1 
ATOM   2704 C  CB    . LYS C 2 182 ? -37.477 23.008  -38.601 1.00 40.71 ? 182 LYS A CB    1 
ATOM   2705 C  CG    . LYS C 2 182 ? -37.189 22.527  -40.004 1.00 49.37 ? 182 LYS A CG    1 
ATOM   2706 C  CD    . LYS C 2 182 ? -37.539 21.064  -40.162 1.00 55.06 ? 182 LYS A CD    1 
ATOM   2707 C  CE    . LYS C 2 182 ? -37.284 20.598  -41.583 1.00 64.85 ? 182 LYS A CE    1 
ATOM   2708 N  NZ    . LYS C 2 182 ? -37.688 19.182  -41.787 1.00 73.30 ? 182 LYS A NZ    1 
ATOM   2709 N  N     . LYS C 2 183 ? -38.977 24.921  -36.731 1.00 45.13 ? 183 LYS A N     1 
ATOM   2710 C  CA    . LYS C 2 183 ? -39.508 25.187  -35.405 1.00 49.02 ? 183 LYS A CA    1 
ATOM   2711 C  C     . LYS C 2 183 ? -40.433 24.022  -35.099 1.00 46.83 ? 183 LYS A C     1 
ATOM   2712 O  O     . LYS C 2 183 ? -41.360 23.743  -35.859 1.00 43.22 ? 183 LYS A O     1 
ATOM   2713 C  CB    . LYS C 2 183 ? -40.298 26.496  -35.384 1.00 56.88 ? 183 LYS A CB    1 
ATOM   2714 C  CG    . LYS C 2 183 ? -40.885 26.833  -34.021 1.00 68.54 ? 183 LYS A CG    1 
ATOM   2715 C  CD    . LYS C 2 183 ? -41.643 28.151  -34.048 1.00 74.73 ? 183 LYS A CD    1 
ATOM   2716 C  CE    . LYS C 2 183 ? -42.294 28.439  -32.706 1.00 81.70 ? 183 LYS A CE    1 
ATOM   2717 N  NZ    . LYS C 2 183 ? -42.947 29.781  -32.661 1.00 88.31 ? 183 LYS A NZ    1 
ATOM   2718 N  N     . PHE C 2 184 ? -40.166 23.326  -34.002 1.00 43.29 ? 184 PHE A N     1 
ATOM   2719 C  CA    . PHE C 2 184 ? -40.990 22.188  -33.619 1.00 39.35 ? 184 PHE A CA    1 
ATOM   2720 C  C     . PHE C 2 184 ? -41.802 22.470  -32.372 1.00 36.80 ? 184 PHE A C     1 
ATOM   2721 O  O     . PHE C 2 184 ? -41.319 23.098  -31.425 1.00 35.86 ? 184 PHE A O     1 
ATOM   2722 C  CB    . PHE C 2 184 ? -40.145 20.942  -33.308 1.00 42.79 ? 184 PHE A CB    1 
ATOM   2723 C  CG    . PHE C 2 184 ? -39.275 20.484  -34.429 1.00 42.14 ? 184 PHE A CG    1 
ATOM   2724 C  CD1   . PHE C 2 184 ? -38.049 21.097  -34.671 1.00 37.96 ? 184 PHE A CD1   1 
ATOM   2725 C  CD2   . PHE C 2 184 ? -39.662 19.415  -35.224 1.00 35.50 ? 184 PHE A CD2   1 
ATOM   2726 C  CE1   . PHE C 2 184 ? -37.216 20.651  -35.689 1.00 42.83 ? 184 PHE A CE1   1 
ATOM   2727 C  CE2   . PHE C 2 184 ? -38.836 18.957  -36.247 1.00 50.76 ? 184 PHE A CE2   1 
ATOM   2728 C  CZ    . PHE C 2 184 ? -37.608 19.577  -36.480 1.00 45.65 ? 184 PHE A CZ    1 
ATOM   2729 N  N     . ILE C 2 185 ? -43.042 21.997  -32.380 1.00 39.14 ? 185 ILE A N     1 
ATOM   2730 C  CA    . ILE C 2 185 ? -43.895 22.114  -31.213 1.00 37.14 ? 185 ILE A CA    1 
ATOM   2731 C  C     . ILE C 2 185 ? -44.263 20.676  -30.873 1.00 39.53 ? 185 ILE A C     1 
ATOM   2732 O  O     . ILE C 2 185 ? -44.853 19.954  -31.681 1.00 35.14 ? 185 ILE A O     1 
ATOM   2733 C  CB    . ILE C 2 185 ? -45.140 22.940  -31.483 1.00 38.74 ? 185 ILE A CB    1 
ATOM   2734 C  CG1   . ILE C 2 185 ? -44.733 24.393  -31.746 1.00 45.24 ? 185 ILE A CG1   1 
ATOM   2735 C  CG2   . ILE C 2 185 ? -46.072 22.858  -30.278 1.00 34.59 ? 185 ILE A CG2   1 
ATOM   2736 C  CD1   . ILE C 2 185 ? -45.867 25.272  -32.231 1.00 51.81 ? 185 ILE A CD1   1 
ATOM   2737 N  N     . VAL C 2 186 ? -43.872 20.258  -29.679 1.00 35.60 ? 186 VAL A N     1 
ATOM   2738 C  CA    . VAL C 2 186 ? -44.111 18.898  -29.229 1.00 39.93 ? 186 VAL A CA    1 
ATOM   2739 C  C     . VAL C 2 186 ? -45.004 18.884  -28.005 1.00 37.61 ? 186 VAL A C     1 
ATOM   2740 O  O     . VAL C 2 186 ? -45.108 19.878  -27.288 1.00 41.61 ? 186 VAL A O     1 
ATOM   2741 C  CB    . VAL C 2 186 ? -42.766 18.189  -28.877 1.00 42.39 ? 186 VAL A CB    1 
ATOM   2742 C  CG1   . VAL C 2 186 ? -43.028 16.755  -28.448 1.00 50.39 ? 186 VAL A CG1   1 
ATOM   2743 C  CG2   . VAL C 2 186 ? -41.828 18.200  -30.079 1.00 38.48 ? 186 VAL A CG2   1 
ATOM   2744 N  N     . GLU C 2 187 ? -45.644 17.749  -27.766 1.00 36.83 ? 187 GLU A N     1 
ATOM   2745 C  CA    . GLU C 2 187 ? -46.520 17.600  -26.616 1.00 40.11 ? 187 GLU A CA    1 
ATOM   2746 C  C     . GLU C 2 187 ? -45.978 16.517  -25.674 1.00 41.67 ? 187 GLU A C     1 
ATOM   2747 O  O     . GLU C 2 187 ? -45.563 15.443  -26.115 1.00 38.72 ? 187 GLU A O     1 
ATOM   2748 C  CB    . GLU C 2 187 ? -47.932 17.225  -27.081 1.00 43.97 ? 187 GLU A CB    1 
ATOM   2749 C  CG    . GLU C 2 187 ? -48.943 17.006  -25.966 1.00 37.33 ? 187 GLU A CG    1 
ATOM   2750 C  CD    . GLU C 2 187 ? -50.163 16.257  -26.457 1.00 47.49 ? 187 GLU A CD    1 
ATOM   2751 O  OE1   . GLU C 2 187 ? -50.046 15.036  -26.712 1.00 43.80 ? 187 GLU A OE1   1 
ATOM   2752 O  OE2   . GLU C 2 187 ? -51.233 16.883  -26.607 1.00 47.39 ? 187 GLU A OE2   1 
ATOM   2753 N  N     . ALA C 2 188 ? -45.978 16.817  -24.380 1.00 34.45 ? 188 ALA A N     1 
ATOM   2754 C  CA    . ALA C 2 188 ? -45.524 15.873  -23.375 1.00 37.70 ? 188 ALA A CA    1 
ATOM   2755 C  C     . ALA C 2 188 ? -46.754 15.508  -22.555 1.00 41.30 ? 188 ALA A C     1 
ATOM   2756 O  O     . ALA C 2 188 ? -47.604 16.365  -22.273 1.00 41.11 ? 188 ALA A O     1 
ATOM   2757 C  CB    . ALA C 2 188 ? -44.462 16.511  -22.487 1.00 30.07 ? 188 ALA A CB    1 
ATOM   2758 N  N     . LYS C 2 189 ? -46.857 14.238  -22.177 1.00 36.24 ? 189 LYS A N     1 
ATOM   2759 C  CA    . LYS C 2 189 ? -47.999 13.793  -21.397 1.00 42.35 ? 189 LYS A CA    1 
ATOM   2760 C  C     . LYS C 2 189 ? -47.678 12.663  -20.426 1.00 38.32 ? 189 LYS A C     1 
ATOM   2761 O  O     . LYS C 2 189 ? -46.735 11.901  -20.618 1.00 37.35 ? 189 LYS A O     1 
ATOM   2762 C  CB    . LYS C 2 189 ? -49.129 13.332  -22.324 1.00 45.65 ? 189 LYS A CB    1 
ATOM   2763 C  CG    . LYS C 2 189 ? -48.874 11.980  -22.980 1.00 48.97 ? 189 LYS A CG    1 
ATOM   2764 C  CD    . LYS C 2 189 ? -50.033 11.554  -23.862 1.00 59.44 ? 189 LYS A CD    1 
ATOM   2765 C  CE    . LYS C 2 189 ? -49.752 10.216  -24.530 1.00 63.18 ? 189 LYS A CE    1 
ATOM   2766 N  NZ    . LYS C 2 189 ? -50.888 9.763   -25.383 1.00 61.80 ? 189 LYS A NZ    1 
ATOM   2767 N  N     . ILE C 2 190 ? -48.489 12.587  -19.379 1.00 38.05 ? 190 ILE A N     1 
ATOM   2768 C  CA    . ILE C 2 190 ? -48.406 11.558  -18.359 1.00 35.04 ? 190 ILE A CA    1 
ATOM   2769 C  C     . ILE C 2 190 ? -49.787 11.573  -17.701 1.00 39.36 ? 190 ILE A C     1 
ATOM   2770 O  O     . ILE C 2 190 ? -50.279 12.629  -17.260 1.00 34.75 ? 190 ILE A O     1 
ATOM   2771 C  CB    . ILE C 2 190 ? -47.299 11.838  -17.303 1.00 34.50 ? 190 ILE A CB    1 
ATOM   2772 C  CG1   . ILE C 2 190 ? -47.232 10.662  -16.335 1.00 35.37 ? 190 ILE A CG1   1 
ATOM   2773 C  CG2   . ILE C 2 190 ? -47.559 13.127  -16.552 1.00 29.98 ? 190 ILE A CG2   1 
ATOM   2774 C  CD1   . ILE C 2 190 ? -46.754 9.389   -16.991 1.00 42.10 ? 190 ILE A CD1   1 
ATOM   2775 N  N     . LYS C 2 191 ? -50.410 10.400  -17.638 1.00 37.57 ? 191 LYS A N     1 
ATOM   2776 C  CA    . LYS C 2 191 ? -51.752 10.288  -17.087 1.00 38.55 ? 191 LYS A CA    1 
ATOM   2777 C  C     . LYS C 2 191 ? -52.617 11.275  -17.878 1.00 41.49 ? 191 LYS A C     1 
ATOM   2778 O  O     . LYS C 2 191 ? -52.610 11.251  -19.105 1.00 37.27 ? 191 LYS A O     1 
ATOM   2779 C  CB    . LYS C 2 191 ? -51.760 10.626  -15.593 1.00 39.28 ? 191 LYS A CB    1 
ATOM   2780 C  CG    . LYS C 2 191 ? -50.982 9.638   -14.721 1.00 36.86 ? 191 LYS A CG    1 
ATOM   2781 C  CD    . LYS C 2 191 ? -51.569 8.234   -14.778 1.00 42.73 ? 191 LYS A CD    1 
ATOM   2782 C  CE    . LYS C 2 191 ? -50.758 7.261   -13.926 1.00 51.25 ? 191 LYS A CE    1 
ATOM   2783 N  NZ    . LYS C 2 191 ? -51.254 5.853   -13.992 1.00 47.99 ? 191 LYS A NZ    1 
ATOM   2784 N  N     . GLU C 2 192 ? -53.334 12.155  -17.192 1.00 37.65 ? 192 GLU A N     1 
ATOM   2785 C  CA    . GLU C 2 192 ? -54.195 13.112  -17.882 1.00 45.54 ? 192 GLU A CA    1 
ATOM   2786 C  C     . GLU C 2 192 ? -53.560 14.483  -18.062 1.00 44.39 ? 192 GLU A C     1 
ATOM   2787 O  O     . GLU C 2 192 ? -54.233 15.430  -18.460 1.00 44.33 ? 192 GLU A O     1 
ATOM   2788 C  CB    . GLU C 2 192 ? -55.523 13.266  -17.133 1.00 45.91 ? 192 GLU A CB    1 
ATOM   2789 C  CG    . GLU C 2 192 ? -56.325 11.972  -17.008 1.00 59.78 ? 192 GLU A CG    1 
ATOM   2790 C  CD    . GLU C 2 192 ? -55.726 10.985  -16.009 1.00 65.03 ? 192 GLU A CD    1 
ATOM   2791 O  OE1   . GLU C 2 192 ? -55.572 11.360  -14.826 1.00 67.95 ? 192 GLU A OE1   1 
ATOM   2792 O  OE2   . GLU C 2 192 ? -55.416 9.837   -16.405 1.00 58.64 ? 192 GLU A OE2   1 
ATOM   2793 N  N     . TYR C 2 193 ? -52.266 14.586  -17.769 1.00 45.21 ? 193 TYR A N     1 
ATOM   2794 C  CA    . TYR C 2 193 ? -51.555 15.852  -17.898 1.00 44.06 ? 193 TYR A CA    1 
ATOM   2795 C  C     . TYR C 2 193 ? -50.796 15.955  -19.213 1.00 43.14 ? 193 TYR A C     1 
ATOM   2796 O  O     . TYR C 2 193 ? -50.102 15.021  -19.611 1.00 43.68 ? 193 TYR A O     1 
ATOM   2797 C  CB    . TYR C 2 193 ? -50.570 16.020  -16.750 1.00 47.62 ? 193 TYR A CB    1 
ATOM   2798 C  CG    . TYR C 2 193 ? -51.185 15.884  -15.382 1.00 47.79 ? 193 TYR A CG    1 
ATOM   2799 C  CD1   . TYR C 2 193 ? -51.965 16.900  -14.845 1.00 43.22 ? 193 TYR A CD1   1 
ATOM   2800 C  CD2   . TYR C 2 193 ? -50.966 14.740  -14.615 1.00 52.47 ? 193 TYR A CD2   1 
ATOM   2801 C  CE1   . TYR C 2 193 ? -52.512 16.786  -13.569 1.00 58.02 ? 193 TYR A CE1   1 
ATOM   2802 C  CE2   . TYR C 2 193 ? -51.502 14.612  -13.344 1.00 55.60 ? 193 TYR A CE2   1 
ATOM   2803 C  CZ    . TYR C 2 193 ? -52.274 15.637  -12.822 1.00 61.27 ? 193 TYR A CZ    1 
ATOM   2804 O  OH    . TYR C 2 193 ? -52.795 15.514  -11.551 1.00 67.41 ? 193 TYR A OH    1 
ATOM   2805 N  N     . ARG C 2 194 ? -50.935 17.099  -19.882 1.00 35.89 ? 194 ARG A N     1 
ATOM   2806 C  CA    . ARG C 2 194 ? -50.253 17.343  -21.145 1.00 41.86 ? 194 ARG A CA    1 
ATOM   2807 C  C     . ARG C 2 194 ? -49.739 18.771  -21.221 1.00 44.16 ? 194 ARG A C     1 
ATOM   2808 O  O     . ARG C 2 194 ? -50.394 19.706  -20.762 1.00 42.07 ? 194 ARG A O     1 
ATOM   2809 C  CB    . ARG C 2 194 ? -51.186 17.068  -22.325 1.00 42.17 ? 194 ARG A CB    1 
ATOM   2810 C  CG    . ARG C 2 194 ? -51.710 15.640  -22.357 1.00 45.78 ? 194 ARG A CG    1 
ATOM   2811 C  CD    . ARG C 2 194 ? -52.280 15.294  -23.714 1.00 42.46 ? 194 ARG A CD    1 
ATOM   2812 N  NE    . ARG C 2 194 ? -52.778 13.924  -23.762 1.00 37.35 ? 194 ARG A NE    1 
ATOM   2813 C  CZ    . ARG C 2 194 ? -53.020 13.268  -24.889 1.00 44.93 ? 194 ARG A CZ    1 
ATOM   2814 N  NH1   . ARG C 2 194 ? -52.803 13.861  -26.059 1.00 40.78 ? 194 ARG A NH1   1 
ATOM   2815 N  NH2   . ARG C 2 194 ? -53.489 12.028  -24.848 1.00 33.54 ? 194 ARG A NH2   1 
ATOM   2816 N  N     . THR C 2 195 ? -48.551 18.931  -21.794 1.00 42.87 ? 195 THR A N     1 
ATOM   2817 C  CA    . THR C 2 195 ? -47.942 20.242  -21.935 1.00 38.73 ? 195 THR A CA    1 
ATOM   2818 C  C     . THR C 2 195 ? -47.301 20.370  -23.313 1.00 39.07 ? 195 THR A C     1 
ATOM   2819 O  O     . THR C 2 195 ? -47.027 19.374  -23.978 1.00 38.52 ? 195 THR A O     1 
ATOM   2820 C  CB    . THR C 2 195 ? -46.849 20.467  -20.872 1.00 35.21 ? 195 THR A CB    1 
ATOM   2821 O  OG1   . THR C 2 195 ? -45.834 19.477  -21.026 1.00 37.55 ? 195 THR A OG1   1 
ATOM   2822 C  CG2   . THR C 2 195 ? -47.418 20.363  -19.474 1.00 34.57 ? 195 THR A CG2   1 
ATOM   2823 N  N     . LEU C 2 196 ? -47.072 21.601  -23.747 1.00 39.97 ? 196 LEU A N     1 
ATOM   2824 C  CA    . LEU C 2 196 ? -46.432 21.817  -25.035 1.00 44.21 ? 196 LEU A CA    1 
ATOM   2825 C  C     . LEU C 2 196 ? -45.062 22.458  -24.833 1.00 44.11 ? 196 LEU A C     1 
ATOM   2826 O  O     . LEU C 2 196 ? -44.798 23.080  -23.802 1.00 45.47 ? 196 LEU A O     1 
ATOM   2827 C  CB    . LEU C 2 196 ? -47.297 22.713  -25.930 1.00 45.12 ? 196 LEU A CB    1 
ATOM   2828 C  CG    . LEU C 2 196 ? -48.661 22.182  -26.398 1.00 43.06 ? 196 LEU A CG    1 
ATOM   2829 C  CD1   . LEU C 2 196 ? -49.316 23.226  -27.275 1.00 39.14 ? 196 LEU A CD1   1 
ATOM   2830 C  CD2   . LEU C 2 196 ? -48.500 20.887  -27.170 1.00 35.04 ? 196 LEU A CD2   1 
ATOM   2831 N  N     . GLY C 2 197 ? -44.193 22.284  -25.823 1.00 48.33 ? 197 GLY A N     1 
ATOM   2832 C  CA    . GLY C 2 197 ? -42.862 22.863  -25.775 1.00 34.57 ? 197 GLY A CA    1 
ATOM   2833 C  C     . GLY C 2 197 ? -42.415 23.068  -27.206 1.00 37.63 ? 197 GLY A C     1 
ATOM   2834 O  O     . GLY C 2 197 ? -42.835 22.324  -28.086 1.00 41.67 ? 197 GLY A O     1 
ATOM   2835 N  N     . GLU C 2 198 ? -41.597 24.082  -27.461 1.00 40.12 ? 198 GLU A N     1 
ATOM   2836 C  CA    . GLU C 2 198 ? -41.114 24.313  -28.819 1.00 43.05 ? 198 GLU A CA    1 
ATOM   2837 C  C     . GLU C 2 198 ? -39.600 24.500  -28.825 1.00 43.47 ? 198 GLU A C     1 
ATOM   2838 O  O     . GLU C 2 198 ? -39.016 24.912  -27.821 1.00 37.68 ? 198 GLU A O     1 
ATOM   2839 C  CB    . GLU C 2 198 ? -41.790 25.538  -29.441 1.00 46.25 ? 198 GLU A CB    1 
ATOM   2840 C  CG    . GLU C 2 198 ? -41.464 26.855  -28.774 1.00 53.73 ? 198 GLU A CG    1 
ATOM   2841 C  CD    . GLU C 2 198 ? -42.133 28.034  -29.468 1.00 65.42 ? 198 GLU A CD    1 
ATOM   2842 O  OE1   . GLU C 2 198 ? -43.383 28.060  -29.529 1.00 67.36 ? 198 GLU A OE1   1 
ATOM   2843 O  OE2   . GLU C 2 198 ? -41.410 28.932  -29.955 1.00 64.00 ? 198 GLU A OE2   1 
ATOM   2844 N  N     . GLY C 2 199 ? -38.972 24.193  -29.958 1.00 40.49 ? 199 GLY A N     1 
ATOM   2845 C  CA    . GLY C 2 199 ? -37.528 24.330  -30.067 1.00 44.86 ? 199 GLY A CA    1 
ATOM   2846 C  C     . GLY C 2 199 ? -37.010 24.118  -31.480 1.00 45.79 ? 199 GLY A C     1 
ATOM   2847 O  O     . GLY C 2 199 ? -37.780 23.791  -32.392 1.00 37.49 ? 199 GLY A O     1 
ATOM   2848 N  N     . LYS C 2 200 ? -35.702 24.302  -31.659 1.00 40.01 ? 200 LYS A N     1 
ATOM   2849 C  CA    . LYS C 2 200 ? -35.070 24.142  -32.963 1.00 39.16 ? 200 LYS A CA    1 
ATOM   2850 C  C     . LYS C 2 200 ? -34.897 22.681  -33.372 1.00 36.34 ? 200 LYS A C     1 
ATOM   2851 O  O     . LYS C 2 200 ? -34.468 22.391  -34.486 1.00 40.68 ? 200 LYS A O     1 
ATOM   2852 C  CB    . LYS C 2 200 ? -33.711 24.849  -32.988 1.00 46.36 ? 200 LYS A CB    1 
ATOM   2853 C  CG    . LYS C 2 200 ? -32.777 24.425  -31.871 1.00 56.90 ? 200 LYS A CG    1 
ATOM   2854 C  CD    . LYS C 2 200 ? -31.314 24.493  -32.283 1.00 57.00 ? 200 LYS A CD    1 
ATOM   2855 C  CE    . LYS C 2 200 ? -30.444 23.790  -31.250 1.00 60.75 ? 200 LYS A CE    1 
ATOM   2856 N  NZ    . LYS C 2 200 ? -29.059 23.542  -31.731 1.00 60.54 ? 200 LYS A NZ    1 
ATOM   2857 N  N     . SER C 2 201 ? -35.223 21.761  -32.471 1.00 37.46 ? 201 SER A N     1 
ATOM   2858 C  CA    . SER C 2 201 ? -35.129 20.332  -32.764 1.00 39.89 ? 201 SER A CA    1 
ATOM   2859 C  C     . SER C 2 201 ? -36.176 19.605  -31.928 1.00 37.87 ? 201 SER A C     1 
ATOM   2860 O  O     . SER C 2 201 ? -36.728 20.179  -30.990 1.00 37.90 ? 201 SER A O     1 
ATOM   2861 C  CB    . SER C 2 201 ? -33.741 19.798  -32.417 1.00 42.20 ? 201 SER A CB    1 
ATOM   2862 O  OG    . SER C 2 201 ? -33.555 19.775  -31.013 1.00 45.14 ? 201 SER A OG    1 
ATOM   2863 N  N     . LYS C 2 202 ? -36.455 18.349  -32.261 1.00 36.87 ? 202 LYS A N     1 
ATOM   2864 C  CA    . LYS C 2 202 ? -37.445 17.596  -31.508 1.00 41.16 ? 202 LYS A CA    1 
ATOM   2865 C  C     . LYS C 2 202 ? -37.045 17.495  -30.046 1.00 41.13 ? 202 LYS A C     1 
ATOM   2866 O  O     . LYS C 2 202 ? -37.860 17.732  -29.156 1.00 39.62 ? 202 LYS A O     1 
ATOM   2867 C  CB    . LYS C 2 202 ? -37.601 16.181  -32.053 1.00 40.91 ? 202 LYS A CB    1 
ATOM   2868 C  CG    . LYS C 2 202 ? -38.286 16.048  -33.393 1.00 52.38 ? 202 LYS A CG    1 
ATOM   2869 C  CD    . LYS C 2 202 ? -38.562 14.565  -33.623 1.00 53.77 ? 202 LYS A CD    1 
ATOM   2870 C  CE    . LYS C 2 202 ? -39.167 14.256  -34.973 1.00 46.78 ? 202 LYS A CE    1 
ATOM   2871 N  NZ    . LYS C 2 202 ? -39.446 12.793  -35.035 1.00 48.44 ? 202 LYS A NZ    1 
ATOM   2872 N  N     . LYS C 2 203 ? -35.788 17.127  -29.805 1.00 40.20 ? 203 LYS A N     1 
ATOM   2873 C  CA    . LYS C 2 203 ? -35.294 16.981  -28.443 1.00 39.67 ? 203 LYS A CA    1 
ATOM   2874 C  C     . LYS C 2 203 ? -35.322 18.280  -27.648 1.00 32.12 ? 203 LYS A C     1 
ATOM   2875 O  O     . LYS C 2 203 ? -35.679 18.285  -26.469 1.00 38.90 ? 203 LYS A O     1 
ATOM   2876 C  CB    . LYS C 2 203 ? -33.895 16.369  -28.457 1.00 39.86 ? 203 LYS A CB    1 
ATOM   2877 C  CG    . LYS C 2 203 ? -33.933 14.866  -28.670 1.00 54.77 ? 203 LYS A CG    1 
ATOM   2878 C  CD    . LYS C 2 203 ? -32.563 14.238  -28.535 1.00 60.13 ? 203 LYS A CD    1 
ATOM   2879 C  CE    . LYS C 2 203 ? -32.659 12.731  -28.647 1.00 62.78 ? 203 LYS A CE    1 
ATOM   2880 N  NZ    . LYS C 2 203 ? -31.310 12.100  -28.598 1.00 75.68 ? 203 LYS A NZ    1 
ATOM   2881 N  N     . GLU C 2 204 ? -34.950 19.386  -28.275 1.00 29.80 ? 204 GLU A N     1 
ATOM   2882 C  CA    . GLU C 2 204 ? -35.014 20.657  -27.570 1.00 32.56 ? 204 GLU A CA    1 
ATOM   2883 C  C     . GLU C 2 204 ? -36.483 20.911  -27.232 1.00 35.03 ? 204 GLU A C     1 
ATOM   2884 O  O     . GLU C 2 204 ? -36.812 21.319  -26.120 1.00 36.09 ? 204 GLU A O     1 
ATOM   2885 C  CB    . GLU C 2 204 ? -34.471 21.787  -28.443 1.00 39.63 ? 204 GLU A CB    1 
ATOM   2886 C  CG    . GLU C 2 204 ? -34.672 23.185  -27.864 1.00 51.37 ? 204 GLU A CG    1 
ATOM   2887 C  CD    . GLU C 2 204 ? -33.889 24.240  -28.627 1.00 62.54 ? 204 GLU A CD    1 
ATOM   2888 O  OE1   . GLU C 2 204 ? -32.641 24.209  -28.550 1.00 71.23 ? 204 GLU A OE1   1 
ATOM   2889 O  OE2   . GLU C 2 204 ? -34.512 25.087  -29.307 1.00 58.26 ? 204 GLU A OE2   1 
ATOM   2890 N  N     . ALA C 2 205 ? -37.373 20.655  -28.187 1.00 30.64 ? 205 ALA A N     1 
ATOM   2891 C  CA    . ALA C 2 205 ? -38.804 20.867  -27.944 1.00 37.16 ? 205 ALA A CA    1 
ATOM   2892 C  C     . ALA C 2 205 ? -39.306 19.986  -26.798 1.00 36.81 ? 205 ALA A C     1 
ATOM   2893 O  O     . ALA C 2 205 ? -40.008 20.462  -25.906 1.00 40.14 ? 205 ALA A O     1 
ATOM   2894 C  CB    . ALA C 2 205 ? -39.615 20.585  -29.216 1.00 29.68 ? 205 ALA A CB    1 
ATOM   2895 N  N     . GLU C 2 206 ? -38.936 18.706  -26.816 1.00 36.85 ? 206 GLU A N     1 
ATOM   2896 C  CA    . GLU C 2 206 ? -39.362 17.779  -25.770 1.00 35.85 ? 206 GLU A CA    1 
ATOM   2897 C  C     . GLU C 2 206 ? -38.765 18.141  -24.410 1.00 39.08 ? 206 GLU A C     1 
ATOM   2898 O  O     . GLU C 2 206 ? -39.417 17.958  -23.370 1.00 32.14 ? 206 GLU A O     1 
ATOM   2899 C  CB    . GLU C 2 206 ? -38.970 16.350  -26.146 1.00 36.14 ? 206 GLU A CB    1 
ATOM   2900 C  CG    . GLU C 2 206 ? -39.612 15.884  -27.443 1.00 38.84 ? 206 GLU A CG    1 
ATOM   2901 C  CD    . GLU C 2 206 ? -38.924 14.675  -28.040 1.00 43.28 ? 206 GLU A CD    1 
ATOM   2902 O  OE1   . GLU C 2 206 ? -37.687 14.550  -27.904 1.00 44.32 ? 206 GLU A OE1   1 
ATOM   2903 O  OE2   . GLU C 2 206 ? -39.618 13.857  -28.666 1.00 43.55 ? 206 GLU A OE2   1 
ATOM   2904 N  N     . GLN C 2 207 ? -37.533 18.648  -24.412 1.00 32.60 ? 207 GLN A N     1 
ATOM   2905 C  CA    . GLN C 2 207 ? -36.887 19.034  -23.157 1.00 35.25 ? 207 GLN A CA    1 
ATOM   2906 C  C     . GLN C 2 207 ? -37.718 20.158  -22.552 1.00 37.82 ? 207 GLN A C     1 
ATOM   2907 O  O     . GLN C 2 207 ? -38.035 20.157  -21.359 1.00 40.21 ? 207 GLN A O     1 
ATOM   2908 C  CB    . GLN C 2 207 ? -35.453 19.523  -23.405 1.00 32.74 ? 207 GLN A CB    1 
ATOM   2909 C  CG    . GLN C 2 207 ? -34.402 18.427  -23.532 1.00 35.23 ? 207 GLN A CG    1 
ATOM   2910 C  CD    . GLN C 2 207 ? -34.221 17.611  -22.254 1.00 42.38 ? 207 GLN A CD    1 
ATOM   2911 O  OE1   . GLN C 2 207 ? -34.547 18.067  -21.155 1.00 41.65 ? 207 GLN A OE1   1 
ATOM   2912 N  NE2   . GLN C 2 207 ? -33.681 16.404  -22.396 1.00 34.78 ? 207 GLN A NE2   1 
ATOM   2913 N  N     . ARG C 2 208 ? -38.059 21.124  -23.392 1.00 35.45 ? 208 ARG A N     1 
ATOM   2914 C  CA    . ARG C 2 208 ? -38.877 22.249  -22.971 1.00 40.86 ? 208 ARG A CA    1 
ATOM   2915 C  C     . ARG C 2 208 ? -40.240 21.726  -22.449 1.00 46.39 ? 208 ARG A C     1 
ATOM   2916 O  O     . ARG C 2 208 ? -40.665 22.069  -21.341 1.00 42.92 ? 208 ARG A O     1 
ATOM   2917 C  CB    . ARG C 2 208 ? -39.082 23.199  -24.158 1.00 44.62 ? 208 ARG A CB    1 
ATOM   2918 C  CG    . ARG C 2 208 ? -38.718 24.651  -23.868 1.00 49.93 ? 208 ARG A CG    1 
ATOM   2919 C  CD    . ARG C 2 208 ? -37.296 25.020  -24.289 1.00 56.42 ? 208 ARG A CD    1 
ATOM   2920 N  NE    . ARG C 2 208 ? -37.207 25.319  -25.719 1.00 64.36 ? 208 ARG A NE    1 
ATOM   2921 C  CZ    . ARG C 2 208 ? -36.185 25.946  -26.302 1.00 59.15 ? 208 ARG A CZ    1 
ATOM   2922 N  NH1   . ARG C 2 208 ? -35.146 26.353  -25.585 1.00 59.62 ? 208 ARG A NH1   1 
ATOM   2923 N  NH2   . ARG C 2 208 ? -36.203 26.169  -27.610 1.00 58.61 ? 208 ARG A NH2   1 
ATOM   2924 N  N     . ALA C 2 209 ? -40.914 20.890  -23.240 1.00 36.83 ? 209 ALA A N     1 
ATOM   2925 C  CA    . ALA C 2 209 ? -42.207 20.326  -22.837 1.00 38.87 ? 209 ALA A CA    1 
ATOM   2926 C  C     . ALA C 2 209 ? -42.111 19.559  -21.520 1.00 39.35 ? 209 ALA A C     1 
ATOM   2927 O  O     . ALA C 2 209 ? -43.025 19.608  -20.702 1.00 33.94 ? 209 ALA A O     1 
ATOM   2928 C  CB    . ALA C 2 209 ? -42.732 19.390  -23.915 1.00 31.84 ? 209 ALA A CB    1 
ATOM   2929 N  N     . ALA C 2 210 ? -41.014 18.831  -21.331 1.00 35.62 ? 210 ALA A N     1 
ATOM   2930 C  CA    . ALA C 2 210 ? -40.830 18.053  -20.114 1.00 34.42 ? 210 ALA A CA    1 
ATOM   2931 C  C     . ALA C 2 210 ? -40.733 18.988  -18.927 1.00 38.58 ? 210 ALA A C     1 
ATOM   2932 O  O     . ALA C 2 210 ? -41.272 18.703  -17.864 1.00 33.43 ? 210 ALA A O     1 
ATOM   2933 C  CB    . ALA C 2 210 ? -39.564 17.188  -20.208 1.00 31.51 ? 210 ALA A CB    1 
ATOM   2934 N  N     . GLU C 2 211 ? -40.043 20.110  -19.115 1.00 42.46 ? 211 GLU A N     1 
ATOM   2935 C  CA    . GLU C 2 211 ? -39.881 21.086  -18.041 1.00 43.31 ? 211 GLU A CA    1 
ATOM   2936 C  C     . GLU C 2 211 ? -41.237 21.633  -17.605 1.00 38.77 ? 211 GLU A C     1 
ATOM   2937 O  O     . GLU C 2 211 ? -41.490 21.814  -16.419 1.00 34.79 ? 211 GLU A O     1 
ATOM   2938 C  CB    . GLU C 2 211 ? -38.960 22.234  -18.486 1.00 38.75 ? 211 GLU A CB    1 
ATOM   2939 C  CG    . GLU C 2 211 ? -39.011 23.445  -17.569 1.00 45.85 ? 211 GLU A CG    1 
ATOM   2940 C  CD    . GLU C 2 211 ? -37.917 24.457  -17.845 1.00 49.53 ? 211 GLU A CD    1 
ATOM   2941 O  OE1   . GLU C 2 211 ? -37.642 24.744  -19.033 1.00 50.50 ? 211 GLU A OE1   1 
ATOM   2942 O  OE2   . GLU C 2 211 ? -37.339 24.975  -16.867 1.00 54.19 ? 211 GLU A OE2   1 
ATOM   2943 N  N     . GLU C 2 212 ? -42.106 21.893  -18.573 1.00 36.49 ? 212 GLU A N     1 
ATOM   2944 C  CA    . GLU C 2 212 ? -43.441 22.406  -18.279 1.00 41.97 ? 212 GLU A CA    1 
ATOM   2945 C  C     . GLU C 2 212 ? -44.277 21.391  -17.490 1.00 43.99 ? 212 GLU A C     1 
ATOM   2946 O  O     . GLU C 2 212 ? -44.922 21.735  -16.495 1.00 45.37 ? 212 GLU A O     1 
ATOM   2947 C  CB    . GLU C 2 212 ? -44.141 22.772  -19.583 1.00 42.86 ? 212 GLU A CB    1 
ATOM   2948 C  CG    . GLU C 2 212 ? -43.953 24.222  -19.964 1.00 53.28 ? 212 GLU A CG    1 
ATOM   2949 C  CD    . GLU C 2 212 ? -44.760 25.136  -19.072 1.00 62.63 ? 212 GLU A CD    1 
ATOM   2950 O  OE1   . GLU C 2 212 ? -46.007 25.023  -19.086 1.00 69.42 ? 212 GLU A OE1   1 
ATOM   2951 O  OE2   . GLU C 2 212 ? -44.156 25.958  -18.354 1.00 64.67 ? 212 GLU A OE2   1 
ATOM   2952 N  N     . LEU C 2 213 ? -44.248 20.139  -17.933 1.00 35.10 ? 213 LEU A N     1 
ATOM   2953 C  CA    . LEU C 2 213 ? -44.989 19.083  -17.274 1.00 36.51 ? 213 LEU A CA    1 
ATOM   2954 C  C     . LEU C 2 213 ? -44.517 18.897  -15.834 1.00 38.11 ? 213 LEU A C     1 
ATOM   2955 O  O     . LEU C 2 213 ? -45.309 18.590  -14.947 1.00 41.65 ? 213 LEU A O     1 
ATOM   2956 C  CB    . LEU C 2 213 ? -44.841 17.779  -18.062 1.00 37.39 ? 213 LEU A CB    1 
ATOM   2957 C  CG    . LEU C 2 213 ? -45.676 16.584  -17.601 1.00 35.54 ? 213 LEU A CG    1 
ATOM   2958 C  CD1   . LEU C 2 213 ? -47.113 17.016  -17.293 1.00 36.13 ? 213 LEU A CD1   1 
ATOM   2959 C  CD2   . LEU C 2 213 ? -45.659 15.522  -18.693 1.00 36.48 ? 213 LEU A CD2   1 
ATOM   2960 N  N     . ILE C 2 214 ? -43.225 19.079  -15.594 1.00 37.13 ? 214 ILE A N     1 
ATOM   2961 C  CA    . ILE C 2 214 ? -42.719 18.931  -14.237 1.00 42.19 ? 214 ILE A CA    1 
ATOM   2962 C  C     . ILE C 2 214 ? -43.413 19.962  -13.348 1.00 47.11 ? 214 ILE A C     1 
ATOM   2963 O  O     . ILE C 2 214 ? -43.862 19.643  -12.245 1.00 44.53 ? 214 ILE A O     1 
ATOM   2964 C  CB    . ILE C 2 214 ? -41.198 19.152  -14.172 1.00 40.30 ? 214 ILE A CB    1 
ATOM   2965 C  CG1   . ILE C 2 214 ? -40.483 18.070  -14.984 1.00 40.79 ? 214 ILE A CG1   1 
ATOM   2966 C  CG2   . ILE C 2 214 ? -40.742 19.131  -12.724 1.00 30.28 ? 214 ILE A CG2   1 
ATOM   2967 C  CD1   . ILE C 2 214 ? -38.996 18.275  -15.120 1.00 33.17 ? 214 ILE A CD1   1 
ATOM   2968 N  N     . LYS C 2 215 ? -43.491 21.198  -13.840 1.00 40.64 ? 215 LYS A N     1 
ATOM   2969 C  CA    . LYS C 2 215 ? -44.148 22.276  -13.113 1.00 50.18 ? 215 LYS A CA    1 
ATOM   2970 C  C     . LYS C 2 215 ? -45.608 21.894  -12.894 1.00 52.96 ? 215 LYS A C     1 
ATOM   2971 O  O     . LYS C 2 215 ? -46.105 21.888  -11.769 1.00 56.64 ? 215 LYS A O     1 
ATOM   2972 C  CB    . LYS C 2 215 ? -44.107 23.580  -13.918 1.00 53.45 ? 215 LYS A CB    1 
ATOM   2973 C  CG    . LYS C 2 215 ? -42.735 24.186  -14.133 1.00 60.06 ? 215 LYS A CG    1 
ATOM   2974 C  CD    . LYS C 2 215 ? -42.845 25.472  -14.945 1.00 69.93 ? 215 LYS A CD    1 
ATOM   2975 C  CE    . LYS C 2 215 ? -43.822 26.461  -14.302 1.00 75.54 ? 215 LYS A CE    1 
ATOM   2976 N  NZ    . LYS C 2 215 ? -43.980 27.725  -15.088 1.00 80.82 ? 215 LYS A NZ    1 
ATOM   2977 N  N     . LEU C 2 216 ? -46.289 21.580  -13.991 1.00 53.59 ? 216 LEU A N     1 
ATOM   2978 C  CA    . LEU C 2 216 ? -47.690 21.207  -13.930 1.00 56.08 ? 216 LEU A CA    1 
ATOM   2979 C  C     . LEU C 2 216 ? -47.912 20.193  -12.823 1.00 57.25 ? 216 LEU A C     1 
ATOM   2980 O  O     . LEU C 2 216 ? -48.883 20.285  -12.078 1.00 60.16 ? 216 LEU A O     1 
ATOM   2981 C  CB    . LEU C 2 216 ? -48.139 20.622  -15.266 1.00 54.17 ? 216 LEU A CB    1 
ATOM   2982 C  CG    . LEU C 2 216 ? -49.612 20.222  -15.344 1.00 52.01 ? 216 LEU A CG    1 
ATOM   2983 C  CD1   . LEU C 2 216 ? -50.492 21.430  -15.036 1.00 44.37 ? 216 LEU A CD1   1 
ATOM   2984 C  CD2   . LEU C 2 216 ? -49.910 19.676  -16.729 1.00 48.94 ? 216 LEU A CD2   1 
ATOM   2985 N  N     . LEU C 2 217 ? -47.003 19.230  -12.714 1.00 56.76 ? 217 LEU A N     1 
ATOM   2986 C  CA    . LEU C 2 217 ? -47.116 18.205  -11.688 1.00 57.32 ? 217 LEU A CA    1 
ATOM   2987 C  C     . LEU C 2 217 ? -46.907 18.756  -10.280 1.00 58.58 ? 217 LEU A C     1 
ATOM   2988 O  O     . LEU C 2 217 ? -47.601 18.357  -9.347  1.00 54.69 ? 217 LEU A O     1 
ATOM   2989 C  CB    . LEU C 2 217 ? -46.120 17.078  -11.954 1.00 50.79 ? 217 LEU A CB    1 
ATOM   2990 C  CG    . LEU C 2 217 ? -46.403 16.216  -13.182 1.00 50.10 ? 217 LEU A CG    1 
ATOM   2991 C  CD1   . LEU C 2 217 ? -45.357 15.115  -13.257 1.00 42.28 ? 217 LEU A CD1   1 
ATOM   2992 C  CD2   . LEU C 2 217 ? -47.810 15.622  -13.102 1.00 45.40 ? 217 LEU A CD2   1 
ATOM   2993 N  N     . GLU C 2 218 ? -45.950 19.665  -10.126 1.00 65.69 ? 218 GLU A N     1 
ATOM   2994 C  CA    . GLU C 2 218 ? -45.683 20.264  -8.822  1.00 74.38 ? 218 GLU A CA    1 
ATOM   2995 C  C     . GLU C 2 218 ? -46.915 21.030  -8.352  1.00 76.65 ? 218 GLU A C     1 
ATOM   2996 O  O     . GLU C 2 218 ? -47.331 20.915  -7.201  1.00 78.03 ? 218 GLU A O     1 
ATOM   2997 C  CB    . GLU C 2 218 ? -44.440 21.154  -8.886  1.00 72.37 ? 218 GLU A CB    1 
ATOM   2998 C  CG    . GLU C 2 218 ? -43.145 20.396  -9.128  1.00 85.62 ? 218 GLU A CG    1 
ATOM   2999 C  CD    . GLU C 2 218 ? -41.937 21.309  -9.185  1.00 93.15 ? 218 GLU A CD    1 
ATOM   3000 O  OE1   . GLU C 2 218 ? -42.126 22.543  -9.226  1.00 99.84 ? 218 GLU A OE1   1 
ATOM   3001 O  OE2   . GLU C 2 218 ? -40.800 20.791  -9.188  1.00 99.39 ? 218 GLU A OE2   1 
ATOM   3002 N  N     . GLU C 2 219 ? -47.497 21.813  -9.251  1.00 81.18 ? 219 GLU A N     1 
ATOM   3003 C  CA    . GLU C 2 219 ? -48.683 22.587  -8.923  1.00 85.97 ? 219 GLU A CA    1 
ATOM   3004 C  C     . GLU C 2 219 ? -49.841 21.612  -8.729  1.00 89.15 ? 219 GLU A C     1 
ATOM   3005 O  O     . GLU C 2 219 ? -50.932 21.998  -8.308  1.00 91.30 ? 219 GLU A O     1 
ATOM   3006 C  CB    . GLU C 2 219 ? -48.943 23.649  -9.994  1.00 85.29 ? 219 GLU A CB    1 
ATOM   3007 C  CG    . GLU C 2 219 ? -47.889 24.743  -10.051 1.00 92.87 ? 219 GLU A CG    1 
ATOM   3008 C  CD    . GLU C 2 219 ? -48.179 25.775  -11.123 1.00 99.71 ? 219 GLU A CD    1 
ATOM   3009 O  OE1   . GLU C 2 219 ? -49.092 25.541  -11.942 1.00 99.84 ? 219 GLU A OE1   1 
ATOM   3010 O  OE2   . GLU C 2 219 ? -47.494 26.819  -11.143 1.00 99.84 ? 219 GLU A OE2   1 
ATOM   3011 N  N     . SER C 2 220 ? -49.577 20.342  -9.031  1.00 90.53 ? 220 SER A N     1 
ATOM   3012 C  CA    . SER C 2 220 ? -50.560 19.263  -8.922  1.00 87.83 ? 220 SER A CA    1 
ATOM   3013 C  C     . SER C 2 220 ? -51.700 19.417  -9.918  1.00 89.68 ? 220 SER A C     1 
ATOM   3014 O  O     . SER C 2 220 ? -51.672 18.718  -10.955 1.00 87.98 ? 220 SER A O     1 
ATOM   3015 C  CB    . SER C 2 220 ? -51.138 19.206  -7.507  1.00 81.55 ? 220 SER A CB    1 
ATOM   3016 O  OG    . SER C 2 220 ? -50.901 17.943  -6.909  1.00 80.26 ? 220 SER A OG    1 
ATOM   3017 N  N     . MET D 2 3   ? -0.841  -18.699 -5.802  1.00 66.37 ? 3   MET B N     1 
ATOM   3018 C  CA    . MET D 2 3   ? -2.023  -18.477 -6.687  1.00 72.55 ? 3   MET B CA    1 
ATOM   3019 C  C     . MET D 2 3   ? -1.803  -17.265 -7.596  1.00 73.01 ? 3   MET B C     1 
ATOM   3020 O  O     . MET D 2 3   ? -1.777  -17.395 -8.819  1.00 75.12 ? 3   MET B O     1 
ATOM   3021 C  CB    . MET D 2 3   ? -3.279  -18.254 -5.842  1.00 76.76 ? 3   MET B CB    1 
ATOM   3022 C  CG    . MET D 2 3   ? -4.580  -18.368 -6.623  1.00 83.72 ? 3   MET B CG    1 
ATOM   3023 S  SD    . MET D 2 3   ? -4.973  -20.076 -7.077  1.00 99.13 ? 3   MET B SD    1 
ATOM   3024 C  CE    . MET D 2 3   ? -4.278  -20.187 -8.728  1.00 93.77 ? 3   MET B CE    1 
ATOM   3025 N  N     . LEU D 2 4   ? -1.646  -16.091 -6.988  1.00 71.51 ? 4   LEU B N     1 
ATOM   3026 C  CA    . LEU D 2 4   ? -1.419  -14.852 -7.730  1.00 68.05 ? 4   LEU B CA    1 
ATOM   3027 C  C     . LEU D 2 4   ? -0.100  -14.905 -8.490  1.00 67.02 ? 4   LEU B C     1 
ATOM   3028 O  O     . LEU D 2 4   ? 0.016   -14.371 -9.595  1.00 67.63 ? 4   LEU B O     1 
ATOM   3029 C  CB    . LEU D 2 4   ? -1.387  -13.656 -6.778  1.00 65.64 ? 4   LEU B CB    1 
ATOM   3030 C  CG    . LEU D 2 4   ? -2.603  -13.389 -5.899  1.00 58.84 ? 4   LEU B CG    1 
ATOM   3031 C  CD1   . LEU D 2 4   ? -2.388  -12.086 -5.152  1.00 64.11 ? 4   LEU B CD1   1 
ATOM   3032 C  CD2   . LEU D 2 4   ? -3.855  -13.308 -6.749  1.00 63.06 ? 4   LEU B CD2   1 
ATOM   3033 N  N     . GLU D 2 5   ? 0.897   -15.537 -7.881  1.00 65.63 ? 5   GLU B N     1 
ATOM   3034 C  CA    . GLU D 2 5   ? 2.210   -15.671 -8.497  1.00 67.34 ? 5   GLU B CA    1 
ATOM   3035 C  C     . GLU D 2 5   ? 2.034   -16.234 -9.902  1.00 64.69 ? 5   GLU B C     1 
ATOM   3036 O  O     . GLU D 2 5   ? 2.758   -15.861 -10.822 1.00 66.60 ? 5   GLU B O     1 
ATOM   3037 C  CB    . GLU D 2 5   ? 3.080   -16.615 -7.670  1.00 73.02 ? 5   GLU B CB    1 
ATOM   3038 C  CG    . GLU D 2 5   ? 3.049   -16.330 -6.179  1.00 88.87 ? 5   GLU B CG    1 
ATOM   3039 C  CD    . GLU D 2 5   ? 3.657   -17.454 -5.357  1.00 95.90 ? 5   GLU B CD    1 
ATOM   3040 O  OE1   . GLU D 2 5   ? 4.879   -17.696 -5.483  1.00 97.60 ? 5   GLU B OE1   1 
ATOM   3041 O  OE2   . GLU D 2 5   ? 2.907   -18.099 -4.590  1.00 97.65 ? 5   GLU B OE2   1 
ATOM   3042 N  N     . GLN D 2 6   ? 1.069   -17.139 -10.056 1.00 63.28 ? 6   GLN B N     1 
ATOM   3043 C  CA    . GLN D 2 6   ? 0.785   -17.751 -11.352 1.00 63.10 ? 6   GLN B CA    1 
ATOM   3044 C  C     . GLN D 2 6   ? 0.380   -16.686 -12.360 1.00 60.04 ? 6   GLN B C     1 
ATOM   3045 O  O     . GLN D 2 6   ? 0.940   -16.606 -13.455 1.00 60.91 ? 6   GLN B O     1 
ATOM   3046 C  CB    . GLN D 2 6   ? -0.353  -18.767 -11.234 1.00 65.67 ? 6   GLN B CB    1 
ATOM   3047 C  CG    . GLN D 2 6   ? 0.006   -20.064 -10.534 1.00 76.38 ? 6   GLN B CG    1 
ATOM   3048 C  CD    . GLN D 2 6   ? -1.168  -21.029 -10.489 1.00 79.71 ? 6   GLN B CD    1 
ATOM   3049 O  OE1   . GLN D 2 6   ? -1.727  -21.395 -11.527 1.00 80.05 ? 6   GLN B OE1   1 
ATOM   3050 N  NE2   . GLN D 2 6   ? -1.549  -21.445 -9.285  1.00 77.31 ? 6   GLN B NE2   1 
ATOM   3051 N  N     . LEU D 2 7   ? -0.609  -15.880 -11.985 1.00 54.83 ? 7   LEU B N     1 
ATOM   3052 C  CA    . LEU D 2 7   ? -1.098  -14.817 -12.851 1.00 54.14 ? 7   LEU B CA    1 
ATOM   3053 C  C     . LEU D 2 7   ? 0.030   -13.838 -13.139 1.00 50.91 ? 7   LEU B C     1 
ATOM   3054 O  O     . LEU D 2 7   ? 0.233   -13.434 -14.286 1.00 51.40 ? 7   LEU B O     1 
ATOM   3055 C  CB    . LEU D 2 7   ? -2.279  -14.094 -12.192 1.00 48.19 ? 7   LEU B CB    1 
ATOM   3056 C  CG    . LEU D 2 7   ? -2.868  -12.889 -12.938 1.00 52.96 ? 7   LEU B CG    1 
ATOM   3057 C  CD1   . LEU D 2 7   ? -3.206  -13.268 -14.381 1.00 35.13 ? 7   LEU B CD1   1 
ATOM   3058 C  CD2   . LEU D 2 7   ? -4.119  -12.398 -12.199 1.00 46.92 ? 7   LEU B CD2   1 
ATOM   3059 N  N     . GLU D 2 8   ? 0.768   -13.465 -12.095 1.00 46.15 ? 8   GLU B N     1 
ATOM   3060 C  CA    . GLU D 2 8   ? 1.885   -12.540 -12.250 1.00 46.14 ? 8   GLU B CA    1 
ATOM   3061 C  C     . GLU D 2 8   ? 2.847   -13.095 -13.289 1.00 49.70 ? 8   GLU B C     1 
ATOM   3062 O  O     . GLU D 2 8   ? 3.448   -12.344 -14.058 1.00 49.80 ? 8   GLU B O     1 
ATOM   3063 C  CB    . GLU D 2 8   ? 2.612   -12.337 -10.917 1.00 45.19 ? 8   GLU B CB    1 
ATOM   3064 C  CG    . GLU D 2 8   ? 1.739   -11.727 -9.837  1.00 53.68 ? 8   GLU B CG    1 
ATOM   3065 C  CD    . GLU D 2 8   ? 2.497   -11.426 -8.557  1.00 54.25 ? 8   GLU B CD    1 
ATOM   3066 O  OE1   . GLU D 2 8   ? 3.138   -12.352 -8.019  1.00 55.05 ? 8   GLU B OE1   1 
ATOM   3067 O  OE2   . GLU D 2 8   ? 2.445   -10.269 -8.083  1.00 52.49 ? 8   GLU B OE2   1 
ATOM   3068 N  N     . LYS D 2 9   ? 2.980   -14.418 -13.316 1.00 46.11 ? 9   LYS B N     1 
ATOM   3069 C  CA    . LYS D 2 9   ? 3.862   -15.073 -14.273 1.00 53.85 ? 9   LYS B CA    1 
ATOM   3070 C  C     . LYS D 2 9   ? 3.299   -14.976 -15.699 1.00 47.80 ? 9   LYS B C     1 
ATOM   3071 O  O     . LYS D 2 9   ? 4.052   -14.774 -16.650 1.00 47.90 ? 9   LYS B O     1 
ATOM   3072 C  CB    . LYS D 2 9   ? 4.072   -16.543 -13.886 1.00 55.37 ? 9   LYS B CB    1 
ATOM   3073 C  CG    . LYS D 2 9   ? 5.140   -17.244 -14.714 1.00 72.98 ? 9   LYS B CG    1 
ATOM   3074 C  CD    . LYS D 2 9   ? 5.346   -18.697 -14.291 1.00 81.32 ? 9   LYS B CD    1 
ATOM   3075 C  CE    . LYS D 2 9   ? 6.395   -19.381 -15.168 1.00 83.42 ? 9   LYS B CE    1 
ATOM   3076 N  NZ    . LYS D 2 9   ? 6.666   -20.786 -14.746 1.00 86.86 ? 9   LYS B NZ    1 
ATOM   3077 N  N     . LYS D 2 10  ? 1.981   -15.117 -15.840 1.00 48.45 ? 10  LYS B N     1 
ATOM   3078 C  CA    . LYS D 2 10  ? 1.326   -15.035 -17.149 1.00 51.03 ? 10  LYS B CA    1 
ATOM   3079 C  C     . LYS D 2 10  ? 1.363   -13.596 -17.655 1.00 55.24 ? 10  LYS B C     1 
ATOM   3080 O  O     . LYS D 2 10  ? 1.479   -13.346 -18.860 1.00 51.32 ? 10  LYS B O     1 
ATOM   3081 C  CB    . LYS D 2 10  ? -0.135  -15.492 -17.059 1.00 51.58 ? 10  LYS B CB    1 
ATOM   3082 C  CG    . LYS D 2 10  ? -0.313  -16.919 -16.593 1.00 57.59 ? 10  LYS B CG    1 
ATOM   3083 C  CD    . LYS D 2 10  ? -1.765  -17.348 -16.651 1.00 60.93 ? 10  LYS B CD    1 
ATOM   3084 C  CE    . LYS D 2 10  ? -1.934  -18.754 -16.097 1.00 67.18 ? 10  LYS B CE    1 
ATOM   3085 N  NZ    . LYS D 2 10  ? -1.063  -19.738 -16.807 1.00 74.98 ? 10  LYS B NZ    1 
ATOM   3086 N  N     . LEU D 2 11  ? 1.254   -12.662 -16.714 1.00 53.79 ? 11  LEU B N     1 
ATOM   3087 C  CA    . LEU D 2 11  ? 1.278   -11.232 -16.998 1.00 55.75 ? 11  LEU B CA    1 
ATOM   3088 C  C     . LEU D 2 11  ? 2.716   -10.796 -17.253 1.00 55.64 ? 11  LEU B C     1 
ATOM   3089 O  O     . LEU D 2 11  ? 2.979   -9.909  -18.062 1.00 57.39 ? 11  LEU B O     1 
ATOM   3090 C  CB    . LEU D 2 11  ? 0.733   -10.469 -15.793 1.00 53.50 ? 11  LEU B CB    1 
ATOM   3091 C  CG    . LEU D 2 11  ? -0.470  -9.548  -15.957 1.00 52.68 ? 11  LEU B CG    1 
ATOM   3092 C  CD1   . LEU D 2 11  ? -1.579  -10.236 -16.728 1.00 54.31 ? 11  LEU B CD1   1 
ATOM   3093 C  CD2   . LEU D 2 11  ? -0.944  -9.146  -14.578 1.00 47.72 ? 11  LEU B CD2   1 
ATOM   3094 N  N     . GLY D 2 12  ? 3.648   -11.432 -16.553 1.00 52.93 ? 12  GLY B N     1 
ATOM   3095 C  CA    . GLY D 2 12  ? 5.044   -11.078 -16.706 1.00 49.51 ? 12  GLY B CA    1 
ATOM   3096 C  C     . GLY D 2 12  ? 5.332   -9.838  -15.887 1.00 45.46 ? 12  GLY B C     1 
ATOM   3097 O  O     . GLY D 2 12  ? 6.141   -8.997  -16.274 1.00 44.90 ? 12  GLY B O     1 
ATOM   3098 N  N     . TYR D 2 13  ? 4.654   -9.723  -14.749 1.00 46.86 ? 13  TYR B N     1 
ATOM   3099 C  CA    . TYR D 2 13  ? 4.832   -8.584  -13.866 1.00 46.55 ? 13  TYR B CA    1 
ATOM   3100 C  C     . TYR D 2 13  ? 4.509   -8.939  -12.429 1.00 49.81 ? 13  TYR B C     1 
ATOM   3101 O  O     . TYR D 2 13  ? 3.439   -9.475  -12.138 1.00 54.57 ? 13  TYR B O     1 
ATOM   3102 C  CB    . TYR D 2 13  ? 3.929   -7.432  -14.290 1.00 46.10 ? 13  TYR B CB    1 
ATOM   3103 C  CG    . TYR D 2 13  ? 4.045   -6.222  -13.392 1.00 40.03 ? 13  TYR B CG    1 
ATOM   3104 C  CD1   . TYR D 2 13  ? 5.139   -5.364  -13.488 1.00 40.63 ? 13  TYR B CD1   1 
ATOM   3105 C  CD2   . TYR D 2 13  ? 3.072   -5.949  -12.433 1.00 39.38 ? 13  TYR B CD2   1 
ATOM   3106 C  CE1   . TYR D 2 13  ? 5.259   -4.262  -12.650 1.00 42.29 ? 13  TYR B CE1   1 
ATOM   3107 C  CE2   . TYR D 2 13  ? 3.182   -4.850  -11.590 1.00 38.72 ? 13  TYR B CE2   1 
ATOM   3108 C  CZ    . TYR D 2 13  ? 4.280   -4.010  -11.704 1.00 39.51 ? 13  TYR B CZ    1 
ATOM   3109 O  OH    . TYR D 2 13  ? 4.398   -2.926  -10.870 1.00 38.46 ? 13  TYR B OH    1 
ATOM   3110 N  N     . THR D 2 14  ? 5.429   -8.617  -11.530 1.00 49.60 ? 14  THR B N     1 
ATOM   3111 C  CA    . THR D 2 14  ? 5.240   -8.891  -10.117 1.00 46.82 ? 14  THR B CA    1 
ATOM   3112 C  C     . THR D 2 14  ? 4.836   -7.601  -9.409  1.00 49.80 ? 14  THR B C     1 
ATOM   3113 O  O     . THR D 2 14  ? 5.540   -6.588  -9.483  1.00 48.53 ? 14  THR B O     1 
ATOM   3114 C  CB    . THR D 2 14  ? 6.535   -9.466  -9.496  1.00 46.04 ? 14  THR B CB    1 
ATOM   3115 O  OG1   . THR D 2 14  ? 6.805   -10.734 -10.093 1.00 45.72 ? 14  THR B OG1   1 
ATOM   3116 C  CG2   . THR D 2 14  ? 6.391   -9.667  -7.997  1.00 40.09 ? 14  THR B CG2   1 
ATOM   3117 N  N     . PHE D 2 15  ? 3.684   -7.641  -8.742  1.00 45.96 ? 15  PHE B N     1 
ATOM   3118 C  CA    . PHE D 2 15  ? 3.189   -6.478  -8.027  1.00 47.78 ? 15  PHE B CA    1 
ATOM   3119 C  C     . PHE D 2 15  ? 4.001   -6.210  -6.778  1.00 49.37 ? 15  PHE B C     1 
ATOM   3120 O  O     . PHE D 2 15  ? 4.497   -7.134  -6.130  1.00 49.14 ? 15  PHE B O     1 
ATOM   3121 C  CB    . PHE D 2 15  ? 1.722   -6.667  -7.624  1.00 43.97 ? 15  PHE B CB    1 
ATOM   3122 C  CG    . PHE D 2 15  ? 0.743   -6.322  -8.706  1.00 48.32 ? 15  PHE B CG    1 
ATOM   3123 C  CD1   . PHE D 2 15  ? 0.621   -7.123  -9.843  1.00 50.55 ? 15  PHE B CD1   1 
ATOM   3124 C  CD2   . PHE D 2 15  ? -0.060  -5.192  -8.594  1.00 43.97 ? 15  PHE B CD2   1 
ATOM   3125 C  CE1   . PHE D 2 15  ? -0.288  -6.801  -10.852 1.00 44.36 ? 15  PHE B CE1   1 
ATOM   3126 C  CE2   . PHE D 2 15  ? -0.974  -4.861  -9.600  1.00 41.95 ? 15  PHE B CE2   1 
ATOM   3127 C  CZ    . PHE D 2 15  ? -1.087  -5.664  -10.727 1.00 38.33 ? 15  PHE B CZ    1 
ATOM   3128 N  N     . LYS D 2 16  ? 4.137   -4.934  -6.447  1.00 51.59 ? 16  LYS B N     1 
ATOM   3129 C  CA    . LYS D 2 16  ? 4.847   -4.532  -5.246  1.00 53.79 ? 16  LYS B CA    1 
ATOM   3130 C  C     . LYS D 2 16  ? 3.779   -4.616  -4.166  1.00 55.95 ? 16  LYS B C     1 
ATOM   3131 O  O     . LYS D 2 16  ? 4.039   -5.037  -3.043  1.00 59.82 ? 16  LYS B O     1 
ATOM   3132 C  CB    . LYS D 2 16  ? 5.361   -3.096  -5.390  1.00 55.71 ? 16  LYS B CB    1 
ATOM   3133 C  CG    . LYS D 2 16  ? 6.293   -2.908  -6.583  1.00 69.90 ? 16  LYS B CG    1 
ATOM   3134 C  CD    . LYS D 2 16  ? 6.715   -1.457  -6.764  1.00 82.39 ? 16  LYS B CD    1 
ATOM   3135 C  CE    . LYS D 2 16  ? 7.653   -0.992  -5.657  1.00 93.16 ? 16  LYS B CE    1 
ATOM   3136 N  NZ    . LYS D 2 16  ? 8.968   -1.703  -5.691  1.00 99.16 ? 16  LYS B NZ    1 
ATOM   3137 N  N     . ASP D 2 17  ? 2.562   -4.230  -4.541  1.00 54.73 ? 17  ASP B N     1 
ATOM   3138 C  CA    . ASP D 2 17  ? 1.406   -4.246  -3.647  1.00 52.93 ? 17  ASP B CA    1 
ATOM   3139 C  C     . ASP D 2 17  ? 0.403   -5.310  -4.115  1.00 55.93 ? 17  ASP B C     1 
ATOM   3140 O  O     . ASP D 2 17  ? -0.438  -5.039  -4.974  1.00 57.74 ? 17  ASP B O     1 
ATOM   3141 C  CB    . ASP D 2 17  ? 0.734   -2.874  -3.654  1.00 48.37 ? 17  ASP B CB    1 
ATOM   3142 C  CG    . ASP D 2 17  ? -0.423  -2.792  -2.695  1.00 48.81 ? 17  ASP B CG    1 
ATOM   3143 O  OD1   . ASP D 2 17  ? -1.031  -3.842  -2.400  1.00 60.70 ? 17  ASP B OD1   1 
ATOM   3144 O  OD2   . ASP D 2 17  ? -0.737  -1.677  -2.242  1.00 56.38 ? 17  ASP B OD2   1 
ATOM   3145 N  N     . LYS D 2 18  ? 0.487   -6.508  -3.539  1.00 50.78 ? 18  LYS B N     1 
ATOM   3146 C  CA    . LYS D 2 18  ? -0.389  -7.617  -3.908  1.00 48.42 ? 18  LYS B CA    1 
ATOM   3147 C  C     . LYS D 2 18  ? -1.868  -7.337  -3.645  1.00 51.38 ? 18  LYS B C     1 
ATOM   3148 O  O     . LYS D 2 18  ? -2.737  -7.960  -4.259  1.00 51.76 ? 18  LYS B O     1 
ATOM   3149 C  CB    . LYS D 2 18  ? 0.013   -8.889  -3.156  1.00 49.12 ? 18  LYS B CB    1 
ATOM   3150 C  CG    . LYS D 2 18  ? 1.507   -9.168  -3.105  1.00 56.52 ? 18  LYS B CG    1 
ATOM   3151 C  CD    . LYS D 2 18  ? 2.118   -9.345  -4.484  1.00 57.22 ? 18  LYS B CD    1 
ATOM   3152 C  CE    . LYS D 2 18  ? 3.602   -9.666  -4.380  1.00 54.98 ? 18  LYS B CE    1 
ATOM   3153 N  NZ    . LYS D 2 18  ? 4.223   -9.798  -5.721  1.00 52.58 ? 18  LYS B NZ    1 
ATOM   3154 N  N     . SER D 2 19  ? -2.159  -6.415  -2.730  1.00 49.48 ? 19  SER B N     1 
ATOM   3155 C  CA    . SER D 2 19  ? -3.551  -6.086  -2.423  1.00 51.00 ? 19  SER B CA    1 
ATOM   3156 C  C     . SER D 2 19  ? -4.158  -5.345  -3.612  1.00 49.85 ? 19  SER B C     1 
ATOM   3157 O  O     . SER D 2 19  ? -5.362  -5.414  -3.862  1.00 46.97 ? 19  SER B O     1 
ATOM   3158 C  CB    . SER D 2 19  ? -3.643  -5.203  -1.177  1.00 45.55 ? 19  SER B CB    1 
ATOM   3159 O  OG    . SER D 2 19  ? -3.240  -3.881  -1.474  1.00 51.72 ? 19  SER B OG    1 
ATOM   3160 N  N     . LEU D 2 20  ? -3.311  -4.628  -4.339  1.00 45.33 ? 20  LEU B N     1 
ATOM   3161 C  CA    . LEU D 2 20  ? -3.764  -3.887  -5.506  1.00 45.12 ? 20  LEU B CA    1 
ATOM   3162 C  C     . LEU D 2 20  ? -4.169  -4.877  -6.595  1.00 44.40 ? 20  LEU B C     1 
ATOM   3163 O  O     . LEU D 2 20  ? -5.148  -4.666  -7.302  1.00 48.45 ? 20  LEU B O     1 
ATOM   3164 C  CB    . LEU D 2 20  ? -2.645  -2.977  -6.009  1.00 48.45 ? 20  LEU B CB    1 
ATOM   3165 C  CG    . LEU D 2 20  ? -2.983  -2.004  -7.136  1.00 48.28 ? 20  LEU B CG    1 
ATOM   3166 C  CD1   . LEU D 2 20  ? -4.142  -1.103  -6.730  1.00 47.80 ? 20  LEU B CD1   1 
ATOM   3167 C  CD2   . LEU D 2 20  ? -1.743  -1.177  -7.457  1.00 54.56 ? 20  LEU B CD2   1 
ATOM   3168 N  N     . LEU D 2 21  ? -3.411  -5.961  -6.720  1.00 45.38 ? 21  LEU B N     1 
ATOM   3169 C  CA    . LEU D 2 21  ? -3.696  -6.992  -7.713  1.00 42.55 ? 21  LEU B CA    1 
ATOM   3170 C  C     . LEU D 2 21  ? -4.987  -7.752  -7.403  1.00 42.33 ? 21  LEU B C     1 
ATOM   3171 O  O     . LEU D 2 21  ? -5.779  -8.059  -8.304  1.00 40.76 ? 21  LEU B O     1 
ATOM   3172 C  CB    . LEU D 2 21  ? -2.524  -7.972  -7.791  1.00 45.29 ? 21  LEU B CB    1 
ATOM   3173 C  CG    . LEU D 2 21  ? -2.717  -9.280  -8.573  1.00 43.68 ? 21  LEU B CG    1 
ATOM   3174 C  CD1   . LEU D 2 21  ? -3.205  -9.009  -9.995  1.00 41.58 ? 21  LEU B CD1   1 
ATOM   3175 C  CD2   . LEU D 2 21  ? -1.397  -10.026 -8.596  1.00 44.62 ? 21  LEU B CD2   1 
ATOM   3176 N  N     . GLU D 2 22  ? -5.213  -8.053  -6.130  1.00 45.07 ? 22  GLU B N     1 
ATOM   3177 C  CA    . GLU D 2 22  ? -6.417  -8.784  -5.764  1.00 48.26 ? 22  GLU B CA    1 
ATOM   3178 C  C     . GLU D 2 22  ? -7.646  -7.894  -5.789  1.00 47.99 ? 22  GLU B C     1 
ATOM   3179 O  O     . GLU D 2 22  ? -8.767  -8.375  -5.958  1.00 45.89 ? 22  GLU B O     1 
ATOM   3180 C  CB    . GLU D 2 22  ? -6.248  -9.458  -4.396  1.00 54.80 ? 22  GLU B CB    1 
ATOM   3181 C  CG    . GLU D 2 22  ? -5.813  -8.560  -3.263  1.00 59.57 ? 22  GLU B CG    1 
ATOM   3182 C  CD    . GLU D 2 22  ? -5.336  -9.362  -2.057  1.00 69.69 ? 22  GLU B CD    1 
ATOM   3183 O  OE1   . GLU D 2 22  ? -5.102  -10.582 -2.211  1.00 67.47 ? 22  GLU B OE1   1 
ATOM   3184 O  OE2   . GLU D 2 22  ? -5.188  -8.778  -0.960  1.00 70.96 ? 22  GLU B OE2   1 
ATOM   3185 N  N     . LYS D 2 23  ? -7.442  -6.592  -5.632  1.00 40.79 ? 23  LYS B N     1 
ATOM   3186 C  CA    . LYS D 2 23  ? -8.561  -5.671  -5.674  1.00 39.12 ? 23  LYS B CA    1 
ATOM   3187 C  C     . LYS D 2 23  ? -9.090  -5.743  -7.107  1.00 37.95 ? 23  LYS B C     1 
ATOM   3188 O  O     . LYS D 2 23  ? -10.295 -5.846  -7.338  1.00 42.18 ? 23  LYS B O     1 
ATOM   3189 C  CB    . LYS D 2 23  ? -8.095  -4.248  -5.355  1.00 43.29 ? 23  LYS B CB    1 
ATOM   3190 C  CG    . LYS D 2 23  ? -9.224  -3.247  -5.161  1.00 42.68 ? 23  LYS B CG    1 
ATOM   3191 C  CD    . LYS D 2 23  ? -8.663  -1.846  -4.944  1.00 51.86 ? 23  LYS B CD    1 
ATOM   3192 C  CE    . LYS D 2 23  ? -9.761  -0.849  -4.657  1.00 53.04 ? 23  LYS B CE    1 
ATOM   3193 N  NZ    . LYS D 2 23  ? -9.208  0.512   -4.452  1.00 65.18 ? 23  LYS B NZ    1 
ATOM   3194 N  N     . ALA D 2 24  ? -8.170  -5.707  -8.065  1.00 34.82 ? 24  ALA B N     1 
ATOM   3195 C  CA    . ALA D 2 24  ? -8.525  -5.769  -9.477  1.00 35.25 ? 24  ALA B CA    1 
ATOM   3196 C  C     . ALA D 2 24  ? -9.298  -7.041  -9.780  1.00 41.50 ? 24  ALA B C     1 
ATOM   3197 O  O     . ALA D 2 24  ? -10.178 -7.051  -10.654 1.00 37.75 ? 24  ALA B O     1 
ATOM   3198 C  CB    . ALA D 2 24  ? -7.269  -5.719  -10.331 1.00 31.02 ? 24  ALA B CB    1 
ATOM   3199 N  N     . LEU D 2 25  ? -8.967  -8.106  -9.047  1.00 37.28 ? 25  LEU B N     1 
ATOM   3200 C  CA    . LEU D 2 25  ? -9.598  -9.413  -9.221  1.00 38.04 ? 25  LEU B CA    1 
ATOM   3201 C  C     . LEU D 2 25  ? -10.872 -9.619  -8.403  1.00 40.65 ? 25  LEU B C     1 
ATOM   3202 O  O     . LEU D 2 25  ? -11.580 -10.616 -8.594  1.00 43.57 ? 25  LEU B O     1 
ATOM   3203 C  CB    . LEU D 2 25  ? -8.607  -10.514 -8.847  1.00 36.84 ? 25  LEU B CB    1 
ATOM   3204 C  CG    . LEU D 2 25  ? -7.357  -10.647 -9.713  1.00 38.83 ? 25  LEU B CG    1 
ATOM   3205 C  CD1   . LEU D 2 25  ? -6.347  -11.553 -9.018  1.00 40.88 ? 25  LEU B CD1   1 
ATOM   3206 C  CD2   . LEU D 2 25  ? -7.742  -11.205 -11.073 1.00 44.98 ? 25  LEU B CD2   1 
ATOM   3207 N  N     . THR D 2 26  ? -11.170 -8.679  -7.512  1.00 31.89 ? 26  THR B N     1 
ATOM   3208 C  CA    . THR D 2 26  ? -12.318 -8.796  -6.624  1.00 38.49 ? 26  THR B CA    1 
ATOM   3209 C  C     . THR D 2 26  ? -13.597 -8.053  -6.991  1.00 42.03 ? 26  THR B C     1 
ATOM   3210 O  O     . THR D 2 26  ? -13.625 -6.823  -7.060  1.00 40.73 ? 26  THR B O     1 
ATOM   3211 C  CB    . THR D 2 26  ? -11.921 -8.377  -5.195  1.00 34.05 ? 26  THR B CB    1 
ATOM   3212 O  OG1   . THR D 2 26  ? -10.793 -9.152  -4.775  1.00 37.58 ? 26  THR B OG1   1 
ATOM   3213 C  CG2   . THR D 2 26  ? -13.077 -8.589  -4.225  1.00 33.68 ? 26  THR B CG2   1 
ATOM   3214 N  N     . HIS D 2 27  ? -14.661 -8.827  -7.189  1.00 39.75 ? 27  HIS B N     1 
ATOM   3215 C  CA    . HIS D 2 27  ? -15.973 -8.296  -7.525  1.00 33.98 ? 27  HIS B CA    1 
ATOM   3216 C  C     . HIS D 2 27  ? -16.650 -7.788  -6.255  1.00 42.15 ? 27  HIS B C     1 
ATOM   3217 O  O     . HIS D 2 27  ? -16.358 -8.263  -5.152  1.00 42.25 ? 27  HIS B O     1 
ATOM   3218 C  CB    . HIS D 2 27  ? -16.813 -9.389  -8.185  1.00 36.68 ? 27  HIS B CB    1 
ATOM   3219 C  CG    . HIS D 2 27  ? -18.201 -8.960  -8.556  1.00 50.30 ? 27  HIS B CG    1 
ATOM   3220 N  ND1   . HIS D 2 27  ? -19.286 -9.143  -7.723  1.00 49.67 ? 27  HIS B ND1   1 
ATOM   3221 C  CD2   . HIS D 2 27  ? -18.681 -8.361  -9.673  1.00 43.63 ? 27  HIS B CD2   1 
ATOM   3222 C  CE1   . HIS D 2 27  ? -20.374 -8.678  -8.312  1.00 55.26 ? 27  HIS B CE1   1 
ATOM   3223 N  NE2   . HIS D 2 27  ? -20.034 -8.197  -9.496  1.00 51.32 ? 27  HIS B NE2   1 
ATOM   3224 N  N     . VAL D 2 28  ? -17.552 -6.821  -6.415  1.00 47.58 ? 28  VAL B N     1 
ATOM   3225 C  CA    . VAL D 2 28  ? -18.262 -6.228  -5.283  1.00 48.43 ? 28  VAL B CA    1 
ATOM   3226 C  C     . VAL D 2 28  ? -19.000 -7.235  -4.394  1.00 49.48 ? 28  VAL B C     1 
ATOM   3227 O  O     . VAL D 2 28  ? -19.172 -6.998  -3.199  1.00 51.73 ? 28  VAL B O     1 
ATOM   3228 C  CB    . VAL D 2 28  ? -19.273 -5.169  -5.759  1.00 47.10 ? 28  VAL B CB    1 
ATOM   3229 C  CG1   . VAL D 2 28  ? -20.411 -5.837  -6.522  1.00 43.83 ? 28  VAL B CG1   1 
ATOM   3230 C  CG2   . VAL D 2 28  ? -19.797 -4.387  -4.572  1.00 44.74 ? 28  VAL B CG2   1 
ATOM   3231 N  N     . SER D 2 29  ? -19.430 -8.354  -4.972  1.00 47.21 ? 29  SER B N     1 
ATOM   3232 C  CA    . SER D 2 29  ? -20.147 -9.375  -4.213  1.00 48.56 ? 29  SER B CA    1 
ATOM   3233 C  C     . SER D 2 29  ? -19.255 -10.051 -3.168  1.00 51.73 ? 29  SER B C     1 
ATOM   3234 O  O     . SER D 2 29  ? -19.738 -10.503 -2.132  1.00 50.64 ? 29  SER B O     1 
ATOM   3235 C  CB    . SER D 2 29  ? -20.704 -10.445 -5.154  1.00 48.42 ? 29  SER B CB    1 
ATOM   3236 O  OG    . SER D 2 29  ? -19.654 -11.228 -5.703  1.00 47.77 ? 29  SER B OG    1 
ATOM   3237 N  N     . TYR D 2 30  ? -17.955 -10.113 -3.446  1.00 49.49 ? 30  TYR B N     1 
ATOM   3238 C  CA    . TYR D 2 30  ? -17.002 -10.738 -2.540  1.00 45.73 ? 30  TYR B CA    1 
ATOM   3239 C  C     . TYR D 2 30  ? -16.470 -9.750  -1.515  1.00 50.89 ? 30  TYR B C     1 
ATOM   3240 O  O     . TYR D 2 30  ? -16.179 -10.120 -0.375  1.00 52.99 ? 30  TYR B O     1 
ATOM   3241 C  CB    . TYR D 2 30  ? -15.854 -11.333 -3.345  1.00 48.33 ? 30  TYR B CB    1 
ATOM   3242 C  CG    . TYR D 2 30  ? -14.824 -12.075 -2.533  1.00 53.37 ? 30  TYR B CG    1 
ATOM   3243 C  CD1   . TYR D 2 30  ? -13.787 -11.395 -1.902  1.00 56.47 ? 30  TYR B CD1   1 
ATOM   3244 C  CD2   . TYR D 2 30  ? -14.870 -13.464 -2.416  1.00 52.16 ? 30  TYR B CD2   1 
ATOM   3245 C  CE1   . TYR D 2 30  ? -12.817 -12.074 -1.179  1.00 59.98 ? 30  TYR B CE1   1 
ATOM   3246 C  CE2   . TYR D 2 30  ? -13.905 -14.155 -1.693  1.00 59.52 ? 30  TYR B CE2   1 
ATOM   3247 C  CZ    . TYR D 2 30  ? -12.879 -13.452 -1.079  1.00 59.80 ? 30  TYR B CZ    1 
ATOM   3248 O  OH    . TYR D 2 30  ? -11.902 -14.121 -0.380  1.00 64.23 ? 30  TYR B OH    1 
ATOM   3249 N  N     . SER D 2 31  ? -16.341 -8.494  -1.922  1.00 46.60 ? 31  SER B N     1 
ATOM   3250 C  CA    . SER D 2 31  ? -15.856 -7.448  -1.028  1.00 48.49 ? 31  SER B CA    1 
ATOM   3251 C  C     . SER D 2 31  ? -16.457 -6.122  -1.450  1.00 53.51 ? 31  SER B C     1 
ATOM   3252 O  O     . SER D 2 31  ? -16.102 -5.566  -2.490  1.00 51.77 ? 31  SER B O     1 
ATOM   3253 C  CB    . SER D 2 31  ? -14.331 -7.358  -1.074  1.00 50.25 ? 31  SER B CB    1 
ATOM   3254 O  OG    . SER D 2 31  ? -13.870 -6.240  -0.335  1.00 52.32 ? 31  SER B OG    1 
ATOM   3255 N  N     . LYS D 2 32  ? -17.375 -5.622  -0.636  1.00 57.28 ? 32  LYS B N     1 
ATOM   3256 C  CA    . LYS D 2 32  ? -18.049 -4.368  -0.921  1.00 62.92 ? 32  LYS B CA    1 
ATOM   3257 C  C     . LYS D 2 32  ? -17.175 -3.155  -0.638  1.00 62.29 ? 32  LYS B C     1 
ATOM   3258 O  O     . LYS D 2 32  ? -17.520 -2.042  -1.021  1.00 65.79 ? 32  LYS B O     1 
ATOM   3259 C  CB    . LYS D 2 32  ? -19.349 -4.287  -0.113  1.00 64.85 ? 32  LYS B CB    1 
ATOM   3260 C  CG    . LYS D 2 32  ? -19.173 -4.547  1.372   1.00 77.32 ? 32  LYS B CG    1 
ATOM   3261 C  CD    . LYS D 2 32  ? -20.509 -4.834  2.051   1.00 84.46 ? 32  LYS B CD    1 
ATOM   3262 C  CE    . LYS D 2 32  ? -20.316 -5.252  3.505   1.00 89.65 ? 32  LYS B CE    1 
ATOM   3263 N  NZ    . LYS D 2 32  ? -21.601 -5.625  4.160   1.00 87.09 ? 32  LYS B NZ    1 
ATOM   3264 N  N     . LYS D 2 33  ? -16.041 -3.365  0.020   1.00 59.40 ? 33  LYS B N     1 
ATOM   3265 C  CA    . LYS D 2 33  ? -15.160 -2.251  0.332   1.00 62.34 ? 33  LYS B CA    1 
ATOM   3266 C  C     . LYS D 2 33  ? -13.919 -2.182  -0.543  1.00 57.81 ? 33  LYS B C     1 
ATOM   3267 O  O     . LYS D 2 33  ? -13.374 -1.106  -0.759  1.00 56.23 ? 33  LYS B O     1 
ATOM   3268 C  CB    . LYS D 2 33  ? -14.758 -2.290  1.812   1.00 69.81 ? 33  LYS B CB    1 
ATOM   3269 C  CG    . LYS D 2 33  ? -15.940 -2.102  2.748   1.00 78.74 ? 33  LYS B CG    1 
ATOM   3270 C  CD    . LYS D 2 33  ? -15.518 -1.894  4.187   1.00 81.51 ? 33  LYS B CD    1 
ATOM   3271 C  CE    . LYS D 2 33  ? -16.735 -1.588  5.048   1.00 88.16 ? 33  LYS B CE    1 
ATOM   3272 N  NZ    . LYS D 2 33  ? -16.366 -1.279  6.455   1.00 96.59 ? 33  LYS B NZ    1 
ATOM   3273 N  N     . GLU D 2 34  ? -13.477 -3.325  -1.051  1.00 57.02 ? 34  GLU B N     1 
ATOM   3274 C  CA    . GLU D 2 34  ? -12.290 -3.369  -1.898  1.00 51.12 ? 34  GLU B CA    1 
ATOM   3275 C  C     . GLU D 2 34  ? -12.526 -4.150  -3.184  1.00 50.45 ? 34  GLU B C     1 
ATOM   3276 O  O     . GLU D 2 34  ? -12.111 -5.306  -3.296  1.00 47.05 ? 34  GLU B O     1 
ATOM   3277 C  CB    . GLU D 2 34  ? -11.120 -4.010  -1.146  1.00 55.58 ? 34  GLU B CB    1 
ATOM   3278 C  CG    . GLU D 2 34  ? -10.653 -3.250  0.081   1.00 66.08 ? 34  GLU B CG    1 
ATOM   3279 C  CD    . GLU D 2 34  ? -10.221 -1.833  -0.242  1.00 72.78 ? 34  GLU B CD    1 
ATOM   3280 O  OE1   . GLU D 2 34  ? -9.408  -1.653  -1.173  1.00 74.03 ? 34  GLU B OE1   1 
ATOM   3281 O  OE2   . GLU D 2 34  ? -10.688 -0.899  0.441   1.00 75.03 ? 34  GLU B OE2   1 
ATOM   3282 N  N     . HIS D 2 35  ? -13.193 -3.532  -4.152  1.00 42.09 ? 35  HIS B N     1 
ATOM   3283 C  CA    . HIS D 2 35  ? -13.438 -4.213  -5.416  1.00 42.75 ? 35  HIS B CA    1 
ATOM   3284 C  C     . HIS D 2 35  ? -12.951 -3.408  -6.607  1.00 45.83 ? 35  HIS B C     1 
ATOM   3285 O  O     . HIS D 2 35  ? -12.615 -2.222  -6.496  1.00 37.45 ? 35  HIS B O     1 
ATOM   3286 C  CB    . HIS D 2 35  ? -14.888 -4.614  -5.561  1.00 47.49 ? 35  HIS B CB    1 
ATOM   3287 C  CG    . HIS D 2 35  ? -15.853 -3.422  -5.447  1.00 48.98 ? 35  HIS B CG    1 
ATOM   3288 N  ND1   . HIS D 2 35  ? -16.385 -2.785  -6.548  1.00 41.55 ? 35  HIS B ND1   1 
ATOM   3289 C  CD2   . HIS D 2 35  ? -16.359 -2.789  -4.362  1.00 39.88 ? 35  HIS B CD2   1 
ATOM   3290 C  CE1   . HIS D 2 35  ? -17.181 -1.812  -6.145  1.00 41.56 ? 35  HIS B CE1   1 
ATOM   3291 N  NE2   . HIS D 2 35  ? -17.182 -1.794  -4.824  1.00 42.86 ? 35  HIS B NE2   1 
ATOM   3292 N  N     . TYR D 2 36  ? -12.936 -4.068  -7.757  1.00 45.30 ? 36  TYR B N     1 
ATOM   3293 C  CA    . TYR D 2 36  ? -12.349 -3.479  -8.981  1.00 43.60 ? 36  TYR B CA    1 
ATOM   3294 C  C     . TYR D 2 36  ? -13.114 -2.354  -9.719  1.00 38.01 ? 36  TYR B C     1 
ATOM   3295 O  O     . TYR D 2 36  ? -12.594 -1.785  -10.684 1.00 39.14 ? 36  TYR B O     1 
ATOM   3296 C  CB    . TYR D 2 36  ? -12.094 -4.614  -9.971  1.00 42.75 ? 36  TYR B CB    1 
ATOM   3297 C  CG    . TYR D 2 36  ? -13.323 -5.345  -10.493 1.00 41.59 ? 36  TYR B CG    1 
ATOM   3298 C  CD1   . TYR D 2 36  ? -14.298 -4.674  -11.236 1.00 40.50 ? 36  TYR B CD1   1 
ATOM   3299 C  CD2   . TYR D 2 36  ? -13.479 -6.727  -10.297 1.00 47.72 ? 36  TYR B CD2   1 
ATOM   3300 C  CE1   . TYR D 2 36  ? -15.388 -5.353  -11.776 1.00 43.73 ? 36  TYR B CE1   1 
ATOM   3301 C  CE2   . TYR D 2 36  ? -14.573 -7.417  -10.836 1.00 39.77 ? 36  TYR B CE2   1 
ATOM   3302 C  CZ    . TYR D 2 36  ? -15.516 -6.722  -11.572 1.00 42.73 ? 36  TYR B CZ    1 
ATOM   3303 O  OH    . TYR D 2 36  ? -16.582 -7.383  -12.119 1.00 50.79 ? 36  TYR B OH    1 
ATOM   3304 N  N     . GLU D 2 37  ? -14.326 -2.013  -9.309  1.00 40.69 ? 37  GLU B N     1 
ATOM   3305 C  CA    . GLU D 2 37  ? -15.087 -0.995  -10.026 1.00 43.81 ? 37  GLU B CA    1 
ATOM   3306 C  C     . GLU D 2 37  ? -14.332 0.268   -10.454 1.00 41.64 ? 37  GLU B C     1 
ATOM   3307 O  O     . GLU D 2 37  ? -14.333 0.620   -11.632 1.00 42.18 ? 37  GLU B O     1 
ATOM   3308 C  CB    . GLU D 2 37  ? -16.297 -0.570  -9.198  1.00 47.32 ? 37  GLU B CB    1 
ATOM   3309 C  CG    . GLU D 2 37  ? -17.253 0.339   -9.985  1.00 54.31 ? 37  GLU B CG    1 
ATOM   3310 C  CD    . GLU D 2 37  ? -18.503 0.663   -9.204  1.00 63.94 ? 37  GLU B CD    1 
ATOM   3311 O  OE1   . GLU D 2 37  ? -19.251 -0.283  -8.874  1.00 68.41 ? 37  GLU B OE1   1 
ATOM   3312 O  OE2   . GLU D 2 37  ? -18.739 1.856   -8.916  1.00 65.35 ? 37  GLU B OE2   1 
ATOM   3313 N  N     . THR D 2 38  ? -13.693 0.951   -9.513  1.00 41.55 ? 38  THR B N     1 
ATOM   3314 C  CA    . THR D 2 38  ? -12.970 2.169   -9.855  1.00 43.99 ? 38  THR B CA    1 
ATOM   3315 C  C     . THR D 2 38  ? -11.750 1.919   -10.737 1.00 43.07 ? 38  THR B C     1 
ATOM   3316 O  O     . THR D 2 38  ? -11.398 2.755   -11.574 1.00 41.95 ? 38  THR B O     1 
ATOM   3317 C  CB    . THR D 2 38  ? -12.512 2.911   -8.606  1.00 42.94 ? 38  THR B CB    1 
ATOM   3318 O  OG1   . THR D 2 38  ? -13.637 3.137   -7.749  1.00 47.52 ? 38  THR B OG1   1 
ATOM   3319 C  CG2   . THR D 2 38  ? -11.890 4.250   -8.996  1.00 47.15 ? 38  THR B CG2   1 
ATOM   3320 N  N     . LEU D 2 39  ? -11.096 0.779   -10.539 1.00 40.85 ? 39  LEU B N     1 
ATOM   3321 C  CA    . LEU D 2 39  ? -9.929  0.431   -11.339 1.00 38.82 ? 39  LEU B CA    1 
ATOM   3322 C  C     . LEU D 2 39  ? -10.401 0.163   -12.768 1.00 39.67 ? 39  LEU B C     1 
ATOM   3323 O  O     . LEU D 2 39  ? -9.712  0.478   -13.738 1.00 40.64 ? 39  LEU B O     1 
ATOM   3324 C  CB    . LEU D 2 39  ? -9.232  -0.809  -10.758 1.00 43.01 ? 39  LEU B CB    1 
ATOM   3325 C  CG    . LEU D 2 39  ? -8.540  -0.692  -9.386  1.00 42.41 ? 39  LEU B CG    1 
ATOM   3326 C  CD1   . LEU D 2 39  ? -8.142  -2.074  -8.874  1.00 37.27 ? 39  LEU B CD1   1 
ATOM   3327 C  CD2   . LEU D 2 39  ? -7.322  0.193   -9.509  1.00 37.27 ? 39  LEU B CD2   1 
ATOM   3328 N  N     . GLU D 2 40  ? -11.595 -0.401  -12.891 1.00 38.81 ? 40  GLU B N     1 
ATOM   3329 C  CA    . GLU D 2 40  ? -12.168 -0.694  -14.196 1.00 40.81 ? 40  GLU B CA    1 
ATOM   3330 C  C     . GLU D 2 40  ? -12.360 0.616   -14.965 1.00 34.16 ? 40  GLU B C     1 
ATOM   3331 O  O     . GLU D 2 40  ? -12.068 0.697   -16.152 1.00 35.30 ? 40  GLU B O     1 
ATOM   3332 C  CB    . GLU D 2 40  ? -13.511 -1.402  -14.037 1.00 46.05 ? 40  GLU B CB    1 
ATOM   3333 C  CG    . GLU D 2 40  ? -14.023 -2.023  -15.320 1.00 48.64 ? 40  GLU B CG    1 
ATOM   3334 C  CD    . GLU D 2 40  ? -15.476 -1.691  -15.596 1.00 61.75 ? 40  GLU B CD    1 
ATOM   3335 O  OE1   . GLU D 2 40  ? -16.309 -1.828  -14.669 1.00 64.40 ? 40  GLU B OE1   1 
ATOM   3336 O  OE2   . GLU D 2 40  ? -15.784 -1.304  -16.747 1.00 65.46 ? 40  GLU B OE2   1 
ATOM   3337 N  N     . PHE D 2 41  ? -12.881 1.628   -14.281 1.00 33.56 ? 41  PHE B N     1 
ATOM   3338 C  CA    . PHE D 2 41  ? -13.080 2.944   -14.889 1.00 34.76 ? 41  PHE B CA    1 
ATOM   3339 C  C     . PHE D 2 41  ? -11.736 3.413   -15.473 1.00 32.31 ? 41  PHE B C     1 
ATOM   3340 O  O     . PHE D 2 41  ? -11.667 3.842   -16.619 1.00 33.03 ? 41  PHE B O     1 
ATOM   3341 C  CB    . PHE D 2 41  ? -13.566 3.934   -13.824 1.00 36.60 ? 41  PHE B CB    1 
ATOM   3342 C  CG    . PHE D 2 41  ? -13.930 5.291   -14.365 1.00 35.87 ? 41  PHE B CG    1 
ATOM   3343 C  CD1   . PHE D 2 41  ? -15.041 5.454   -15.190 1.00 38.66 ? 41  PHE B CD1   1 
ATOM   3344 C  CD2   . PHE D 2 41  ? -13.172 6.410   -14.039 1.00 44.65 ? 41  PHE B CD2   1 
ATOM   3345 C  CE1   . PHE D 2 41  ? -15.394 6.715   -15.682 1.00 43.35 ? 41  PHE B CE1   1 
ATOM   3346 C  CE2   . PHE D 2 41  ? -13.516 7.687   -14.530 1.00 46.60 ? 41  PHE B CE2   1 
ATOM   3347 C  CZ    . PHE D 2 41  ? -14.629 7.836   -15.353 1.00 38.77 ? 41  PHE B CZ    1 
ATOM   3348 N  N     . LEU D 2 42  ? -10.664 3.316   -14.688 1.00 26.83 ? 42  LEU B N     1 
ATOM   3349 C  CA    . LEU D 2 42  ? -9.338  3.726   -15.164 1.00 29.96 ? 42  LEU B CA    1 
ATOM   3350 C  C     . LEU D 2 42  ? -8.770  2.827   -16.269 1.00 32.17 ? 42  LEU B C     1 
ATOM   3351 O  O     . LEU D 2 42  ? -8.242  3.318   -17.261 1.00 29.67 ? 42  LEU B O     1 
ATOM   3352 C  CB    . LEU D 2 42  ? -8.348  3.786   -13.994 1.00 30.78 ? 42  LEU B CB    1 
ATOM   3353 C  CG    . LEU D 2 42  ? -6.863  4.050   -14.305 1.00 29.82 ? 42  LEU B CG    1 
ATOM   3354 C  CD1   . LEU D 2 42  ? -6.694  5.302   -15.154 1.00 31.61 ? 42  LEU B CD1   1 
ATOM   3355 C  CD2   . LEU D 2 42  ? -6.099  4.215   -12.991 1.00 29.13 ? 42  LEU B CD2   1 
ATOM   3356 N  N     . GLY D 2 43  ? -8.877  1.510   -16.099 1.00 34.65 ? 43  GLY B N     1 
ATOM   3357 C  CA    . GLY D 2 43  ? -8.347  0.599   -17.099 1.00 26.67 ? 43  GLY B CA    1 
ATOM   3358 C  C     . GLY D 2 43  ? -8.984  0.774   -18.463 1.00 29.15 ? 43  GLY B C     1 
ATOM   3359 O  O     . GLY D 2 43  ? -8.328  0.625   -19.488 1.00 29.10 ? 43  GLY B O     1 
ATOM   3360 N  N     . ASN D 2 44  ? -10.275 1.080   -18.477 1.00 33.64 ? 44  ASN B N     1 
ATOM   3361 C  CA    . ASN D 2 44  ? -10.986 1.295   -19.728 1.00 38.75 ? 44  ASN B CA    1 
ATOM   3362 C  C     . ASN D 2 44  ? -10.319 2.436   -20.515 1.00 38.37 ? 44  ASN B C     1 
ATOM   3363 O  O     . ASN D 2 44  ? -10.046 2.307   -21.718 1.00 33.06 ? 44  ASN B O     1 
ATOM   3364 C  CB    . ASN D 2 44  ? -12.460 1.628   -19.439 1.00 43.64 ? 44  ASN B CB    1 
ATOM   3365 C  CG    . ASN D 2 44  ? -13.306 1.730   -20.705 1.00 48.46 ? 44  ASN B CG    1 
ATOM   3366 O  OD1   . ASN D 2 44  ? -14.530 1.663   -20.648 1.00 55.02 ? 44  ASN B OD1   1 
ATOM   3367 N  ND2   . ASN D 2 44  ? -12.656 1.905   -21.848 1.00 57.83 ? 44  ASN B ND2   1 
ATOM   3368 N  N     . ALA D 2 45  ? -10.047 3.547   -19.832 1.00 32.18 ? 45  ALA B N     1 
ATOM   3369 C  CA    . ALA D 2 45  ? -9.409  4.682   -20.484 1.00 32.07 ? 45  ALA B CA    1 
ATOM   3370 C  C     . ALA D 2 45  ? -8.020  4.254   -20.944 1.00 30.03 ? 45  ALA B C     1 
ATOM   3371 O  O     . ALA D 2 45  ? -7.632  4.441   -22.099 1.00 33.85 ? 45  ALA B O     1 
ATOM   3372 C  CB    . ALA D 2 45  ? -9.303  5.868   -19.508 1.00 29.11 ? 45  ALA B CB    1 
ATOM   3373 N  N     . LEU D 2 46  ? -7.281  3.652   -20.025 1.00 31.91 ? 46  LEU B N     1 
ATOM   3374 C  CA    . LEU D 2 46  ? -5.931  3.194   -20.302 1.00 32.67 ? 46  LEU B CA    1 
ATOM   3375 C  C     . LEU D 2 46  ? -5.857  2.252   -21.510 1.00 36.23 ? 46  LEU B C     1 
ATOM   3376 O  O     . LEU D 2 46  ? -5.098  2.501   -22.454 1.00 35.13 ? 46  LEU B O     1 
ATOM   3377 C  CB    . LEU D 2 46  ? -5.378  2.498   -19.062 1.00 34.96 ? 46  LEU B CB    1 
ATOM   3378 C  CG    . LEU D 2 46  ? -3.882  2.249   -19.058 1.00 42.56 ? 46  LEU B CG    1 
ATOM   3379 C  CD1   . LEU D 2 46  ? -3.144  3.583   -18.960 1.00 42.50 ? 46  LEU B CD1   1 
ATOM   3380 C  CD2   . LEU D 2 46  ? -3.535  1.356   -17.876 1.00 55.35 ? 46  LEU B CD2   1 
ATOM   3381 N  N     . VAL D 2 47  ? -6.637  1.171   -21.478 1.00 31.46 ? 47  VAL B N     1 
ATOM   3382 C  CA    . VAL D 2 47  ? -6.633  0.214   -22.576 1.00 32.83 ? 47  VAL B CA    1 
ATOM   3383 C  C     . VAL D 2 47  ? -7.163  0.848   -23.858 1.00 29.05 ? 47  VAL B C     1 
ATOM   3384 O  O     . VAL D 2 47  ? -6.688  0.547   -24.956 1.00 29.98 ? 47  VAL B O     1 
ATOM   3385 C  CB    . VAL D 2 47  ? -7.453  -1.050  -22.219 1.00 31.23 ? 47  VAL B CB    1 
ATOM   3386 C  CG1   . VAL D 2 47  ? -7.600  -1.946  -23.435 1.00 34.17 ? 47  VAL B CG1   1 
ATOM   3387 C  CG2   . VAL D 2 47  ? -6.742  -1.816  -21.116 1.00 25.94 ? 47  VAL B CG2   1 
ATOM   3388 N  N     . ASN D 2 48  ? -8.136  1.740   -23.725 1.00 36.45 ? 48  ASN B N     1 
ATOM   3389 C  CA    . ASN D 2 48  ? -8.668  2.405   -24.907 1.00 39.86 ? 48  ASN B CA    1 
ATOM   3390 C  C     . ASN D 2 48  ? -7.527  3.107   -25.633 1.00 34.29 ? 48  ASN B C     1 
ATOM   3391 O  O     . ASN D 2 48  ? -7.426  3.058   -26.861 1.00 35.87 ? 48  ASN B O     1 
ATOM   3392 C  CB    . ASN D 2 48  ? -9.728  3.436   -24.539 1.00 34.05 ? 48  ASN B CB    1 
ATOM   3393 C  CG    . ASN D 2 48  ? -10.287 4.132   -25.767 1.00 41.18 ? 48  ASN B CG    1 
ATOM   3394 O  OD1   . ASN D 2 48  ? -10.823 3.479   -26.660 1.00 39.52 ? 48  ASN B OD1   1 
ATOM   3395 N  ND2   . ASN D 2 48  ? -10.146 5.458   -25.827 1.00 36.27 ? 48  ASN B ND2   1 
ATOM   3396 N  N     . PHE D 2 49  ? -6.666  3.758   -24.859 1.00 33.68 ? 49  PHE B N     1 
ATOM   3397 C  CA    . PHE D 2 49  ? -5.513  4.468   -25.404 1.00 33.80 ? 49  PHE B CA    1 
ATOM   3398 C  C     . PHE D 2 49  ? -4.499  3.551   -26.110 1.00 29.78 ? 49  PHE B C     1 
ATOM   3399 O  O     . PHE D 2 49  ? -4.053  3.858   -27.212 1.00 29.46 ? 49  PHE B O     1 
ATOM   3400 C  CB    . PHE D 2 49  ? -4.833  5.268   -24.277 1.00 35.05 ? 49  PHE B CB    1 
ATOM   3401 C  CG    . PHE D 2 49  ? -3.421  5.674   -24.580 1.00 40.11 ? 49  PHE B CG    1 
ATOM   3402 C  CD1   . PHE D 2 49  ? -3.105  6.331   -25.767 1.00 40.50 ? 49  PHE B CD1   1 
ATOM   3403 C  CD2   . PHE D 2 49  ? -2.399  5.388   -23.680 1.00 40.53 ? 49  PHE B CD2   1 
ATOM   3404 C  CE1   . PHE D 2 49  ? -1.793  6.689   -26.052 1.00 36.44 ? 49  PHE B CE1   1 
ATOM   3405 C  CE2   . PHE D 2 49  ? -1.086  5.743   -23.955 1.00 41.06 ? 49  PHE B CE2   1 
ATOM   3406 C  CZ    . PHE D 2 49  ? -0.785  6.395   -25.149 1.00 39.11 ? 49  PHE B CZ    1 
ATOM   3407 N  N     . PHE D 2 50  ? -4.140  2.428   -25.484 1.00 31.24 ? 50  PHE B N     1 
ATOM   3408 C  CA    . PHE D 2 50  ? -3.173  1.501   -26.091 1.00 29.47 ? 50  PHE B CA    1 
ATOM   3409 C  C     . PHE D 2 50  ? -3.659  0.981   -27.448 1.00 27.79 ? 50  PHE B C     1 
ATOM   3410 O  O     . PHE D 2 50  ? -2.880  0.847   -28.399 1.00 32.42 ? 50  PHE B O     1 
ATOM   3411 C  CB    . PHE D 2 50  ? -2.921  0.268   -25.209 1.00 26.61 ? 50  PHE B CB    1 
ATOM   3412 C  CG    . PHE D 2 50  ? -2.513  0.570   -23.790 1.00 29.69 ? 50  PHE B CG    1 
ATOM   3413 C  CD1   . PHE D 2 50  ? -1.870  1.755   -23.456 1.00 29.83 ? 50  PHE B CD1   1 
ATOM   3414 C  CD2   . PHE D 2 50  ? -2.713  -0.388  -22.794 1.00 31.89 ? 50  PHE B CD2   1 
ATOM   3415 C  CE1   . PHE D 2 50  ? -1.428  1.980   -22.161 1.00 32.12 ? 50  PHE B CE1   1 
ATOM   3416 C  CE2   . PHE D 2 50  ? -2.273  -0.169  -21.499 1.00 30.71 ? 50  PHE B CE2   1 
ATOM   3417 C  CZ    . PHE D 2 50  ? -1.629  1.016   -21.182 1.00 33.58 ? 50  PHE B CZ    1 
ATOM   3418 N  N     . ILE D 2 51  ? -4.950  0.682   -27.519 1.00 28.61 ? 51  ILE B N     1 
ATOM   3419 C  CA    . ILE D 2 51  ? -5.553  0.145   -28.733 1.00 33.28 ? 51  ILE B CA    1 
ATOM   3420 C  C     . ILE D 2 51  ? -5.662  1.179   -29.845 1.00 28.30 ? 51  ILE B C     1 
ATOM   3421 O  O     . ILE D 2 51  ? -5.332  0.897   -30.995 1.00 34.59 ? 51  ILE B O     1 
ATOM   3422 C  CB    . ILE D 2 51  ? -6.937  -0.468  -28.415 1.00 33.15 ? 51  ILE B CB    1 
ATOM   3423 C  CG1   . ILE D 2 51  ? -6.731  -1.779  -27.646 1.00 48.56 ? 51  ILE B CG1   1 
ATOM   3424 C  CG2   . ILE D 2 51  ? -7.733  -0.703  -29.692 1.00 34.46 ? 51  ILE B CG2   1 
ATOM   3425 C  CD1   . ILE D 2 51  ? -7.975  -2.307  -26.977 1.00 48.98 ? 51  ILE B CD1   1 
ATOM   3426 N  N     . VAL D 2 52  ? -6.112  2.379   -29.512 1.00 33.92 ? 52  VAL B N     1 
ATOM   3427 C  CA    . VAL D 2 52  ? -6.218  3.419   -30.527 1.00 27.95 ? 52  VAL B CA    1 
ATOM   3428 C  C     . VAL D 2 52  ? -4.839  3.700   -31.117 1.00 28.18 ? 52  VAL B C     1 
ATOM   3429 O  O     . VAL D 2 52  ? -4.676  3.822   -32.336 1.00 34.29 ? 52  VAL B O     1 
ATOM   3430 C  CB    . VAL D 2 52  ? -6.799  4.722   -29.928 1.00 27.71 ? 52  VAL B CB    1 
ATOM   3431 C  CG1   . VAL D 2 52  ? -6.598  5.885   -30.902 1.00 27.14 ? 52  VAL B CG1   1 
ATOM   3432 C  CG2   . VAL D 2 52  ? -8.296  4.528   -29.622 1.00 31.36 ? 52  VAL B CG2   1 
ATOM   3433 N  N     . ASP D 2 53  ? -3.843  3.782   -30.244 1.00 30.55 ? 53  ASP B N     1 
ATOM   3434 C  CA    . ASP D 2 53  ? -2.478  4.062   -30.674 1.00 34.80 ? 53  ASP B CA    1 
ATOM   3435 C  C     . ASP D 2 53  ? -2.021  3.053   -31.723 1.00 33.58 ? 53  ASP B C     1 
ATOM   3436 O  O     . ASP D 2 53  ? -1.389  3.423   -32.718 1.00 29.97 ? 53  ASP B O     1 
ATOM   3437 C  CB    . ASP D 2 53  ? -1.538  4.049   -29.469 1.00 35.92 ? 53  ASP B CB    1 
ATOM   3438 C  CG    . ASP D 2 53  ? -0.233  4.783   -29.732 1.00 41.72 ? 53  ASP B CG    1 
ATOM   3439 O  OD1   . ASP D 2 53  ? -0.181  5.623   -30.662 1.00 41.79 ? 53  ASP B OD1   1 
ATOM   3440 O  OD2   . ASP D 2 53  ? 0.741   4.534   -28.992 1.00 41.42 ? 53  ASP B OD2   1 
ATOM   3441 N  N     . LEU D 2 54  ? -2.344  1.780   -31.508 1.00 36.08 ? 54  LEU B N     1 
ATOM   3442 C  CA    . LEU D 2 54  ? -1.965  0.746   -32.463 1.00 33.25 ? 54  LEU B CA    1 
ATOM   3443 C  C     . LEU D 2 54  ? -2.787  0.912   -33.727 1.00 31.33 ? 54  LEU B C     1 
ATOM   3444 O  O     . LEU D 2 54  ? -2.265  0.843   -34.837 1.00 32.80 ? 54  LEU B O     1 
ATOM   3445 C  CB    . LEU D 2 54  ? -2.207  -0.662  -31.887 1.00 31.58 ? 54  LEU B CB    1 
ATOM   3446 C  CG    . LEU D 2 54  ? -1.326  -1.185  -30.748 1.00 44.82 ? 54  LEU B CG    1 
ATOM   3447 C  CD1   . LEU D 2 54  ? -1.716  -2.626  -30.431 1.00 44.10 ? 54  LEU B CD1   1 
ATOM   3448 C  CD2   . LEU D 2 54  ? 0.135   -1.128  -31.155 1.00 36.67 ? 54  LEU B CD2   1 
ATOM   3449 N  N     . LEU D 2 55  ? -4.085  1.127   -33.546 1.00 37.55 ? 55  LEU B N     1 
ATOM   3450 C  CA    . LEU D 2 55  ? -5.007  1.286   -34.665 1.00 35.76 ? 55  LEU B CA    1 
ATOM   3451 C  C     . LEU D 2 55  ? -4.548  2.387   -35.623 1.00 40.30 ? 55  LEU B C     1 
ATOM   3452 O  O     . LEU D 2 55  ? -4.510  2.191   -36.834 1.00 39.90 ? 55  LEU B O     1 
ATOM   3453 C  CB    . LEU D 2 55  ? -6.400  1.589   -34.112 1.00 40.13 ? 55  LEU B CB    1 
ATOM   3454 C  CG    . LEU D 2 55  ? -7.603  1.594   -35.049 1.00 39.28 ? 55  LEU B CG    1 
ATOM   3455 C  CD1   . LEU D 2 55  ? -7.649  0.313   -35.889 1.00 38.28 ? 55  LEU B CD1   1 
ATOM   3456 C  CD2   . LEU D 2 55  ? -8.865  1.729   -34.195 1.00 37.86 ? 55  LEU B CD2   1 
ATOM   3457 N  N     . VAL D 2 56  ? -4.186  3.539   -35.069 1.00 42.64 ? 56  VAL B N     1 
ATOM   3458 C  CA    . VAL D 2 56  ? -3.722  4.669   -35.861 1.00 41.31 ? 56  VAL B CA    1 
ATOM   3459 C  C     . VAL D 2 56  ? -2.416  4.375   -36.610 1.00 47.29 ? 56  VAL B C     1 
ATOM   3460 O  O     . VAL D 2 56  ? -2.192  4.893   -37.706 1.00 44.39 ? 56  VAL B O     1 
ATOM   3461 C  CB    . VAL D 2 56  ? -3.531  5.915   -34.962 1.00 40.07 ? 56  VAL B CB    1 
ATOM   3462 C  CG1   . VAL D 2 56  ? -2.661  6.948   -35.665 1.00 39.91 ? 56  VAL B CG1   1 
ATOM   3463 C  CG2   . VAL D 2 56  ? -4.896  6.516   -34.621 1.00 40.07 ? 56  VAL B CG2   1 
ATOM   3464 N  N     . GLN D 2 57  ? -1.557  3.540   -36.035 1.00 45.89 ? 57  GLN B N     1 
ATOM   3465 C  CA    . GLN D 2 57  ? -0.294  3.220   -36.693 1.00 43.86 ? 57  GLN B CA    1 
ATOM   3466 C  C     . GLN D 2 57  ? -0.384  2.145   -37.771 1.00 46.98 ? 57  GLN B C     1 
ATOM   3467 O  O     . GLN D 2 57  ? 0.191   2.293   -38.845 1.00 46.95 ? 57  GLN B O     1 
ATOM   3468 C  CB    . GLN D 2 57  ? 0.745   2.755   -35.683 1.00 47.08 ? 57  GLN B CB    1 
ATOM   3469 C  CG    . GLN D 2 57  ? 1.138   3.758   -34.643 1.00 51.91 ? 57  GLN B CG    1 
ATOM   3470 C  CD    . GLN D 2 57  ? 2.184   3.196   -33.698 1.00 58.73 ? 57  GLN B CD    1 
ATOM   3471 O  OE1   . GLN D 2 57  ? 3.344   2.996   -34.078 1.00 55.00 ? 57  GLN B OE1   1 
ATOM   3472 N  NE2   . GLN D 2 57  ? 1.777   2.925   -32.462 1.00 57.58 ? 57  GLN B NE2   1 
ATOM   3473 N  N     . TYR D 2 58  ? -1.113  1.072   -37.492 1.00 43.84 ? 58  TYR B N     1 
ATOM   3474 C  CA    . TYR D 2 58  ? -1.184  -0.045  -38.425 1.00 42.19 ? 58  TYR B CA    1 
ATOM   3475 C  C     . TYR D 2 58  ? -2.434  -0.238  -39.267 1.00 48.24 ? 58  TYR B C     1 
ATOM   3476 O  O     . TYR D 2 58  ? -2.435  -1.088  -40.157 1.00 54.43 ? 58  TYR B O     1 
ATOM   3477 C  CB    . TYR D 2 58  ? -0.898  -1.338  -37.657 1.00 42.41 ? 58  TYR B CB    1 
ATOM   3478 C  CG    . TYR D 2 58  ? 0.416   -1.301  -36.906 1.00 50.29 ? 58  TYR B CG    1 
ATOM   3479 C  CD1   . TYR D 2 58  ? 1.617   -1.630  -37.536 1.00 53.86 ? 58  TYR B CD1   1 
ATOM   3480 C  CD2   . TYR D 2 58  ? 0.465   -0.881  -35.578 1.00 46.48 ? 58  TYR B CD2   1 
ATOM   3481 C  CE1   . TYR D 2 58  ? 2.836   -1.537  -36.858 1.00 56.17 ? 58  TYR B CE1   1 
ATOM   3482 C  CE2   . TYR D 2 58  ? 1.673   -0.782  -34.896 1.00 48.53 ? 58  TYR B CE2   1 
ATOM   3483 C  CZ    . TYR D 2 58  ? 2.853   -1.108  -35.538 1.00 58.16 ? 58  TYR B CZ    1 
ATOM   3484 O  OH    . TYR D 2 58  ? 4.046   -0.978  -34.863 1.00 59.99 ? 58  TYR B OH    1 
ATOM   3485 N  N     . SER D 2 59  ? -3.496  0.522   -39.015 1.00 45.40 ? 59  SER B N     1 
ATOM   3486 C  CA    . SER D 2 59  ? -4.706  0.332   -39.806 1.00 47.36 ? 59  SER B CA    1 
ATOM   3487 C  C     . SER D 2 59  ? -4.505  0.640   -41.282 1.00 51.19 ? 59  SER B C     1 
ATOM   3488 O  O     . SER D 2 59  ? -3.927  1.664   -41.641 1.00 43.51 ? 59  SER B O     1 
ATOM   3489 C  CB    . SER D 2 59  ? -5.855  1.190   -39.292 1.00 45.00 ? 59  SER B CB    1 
ATOM   3490 O  OG    . SER D 2 59  ? -7.003  0.989   -40.109 1.00 39.70 ? 59  SER B OG    1 
ATOM   3491 N  N     . PRO D 2 60  ? -4.995  -0.248  -42.161 1.00 54.59 ? 60  PRO B N     1 
ATOM   3492 C  CA    . PRO D 2 60  ? -4.854  -0.039  -43.604 1.00 58.87 ? 60  PRO B CA    1 
ATOM   3493 C  C     . PRO D 2 60  ? -5.706  1.146   -44.064 1.00 61.68 ? 60  PRO B C     1 
ATOM   3494 O  O     . PRO D 2 60  ? -5.264  1.983   -44.856 1.00 65.98 ? 60  PRO B O     1 
ATOM   3495 C  CB    . PRO D 2 60  ? -5.333  -1.366  -44.187 1.00 55.68 ? 60  PRO B CB    1 
ATOM   3496 C  CG    . PRO D 2 60  ? -6.396  -1.783  -43.212 1.00 55.84 ? 60  PRO B CG    1 
ATOM   3497 C  CD    . PRO D 2 60  ? -5.756  -1.480  -41.877 1.00 51.43 ? 60  PRO B CD    1 
ATOM   3498 N  N     . ASN D 2 61  ? -6.924  1.212   -43.540 1.00 53.22 ? 61  ASN B N     1 
ATOM   3499 C  CA    . ASN D 2 61  ? -7.870  2.266   -43.877 1.00 49.20 ? 61  ASN B CA    1 
ATOM   3500 C  C     . ASN D 2 61  ? -7.983  3.244   -42.701 1.00 51.10 ? 61  ASN B C     1 
ATOM   3501 O  O     . ASN D 2 61  ? -8.329  2.845   -41.589 1.00 48.51 ? 61  ASN B O     1 
ATOM   3502 C  CB    . ASN D 2 61  ? -9.230  1.627   -44.163 1.00 42.62 ? 61  ASN B CB    1 
ATOM   3503 C  CG    . ASN D 2 61  ? -10.254 2.619   -44.666 1.00 54.56 ? 61  ASN B CG    1 
ATOM   3504 O  OD1   . ASN D 2 61  ? -10.261 3.784   -44.269 1.00 45.77 ? 61  ASN B OD1   1 
ATOM   3505 N  ND2   . ASN D 2 61  ? -11.148 2.151   -45.535 1.00 60.94 ? 61  ASN B ND2   1 
ATOM   3506 N  N     . LYS D 2 62  ? -7.698  4.520   -42.937 1.00 49.74 ? 62  LYS B N     1 
ATOM   3507 C  CA    . LYS D 2 62  ? -7.787  5.500   -41.864 1.00 45.68 ? 62  LYS B CA    1 
ATOM   3508 C  C     . LYS D 2 62  ? -9.005  6.421   -41.932 1.00 47.16 ? 62  LYS B C     1 
ATOM   3509 O  O     . LYS D 2 62  ? -9.040  7.483   -41.306 1.00 47.26 ? 62  LYS B O     1 
ATOM   3510 C  CB    . LYS D 2 62  ? -6.484  6.293   -41.789 1.00 46.37 ? 62  LYS B CB    1 
ATOM   3511 C  CG    . LYS D 2 62  ? -5.326  5.376   -41.424 1.00 50.19 ? 62  LYS B CG    1 
ATOM   3512 C  CD    . LYS D 2 62  ? -4.003  6.079   -41.257 1.00 57.57 ? 62  LYS B CD    1 
ATOM   3513 C  CE    . LYS D 2 62  ? -2.934  5.055   -40.907 1.00 55.96 ? 62  LYS B CE    1 
ATOM   3514 N  NZ    . LYS D 2 62  ? -1.585  5.662   -40.783 1.00 70.24 ? 62  LYS B NZ    1 
ATOM   3515 N  N     . ARG D 2 63  ? -10.014 5.997   -42.688 1.00 43.94 ? 63  ARG B N     1 
ATOM   3516 C  CA    . ARG D 2 63  ? -11.260 6.751   -42.806 1.00 53.27 ? 63  ARG B CA    1 
ATOM   3517 C  C     . ARG D 2 63  ? -12.055 6.563   -41.508 1.00 48.57 ? 63  ARG B C     1 
ATOM   3518 O  O     . ARG D 2 63  ? -12.087 5.466   -40.951 1.00 47.01 ? 63  ARG B O     1 
ATOM   3519 C  CB    . ARG D 2 63  ? -12.064 6.243   -44.007 1.00 59.30 ? 63  ARG B CB    1 
ATOM   3520 C  CG    . ARG D 2 63  ? -11.514 6.705   -45.352 1.00 64.59 ? 63  ARG B CG    1 
ATOM   3521 C  CD    . ARG D 2 63  ? -11.711 5.654   -46.428 1.00 75.50 ? 63  ARG B CD    1 
ATOM   3522 N  NE    . ARG D 2 63  ? -13.064 5.108   -46.426 1.00 87.66 ? 63  ARG B NE    1 
ATOM   3523 C  CZ    . ARG D 2 63  ? -13.469 4.114   -47.213 1.00 96.44 ? 63  ARG B CZ    1 
ATOM   3524 N  NH1   . ARG D 2 63  ? -12.622 3.556   -48.073 1.00 97.13 ? 63  ARG B NH1   1 
ATOM   3525 N  NH2   . ARG D 2 63  ? -14.718 3.669   -47.135 1.00 98.58 ? 63  ARG B NH2   1 
ATOM   3526 N  N     . GLU D 2 64  ? -12.682 7.632   -41.025 1.00 48.31 ? 64  GLU B N     1 
ATOM   3527 C  CA    . GLU D 2 64  ? -13.452 7.580   -39.780 1.00 45.25 ? 64  GLU B CA    1 
ATOM   3528 C  C     . GLU D 2 64  ? -14.492 6.471   -39.761 1.00 46.06 ? 64  GLU B C     1 
ATOM   3529 O  O     . GLU D 2 64  ? -14.690 5.820   -38.736 1.00 40.69 ? 64  GLU B O     1 
ATOM   3530 C  CB    . GLU D 2 64  ? -14.165 8.908   -39.533 1.00 48.01 ? 64  GLU B CB    1 
ATOM   3531 C  CG    . GLU D 2 64  ? -13.268 10.127  -39.567 1.00 57.96 ? 64  GLU B CG    1 
ATOM   3532 C  CD    . GLU D 2 64  ? -14.040 11.417  -39.356 1.00 60.94 ? 64  GLU B CD    1 
ATOM   3533 O  OE1   . GLU D 2 64  ? -14.995 11.670  -40.124 1.00 66.01 ? 64  GLU B OE1   1 
ATOM   3534 O  OE2   . GLU D 2 64  ? -13.692 12.177  -38.425 1.00 62.76 ? 64  GLU B OE2   1 
ATOM   3535 N  N     . GLY D 2 65  ? -15.165 6.276   -40.894 1.00 41.83 ? 65  GLY B N     1 
ATOM   3536 C  CA    . GLY D 2 65  ? -16.195 5.253   -40.995 1.00 40.56 ? 65  GLY B CA    1 
ATOM   3537 C  C     . GLY D 2 65  ? -15.673 3.834   -40.871 1.00 39.79 ? 65  GLY B C     1 
ATOM   3538 O  O     . GLY D 2 65  ? -16.446 2.889   -40.743 1.00 41.56 ? 65  GLY B O     1 
ATOM   3539 N  N     . PHE D 2 66  ? -14.357 3.680   -40.921 1.00 36.92 ? 66  PHE B N     1 
ATOM   3540 C  CA    . PHE D 2 66  ? -13.735 2.372   -40.797 1.00 42.24 ? 66  PHE B CA    1 
ATOM   3541 C  C     . PHE D 2 66  ? -13.109 2.252   -39.410 1.00 37.45 ? 66  PHE B C     1 
ATOM   3542 O  O     . PHE D 2 66  ? -13.325 1.271   -38.697 1.00 39.60 ? 66  PHE B O     1 
ATOM   3543 C  CB    . PHE D 2 66  ? -12.652 2.206   -41.859 1.00 41.77 ? 66  PHE B CB    1 
ATOM   3544 C  CG    . PHE D 2 66  ? -11.945 0.886   -41.796 1.00 42.63 ? 66  PHE B CG    1 
ATOM   3545 C  CD1   . PHE D 2 66  ? -12.561 -0.273  -42.262 1.00 41.97 ? 66  PHE B CD1   1 
ATOM   3546 C  CD2   . PHE D 2 66  ? -10.662 0.795   -41.264 1.00 44.30 ? 66  PHE B CD2   1 
ATOM   3547 C  CE1   . PHE D 2 66  ? -11.908 -1.501  -42.199 1.00 37.59 ? 66  PHE B CE1   1 
ATOM   3548 C  CE2   . PHE D 2 66  ? -10.003 -0.431  -41.197 1.00 39.98 ? 66  PHE B CE2   1 
ATOM   3549 C  CZ    . PHE D 2 66  ? -10.627 -1.578  -41.666 1.00 40.89 ? 66  PHE B CZ    1 
ATOM   3550 N  N     . LEU D 2 67  ? -12.330 3.264   -39.042 1.00 35.10 ? 67  LEU B N     1 
ATOM   3551 C  CA    . LEU D 2 67  ? -11.653 3.302   -37.750 1.00 36.55 ? 67  LEU B CA    1 
ATOM   3552 C  C     . LEU D 2 67  ? -12.587 3.256   -36.547 1.00 37.45 ? 67  LEU B C     1 
ATOM   3553 O  O     . LEU D 2 67  ? -12.321 2.536   -35.593 1.00 41.90 ? 67  LEU B O     1 
ATOM   3554 C  CB    . LEU D 2 67  ? -10.772 4.551   -37.642 1.00 30.24 ? 67  LEU B CB    1 
ATOM   3555 C  CG    . LEU D 2 67  ? -9.512  4.628   -38.506 1.00 33.37 ? 67  LEU B CG    1 
ATOM   3556 C  CD1   . LEU D 2 67  ? -8.836  5.973   -38.297 1.00 33.82 ? 67  LEU B CD1   1 
ATOM   3557 C  CD2   . LEU D 2 67  ? -8.568  3.485   -38.143 1.00 32.90 ? 67  LEU B CD2   1 
ATOM   3558 N  N     . SER D 2 68  ? -13.676 4.017   -36.583 1.00 39.11 ? 68  SER B N     1 
ATOM   3559 C  CA    . SER D 2 68  ? -14.603 4.035   -35.456 1.00 39.01 ? 68  SER B CA    1 
ATOM   3560 C  C     . SER D 2 68  ? -15.293 2.699   -35.195 1.00 38.61 ? 68  SER B C     1 
ATOM   3561 O  O     . SER D 2 68  ? -15.332 2.231   -34.062 1.00 36.83 ? 68  SER B O     1 
ATOM   3562 C  CB    . SER D 2 68  ? -15.652 5.131   -35.637 1.00 36.02 ? 68  SER B CB    1 
ATOM   3563 O  OG    . SER D 2 68  ? -15.039 6.406   -35.613 1.00 51.14 ? 68  SER B OG    1 
ATOM   3564 N  N     . PRO D 2 69  ? -15.861 2.072   -36.232 1.00 41.88 ? 69  PRO B N     1 
ATOM   3565 C  CA    . PRO D 2 69  ? -16.517 0.786   -35.960 1.00 39.13 ? 69  PRO B CA    1 
ATOM   3566 C  C     . PRO D 2 69  ? -15.501 -0.275  -35.528 1.00 36.74 ? 69  PRO B C     1 
ATOM   3567 O  O     . PRO D 2 69  ? -15.775 -1.092  -34.650 1.00 39.55 ? 69  PRO B O     1 
ATOM   3568 C  CB    . PRO D 2 69  ? -17.187 0.446   -37.297 1.00 40.45 ? 69  PRO B CB    1 
ATOM   3569 C  CG    . PRO D 2 69  ? -17.439 1.811   -37.912 1.00 43.95 ? 69  PRO B CG    1 
ATOM   3570 C  CD    . PRO D 2 69  ? -16.145 2.535   -37.603 1.00 41.87 ? 69  PRO B CD    1 
ATOM   3571 N  N     . LEU D 2 70  ? -14.322 -0.258  -36.140 1.00 36.19 ? 70  LEU B N     1 
ATOM   3572 C  CA    . LEU D 2 70  ? -13.306 -1.233  -35.782 1.00 37.93 ? 70  LEU B CA    1 
ATOM   3573 C  C     . LEU D 2 70  ? -12.817 -1.013  -34.348 1.00 40.88 ? 70  LEU B C     1 
ATOM   3574 O  O     . LEU D 2 70  ? -12.655 -1.973  -33.592 1.00 39.49 ? 70  LEU B O     1 
ATOM   3575 C  CB    . LEU D 2 70  ? -12.134 -1.176  -36.764 1.00 36.33 ? 70  LEU B CB    1 
ATOM   3576 C  CG    . LEU D 2 70  ? -11.025 -2.220  -36.584 1.00 39.37 ? 70  LEU B CG    1 
ATOM   3577 C  CD1   . LEU D 2 70  ? -11.608 -3.631  -36.481 1.00 39.47 ? 70  LEU B CD1   1 
ATOM   3578 C  CD2   . LEU D 2 70  ? -10.080 -2.129  -37.756 1.00 36.84 ? 70  LEU B CD2   1 
ATOM   3579 N  N     . LYS D 2 71  ? -12.595 0.242   -33.964 1.00 36.25 ? 71  LYS B N     1 
ATOM   3580 C  CA    . LYS D 2 71  ? -12.135 0.518   -32.602 1.00 34.74 ? 71  LYS B CA    1 
ATOM   3581 C  C     . LYS D 2 71  ? -13.147 0.008   -31.586 1.00 32.11 ? 71  LYS B C     1 
ATOM   3582 O  O     . LYS D 2 71  ? -12.777 -0.565  -30.561 1.00 30.51 ? 71  LYS B O     1 
ATOM   3583 C  CB    . LYS D 2 71  ? -11.930 2.021   -32.366 1.00 40.79 ? 71  LYS B CB    1 
ATOM   3584 C  CG    . LYS D 2 71  ? -11.544 2.350   -30.906 1.00 34.19 ? 71  LYS B CG    1 
ATOM   3585 C  CD    . LYS D 2 71  ? -11.656 3.836   -30.618 1.00 45.28 ? 71  LYS B CD    1 
ATOM   3586 C  CE    . LYS D 2 71  ? -12.489 4.098   -29.383 1.00 29.23 ? 71  LYS B CE    1 
ATOM   3587 N  NZ    . LYS D 2 71  ? -12.698 5.552   -29.216 1.00 50.13 ? 71  LYS B NZ    1 
ATOM   3588 N  N     . ALA D 2 72  ? -14.425 0.236   -31.871 1.00 32.90 ? 72  ALA B N     1 
ATOM   3589 C  CA    . ALA D 2 72  ? -15.493 -0.203  -30.983 1.00 33.94 ? 72  ALA B CA    1 
ATOM   3590 C  C     . ALA D 2 72  ? -15.391 -1.702  -30.741 1.00 37.25 ? 72  ALA B C     1 
ATOM   3591 O  O     . ALA D 2 72  ? -15.599 -2.171  -29.622 1.00 38.42 ? 72  ALA B O     1 
ATOM   3592 C  CB    . ALA D 2 72  ? -16.855 0.144   -31.580 1.00 30.28 ? 72  ALA B CB    1 
ATOM   3593 N  N     . TYR D 2 73  ? -15.072 -2.461  -31.786 1.00 35.71 ? 73  TYR B N     1 
ATOM   3594 C  CA    . TYR D 2 73  ? -14.937 -3.903  -31.616 1.00 36.88 ? 73  TYR B CA    1 
ATOM   3595 C  C     . TYR D 2 73  ? -13.673 -4.237  -30.823 1.00 39.91 ? 73  TYR B C     1 
ATOM   3596 O  O     . TYR D 2 73  ? -13.697 -5.098  -29.944 1.00 36.91 ? 73  TYR B O     1 
ATOM   3597 C  CB    . TYR D 2 73  ? -14.879 -4.620  -32.965 1.00 36.32 ? 73  TYR B CB    1 
ATOM   3598 C  CG    . TYR D 2 73  ? -14.499 -6.080  -32.829 1.00 36.21 ? 73  TYR B CG    1 
ATOM   3599 C  CD1   . TYR D 2 73  ? -15.365 -6.998  -32.230 1.00 36.53 ? 73  TYR B CD1   1 
ATOM   3600 C  CD2   . TYR D 2 73  ? -13.255 -6.532  -33.255 1.00 34.06 ? 73  TYR B CD2   1 
ATOM   3601 C  CE1   . TYR D 2 73  ? -14.993 -8.333  -32.059 1.00 41.35 ? 73  TYR B CE1   1 
ATOM   3602 C  CE2   . TYR D 2 73  ? -12.871 -7.858  -33.088 1.00 44.23 ? 73  TYR B CE2   1 
ATOM   3603 C  CZ    . TYR D 2 73  ? -13.743 -8.751  -32.491 1.00 41.40 ? 73  TYR B CZ    1 
ATOM   3604 O  OH    . TYR D 2 73  ? -13.353 -10.058 -32.327 1.00 49.93 ? 73  TYR B OH    1 
ATOM   3605 N  N     . LEU D 2 74  ? -12.574 -3.553  -31.130 1.00 28.33 ? 74  LEU B N     1 
ATOM   3606 C  CA    . LEU D 2 74  ? -11.310 -3.805  -30.446 1.00 32.43 ? 74  LEU B CA    1 
ATOM   3607 C  C     . LEU D 2 74  ? -11.290 -3.453  -28.948 1.00 39.05 ? 74  LEU B C     1 
ATOM   3608 O  O     . LEU D 2 74  ? -10.304 -3.717  -28.263 1.00 39.17 ? 74  LEU B O     1 
ATOM   3609 C  CB    . LEU D 2 74  ? -10.172 -3.090  -31.184 1.00 27.83 ? 74  LEU B CB    1 
ATOM   3610 C  CG    . LEU D 2 74  ? -9.977  -3.623  -32.611 1.00 41.31 ? 74  LEU B CG    1 
ATOM   3611 C  CD1   . LEU D 2 74  ? -8.988  -2.749  -33.374 1.00 32.49 ? 74  LEU B CD1   1 
ATOM   3612 C  CD2   . LEU D 2 74  ? -9.498  -5.082  -32.553 1.00 30.11 ? 74  LEU B CD2   1 
ATOM   3613 N  N     . ILE D 2 75  ? -12.367 -2.853  -28.441 1.00 39.47 ? 75  ILE B N     1 
ATOM   3614 C  CA    . ILE D 2 75  ? -12.454 -2.529  -27.015 1.00 40.34 ? 75  ILE B CA    1 
ATOM   3615 C  C     . ILE D 2 75  ? -13.770 -3.087  -26.506 1.00 40.53 ? 75  ILE B C     1 
ATOM   3616 O  O     . ILE D 2 75  ? -14.272 -2.691  -25.458 1.00 42.55 ? 75  ILE B O     1 
ATOM   3617 C  CB    . ILE D 2 75  ? -12.420 -1.003  -26.722 1.00 37.04 ? 75  ILE B CB    1 
ATOM   3618 C  CG1   . ILE D 2 75  ? -13.711 -0.337  -27.216 1.00 30.04 ? 75  ILE B CG1   1 
ATOM   3619 C  CG2   . ILE D 2 75  ? -11.183 -0.388  -27.336 1.00 31.60 ? 75  ILE B CG2   1 
ATOM   3620 C  CD1   . ILE D 2 75  ? -13.820 1.142   -26.872 1.00 38.19 ? 75  ILE B CD1   1 
ATOM   3621 N  N     . SER D 2 76  ? -14.331 -4.008  -27.278 1.00 42.36 ? 76  SER B N     1 
ATOM   3622 C  CA    . SER D 2 76  ? -15.581 -4.647  -26.912 1.00 42.72 ? 76  SER B CA    1 
ATOM   3623 C  C     . SER D 2 76  ? -15.312 -5.761  -25.901 1.00 42.37 ? 76  SER B C     1 
ATOM   3624 O  O     . SER D 2 76  ? -14.202 -6.308  -25.822 1.00 41.01 ? 76  SER B O     1 
ATOM   3625 C  CB    . SER D 2 76  ? -16.244 -5.250  -28.147 1.00 44.33 ? 76  SER B CB    1 
ATOM   3626 O  OG    . SER D 2 76  ? -15.477 -6.344  -28.611 1.00 47.03 ? 76  SER B OG    1 
ATOM   3627 N  N     . GLU D 2 77  ? -16.337 -6.078  -25.123 1.00 35.46 ? 77  GLU B N     1 
ATOM   3628 C  CA    . GLU D 2 77  ? -16.250 -7.134  -24.128 1.00 46.12 ? 77  GLU B CA    1 
ATOM   3629 C  C     . GLU D 2 77  ? -15.725 -8.383  -24.829 1.00 47.48 ? 77  GLU B C     1 
ATOM   3630 O  O     . GLU D 2 77  ? -14.805 -9.057  -24.352 1.00 46.89 ? 77  GLU B O     1 
ATOM   3631 C  CB    . GLU D 2 77  ? -17.643 -7.398  -23.565 1.00 45.70 ? 77  GLU B CB    1 
ATOM   3632 C  CG    . GLU D 2 77  ? -17.746 -8.555  -22.607 1.00 57.55 ? 77  GLU B CG    1 
ATOM   3633 C  CD    . GLU D 2 77  ? -19.176 -8.782  -22.167 1.00 64.65 ? 77  GLU B CD    1 
ATOM   3634 O  OE1   . GLU D 2 77  ? -19.769 -7.841  -21.599 1.00 58.57 ? 77  GLU B OE1   1 
ATOM   3635 O  OE2   . GLU D 2 77  ? -19.706 -9.892  -22.392 1.00 69.13 ? 77  GLU B OE2   1 
ATOM   3636 N  N     . GLU D 2 78  ? -16.318 -8.657  -25.984 1.00 45.98 ? 78  GLU B N     1 
ATOM   3637 C  CA    . GLU D 2 78  ? -15.966 -9.806  -26.797 1.00 47.58 ? 78  GLU B CA    1 
ATOM   3638 C  C     . GLU D 2 78  ? -14.460 -9.926  -27.005 1.00 43.87 ? 78  GLU B C     1 
ATOM   3639 O  O     . GLU D 2 78  ? -13.844 -10.934 -26.644 1.00 42.68 ? 78  GLU B O     1 
ATOM   3640 C  CB    . GLU D 2 78  ? -16.657 -9.706  -28.159 1.00 49.76 ? 78  GLU B CB    1 
ATOM   3641 C  CG    . GLU D 2 78  ? -16.723 -11.023 -28.910 1.00 51.19 ? 78  GLU B CG    1 
ATOM   3642 C  CD    . GLU D 2 78  ? -17.041 -10.842 -30.377 1.00 56.04 ? 78  GLU B CD    1 
ATOM   3643 O  OE1   . GLU D 2 78  ? -17.912 -10.007 -30.696 1.00 61.91 ? 78  GLU B OE1   1 
ATOM   3644 O  OE2   . GLU D 2 78  ? -16.425 -11.541 -31.213 1.00 56.50 ? 78  GLU B OE2   1 
ATOM   3645 N  N     . PHE D 2 79  ? -13.866 -8.894  -27.589 1.00 37.43 ? 79  PHE B N     1 
ATOM   3646 C  CA    . PHE D 2 79  ? -12.436 -8.914  -27.858 1.00 36.14 ? 79  PHE B CA    1 
ATOM   3647 C  C     . PHE D 2 79  ? -11.593 -9.025  -26.598 1.00 37.56 ? 79  PHE B C     1 
ATOM   3648 O  O     . PHE D 2 79  ? -10.566 -9.693  -26.600 1.00 47.02 ? 79  PHE B O     1 
ATOM   3649 C  CB    . PHE D 2 79  ? -12.020 -7.666  -28.626 1.00 37.63 ? 79  PHE B CB    1 
ATOM   3650 C  CG    . PHE D 2 79  ? -10.671 -7.780  -29.255 1.00 38.02 ? 79  PHE B CG    1 
ATOM   3651 C  CD1   . PHE D 2 79  ? -10.451 -8.679  -30.293 1.00 38.09 ? 79  PHE B CD1   1 
ATOM   3652 C  CD2   . PHE D 2 79  ? -9.615  -7.009  -28.804 1.00 35.79 ? 79  PHE B CD2   1 
ATOM   3653 C  CE1   . PHE D 2 79  ? -9.192  -8.807  -30.872 1.00 42.75 ? 79  PHE B CE1   1 
ATOM   3654 C  CE2   . PHE D 2 79  ? -8.346  -7.131  -29.378 1.00 39.44 ? 79  PHE B CE2   1 
ATOM   3655 C  CZ    . PHE D 2 79  ? -8.140  -8.033  -30.413 1.00 40.92 ? 79  PHE B CZ    1 
ATOM   3656 N  N     . PHE D 2 80  ? -12.019 -8.365  -25.526 1.00 41.05 ? 80  PHE B N     1 
ATOM   3657 C  CA    . PHE D 2 80  ? -11.277 -8.417  -24.280 1.00 41.92 ? 80  PHE B CA    1 
ATOM   3658 C  C     . PHE D 2 80  ? -11.268 -9.839  -23.736 1.00 42.38 ? 80  PHE B C     1 
ATOM   3659 O  O     . PHE D 2 80  ? -10.238 -10.319 -23.261 1.00 42.06 ? 80  PHE B O     1 
ATOM   3660 C  CB    . PHE D 2 80  ? -11.875 -7.445  -23.265 1.00 43.09 ? 80  PHE B CB    1 
ATOM   3661 C  CG    . PHE D 2 80  ? -11.485 -6.007  -23.501 1.00 41.69 ? 80  PHE B CG    1 
ATOM   3662 C  CD1   . PHE D 2 80  ? -10.701 -5.650  -24.599 1.00 35.04 ? 80  PHE B CD1   1 
ATOM   3663 C  CD2   . PHE D 2 80  ? -11.886 -5.012  -22.617 1.00 48.04 ? 80  PHE B CD2   1 
ATOM   3664 C  CE1   . PHE D 2 80  ? -10.324 -4.324  -24.809 1.00 46.97 ? 80  PHE B CE1   1 
ATOM   3665 C  CE2   . PHE D 2 80  ? -11.512 -3.679  -22.821 1.00 46.78 ? 80  PHE B CE2   1 
ATOM   3666 C  CZ    . PHE D 2 80  ? -10.731 -3.338  -23.917 1.00 37.76 ? 80  PHE B CZ    1 
ATOM   3667 N  N     . ASN D 2 81  ? -12.413 -10.509 -23.807 1.00 40.11 ? 81  ASN B N     1 
ATOM   3668 C  CA    . ASN D 2 81  ? -12.503 -11.894 -23.353 1.00 48.61 ? 81  ASN B CA    1 
ATOM   3669 C  C     . ASN D 2 81  ? -11.574 -12.729 -24.218 1.00 47.37 ? 81  ASN B C     1 
ATOM   3670 O  O     . ASN D 2 81  ? -10.913 -13.639 -23.730 1.00 53.52 ? 81  ASN B O     1 
ATOM   3671 C  CB    . ASN D 2 81  ? -13.938 -12.407 -23.468 1.00 42.13 ? 81  ASN B CB    1 
ATOM   3672 C  CG    . ASN D 2 81  ? -14.738 -12.167 -22.203 1.00 49.96 ? 81  ASN B CG    1 
ATOM   3673 O  OD1   . ASN D 2 81  ? -14.771 -13.011 -21.307 1.00 50.01 ? 81  ASN B OD1   1 
ATOM   3674 N  ND2   . ASN D 2 81  ? -15.369 -11.003 -22.113 1.00 47.76 ? 81  ASN B ND2   1 
ATOM   3675 N  N     . LEU D 2 82  ? -11.515 -12.393 -25.503 1.00 46.35 ? 82  LEU B N     1 
ATOM   3676 C  CA    . LEU D 2 82  ? -10.649 -13.090 -26.439 1.00 46.84 ? 82  LEU B CA    1 
ATOM   3677 C  C     . LEU D 2 82  ? -9.184  -12.922 -26.011 1.00 49.99 ? 82  LEU B C     1 
ATOM   3678 O  O     . LEU D 2 82  ? -8.414  -13.884 -26.008 1.00 52.19 ? 82  LEU B O     1 
ATOM   3679 C  CB    . LEU D 2 82  ? -10.874 -12.538 -27.847 1.00 52.91 ? 82  LEU B CB    1 
ATOM   3680 C  CG    . LEU D 2 82  ? -10.150 -13.163 -29.043 1.00 58.97 ? 82  LEU B CG    1 
ATOM   3681 C  CD1   . LEU D 2 82  ? -8.735  -12.622 -29.153 1.00 65.46 ? 82  LEU B CD1   1 
ATOM   3682 C  CD2   . LEU D 2 82  ? -10.151 -14.678 -28.901 1.00 63.72 ? 82  LEU B CD2   1 
ATOM   3683 N  N     . LEU D 2 83  ? -8.805  -11.703 -25.632 1.00 44.88 ? 83  LEU B N     1 
ATOM   3684 C  CA    . LEU D 2 83  ? -7.436  -11.434 -25.196 1.00 45.29 ? 83  LEU B CA    1 
ATOM   3685 C  C     . LEU D 2 83  ? -7.143  -11.997 -23.799 1.00 40.84 ? 83  LEU B C     1 
ATOM   3686 O  O     . LEU D 2 83  ? -6.003  -12.326 -23.484 1.00 42.37 ? 83  LEU B O     1 
ATOM   3687 C  CB    . LEU D 2 83  ? -7.156  -9.924  -25.183 1.00 43.56 ? 83  LEU B CB    1 
ATOM   3688 C  CG    . LEU D 2 83  ? -7.115  -9.136  -26.500 1.00 53.43 ? 83  LEU B CG    1 
ATOM   3689 C  CD1   . LEU D 2 83  ? -6.784  -7.675  -26.206 1.00 46.07 ? 83  LEU B CD1   1 
ATOM   3690 C  CD2   . LEU D 2 83  ? -6.073  -9.725  -27.434 1.00 48.36 ? 83  LEU B CD2   1 
ATOM   3691 N  N     . ALA D 2 84  ? -8.172  -12.099 -22.967 1.00 39.14 ? 84  ALA B N     1 
ATOM   3692 C  CA    . ALA D 2 84  ? -8.014  -12.589 -21.602 1.00 41.75 ? 84  ALA B CA    1 
ATOM   3693 C  C     . ALA D 2 84  ? -7.769  -14.099 -21.471 1.00 46.94 ? 84  ALA B C     1 
ATOM   3694 O  O     . ALA D 2 84  ? -7.202  -14.553 -20.471 1.00 41.99 ? 84  ALA B O     1 
ATOM   3695 C  CB    . ALA D 2 84  ? -9.230  -12.187 -20.776 1.00 33.90 ? 84  ALA B CB    1 
ATOM   3696 N  N     . GLN D 2 85  ? -8.189  -14.874 -22.467 1.00 48.50 ? 85  GLN B N     1 
ATOM   3697 C  CA    . GLN D 2 85  ? -8.012  -16.328 -22.419 1.00 50.95 ? 85  GLN B CA    1 
ATOM   3698 C  C     . GLN D 2 85  ? -6.609  -16.707 -21.958 1.00 54.58 ? 85  GLN B C     1 
ATOM   3699 O  O     . GLN D 2 85  ? -6.421  -17.505 -21.041 1.00 54.59 ? 85  GLN B O     1 
ATOM   3700 C  CB    . GLN D 2 85  ? -8.275  -16.934 -23.794 1.00 55.17 ? 85  GLN B CB    1 
ATOM   3701 C  CG    . GLN D 2 85  ? -9.708  -16.775 -24.280 1.00 58.16 ? 85  GLN B CG    1 
ATOM   3702 C  CD    . GLN D 2 85  ? -9.946  -17.459 -25.619 1.00 67.32 ? 85  GLN B CD    1 
ATOM   3703 O  OE1   . GLN D 2 85  ? -11.062 -17.448 -26.146 1.00 68.43 ? 85  GLN B OE1   1 
ATOM   3704 N  NE2   . GLN D 2 85  ? -8.893  -18.062 -26.176 1.00 61.63 ? 85  GLN B NE2   1 
ATOM   3705 N  N     . LYS D 2 86  ? -5.632  -16.108 -22.614 1.00 55.90 ? 86  LYS B N     1 
ATOM   3706 C  CA    . LYS D 2 86  ? -4.223  -16.314 -22.336 1.00 52.28 ? 86  LYS B CA    1 
ATOM   3707 C  C     . LYS D 2 86  ? -3.896  -16.170 -20.843 1.00 57.79 ? 86  LYS B C     1 
ATOM   3708 O  O     . LYS D 2 86  ? -2.974  -16.817 -20.333 1.00 51.41 ? 86  LYS B O     1 
ATOM   3709 C  CB    . LYS D 2 86  ? -3.445  -15.285 -23.153 1.00 55.64 ? 86  LYS B CB    1 
ATOM   3710 C  CG    . LYS D 2 86  ? -1.946  -15.373 -23.117 1.00 52.71 ? 86  LYS B CG    1 
ATOM   3711 C  CD    . LYS D 2 86  ? -1.397  -14.286 -24.030 1.00 57.50 ? 86  LYS B CD    1 
ATOM   3712 C  CE    . LYS D 2 86  ? 0.078   -14.438 -24.296 1.00 55.85 ? 86  LYS B CE    1 
ATOM   3713 N  NZ    . LYS D 2 86  ? 0.511   -13.464 -25.328 1.00 55.24 ? 86  LYS B NZ    1 
ATOM   3714 N  N     . LEU D 2 87  ? -4.658  -15.329 -20.147 1.00 52.82 ? 87  LEU B N     1 
ATOM   3715 C  CA    . LEU D 2 87  ? -4.422  -15.080 -18.724 1.00 51.53 ? 87  LEU B CA    1 
ATOM   3716 C  C     . LEU D 2 87  ? -5.185  -15.991 -17.760 1.00 48.83 ? 87  LEU B C     1 
ATOM   3717 O  O     . LEU D 2 87  ? -4.826  -16.073 -16.587 1.00 42.07 ? 87  LEU B O     1 
ATOM   3718 C  CB    . LEU D 2 87  ? -4.734  -13.612 -18.393 1.00 50.57 ? 87  LEU B CB    1 
ATOM   3719 C  CG    . LEU D 2 87  ? -3.913  -12.557 -19.150 1.00 49.36 ? 87  LEU B CG    1 
ATOM   3720 C  CD1   . LEU D 2 87  ? -4.429  -11.157 -18.853 1.00 43.19 ? 87  LEU B CD1   1 
ATOM   3721 C  CD2   . LEU D 2 87  ? -2.451  -12.681 -18.758 1.00 46.55 ? 87  LEU B CD2   1 
ATOM   3722 N  N     . GLU D 2 88  ? -6.225  -16.665 -18.249 1.00 48.78 ? 88  GLU B N     1 
ATOM   3723 C  CA    . GLU D 2 88  ? -7.039  -17.565 -17.423 1.00 55.70 ? 88  GLU B CA    1 
ATOM   3724 C  C     . GLU D 2 88  ? -7.590  -16.871 -16.181 1.00 56.96 ? 88  GLU B C     1 
ATOM   3725 O  O     . GLU D 2 88  ? -7.580  -17.442 -15.086 1.00 54.70 ? 88  GLU B O     1 
ATOM   3726 C  CB    . GLU D 2 88  ? -6.223  -18.777 -16.966 1.00 56.84 ? 88  GLU B CB    1 
ATOM   3727 C  CG    . GLU D 2 88  ? -5.549  -19.550 -18.070 1.00 63.24 ? 88  GLU B CG    1 
ATOM   3728 C  CD    . GLU D 2 88  ? -4.841  -20.784 -17.547 1.00 66.72 ? 88  GLU B CD    1 
ATOM   3729 O  OE1   . GLU D 2 88  ? -5.533  -21.710 -17.072 1.00 67.26 ? 88  GLU B OE1   1 
ATOM   3730 O  OE2   . GLU D 2 88  ? -3.593  -20.822 -17.607 1.00 68.86 ? 88  GLU B OE2   1 
ATOM   3731 N  N     . LEU D 2 89  ? -8.073  -15.645 -16.353 1.00 57.80 ? 89  LEU B N     1 
ATOM   3732 C  CA    . LEU D 2 89  ? -8.615  -14.867 -15.242 1.00 58.11 ? 89  LEU B CA    1 
ATOM   3733 C  C     . LEU D 2 89  ? -9.657  -15.611 -14.419 1.00 58.49 ? 89  LEU B C     1 
ATOM   3734 O  O     . LEU D 2 89  ? -9.699  -15.481 -13.196 1.00 53.18 ? 89  LEU B O     1 
ATOM   3735 C  CB    . LEU D 2 89  ? -9.233  -13.568 -15.764 1.00 56.46 ? 89  LEU B CB    1 
ATOM   3736 C  CG    . LEU D 2 89  ? -8.272  -12.572 -16.403 1.00 53.51 ? 89  LEU B CG    1 
ATOM   3737 C  CD1   . LEU D 2 89  ? -9.046  -11.375 -16.940 1.00 49.28 ? 89  LEU B CD1   1 
ATOM   3738 C  CD2   . LEU D 2 89  ? -7.241  -12.146 -15.370 1.00 45.96 ? 89  LEU B CD2   1 
ATOM   3739 N  N     . HIS D 2 90  ? -10.494 -16.388 -15.102 1.00 63.40 ? 90  HIS B N     1 
ATOM   3740 C  CA    . HIS D 2 90  ? -11.561 -17.142 -14.455 1.00 65.41 ? 90  HIS B CA    1 
ATOM   3741 C  C     . HIS D 2 90  ? -11.127 -17.863 -13.183 1.00 63.05 ? 90  HIS B C     1 
ATOM   3742 O  O     . HIS D 2 90  ? -11.956 -18.128 -12.313 1.00 63.92 ? 90  HIS B O     1 
ATOM   3743 C  CB    . HIS D 2 90  ? -12.168 -18.163 -15.432 1.00 70.13 ? 90  HIS B CB    1 
ATOM   3744 C  CG    . HIS D 2 90  ? -11.276 -19.332 -15.718 1.00 75.20 ? 90  HIS B CG    1 
ATOM   3745 N  ND1   . HIS D 2 90  ? -10.438 -19.381 -16.811 1.00 77.68 ? 90  HIS B ND1   1 
ATOM   3746 C  CD2   . HIS D 2 90  ? -11.063 -20.478 -15.029 1.00 72.60 ? 90  HIS B CD2   1 
ATOM   3747 C  CE1   . HIS D 2 90  ? -9.746  -20.506 -16.783 1.00 77.95 ? 90  HIS B CE1   1 
ATOM   3748 N  NE2   . HIS D 2 90  ? -10.106 -21.189 -15.711 1.00 73.69 ? 90  HIS B NE2   1 
ATOM   3749 N  N     . LYS D 2 91  ? -9.843  -18.185 -13.059 1.00 57.63 ? 91  LYS B N     1 
ATOM   3750 C  CA    . LYS D 2 91  ? -9.402  -18.879 -11.860 1.00 60.75 ? 91  LYS B CA    1 
ATOM   3751 C  C     . LYS D 2 91  ? -8.612  -18.031 -10.870 1.00 61.15 ? 91  LYS B C     1 
ATOM   3752 O  O     . LYS D 2 91  ? -7.869  -18.556 -10.038 1.00 60.07 ? 91  LYS B O     1 
ATOM   3753 C  CB    . LYS D 2 91  ? -8.616  -20.141 -12.230 1.00 61.24 ? 91  LYS B CB    1 
ATOM   3754 C  CG    . LYS D 2 91  ? -7.326  -19.952 -13.005 1.00 64.60 ? 91  LYS B CG    1 
ATOM   3755 C  CD    . LYS D 2 91  ? -6.753  -21.334 -13.310 1.00 61.08 ? 91  LYS B CD    1 
ATOM   3756 C  CE    . LYS D 2 91  ? -5.463  -21.291 -14.097 1.00 61.36 ? 91  LYS B CE    1 
ATOM   3757 N  NZ    . LYS D 2 91  ? -5.025  -22.677 -14.454 1.00 67.01 ? 91  LYS B NZ    1 
ATOM   3758 N  N     . PHE D 2 92  ? -8.789  -16.717 -10.956 1.00 57.35 ? 92  PHE B N     1 
ATOM   3759 C  CA    . PHE D 2 92  ? -8.116  -15.787 -10.059 1.00 52.38 ? 92  PHE B CA    1 
ATOM   3760 C  C     . PHE D 2 92  ? -9.150  -14.820 -9.519  1.00 52.44 ? 92  PHE B C     1 
ATOM   3761 O  O     . PHE D 2 92  ? -8.957  -14.210 -8.467  1.00 54.76 ? 92  PHE B O     1 
ATOM   3762 C  CB    . PHE D 2 92  ? -7.044  -14.994 -10.802 1.00 55.94 ? 92  PHE B CB    1 
ATOM   3763 C  CG    . PHE D 2 92  ? -5.945  -15.837 -11.354 1.00 54.07 ? 92  PHE B CG    1 
ATOM   3764 C  CD1   . PHE D 2 92  ? -5.071  -16.501 -10.505 1.00 56.68 ? 92  PHE B CD1   1 
ATOM   3765 C  CD2   . PHE D 2 92  ? -5.785  -15.975 -12.725 1.00 51.81 ? 92  PHE B CD2   1 
ATOM   3766 C  CE1   . PHE D 2 92  ? -4.053  -17.292 -11.016 1.00 54.55 ? 92  PHE B CE1   1 
ATOM   3767 C  CE2   . PHE D 2 92  ? -4.772  -16.763 -13.244 1.00 49.55 ? 92  PHE B CE2   1 
ATOM   3768 C  CZ    . PHE D 2 92  ? -3.905  -17.423 -12.388 1.00 51.83 ? 92  PHE B CZ    1 
ATOM   3769 N  N     . ILE D 2 93  ? -10.248 -14.694 -10.260 1.00 49.24 ? 93  ILE B N     1 
ATOM   3770 C  CA    . ILE D 2 93  ? -11.340 -13.794 -9.916  1.00 47.59 ? 93  ILE B CA    1 
ATOM   3771 C  C     . ILE D 2 93  ? -12.132 -14.198 -8.673  1.00 51.31 ? 93  ILE B C     1 
ATOM   3772 O  O     . ILE D 2 93  ? -12.530 -15.351 -8.526  1.00 54.05 ? 93  ILE B O     1 
ATOM   3773 C  CB    . ILE D 2 93  ? -12.300 -13.653 -11.115 1.00 46.32 ? 93  ILE B CB    1 
ATOM   3774 C  CG1   . ILE D 2 93  ? -11.596 -12.868 -12.234 1.00 46.62 ? 93  ILE B CG1   1 
ATOM   3775 C  CG2   . ILE D 2 93  ? -13.596 -12.988 -10.674 1.00 35.24 ? 93  ILE B CG2   1 
ATOM   3776 C  CD1   . ILE D 2 93  ? -12.372 -12.773 -13.539 1.00 51.92 ? 93  ILE B CD1   1 
ATOM   3777 N  N     . ARG D 2 94  ? -12.367 -13.231 -7.788  1.00 48.61 ? 94  ARG B N     1 
ATOM   3778 C  CA    . ARG D 2 94  ? -13.101 -13.487 -6.557  1.00 45.52 ? 94  ARG B CA    1 
ATOM   3779 C  C     . ARG D 2 94  ? -14.508 -12.906 -6.600  1.00 46.52 ? 94  ARG B C     1 
ATOM   3780 O  O     . ARG D 2 94  ? -14.694 -11.690 -6.662  1.00 49.56 ? 94  ARG B O     1 
ATOM   3781 C  CB    . ARG D 2 94  ? -12.340 -12.912 -5.359  1.00 38.62 ? 94  ARG B CB    1 
ATOM   3782 C  CG    . ARG D 2 94  ? -10.860 -13.270 -5.339  1.00 42.93 ? 94  ARG B CG    1 
ATOM   3783 C  CD    . ARG D 2 94  ? -10.229 -12.958 -3.993  1.00 50.29 ? 94  ARG B CD    1 
ATOM   3784 N  NE    . ARG D 2 94  ? -10.447 -11.574 -3.574  1.00 53.44 ? 94  ARG B NE    1 
ATOM   3785 C  CZ    . ARG D 2 94  ? -9.915  -11.031 -2.482  1.00 55.33 ? 94  ARG B CZ    1 
ATOM   3786 N  NH1   . ARG D 2 94  ? -9.132  -11.758 -1.699  1.00 47.93 ? 94  ARG B NH1   1 
ATOM   3787 N  NH2   . ARG D 2 94  ? -10.167 -9.764  -2.171  1.00 44.87 ? 94  ARG B NH2   1 
ATOM   3788 N  N     . ILE D 2 95  ? -15.501 -13.782 -6.548  1.00 43.87 ? 95  ILE B N     1 
ATOM   3789 C  CA    . ILE D 2 95  ? -16.893 -13.355 -6.588  1.00 58.60 ? 95  ILE B CA    1 
ATOM   3790 C  C     . ILE D 2 95  ? -17.737 -14.283 -5.700  1.00 65.10 ? 95  ILE B C     1 
ATOM   3791 O  O     . ILE D 2 95  ? -17.301 -15.385 -5.360  1.00 64.59 ? 95  ILE B O     1 
ATOM   3792 C  CB    . ILE D 2 95  ? -17.410 -13.374 -8.053  1.00 55.29 ? 95  ILE B CB    1 
ATOM   3793 C  CG1   . ILE D 2 95  ? -18.815 -12.786 -8.132  1.00 54.99 ? 95  ILE B CG1   1 
ATOM   3794 C  CG2   . ILE D 2 95  ? -17.399 -14.794 -8.589  1.00 55.52 ? 95  ILE B CG2   1 
ATOM   3795 C  CD1   . ILE D 2 95  ? -19.326 -12.657 -9.548  1.00 58.49 ? 95  ILE B CD1   1 
ATOM   3796 N  N     . LYS D 2 96  ? -18.930 -13.831 -5.316  1.00 69.50 ? 96  LYS B N     1 
ATOM   3797 C  CA    . LYS D 2 96  ? -19.823 -14.621 -4.465  1.00 76.90 ? 96  LYS B CA    1 
ATOM   3798 C  C     . LYS D 2 96  ? -21.193 -14.809 -5.104  1.00 78.30 ? 96  LYS B C     1 
ATOM   3799 O  O     . LYS D 2 96  ? -21.538 -15.900 -5.556  1.00 78.41 ? 96  LYS B O     1 
ATOM   3800 C  CB    . LYS D 2 96  ? -20.005 -13.937 -3.107  1.00 80.57 ? 96  LYS B CB    1 
ATOM   3801 C  CG    . LYS D 2 96  ? -18.749 -13.869 -2.263  1.00 86.86 ? 96  LYS B CG    1 
ATOM   3802 C  CD    . LYS D 2 96  ? -18.559 -15.133 -1.451  1.00 89.60 ? 96  LYS B CD    1 
ATOM   3803 C  CE    . LYS D 2 96  ? -18.650 -14.830 0.039   1.00 93.98 ? 96  LYS B CE    1 
ATOM   3804 N  NZ    . LYS D 2 96  ? -19.946 -14.194 0.408   1.00 91.04 ? 96  LYS B NZ    1 
ATOM   3805 N  N     . ARG D 2 97  ? -21.972 -13.734 -5.131  1.00 81.16 ? 97  ARG B N     1 
ATOM   3806 C  CA    . ARG D 2 97  ? -23.311 -13.766 -5.703  1.00 85.56 ? 97  ARG B CA    1 
ATOM   3807 C  C     . ARG D 2 97  ? -23.272 -13.621 -7.221  1.00 86.72 ? 97  ARG B C     1 
ATOM   3808 O  O     . ARG D 2 97  ? -23.689 -12.597 -7.766  1.00 85.74 ? 97  ARG B O     1 
ATOM   3809 C  CB    . ARG D 2 97  ? -24.164 -12.648 -5.089  1.00 86.90 ? 97  ARG B CB    1 
ATOM   3810 C  CG    . ARG D 2 97  ? -24.358 -12.780 -3.581  1.00 92.70 ? 97  ARG B CG    1 
ATOM   3811 C  CD    . ARG D 2 97  ? -25.184 -14.013 -3.240  1.00 95.03 ? 97  ARG B CD    1 
ATOM   3812 N  NE    . ARG D 2 97  ? -25.090 -14.380 -1.830  1.00 97.04 ? 97  ARG B NE    1 
ATOM   3813 C  CZ    . ARG D 2 97  ? -23.980 -14.815 -1.242  1.00 98.33 ? 97  ARG B CZ    1 
ATOM   3814 N  NH1   . ARG D 2 97  ? -22.862 -14.937 -1.944  1.00 99.84 ? 97  ARG B NH1   1 
ATOM   3815 N  NH2   . ARG D 2 97  ? -23.989 -15.136 0.045   1.00 99.05 ? 97  ARG B NH2   1 
ATOM   3816 N  N     . GLY D 2 98  ? -22.772 -14.652 -7.901  1.00 86.72 ? 98  GLY B N     1 
ATOM   3817 C  CA    . GLY D 2 98  ? -22.696 -14.611 -9.351  1.00 84.17 ? 98  GLY B CA    1 
ATOM   3818 C  C     . GLY D 2 98  ? -21.721 -15.595 -9.974  1.00 80.75 ? 98  GLY B C     1 
ATOM   3819 O  O     . GLY D 2 98  ? -20.970 -16.281 -9.279  1.00 79.45 ? 98  GLY B O     1 
ATOM   3820 N  N     . LYS D 2 99  ? -21.738 -15.660 -11.301 1.00 76.84 ? 99  LYS B N     1 
ATOM   3821 C  CA    . LYS D 2 99  ? -20.861 -16.554 -12.047 1.00 73.78 ? 99  LYS B CA    1 
ATOM   3822 C  C     . LYS D 2 99  ? -19.922 -15.713 -12.900 1.00 66.34 ? 99  LYS B C     1 
ATOM   3823 O  O     . LYS D 2 99  ? -20.315 -14.677 -13.428 1.00 70.48 ? 99  LYS B O     1 
ATOM   3824 C  CB    . LYS D 2 99  ? -21.698 -17.484 -12.932 1.00 81.71 ? 99  LYS B CB    1 
ATOM   3825 C  CG    . LYS D 2 99  ? -20.927 -18.620 -13.588 1.00 87.93 ? 99  LYS B CG    1 
ATOM   3826 C  CD    . LYS D 2 99  ? -21.878 -19.565 -14.323 1.00 95.87 ? 99  LYS B CD    1 
ATOM   3827 C  CE    . LYS D 2 99  ? -21.149 -20.773 -14.908 1.00 99.35 ? 99  LYS B CE    1 
ATOM   3828 N  NZ    . LYS D 2 99  ? -22.087 -21.725 -15.573 1.00 97.44 ? 99  LYS B NZ    1 
ATOM   3829 N  N     . ILE D 2 100 ? -18.680 -16.160 -13.033 1.00 60.49 ? 100 ILE B N     1 
ATOM   3830 C  CA    . ILE D 2 100 ? -17.692 -15.426 -13.810 1.00 57.40 ? 100 ILE B CA    1 
ATOM   3831 C  C     . ILE D 2 100 ? -18.013 -15.406 -15.299 1.00 58.86 ? 100 ILE B C     1 
ATOM   3832 O  O     . ILE D 2 100 ? -17.386 -16.123 -16.081 1.00 61.03 ? 100 ILE B O     1 
ATOM   3833 C  CB    . ILE D 2 100 ? -16.283 -16.024 -13.624 1.00 52.79 ? 100 ILE B CB    1 
ATOM   3834 C  CG1   . ILE D 2 100 ? -15.927 -16.075 -12.137 1.00 53.29 ? 100 ILE B CG1   1 
ATOM   3835 C  CG2   . ILE D 2 100 ? -15.265 -15.176 -14.365 1.00 57.38 ? 100 ILE B CG2   1 
ATOM   3836 C  CD1   . ILE D 2 100 ? -14.527 -16.576 -11.851 1.00 48.61 ? 100 ILE B CD1   1 
ATOM   3837 N  N     . ASN D 2 101 ? -18.981 -14.586 -15.698 1.00 55.68 ? 101 ASN B N     1 
ATOM   3838 C  CA    . ASN D 2 101 ? -19.347 -14.501 -17.108 1.00 53.62 ? 101 ASN B CA    1 
ATOM   3839 C  C     . ASN D 2 101 ? -18.379 -13.613 -17.895 1.00 52.91 ? 101 ASN B C     1 
ATOM   3840 O  O     . ASN D 2 101 ? -17.345 -13.186 -17.384 1.00 54.07 ? 101 ASN B O     1 
ATOM   3841 C  CB    . ASN D 2 101 ? -20.768 -13.967 -17.266 1.00 52.50 ? 101 ASN B CB    1 
ATOM   3842 C  CG    . ASN D 2 101 ? -20.921 -12.575 -16.720 1.00 59.21 ? 101 ASN B CG    1 
ATOM   3843 O  OD1   . ASN D 2 101 ? -20.027 -11.742 -16.863 1.00 60.83 ? 101 ASN B OD1   1 
ATOM   3844 N  ND2   . ASN D 2 101 ? -22.062 -12.305 -16.099 1.00 59.72 ? 101 ASN B ND2   1 
ATOM   3845 N  N     . GLU D 2 102 ? -18.725 -13.322 -19.139 1.00 50.08 ? 102 GLU B N     1 
ATOM   3846 C  CA    . GLU D 2 102 ? -17.855 -12.514 -19.972 1.00 53.80 ? 102 GLU B CA    1 
ATOM   3847 C  C     . GLU D 2 102 ? -17.847 -11.032 -19.612 1.00 50.13 ? 102 GLU B C     1 
ATOM   3848 O  O     . GLU D 2 102 ? -16.914 -10.314 -19.963 1.00 48.62 ? 102 GLU B O     1 
ATOM   3849 C  CB    . GLU D 2 102 ? -18.207 -12.725 -21.444 1.00 52.88 ? 102 GLU B CB    1 
ATOM   3850 C  CG    . GLU D 2 102 ? -18.206 -14.199 -21.830 1.00 64.85 ? 102 GLU B CG    1 
ATOM   3851 C  CD    . GLU D 2 102 ? -17.938 -14.422 -23.299 1.00 70.85 ? 102 GLU B CD    1 
ATOM   3852 O  OE1   . GLU D 2 102 ? -18.588 -13.754 -24.133 1.00 74.93 ? 102 GLU B OE1   1 
ATOM   3853 O  OE2   . GLU D 2 102 ? -17.078 -15.272 -23.619 1.00 74.15 ? 102 GLU B OE2   1 
ATOM   3854 N  N     . THR D 2 103 ? -18.869 -10.568 -18.909 1.00 45.83 ? 103 THR B N     1 
ATOM   3855 C  CA    . THR D 2 103 ? -18.891 -9.172  -18.507 1.00 48.95 ? 103 THR B CA    1 
ATOM   3856 C  C     . THR D 2 103 ? -17.870 -8.986  -17.385 1.00 50.03 ? 103 THR B C     1 
ATOM   3857 O  O     . THR D 2 103 ? -17.077 -8.043  -17.401 1.00 49.82 ? 103 THR B O     1 
ATOM   3858 C  CB    . THR D 2 103 ? -20.271 -8.746  -18.003 1.00 44.78 ? 103 THR B CB    1 
ATOM   3859 O  OG1   . THR D 2 103 ? -21.220 -8.861  -19.068 1.00 53.68 ? 103 THR B OG1   1 
ATOM   3860 C  CG2   . THR D 2 103 ? -20.232 -7.301  -17.522 1.00 42.00 ? 103 THR B CG2   1 
ATOM   3861 N  N     . ILE D 2 104 ? -17.891 -9.898  -16.419 1.00 41.49 ? 104 ILE B N     1 
ATOM   3862 C  CA    . ILE D 2 104 ? -16.961 -9.854  -15.297 1.00 43.91 ? 104 ILE B CA    1 
ATOM   3863 C  C     . ILE D 2 104 ? -15.522 -9.941  -15.803 1.00 38.91 ? 104 ILE B C     1 
ATOM   3864 O  O     . ILE D 2 104 ? -14.658 -9.178  -15.386 1.00 46.44 ? 104 ILE B O     1 
ATOM   3865 C  CB    . ILE D 2 104 ? -17.191 -11.039 -14.313 1.00 45.20 ? 104 ILE B CB    1 
ATOM   3866 C  CG1   . ILE D 2 104 ? -18.607 -10.993 -13.741 1.00 47.66 ? 104 ILE B CG1   1 
ATOM   3867 C  CG2   . ILE D 2 104 ? -16.171 -10.989 -13.191 1.00 41.47 ? 104 ILE B CG2   1 
ATOM   3868 C  CD1   . ILE D 2 104 ? -18.917 -9.738  -12.975 1.00 56.66 ? 104 ILE B CD1   1 
ATOM   3869 N  N     . ILE D 2 105 ? -15.275 -10.882 -16.701 1.00 32.69 ? 105 ILE B N     1 
ATOM   3870 C  CA    . ILE D 2 105 ? -13.947 -11.087 -17.259 1.00 38.50 ? 105 ILE B CA    1 
ATOM   3871 C  C     . ILE D 2 105 ? -13.400 -9.846  -17.947 1.00 37.87 ? 105 ILE B C     1 
ATOM   3872 O  O     . ILE D 2 105 ? -12.239 -9.472  -17.746 1.00 37.83 ? 105 ILE B O     1 
ATOM   3873 C  CB    . ILE D 2 105 ? -13.958 -12.247 -18.261 1.00 41.55 ? 105 ILE B CB    1 
ATOM   3874 C  CG1   . ILE D 2 105 ? -14.323 -13.541 -17.527 1.00 54.72 ? 105 ILE B CG1   1 
ATOM   3875 C  CG2   . ILE D 2 105 ? -12.602 -12.362 -18.939 1.00 33.75 ? 105 ILE B CG2   1 
ATOM   3876 C  CD1   . ILE D 2 105 ? -14.563 -14.724 -18.431 1.00 54.58 ? 105 ILE B CD1   1 
ATOM   3877 N  N     . GLY D 2 106 ? -14.238 -9.218  -18.766 1.00 38.61 ? 106 GLY B N     1 
ATOM   3878 C  CA    . GLY D 2 106 ? -13.824 -8.015  -19.462 1.00 40.24 ? 106 GLY B CA    1 
ATOM   3879 C  C     . GLY D 2 106 ? -13.498 -6.887  -18.493 1.00 36.08 ? 106 GLY B C     1 
ATOM   3880 O  O     . GLY D 2 106 ? -12.497 -6.189  -18.660 1.00 38.90 ? 106 GLY B O     1 
ATOM   3881 N  N     . ASP D 2 107 ? -14.330 -6.707  -17.472 1.00 37.41 ? 107 ASP B N     1 
ATOM   3882 C  CA    . ASP D 2 107 ? -14.084 -5.644  -16.510 1.00 38.65 ? 107 ASP B CA    1 
ATOM   3883 C  C     . ASP D 2 107 ? -12.837 -5.916  -15.684 1.00 43.67 ? 107 ASP B C     1 
ATOM   3884 O  O     . ASP D 2 107 ? -12.082 -4.988  -15.384 1.00 39.89 ? 107 ASP B O     1 
ATOM   3885 C  CB    . ASP D 2 107 ? -15.301 -5.430  -15.611 1.00 42.84 ? 107 ASP B CB    1 
ATOM   3886 C  CG    . ASP D 2 107 ? -16.508 -4.911  -16.384 1.00 41.63 ? 107 ASP B CG    1 
ATOM   3887 O  OD1   . ASP D 2 107 ? -16.314 -4.197  -17.391 1.00 44.56 ? 107 ASP B OD1   1 
ATOM   3888 O  OD2   . ASP D 2 107 ? -17.648 -5.203  -15.980 1.00 49.07 ? 107 ASP B OD2   1 
ATOM   3889 N  N     . VAL D 2 108 ? -12.608 -7.179  -15.328 1.00 36.09 ? 108 VAL B N     1 
ATOM   3890 C  CA    . VAL D 2 108 ? -11.433 -7.533  -14.544 1.00 35.40 ? 108 VAL B CA    1 
ATOM   3891 C  C     . VAL D 2 108 ? -10.209 -7.336  -15.421 1.00 35.74 ? 108 VAL B C     1 
ATOM   3892 O  O     . VAL D 2 108 ? -9.128  -6.971  -14.941 1.00 34.54 ? 108 VAL B O     1 
ATOM   3893 C  CB    . VAL D 2 108 ? -11.493 -9.006  -14.045 1.00 36.38 ? 108 VAL B CB    1 
ATOM   3894 C  CG1   . VAL D 2 108 ? -10.113 -9.471  -13.576 1.00 27.32 ? 108 VAL B CG1   1 
ATOM   3895 C  CG2   . VAL D 2 108 ? -12.467 -9.113  -12.893 1.00 31.61 ? 108 VAL B CG2   1 
ATOM   3896 N  N     . PHE D 2 109 ? -10.379 -7.580  -16.714 1.00 32.82 ? 109 PHE B N     1 
ATOM   3897 C  CA    . PHE D 2 109 ? -9.275  -7.394  -17.640 1.00 31.67 ? 109 PHE B CA    1 
ATOM   3898 C  C     . PHE D 2 109 ? -8.878  -5.918  -17.632 1.00 34.35 ? 109 PHE B C     1 
ATOM   3899 O  O     . PHE D 2 109 ? -7.696  -5.589  -17.582 1.00 38.35 ? 109 PHE B O     1 
ATOM   3900 C  CB    . PHE D 2 109 ? -9.687  -7.803  -19.048 1.00 34.36 ? 109 PHE B CB    1 
ATOM   3901 C  CG    . PHE D 2 109 ? -8.613  -7.603  -20.070 1.00 36.93 ? 109 PHE B CG    1 
ATOM   3902 C  CD1   . PHE D 2 109 ? -7.512  -8.453  -20.115 1.00 41.84 ? 109 PHE B CD1   1 
ATOM   3903 C  CD2   . PHE D 2 109 ? -8.707  -6.571  -21.002 1.00 33.92 ? 109 PHE B CD2   1 
ATOM   3904 C  CE1   . PHE D 2 109 ? -6.513  -8.282  -21.080 1.00 41.63 ? 109 PHE B CE1   1 
ATOM   3905 C  CE2   . PHE D 2 109 ? -7.722  -6.389  -21.971 1.00 37.53 ? 109 PHE B CE2   1 
ATOM   3906 C  CZ    . PHE D 2 109 ? -6.620  -7.247  -22.013 1.00 41.85 ? 109 PHE B CZ    1 
ATOM   3907 N  N     . GLU D 2 110 ? -9.872  -5.037  -17.686 1.00 31.28 ? 110 GLU B N     1 
ATOM   3908 C  CA    . GLU D 2 110 ? -9.615  -3.596  -17.676 1.00 43.53 ? 110 GLU B CA    1 
ATOM   3909 C  C     . GLU D 2 110 ? -9.022  -3.119  -16.355 1.00 43.43 ? 110 GLU B C     1 
ATOM   3910 O  O     . GLU D 2 110 ? -8.056  -2.362  -16.341 1.00 41.74 ? 110 GLU B O     1 
ATOM   3911 C  CB    . GLU D 2 110 ? -10.909 -2.830  -17.941 1.00 41.39 ? 110 GLU B CB    1 
ATOM   3912 C  CG    . GLU D 2 110 ? -11.590 -3.212  -19.229 1.00 47.58 ? 110 GLU B CG    1 
ATOM   3913 C  CD    . GLU D 2 110 ? -12.921 -2.522  -19.395 1.00 53.42 ? 110 GLU B CD    1 
ATOM   3914 O  OE1   . GLU D 2 110 ? -13.896 -2.941  -18.732 1.00 58.75 ? 110 GLU B OE1   1 
ATOM   3915 O  OE2   . GLU D 2 110 ? -12.989 -1.557  -20.188 1.00 60.24 ? 110 GLU B OE2   1 
ATOM   3916 N  N     . ALA D 2 111 ? -9.615  -3.555  -15.246 1.00 42.40 ? 111 ALA B N     1 
ATOM   3917 C  CA    . ALA D 2 111 ? -9.141  -3.170  -13.920 1.00 41.38 ? 111 ALA B CA    1 
ATOM   3918 C  C     . ALA D 2 111 ? -7.723  -3.686  -13.679 1.00 41.13 ? 111 ALA B C     1 
ATOM   3919 O  O     . ALA D 2 111 ? -6.907  -3.046  -13.011 1.00 35.26 ? 111 ALA B O     1 
ATOM   3920 C  CB    . ALA D 2 111 ? -10.080 -3.720  -12.863 1.00 42.33 ? 111 ALA B CB    1 
ATOM   3921 N  N     . LEU D 2 112 ? -7.440  -4.853  -14.237 1.00 39.08 ? 112 LEU B N     1 
ATOM   3922 C  CA    . LEU D 2 112 ? -6.143  -5.481  -14.093 1.00 41.19 ? 112 LEU B CA    1 
ATOM   3923 C  C     . LEU D 2 112 ? -5.068  -4.596  -14.719 1.00 39.02 ? 112 LEU B C     1 
ATOM   3924 O  O     . LEU D 2 112 ? -3.959  -4.495  -14.201 1.00 38.52 ? 112 LEU B O     1 
ATOM   3925 C  CB    . LEU D 2 112 ? -6.169  -6.860  -14.768 1.00 46.35 ? 112 LEU B CB    1 
ATOM   3926 C  CG    . LEU D 2 112 ? -5.355  -7.990  -14.143 1.00 50.47 ? 112 LEU B CG    1 
ATOM   3927 C  CD1   . LEU D 2 112 ? -5.426  -9.240  -15.009 1.00 50.15 ? 112 LEU B CD1   1 
ATOM   3928 C  CD2   . LEU D 2 112 ? -3.904  -7.557  -13.953 1.00 58.27 ? 112 LEU B CD2   1 
ATOM   3929 N  N     . TRP D 2 113 ? -5.387  -3.961  -15.843 1.00 33.95 ? 113 TRP B N     1 
ATOM   3930 C  CA    . TRP D 2 113 ? -4.410  -3.094  -16.476 1.00 35.85 ? 113 TRP B CA    1 
ATOM   3931 C  C     . TRP D 2 113 ? -4.236  -1.788  -15.708 1.00 31.34 ? 113 TRP B C     1 
ATOM   3932 O  O     . TRP D 2 113 ? -3.143  -1.205  -15.696 1.00 33.69 ? 113 TRP B O     1 
ATOM   3933 C  CB    . TRP D 2 113 ? -4.760  -2.877  -17.923 1.00 31.69 ? 113 TRP B CB    1 
ATOM   3934 C  CG    . TRP D 2 113 ? -4.353  -4.149  -18.590 1.00 37.59 ? 113 TRP B CG    1 
ATOM   3935 C  CD1   . TRP D 2 113 ? -5.170  -5.136  -19.088 1.00 42.59 ? 113 TRP B CD1   1 
ATOM   3936 C  CD2   . TRP D 2 113 ? -3.008  -4.617  -18.778 1.00 36.11 ? 113 TRP B CD2   1 
ATOM   3937 N  NE1   . TRP D 2 113 ? -4.412  -6.190  -19.556 1.00 31.32 ? 113 TRP B NE1   1 
ATOM   3938 C  CE2   . TRP D 2 113 ? -3.085  -5.898  -19.376 1.00 36.15 ? 113 TRP B CE2   1 
ATOM   3939 C  CE3   . TRP D 2 113 ? -1.743  -4.078  -18.491 1.00 41.17 ? 113 TRP B CE3   1 
ATOM   3940 C  CZ2   . TRP D 2 113 ? -1.943  -6.651  -19.688 1.00 30.38 ? 113 TRP B CZ2   1 
ATOM   3941 C  CZ3   . TRP D 2 113 ? -0.606  -4.825  -18.804 1.00 36.97 ? 113 TRP B CZ3   1 
ATOM   3942 C  CH2   . TRP D 2 113 ? -0.718  -6.101  -19.396 1.00 38.85 ? 113 TRP B CH2   1 
ATOM   3943 N  N     . ALA D 2 114 ? -5.298  -1.321  -15.063 1.00 35.62 ? 114 ALA B N     1 
ATOM   3944 C  CA    . ALA D 2 114 ? -5.218  -0.109  -14.255 1.00 33.17 ? 114 ALA B CA    1 
ATOM   3945 C  C     . ALA D 2 114 ? -4.319  -0.392  -13.041 1.00 37.43 ? 114 ALA B C     1 
ATOM   3946 O  O     . ALA D 2 114 ? -3.509  0.448   -12.640 1.00 35.88 ? 114 ALA B O     1 
ATOM   3947 C  CB    . ALA D 2 114 ? -6.600  0.332   -13.792 1.00 30.52 ? 114 ALA B CB    1 
ATOM   3948 N  N     . ALA D 2 115 ? -4.462  -1.587  -12.467 1.00 39.49 ? 115 ALA B N     1 
ATOM   3949 C  CA    . ALA D 2 115 ? -3.671  -1.995  -11.306 1.00 38.41 ? 115 ALA B CA    1 
ATOM   3950 C  C     . ALA D 2 115 ? -2.179  -1.990  -11.630 1.00 37.39 ? 115 ALA B C     1 
ATOM   3951 O  O     . ALA D 2 115 ? -1.371  -1.450  -10.876 1.00 39.26 ? 115 ALA B O     1 
ATOM   3952 C  CB    . ALA D 2 115 ? -4.099  -3.391  -10.846 1.00 45.28 ? 115 ALA B CB    1 
ATOM   3953 N  N     . VAL D 2 116 ? -1.814  -2.610  -12.748 1.00 39.33 ? 116 VAL B N     1 
ATOM   3954 C  CA    . VAL D 2 116 ? -0.417  -2.647  -13.165 1.00 36.61 ? 116 VAL B CA    1 
ATOM   3955 C  C     . VAL D 2 116 ? 0.089   -1.211  -13.314 1.00 39.44 ? 116 VAL B C     1 
ATOM   3956 O  O     . VAL D 2 116 ? 1.146   -0.855  -12.811 1.00 38.56 ? 116 VAL B O     1 
ATOM   3957 C  CB    . VAL D 2 116 ? -0.247  -3.358  -14.522 1.00 33.67 ? 116 VAL B CB    1 
ATOM   3958 C  CG1   . VAL D 2 116 ? 1.171   -3.147  -15.028 1.00 34.98 ? 116 VAL B CG1   1 
ATOM   3959 C  CG2   . VAL D 2 116 ? -0.556  -4.853  -14.382 1.00 36.71 ? 116 VAL B CG2   1 
ATOM   3960 N  N     . TYR D 2 117 ? -0.681  -0.389  -14.014 1.00 35.00 ? 117 TYR B N     1 
ATOM   3961 C  CA    . TYR D 2 117 ? -0.305  1.002   -14.218 1.00 36.23 ? 117 TYR B CA    1 
ATOM   3962 C  C     . TYR D 2 117 ? 0.016   1.667   -12.881 1.00 36.04 ? 117 TYR B C     1 
ATOM   3963 O  O     . TYR D 2 117 ? 1.096   2.230   -12.691 1.00 39.23 ? 117 TYR B O     1 
ATOM   3964 C  CB    . TYR D 2 117 ? -1.452  1.733   -14.916 1.00 35.65 ? 117 TYR B CB    1 
ATOM   3965 C  CG    . TYR D 2 117 ? -1.332  3.233   -14.948 1.00 32.98 ? 117 TYR B CG    1 
ATOM   3966 C  CD1   . TYR D 2 117 ? -0.270  3.865   -15.603 1.00 27.29 ? 117 TYR B CD1   1 
ATOM   3967 C  CD2   . TYR D 2 117 ? -2.320  4.029   -14.374 1.00 35.40 ? 117 TYR B CD2   1 
ATOM   3968 C  CE1   . TYR D 2 117 ? -0.209  5.257   -15.689 1.00 32.25 ? 117 TYR B CE1   1 
ATOM   3969 C  CE2   . TYR D 2 117 ? -2.266  5.413   -14.454 1.00 33.66 ? 117 TYR B CE2   1 
ATOM   3970 C  CZ    . TYR D 2 117 ? -1.215  6.019   -15.114 1.00 37.23 ? 117 TYR B CZ    1 
ATOM   3971 O  OH    . TYR D 2 117 ? -1.200  7.389   -15.210 1.00 36.63 ? 117 TYR B OH    1 
ATOM   3972 N  N     . ILE D 2 118 ? -0.917  1.576   -11.945 1.00 32.09 ? 118 ILE B N     1 
ATOM   3973 C  CA    . ILE D 2 118 ? -0.731  2.184   -10.638 1.00 33.71 ? 118 ILE B CA    1 
ATOM   3974 C  C     . ILE D 2 118 ? 0.426   1.585   -9.832  1.00 40.06 ? 118 ILE B C     1 
ATOM   3975 O  O     . ILE D 2 118 ? 1.250   2.317   -9.271  1.00 33.17 ? 118 ILE B O     1 
ATOM   3976 C  CB    . ILE D 2 118 ? -2.032  2.097   -9.825  1.00 35.30 ? 118 ILE B CB    1 
ATOM   3977 C  CG1   . ILE D 2 118 ? -3.073  3.043   -10.433 1.00 32.57 ? 118 ILE B CG1   1 
ATOM   3978 C  CG2   . ILE D 2 118 ? -1.762  2.438   -8.357  1.00 43.57 ? 118 ILE B CG2   1 
ATOM   3979 C  CD1   . ILE D 2 118 ? -4.456  2.907   -9.831  1.00 31.59 ? 118 ILE B CD1   1 
ATOM   3980 N  N     . ASP D 2 119 ? 0.495   0.257   -9.792  1.00 38.04 ? 119 ASP B N     1 
ATOM   3981 C  CA    . ASP D 2 119 ? 1.532   -0.436  -9.041  1.00 33.92 ? 119 ASP B CA    1 
ATOM   3982 C  C     . ASP D 2 119 ? 2.927   -0.074  -9.520  1.00 37.11 ? 119 ASP B C     1 
ATOM   3983 O  O     . ASP D 2 119 ? 3.872   -0.041  -8.733  1.00 36.66 ? 119 ASP B O     1 
ATOM   3984 C  CB    . ASP D 2 119 ? 1.347   -1.951  -9.146  1.00 43.91 ? 119 ASP B CB    1 
ATOM   3985 C  CG    . ASP D 2 119 ? 2.140   -2.697  -8.098  1.00 46.02 ? 119 ASP B CG    1 
ATOM   3986 O  OD1   . ASP D 2 119 ? 1.713   -2.693  -6.926  1.00 43.59 ? 119 ASP B OD1   1 
ATOM   3987 O  OD2   . ASP D 2 119 ? 3.195   -3.270  -8.442  1.00 48.75 ? 119 ASP B OD2   1 
ATOM   3988 N  N     . SER D 2 120 ? 3.050   0.202   -10.812 1.00 36.65 ? 120 SER B N     1 
ATOM   3989 C  CA    . SER D 2 120 ? 4.338   0.553   -11.391 1.00 39.04 ? 120 SER B CA    1 
ATOM   3990 C  C     . SER D 2 120 ? 4.665   2.030   -11.192 1.00 39.23 ? 120 SER B C     1 
ATOM   3991 O  O     . SER D 2 120 ? 5.583   2.545   -11.823 1.00 43.54 ? 120 SER B O     1 
ATOM   3992 C  CB    . SER D 2 120 ? 4.355   0.233   -12.889 1.00 38.77 ? 120 SER B CB    1 
ATOM   3993 O  OG    . SER D 2 120 ? 3.526   1.131   -13.603 1.00 43.01 ? 120 SER B OG    1 
ATOM   3994 N  N     . GLY D 2 121 ? 3.919   2.703   -10.318 1.00 36.23 ? 121 GLY B N     1 
ATOM   3995 C  CA    . GLY D 2 121 ? 4.167   4.116   -10.071 1.00 35.83 ? 121 GLY B CA    1 
ATOM   3996 C  C     . GLY D 2 121 ? 3.594   4.968   -11.190 1.00 41.89 ? 121 GLY B C     1 
ATOM   3997 O  O     . GLY D 2 121 ? 4.159   5.997   -11.564 1.00 42.53 ? 121 GLY B O     1 
ATOM   3998 N  N     . ARG D 2 122 ? 2.454   4.530   -11.714 1.00 40.71 ? 122 ARG B N     1 
ATOM   3999 C  CA    . ARG D 2 122 ? 1.780   5.205   -12.807 1.00 41.55 ? 122 ARG B CA    1 
ATOM   4000 C  C     . ARG D 2 122 ? 2.720   5.415   -13.984 1.00 42.35 ? 122 ARG B C     1 
ATOM   4001 O  O     . ARG D 2 122 ? 2.905   6.541   -14.444 1.00 41.40 ? 122 ARG B O     1 
ATOM   4002 C  CB    . ARG D 2 122 ? 1.195   6.547   -12.343 1.00 35.33 ? 122 ARG B CB    1 
ATOM   4003 C  CG    . ARG D 2 122 ? -0.079  6.395   -11.530 1.00 41.20 ? 122 ARG B CG    1 
ATOM   4004 C  CD    . ARG D 2 122 ? -0.880  7.681   -11.533 1.00 47.12 ? 122 ARG B CD    1 
ATOM   4005 N  NE    . ARG D 2 122 ? -2.316  7.436   -11.420 1.00 46.86 ? 122 ARG B NE    1 
ATOM   4006 C  CZ    . ARG D 2 122 ? -2.940  7.050   -10.310 1.00 46.97 ? 122 ARG B CZ    1 
ATOM   4007 N  NH1   . ARG D 2 122 ? -2.258  6.864   -9.188  1.00 51.44 ? 122 ARG B NH1   1 
ATOM   4008 N  NH2   . ARG D 2 122 ? -4.254  6.843   -10.327 1.00 42.92 ? 122 ARG B NH2   1 
ATOM   4009 N  N     . ASP D 2 123 ? 3.314   4.323   -14.462 1.00 38.44 ? 123 ASP B N     1 
ATOM   4010 C  CA    . ASP D 2 123 ? 4.224   4.381   -15.603 1.00 41.16 ? 123 ASP B CA    1 
ATOM   4011 C  C     . ASP D 2 123 ? 3.496   3.884   -16.856 1.00 40.00 ? 123 ASP B C     1 
ATOM   4012 O  O     . ASP D 2 123 ? 3.533   2.692   -17.184 1.00 37.10 ? 123 ASP B O     1 
ATOM   4013 C  CB    . ASP D 2 123 ? 5.456   3.514   -15.354 1.00 42.91 ? 123 ASP B CB    1 
ATOM   4014 C  CG    . ASP D 2 123 ? 6.519   3.683   -16.427 1.00 45.45 ? 123 ASP B CG    1 
ATOM   4015 O  OD1   . ASP D 2 123 ? 6.179   3.869   -17.621 1.00 41.59 ? 123 ASP B OD1   1 
ATOM   4016 O  OD2   . ASP D 2 123 ? 7.709   3.609   -16.069 1.00 46.70 ? 123 ASP B OD2   1 
ATOM   4017 N  N     . ALA D 2 124 ? 2.854   4.814   -17.557 1.00 37.28 ? 124 ALA B N     1 
ATOM   4018 C  CA    . ALA D 2 124 ? 2.098   4.503   -18.766 1.00 37.36 ? 124 ALA B CA    1 
ATOM   4019 C  C     . ALA D 2 124 ? 2.946   3.829   -19.847 1.00 34.30 ? 124 ALA B C     1 
ATOM   4020 O  O     . ALA D 2 124 ? 2.514   2.857   -20.473 1.00 37.44 ? 124 ALA B O     1 
ATOM   4021 C  CB    . ALA D 2 124 ? 1.453   5.784   -19.318 1.00 38.63 ? 124 ALA B CB    1 
ATOM   4022 N  N     . ASN D 2 125 ? 4.149   4.349   -20.069 1.00 35.61 ? 125 ASN B N     1 
ATOM   4023 C  CA    . ASN D 2 125 ? 5.033   3.780   -21.076 1.00 37.44 ? 125 ASN B CA    1 
ATOM   4024 C  C     . ASN D 2 125 ? 5.323   2.311   -20.789 1.00 39.43 ? 125 ASN B C     1 
ATOM   4025 O  O     . ASN D 2 125 ? 5.236   1.461   -21.675 1.00 36.50 ? 125 ASN B O     1 
ATOM   4026 C  CB    . ASN D 2 125 ? 6.336   4.578   -21.134 1.00 43.04 ? 125 ASN B CB    1 
ATOM   4027 C  CG    . ASN D 2 125 ? 6.108   6.036   -21.518 1.00 50.62 ? 125 ASN B CG    1 
ATOM   4028 O  OD1   . ASN D 2 125 ? 5.101   6.379   -22.154 1.00 48.66 ? 125 ASN B OD1   1 
ATOM   4029 N  ND2   . ASN D 2 125 ? 7.049   6.895   -21.152 1.00 41.75 ? 125 ASN B ND2   1 
ATOM   4030 N  N     . PHE D 2 126 ? 5.667   2.019   -19.541 1.00 43.18 ? 126 PHE B N     1 
ATOM   4031 C  CA    . PHE D 2 126 ? 5.957   0.655   -19.142 1.00 45.26 ? 126 PHE B CA    1 
ATOM   4032 C  C     . PHE D 2 126 ? 4.737   -0.236  -19.352 1.00 43.63 ? 126 PHE B C     1 
ATOM   4033 O  O     . PHE D 2 126 ? 4.839   -1.295  -19.973 1.00 36.47 ? 126 PHE B O     1 
ATOM   4034 C  CB    . PHE D 2 126 ? 6.359   0.602   -17.669 1.00 46.96 ? 126 PHE B CB    1 
ATOM   4035 C  CG    . PHE D 2 126 ? 6.578   -0.794  -17.161 1.00 59.88 ? 126 PHE B CG    1 
ATOM   4036 C  CD1   . PHE D 2 126 ? 7.748   -1.485  -17.467 1.00 60.71 ? 126 PHE B CD1   1 
ATOM   4037 C  CD2   . PHE D 2 126 ? 5.593   -1.441  -16.422 1.00 58.84 ? 126 PHE B CD2   1 
ATOM   4038 C  CE1   . PHE D 2 126 ? 7.932   -2.805  -17.046 1.00 61.69 ? 126 PHE B CE1   1 
ATOM   4039 C  CE2   . PHE D 2 126 ? 5.768   -2.760  -15.997 1.00 66.64 ? 126 PHE B CE2   1 
ATOM   4040 C  CZ    . PHE D 2 126 ? 6.939   -3.441  -16.312 1.00 63.62 ? 126 PHE B CZ    1 
ATOM   4041 N  N     . THR D 2 127 ? 3.586   0.207   -18.840 1.00 43.06 ? 127 THR B N     1 
ATOM   4042 C  CA    . THR D 2 127 ? 2.350   -0.564  -18.944 1.00 35.21 ? 127 THR B CA    1 
ATOM   4043 C  C     . THR D 2 127 ? 1.946   -0.816  -20.392 1.00 39.93 ? 127 THR B C     1 
ATOM   4044 O  O     . THR D 2 127 ? 1.516   -1.919  -20.743 1.00 35.54 ? 127 THR B O     1 
ATOM   4045 C  CB    . THR D 2 127 ? 1.195   0.127   -18.188 1.00 38.60 ? 127 THR B CB    1 
ATOM   4046 O  OG1   . THR D 2 127 ? 1.625   0.464   -16.861 1.00 41.68 ? 127 THR B OG1   1 
ATOM   4047 C  CG2   . THR D 2 127 ? -0.007  -0.805  -18.080 1.00 27.88 ? 127 THR B CG2   1 
ATOM   4048 N  N     . ARG D 2 128 ? 2.082   0.201   -21.235 1.00 37.99 ? 128 ARG B N     1 
ATOM   4049 C  CA    . ARG D 2 128 ? 1.742   0.043   -22.643 1.00 37.02 ? 128 ARG B CA    1 
ATOM   4050 C  C     . ARG D 2 128 ? 2.592   -1.063  -23.266 1.00 40.06 ? 128 ARG B C     1 
ATOM   4051 O  O     . ARG D 2 128 ? 2.084   -1.893  -24.017 1.00 35.82 ? 128 ARG B O     1 
ATOM   4052 C  CB    . ARG D 2 128 ? 1.998   1.335   -23.411 1.00 39.33 ? 128 ARG B CB    1 
ATOM   4053 C  CG    . ARG D 2 128 ? 1.598   1.258   -24.884 1.00 35.63 ? 128 ARG B CG    1 
ATOM   4054 C  CD    . ARG D 2 128 ? 2.089   2.501   -25.627 1.00 43.59 ? 128 ARG B CD    1 
ATOM   4055 N  NE    . ARG D 2 128 ? 3.541   2.487   -25.766 1.00 42.23 ? 128 ARG B NE    1 
ATOM   4056 C  CZ    . ARG D 2 128 ? 4.308   3.568   -25.763 1.00 44.89 ? 128 ARG B CZ    1 
ATOM   4057 N  NH1   . ARG D 2 128 ? 3.762   4.772   -25.629 1.00 48.01 ? 128 ARG B NH1   1 
ATOM   4058 N  NH2   . ARG D 2 128 ? 5.626   3.441   -25.874 1.00 44.50 ? 128 ARG B NH2   1 
ATOM   4059 N  N     . GLU D 2 129 ? 3.891   -1.059  -22.964 1.00 37.34 ? 129 GLU B N     1 
ATOM   4060 C  CA    . GLU D 2 129 ? 4.790   -2.064  -23.524 1.00 44.90 ? 129 GLU B CA    1 
ATOM   4061 C  C     . GLU D 2 129 ? 4.461   -3.462  -23.020 1.00 42.07 ? 129 GLU B C     1 
ATOM   4062 O  O     . GLU D 2 129 ? 4.442   -4.424  -23.791 1.00 39.59 ? 129 GLU B O     1 
ATOM   4063 C  CB    . GLU D 2 129 ? 6.247   -1.716  -23.211 1.00 47.43 ? 129 GLU B CB    1 
ATOM   4064 C  CG    . GLU D 2 129 ? 6.718   -0.449  -23.889 1.00 59.13 ? 129 GLU B CG    1 
ATOM   4065 C  CD    . GLU D 2 129 ? 6.298   -0.381  -25.350 1.00 66.16 ? 129 GLU B CD    1 
ATOM   4066 O  OE1   . GLU D 2 129 ? 6.691   -1.271  -26.141 1.00 65.82 ? 129 GLU B OE1   1 
ATOM   4067 O  OE2   . GLU D 2 129 ? 5.567   0.567   -25.705 1.00 67.80 ? 129 GLU B OE2   1 
ATOM   4068 N  N     . LEU D 2 130 ? 4.199   -3.575  -21.725 1.00 43.20 ? 130 LEU B N     1 
ATOM   4069 C  CA    . LEU D 2 130 ? 3.839   -4.863  -21.162 1.00 43.86 ? 130 LEU B CA    1 
ATOM   4070 C  C     . LEU D 2 130 ? 2.603   -5.356  -21.916 1.00 45.44 ? 130 LEU B C     1 
ATOM   4071 O  O     . LEU D 2 130 ? 2.536   -6.522  -22.315 1.00 47.58 ? 130 LEU B O     1 
ATOM   4072 C  CB    . LEU D 2 130 ? 3.509   -4.729  -19.675 1.00 39.81 ? 130 LEU B CB    1 
ATOM   4073 C  CG    . LEU D 2 130 ? 3.903   -5.920  -18.800 1.00 51.01 ? 130 LEU B CG    1 
ATOM   4074 C  CD1   . LEU D 2 130 ? 3.078   -5.895  -17.515 1.00 47.23 ? 130 LEU B CD1   1 
ATOM   4075 C  CD2   . LEU D 2 130 ? 3.684   -7.224  -19.548 1.00 52.58 ? 130 LEU B CD2   1 
ATOM   4076 N  N     . PHE D 2 131 ? 1.635   -4.456  -22.111 1.00 34.64 ? 131 PHE B N     1 
ATOM   4077 C  CA    . PHE D 2 131 ? 0.390   -4.775  -22.813 1.00 37.80 ? 131 PHE B CA    1 
ATOM   4078 C  C     . PHE D 2 131 ? 0.671   -5.213  -24.248 1.00 39.20 ? 131 PHE B C     1 
ATOM   4079 O  O     . PHE D 2 131 ? 0.052   -6.141  -24.752 1.00 43.24 ? 131 PHE B O     1 
ATOM   4080 C  CB    . PHE D 2 131 ? -0.531  -3.554  -22.825 1.00 39.62 ? 131 PHE B CB    1 
ATOM   4081 C  CG    . PHE D 2 131 ? -1.898  -3.811  -23.411 1.00 26.92 ? 131 PHE B CG    1 
ATOM   4082 C  CD1   . PHE D 2 131 ? -2.135  -3.630  -24.778 1.00 31.52 ? 131 PHE B CD1   1 
ATOM   4083 C  CD2   . PHE D 2 131 ? -2.964  -4.187  -22.590 1.00 31.53 ? 131 PHE B CD2   1 
ATOM   4084 C  CE1   . PHE D 2 131 ? -3.419  -3.818  -25.317 1.00 29.34 ? 131 PHE B CE1   1 
ATOM   4085 C  CE2   . PHE D 2 131 ? -4.259  -4.379  -23.117 1.00 26.85 ? 131 PHE B CE2   1 
ATOM   4086 C  CZ    . PHE D 2 131 ? -4.486  -4.194  -24.483 1.00 24.33 ? 131 PHE B CZ    1 
ATOM   4087 N  N     . TYR D 2 132 ? 1.601   -4.536  -24.910 1.00 43.03 ? 132 TYR B N     1 
ATOM   4088 C  CA    . TYR D 2 132 ? 1.939   -4.893  -26.285 1.00 46.25 ? 132 TYR B CA    1 
ATOM   4089 C  C     . TYR D 2 132 ? 2.696   -6.215  -26.332 1.00 44.30 ? 132 TYR B C     1 
ATOM   4090 O  O     . TYR D 2 132 ? 2.509   -7.016  -27.254 1.00 40.33 ? 132 TYR B O     1 
ATOM   4091 C  CB    . TYR D 2 132 ? 2.800   -3.808  -26.952 1.00 35.26 ? 132 TYR B CB    1 
ATOM   4092 C  CG    . TYR D 2 132 ? 2.073   -2.507  -27.232 1.00 43.84 ? 132 TYR B CG    1 
ATOM   4093 C  CD1   . TYR D 2 132 ? 0.682   -2.429  -27.152 1.00 39.71 ? 132 TYR B CD1   1 
ATOM   4094 C  CD2   . TYR D 2 132 ? 2.773   -1.367  -27.627 1.00 35.32 ? 132 TYR B CD2   1 
ATOM   4095 C  CE1   . TYR D 2 132 ? 0.007   -1.246  -27.465 1.00 49.42 ? 132 TYR B CE1   1 
ATOM   4096 C  CE2   . TYR D 2 132 ? 2.110   -0.186  -27.942 1.00 42.90 ? 132 TYR B CE2   1 
ATOM   4097 C  CZ    . TYR D 2 132 ? 0.728   -0.131  -27.863 1.00 42.48 ? 132 TYR B CZ    1 
ATOM   4098 O  OH    . TYR D 2 132 ? 0.065   1.023   -28.207 1.00 52.97 ? 132 TYR B OH    1 
ATOM   4099 N  N     . LYS D 2 133 ? 3.555   -6.440  -25.342 1.00 43.83 ? 133 LYS B N     1 
ATOM   4100 C  CA    . LYS D 2 133 ? 4.336   -7.665  -25.326 1.00 46.65 ? 133 LYS B CA    1 
ATOM   4101 C  C     . LYS D 2 133 ? 3.398   -8.852  -25.255 1.00 43.03 ? 133 LYS B C     1 
ATOM   4102 O  O     . LYS D 2 133 ? 3.712   -9.920  -25.761 1.00 47.82 ? 133 LYS B O     1 
ATOM   4103 C  CB    . LYS D 2 133 ? 5.310   -7.685  -24.146 1.00 51.03 ? 133 LYS B CB    1 
ATOM   4104 C  CG    . LYS D 2 133 ? 6.210   -8.910  -24.153 1.00 64.11 ? 133 LYS B CG    1 
ATOM   4105 C  CD    . LYS D 2 133 ? 7.321   -8.828  -23.118 1.00 72.20 ? 133 LYS B CD    1 
ATOM   4106 C  CE    . LYS D 2 133 ? 8.225   -10.057 -23.199 1.00 76.40 ? 133 LYS B CE    1 
ATOM   4107 N  NZ    . LYS D 2 133 ? 9.436   -9.938  -22.332 1.00 81.56 ? 133 LYS B NZ    1 
ATOM   4108 N  N     . LEU D 2 134 ? 2.236   -8.650  -24.645 1.00 42.13 ? 134 LEU B N     1 
ATOM   4109 C  CA    . LEU D 2 134 ? 1.247   -9.707  -24.507 1.00 45.31 ? 134 LEU B CA    1 
ATOM   4110 C  C     . LEU D 2 134 ? 0.205   -9.759  -25.618 1.00 48.96 ? 134 LEU B C     1 
ATOM   4111 O  O     . LEU D 2 134 ? -0.177  -10.849 -26.047 1.00 37.72 ? 134 LEU B O     1 
ATOM   4112 C  CB    . LEU D 2 134 ? 0.496   -9.575  -23.179 1.00 45.40 ? 134 LEU B CB    1 
ATOM   4113 C  CG    . LEU D 2 134 ? 1.182   -9.856  -21.843 1.00 47.92 ? 134 LEU B CG    1 
ATOM   4114 C  CD1   . LEU D 2 134 ? 0.241   -9.456  -20.727 1.00 46.20 ? 134 LEU B CD1   1 
ATOM   4115 C  CD2   . LEU D 2 134 ? 1.540   -11.330 -21.727 1.00 45.82 ? 134 LEU B CD2   1 
ATOM   4116 N  N     . PHE D 2 135 ? -0.255  -8.598  -26.092 1.00 42.03 ? 135 PHE B N     1 
ATOM   4117 C  CA    . PHE D 2 135 ? -1.315  -8.595  -27.104 1.00 41.62 ? 135 PHE B CA    1 
ATOM   4118 C  C     . PHE D 2 135 ? -1.110  -7.826  -28.410 1.00 40.11 ? 135 PHE B C     1 
ATOM   4119 O  O     . PHE D 2 135 ? -2.010  -7.820  -29.248 1.00 36.81 ? 135 PHE B O     1 
ATOM   4120 C  CB    . PHE D 2 135 ? -2.620  -8.078  -26.478 1.00 43.40 ? 135 PHE B CB    1 
ATOM   4121 C  CG    . PHE D 2 135 ? -2.884  -8.580  -25.084 1.00 48.05 ? 135 PHE B CG    1 
ATOM   4122 C  CD1   . PHE D 2 135 ? -3.063  -9.942  -24.833 1.00 45.69 ? 135 PHE B CD1   1 
ATOM   4123 C  CD2   . PHE D 2 135 ? -2.986  -7.684  -24.018 1.00 46.85 ? 135 PHE B CD2   1 
ATOM   4124 C  CE1   . PHE D 2 135 ? -3.343  -10.405 -23.541 1.00 41.35 ? 135 PHE B CE1   1 
ATOM   4125 C  CE2   . PHE D 2 135 ? -3.265  -8.138  -22.724 1.00 48.95 ? 135 PHE B CE2   1 
ATOM   4126 C  CZ    . PHE D 2 135 ? -3.445  -9.504  -22.486 1.00 42.86 ? 135 PHE B CZ    1 
ATOM   4127 N  N     . LYS D 2 136 ? 0.035   -7.178  -28.599 1.00 41.98 ? 136 LYS B N     1 
ATOM   4128 C  CA    . LYS D 2 136 ? 0.234   -6.398  -29.820 1.00 46.18 ? 136 LYS B CA    1 
ATOM   4129 C  C     . LYS D 2 136 ? -0.087  -7.185  -31.092 1.00 54.72 ? 136 LYS B C     1 
ATOM   4130 O  O     . LYS D 2 136 ? -0.913  -6.763  -31.913 1.00 53.28 ? 136 LYS B O     1 
ATOM   4131 C  CB    . LYS D 2 136 ? 1.664   -5.848  -29.894 1.00 43.23 ? 136 LYS B CB    1 
ATOM   4132 C  CG    . LYS D 2 136 ? 1.897   -4.973  -31.124 1.00 46.50 ? 136 LYS B CG    1 
ATOM   4133 C  CD    . LYS D 2 136 ? 3.266   -4.297  -31.137 1.00 46.98 ? 136 LYS B CD    1 
ATOM   4134 C  CE    . LYS D 2 136 ? 3.448   -3.481  -32.417 1.00 50.48 ? 136 LYS B CE    1 
ATOM   4135 N  NZ    . LYS D 2 136 ? 4.783   -2.817  -32.524 1.00 54.58 ? 136 LYS B NZ    1 
ATOM   4136 N  N     . GLU D 2 137 ? 0.564   -8.332  -31.244 1.00 54.25 ? 137 GLU B N     1 
ATOM   4137 C  CA    . GLU D 2 137 ? 0.365   -9.189  -32.403 1.00 54.23 ? 137 GLU B CA    1 
ATOM   4138 C  C     . GLU D 2 137 ? -1.102  -9.580  -32.569 1.00 48.99 ? 137 GLU B C     1 
ATOM   4139 O  O     . GLU D 2 137 ? -1.635  -9.570  -33.676 1.00 43.32 ? 137 GLU B O     1 
ATOM   4140 C  CB    . GLU D 2 137 ? 1.234   -10.440 -32.260 1.00 64.35 ? 137 GLU B CB    1 
ATOM   4141 C  CG    . GLU D 2 137 ? 1.157   -11.415 -33.411 1.00 75.46 ? 137 GLU B CG    1 
ATOM   4142 C  CD    . GLU D 2 137 ? 2.054   -12.620 -33.193 1.00 86.73 ? 137 GLU B CD    1 
ATOM   4143 O  OE1   . GLU D 2 137 ? 1.882   -13.312 -32.165 1.00 90.18 ? 137 GLU B OE1   1 
ATOM   4144 O  OE2   . GLU D 2 137 ? 2.931   -12.873 -34.047 1.00 87.66 ? 137 GLU B OE2   1 
ATOM   4145 N  N     . ASP D 2 138 ? -1.763  -9.913  -31.469 1.00 46.43 ? 138 ASP B N     1 
ATOM   4146 C  CA    . ASP D 2 138 ? -3.164  -10.307 -31.552 1.00 50.62 ? 138 ASP B CA    1 
ATOM   4147 C  C     . ASP D 2 138 ? -4.030  -9.156  -32.052 1.00 51.01 ? 138 ASP B C     1 
ATOM   4148 O  O     . ASP D 2 138 ? -5.014  -9.367  -32.761 1.00 47.34 ? 138 ASP B O     1 
ATOM   4149 C  CB    . ASP D 2 138 ? -3.675  -10.785 -30.187 1.00 58.16 ? 138 ASP B CB    1 
ATOM   4150 C  CG    . ASP D 2 138 ? -2.830  -11.913 -29.603 1.00 67.69 ? 138 ASP B CG    1 
ATOM   4151 O  OD1   . ASP D 2 138 ? -2.599  -12.922 -30.309 1.00 68.11 ? 138 ASP B OD1   1 
ATOM   4152 O  OD2   . ASP D 2 138 ? -2.402  -11.790 -28.433 1.00 62.67 ? 138 ASP B OD2   1 
ATOM   4153 N  N     . ILE D 2 139 ? -3.661  -7.934  -31.679 1.00 49.66 ? 139 ILE B N     1 
ATOM   4154 C  CA    . ILE D 2 139 ? -4.420  -6.766  -32.103 1.00 46.27 ? 139 ILE B CA    1 
ATOM   4155 C  C     . ILE D 2 139 ? -4.118  -6.442  -33.563 1.00 45.35 ? 139 ILE B C     1 
ATOM   4156 O  O     . ILE D 2 139 ? -5.040  -6.243  -34.360 1.00 38.98 ? 139 ILE B O     1 
ATOM   4157 C  CB    . ILE D 2 139 ? -4.110  -5.547  -31.204 1.00 44.47 ? 139 ILE B CB    1 
ATOM   4158 C  CG1   . ILE D 2 139 ? -4.608  -5.829  -29.781 1.00 42.56 ? 139 ILE B CG1   1 
ATOM   4159 C  CG2   . ILE D 2 139 ? -4.784  -4.293  -31.759 1.00 32.16 ? 139 ILE B CG2   1 
ATOM   4160 C  CD1   . ILE D 2 139 ? -4.132  -4.827  -28.725 1.00 41.06 ? 139 ILE B CD1   1 
ATOM   4161 N  N     . LEU D 2 140 ? -2.835  -6.395  -33.917 1.00 44.41 ? 140 LEU B N     1 
ATOM   4162 C  CA    . LEU D 2 140 ? -2.453  -6.111  -35.295 1.00 40.86 ? 140 LEU B CA    1 
ATOM   4163 C  C     . LEU D 2 140 ? -3.082  -7.155  -36.202 1.00 46.96 ? 140 LEU B C     1 
ATOM   4164 O  O     . LEU D 2 140 ? -3.475  -6.860  -37.334 1.00 45.01 ? 140 LEU B O     1 
ATOM   4165 C  CB    . LEU D 2 140 ? -0.931  -6.122  -35.457 1.00 41.11 ? 140 LEU B CB    1 
ATOM   4166 C  CG    . LEU D 2 140 ? -0.266  -4.747  -35.320 1.00 49.00 ? 140 LEU B CG    1 
ATOM   4167 C  CD1   . LEU D 2 140 ? -0.755  -4.057  -34.052 1.00 50.35 ? 140 LEU B CD1   1 
ATOM   4168 C  CD2   . LEU D 2 140 ? 1.246   -4.900  -35.306 1.00 43.50 ? 140 LEU B CD2   1 
ATOM   4169 N  N     . SER D 2 141 ? -3.191  -8.377  -35.696 1.00 41.21 ? 141 SER B N     1 
ATOM   4170 C  CA    . SER D 2 141 ? -3.795  -9.434  -36.476 1.00 42.09 ? 141 SER B CA    1 
ATOM   4171 C  C     . SER D 2 141 ? -5.240  -9.072  -36.789 1.00 40.46 ? 141 SER B C     1 
ATOM   4172 O  O     . SER D 2 141 ? -5.654  -9.092  -37.942 1.00 43.85 ? 141 SER B O     1 
ATOM   4173 C  CB    . SER D 2 141 ? -3.751  -10.755 -35.712 1.00 46.26 ? 141 SER B CB    1 
ATOM   4174 O  OG    . SER D 2 141 ? -4.418  -11.765 -36.444 1.00 49.15 ? 141 SER B OG    1 
ATOM   4175 N  N     . ALA D 2 142 ? -6.002  -8.730  -35.755 1.00 37.96 ? 142 ALA B N     1 
ATOM   4176 C  CA    . ALA D 2 142 ? -7.406  -8.380  -35.919 1.00 39.42 ? 142 ALA B CA    1 
ATOM   4177 C  C     . ALA D 2 142 ? -7.594  -7.109  -36.745 1.00 47.60 ? 142 ALA B C     1 
ATOM   4178 O  O     . ALA D 2 142 ? -8.598  -6.965  -37.437 1.00 43.70 ? 142 ALA B O     1 
ATOM   4179 C  CB    . ALA D 2 142 ? -8.069  -8.222  -34.550 1.00 42.65 ? 142 ALA B CB    1 
ATOM   4180 N  N     . ILE D 2 143 ? -6.636  -6.187  -36.667 1.00 45.82 ? 143 ILE B N     1 
ATOM   4181 C  CA    . ILE D 2 143 ? -6.725  -4.940  -37.426 1.00 50.63 ? 143 ILE B CA    1 
ATOM   4182 C  C     . ILE D 2 143 ? -6.535  -5.214  -38.915 1.00 55.08 ? 143 ILE B C     1 
ATOM   4183 O  O     . ILE D 2 143 ? -7.183  -4.596  -39.760 1.00 53.85 ? 143 ILE B O     1 
ATOM   4184 C  CB    . ILE D 2 143 ? -5.652  -3.922  -36.973 1.00 46.80 ? 143 ILE B CB    1 
ATOM   4185 C  CG1   . ILE D 2 143 ? -6.004  -3.359  -35.598 1.00 45.48 ? 143 ILE B CG1   1 
ATOM   4186 C  CG2   . ILE D 2 143 ? -5.538  -2.788  -37.982 1.00 49.83 ? 143 ILE B CG2   1 
ATOM   4187 C  CD1   . ILE D 2 143 ? -4.888  -2.530  -35.012 1.00 45.52 ? 143 ILE B CD1   1 
ATOM   4188 N  N     . LYS D 2 144 ? -5.634  -6.138  -39.227 1.00 57.74 ? 144 LYS B N     1 
ATOM   4189 C  CA    . LYS D 2 144 ? -5.357  -6.501  -40.608 1.00 61.57 ? 144 LYS B CA    1 
ATOM   4190 C  C     . LYS D 2 144 ? -6.589  -7.152  -41.235 1.00 59.04 ? 144 LYS B C     1 
ATOM   4191 O  O     . LYS D 2 144 ? -6.936  -6.877  -42.383 1.00 57.79 ? 144 LYS B O     1 
ATOM   4192 C  CB    . LYS D 2 144 ? -4.169  -7.463  -40.669 1.00 61.85 ? 144 LYS B CB    1 
ATOM   4193 C  CG    . LYS D 2 144 ? -3.727  -7.798  -42.081 1.00 68.91 ? 144 LYS B CG    1 
ATOM   4194 C  CD    . LYS D 2 144 ? -2.406  -8.545  -42.091 1.00 76.44 ? 144 LYS B CD    1 
ATOM   4195 C  CE    . LYS D 2 144 ? -1.893  -8.722  -43.513 1.00 81.32 ? 144 LYS B CE    1 
ATOM   4196 N  NZ    . LYS D 2 144 ? -0.564  -9.394  -43.552 1.00 81.18 ? 144 LYS B NZ    1 
ATOM   4197 N  N     . GLU D 2 145 ? -7.245  -8.018  -40.473 1.00 56.32 ? 145 GLU B N     1 
ATOM   4198 C  CA    . GLU D 2 145 ? -8.440  -8.701  -40.951 1.00 62.89 ? 145 GLU B CA    1 
ATOM   4199 C  C     . GLU D 2 145 ? -9.684  -7.921  -40.543 1.00 64.76 ? 145 GLU B C     1 
ATOM   4200 O  O     . GLU D 2 145 ? -10.779 -8.477  -40.452 1.00 63.74 ? 145 GLU B O     1 
ATOM   4201 C  CB    . GLU D 2 145 ? -8.496  -10.118 -40.374 1.00 64.68 ? 145 GLU B CB    1 
ATOM   4202 C  CG    . GLU D 2 145 ? -8.115  -10.193 -38.902 1.00 77.96 ? 145 GLU B CG    1 
ATOM   4203 C  CD    . GLU D 2 145 ? -8.169  -11.604 -38.344 1.00 82.00 ? 145 GLU B CD    1 
ATOM   4204 O  OE1   . GLU D 2 145 ? -7.684  -12.533 -39.027 1.00 84.77 ? 145 GLU B OE1   1 
ATOM   4205 O  OE2   . GLU D 2 145 ? -8.684  -11.779 -37.218 1.00 79.65 ? 145 GLU B OE2   1 
ATOM   4206 N  N     . GLY D 2 146 ? -9.502  -6.625  -40.304 1.00 63.54 ? 146 GLY B N     1 
ATOM   4207 C  CA    . GLY D 2 146 ? -10.606 -5.778  -39.896 1.00 62.42 ? 146 GLY B CA    1 
ATOM   4208 C  C     . GLY D 2 146 ? -11.625 -5.588  -40.995 1.00 67.47 ? 146 GLY B C     1 
ATOM   4209 O  O     . GLY D 2 146 ? -11.267 -5.373  -42.151 1.00 66.78 ? 146 GLY B O     1 
ATOM   4210 N  N     . ARG D 2 147 ? -12.900 -5.662  -40.630 1.00 64.16 ? 147 ARG B N     1 
ATOM   4211 C  CA    . ARG D 2 147 ? -13.981 -5.507  -41.590 1.00 66.53 ? 147 ARG B CA    1 
ATOM   4212 C  C     . ARG D 2 147 ? -15.238 -4.924  -40.949 1.00 64.97 ? 147 ARG B C     1 
ATOM   4213 O  O     . ARG D 2 147 ? -15.882 -5.571  -40.123 1.00 64.83 ? 147 ARG B O     1 
ATOM   4214 C  CB    . ARG D 2 147 ? -14.327 -6.862  -42.218 1.00 68.72 ? 147 ARG B CB    1 
ATOM   4215 C  CG    . ARG D 2 147 ? -15.520 -6.805  -43.157 1.00 78.26 ? 147 ARG B CG    1 
ATOM   4216 C  CD    . ARG D 2 147 ? -16.477 -7.972  -42.934 1.00 83.31 ? 147 ARG B CD    1 
ATOM   4217 N  NE    . ARG D 2 147 ? -17.838 -7.624  -43.342 1.00 85.10 ? 147 ARG B NE    1 
ATOM   4218 C  CZ    . ARG D 2 147 ? -18.914 -8.369  -43.101 1.00 84.63 ? 147 ARG B CZ    1 
ATOM   4219 N  NH1   . ARG D 2 147 ? -18.802 -9.520  -42.452 1.00 84.12 ? 147 ARG B NH1   1 
ATOM   4220 N  NH2   . ARG D 2 147 ? -20.108 -7.951  -43.497 1.00 86.89 ? 147 ARG B NH2   1 
ATOM   4221 N  N     . VAL D 2 148 ? -15.585 -3.699  -41.329 1.00 63.06 ? 148 VAL B N     1 
ATOM   4222 C  CA    . VAL D 2 148 ? -16.786 -3.066  -40.802 1.00 60.01 ? 148 VAL B CA    1 
ATOM   4223 C  C     . VAL D 2 148 ? -17.997 -3.739  -41.446 1.00 57.97 ? 148 VAL B C     1 
ATOM   4224 O  O     . VAL D 2 148 ? -18.025 -3.961  -42.658 1.00 55.64 ? 148 VAL B O     1 
ATOM   4225 C  CB    . VAL D 2 148 ? -16.841 -1.559  -41.141 1.00 57.74 ? 148 VAL B CB    1 
ATOM   4226 C  CG1   . VAL D 2 148 ? -18.142 -0.957  -40.618 1.00 55.48 ? 148 VAL B CG1   1 
ATOM   4227 C  CG2   . VAL D 2 148 ? -15.643 -0.844  -40.547 1.00 61.23 ? 148 VAL B CG2   1 
ATOM   4228 N  N     . LYS D 2 149 ? -18.989 -4.083  -40.638 1.00 54.13 ? 149 LYS B N     1 
ATOM   4229 C  CA    . LYS D 2 149 ? -20.191 -4.705  -41.175 1.00 60.44 ? 149 LYS B CA    1 
ATOM   4230 C  C     . LYS D 2 149 ? -21.437 -4.023  -40.628 1.00 55.87 ? 149 LYS B C     1 
ATOM   4231 O  O     . LYS D 2 149 ? -21.637 -3.932  -39.413 1.00 52.39 ? 149 LYS B O     1 
ATOM   4232 C  CB    . LYS D 2 149 ? -20.214 -6.205  -40.864 1.00 67.32 ? 149 LYS B CB    1 
ATOM   4233 C  CG    . LYS D 2 149 ? -19.928 -6.579  -39.415 1.00 72.11 ? 149 LYS B CG    1 
ATOM   4234 C  CD    . LYS D 2 149 ? -19.986 -8.093  -39.243 1.00 80.18 ? 149 LYS B CD    1 
ATOM   4235 C  CE    . LYS D 2 149 ? -19.658 -8.520  -37.823 1.00 85.55 ? 149 LYS B CE    1 
ATOM   4236 N  NZ    . LYS D 2 149 ? -19.685 -10.004 -37.674 1.00 87.91 ? 149 LYS B NZ    1 
ATOM   4237 N  N     . LYS D 2 150 ? -22.267 -3.527  -41.537 1.00 49.92 ? 150 LYS B N     1 
ATOM   4238 C  CA    . LYS D 2 150 ? -23.484 -2.844  -41.147 1.00 43.53 ? 150 LYS B CA    1 
ATOM   4239 C  C     . LYS D 2 150 ? -24.598 -3.795  -40.732 1.00 46.49 ? 150 LYS B C     1 
ATOM   4240 O  O     . LYS D 2 150 ? -24.682 -4.934  -41.207 1.00 45.93 ? 150 LYS B O     1 
ATOM   4241 C  CB    . LYS D 2 150 ? -23.965 -1.951  -42.289 1.00 42.04 ? 150 LYS B CB    1 
ATOM   4242 C  CG    . LYS D 2 150 ? -23.050 -0.776  -42.550 1.00 47.56 ? 150 LYS B CG    1 
ATOM   4243 C  CD    . LYS D 2 150 ? -23.613 0.150   -43.610 1.00 41.42 ? 150 LYS B CD    1 
ATOM   4244 C  CE    . LYS D 2 150 ? -22.779 1.404   -43.729 1.00 40.33 ? 150 LYS B CE    1 
ATOM   4245 N  NZ    . LYS D 2 150 ? -23.328 2.313   -44.761 1.00 45.23 ? 150 LYS B NZ    1 
ATOM   4246 N  N     . ASP D 2 151 ? -25.449 -3.318  -39.832 1.00 42.05 ? 151 ASP B N     1 
ATOM   4247 C  CA    . ASP D 2 151 ? -26.581 -4.103  -39.364 1.00 43.81 ? 151 ASP B CA    1 
ATOM   4248 C  C     . ASP D 2 151 ? -27.702 -3.859  -40.365 1.00 42.77 ? 151 ASP B C     1 
ATOM   4249 O  O     . ASP D 2 151 ? -27.704 -2.846  -41.082 1.00 43.31 ? 151 ASP B O     1 
ATOM   4250 C  CB    . ASP D 2 151 ? -27.030 -3.633  -37.981 1.00 43.07 ? 151 ASP B CB    1 
ATOM   4251 C  CG    . ASP D 2 151 ? -27.478 -2.193  -37.993 1.00 39.05 ? 151 ASP B CG    1 
ATOM   4252 O  OD1   . ASP D 2 151 ? -26.604 -1.307  -38.115 1.00 45.10 ? 151 ASP B OD1   1 
ATOM   4253 O  OD2   . ASP D 2 151 ? -28.702 -1.948  -37.906 1.00 43.81 ? 151 ASP B OD2   1 
ATOM   4254 N  N     . TYR D 2 152 ? -28.655 -4.782  -40.395 1.00 43.60 ? 152 TYR B N     1 
ATOM   4255 C  CA    . TYR D 2 152 ? -29.792 -4.705  -41.305 1.00 46.02 ? 152 TYR B CA    1 
ATOM   4256 C  C     . TYR D 2 152 ? -30.621 -3.426  -41.222 1.00 45.34 ? 152 TYR B C     1 
ATOM   4257 O  O     . TYR D 2 152 ? -30.968 -2.850  -42.256 1.00 50.16 ? 152 TYR B O     1 
ATOM   4258 C  CB    . TYR D 2 152 ? -30.687 -5.928  -41.113 1.00 39.66 ? 152 TYR B CB    1 
ATOM   4259 C  CG    . TYR D 2 152 ? -29.951 -7.219  -41.382 1.00 43.45 ? 152 TYR B CG    1 
ATOM   4260 C  CD1   . TYR D 2 152 ? -29.343 -7.445  -42.617 1.00 47.56 ? 152 TYR B CD1   1 
ATOM   4261 C  CD2   . TYR D 2 152 ? -29.834 -8.200  -40.400 1.00 44.44 ? 152 TYR B CD2   1 
ATOM   4262 C  CE1   . TYR D 2 152 ? -28.633 -8.611  -42.872 1.00 52.22 ? 152 TYR B CE1   1 
ATOM   4263 C  CE2   . TYR D 2 152 ? -29.125 -9.375  -40.643 1.00 53.39 ? 152 TYR B CE2   1 
ATOM   4264 C  CZ    . TYR D 2 152 ? -28.526 -9.572  -41.885 1.00 56.83 ? 152 TYR B CZ    1 
ATOM   4265 O  OH    . TYR D 2 152 ? -27.817 -10.723 -42.140 1.00 57.45 ? 152 TYR B OH    1 
ATOM   4266 N  N     . LYS D 2 153 ? -30.943 -2.973  -40.014 1.00 48.21 ? 153 LYS B N     1 
ATOM   4267 C  CA    . LYS D 2 153 ? -31.726 -1.746  -39.888 1.00 45.51 ? 153 LYS B CA    1 
ATOM   4268 C  C     . LYS D 2 153 ? -31.018 -0.583  -40.584 1.00 44.12 ? 153 LYS B C     1 
ATOM   4269 O  O     . LYS D 2 153 ? -31.660 0.253   -41.221 1.00 41.79 ? 153 LYS B O     1 
ATOM   4270 C  CB    . LYS D 2 153 ? -31.981 -1.409  -38.416 1.00 45.81 ? 153 LYS B CB    1 
ATOM   4271 C  CG    . LYS D 2 153 ? -33.011 -2.312  -37.764 1.00 47.99 ? 153 LYS B CG    1 
ATOM   4272 C  CD    . LYS D 2 153 ? -33.359 -1.845  -36.364 1.00 50.49 ? 153 LYS B CD    1 
ATOM   4273 C  CE    . LYS D 2 153 ? -34.154 -0.550  -36.389 1.00 45.58 ? 153 LYS B CE    1 
ATOM   4274 N  NZ    . LYS D 2 153 ? -34.411 -0.067  -35.008 1.00 35.59 ? 153 LYS B NZ    1 
ATOM   4275 N  N     . THR D 2 154 ? -29.693 -0.534  -40.470 1.00 39.75 ? 154 THR B N     1 
ATOM   4276 C  CA    . THR D 2 154 ? -28.926 0.523   -41.111 1.00 39.88 ? 154 THR B CA    1 
ATOM   4277 C  C     . THR D 2 154 ? -28.946 0.337   -42.632 1.00 41.68 ? 154 THR B C     1 
ATOM   4278 O  O     . THR D 2 154 ? -29.227 1.273   -43.385 1.00 38.55 ? 154 THR B O     1 
ATOM   4279 C  CB    . THR D 2 154 ? -27.467 0.520   -40.617 1.00 37.09 ? 154 THR B CB    1 
ATOM   4280 O  OG1   . THR D 2 154 ? -27.448 0.757   -39.205 1.00 46.28 ? 154 THR B OG1   1 
ATOM   4281 C  CG2   . THR D 2 154 ? -26.666 1.604   -41.311 1.00 39.19 ? 154 THR B CG2   1 
ATOM   4282 N  N     . ILE D 2 155 ? -28.650 -0.881  -43.075 1.00 46.62 ? 155 ILE B N     1 
ATOM   4283 C  CA    . ILE D 2 155 ? -28.642 -1.199  -44.494 1.00 42.94 ? 155 ILE B CA    1 
ATOM   4284 C  C     . ILE D 2 155 ? -29.980 -0.867  -45.145 1.00 46.83 ? 155 ILE B C     1 
ATOM   4285 O  O     . ILE D 2 155 ? -30.027 -0.236  -46.203 1.00 46.66 ? 155 ILE B O     1 
ATOM   4286 C  CB    . ILE D 2 155 ? -28.349 -2.692  -44.715 1.00 47.66 ? 155 ILE B CB    1 
ATOM   4287 C  CG1   . ILE D 2 155 ? -26.929 -3.014  -44.257 1.00 39.03 ? 155 ILE B CG1   1 
ATOM   4288 C  CG2   . ILE D 2 155 ? -28.534 -3.047  -46.184 1.00 45.96 ? 155 ILE B CG2   1 
ATOM   4289 C  CD1   . ILE D 2 155 ? -26.641 -4.490  -44.176 1.00 40.85 ? 155 ILE B CD1   1 
ATOM   4290 N  N     . LEU D 2 156 ? -31.067 -1.287  -44.508 1.00 47.96 ? 156 LEU B N     1 
ATOM   4291 C  CA    . LEU D 2 156 ? -32.399 -1.042  -45.049 1.00 47.47 ? 156 LEU B CA    1 
ATOM   4292 C  C     . LEU D 2 156 ? -32.713 0.431   -45.280 1.00 51.87 ? 156 LEU B C     1 
ATOM   4293 O  O     . LEU D 2 156 ? -33.140 0.806   -46.378 1.00 46.66 ? 156 LEU B O     1 
ATOM   4294 C  CB    . LEU D 2 156 ? -33.470 -1.648  -44.138 1.00 46.29 ? 156 LEU B CB    1 
ATOM   4295 C  CG    . LEU D 2 156 ? -34.917 -1.381  -44.570 1.00 47.65 ? 156 LEU B CG    1 
ATOM   4296 C  CD1   . LEU D 2 156 ? -35.142 -1.885  -45.993 1.00 46.15 ? 156 LEU B CD1   1 
ATOM   4297 C  CD2   . LEU D 2 156 ? -35.876 -2.061  -43.606 1.00 39.60 ? 156 LEU B CD2   1 
ATOM   4298 N  N     . GLN D 2 157 ? -32.504 1.274   -44.267 1.00 47.29 ? 157 GLN B N     1 
ATOM   4299 C  CA    . GLN D 2 157 ? -32.817 2.691   -44.438 1.00 46.50 ? 157 GLN B CA    1 
ATOM   4300 C  C     . GLN D 2 157 ? -31.946 3.390   -45.481 1.00 44.16 ? 157 GLN B C     1 
ATOM   4301 O  O     . GLN D 2 157 ? -32.347 4.398   -46.054 1.00 41.47 ? 157 GLN B O     1 
ATOM   4302 C  CB    . GLN D 2 157 ? -32.745 3.448   -43.102 1.00 43.81 ? 157 GLN B CB    1 
ATOM   4303 C  CG    . GLN D 2 157 ? -31.360 3.809   -42.592 1.00 33.09 ? 157 GLN B CG    1 
ATOM   4304 C  CD    . GLN D 2 157 ? -31.432 4.939   -41.568 1.00 46.52 ? 157 GLN B CD    1 
ATOM   4305 O  OE1   . GLN D 2 157 ? -32.512 5.252   -41.057 1.00 46.15 ? 157 GLN B OE1   1 
ATOM   4306 N  NE2   . GLN D 2 157 ? -30.288 5.550   -41.262 1.00 38.02 ? 157 GLN B NE2   1 
ATOM   4307 N  N     . GLU D 2 158 ? -30.757 2.858   -45.732 1.00 42.57 ? 158 GLU B N     1 
ATOM   4308 C  CA    . GLU D 2 158 ? -29.878 3.463   -46.719 1.00 48.75 ? 158 GLU B CA    1 
ATOM   4309 C  C     . GLU D 2 158 ? -30.360 3.068   -48.118 1.00 47.45 ? 158 GLU B C     1 
ATOM   4310 O  O     . GLU D 2 158 ? -30.169 3.800   -49.090 1.00 46.90 ? 158 GLU B O     1 
ATOM   4311 C  CB    . GLU D 2 158 ? -28.430 3.039   -46.456 1.00 43.34 ? 158 GLU B CB    1 
ATOM   4312 C  CG    . GLU D 2 158 ? -28.020 3.346   -45.014 1.00 52.75 ? 158 GLU B CG    1 
ATOM   4313 C  CD    . GLU D 2 158 ? -26.521 3.361   -44.785 1.00 57.22 ? 158 GLU B CD    1 
ATOM   4314 O  OE1   . GLU D 2 158 ? -25.776 2.901   -45.675 1.00 58.37 ? 158 GLU B OE1   1 
ATOM   4315 O  OE2   . GLU D 2 158 ? -26.090 3.830   -43.705 1.00 54.37 ? 158 GLU B OE2   1 
ATOM   4316 N  N     . ILE D 2 159 ? -31.011 1.915   -48.204 1.00 49.47 ? 159 ILE B N     1 
ATOM   4317 C  CA    . ILE D 2 159 ? -31.568 1.455   -49.462 1.00 51.41 ? 159 ILE B CA    1 
ATOM   4318 C  C     . ILE D 2 159 ? -32.790 2.323   -49.752 1.00 54.82 ? 159 ILE B C     1 
ATOM   4319 O  O     . ILE D 2 159 ? -32.890 2.940   -50.814 1.00 57.80 ? 159 ILE B O     1 
ATOM   4320 C  CB    . ILE D 2 159 ? -32.038 -0.013  -49.374 1.00 52.35 ? 159 ILE B CB    1 
ATOM   4321 C  CG1   . ILE D 2 159 ? -30.833 -0.953  -49.372 1.00 45.18 ? 159 ILE B CG1   1 
ATOM   4322 C  CG2   . ILE D 2 159 ? -32.988 -0.327  -50.529 1.00 51.05 ? 159 ILE B CG2   1 
ATOM   4323 C  CD1   . ILE D 2 159 ? -31.211 -2.419  -49.234 1.00 47.57 ? 159 ILE B CD1   1 
ATOM   4324 N  N     . THR D 2 160 ? -33.708 2.375   -48.789 1.00 55.19 ? 160 THR B N     1 
ATOM   4325 C  CA    . THR D 2 160 ? -34.940 3.141   -48.936 1.00 53.05 ? 160 THR B CA    1 
ATOM   4326 C  C     . THR D 2 160 ? -34.725 4.644   -49.053 1.00 57.52 ? 160 THR B C     1 
ATOM   4327 O  O     . THR D 2 160 ? -35.536 5.337   -49.664 1.00 59.36 ? 160 THR B O     1 
ATOM   4328 C  CB    . THR D 2 160 ? -35.923 2.871   -47.768 1.00 53.28 ? 160 THR B CB    1 
ATOM   4329 O  OG1   . THR D 2 160 ? -35.362 3.342   -46.537 1.00 56.83 ? 160 THR B OG1   1 
ATOM   4330 C  CG2   . THR D 2 160 ? -36.214 1.383   -47.652 1.00 43.68 ? 160 THR B CG2   1 
ATOM   4331 N  N     . GLN D 2 161 ? -33.650 5.160   -48.467 1.00 55.40 ? 161 GLN B N     1 
ATOM   4332 C  CA    . GLN D 2 161 ? -33.393 6.592   -48.564 1.00 57.83 ? 161 GLN B CA    1 
ATOM   4333 C  C     . GLN D 2 161 ? -32.774 6.907   -49.920 1.00 58.82 ? 161 GLN B C     1 
ATOM   4334 O  O     . GLN D 2 161 ? -32.819 8.042   -50.393 1.00 56.67 ? 161 GLN B O     1 
ATOM   4335 C  CB    . GLN D 2 161 ? -32.475 7.061   -47.427 1.00 52.15 ? 161 GLN B CB    1 
ATOM   4336 C  CG    . GLN D 2 161 ? -33.198 7.155   -46.089 1.00 52.36 ? 161 GLN B CG    1 
ATOM   4337 C  CD    . GLN D 2 161 ? -32.367 7.800   -44.994 1.00 53.18 ? 161 GLN B CD    1 
ATOM   4338 O  OE1   . GLN D 2 161 ? -32.873 8.621   -44.222 1.00 48.00 ? 161 GLN B OE1   1 
ATOM   4339 N  NE2   . GLN D 2 161 ? -31.090 7.423   -44.912 1.00 44.57 ? 161 GLN B NE2   1 
ATOM   4340 N  N     . LYS D 2 162 ? -32.211 5.884   -50.550 1.00 60.67 ? 162 LYS B N     1 
ATOM   4341 C  CA    . LYS D 2 162 ? -31.592 6.044   -51.855 1.00 65.36 ? 162 LYS B CA    1 
ATOM   4342 C  C     . LYS D 2 162 ? -32.662 5.936   -52.937 1.00 68.84 ? 162 LYS B C     1 
ATOM   4343 O  O     . LYS D 2 162 ? -32.720 6.757   -53.852 1.00 68.34 ? 162 LYS B O     1 
ATOM   4344 C  CB    . LYS D 2 162 ? -30.531 4.962   -52.069 1.00 66.04 ? 162 LYS B CB    1 
ATOM   4345 C  CG    . LYS D 2 162 ? -29.601 5.209   -53.246 1.00 65.03 ? 162 LYS B CG    1 
ATOM   4346 C  CD    . LYS D 2 162 ? -28.493 4.169   -53.281 1.00 72.29 ? 162 LYS B CD    1 
ATOM   4347 C  CE    . LYS D 2 162 ? -27.419 4.529   -54.296 1.00 80.47 ? 162 LYS B CE    1 
ATOM   4348 N  NZ    . LYS D 2 162 ? -26.223 3.632   -54.203 1.00 86.23 ? 162 LYS B NZ    1 
ATOM   4349 N  N     . ARG D 2 163 ? -33.518 4.927   -52.812 1.00 69.44 ? 163 ARG B N     1 
ATOM   4350 C  CA    . ARG D 2 163 ? -34.578 4.686   -53.785 1.00 71.68 ? 163 ARG B CA    1 
ATOM   4351 C  C     . ARG D 2 163 ? -35.741 5.669   -53.697 1.00 71.64 ? 163 ARG B C     1 
ATOM   4352 O  O     . ARG D 2 163 ? -36.067 6.339   -54.674 1.00 71.37 ? 163 ARG B O     1 
ATOM   4353 C  CB    . ARG D 2 163 ? -35.095 3.250   -53.633 1.00 77.20 ? 163 ARG B CB    1 
ATOM   4354 C  CG    . ARG D 2 163 ? -36.094 2.796   -54.690 1.00 77.58 ? 163 ARG B CG    1 
ATOM   4355 C  CD    . ARG D 2 163 ? -36.315 1.290   -54.582 1.00 84.91 ? 163 ARG B CD    1 
ATOM   4356 N  NE    . ARG D 2 163 ? -37.353 0.796   -55.486 1.00 95.15 ? 163 ARG B NE    1 
ATOM   4357 C  CZ    . ARG D 2 163 ? -37.762 -0.471  -55.535 1.00 96.30 ? 163 ARG B CZ    1 
ATOM   4358 N  NH1   . ARG D 2 163 ? -37.221 -1.379  -54.734 1.00 99.09 ? 163 ARG B NH1   1 
ATOM   4359 N  NH2   . ARG D 2 163 ? -38.721 -0.831  -56.377 1.00 96.99 ? 163 ARG B NH2   1 
ATOM   4360 N  N     . TRP D 2 164 ? -36.365 5.765   -52.530 1.00 71.41 ? 164 TRP B N     1 
ATOM   4361 C  CA    . TRP D 2 164 ? -37.505 6.661   -52.367 1.00 69.19 ? 164 TRP B CA    1 
ATOM   4362 C  C     . TRP D 2 164 ? -37.230 7.840   -51.447 1.00 68.27 ? 164 TRP B C     1 
ATOM   4363 O  O     . TRP D 2 164 ? -38.131 8.630   -51.167 1.00 64.66 ? 164 TRP B O     1 
ATOM   4364 C  CB    . TRP D 2 164 ? -38.699 5.885   -51.817 1.00 73.03 ? 164 TRP B CB    1 
ATOM   4365 C  CG    . TRP D 2 164 ? -39.088 4.700   -52.636 1.00 76.29 ? 164 TRP B CG    1 
ATOM   4366 C  CD1   . TRP D 2 164 ? -39.677 4.710   -53.865 1.00 75.34 ? 164 TRP B CD1   1 
ATOM   4367 C  CD2   . TRP D 2 164 ? -38.939 3.324   -52.271 1.00 79.20 ? 164 TRP B CD2   1 
ATOM   4368 N  NE1   . TRP D 2 164 ? -39.911 3.423   -54.289 1.00 78.29 ? 164 TRP B NE1   1 
ATOM   4369 C  CE2   . TRP D 2 164 ? -39.467 2.552   -53.329 1.00 78.60 ? 164 TRP B CE2   1 
ATOM   4370 C  CE3   . TRP D 2 164 ? -38.410 2.666   -51.152 1.00 79.75 ? 164 TRP B CE3   1 
ATOM   4371 C  CZ2   . TRP D 2 164 ? -39.485 1.153   -53.301 1.00 78.03 ? 164 TRP B CZ2   1 
ATOM   4372 C  CZ3   . TRP D 2 164 ? -38.428 1.272   -51.124 1.00 78.05 ? 164 TRP B CZ3   1 
ATOM   4373 C  CH2   . TRP D 2 164 ? -38.963 0.534   -52.194 1.00 78.34 ? 164 TRP B CH2   1 
ATOM   4374 N  N     . LYS D 2 165 ? -35.995 7.964   -50.976 1.00 65.03 ? 165 LYS B N     1 
ATOM   4375 C  CA    . LYS D 2 165 ? -35.657 9.051   -50.069 1.00 67.38 ? 165 LYS B CA    1 
ATOM   4376 C  C     . LYS D 2 165 ? -36.618 9.072   -48.877 1.00 62.80 ? 165 LYS B C     1 
ATOM   4377 O  O     . LYS D 2 165 ? -37.118 10.130  -48.483 1.00 61.26 ? 165 LYS B O     1 
ATOM   4378 C  CB    . LYS D 2 165 ? -35.706 10.397  -50.797 1.00 69.68 ? 165 LYS B CB    1 
ATOM   4379 C  CG    . LYS D 2 165 ? -34.672 10.536  -51.897 1.00 74.98 ? 165 LYS B CG    1 
ATOM   4380 C  CD    . LYS D 2 165 ? -34.553 11.977  -52.366 1.00 82.33 ? 165 LYS B CD    1 
ATOM   4381 C  CE    . LYS D 2 165 ? -33.567 12.094  -53.518 1.00 84.11 ? 165 LYS B CE    1 
ATOM   4382 N  NZ    . LYS D 2 165 ? -32.268 11.442  -53.189 1.00 87.44 ? 165 LYS B NZ    1 
ATOM   4383 N  N     . GLU D 2 166 ? -36.874 7.893   -48.318 1.00 53.22 ? 166 GLU B N     1 
ATOM   4384 C  CA    . GLU D 2 166 ? -37.755 7.749   -47.166 1.00 56.10 ? 166 GLU B CA    1 
ATOM   4385 C  C     . GLU D 2 166 ? -37.188 6.681   -46.238 1.00 56.83 ? 166 GLU B C     1 
ATOM   4386 O  O     . GLU D 2 166 ? -36.287 5.935   -46.622 1.00 55.88 ? 166 GLU B O     1 
ATOM   4387 C  CB    . GLU D 2 166 ? -39.161 7.336   -47.606 1.00 60.04 ? 166 GLU B CB    1 
ATOM   4388 C  CG    . GLU D 2 166 ? -39.801 8.274   -48.607 1.00 61.12 ? 166 GLU B CG    1 
ATOM   4389 C  CD    . GLU D 2 166 ? -41.261 7.951   -48.849 1.00 65.63 ? 166 GLU B CD    1 
ATOM   4390 O  OE1   . GLU D 2 166 ? -41.565 6.803   -49.241 1.00 67.59 ? 166 GLU B OE1   1 
ATOM   4391 O  OE2   . GLU D 2 166 ? -42.104 8.851   -48.645 1.00 66.07 ? 166 GLU B OE2   1 
ATOM   4392 N  N     . ARG D 2 167 ? -37.726 6.603   -45.025 1.00 54.38 ? 167 ARG B N     1 
ATOM   4393 C  CA    . ARG D 2 167 ? -37.263 5.627   -44.044 1.00 51.61 ? 167 ARG B CA    1 
ATOM   4394 C  C     . ARG D 2 167 ? -38.365 4.640   -43.674 1.00 51.34 ? 167 ARG B C     1 
ATOM   4395 O  O     . ARG D 2 167 ? -39.522 5.023   -43.492 1.00 49.07 ? 167 ARG B O     1 
ATOM   4396 C  CB    . ARG D 2 167 ? -36.769 6.345   -42.782 1.00 44.38 ? 167 ARG B CB    1 
ATOM   4397 C  CG    . ARG D 2 167 ? -35.649 7.325   -43.048 1.00 47.72 ? 167 ARG B CG    1 
ATOM   4398 C  CD    . ARG D 2 167 ? -35.280 8.142   -41.822 1.00 48.63 ? 167 ARG B CD    1 
ATOM   4399 N  NE    . ARG D 2 167 ? -36.374 8.981   -41.336 1.00 52.67 ? 167 ARG B NE    1 
ATOM   4400 C  CZ    . ARG D 2 167 ? -37.310 8.585   -40.471 1.00 60.18 ? 167 ARG B CZ    1 
ATOM   4401 N  NH1   . ARG D 2 167 ? -37.295 7.348   -39.982 1.00 56.25 ? 167 ARG B NH1   1 
ATOM   4402 N  NH2   . ARG D 2 167 ? -38.265 9.431   -40.090 1.00 50.26 ? 167 ARG B NH2   1 
ATOM   4403 N  N     . PRO D 2 168 ? -38.015 3.349   -43.549 1.00 49.41 ? 168 PRO B N     1 
ATOM   4404 C  CA    . PRO D 2 168 ? -38.989 2.313   -43.197 1.00 47.73 ? 168 PRO B CA    1 
ATOM   4405 C  C     . PRO D 2 168 ? -39.674 2.563   -41.856 1.00 52.55 ? 168 PRO B C     1 
ATOM   4406 O  O     . PRO D 2 168 ? -39.086 3.137   -40.939 1.00 52.22 ? 168 PRO B O     1 
ATOM   4407 C  CB    . PRO D 2 168 ? -38.149 1.038   -43.196 1.00 41.33 ? 168 PRO B CB    1 
ATOM   4408 C  CG    . PRO D 2 168 ? -36.800 1.529   -42.800 1.00 49.42 ? 168 PRO B CG    1 
ATOM   4409 C  CD    . PRO D 2 168 ? -36.660 2.781   -43.626 1.00 44.98 ? 168 PRO B CD    1 
ATOM   4410 N  N     . GLU D 2 169 ? -40.930 2.144   -41.763 1.00 54.14 ? 169 GLU B N     1 
ATOM   4411 C  CA    . GLU D 2 169 ? -41.706 2.302   -40.547 1.00 54.73 ? 169 GLU B CA    1 
ATOM   4412 C  C     . GLU D 2 169 ? -41.745 0.985   -39.785 1.00 52.75 ? 169 GLU B C     1 
ATOM   4413 O  O     . GLU D 2 169 ? -42.143 -0.046  -40.323 1.00 51.65 ? 169 GLU B O     1 
ATOM   4414 C  CB    . GLU D 2 169 ? -43.134 2.748   -40.872 1.00 58.49 ? 169 GLU B CB    1 
ATOM   4415 C  CG    . GLU D 2 169 ? -43.284 4.240   -41.119 1.00 66.47 ? 169 GLU B CG    1 
ATOM   4416 C  CD    . GLU D 2 169 ? -44.728 4.649   -41.373 1.00 72.30 ? 169 GLU B CD    1 
ATOM   4417 O  OE1   . GLU D 2 169 ? -45.608 4.260   -40.577 1.00 76.33 ? 169 GLU B OE1   1 
ATOM   4418 O  OE2   . GLU D 2 169 ? -44.985 5.366   -42.363 1.00 75.45 ? 169 GLU B OE2   1 
ATOM   4419 N  N     . TYR D 2 170 ? -41.321 1.029   -38.528 1.00 49.71 ? 170 TYR B N     1 
ATOM   4420 C  CA    . TYR D 2 170 ? -41.307 -0.150  -37.680 1.00 47.71 ? 170 TYR B CA    1 
ATOM   4421 C  C     . TYR D 2 170 ? -42.496 -0.107  -36.745 1.00 51.42 ? 170 TYR B C     1 
ATOM   4422 O  O     . TYR D 2 170 ? -42.659 0.836   -35.974 1.00 54.97 ? 170 TYR B O     1 
ATOM   4423 C  CB    . TYR D 2 170 ? -40.006 -0.196  -36.892 1.00 49.12 ? 170 TYR B CB    1 
ATOM   4424 C  CG    . TYR D 2 170 ? -38.814 -0.508  -37.761 1.00 43.19 ? 170 TYR B CG    1 
ATOM   4425 C  CD1   . TYR D 2 170 ? -38.529 -1.819  -38.131 1.00 44.58 ? 170 TYR B CD1   1 
ATOM   4426 C  CD2   . TYR D 2 170 ? -37.983 0.509   -38.234 1.00 44.67 ? 170 TYR B CD2   1 
ATOM   4427 C  CE1   . TYR D 2 170 ? -37.444 -2.115  -38.948 1.00 46.27 ? 170 TYR B CE1   1 
ATOM   4428 C  CE2   . TYR D 2 170 ? -36.896 0.225   -39.053 1.00 47.04 ? 170 TYR B CE2   1 
ATOM   4429 C  CZ    . TYR D 2 170 ? -36.632 -1.092  -39.405 1.00 48.27 ? 170 TYR B CZ    1 
ATOM   4430 O  OH    . TYR D 2 170 ? -35.552 -1.396  -40.205 1.00 55.90 ? 170 TYR B OH    1 
ATOM   4431 N  N     . ARG D 2 171 ? -43.331 -1.134  -36.817 1.00 54.10 ? 171 ARG B N     1 
ATOM   4432 C  CA    . ARG D 2 171 ? -44.523 -1.186  -35.993 1.00 55.22 ? 171 ARG B CA    1 
ATOM   4433 C  C     . ARG D 2 171 ? -44.515 -2.404  -35.078 1.00 53.31 ? 171 ARG B C     1 
ATOM   4434 O  O     . ARG D 2 171 ? -44.276 -3.525  -35.525 1.00 52.46 ? 171 ARG B O     1 
ATOM   4435 C  CB    . ARG D 2 171 ? -45.753 -1.212  -36.902 1.00 62.50 ? 171 ARG B CB    1 
ATOM   4436 C  CG    . ARG D 2 171 ? -47.075 -1.001  -36.201 1.00 73.03 ? 171 ARG B CG    1 
ATOM   4437 C  CD    . ARG D 2 171 ? -48.212 -1.010  -37.210 1.00 80.63 ? 171 ARG B CD    1 
ATOM   4438 N  NE    . ARG D 2 171 ? -49.507 -0.790  -36.574 1.00 92.78 ? 171 ARG B NE    1 
ATOM   4439 C  CZ    . ARG D 2 171 ? -50.663 -0.730  -37.229 1.00 98.89 ? 171 ARG B CZ    1 
ATOM   4440 N  NH1   . ARG D 2 171 ? -50.690 -0.875  -38.548 1.00 98.95 ? 171 ARG B NH1   1 
ATOM   4441 N  NH2   . ARG D 2 171 ? -51.795 -0.528  -36.563 1.00 99.84 ? 171 ARG B NH2   1 
ATOM   4442 N  N     . LEU D 2 172 ? -44.756 -2.179  -33.790 1.00 50.52 ? 172 LEU B N     1 
ATOM   4443 C  CA    . LEU D 2 172 ? -44.795 -3.277  -32.839 1.00 52.33 ? 172 LEU B CA    1 
ATOM   4444 C  C     . LEU D 2 172 ? -46.121 -4.005  -33.032 1.00 54.40 ? 172 LEU B C     1 
ATOM   4445 O  O     . LEU D 2 172 ? -47.191 -3.397  -32.971 1.00 53.04 ? 172 LEU B O     1 
ATOM   4446 C  CB    . LEU D 2 172 ? -44.686 -2.753  -31.406 1.00 50.75 ? 172 LEU B CB    1 
ATOM   4447 C  CG    . LEU D 2 172 ? -44.802 -3.793  -30.286 1.00 49.76 ? 172 LEU B CG    1 
ATOM   4448 C  CD1   . LEU D 2 172 ? -43.877 -4.972  -30.550 1.00 51.75 ? 172 LEU B CD1   1 
ATOM   4449 C  CD2   . LEU D 2 172 ? -44.465 -3.133  -28.960 1.00 45.41 ? 172 LEU B CD2   1 
ATOM   4450 N  N     . ILE D 2 173 ? -46.048 -5.306  -33.272 1.00 53.76 ? 173 ILE B N     1 
ATOM   4451 C  CA    . ILE D 2 173 ? -47.248 -6.099  -33.492 1.00 57.54 ? 173 ILE B CA    1 
ATOM   4452 C  C     . ILE D 2 173 ? -47.709 -6.835  -32.240 1.00 55.12 ? 173 ILE B C     1 
ATOM   4453 O  O     . ILE D 2 173 ? -48.835 -6.656  -31.780 1.00 58.30 ? 173 ILE B O     1 
ATOM   4454 C  CB    . ILE D 2 173 ? -47.023 -7.138  -34.629 1.00 56.47 ? 173 ILE B CB    1 
ATOM   4455 C  CG1   . ILE D 2 173 ? -46.586 -6.425  -35.916 1.00 55.82 ? 173 ILE B CG1   1 
ATOM   4456 C  CG2   . ILE D 2 173 ? -48.287 -7.945  -34.863 1.00 51.89 ? 173 ILE B CG2   1 
ATOM   4457 C  CD1   . ILE D 2 173 ? -47.529 -5.324  -36.389 1.00 50.99 ? 173 ILE B CD1   1 
ATOM   4458 N  N     . SER D 2 174 ? -46.830 -7.656  -31.681 1.00 59.37 ? 174 SER B N     1 
ATOM   4459 C  CA    . SER D 2 174 ? -47.173 -8.440  -30.503 1.00 62.63 ? 174 SER B CA    1 
ATOM   4460 C  C     . SER D 2 174 ? -46.082 -8.423  -29.432 1.00 60.98 ? 174 SER B C     1 
ATOM   4461 O  O     . SER D 2 174 ? -44.950 -8.020  -29.688 1.00 59.21 ? 174 SER B O     1 
ATOM   4462 C  CB    . SER D 2 174 ? -47.453 -9.883  -30.938 1.00 62.26 ? 174 SER B CB    1 
ATOM   4463 O  OG    . SER D 2 174 ? -47.656 -10.738 -29.828 1.00 78.88 ? 174 SER B OG    1 
ATOM   4464 N  N     . VAL D 2 175 ? -46.447 -8.857  -28.229 1.00 65.54 ? 175 VAL B N     1 
ATOM   4465 C  CA    . VAL D 2 175 ? -45.529 -8.940  -27.093 1.00 68.09 ? 175 VAL B CA    1 
ATOM   4466 C  C     . VAL D 2 175 ? -46.053 -10.049 -26.188 1.00 70.15 ? 175 VAL B C     1 
ATOM   4467 O  O     . VAL D 2 175 ? -47.029 -9.856  -25.463 1.00 69.72 ? 175 VAL B O     1 
ATOM   4468 C  CB    . VAL D 2 175 ? -45.486 -7.629  -26.276 1.00 68.49 ? 175 VAL B CB    1 
ATOM   4469 C  CG1   . VAL D 2 175 ? -44.510 -7.776  -25.120 1.00 69.04 ? 175 VAL B CG1   1 
ATOM   4470 C  CG2   . VAL D 2 175 ? -45.073 -6.469  -27.161 1.00 68.65 ? 175 VAL B CG2   1 
ATOM   4471 N  N     . GLU D 2 176 ? -45.408 -11.210 -26.235 1.00 69.98 ? 176 GLU B N     1 
ATOM   4472 C  CA    . GLU D 2 176 ? -45.836 -12.349 -25.433 1.00 70.81 ? 176 GLU B CA    1 
ATOM   4473 C  C     . GLU D 2 176 ? -44.754 -12.805 -24.463 1.00 70.18 ? 176 GLU B C     1 
ATOM   4474 O  O     . GLU D 2 176 ? -43.618 -12.330 -24.507 1.00 73.34 ? 176 GLU B O     1 
ATOM   4475 C  CB    . GLU D 2 176 ? -46.193 -13.524 -26.348 1.00 76.69 ? 176 GLU B CB    1 
ATOM   4476 C  CG    . GLU D 2 176 ? -47.058 -13.165 -27.548 1.00 87.45 ? 176 GLU B CG    1 
ATOM   4477 C  CD    . GLU D 2 176 ? -48.443 -12.692 -27.157 1.00 91.36 ? 176 GLU B CD    1 
ATOM   4478 O  OE1   . GLU D 2 176 ? -49.167 -13.455 -26.482 1.00 95.08 ? 176 GLU B OE1   1 
ATOM   4479 O  OE2   . GLU D 2 176 ? -48.808 -11.557 -27.529 1.00 96.08 ? 176 GLU B OE2   1 
ATOM   4480 N  N     . GLY D 2 177 ? -45.119 -13.740 -23.593 1.00 66.19 ? 177 GLY B N     1 
ATOM   4481 C  CA    . GLY D 2 177 ? -44.171 -14.280 -22.639 1.00 62.41 ? 177 GLY B CA    1 
ATOM   4482 C  C     . GLY D 2 177 ? -44.127 -13.578 -21.298 1.00 58.59 ? 177 GLY B C     1 
ATOM   4483 O  O     . GLY D 2 177 ? -44.731 -12.519 -21.122 1.00 56.67 ? 177 GLY B O     1 
ATOM   4484 N  N     . PRO D 2 178 ? -43.419 -14.162 -20.321 1.00 55.39 ? 178 PRO B N     1 
ATOM   4485 C  CA    . PRO D 2 178 ? -43.293 -13.585 -18.981 1.00 54.68 ? 178 PRO B CA    1 
ATOM   4486 C  C     . PRO D 2 178 ? -42.406 -12.354 -19.103 1.00 52.84 ? 178 PRO B C     1 
ATOM   4487 O  O     . PRO D 2 178 ? -41.647 -12.234 -20.067 1.00 50.57 ? 178 PRO B O     1 
ATOM   4488 C  CB    . PRO D 2 178 ? -42.606 -14.693 -18.181 1.00 46.16 ? 178 PRO B CB    1 
ATOM   4489 C  CG    . PRO D 2 178 ? -42.826 -15.928 -18.991 1.00 55.55 ? 178 PRO B CG    1 
ATOM   4490 C  CD    . PRO D 2 178 ? -42.703 -15.443 -20.398 1.00 51.05 ? 178 PRO B CD    1 
ATOM   4491 N  N     . HIS D 2 179 ? -42.485 -11.456 -18.128 1.00 56.36 ? 179 HIS B N     1 
ATOM   4492 C  CA    . HIS D 2 179 ? -41.679 -10.238 -18.159 1.00 59.33 ? 179 HIS B CA    1 
ATOM   4493 C  C     . HIS D 2 179 ? -40.170 -10.465 -18.283 1.00 57.24 ? 179 HIS B C     1 
ATOM   4494 O  O     . HIS D 2 179 ? -39.480 -9.697  -18.954 1.00 60.67 ? 179 HIS B O     1 
ATOM   4495 C  CB    . HIS D 2 179 ? -41.958 -9.392  -16.918 1.00 62.14 ? 179 HIS B CB    1 
ATOM   4496 C  CG    . HIS D 2 179 ? -43.301 -8.736  -16.925 1.00 67.22 ? 179 HIS B CG    1 
ATOM   4497 N  ND1   . HIS D 2 179 ? -43.709 -7.891  -17.934 1.00 69.24 ? 179 HIS B ND1   1 
ATOM   4498 C  CD2   . HIS D 2 179 ? -44.321 -8.781  -16.036 1.00 67.10 ? 179 HIS B CD2   1 
ATOM   4499 C  CE1   . HIS D 2 179 ? -44.922 -7.443  -17.666 1.00 69.39 ? 179 HIS B CE1   1 
ATOM   4500 N  NE2   . HIS D 2 179 ? -45.316 -7.967  -16.520 1.00 68.79 ? 179 HIS B NE2   1 
ATOM   4501 N  N     . HIS D 2 180 ? -39.658 -11.508 -17.637 1.00 55.67 ? 180 HIS B N     1 
ATOM   4502 C  CA    . HIS D 2 180 ? -38.229 -11.794 -17.682 1.00 53.76 ? 180 HIS B CA    1 
ATOM   4503 C  C     . HIS D 2 180 ? -37.788 -12.487 -18.965 1.00 56.45 ? 180 HIS B C     1 
ATOM   4504 O  O     . HIS D 2 180 ? -36.603 -12.741 -19.164 1.00 56.92 ? 180 HIS B O     1 
ATOM   4505 C  CB    . HIS D 2 180 ? -37.813 -12.630 -16.471 1.00 57.20 ? 180 HIS B CB    1 
ATOM   4506 C  CG    . HIS D 2 180 ? -38.720 -13.787 -16.192 1.00 58.03 ? 180 HIS B CG    1 
ATOM   4507 N  ND1   . HIS D 2 180 ? -40.023 -13.627 -15.773 1.00 61.79 ? 180 HIS B ND1   1 
ATOM   4508 C  CD2   . HIS D 2 180 ? -38.504 -15.122 -16.247 1.00 57.03 ? 180 HIS B CD2   1 
ATOM   4509 C  CE1   . HIS D 2 180 ? -40.570 -14.812 -15.577 1.00 58.82 ? 180 HIS B CE1   1 
ATOM   4510 N  NE2   . HIS D 2 180 ? -39.669 -15.736 -15.858 1.00 58.22 ? 180 HIS B NE2   1 
ATOM   4511 N  N     . LYS D 2 181 ? -38.743 -12.812 -19.827 1.00 55.55 ? 181 LYS B N     1 
ATOM   4512 C  CA    . LYS D 2 181 ? -38.422 -13.428 -21.105 1.00 60.06 ? 181 LYS B CA    1 
ATOM   4513 C  C     . LYS D 2 181 ? -39.557 -13.185 -22.081 1.00 62.71 ? 181 LYS B C     1 
ATOM   4514 O  O     . LYS D 2 181 ? -40.354 -14.077 -22.371 1.00 68.19 ? 181 LYS B O     1 
ATOM   4515 C  CB    . LYS D 2 181 ? -38.160 -14.929 -20.973 1.00 58.60 ? 181 LYS B CB    1 
ATOM   4516 C  CG    . LYS D 2 181 ? -37.612 -15.509 -22.276 1.00 69.14 ? 181 LYS B CG    1 
ATOM   4517 C  CD    . LYS D 2 181 ? -37.053 -16.918 -22.146 1.00 65.97 ? 181 LYS B CD    1 
ATOM   4518 C  CE    . LYS D 2 181 ? -36.398 -17.344 -23.456 1.00 65.53 ? 181 LYS B CE    1 
ATOM   4519 N  NZ    . LYS D 2 181 ? -35.839 -18.725 -23.411 1.00 72.89 ? 181 LYS B NZ    1 
ATOM   4520 N  N     . LYS D 2 182 ? -39.615 -11.956 -22.579 1.00 56.56 ? 182 LYS B N     1 
ATOM   4521 C  CA    . LYS D 2 182 ? -40.640 -11.534 -23.520 1.00 56.43 ? 182 LYS B CA    1 
ATOM   4522 C  C     . LYS D 2 182 ? -40.299 -11.930 -24.944 1.00 56.12 ? 182 LYS B C     1 
ATOM   4523 O  O     . LYS D 2 182 ? -39.141 -12.186 -25.269 1.00 56.29 ? 182 LYS B O     1 
ATOM   4524 C  CB    . LYS D 2 182 ? -40.801 -10.013 -23.463 1.00 56.64 ? 182 LYS B CB    1 
ATOM   4525 C  CG    . LYS D 2 182 ? -41.182 -9.473  -22.103 1.00 55.42 ? 182 LYS B CG    1 
ATOM   4526 C  CD    . LYS D 2 182 ? -41.119 -7.964  -22.081 1.00 55.94 ? 182 LYS B CD    1 
ATOM   4527 C  CE    . LYS D 2 182 ? -41.730 -7.417  -20.807 1.00 59.33 ? 182 LYS B CE    1 
ATOM   4528 N  NZ    . LYS D 2 182 ? -43.179 -7.739  -20.740 1.00 60.32 ? 182 LYS B NZ    1 
ATOM   4529 N  N     . LYS D 2 183 ? -41.324 -11.973 -25.787 1.00 57.23 ? 183 LYS B N     1 
ATOM   4530 C  CA    . LYS D 2 183 ? -41.157 -12.293 -27.198 1.00 60.00 ? 183 LYS B CA    1 
ATOM   4531 C  C     . LYS D 2 183 ? -41.813 -11.153 -27.957 1.00 50.73 ? 183 LYS B C     1 
ATOM   4532 O  O     . LYS D 2 183 ? -43.002 -10.892 -27.788 1.00 57.03 ? 183 LYS B O     1 
ATOM   4533 C  CB    . LYS D 2 183 ? -41.839 -13.616 -27.544 1.00 65.38 ? 183 LYS B CB    1 
ATOM   4534 C  CG    . LYS D 2 183 ? -41.613 -14.062 -28.981 1.00 74.20 ? 183 LYS B CG    1 
ATOM   4535 C  CD    . LYS D 2 183 ? -42.177 -15.453 -29.215 1.00 82.33 ? 183 LYS B CD    1 
ATOM   4536 C  CE    . LYS D 2 183 ? -41.808 -15.985 -30.588 1.00 83.39 ? 183 LYS B CE    1 
ATOM   4537 N  NZ    . LYS D 2 183 ? -42.246 -17.401 -30.771 1.00 91.18 ? 183 LYS B NZ    1 
ATOM   4538 N  N     . PHE D 2 184 ? -41.030 -10.472 -28.785 1.00 50.91 ? 184 PHE B N     1 
ATOM   4539 C  CA    . PHE D 2 184 ? -41.521 -9.329  -29.550 1.00 43.25 ? 184 PHE B CA    1 
ATOM   4540 C  C     . PHE D 2 184 ? -41.705 -9.622  -31.031 1.00 46.09 ? 184 PHE B C     1 
ATOM   4541 O  O     . PHE D 2 184 ? -40.831 -10.208 -31.671 1.00 42.68 ? 184 PHE B O     1 
ATOM   4542 C  CB    . PHE D 2 184 ? -40.541 -8.157  -29.429 1.00 48.97 ? 184 PHE B CB    1 
ATOM   4543 C  CG    . PHE D 2 184 ? -40.450 -7.558  -28.052 1.00 42.19 ? 184 PHE B CG    1 
ATOM   4544 C  CD1   . PHE D 2 184 ? -41.350 -6.581  -27.643 1.00 45.43 ? 184 PHE B CD1   1 
ATOM   4545 C  CD2   . PHE D 2 184 ? -39.434 -7.937  -27.182 1.00 43.15 ? 184 PHE B CD2   1 
ATOM   4546 C  CE1   . PHE D 2 184 ? -41.237 -5.982  -26.384 1.00 51.65 ? 184 PHE B CE1   1 
ATOM   4547 C  CE2   . PHE D 2 184 ? -39.309 -7.346  -25.920 1.00 46.65 ? 184 PHE B CE2   1 
ATOM   4548 C  CZ    . PHE D 2 184 ? -40.212 -6.366  -25.520 1.00 49.21 ? 184 PHE B CZ    1 
ATOM   4549 N  N     . ILE D 2 185 ? -42.841 -9.196  -31.572 1.00 45.16 ? 185 ILE B N     1 
ATOM   4550 C  CA    . ILE D 2 185 ? -43.115 -9.358  -32.990 1.00 48.30 ? 185 ILE B CA    1 
ATOM   4551 C  C     . ILE D 2 185 ? -43.343 -7.967  -33.561 1.00 50.23 ? 185 ILE B C     1 
ATOM   4552 O  O     . ILE D 2 185 ? -44.268 -7.260  -33.166 1.00 50.86 ? 185 ILE B O     1 
ATOM   4553 C  CB    . ILE D 2 185 ? -44.356 -10.245 -33.247 1.00 55.66 ? 185 ILE B CB    1 
ATOM   4554 C  CG1   . ILE D 2 185 ? -44.036 -11.693 -32.864 1.00 52.80 ? 185 ILE B CG1   1 
ATOM   4555 C  CG2   . ILE D 2 185 ? -44.769 -10.158 -34.726 1.00 45.25 ? 185 ILE B CG2   1 
ATOM   4556 C  CD1   . ILE D 2 185 ? -45.226 -12.631 -32.936 1.00 57.92 ? 185 ILE B CD1   1 
ATOM   4557 N  N     . VAL D 2 186 ? -42.479 -7.577  -34.489 1.00 54.79 ? 186 VAL B N     1 
ATOM   4558 C  CA    . VAL D 2 186 ? -42.562 -6.261  -35.105 1.00 58.22 ? 186 VAL B CA    1 
ATOM   4559 C  C     . VAL D 2 186 ? -42.768 -6.345  -36.614 1.00 58.36 ? 186 VAL B C     1 
ATOM   4560 O  O     . VAL D 2 186 ? -42.432 -7.348  -37.253 1.00 53.43 ? 186 VAL B O     1 
ATOM   4561 C  CB    . VAL D 2 186 ? -41.271 -5.451  -34.824 1.00 57.64 ? 186 VAL B CB    1 
ATOM   4562 C  CG1   . VAL D 2 186 ? -41.350 -4.083  -35.487 1.00 67.19 ? 186 VAL B CG1   1 
ATOM   4563 C  CG2   . VAL D 2 186 ? -41.073 -5.297  -33.325 1.00 56.67 ? 186 VAL B CG2   1 
ATOM   4564 N  N     . GLU D 2 187 ? -43.326 -5.279  -37.173 1.00 57.95 ? 187 GLU B N     1 
ATOM   4565 C  CA    . GLU D 2 187 ? -43.561 -5.203  -38.605 1.00 60.87 ? 187 GLU B CA    1 
ATOM   4566 C  C     . GLU D 2 187 ? -42.761 -4.063  -39.218 1.00 60.16 ? 187 GLU B C     1 
ATOM   4567 O  O     . GLU D 2 187 ? -42.771 -2.940  -38.709 1.00 60.17 ? 187 GLU B O     1 
ATOM   4568 C  CB    . GLU D 2 187 ? -45.041 -4.965  -38.904 1.00 62.11 ? 187 GLU B CB    1 
ATOM   4569 C  CG    . GLU D 2 187 ? -45.340 -4.912  -40.392 1.00 67.59 ? 187 GLU B CG    1 
ATOM   4570 C  CD    . GLU D 2 187 ? -46.712 -4.362  -40.693 1.00 68.22 ? 187 GLU B CD    1 
ATOM   4571 O  OE1   . GLU D 2 187 ? -46.922 -3.150  -40.482 1.00 67.31 ? 187 GLU B OE1   1 
ATOM   4572 O  OE2   . GLU D 2 187 ? -47.579 -5.143  -41.137 1.00 74.40 ? 187 GLU B OE2   1 
ATOM   4573 N  N     . ALA D 2 188 ? -42.066 -4.364  -40.310 1.00 54.96 ? 188 ALA B N     1 
ATOM   4574 C  CA    . ALA D 2 188 ? -41.288 -3.364  -41.023 1.00 56.68 ? 188 ALA B CA    1 
ATOM   4575 C  C     . ALA D 2 188 ? -42.068 -3.046  -42.300 1.00 61.14 ? 188 ALA B C     1 
ATOM   4576 O  O     . ALA D 2 188 ? -42.529 -3.956  -42.998 1.00 52.41 ? 188 ALA B O     1 
ATOM   4577 C  CB    . ALA D 2 188 ? -39.918 -3.911  -41.361 1.00 51.65 ? 188 ALA B CB    1 
ATOM   4578 N  N     . LYS D 2 189 ? -42.220 -1.759  -42.602 1.00 60.72 ? 189 LYS B N     1 
ATOM   4579 C  CA    . LYS D 2 189 ? -42.964 -1.349  -43.785 1.00 63.85 ? 189 LYS B CA    1 
ATOM   4580 C  C     . LYS D 2 189 ? -42.374 -0.149  -44.529 1.00 65.21 ? 189 LYS B C     1 
ATOM   4581 O  O     . LYS D 2 189 ? -41.986 0.851   -43.927 1.00 62.24 ? 189 LYS B O     1 
ATOM   4582 C  CB    . LYS D 2 189 ? -44.417 -1.033  -43.404 1.00 64.90 ? 189 LYS B CB    1 
ATOM   4583 C  CG    . LYS D 2 189 ? -45.237 -0.432  -44.537 1.00 69.36 ? 189 LYS B CG    1 
ATOM   4584 C  CD    . LYS D 2 189 ? -46.498 0.249   -44.031 1.00 73.00 ? 189 LYS B CD    1 
ATOM   4585 C  CE    . LYS D 2 189 ? -47.165 1.047   -45.146 1.00 78.67 ? 189 LYS B CE    1 
ATOM   4586 N  NZ    . LYS D 2 189 ? -48.314 1.873   -44.673 1.00 79.94 ? 189 LYS B NZ    1 
ATOM   4587 N  N     . ILE D 2 190 ? -42.320 -0.267  -45.851 1.00 62.84 ? 190 ILE B N     1 
ATOM   4588 C  CA    . ILE D 2 190 ? -41.829 0.799   -46.712 1.00 61.62 ? 190 ILE B CA    1 
ATOM   4589 C  C     . ILE D 2 190 ? -42.739 0.809   -47.937 1.00 65.50 ? 190 ILE B C     1 
ATOM   4590 O  O     . ILE D 2 190 ? -42.933 -0.224  -48.583 1.00 54.54 ? 190 ILE B O     1 
ATOM   4591 C  CB    . ILE D 2 190 ? -40.366 0.566   -47.141 1.00 59.98 ? 190 ILE B CB    1 
ATOM   4592 C  CG1   . ILE D 2 190 ? -39.874 1.769   -47.942 1.00 58.43 ? 190 ILE B CG1   1 
ATOM   4593 C  CG2   . ILE D 2 190 ? -40.248 -0.705  -47.959 1.00 64.86 ? 190 ILE B CG2   1 
ATOM   4594 C  CD1   . ILE D 2 190 ? -40.030 3.087   -47.207 1.00 57.08 ? 190 ILE B CD1   1 
ATOM   4595 N  N     . LYS D 2 191 ? -43.298 1.977   -48.248 1.00 67.64 ? 191 LYS B N     1 
ATOM   4596 C  CA    . LYS D 2 191 ? -44.224 2.110   -49.368 1.00 68.71 ? 191 LYS B CA    1 
ATOM   4597 C  C     . LYS D 2 191 ? -45.386 1.179   -49.070 1.00 69.63 ? 191 LYS B C     1 
ATOM   4598 O  O     . LYS D 2 191 ? -46.193 1.458   -48.185 1.00 71.38 ? 191 LYS B O     1 
ATOM   4599 C  CB    . LYS D 2 191 ? -43.552 1.723   -50.692 1.00 65.65 ? 191 LYS B CB    1 
ATOM   4600 C  CG    . LYS D 2 191 ? -42.614 2.785   -51.240 1.00 65.46 ? 191 LYS B CG    1 
ATOM   4601 C  CD    . LYS D 2 191 ? -43.356 4.102   -51.431 1.00 68.97 ? 191 LYS B CD    1 
ATOM   4602 C  CE    . LYS D 2 191 ? -42.439 5.215   -51.906 1.00 69.88 ? 191 LYS B CE    1 
ATOM   4603 N  NZ    . LYS D 2 191 ? -43.162 6.517   -51.960 1.00 74.27 ? 191 LYS B NZ    1 
ATOM   4604 N  N     . GLU D 2 192 ? -45.467 0.070   -49.796 1.00 74.46 ? 192 GLU B N     1 
ATOM   4605 C  CA    . GLU D 2 192 ? -46.531 -0.899  -49.566 1.00 75.83 ? 192 GLU B CA    1 
ATOM   4606 C  C     . GLU D 2 192 ? -45.957 -2.249  -49.172 1.00 73.99 ? 192 GLU B C     1 
ATOM   4607 O  O     . GLU D 2 192 ? -46.694 -3.220  -49.020 1.00 75.50 ? 192 GLU B O     1 
ATOM   4608 C  CB    . GLU D 2 192 ? -47.410 -1.050  -50.811 1.00 83.23 ? 192 GLU B CB    1 
ATOM   4609 C  CG    . GLU D 2 192 ? -48.443 0.064   -50.987 1.00 90.13 ? 192 GLU B CG    1 
ATOM   4610 C  CD    . GLU D 2 192 ? -49.474 0.108   -49.864 1.00 93.31 ? 192 GLU B CD    1 
ATOM   4611 O  OE1   . GLU D 2 192 ? -49.404 -0.727  -48.935 1.00 94.17 ? 192 GLU B OE1   1 
ATOM   4612 O  OE2   . GLU D 2 192 ? -50.361 0.986   -49.912 1.00 97.93 ? 192 GLU B OE2   1 
ATOM   4613 N  N     . TYR D 2 193 ? -44.640 -2.307  -49.009 1.00 71.79 ? 193 TYR B N     1 
ATOM   4614 C  CA    . TYR D 2 193 ? -43.980 -3.546  -48.618 1.00 72.46 ? 193 TYR B CA    1 
ATOM   4615 C  C     . TYR D 2 193 ? -43.993 -3.650  -47.097 1.00 71.57 ? 193 TYR B C     1 
ATOM   4616 O  O     . TYR D 2 193 ? -43.839 -2.648  -46.397 1.00 67.38 ? 193 TYR B O     1 
ATOM   4617 C  CB    . TYR D 2 193 ? -42.540 -3.579  -49.136 1.00 76.32 ? 193 TYR B CB    1 
ATOM   4618 C  CG    . TYR D 2 193 ? -42.436 -3.419  -50.632 1.00 79.26 ? 193 TYR B CG    1 
ATOM   4619 C  CD1   . TYR D 2 193 ? -42.683 -2.187  -51.239 1.00 84.00 ? 193 TYR B CD1   1 
ATOM   4620 C  CD2   . TYR D 2 193 ? -42.138 -4.508  -51.449 1.00 80.40 ? 193 TYR B CD2   1 
ATOM   4621 C  CE1   . TYR D 2 193 ? -42.640 -2.043  -52.625 1.00 87.74 ? 193 TYR B CE1   1 
ATOM   4622 C  CE2   . TYR D 2 193 ? -42.093 -4.378  -52.838 1.00 84.97 ? 193 TYR B CE2   1 
ATOM   4623 C  CZ    . TYR D 2 193 ? -42.347 -3.142  -53.419 1.00 87.24 ? 193 TYR B CZ    1 
ATOM   4624 O  OH    . TYR D 2 193 ? -42.320 -3.008  -54.790 1.00 87.04 ? 193 TYR B OH    1 
ATOM   4625 N  N     . ARG D 2 194 ? -44.190 -4.864  -46.592 1.00 71.20 ? 194 ARG B N     1 
ATOM   4626 C  CA    . ARG D 2 194 ? -44.243 -5.094  -45.155 1.00 70.24 ? 194 ARG B CA    1 
ATOM   4627 C  C     . ARG D 2 194 ? -43.766 -6.496  -44.813 1.00 68.24 ? 194 ARG B C     1 
ATOM   4628 O  O     . ARG D 2 194 ? -44.188 -7.469  -45.431 1.00 65.23 ? 194 ARG B O     1 
ATOM   4629 C  CB    . ARG D 2 194 ? -45.679 -4.921  -44.650 1.00 71.51 ? 194 ARG B CB    1 
ATOM   4630 C  CG    . ARG D 2 194 ? -46.359 -3.672  -45.165 1.00 78.85 ? 194 ARG B CG    1 
ATOM   4631 C  CD    . ARG D 2 194 ? -47.789 -3.558  -44.686 1.00 84.00 ? 194 ARG B CD    1 
ATOM   4632 N  NE    . ARG D 2 194 ? -48.512 -2.553  -45.458 1.00 92.46 ? 194 ARG B NE    1 
ATOM   4633 C  CZ    . ARG D 2 194 ? -49.762 -2.177  -45.216 1.00 95.77 ? 194 ARG B CZ    1 
ATOM   4634 N  NH1   . ARG D 2 194 ? -50.436 -2.721  -44.210 1.00 98.29 ? 194 ARG B NH1   1 
ATOM   4635 N  NH2   . ARG D 2 194 ? -50.342 -1.267  -45.991 1.00 94.54 ? 194 ARG B NH2   1 
ATOM   4636 N  N     . THR D 2 195 ? -42.882 -6.595  -43.829 1.00 66.43 ? 195 THR B N     1 
ATOM   4637 C  CA    . THR D 2 195 ? -42.382 -7.889  -43.396 1.00 63.53 ? 195 THR B CA    1 
ATOM   4638 C  C     . THR D 2 195 ? -42.541 -7.982  -41.885 1.00 63.80 ? 195 THR B C     1 
ATOM   4639 O  O     . THR D 2 195 ? -42.860 -6.995  -41.221 1.00 61.07 ? 195 THR B O     1 
ATOM   4640 C  CB    . THR D 2 195 ? -40.895 -8.082  -43.760 1.00 65.39 ? 195 THR B CB    1 
ATOM   4641 O  OG1   . THR D 2 195 ? -40.113 -7.054  -43.142 1.00 65.65 ? 195 THR B OG1   1 
ATOM   4642 C  CG2   . THR D 2 195 ? -40.702 -8.024  -45.270 1.00 68.63 ? 195 THR B CG2   1 
ATOM   4643 N  N     . LEU D 2 196 ? -42.329 -9.174  -41.345 1.00 62.62 ? 196 LEU B N     1 
ATOM   4644 C  CA    . LEU D 2 196 ? -42.448 -9.376  -39.911 1.00 63.44 ? 196 LEU B CA    1 
ATOM   4645 C  C     . LEU D 2 196 ? -41.119 -9.821  -39.346 1.00 61.54 ? 196 LEU B C     1 
ATOM   4646 O  O     . LEU D 2 196 ? -40.228 -10.237 -40.084 1.00 60.28 ? 196 LEU B O     1 
ATOM   4647 C  CB    . LEU D 2 196 ? -43.506 -10.436 -39.593 1.00 61.91 ? 196 LEU B CB    1 
ATOM   4648 C  CG    . LEU D 2 196 ? -44.959 -10.127 -39.945 1.00 61.63 ? 196 LEU B CG    1 
ATOM   4649 C  CD1   . LEU D 2 196 ? -45.836 -11.259 -39.437 1.00 57.55 ? 196 LEU B CD1   1 
ATOM   4650 C  CD2   . LEU D 2 196 ? -45.381 -8.806  -39.322 1.00 56.26 ? 196 LEU B CD2   1 
ATOM   4651 N  N     . GLY D 2 197 ? -40.997 -9.728  -38.029 1.00 59.36 ? 197 GLY B N     1 
ATOM   4652 C  CA    . GLY D 2 197 ? -39.778 -10.137 -37.365 1.00 54.22 ? 197 GLY B CA    1 
ATOM   4653 C  C     . GLY D 2 197 ? -40.015 -10.296 -35.881 1.00 50.62 ? 197 GLY B C     1 
ATOM   4654 O  O     . GLY D 2 197 ? -40.786 -9.545  -35.282 1.00 50.22 ? 197 GLY B O     1 
ATOM   4655 N  N     . GLU D 2 198 ? -39.372 -11.288 -35.281 1.00 53.84 ? 198 GLU B N     1 
ATOM   4656 C  CA    . GLU D 2 198 ? -39.515 -11.493 -33.851 1.00 59.58 ? 198 GLU B CA    1 
ATOM   4657 C  C     . GLU D 2 198 ? -38.158 -11.682 -33.196 1.00 55.00 ? 198 GLU B C     1 
ATOM   4658 O  O     . GLU D 2 198 ? -37.180 -12.044 -33.852 1.00 54.61 ? 198 GLU B O     1 
ATOM   4659 C  CB    . GLU D 2 198 ? -40.427 -12.687 -33.549 1.00 67.18 ? 198 GLU B CB    1 
ATOM   4660 C  CG    . GLU D 2 198 ? -39.968 -14.007 -34.116 1.00 78.83 ? 198 GLU B CG    1 
ATOM   4661 C  CD    . GLU D 2 198 ? -40.852 -15.153 -33.664 1.00 84.80 ? 198 GLU B CD    1 
ATOM   4662 O  OE1   . GLU D 2 198 ? -42.080 -15.084 -33.888 1.00 86.73 ? 198 GLU B OE1   1 
ATOM   4663 O  OE2   . GLU D 2 198 ? -40.317 -16.121 -33.083 1.00 90.87 ? 198 GLU B OE2   1 
ATOM   4664 N  N     . GLY D 2 199 ? -38.109 -11.407 -31.897 1.00 53.31 ? 199 GLY B N     1 
ATOM   4665 C  CA    . GLY D 2 199 ? -36.878 -11.537 -31.145 1.00 51.45 ? 199 GLY B CA    1 
ATOM   4666 C  C     . GLY D 2 199 ? -37.145 -11.312 -29.670 1.00 49.21 ? 199 GLY B C     1 
ATOM   4667 O  O     . GLY D 2 199 ? -38.293 -11.090 -29.270 1.00 46.89 ? 199 GLY B O     1 
ATOM   4668 N  N     . LYS D 2 200 ? -36.092 -11.371 -28.861 1.00 43.18 ? 200 LYS B N     1 
ATOM   4669 C  CA    . LYS D 2 200 ? -36.228 -11.170 -27.423 1.00 46.50 ? 200 LYS B CA    1 
ATOM   4670 C  C     . LYS D 2 200 ? -36.244 -9.686  -27.029 1.00 44.31 ? 200 LYS B C     1 
ATOM   4671 O  O     . LYS D 2 200 ? -36.410 -9.349  -25.857 1.00 46.01 ? 200 LYS B O     1 
ATOM   4672 C  CB    . LYS D 2 200 ? -35.101 -11.898 -26.682 1.00 47.67 ? 200 LYS B CB    1 
ATOM   4673 C  CG    . LYS D 2 200 ? -33.710 -11.597 -27.216 1.00 56.19 ? 200 LYS B CG    1 
ATOM   4674 C  CD    . LYS D 2 200 ? -32.708 -11.387 -26.090 1.00 54.54 ? 200 LYS B CD    1 
ATOM   4675 C  CE    . LYS D 2 200 ? -31.340 -11.027 -26.646 1.00 55.36 ? 200 LYS B CE    1 
ATOM   4676 N  NZ    . LYS D 2 200 ? -30.409 -10.609 -25.574 1.00 57.01 ? 200 LYS B NZ    1 
ATOM   4677 N  N     . SER D 2 201 ? -36.064 -8.802  -28.008 1.00 41.67 ? 201 SER B N     1 
ATOM   4678 C  CA    . SER D 2 201 ? -36.083 -7.362  -27.751 1.00 41.49 ? 201 SER B CA    1 
ATOM   4679 C  C     . SER D 2 201 ? -36.679 -6.687  -28.975 1.00 40.06 ? 201 SER B C     1 
ATOM   4680 O  O     . SER D 2 201 ? -36.728 -7.286  -30.048 1.00 41.55 ? 201 SER B O     1 
ATOM   4681 C  CB    . SER D 2 201 ? -34.666 -6.823  -27.507 1.00 38.37 ? 201 SER B CB    1 
ATOM   4682 O  OG    . SER D 2 201 ? -33.908 -6.780  -28.704 1.00 42.51 ? 201 SER B OG    1 
ATOM   4683 N  N     . LYS D 2 202 ? -37.144 -5.453  -28.813 1.00 40.23 ? 202 LYS B N     1 
ATOM   4684 C  CA    . LYS D 2 202 ? -37.733 -4.716  -29.928 1.00 45.75 ? 202 LYS B CA    1 
ATOM   4685 C  C     . LYS D 2 202 ? -36.729 -4.643  -31.062 1.00 45.62 ? 202 LYS B C     1 
ATOM   4686 O  O     . LYS D 2 202 ? -37.035 -5.002  -32.196 1.00 43.30 ? 202 LYS B O     1 
ATOM   4687 C  CB    . LYS D 2 202 ? -38.116 -3.294  -29.508 1.00 41.30 ? 202 LYS B CB    1 
ATOM   4688 C  CG    . LYS D 2 202 ? -39.344 -3.204  -28.625 1.00 50.48 ? 202 LYS B CG    1 
ATOM   4689 C  CD    . LYS D 2 202 ? -39.666 -1.747  -28.296 1.00 47.50 ? 202 LYS B CD    1 
ATOM   4690 C  CE    . LYS D 2 202 ? -40.906 -1.627  -27.425 1.00 43.59 ? 202 LYS B CE    1 
ATOM   4691 N  NZ    . LYS D 2 202 ? -41.290 -0.207  -27.224 1.00 48.67 ? 202 LYS B NZ    1 
ATOM   4692 N  N     . LYS D 2 203 ? -35.524 -4.183  -30.739 1.00 42.90 ? 203 LYS B N     1 
ATOM   4693 C  CA    . LYS D 2 203 ? -34.470 -4.054  -31.726 1.00 40.64 ? 203 LYS B CA    1 
ATOM   4694 C  C     . LYS D 2 203 ? -34.176 -5.375  -32.437 1.00 42.30 ? 203 LYS B C     1 
ATOM   4695 O  O     . LYS D 2 203 ? -34.110 -5.413  -33.668 1.00 40.46 ? 203 LYS B O     1 
ATOM   4696 C  CB    . LYS D 2 203 ? -33.208 -3.490  -31.071 1.00 38.28 ? 203 LYS B CB    1 
ATOM   4697 C  CG    . LYS D 2 203 ? -33.380 -2.042  -30.630 1.00 52.80 ? 203 LYS B CG    1 
ATOM   4698 C  CD    . LYS D 2 203 ? -32.056 -1.397  -30.279 1.00 54.50 ? 203 LYS B CD    1 
ATOM   4699 C  CE    . LYS D 2 203 ? -32.236 0.079   -29.954 1.00 63.19 ? 203 LYS B CE    1 
ATOM   4700 N  NZ    . LYS D 2 203 ? -32.787 0.850   -31.102 1.00 67.21 ? 203 LYS B NZ    1 
ATOM   4701 N  N     . GLU D 2 204 ? -33.999 -6.455  -31.683 1.00 36.69 ? 204 GLU B N     1 
ATOM   4702 C  CA    . GLU D 2 204 ? -33.743 -7.741  -32.327 1.00 45.78 ? 204 GLU B CA    1 
ATOM   4703 C  C     . GLU D 2 204 ? -34.868 -8.049  -33.317 1.00 42.03 ? 204 GLU B C     1 
ATOM   4704 O  O     . GLU D 2 204 ? -34.618 -8.449  -34.457 1.00 44.02 ? 204 GLU B O     1 
ATOM   4705 C  CB    . GLU D 2 204 ? -33.644 -8.874  -31.298 1.00 45.97 ? 204 GLU B CB    1 
ATOM   4706 C  CG    . GLU D 2 204 ? -33.315 -10.236 -31.931 1.00 53.30 ? 204 GLU B CG    1 
ATOM   4707 C  CD    . GLU D 2 204 ? -32.952 -11.314 -30.912 1.00 58.42 ? 204 GLU B CD    1 
ATOM   4708 O  OE1   . GLU D 2 204 ? -33.847 -11.784 -30.171 1.00 51.70 ? 204 GLU B OE1   1 
ATOM   4709 O  OE2   . GLU D 2 204 ? -31.759 -11.687 -30.857 1.00 60.78 ? 204 GLU B OE2   1 
ATOM   4710 N  N     . ALA D 2 205 ? -36.106 -7.847  -32.883 1.00 40.07 ? 205 ALA B N     1 
ATOM   4711 C  CA    . ALA D 2 205 ? -37.254 -8.106  -33.736 1.00 41.35 ? 205 ALA B CA    1 
ATOM   4712 C  C     . ALA D 2 205 ? -37.233 -7.218  -34.984 1.00 49.91 ? 205 ALA B C     1 
ATOM   4713 O  O     . ALA D 2 205 ? -37.499 -7.693  -36.098 1.00 45.87 ? 205 ALA B O     1 
ATOM   4714 C  CB    . ALA D 2 205 ? -38.541 -7.885  -32.951 1.00 44.75 ? 205 ALA B CB    1 
ATOM   4715 N  N     . GLU D 2 206 ? -36.913 -5.936  -34.796 1.00 45.60 ? 206 GLU B N     1 
ATOM   4716 C  CA    . GLU D 2 206 ? -36.859 -4.986  -35.903 1.00 42.96 ? 206 GLU B CA    1 
ATOM   4717 C  C     . GLU D 2 206 ? -35.720 -5.333  -36.850 1.00 49.46 ? 206 GLU B C     1 
ATOM   4718 O  O     . GLU D 2 206 ? -35.841 -5.145  -38.063 1.00 49.92 ? 206 GLU B O     1 
ATOM   4719 C  CB    . GLU D 2 206 ? -36.684 -3.562  -35.376 1.00 46.73 ? 206 GLU B CB    1 
ATOM   4720 C  CG    . GLU D 2 206 ? -37.788 -3.128  -34.425 1.00 52.63 ? 206 GLU B CG    1 
ATOM   4721 C  CD    . GLU D 2 206 ? -37.520 -1.779  -33.780 1.00 51.17 ? 206 GLU B CD    1 
ATOM   4722 O  OE1   . GLU D 2 206 ? -36.354 -1.520  -33.406 1.00 48.37 ? 206 GLU B OE1   1 
ATOM   4723 O  OE2   . GLU D 2 206 ? -38.476 -0.988  -33.630 1.00 49.78 ? 206 GLU B OE2   1 
ATOM   4724 N  N     . GLN D 2 207 ? -34.613 -5.830  -36.296 1.00 44.37 ? 207 GLN B N     1 
ATOM   4725 C  CA    . GLN D 2 207 ? -33.466 -6.232  -37.104 1.00 46.80 ? 207 GLN B CA    1 
ATOM   4726 C  C     . GLN D 2 207 ? -33.871 -7.409  -37.999 1.00 51.31 ? 207 GLN B C     1 
ATOM   4727 O  O     . GLN D 2 207 ? -33.502 -7.464  -39.171 1.00 52.93 ? 207 GLN B O     1 
ATOM   4728 C  CB    . GLN D 2 207 ? -32.294 -6.644  -36.208 1.00 48.64 ? 207 GLN B CB    1 
ATOM   4729 C  CG    . GLN D 2 207 ? -31.526 -5.490  -35.564 1.00 49.64 ? 207 GLN B CG    1 
ATOM   4730 C  CD    . GLN D 2 207 ? -30.707 -4.689  -36.564 1.00 55.40 ? 207 GLN B CD    1 
ATOM   4731 O  OE1   . GLN D 2 207 ? -30.064 -5.250  -37.453 1.00 54.95 ? 207 GLN B OE1   1 
ATOM   4732 N  NE2   . GLN D 2 207 ? -30.713 -3.372  -36.409 1.00 55.54 ? 207 GLN B NE2   1 
ATOM   4733 N  N     . ARG D 2 208 ? -34.619 -8.356  -37.436 1.00 50.19 ? 208 ARG B N     1 
ATOM   4734 C  CA    . ARG D 2 208 ? -35.098 -9.500  -38.202 1.00 54.00 ? 208 ARG B CA    1 
ATOM   4735 C  C     . ARG D 2 208 ? -36.049 -8.983  -39.275 1.00 54.65 ? 208 ARG B C     1 
ATOM   4736 O  O     . ARG D 2 208 ? -35.908 -9.313  -40.454 1.00 55.21 ? 208 ARG B O     1 
ATOM   4737 C  CB    . ARG D 2 208 ? -35.837 -10.489 -37.296 1.00 54.95 ? 208 ARG B CB    1 
ATOM   4738 C  CG    . ARG D 2 208 ? -34.985 -11.641 -36.796 1.00 54.05 ? 208 ARG B CG    1 
ATOM   4739 C  CD    . ARG D 2 208 ? -33.729 -11.156 -36.101 1.00 61.43 ? 208 ARG B CD    1 
ATOM   4740 N  NE    . ARG D 2 208 ? -32.956 -12.259 -35.529 1.00 69.83 ? 208 ARG B NE    1 
ATOM   4741 C  CZ    . ARG D 2 208 ? -33.364 -13.030 -34.523 1.00 67.77 ? 208 ARG B CZ    1 
ATOM   4742 N  NH1   . ARG D 2 208 ? -34.549 -12.830 -33.955 1.00 62.67 ? 208 ARG B NH1   1 
ATOM   4743 N  NH2   . ARG D 2 208 ? -32.580 -14.004 -34.082 1.00 62.92 ? 208 ARG B NH2   1 
ATOM   4744 N  N     . ALA D 2 209 ? -37.014 -8.168  -38.861 1.00 49.01 ? 209 ALA B N     1 
ATOM   4745 C  CA    . ALA D 2 209 ? -37.974 -7.600  -39.797 1.00 51.96 ? 209 ALA B CA    1 
ATOM   4746 C  C     . ALA D 2 209 ? -37.259 -6.905  -40.959 1.00 53.59 ? 209 ALA B C     1 
ATOM   4747 O  O     . ALA D 2 209 ? -37.593 -7.122  -42.123 1.00 53.74 ? 209 ALA B O     1 
ATOM   4748 C  CB    . ALA D 2 209 ? -38.872 -6.614  -39.083 1.00 51.90 ? 209 ALA B CB    1 
ATOM   4749 N  N     . ALA D 2 210 ? -36.274 -6.071  -40.637 1.00 50.74 ? 210 ALA B N     1 
ATOM   4750 C  CA    . ALA D 2 210 ? -35.521 -5.344  -41.652 1.00 47.97 ? 210 ALA B CA    1 
ATOM   4751 C  C     . ALA D 2 210 ? -34.782 -6.277  -42.586 1.00 50.52 ? 210 ALA B C     1 
ATOM   4752 O  O     . ALA D 2 210 ? -34.729 -6.029  -43.791 1.00 51.38 ? 210 ALA B O     1 
ATOM   4753 C  CB    . ALA D 2 210 ? -34.537 -4.384  -40.998 1.00 48.29 ? 210 ALA B CB    1 
ATOM   4754 N  N     . GLU D 2 211 ? -34.206 -7.344  -42.036 1.00 48.39 ? 211 GLU B N     1 
ATOM   4755 C  CA    . GLU D 2 211 ? -33.473 -8.311  -42.849 1.00 54.32 ? 211 GLU B CA    1 
ATOM   4756 C  C     . GLU D 2 211 ? -34.396 -8.934  -43.896 1.00 55.40 ? 211 GLU B C     1 
ATOM   4757 O  O     . GLU D 2 211 ? -33.955 -9.308  -44.987 1.00 48.99 ? 211 GLU B O     1 
ATOM   4758 C  CB    . GLU D 2 211 ? -32.857 -9.404  -41.964 1.00 52.99 ? 211 GLU B CB    1 
ATOM   4759 C  CG    . GLU D 2 211 ? -32.301 -10.595 -42.738 1.00 62.18 ? 211 GLU B CG    1 
ATOM   4760 C  CD    . GLU D 2 211 ? -31.448 -11.519 -41.884 1.00 65.42 ? 211 GLU B CD    1 
ATOM   4761 O  OE1   . GLU D 2 211 ? -31.843 -11.826 -40.737 1.00 66.41 ? 211 GLU B OE1   1 
ATOM   4762 O  OE2   . GLU D 2 211 ? -30.381 -11.951 -42.370 1.00 70.73 ? 211 GLU B OE2   1 
ATOM   4763 N  N     . GLU D 2 212 ? -35.678 -9.034  -43.556 1.00 57.50 ? 212 GLU B N     1 
ATOM   4764 C  CA    . GLU D 2 212 ? -36.680 -9.586  -44.460 1.00 58.45 ? 212 GLU B CA    1 
ATOM   4765 C  C     . GLU D 2 212 ? -37.082 -8.577  -45.532 1.00 60.49 ? 212 GLU B C     1 
ATOM   4766 O  O     . GLU D 2 212 ? -37.143 -8.909  -46.715 1.00 63.15 ? 212 GLU B O     1 
ATOM   4767 C  CB    . GLU D 2 212 ? -37.925 -10.013 -43.679 1.00 62.82 ? 212 GLU B CB    1 
ATOM   4768 C  CG    . GLU D 2 212 ? -37.757 -11.300 -42.891 1.00 72.06 ? 212 GLU B CG    1 
ATOM   4769 C  CD    . GLU D 2 212 ? -37.370 -12.468 -43.775 1.00 78.01 ? 212 GLU B CD    1 
ATOM   4770 O  OE1   . GLU D 2 212 ? -38.092 -12.729 -44.760 1.00 85.83 ? 212 GLU B OE1   1 
ATOM   4771 O  OE2   . GLU D 2 212 ? -36.347 -13.125 -43.486 1.00 82.06 ? 212 GLU B OE2   1 
ATOM   4772 N  N     . LEU D 2 213 ? -37.354 -7.343  -45.118 1.00 55.89 ? 213 LEU B N     1 
ATOM   4773 C  CA    . LEU D 2 213 ? -37.760 -6.308  -46.059 1.00 52.55 ? 213 LEU B CA    1 
ATOM   4774 C  C     . LEU D 2 213 ? -36.685 -6.045  -47.110 1.00 54.28 ? 213 LEU B C     1 
ATOM   4775 O  O     . LEU D 2 213 ? -36.980 -5.575  -48.207 1.00 57.33 ? 213 LEU B O     1 
ATOM   4776 C  CB    . LEU D 2 213 ? -38.110 -5.016  -45.311 1.00 46.43 ? 213 LEU B CB    1 
ATOM   4777 C  CG    . LEU D 2 213 ? -38.701 -3.875  -46.153 1.00 55.40 ? 213 LEU B CG    1 
ATOM   4778 C  CD1   . LEU D 2 213 ? -39.827 -4.407  -47.037 1.00 54.72 ? 213 LEU B CD1   1 
ATOM   4779 C  CD2   . LEU D 2 213 ? -39.215 -2.765  -45.239 1.00 50.95 ? 213 LEU B CD2   1 
ATOM   4780 N  N     . ILE D 2 214 ? -35.436 -6.351  -46.777 1.00 52.68 ? 214 ILE B N     1 
ATOM   4781 C  CA    . ILE D 2 214 ? -34.345 -6.157  -47.720 1.00 51.21 ? 214 ILE B CA    1 
ATOM   4782 C  C     . ILE D 2 214 ? -34.453 -7.261  -48.770 1.00 58.51 ? 214 ILE B C     1 
ATOM   4783 O  O     . ILE D 2 214 ? -34.453 -6.995  -49.974 1.00 57.46 ? 214 ILE B O     1 
ATOM   4784 C  CB    . ILE D 2 214 ? -32.979 -6.256  -47.025 1.00 53.17 ? 214 ILE B CB    1 
ATOM   4785 C  CG1   . ILE D 2 214 ? -32.881 -5.207  -45.913 1.00 56.95 ? 214 ILE B CG1   1 
ATOM   4786 C  CG2   . ILE D 2 214 ? -31.871 -6.045  -48.037 1.00 46.02 ? 214 ILE B CG2   1 
ATOM   4787 C  CD1   . ILE D 2 214 ? -31.635 -5.325  -45.064 1.00 53.12 ? 214 ILE B CD1   1 
ATOM   4788 N  N     . LYS D 2 215 ? -34.544 -8.502  -48.303 1.00 58.84 ? 215 LYS B N     1 
ATOM   4789 C  CA    . LYS D 2 215 ? -34.676 -9.645  -49.196 1.00 65.93 ? 215 LYS B CA    1 
ATOM   4790 C  C     . LYS D 2 215 ? -35.943 -9.450  -50.021 1.00 67.14 ? 215 LYS B C     1 
ATOM   4791 O  O     . LYS D 2 215 ? -35.950 -9.676  -51.229 1.00 72.41 ? 215 LYS B O     1 
ATOM   4792 C  CB    . LYS D 2 215 ? -34.756 -10.943 -48.382 1.00 66.23 ? 215 LYS B CB    1 
ATOM   4793 C  CG    . LYS D 2 215 ? -33.448 -11.304 -47.685 1.00 71.33 ? 215 LYS B CG    1 
ATOM   4794 C  CD    . LYS D 2 215 ? -33.651 -12.222 -46.483 1.00 81.01 ? 215 LYS B CD    1 
ATOM   4795 C  CE    . LYS D 2 215 ? -34.155 -13.603 -46.873 1.00 87.50 ? 215 LYS B CE    1 
ATOM   4796 N  NZ    . LYS D 2 215 ? -34.313 -14.484 -45.673 1.00 87.40 ? 215 LYS B NZ    1 
ATOM   4797 N  N     . LEU D 2 216 ? -37.011 -9.013  -49.362 1.00 65.13 ? 216 LEU B N     1 
ATOM   4798 C  CA    . LEU D 2 216 ? -38.271 -8.770  -50.044 1.00 66.15 ? 216 LEU B CA    1 
ATOM   4799 C  C     . LEU D 2 216 ? -38.063 -7.793  -51.198 1.00 67.74 ? 216 LEU B C     1 
ATOM   4800 O  O     . LEU D 2 216 ? -38.529 -8.020  -52.311 1.00 67.57 ? 216 LEU B O     1 
ATOM   4801 C  CB    . LEU D 2 216 ? -39.306 -8.200  -49.068 1.00 64.72 ? 216 LEU B CB    1 
ATOM   4802 C  CG    . LEU D 2 216 ? -40.641 -7.762  -49.687 1.00 62.87 ? 216 LEU B CG    1 
ATOM   4803 C  CD1   . LEU D 2 216 ? -41.255 -8.938  -50.434 1.00 66.68 ? 216 LEU B CD1   1 
ATOM   4804 C  CD2   . LEU D 2 216 ? -41.595 -7.247  -48.609 1.00 57.41 ? 216 LEU B CD2   1 
ATOM   4805 N  N     . LEU D 2 217 ? -37.356 -6.704  -50.925 1.00 70.56 ? 217 LEU B N     1 
ATOM   4806 C  CA    . LEU D 2 217 ? -37.102 -5.698  -51.944 1.00 71.97 ? 217 LEU B CA    1 
ATOM   4807 C  C     . LEU D 2 217 ? -36.209 -6.197  -53.069 1.00 75.22 ? 217 LEU B C     1 
ATOM   4808 O  O     . LEU D 2 217 ? -36.328 -5.733  -54.202 1.00 74.72 ? 217 LEU B O     1 
ATOM   4809 C  CB    . LEU D 2 217 ? -36.480 -4.450  -51.315 1.00 68.19 ? 217 LEU B CB    1 
ATOM   4810 C  CG    . LEU D 2 217 ? -37.408 -3.611  -50.439 1.00 69.56 ? 217 LEU B CG    1 
ATOM   4811 C  CD1   . LEU D 2 217 ? -36.660 -2.388  -49.938 1.00 65.91 ? 217 LEU B CD1   1 
ATOM   4812 C  CD2   . LEU D 2 217 ? -38.633 -3.195  -51.242 1.00 63.63 ? 217 LEU B CD2   1 
ATOM   4813 N  N     . GLU D 2 218 ? -35.313 -7.133  -52.764 1.00 78.58 ? 218 GLU B N     1 
ATOM   4814 C  CA    . GLU D 2 218 ? -34.415 -7.666  -53.785 1.00 83.53 ? 218 GLU B CA    1 
ATOM   4815 C  C     . GLU D 2 218 ? -35.232 -8.324  -54.893 1.00 86.66 ? 218 GLU B C     1 
ATOM   4816 O  O     . GLU D 2 218 ? -34.874 -8.245  -56.071 1.00 89.30 ? 218 GLU B O     1 
ATOM   4817 C  CB    . GLU D 2 218 ? -33.408 -8.634  -53.160 1.00 84.40 ? 218 GLU B CB    1 
ATOM   4818 C  CG    . GLU D 2 218 ? -32.259 -7.953  -52.437 1.00 90.49 ? 218 GLU B CG    1 
ATOM   4819 C  CD    . GLU D 2 218 ? -31.948 -8.597  -51.100 1.00 95.65 ? 218 GLU B CD    1 
ATOM   4820 O  OE1   . GLU D 2 218 ? -31.767 -9.833  -51.064 1.00 94.78 ? 218 GLU B OE1   1 
ATOM   4821 O  OE2   . GLU D 2 218 ? -31.886 -7.867  -50.088 1.00 99.84 ? 218 GLU B OE2   1 
ATOM   4822 N  N     . GLU D 2 219 ? -36.247 -9.093  -54.504 1.00 88.57 ? 219 GLU B N     1 
ATOM   4823 C  CA    . GLU D 2 219 ? -37.109 -9.756  -55.475 1.00 92.29 ? 219 GLU B CA    1 
ATOM   4824 C  C     . GLU D 2 219 ? -37.857 -8.692  -56.266 1.00 94.58 ? 219 GLU B C     1 
ATOM   4825 O  O     . GLU D 2 219 ? -38.447 -8.972  -57.310 1.00 97.49 ? 219 GLU B O     1 
ATOM   4826 C  CB    . GLU D 2 219 ? -38.032 -10.756 -54.777 1.00 90.22 ? 219 GLU B CB    1 
ATOM   4827 C  CG    . GLU D 2 219 ? -37.310 -11.947 -54.168 1.00 94.75 ? 219 GLU B CG    1 
ATOM   4828 C  CD    . GLU D 2 219 ? -38.256 -12.916 -53.486 1.00 99.84 ? 219 GLU B CD    1 
ATOM   4829 O  OE1   . GLU D 2 219 ? -39.445 -12.568 -53.321 1.00 99.84 ? 219 GLU B OE1   1 
ATOM   4830 O  OE2   . GLU D 2 219 ? -37.809 -14.022 -53.116 1.00 99.84 ? 219 GLU B OE2   1 
ATOM   4831 N  N     . SER D 2 220 ? -37.817 -7.468  -55.749 1.00 95.42 ? 220 SER B N     1 
ATOM   4832 C  CA    . SER D 2 220 ? -38.469 -6.320  -56.369 1.00 96.78 ? 220 SER B CA    1 
ATOM   4833 C  C     . SER D 2 220 ? -39.987 -6.480  -56.344 1.00 96.20 ? 220 SER B C     1 
ATOM   4834 O  O     . SER D 2 220 ? -40.601 -6.430  -57.431 1.00 98.24 ? 220 SER B O     1 
ATOM   4835 C  CB    . SER D 2 220 ? -37.970 -6.130  -57.803 1.00 95.50 ? 220 SER B CB    1 
ATOM   4836 O  OG    . SER D 2 220 ? -38.101 -4.781  -58.214 1.00 98.90 ? 220 SER B OG    1 
HETATM 4837 MG MG    . MG  E 3 .   ? -13.171 15.640  -31.301 1.00 62.54 ? 501 MG  A MG    1 
HETATM 4838 MG MG    . MG  F 3 .   ? -16.186 -2.528  -18.620 1.00 51.83 ? 502 MG  B MG    1 
HETATM 4839 O  O     . HOH G 4 .   ? -15.119 15.369  -32.477 1.00 53.43 ? 29  HOH C O     1 
HETATM 4840 O  O     . HOH G 4 .   ? -16.302 22.926  -37.542 1.00 52.84 ? 30  HOH C O     1 
HETATM 4841 O  O     . HOH G 4 .   ? -15.491 20.328  -38.100 1.00 41.12 ? 31  HOH C O     1 
HETATM 4842 O  O     . HOH G 4 .   ? -31.304 16.543  -31.841 1.00 49.07 ? 32  HOH C O     1 
HETATM 4843 O  O     . HOH G 4 .   ? -34.204 15.912  -31.952 1.00 39.32 ? 33  HOH C O     1 
HETATM 4844 O  O     . HOH G 4 .   ? -35.307 13.411  -32.145 1.00 34.70 ? 34  HOH C O     1 
HETATM 4845 O  O     . HOH G 4 .   ? -19.392 2.956   -30.355 1.00 38.29 ? 35  HOH C O     1 
HETATM 4846 O  O     . HOH G 4 .   ? -18.820 4.565   -32.348 1.00 61.64 ? 36  HOH C O     1 
HETATM 4847 O  O     . HOH G 4 .   ? -27.601 5.351   -42.061 1.00 41.83 ? 37  HOH C O     1 
HETATM 4848 O  O     . HOH G 4 .   ? -29.779 -3.785  -32.088 1.00 66.91 ? 38  HOH C O     1 
HETATM 4849 O  O     . HOH G 4 .   ? -23.977 11.194  -31.382 1.00 54.49 ? 39  HOH C O     1 
HETATM 4850 O  O     . HOH G 4 .   ? -25.539 16.743  -38.430 1.00 56.20 ? 40  HOH C O     1 
HETATM 4851 O  O     . HOH G 4 .   ? -24.998 14.171  -38.245 1.00 74.54 ? 41  HOH C O     1 
HETATM 4852 O  O     . HOH G 4 .   ? -25.548 17.825  -42.962 1.00 42.17 ? 42  HOH C O     1 
HETATM 4853 O  O     . HOH G 4 .   ? -26.739 12.915  -48.754 1.00 46.58 ? 43  HOH C O     1 
HETATM 4854 O  O     . HOH G 4 .   ? -34.225 18.990  -44.234 1.00 47.40 ? 44  HOH C O     1 
HETATM 4855 O  O     . HOH G 4 .   ? -20.470 28.565  -41.887 1.00 55.50 ? 45  HOH C O     1 
HETATM 4856 O  O     . HOH G 4 .   ? -18.162 30.101  -42.288 1.00 54.45 ? 46  HOH C O     1 
HETATM 4857 O  O     . HOH G 4 .   ? -16.853 29.821  -46.412 1.00 66.71 ? 47  HOH C O     1 
HETATM 4858 O  O     . HOH G 4 .   ? -20.019 29.232  -46.126 1.00 54.06 ? 48  HOH C O     1 
HETATM 4859 O  O     . HOH G 4 .   ? -18.000 25.976  -60.475 1.00 50.37 ? 49  HOH C O     1 
HETATM 4860 O  O     . HOH G 4 .   ? -12.293 23.586  -54.151 1.00 57.82 ? 50  HOH C O     1 
HETATM 4861 O  O     . HOH G 4 .   ? -9.795  24.219  -54.942 1.00 77.31 ? 51  HOH C O     1 
HETATM 4862 O  O     . HOH G 4 .   ? -12.512 16.521  -53.865 1.00 70.80 ? 52  HOH C O     1 
HETATM 4863 O  O     . HOH G 4 .   ? -21.875 18.302  -52.676 1.00 53.94 ? 53  HOH C O     1 
HETATM 4864 O  O     . HOH G 4 .   ? -20.755 18.945  -48.464 1.00 57.91 ? 54  HOH C O     1 
HETATM 4865 O  O     . HOH G 4 .   ? -27.938 27.717  -39.344 1.00 63.40 ? 55  HOH C O     1 
HETATM 4866 O  O     . HOH G 4 .   ? -26.443 20.243  -37.121 1.00 44.82 ? 56  HOH C O     1 
HETATM 4867 O  O     . HOH G 4 .   ? -32.153 13.677  -34.728 1.00 41.42 ? 57  HOH C O     1 
HETATM 4868 O  O     . HOH G 4 .   ? -28.571 13.842  -35.417 1.00 52.74 ? 58  HOH C O     1 
HETATM 4869 O  O     . HOH G 4 .   ? -29.635 17.105  -34.809 1.00 65.57 ? 59  HOH C O     1 
HETATM 4870 O  O     . HOH G 4 .   ? -28.074 15.867  -36.915 1.00 47.12 ? 60  HOH C O     1 
HETATM 4871 O  O     . HOH G 4 .   ? -28.222 3.366   -29.661 1.00 61.29 ? 61  HOH C O     1 
HETATM 4872 O  O     . HOH G 4 .   ? -21.905 0.585   -35.166 1.00 59.99 ? 62  HOH C O     1 
HETATM 4873 O  O     . HOH G 4 .   ? -14.116 10.540  -35.533 1.00 49.50 ? 63  HOH C O     1 
HETATM 4874 O  O     . HOH G 4 .   ? -14.492 12.908  -33.956 1.00 48.12 ? 64  HOH C O     1 
HETATM 4875 O  O     . HOH G 4 .   ? -33.748 23.220  -39.253 1.00 33.27 ? 65  HOH C O     1 
HETATM 4876 O  O     . HOH G 4 .   ? -35.111 17.794  -42.198 1.00 58.76 ? 66  HOH C O     1 
HETATM 4877 O  O     . HOH G 4 .   ? -29.993 19.874  -32.146 1.00 48.59 ? 67  HOH C O     1 
HETATM 4878 O  O     . HOH G 4 .   ? -21.324 11.744  -35.196 1.00 65.81 ? 68  HOH C O     1 
HETATM 4879 O  O     . HOH G 4 .   ? -23.796 11.685  -41.811 1.00 47.24 ? 69  HOH C O     1 
HETATM 4880 O  O     . HOH G 4 .   ? -25.056 13.686  -40.782 1.00 51.15 ? 70  HOH C O     1 
HETATM 4881 O  O     . HOH G 4 .   ? -23.198 9.994   -49.671 1.00 66.48 ? 71  HOH C O     1 
HETATM 4882 O  O     . HOH G 4 .   ? -28.744 25.233  -51.171 1.00 63.81 ? 72  HOH C O     1 
HETATM 4883 O  O     . HOH G 4 .   ? -32.707 20.464  -54.025 1.00 66.24 ? 73  HOH C O     1 
HETATM 4884 O  O     . HOH G 4 .   ? -22.727 20.431  -49.811 1.00 50.07 ? 74  HOH C O     1 
HETATM 4885 O  O     . HOH G 4 .   ? -28.491 27.986  -43.360 1.00 58.32 ? 75  HOH C O     1 
HETATM 4886 O  O     . HOH G 4 .   ? -17.994 34.675  -51.618 1.00 65.42 ? 76  HOH C O     1 
HETATM 4887 O  O     . HOH G 4 .   ? -15.905 27.747  -59.372 1.00 56.55 ? 77  HOH C O     1 
HETATM 4888 O  O     . HOH G 4 .   ? -23.249 14.283  -62.635 1.00 69.21 ? 78  HOH C O     1 
HETATM 4889 O  O     . HOH G 4 .   ? -25.001 13.997  -60.101 1.00 52.62 ? 79  HOH C O     1 
HETATM 4890 O  O     . HOH G 4 .   ? -20.551 14.664  -64.663 1.00 68.44 ? 80  HOH C O     1 
HETATM 4891 O  O     . HOH G 4 .   ? -18.673 11.115  -48.777 1.00 88.77 ? 81  HOH C O     1 
HETATM 4892 O  O     . HOH G 4 .   ? -16.812 13.060  -44.474 1.00 70.81 ? 82  HOH C O     1 
HETATM 4893 O  O     . HOH G 4 .   ? -19.074 13.342  -43.032 1.00 71.18 ? 83  HOH C O     1 
HETATM 4894 O  O     . HOH G 4 .   ? -13.103 15.148  -44.390 1.00 53.59 ? 84  HOH C O     1 
HETATM 4895 O  O     . HOH G 4 .   ? -30.227 -6.406  -32.033 1.00 56.76 ? 85  HOH C O     1 
HETATM 4896 O  O     . HOH G 4 .   ? -30.452 -6.467  -29.273 1.00 67.60 ? 86  HOH C O     1 
HETATM 4897 O  O     . HOH G 4 .   ? -16.202 16.326  -29.315 1.00 51.13 ? 87  HOH C O     1 
HETATM 4898 O  O     . HOH G 4 .   ? -28.757 26.539  -41.552 1.00 58.70 ? 88  HOH C O     1 
HETATM 4899 O  O     . HOH H 4 .   ? -16.005 -0.987  -20.213 1.00 57.22 ? 29  HOH D O     1 
HETATM 4900 O  O     . HOH H 4 .   ? -18.396 -2.257  -18.381 1.00 68.02 ? 30  HOH D O     1 
HETATM 4901 O  O     . HOH H 4 .   ? -21.600 8.719   -20.230 1.00 66.52 ? 31  HOH D O     1 
HETATM 4902 O  O     . HOH H 4 .   ? -28.479 15.990  -20.526 1.00 35.86 ? 32  HOH D O     1 
HETATM 4903 O  O     . HOH H 4 .   ? -32.762 15.491  -25.129 1.00 46.19 ? 33  HOH D O     1 
HETATM 4904 O  O     . HOH H 4 .   ? -18.154 -3.067  -22.016 1.00 52.76 ? 34  HOH D O     1 
HETATM 4905 O  O     . HOH H 4 .   ? -27.442 -3.863  -16.009 1.00 56.95 ? 35  HOH D O     1 
HETATM 4906 O  O     . HOH H 4 .   ? -40.686 -5.910  -16.783 1.00 46.35 ? 36  HOH D O     1 
HETATM 4907 O  O     . HOH H 4 .   ? -27.246 1.531   -21.420 1.00 61.15 ? 37  HOH D O     1 
HETATM 4908 O  O     . HOH H 4 .   ? -23.930 0.305   -16.703 1.00 74.17 ? 38  HOH D O     1 
HETATM 4909 O  O     . HOH H 4 .   ? -30.038 1.389   -14.211 1.00 43.98 ? 39  HOH D O     1 
HETATM 4910 O  O     . HOH H 4 .   ? -30.168 -3.414  -18.193 1.00 58.05 ? 40  HOH D O     1 
HETATM 4911 O  O     . HOH H 4 .   ? -30.178 -3.643  -15.384 1.00 54.41 ? 41  HOH D O     1 
HETATM 4912 O  O     . HOH H 4 .   ? -32.160 -4.636  -13.863 1.00 41.80 ? 42  HOH D O     1 
HETATM 4913 O  O     . HOH H 4 .   ? -30.563 -6.279  -15.879 1.00 48.01 ? 43  HOH D O     1 
HETATM 4914 O  O     . HOH H 4 .   ? -30.336 -6.962  -19.837 1.00 47.90 ? 44  HOH D O     1 
HETATM 4915 O  O     . HOH H 4 .   ? -31.935 -5.754  -11.463 1.00 57.02 ? 45  HOH D O     1 
HETATM 4916 O  O     . HOH H 4 .   ? -30.700 -5.814  -7.291  1.00 55.81 ? 46  HOH D O     1 
HETATM 4917 O  O     . HOH H 4 .   ? -38.216 -19.409 -6.136  1.00 62.51 ? 47  HOH D O     1 
HETATM 4918 O  O     . HOH H 4 .   ? -36.044 -21.656 -6.046  1.00 79.07 ? 48  HOH D O     1 
HETATM 4919 O  O     . HOH H 4 .   ? -36.838 -20.837 -8.540  1.00 58.22 ? 49  HOH D O     1 
HETATM 4920 O  O     . HOH H 4 .   ? -29.454 -15.561 -9.144  1.00 46.72 ? 50  HOH D O     1 
HETATM 4921 O  O     . HOH H 4 .   ? -33.736 -14.746 -13.269 1.00 50.86 ? 51  HOH D O     1 
HETATM 4922 O  O     . HOH H 4 .   ? -41.658 -1.702  -18.127 1.00 56.83 ? 52  HOH D O     1 
HETATM 4923 O  O     . HOH H 4 .   ? -32.951 -14.198 -17.509 1.00 57.13 ? 53  HOH D O     1 
HETATM 4924 O  O     . HOH H 4 .   ? -34.788 -13.037 4.149   1.00 47.56 ? 54  HOH D O     1 
HETATM 4925 O  O     . HOH H 4 .   ? -37.562 -7.629  1.658   1.00 52.28 ? 55  HOH D O     1 
HETATM 4926 O  O     . HOH H 4 .   ? -27.492 -8.460  3.427   1.00 52.67 ? 56  HOH D O     1 
HETATM 4927 O  O     . HOH H 4 .   ? -26.803 -3.480  1.582   1.00 56.79 ? 57  HOH D O     1 
HETATM 4928 O  O     . HOH H 4 .   ? -26.951 -5.961  0.893   1.00 74.59 ? 58  HOH D O     1 
HETATM 4929 O  O     . HOH H 4 .   ? -26.393 -6.000  4.281   1.00 64.19 ? 59  HOH D O     1 
HETATM 4930 O  O     . HOH H 4 .   ? -37.578 6.709   -10.370 1.00 34.73 ? 60  HOH D O     1 
HETATM 4931 O  O     . HOH H 4 .   ? -18.069 6.508   -28.043 1.00 63.43 ? 61  HOH D O     1 
HETATM 4932 O  O     . HOH H 4 .   ? -35.041 -2.935  -27.917 1.00 36.54 ? 62  HOH D O     1 
HETATM 4933 O  O     . HOH H 4 .   ? -32.521 -3.117  -27.250 1.00 48.12 ? 63  HOH D O     1 
HETATM 4934 O  O     . HOH H 4 .   ? -25.907 9.540   -16.292 1.00 48.64 ? 64  HOH D O     1 
HETATM 4935 O  O     . HOH H 4 .   ? -27.023 10.968  -14.570 1.00 62.44 ? 65  HOH D O     1 
HETATM 4936 O  O     . HOH H 4 .   ? -34.116 2.450   -26.186 1.00 62.27 ? 66  HOH D O     1 
HETATM 4937 O  O     . HOH H 4 .   ? -32.926 7.688   -26.064 1.00 45.70 ? 67  HOH D O     1 
HETATM 4938 O  O     . HOH H 4 .   ? -37.943 10.504  -26.168 1.00 40.51 ? 68  HOH D O     1 
HETATM 4939 O  O     . HOH H 4 .   ? -30.470 -0.805  -15.952 1.00 49.63 ? 69  HOH D O     1 
HETATM 4940 O  O     . HOH H 4 .   ? -34.577 -12.637 -23.525 1.00 57.09 ? 70  HOH D O     1 
HETATM 4941 O  O     . HOH H 4 .   ? -35.891 -4.631  -9.591  1.00 49.90 ? 71  HOH D O     1 
HETATM 4942 O  O     . HOH H 4 .   ? -34.811 -2.454  -8.684  1.00 55.88 ? 72  HOH D O     1 
HETATM 4943 O  O     . HOH H 4 .   ? -38.672 -4.087  -9.636  1.00 62.95 ? 73  HOH D O     1 
HETATM 4944 O  O     . HOH H 4 .   ? -36.077 -0.296  -9.472  1.00 55.53 ? 74  HOH D O     1 
HETATM 4945 O  O     . HOH H 4 .   ? -25.311 -14.873 3.215   1.00 64.76 ? 75  HOH D O     1 
HETATM 4946 O  O     . HOH I 4 .   ? -13.849 14.230  -29.614 1.00 50.70 ? 502 HOH A O     1 
HETATM 4947 O  O     . HOH I 4 .   ? -13.937 17.026  -29.817 1.00 68.62 ? 503 HOH A O     1 
HETATM 4948 O  O     . HOH I 4 .   ? 7.850   29.327  -37.568 1.00 60.97 ? 504 HOH A O     1 
HETATM 4949 O  O     . HOH I 4 .   ? 9.693   27.195  -36.713 1.00 69.92 ? 505 HOH A O     1 
HETATM 4950 O  O     . HOH I 4 .   ? 7.144   34.927  -33.642 1.00 53.60 ? 506 HOH A O     1 
HETATM 4951 O  O     . HOH I 4 .   ? 1.329   34.792  -28.966 1.00 65.12 ? 507 HOH A O     1 
HETATM 4952 O  O     . HOH I 4 .   ? 2.771   35.526  -25.121 1.00 63.44 ? 508 HOH A O     1 
HETATM 4953 O  O     . HOH I 4 .   ? 9.912   25.936  -24.871 1.00 64.14 ? 509 HOH A O     1 
HETATM 4954 O  O     . HOH I 4 .   ? 11.333  23.169  -24.926 1.00 55.41 ? 510 HOH A O     1 
HETATM 4955 O  O     . HOH I 4 .   ? 11.137  20.459  -25.166 1.00 48.24 ? 511 HOH A O     1 
HETATM 4956 O  O     . HOH I 4 .   ? 11.929  19.524  -27.374 1.00 37.70 ? 512 HOH A O     1 
HETATM 4957 O  O     . HOH I 4 .   ? 9.042   13.545  -34.640 1.00 46.05 ? 513 HOH A O     1 
HETATM 4958 O  O     . HOH I 4 .   ? 10.226  11.176  -33.841 1.00 50.29 ? 514 HOH A O     1 
HETATM 4959 O  O     . HOH I 4 .   ? 6.835   13.934  -41.472 1.00 58.08 ? 515 HOH A O     1 
HETATM 4960 O  O     . HOH I 4 .   ? 4.524   13.680  -40.110 1.00 53.17 ? 516 HOH A O     1 
HETATM 4961 O  O     . HOH I 4 .   ? -0.708  20.307  -43.094 1.00 35.37 ? 517 HOH A O     1 
HETATM 4962 O  O     . HOH I 4 .   ? -9.443  18.280  -40.838 1.00 38.51 ? 518 HOH A O     1 
HETATM 4963 O  O     . HOH I 4 .   ? -11.633 16.584  -40.598 1.00 57.39 ? 519 HOH A O     1 
HETATM 4964 O  O     . HOH I 4 .   ? -5.800  20.689  -50.914 1.00 62.62 ? 520 HOH A O     1 
HETATM 4965 O  O     . HOH I 4 .   ? -7.106  23.081  -51.046 1.00 57.30 ? 521 HOH A O     1 
HETATM 4966 O  O     . HOH I 4 .   ? -4.104  13.854  -43.130 1.00 48.39 ? 522 HOH A O     1 
HETATM 4967 O  O     . HOH I 4 .   ? -4.207  13.516  -38.691 1.00 33.60 ? 523 HOH A O     1 
HETATM 4968 O  O     . HOH I 4 .   ? -8.522  6.606   -23.491 1.00 28.17 ? 524 HOH A O     1 
HETATM 4969 O  O     . HOH I 4 .   ? -1.826  10.675  -12.846 1.00 60.91 ? 525 HOH A O     1 
HETATM 4970 O  O     . HOH I 4 .   ? -16.956 7.605   -3.180  1.00 56.53 ? 526 HOH A O     1 
HETATM 4971 O  O     . HOH I 4 .   ? -16.148 3.641   -9.033  1.00 55.22 ? 527 HOH A O     1 
HETATM 4972 O  O     . HOH I 4 .   ? -16.991 1.351   -13.440 1.00 54.07 ? 528 HOH A O     1 
HETATM 4973 O  O     . HOH I 4 .   ? -18.495 9.234   -19.156 1.00 43.88 ? 529 HOH A O     1 
HETATM 4974 O  O     . HOH I 4 .   ? -22.895 10.598  -18.330 1.00 58.41 ? 530 HOH A O     1 
HETATM 4975 O  O     . HOH I 4 .   ? -13.127 6.263   -21.060 1.00 40.17 ? 531 HOH A O     1 
HETATM 4976 O  O     . HOH I 4 .   ? -17.886 17.088  -27.165 1.00 48.73 ? 532 HOH A O     1 
HETATM 4977 O  O     . HOH I 4 .   ? -8.557  30.946  -28.823 1.00 54.18 ? 533 HOH A O     1 
HETATM 4978 O  O     . HOH I 4 .   ? -10.672 34.074  -18.937 1.00 73.10 ? 534 HOH A O     1 
HETATM 4979 O  O     . HOH I 4 .   ? 0.396   28.483  -18.503 1.00 58.80 ? 535 HOH A O     1 
HETATM 4980 O  O     . HOH I 4 .   ? -18.080 28.304  -31.340 1.00 56.54 ? 536 HOH A O     1 
HETATM 4981 O  O     . HOH I 4 .   ? -13.151 19.303  -36.712 1.00 36.08 ? 537 HOH A O     1 
HETATM 4982 O  O     . HOH I 4 .   ? -14.497 19.697  -30.935 1.00 56.95 ? 538 HOH A O     1 
HETATM 4983 O  O     . HOH I 4 .   ? 7.233   8.504   -32.628 1.00 41.66 ? 539 HOH A O     1 
HETATM 4984 O  O     . HOH I 4 .   ? -2.195  23.603  -14.029 1.00 55.97 ? 540 HOH A O     1 
HETATM 4985 O  O     . HOH I 4 .   ? -11.756 25.065  -14.728 1.00 60.97 ? 541 HOH A O     1 
HETATM 4986 O  O     . HOH I 4 .   ? -9.972  18.404  -7.022  1.00 44.84 ? 542 HOH A O     1 
HETATM 4987 O  O     . HOH I 4 .   ? -17.421 20.941  -12.555 1.00 50.71 ? 543 HOH A O     1 
HETATM 4988 O  O     . HOH I 4 .   ? -32.407 19.953  -19.762 1.00 49.01 ? 544 HOH A O     1 
HETATM 4989 O  O     . HOH I 4 .   ? -38.637 11.640  -20.510 1.00 30.84 ? 545 HOH A O     1 
HETATM 4990 O  O     . HOH I 4 .   ? -39.265 9.165   -20.616 1.00 32.84 ? 546 HOH A O     1 
HETATM 4991 O  O     . HOH I 4 .   ? -33.893 7.733   -15.950 1.00 42.72 ? 547 HOH A O     1 
HETATM 4992 O  O     . HOH I 4 .   ? -37.253 11.814  -8.318  1.00 49.20 ? 548 HOH A O     1 
HETATM 4993 O  O     . HOH I 4 .   ? -51.619 9.418   -8.053  1.00 47.58 ? 549 HOH A O     1 
HETATM 4994 O  O     . HOH I 4 .   ? -45.003 3.608   -19.607 1.00 42.82 ? 550 HOH A O     1 
HETATM 4995 O  O     . HOH I 4 .   ? -49.565 7.638   -18.265 1.00 54.22 ? 551 HOH A O     1 
HETATM 4996 O  O     . HOH I 4 .   ? -47.791 7.808   -20.811 1.00 52.43 ? 552 HOH A O     1 
HETATM 4997 O  O     . HOH I 4 .   ? -41.663 14.105  -30.551 1.00 40.56 ? 553 HOH A O     1 
HETATM 4998 O  O     . HOH I 4 .   ? -41.806 12.671  -32.836 1.00 50.86 ? 554 HOH A O     1 
HETATM 4999 O  O     . HOH I 4 .   ? -45.491 12.080  -33.716 1.00 53.96 ? 555 HOH A O     1 
HETATM 5000 O  O     . HOH I 4 .   ? -48.109 13.342  -25.581 1.00 46.03 ? 556 HOH A O     1 
HETATM 5001 O  O     . HOH I 4 .   ? -48.468 11.396  -27.399 1.00 44.92 ? 557 HOH A O     1 
HETATM 5002 O  O     . HOH I 4 .   ? -51.354 11.326  -27.729 1.00 47.42 ? 558 HOH A O     1 
HETATM 5003 O  O     . HOH I 4 .   ? -51.412 9.605   -29.816 1.00 60.17 ? 559 HOH A O     1 
HETATM 5004 O  O     . HOH I 4 .   ? -51.309 11.852  -32.024 1.00 40.66 ? 560 HOH A O     1 
HETATM 5005 O  O     . HOH I 4 .   ? 11.640  7.980   -32.035 1.00 62.96 ? 561 HOH A O     1 
HETATM 5006 O  O     . HOH I 4 .   ? -53.224 12.497  -21.525 1.00 39.05 ? 562 HOH A O     1 
HETATM 5007 O  O     . HOH I 4 .   ? -47.841 23.988  -22.451 1.00 45.29 ? 563 HOH A O     1 
HETATM 5008 O  O     . HOH I 4 .   ? -34.172 24.356  -36.510 1.00 44.80 ? 564 HOH A O     1 
HETATM 5009 O  O     . HOH I 4 .   ? -36.070 12.782  -29.740 1.00 58.38 ? 565 HOH A O     1 
HETATM 5010 O  O     . HOH I 4 .   ? -14.868 8.624   -24.684 1.00 51.24 ? 566 HOH A O     1 
HETATM 5011 O  O     . HOH I 4 .   ? -11.345 11.581  -36.370 1.00 50.83 ? 567 HOH A O     1 
HETATM 5012 O  O     . HOH I 4 .   ? -39.568 16.239  -39.269 1.00 44.31 ? 568 HOH A O     1 
HETATM 5013 O  O     . HOH I 4 .   ? -36.744 17.063  -40.689 1.00 51.16 ? 569 HOH A O     1 
HETATM 5014 O  O     . HOH I 4 .   ? 4.044   32.391  -26.751 1.00 55.34 ? 570 HOH A O     1 
HETATM 5015 O  O     . HOH I 4 .   ? 9.522   20.129  -23.158 1.00 46.44 ? 571 HOH A O     1 
HETATM 5016 O  O     . HOH I 4 .   ? 7.594   12.718  -36.916 1.00 49.70 ? 572 HOH A O     1 
HETATM 5017 O  O     . HOH I 4 .   ? -3.161  10.908  -41.515 1.00 54.42 ? 573 HOH A O     1 
HETATM 5018 O  O     . HOH I 4 .   ? -2.013  11.177  -39.237 1.00 74.07 ? 574 HOH A O     1 
HETATM 5019 O  O     . HOH I 4 .   ? 0.089   10.653  -37.777 1.00 56.99 ? 575 HOH A O     1 
HETATM 5020 O  O     . HOH I 4 .   ? 10.795  19.874  -39.107 1.00 44.39 ? 576 HOH A O     1 
HETATM 5021 O  O     . HOH I 4 .   ? -2.207  22.379  -48.881 1.00 51.15 ? 577 HOH A O     1 
HETATM 5022 O  O     . HOH I 4 .   ? -8.404  9.860   -39.876 1.00 63.40 ? 578 HOH A O     1 
HETATM 5023 O  O     . HOH I 4 .   ? -12.513 11.331  -32.931 1.00 58.68 ? 579 HOH A O     1 
HETATM 5024 O  O     . HOH I 4 .   ? -12.518 15.845  -37.021 1.00 50.79 ? 580 HOH A O     1 
HETATM 5025 O  O     . HOH I 4 .   ? -11.930 16.987  -5.865  1.00 48.67 ? 581 HOH A O     1 
HETATM 5026 O  O     . HOH I 4 .   ? -23.370 5.144   -9.235  1.00 48.78 ? 582 HOH A O     1 
HETATM 5027 O  O     . HOH I 4 .   ? -7.800  28.577  -27.899 1.00 51.32 ? 583 HOH A O     1 
HETATM 5028 O  O     . HOH I 4 .   ? -8.259  31.820  -20.106 1.00 52.60 ? 584 HOH A O     1 
HETATM 5029 O  O     . HOH I 4 .   ? -18.217 29.793  -25.234 1.00 77.85 ? 585 HOH A O     1 
HETATM 5030 O  O     . HOH I 4 .   ? 2.480   7.442   -36.730 1.00 58.07 ? 586 HOH A O     1 
HETATM 5031 O  O     . HOH I 4 .   ? 6.462   8.499   -35.997 1.00 62.45 ? 587 HOH A O     1 
HETATM 5032 O  O     . HOH I 4 .   ? -4.518  24.649  -15.370 1.00 57.02 ? 588 HOH A O     1 
HETATM 5033 O  O     . HOH I 4 .   ? -19.708 19.740  -12.959 1.00 47.97 ? 589 HOH A O     1 
HETATM 5034 O  O     . HOH I 4 .   ? -20.851 21.051  -14.651 1.00 59.85 ? 590 HOH A O     1 
HETATM 5035 O  O     . HOH I 4 .   ? -23.930 16.761  -16.005 1.00 52.76 ? 591 HOH A O     1 
HETATM 5036 O  O     . HOH I 4 .   ? -41.678 4.617   -22.201 1.00 53.60 ? 592 HOH A O     1 
HETATM 5037 O  O     . HOH I 4 .   ? -40.755 8.001   -22.729 1.00 49.73 ? 593 HOH A O     1 
HETATM 5038 O  O     . HOH I 4 .   ? -40.785 7.887   -25.124 1.00 61.73 ? 594 HOH A O     1 
HETATM 5039 O  O     . HOH I 4 .   ? -45.796 7.578   -27.319 1.00 65.22 ? 595 HOH A O     1 
HETATM 5040 O  O     . HOH I 4 .   ? 17.867  13.043  -36.194 1.00 58.11 ? 596 HOH A O     1 
HETATM 5041 O  O     . HOH I 4 .   ? -44.081 24.076  -35.702 1.00 54.10 ? 597 HOH A O     1 
HETATM 5042 O  O     . HOH I 4 .   ? -43.462 27.739  -41.870 1.00 59.81 ? 598 HOH A O     1 
HETATM 5043 O  O     . HOH I 4 .   ? -45.812 27.359  -28.622 1.00 55.35 ? 599 HOH A O     1 
HETATM 5044 O  O     . HOH I 4 .   ? -44.766 27.129  -26.248 1.00 65.04 ? 600 HOH A O     1 
HETATM 5045 O  O     . HOH I 4 .   ? -31.022 26.171  -28.112 1.00 53.75 ? 601 HOH A O     1 
HETATM 5046 O  O     . HOH I 4 .   ? -33.217 27.933  -31.450 1.00 67.84 ? 602 HOH A O     1 
HETATM 5047 O  O     . HOH I 4 .   ? -34.569 27.770  -29.193 1.00 58.79 ? 603 HOH A O     1 
HETATM 5048 O  O     . HOH I 4 .   ? -1.103  8.367   -38.169 1.00 65.89 ? 604 HOH A O     1 
HETATM 5049 O  O     . HOH I 4 .   ? -18.696 -0.369  -14.784 1.00 74.66 ? 605 HOH A O     1 
HETATM 5050 O  O     . HOH I 4 .   ? -15.577 16.934  -34.619 1.00 53.47 ? 606 HOH A O     1 
HETATM 5051 O  O     . HOH I 4 .   ? 5.893   24.454  -44.521 1.00 56.32 ? 607 HOH A O     1 
HETATM 5052 O  O     . HOH I 4 .   ? -8.553  19.992  -5.641  1.00 51.07 ? 608 HOH A O     1 
HETATM 5053 O  O     . HOH I 4 .   ? -26.138 9.783   -12.453 1.00 44.55 ? 609 HOH A O     1 
HETATM 5054 O  O     . HOH I 4 .   ? -16.185 26.883  -23.672 1.00 53.56 ? 610 HOH A O     1 
HETATM 5055 O  O     . HOH I 4 .   ? -19.846 23.831  -34.367 1.00 48.43 ? 611 HOH A O     1 
HETATM 5056 O  O     . HOH I 4 .   ? -17.751 30.429  -22.153 1.00 51.22 ? 612 HOH A O     1 
HETATM 5057 O  O     . HOH I 4 .   ? -19.048 29.490  -19.299 1.00 63.07 ? 613 HOH A O     1 
HETATM 5058 O  O     . HOH I 4 .   ? 6.390   15.857  -14.147 1.00 49.01 ? 614 HOH A O     1 
HETATM 5059 O  O     . HOH I 4 .   ? 1.577   12.779  -12.542 1.00 53.12 ? 615 HOH A O     1 
HETATM 5060 O  O     . HOH I 4 .   ? -48.334 10.664  -33.015 1.00 58.67 ? 616 HOH A O     1 
HETATM 5061 O  O     . HOH I 4 .   ? -46.974 20.847  -38.976 1.00 49.34 ? 617 HOH A O     1 
HETATM 5062 O  O     . HOH I 4 .   ? -49.822 4.427   -12.419 1.00 52.38 ? 618 HOH A O     1 
HETATM 5063 O  O     . HOH I 4 .   ? -14.057 6.653   -23.977 1.00 50.67 ? 619 HOH A O     1 
HETATM 5064 O  O     . HOH I 4 .   ? -13.942 4.148   -24.216 1.00 53.40 ? 620 HOH A O     1 
HETATM 5065 O  O     . HOH J 4 .   ? -16.191 -4.038  -20.063 1.00 62.25 ? 503 HOH B O     1 
HETATM 5066 O  O     . HOH J 4 .   ? -5.475  5.846   -7.502  1.00 70.23 ? 504 HOH B O     1 
HETATM 5067 O  O     . HOH J 4 .   ? -8.178  5.131   -7.421  1.00 71.40 ? 505 HOH B O     1 
HETATM 5068 O  O     . HOH J 4 .   ? -7.461  2.382   -6.199  1.00 57.76 ? 506 HOH B O     1 
HETATM 5069 O  O     . HOH J 4 .   ? -9.929  1.947   -6.534  1.00 70.73 ? 507 HOH B O     1 
HETATM 5070 O  O     . HOH J 4 .   ? -11.328 -0.253  -7.796  1.00 35.60 ? 508 HOH B O     1 
HETATM 5071 O  O     . HOH J 4 .   ? -14.306 0.612   -6.603  1.00 46.62 ? 509 HOH B O     1 
HETATM 5072 O  O     . HOH J 4 .   ? -13.418 -0.681  -4.025  1.00 51.99 ? 510 HOH B O     1 
HETATM 5073 O  O     . HOH J 4 .   ? -11.953 2.461   -4.988  1.00 64.05 ? 511 HOH B O     1 
HETATM 5074 O  O     . HOH J 4 .   ? 3.467   2.473   -6.049  1.00 60.79 ? 512 HOH B O     1 
HETATM 5075 O  O     . HOH J 4 .   ? 2.175   -0.135  -5.485  1.00 56.79 ? 513 HOH B O     1 
HETATM 5076 O  O     . HOH J 4 .   ? 1.246   4.574   -7.831  1.00 55.65 ? 514 HOH B O     1 
HETATM 5077 O  O     . HOH J 4 .   ? 0.482   7.228   -8.514  1.00 59.97 ? 515 HOH B O     1 
HETATM 5078 O  O     . HOH J 4 .   ? -11.239 7.110   -27.563 1.00 44.18 ? 516 HOH B O     1 
HETATM 5079 O  O     . HOH J 4 .   ? -20.721 3.392   -8.161  1.00 54.76 ? 517 HOH B O     1 
HETATM 5080 O  O     . HOH J 4 .   ? -13.403 5.320   -18.338 1.00 41.94 ? 518 HOH B O     1 
HETATM 5081 O  O     . HOH J 4 .   ? -0.827  5.805   -33.528 1.00 87.65 ? 519 HOH B O     1 
HETATM 5082 O  O     . HOH J 4 .   ? 5.205   8.177   -14.233 1.00 56.14 ? 520 HOH B O     1 
HETATM 5083 O  O     . HOH J 4 .   ? 9.411   3.311   -17.941 1.00 59.03 ? 521 HOH B O     1 
HETATM 5084 O  O     . HOH J 4 .   ? 6.451   -11.504 -5.149  1.00 49.15 ? 522 HOH B O     1 
HETATM 5085 O  O     . HOH J 4 .   ? 7.563   -4.563  -9.807  1.00 65.74 ? 523 HOH B O     1 
HETATM 5086 O  O     . HOH J 4 .   ? 8.201   -6.629  -12.427 1.00 51.89 ? 524 HOH B O     1 
HETATM 5087 O  O     . HOH J 4 .   ? -10.433 -7.026  -2.435  1.00 50.70 ? 525 HOH B O     1 
HETATM 5088 O  O     . HOH J 4 .   ? -21.421 -6.729  -1.845  1.00 62.47 ? 526 HOH B O     1 
HETATM 5089 O  O     . HOH J 4 .   ? -7.087  5.742   -45.762 1.00 51.63 ? 527 HOH B O     1 
HETATM 5090 O  O     . HOH J 4 .   ? -15.788 5.448   -44.695 1.00 77.00 ? 528 HOH B O     1 
HETATM 5091 O  O     . HOH J 4 .   ? -15.475 7.580   -43.322 1.00 50.20 ? 529 HOH B O     1 
HETATM 5092 O  O     . HOH J 4 .   ? -15.301 3.907   -31.848 1.00 39.82 ? 530 HOH B O     1 
HETATM 5093 O  O     . HOH J 4 .   ? -15.281 3.126   -29.396 1.00 55.14 ? 531 HOH B O     1 
HETATM 5094 O  O     . HOH J 4 .   ? -19.341 -4.407  -25.147 1.00 55.90 ? 532 HOH B O     1 
HETATM 5095 O  O     . HOH J 4 .   ? -19.009 -7.338  -27.241 1.00 48.36 ? 533 HOH B O     1 
HETATM 5096 O  O     . HOH J 4 .   ? -18.694 -7.368  -29.702 1.00 52.15 ? 534 HOH B O     1 
HETATM 5097 O  O     . HOH J 4 .   ? -21.458 -14.674 -20.774 1.00 49.69 ? 535 HOH B O     1 
HETATM 5098 O  O     . HOH J 4 .   ? 2.818   -9.109  -29.077 1.00 48.78 ? 536 HOH B O     1 
HETATM 5099 O  O     . HOH J 4 .   ? -24.601 -7.464  -42.860 1.00 68.07 ? 537 HOH B O     1 
HETATM 5100 O  O     . HOH J 4 .   ? -24.802 -9.821  -44.251 1.00 92.04 ? 538 HOH B O     1 
HETATM 5101 O  O     . HOH J 4 .   ? -34.082 0.846   -40.597 1.00 60.44 ? 539 HOH B O     1 
HETATM 5102 O  O     . HOH J 4 .   ? -34.796 3.435   -40.130 1.00 52.79 ? 540 HOH B O     1 
HETATM 5103 O  O     . HOH J 4 .   ? -39.563 8.725   -44.202 1.00 64.52 ? 541 HOH B O     1 
HETATM 5104 O  O     . HOH J 4 .   ? -45.423 0.283   -32.690 1.00 57.24 ? 542 HOH B O     1 
HETATM 5105 O  O     . HOH J 4 .   ? -49.489 -0.804  -33.524 1.00 65.60 ? 543 HOH B O     1 
HETATM 5106 O  O     . HOH J 4 .   ? -49.341 -8.268  -27.630 1.00 66.74 ? 544 HOH B O     1 
HETATM 5107 O  O     . HOH J 4 .   ? -51.838 -8.661  -29.597 1.00 72.67 ? 545 HOH B O     1 
HETATM 5108 O  O     . HOH J 4 .   ? -47.130 -7.403  -42.415 1.00 64.05 ? 546 HOH B O     1 
HETATM 5109 O  O     . HOH J 4 .   ? -37.837 -13.652 -37.392 1.00 50.59 ? 547 HOH B O     1 
HETATM 5110 O  O     . HOH J 4 .   ? -36.225 -14.325 -39.447 1.00 91.50 ? 548 HOH B O     1 
HETATM 5111 O  O     . HOH J 4 .   ? -37.028 -15.386 -35.685 1.00 67.36 ? 549 HOH B O     1 
HETATM 5112 O  O     . HOH J 4 .   ? -36.625 0.435   -30.826 1.00 60.06 ? 550 HOH B O     1 
HETATM 5113 O  O     . HOH J 4 .   ? -38.945 6.908   -36.770 1.00 62.08 ? 551 HOH B O     1 
HETATM 5114 O  O     . HOH J 4 .   ? -38.170 4.837   -37.225 1.00 42.62 ? 552 HOH B O     1 
HETATM 5115 O  O     . HOH J 4 .   ? 7.812   -6.284  -15.114 1.00 56.70 ? 553 HOH B O     1 
HETATM 5116 O  O     . HOH J 4 .   ? 9.968   -5.474  -13.781 1.00 64.08 ? 554 HOH B O     1 
HETATM 5117 O  O     . HOH J 4 .   ? -3.134  -3.650  -40.511 1.00 54.62 ? 555 HOH B O     1 
HETATM 5118 O  O     . HOH J 4 .   ? -14.209 -13.675 -26.675 1.00 64.65 ? 556 HOH B O     1 
HETATM 5119 O  O     . HOH J 4 .   ? 11.318  1.730   -17.226 1.00 67.91 ? 557 HOH B O     1 
HETATM 5120 O  O     . HOH J 4 .   ? 0.673   -10.510 -28.887 1.00 41.05 ? 558 HOH B O     1 
HETATM 5121 O  O     . HOH J 4 .   ? 1.551   -13.089 -28.687 1.00 53.72 ? 559 HOH B O     1 
HETATM 5122 O  O     . HOH J 4 .   ? -0.060  -9.789  -35.984 1.00 50.85 ? 560 HOH B O     1 
HETATM 5123 O  O     . HOH J 4 .   ? -5.397  -13.416 -30.927 1.00 58.38 ? 561 HOH B O     1 
HETATM 5124 O  O     . HOH J 4 .   ? -41.448 -1.485  -33.256 1.00 55.09 ? 562 HOH B O     1 
HETATM 5125 O  O     . HOH J 4 .   ? -44.185 -12.530 -15.790 1.00 59.79 ? 563 HOH B O     1 
HETATM 5126 O  O     . HOH J 4 .   ? -42.303 -11.991 -42.887 1.00 56.86 ? 564 HOH B O     1 
HETATM 5127 O  O     . HOH J 4 .   ? -23.893 -0.573  -38.413 1.00 46.25 ? 565 HOH B O     1 
HETATM 5128 O  O     . HOH J 4 .   ? -37.124 4.324   -39.197 1.00 42.43 ? 566 HOH B O     1 
HETATM 5129 O  O     . HOH J 4 .   ? 3.902   -15.754 -19.965 1.00 58.64 ? 567 HOH B O     1 
HETATM 5130 O  O     . HOH J 4 .   ? 2.540   -17.579 -19.602 1.00 54.15 ? 568 HOH B O     1 
HETATM 5131 O  O     . HOH J 4 .   ? 4.477   -13.499 -20.056 1.00 51.39 ? 569 HOH B O     1 
HETATM 5132 O  O     . HOH J 4 .   ? -7.560  -8.326  -0.073  1.00 49.18 ? 570 HOH B O     1 
HETATM 5133 O  O     . HOH J 4 .   ? -17.122 -4.624  -8.686  1.00 43.10 ? 571 HOH B O     1 
HETATM 5134 O  O     . HOH J 4 .   ? -19.141 -3.675  -9.892  1.00 50.14 ? 572 HOH B O     1 
HETATM 5135 O  O     . HOH J 4 .   ? -14.672 7.043   -28.794 1.00 49.77 ? 573 HOH B O     1 
HETATM 5136 O  O     . HOH J 4 .   ? -14.074 7.139   -26.415 1.00 51.08 ? 574 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   A   1   1   1   A   A   C . n 
A 1 2   A   2   2   2   A   A   C . n 
A 1 3   A   3   3   3   A   A   C . n 
A 1 4   G   4   4   4   G   G   C . n 
A 1 5   G   5   5   5   G   G   C . n 
A 1 6   U   6   6   6   U   U   C . n 
A 1 7   C   7   7   7   C   C   C . n 
A 1 8   A   8   8   8   A   A   C . n 
A 1 9   U   9   9   9   U   U   C . n 
A 1 10  U   10  10  10  U   U   C . n 
A 1 11  C   11  11  11  C   C   C . n 
A 1 12  G   12  12  12  G   G   C . n 
A 1 13  C   13  13  13  C   C   C . n 
A 1 14  A   14  14  14  A   A   C . n 
A 1 15  A   15  15  15  A   A   C . n 
A 1 16  G   16  16  16  G   G   C . n 
A 1 17  A   17  17  17  A   A   C . n 
A 1 18  G   18  18  18  G   G   C . n 
A 1 19  U   19  19  19  U   U   C . n 
A 1 20  G   20  20  20  G   G   C . n 
A 1 21  G   21  21  21  G   G   C . n 
A 1 22  C   22  22  22  C   C   C . n 
A 1 23  C   23  23  23  C   C   C . n 
A 1 24  U   24  24  24  U   U   C . n 
A 1 25  U   25  25  25  U   U   C . n 
A 1 26  U   26  26  26  U   U   C . n 
A 1 27  A   27  27  27  A   A   C . n 
A 1 28  U   28  28  28  U   U   C . n 
B 1 1   A   1   1   1   A   A   D . n 
B 1 2   A   2   2   2   A   A   D . n 
B 1 3   A   3   3   3   A   A   D . n 
B 1 4   G   4   4   4   G   G   D . n 
B 1 5   G   5   5   5   G   G   D . n 
B 1 6   U   6   6   6   U   U   D . n 
B 1 7   C   7   7   7   C   C   D . n 
B 1 8   A   8   8   8   A   A   D . n 
B 1 9   U   9   9   9   U   U   D . n 
B 1 10  U   10  10  10  U   U   D . n 
B 1 11  C   11  11  11  C   C   D . n 
B 1 12  G   12  12  12  G   G   D . n 
B 1 13  C   13  13  13  C   C   D . n 
B 1 14  A   14  14  14  A   A   D . n 
B 1 15  A   15  15  15  A   A   D . n 
B 1 16  G   16  16  16  G   G   D . n 
B 1 17  A   17  17  17  A   A   D . n 
B 1 18  G   18  18  18  G   G   D . n 
B 1 19  U   19  19  19  U   U   D . n 
B 1 20  G   20  20  20  G   G   D . n 
B 1 21  G   21  21  21  G   G   D . n 
B 1 22  C   22  22  22  C   C   D . n 
B 1 23  C   23  23  23  C   C   D . n 
B 1 24  U   24  24  24  U   U   D . n 
B 1 25  U   25  25  25  U   U   D . n 
B 1 26  U   26  26  26  U   U   D . n 
B 1 27  A   27  27  27  A   A   D . n 
B 1 28  U   28  28  28  U   U   D . n 
C 2 1   MET 1   1   ?   ?   ?   A . n 
C 2 2   LYS 2   2   ?   ?   ?   A . n 
C 2 3   MET 3   3   3   MET MET A . n 
C 2 4   LEU 4   4   4   LEU LEU A . n 
C 2 5   GLU 5   5   5   GLU GLU A . n 
C 2 6   GLN 6   6   6   GLN GLN A . n 
C 2 7   LEU 7   7   7   LEU LEU A . n 
C 2 8   GLU 8   8   8   GLU GLU A . n 
C 2 9   LYS 9   9   9   LYS LYS A . n 
C 2 10  LYS 10  10  10  LYS LYS A . n 
C 2 11  LEU 11  11  11  LEU LEU A . n 
C 2 12  GLY 12  12  12  GLY GLY A . n 
C 2 13  TYR 13  13  13  TYR TYR A . n 
C 2 14  THR 14  14  14  THR THR A . n 
C 2 15  PHE 15  15  15  PHE PHE A . n 
C 2 16  LYS 16  16  16  LYS LYS A . n 
C 2 17  ASP 17  17  17  ASP ASP A . n 
C 2 18  LYS 18  18  18  LYS LYS A . n 
C 2 19  SER 19  19  19  SER SER A . n 
C 2 20  LEU 20  20  20  LEU LEU A . n 
C 2 21  LEU 21  21  21  LEU LEU A . n 
C 2 22  GLU 22  22  22  GLU GLU A . n 
C 2 23  LYS 23  23  23  LYS LYS A . n 
C 2 24  ALA 24  24  24  ALA ALA A . n 
C 2 25  LEU 25  25  25  LEU LEU A . n 
C 2 26  THR 26  26  26  THR THR A . n 
C 2 27  HIS 27  27  27  HIS HIS A . n 
C 2 28  VAL 28  28  28  VAL VAL A . n 
C 2 29  SER 29  29  29  SER SER A . n 
C 2 30  TYR 30  30  30  TYR TYR A . n 
C 2 31  SER 31  31  31  SER SER A . n 
C 2 32  LYS 32  32  32  LYS LYS A . n 
C 2 33  LYS 33  33  33  LYS LYS A . n 
C 2 34  GLU 34  34  34  GLU GLU A . n 
C 2 35  HIS 35  35  35  HIS HIS A . n 
C 2 36  TYR 36  36  36  TYR TYR A . n 
C 2 37  GLU 37  37  37  GLU GLU A . n 
C 2 38  THR 38  38  38  THR THR A . n 
C 2 39  LEU 39  39  39  LEU LEU A . n 
C 2 40  GLU 40  40  40  GLU GLU A . n 
C 2 41  PHE 41  41  41  PHE PHE A . n 
C 2 42  LEU 42  42  42  LEU LEU A . n 
C 2 43  GLY 43  43  43  GLY GLY A . n 
C 2 44  ASN 44  44  44  ASN ASN A . n 
C 2 45  ALA 45  45  45  ALA ALA A . n 
C 2 46  LEU 46  46  46  LEU LEU A . n 
C 2 47  VAL 47  47  47  VAL VAL A . n 
C 2 48  ASN 48  48  48  ASN ASN A . n 
C 2 49  PHE 49  49  49  PHE PHE A . n 
C 2 50  PHE 50  50  50  PHE PHE A . n 
C 2 51  ILE 51  51  51  ILE ILE A . n 
C 2 52  VAL 52  52  52  VAL VAL A . n 
C 2 53  ASP 53  53  53  ASP ASP A . n 
C 2 54  LEU 54  54  54  LEU LEU A . n 
C 2 55  LEU 55  55  55  LEU LEU A . n 
C 2 56  VAL 56  56  56  VAL VAL A . n 
C 2 57  GLN 57  57  57  GLN GLN A . n 
C 2 58  TYR 58  58  58  TYR TYR A . n 
C 2 59  SER 59  59  59  SER SER A . n 
C 2 60  PRO 60  60  60  PRO PRO A . n 
C 2 61  ASN 61  61  61  ASN ASN A . n 
C 2 62  LYS 62  62  62  LYS LYS A . n 
C 2 63  ARG 63  63  63  ARG ARG A . n 
C 2 64  GLU 64  64  64  GLU GLU A . n 
C 2 65  GLY 65  65  65  GLY GLY A . n 
C 2 66  PHE 66  66  66  PHE PHE A . n 
C 2 67  LEU 67  67  67  LEU LEU A . n 
C 2 68  SER 68  68  68  SER SER A . n 
C 2 69  PRO 69  69  69  PRO PRO A . n 
C 2 70  LEU 70  70  70  LEU LEU A . n 
C 2 71  LYS 71  71  71  LYS LYS A . n 
C 2 72  ALA 72  72  72  ALA ALA A . n 
C 2 73  TYR 73  73  73  TYR TYR A . n 
C 2 74  LEU 74  74  74  LEU LEU A . n 
C 2 75  ILE 75  75  75  ILE ILE A . n 
C 2 76  SER 76  76  76  SER SER A . n 
C 2 77  GLU 77  77  77  GLU GLU A . n 
C 2 78  GLU 78  78  78  GLU GLU A . n 
C 2 79  PHE 79  79  79  PHE PHE A . n 
C 2 80  PHE 80  80  80  PHE PHE A . n 
C 2 81  ASN 81  81  81  ASN ASN A . n 
C 2 82  LEU 82  82  82  LEU LEU A . n 
C 2 83  LEU 83  83  83  LEU LEU A . n 
C 2 84  ALA 84  84  84  ALA ALA A . n 
C 2 85  GLN 85  85  85  GLN GLN A . n 
C 2 86  LYS 86  86  86  LYS LYS A . n 
C 2 87  LEU 87  87  87  LEU LEU A . n 
C 2 88  GLU 88  88  88  GLU GLU A . n 
C 2 89  LEU 89  89  89  LEU LEU A . n 
C 2 90  HIS 90  90  90  HIS HIS A . n 
C 2 91  LYS 91  91  91  LYS LYS A . n 
C 2 92  PHE 92  92  92  PHE PHE A . n 
C 2 93  ILE 93  93  93  ILE ILE A . n 
C 2 94  ARG 94  94  94  ARG ARG A . n 
C 2 95  ILE 95  95  95  ILE ILE A . n 
C 2 96  LYS 96  96  96  LYS LYS A . n 
C 2 97  ARG 97  97  97  ARG ARG A . n 
C 2 98  GLY 98  98  98  GLY GLY A . n 
C 2 99  LYS 99  99  99  LYS LYS A . n 
C 2 100 ILE 100 100 100 ILE ILE A . n 
C 2 101 ASN 101 101 101 ASN ASN A . n 
C 2 102 GLU 102 102 102 GLU GLU A . n 
C 2 103 THR 103 103 103 THR THR A . n 
C 2 104 ILE 104 104 104 ILE ILE A . n 
C 2 105 ILE 105 105 105 ILE ILE A . n 
C 2 106 GLY 106 106 106 GLY GLY A . n 
C 2 107 ASP 107 107 107 ASP ASP A . n 
C 2 108 VAL 108 108 108 VAL VAL A . n 
C 2 109 PHE 109 109 109 PHE PHE A . n 
C 2 110 GLU 110 110 110 GLU GLU A . n 
C 2 111 ALA 111 111 111 ALA ALA A . n 
C 2 112 LEU 112 112 112 LEU LEU A . n 
C 2 113 TRP 113 113 113 TRP TRP A . n 
C 2 114 ALA 114 114 114 ALA ALA A . n 
C 2 115 ALA 115 115 115 ALA ALA A . n 
C 2 116 VAL 116 116 116 VAL VAL A . n 
C 2 117 TYR 117 117 117 TYR TYR A . n 
C 2 118 ILE 118 118 118 ILE ILE A . n 
C 2 119 ASP 119 119 119 ASP ASP A . n 
C 2 120 SER 120 120 120 SER SER A . n 
C 2 121 GLY 121 121 121 GLY GLY A . n 
C 2 122 ARG 122 122 122 ARG ARG A . n 
C 2 123 ASP 123 123 123 ASP ASP A . n 
C 2 124 ALA 124 124 124 ALA ALA A . n 
C 2 125 ASN 125 125 125 ASN ASN A . n 
C 2 126 PHE 126 126 126 PHE PHE A . n 
C 2 127 THR 127 127 127 THR THR A . n 
C 2 128 ARG 128 128 128 ARG ARG A . n 
C 2 129 GLU 129 129 129 GLU GLU A . n 
C 2 130 LEU 130 130 130 LEU LEU A . n 
C 2 131 PHE 131 131 131 PHE PHE A . n 
C 2 132 TYR 132 132 132 TYR TYR A . n 
C 2 133 LYS 133 133 133 LYS LYS A . n 
C 2 134 LEU 134 134 134 LEU LEU A . n 
C 2 135 PHE 135 135 135 PHE PHE A . n 
C 2 136 LYS 136 136 136 LYS LYS A . n 
C 2 137 GLU 137 137 137 GLU GLU A . n 
C 2 138 ASP 138 138 138 ASP ASP A . n 
C 2 139 ILE 139 139 139 ILE ILE A . n 
C 2 140 LEU 140 140 140 LEU LEU A . n 
C 2 141 SER 141 141 141 SER SER A . n 
C 2 142 ALA 142 142 142 ALA ALA A . n 
C 2 143 ILE 143 143 143 ILE ILE A . n 
C 2 144 LYS 144 144 144 LYS LYS A . n 
C 2 145 GLU 145 145 145 GLU GLU A . n 
C 2 146 GLY 146 146 146 GLY GLY A . n 
C 2 147 ARG 147 147 147 ARG ARG A . n 
C 2 148 VAL 148 148 148 VAL VAL A . n 
C 2 149 LYS 149 149 149 LYS LYS A . n 
C 2 150 LYS 150 150 150 LYS LYS A . n 
C 2 151 ASP 151 151 151 ASP ASP A . n 
C 2 152 TYR 152 152 152 TYR TYR A . n 
C 2 153 LYS 153 153 153 LYS LYS A . n 
C 2 154 THR 154 154 154 THR THR A . n 
C 2 155 ILE 155 155 155 ILE ILE A . n 
C 2 156 LEU 156 156 156 LEU LEU A . n 
C 2 157 GLN 157 157 157 GLN GLN A . n 
C 2 158 GLU 158 158 158 GLU GLU A . n 
C 2 159 ILE 159 159 159 ILE ILE A . n 
C 2 160 THR 160 160 160 THR THR A . n 
C 2 161 GLN 161 161 161 GLN GLN A . n 
C 2 162 LYS 162 162 162 LYS LYS A . n 
C 2 163 ARG 163 163 163 ARG ARG A . n 
C 2 164 TRP 164 164 164 TRP TRP A . n 
C 2 165 LYS 165 165 165 LYS LYS A . n 
C 2 166 GLU 166 166 166 GLU GLU A . n 
C 2 167 ARG 167 167 167 ARG ARG A . n 
C 2 168 PRO 168 168 168 PRO PRO A . n 
C 2 169 GLU 169 169 169 GLU GLU A . n 
C 2 170 TYR 170 170 170 TYR TYR A . n 
C 2 171 ARG 171 171 171 ARG ARG A . n 
C 2 172 LEU 172 172 172 LEU LEU A . n 
C 2 173 ILE 173 173 173 ILE ILE A . n 
C 2 174 SER 174 174 174 SER SER A . n 
C 2 175 VAL 175 175 175 VAL VAL A . n 
C 2 176 GLU 176 176 176 GLU GLU A . n 
C 2 177 GLY 177 177 177 GLY GLY A . n 
C 2 178 PRO 178 178 178 PRO PRO A . n 
C 2 179 HIS 179 179 179 HIS HIS A . n 
C 2 180 HIS 180 180 180 HIS HIS A . n 
C 2 181 LYS 181 181 181 LYS LYS A . n 
C 2 182 LYS 182 182 182 LYS LYS A . n 
C 2 183 LYS 183 183 183 LYS LYS A . n 
C 2 184 PHE 184 184 184 PHE PHE A . n 
C 2 185 ILE 185 185 185 ILE ILE A . n 
C 2 186 VAL 186 186 186 VAL VAL A . n 
C 2 187 GLU 187 187 187 GLU GLU A . n 
C 2 188 ALA 188 188 188 ALA ALA A . n 
C 2 189 LYS 189 189 189 LYS LYS A . n 
C 2 190 ILE 190 190 190 ILE ILE A . n 
C 2 191 LYS 191 191 191 LYS LYS A . n 
C 2 192 GLU 192 192 192 GLU GLU A . n 
C 2 193 TYR 193 193 193 TYR TYR A . n 
C 2 194 ARG 194 194 194 ARG ARG A . n 
C 2 195 THR 195 195 195 THR THR A . n 
C 2 196 LEU 196 196 196 LEU LEU A . n 
C 2 197 GLY 197 197 197 GLY GLY A . n 
C 2 198 GLU 198 198 198 GLU GLU A . n 
C 2 199 GLY 199 199 199 GLY GLY A . n 
C 2 200 LYS 200 200 200 LYS LYS A . n 
C 2 201 SER 201 201 201 SER SER A . n 
C 2 202 LYS 202 202 202 LYS LYS A . n 
C 2 203 LYS 203 203 203 LYS LYS A . n 
C 2 204 GLU 204 204 204 GLU GLU A . n 
C 2 205 ALA 205 205 205 ALA ALA A . n 
C 2 206 GLU 206 206 206 GLU GLU A . n 
C 2 207 GLN 207 207 207 GLN GLN A . n 
C 2 208 ARG 208 208 208 ARG ARG A . n 
C 2 209 ALA 209 209 209 ALA ALA A . n 
C 2 210 ALA 210 210 210 ALA ALA A . n 
C 2 211 GLU 211 211 211 GLU GLU A . n 
C 2 212 GLU 212 212 212 GLU GLU A . n 
C 2 213 LEU 213 213 213 LEU LEU A . n 
C 2 214 ILE 214 214 214 ILE ILE A . n 
C 2 215 LYS 215 215 215 LYS LYS A . n 
C 2 216 LEU 216 216 216 LEU LEU A . n 
C 2 217 LEU 217 217 217 LEU LEU A . n 
C 2 218 GLU 218 218 218 GLU GLU A . n 
C 2 219 GLU 219 219 219 GLU GLU A . n 
C 2 220 SER 220 220 220 SER SER A . n 
C 2 221 GLU 221 221 ?   ?   ?   A . n 
D 2 1   MET 1   1   ?   ?   ?   B . n 
D 2 2   LYS 2   2   ?   ?   ?   B . n 
D 2 3   MET 3   3   3   MET MET B . n 
D 2 4   LEU 4   4   4   LEU LEU B . n 
D 2 5   GLU 5   5   5   GLU GLU B . n 
D 2 6   GLN 6   6   6   GLN GLN B . n 
D 2 7   LEU 7   7   7   LEU LEU B . n 
D 2 8   GLU 8   8   8   GLU GLU B . n 
D 2 9   LYS 9   9   9   LYS LYS B . n 
D 2 10  LYS 10  10  10  LYS LYS B . n 
D 2 11  LEU 11  11  11  LEU LEU B . n 
D 2 12  GLY 12  12  12  GLY GLY B . n 
D 2 13  TYR 13  13  13  TYR TYR B . n 
D 2 14  THR 14  14  14  THR THR B . n 
D 2 15  PHE 15  15  15  PHE PHE B . n 
D 2 16  LYS 16  16  16  LYS LYS B . n 
D 2 17  ASP 17  17  17  ASP ASP B . n 
D 2 18  LYS 18  18  18  LYS LYS B . n 
D 2 19  SER 19  19  19  SER SER B . n 
D 2 20  LEU 20  20  20  LEU LEU B . n 
D 2 21  LEU 21  21  21  LEU LEU B . n 
D 2 22  GLU 22  22  22  GLU GLU B . n 
D 2 23  LYS 23  23  23  LYS LYS B . n 
D 2 24  ALA 24  24  24  ALA ALA B . n 
D 2 25  LEU 25  25  25  LEU LEU B . n 
D 2 26  THR 26  26  26  THR THR B . n 
D 2 27  HIS 27  27  27  HIS HIS B . n 
D 2 28  VAL 28  28  28  VAL VAL B . n 
D 2 29  SER 29  29  29  SER SER B . n 
D 2 30  TYR 30  30  30  TYR TYR B . n 
D 2 31  SER 31  31  31  SER SER B . n 
D 2 32  LYS 32  32  32  LYS LYS B . n 
D 2 33  LYS 33  33  33  LYS LYS B . n 
D 2 34  GLU 34  34  34  GLU GLU B . n 
D 2 35  HIS 35  35  35  HIS HIS B . n 
D 2 36  TYR 36  36  36  TYR TYR B . n 
D 2 37  GLU 37  37  37  GLU GLU B . n 
D 2 38  THR 38  38  38  THR THR B . n 
D 2 39  LEU 39  39  39  LEU LEU B . n 
D 2 40  GLU 40  40  40  GLU GLU B . n 
D 2 41  PHE 41  41  41  PHE PHE B . n 
D 2 42  LEU 42  42  42  LEU LEU B . n 
D 2 43  GLY 43  43  43  GLY GLY B . n 
D 2 44  ASN 44  44  44  ASN ASN B . n 
D 2 45  ALA 45  45  45  ALA ALA B . n 
D 2 46  LEU 46  46  46  LEU LEU B . n 
D 2 47  VAL 47  47  47  VAL VAL B . n 
D 2 48  ASN 48  48  48  ASN ASN B . n 
D 2 49  PHE 49  49  49  PHE PHE B . n 
D 2 50  PHE 50  50  50  PHE PHE B . n 
D 2 51  ILE 51  51  51  ILE ILE B . n 
D 2 52  VAL 52  52  52  VAL VAL B . n 
D 2 53  ASP 53  53  53  ASP ASP B . n 
D 2 54  LEU 54  54  54  LEU LEU B . n 
D 2 55  LEU 55  55  55  LEU LEU B . n 
D 2 56  VAL 56  56  56  VAL VAL B . n 
D 2 57  GLN 57  57  57  GLN GLN B . n 
D 2 58  TYR 58  58  58  TYR TYR B . n 
D 2 59  SER 59  59  59  SER SER B . n 
D 2 60  PRO 60  60  60  PRO PRO B . n 
D 2 61  ASN 61  61  61  ASN ASN B . n 
D 2 62  LYS 62  62  62  LYS LYS B . n 
D 2 63  ARG 63  63  63  ARG ARG B . n 
D 2 64  GLU 64  64  64  GLU GLU B . n 
D 2 65  GLY 65  65  65  GLY GLY B . n 
D 2 66  PHE 66  66  66  PHE PHE B . n 
D 2 67  LEU 67  67  67  LEU LEU B . n 
D 2 68  SER 68  68  68  SER SER B . n 
D 2 69  PRO 69  69  69  PRO PRO B . n 
D 2 70  LEU 70  70  70  LEU LEU B . n 
D 2 71  LYS 71  71  71  LYS LYS B . n 
D 2 72  ALA 72  72  72  ALA ALA B . n 
D 2 73  TYR 73  73  73  TYR TYR B . n 
D 2 74  LEU 74  74  74  LEU LEU B . n 
D 2 75  ILE 75  75  75  ILE ILE B . n 
D 2 76  SER 76  76  76  SER SER B . n 
D 2 77  GLU 77  77  77  GLU GLU B . n 
D 2 78  GLU 78  78  78  GLU GLU B . n 
D 2 79  PHE 79  79  79  PHE PHE B . n 
D 2 80  PHE 80  80  80  PHE PHE B . n 
D 2 81  ASN 81  81  81  ASN ASN B . n 
D 2 82  LEU 82  82  82  LEU LEU B . n 
D 2 83  LEU 83  83  83  LEU LEU B . n 
D 2 84  ALA 84  84  84  ALA ALA B . n 
D 2 85  GLN 85  85  85  GLN GLN B . n 
D 2 86  LYS 86  86  86  LYS LYS B . n 
D 2 87  LEU 87  87  87  LEU LEU B . n 
D 2 88  GLU 88  88  88  GLU GLU B . n 
D 2 89  LEU 89  89  89  LEU LEU B . n 
D 2 90  HIS 90  90  90  HIS HIS B . n 
D 2 91  LYS 91  91  91  LYS LYS B . n 
D 2 92  PHE 92  92  92  PHE PHE B . n 
D 2 93  ILE 93  93  93  ILE ILE B . n 
D 2 94  ARG 94  94  94  ARG ARG B . n 
D 2 95  ILE 95  95  95  ILE ILE B . n 
D 2 96  LYS 96  96  96  LYS LYS B . n 
D 2 97  ARG 97  97  97  ARG ARG B . n 
D 2 98  GLY 98  98  98  GLY GLY B . n 
D 2 99  LYS 99  99  99  LYS LYS B . n 
D 2 100 ILE 100 100 100 ILE ILE B . n 
D 2 101 ASN 101 101 101 ASN ASN B . n 
D 2 102 GLU 102 102 102 GLU GLU B . n 
D 2 103 THR 103 103 103 THR THR B . n 
D 2 104 ILE 104 104 104 ILE ILE B . n 
D 2 105 ILE 105 105 105 ILE ILE B . n 
D 2 106 GLY 106 106 106 GLY GLY B . n 
D 2 107 ASP 107 107 107 ASP ASP B . n 
D 2 108 VAL 108 108 108 VAL VAL B . n 
D 2 109 PHE 109 109 109 PHE PHE B . n 
D 2 110 GLU 110 110 110 GLU GLU B . n 
D 2 111 ALA 111 111 111 ALA ALA B . n 
D 2 112 LEU 112 112 112 LEU LEU B . n 
D 2 113 TRP 113 113 113 TRP TRP B . n 
D 2 114 ALA 114 114 114 ALA ALA B . n 
D 2 115 ALA 115 115 115 ALA ALA B . n 
D 2 116 VAL 116 116 116 VAL VAL B . n 
D 2 117 TYR 117 117 117 TYR TYR B . n 
D 2 118 ILE 118 118 118 ILE ILE B . n 
D 2 119 ASP 119 119 119 ASP ASP B . n 
D 2 120 SER 120 120 120 SER SER B . n 
D 2 121 GLY 121 121 121 GLY GLY B . n 
D 2 122 ARG 122 122 122 ARG ARG B . n 
D 2 123 ASP 123 123 123 ASP ASP B . n 
D 2 124 ALA 124 124 124 ALA ALA B . n 
D 2 125 ASN 125 125 125 ASN ASN B . n 
D 2 126 PHE 126 126 126 PHE PHE B . n 
D 2 127 THR 127 127 127 THR THR B . n 
D 2 128 ARG 128 128 128 ARG ARG B . n 
D 2 129 GLU 129 129 129 GLU GLU B . n 
D 2 130 LEU 130 130 130 LEU LEU B . n 
D 2 131 PHE 131 131 131 PHE PHE B . n 
D 2 132 TYR 132 132 132 TYR TYR B . n 
D 2 133 LYS 133 133 133 LYS LYS B . n 
D 2 134 LEU 134 134 134 LEU LEU B . n 
D 2 135 PHE 135 135 135 PHE PHE B . n 
D 2 136 LYS 136 136 136 LYS LYS B . n 
D 2 137 GLU 137 137 137 GLU GLU B . n 
D 2 138 ASP 138 138 138 ASP ASP B . n 
D 2 139 ILE 139 139 139 ILE ILE B . n 
D 2 140 LEU 140 140 140 LEU LEU B . n 
D 2 141 SER 141 141 141 SER SER B . n 
D 2 142 ALA 142 142 142 ALA ALA B . n 
D 2 143 ILE 143 143 143 ILE ILE B . n 
D 2 144 LYS 144 144 144 LYS LYS B . n 
D 2 145 GLU 145 145 145 GLU GLU B . n 
D 2 146 GLY 146 146 146 GLY GLY B . n 
D 2 147 ARG 147 147 147 ARG ARG B . n 
D 2 148 VAL 148 148 148 VAL VAL B . n 
D 2 149 LYS 149 149 149 LYS LYS B . n 
D 2 150 LYS 150 150 150 LYS LYS B . n 
D 2 151 ASP 151 151 151 ASP ASP B . n 
D 2 152 TYR 152 152 152 TYR TYR B . n 
D 2 153 LYS 153 153 153 LYS LYS B . n 
D 2 154 THR 154 154 154 THR THR B . n 
D 2 155 ILE 155 155 155 ILE ILE B . n 
D 2 156 LEU 156 156 156 LEU LEU B . n 
D 2 157 GLN 157 157 157 GLN GLN B . n 
D 2 158 GLU 158 158 158 GLU GLU B . n 
D 2 159 ILE 159 159 159 ILE ILE B . n 
D 2 160 THR 160 160 160 THR THR B . n 
D 2 161 GLN 161 161 161 GLN GLN B . n 
D 2 162 LYS 162 162 162 LYS LYS B . n 
D 2 163 ARG 163 163 163 ARG ARG B . n 
D 2 164 TRP 164 164 164 TRP TRP B . n 
D 2 165 LYS 165 165 165 LYS LYS B . n 
D 2 166 GLU 166 166 166 GLU GLU B . n 
D 2 167 ARG 167 167 167 ARG ARG B . n 
D 2 168 PRO 168 168 168 PRO PRO B . n 
D 2 169 GLU 169 169 169 GLU GLU B . n 
D 2 170 TYR 170 170 170 TYR TYR B . n 
D 2 171 ARG 171 171 171 ARG ARG B . n 
D 2 172 LEU 172 172 172 LEU LEU B . n 
D 2 173 ILE 173 173 173 ILE ILE B . n 
D 2 174 SER 174 174 174 SER SER B . n 
D 2 175 VAL 175 175 175 VAL VAL B . n 
D 2 176 GLU 176 176 176 GLU GLU B . n 
D 2 177 GLY 177 177 177 GLY GLY B . n 
D 2 178 PRO 178 178 178 PRO PRO B . n 
D 2 179 HIS 179 179 179 HIS HIS B . n 
D 2 180 HIS 180 180 180 HIS HIS B . n 
D 2 181 LYS 181 181 181 LYS LYS B . n 
D 2 182 LYS 182 182 182 LYS LYS B . n 
D 2 183 LYS 183 183 183 LYS LYS B . n 
D 2 184 PHE 184 184 184 PHE PHE B . n 
D 2 185 ILE 185 185 185 ILE ILE B . n 
D 2 186 VAL 186 186 186 VAL VAL B . n 
D 2 187 GLU 187 187 187 GLU GLU B . n 
D 2 188 ALA 188 188 188 ALA ALA B . n 
D 2 189 LYS 189 189 189 LYS LYS B . n 
D 2 190 ILE 190 190 190 ILE ILE B . n 
D 2 191 LYS 191 191 191 LYS LYS B . n 
D 2 192 GLU 192 192 192 GLU GLU B . n 
D 2 193 TYR 193 193 193 TYR TYR B . n 
D 2 194 ARG 194 194 194 ARG ARG B . n 
D 2 195 THR 195 195 195 THR THR B . n 
D 2 196 LEU 196 196 196 LEU LEU B . n 
D 2 197 GLY 197 197 197 GLY GLY B . n 
D 2 198 GLU 198 198 198 GLU GLU B . n 
D 2 199 GLY 199 199 199 GLY GLY B . n 
D 2 200 LYS 200 200 200 LYS LYS B . n 
D 2 201 SER 201 201 201 SER SER B . n 
D 2 202 LYS 202 202 202 LYS LYS B . n 
D 2 203 LYS 203 203 203 LYS LYS B . n 
D 2 204 GLU 204 204 204 GLU GLU B . n 
D 2 205 ALA 205 205 205 ALA ALA B . n 
D 2 206 GLU 206 206 206 GLU GLU B . n 
D 2 207 GLN 207 207 207 GLN GLN B . n 
D 2 208 ARG 208 208 208 ARG ARG B . n 
D 2 209 ALA 209 209 209 ALA ALA B . n 
D 2 210 ALA 210 210 210 ALA ALA B . n 
D 2 211 GLU 211 211 211 GLU GLU B . n 
D 2 212 GLU 212 212 212 GLU GLU B . n 
D 2 213 LEU 213 213 213 LEU LEU B . n 
D 2 214 ILE 214 214 214 ILE ILE B . n 
D 2 215 LYS 215 215 215 LYS LYS B . n 
D 2 216 LEU 216 216 216 LEU LEU B . n 
D 2 217 LEU 217 217 217 LEU LEU B . n 
D 2 218 GLU 218 218 218 GLU GLU B . n 
D 2 219 GLU 219 219 219 GLU GLU B . n 
D 2 220 SER 220 220 220 SER SER B . n 
D 2 221 GLU 221 221 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MG  1   501 501 MG  MG2 A . 
F 3 MG  1   502 502 MG  MG2 B . 
G 4 HOH 1   29  2   HOH HOH C . 
G 4 HOH 2   30  56  HOH HOH C . 
G 4 HOH 3   31  58  HOH HOH C . 
G 4 HOH 4   32  90  HOH HOH C . 
G 4 HOH 5   33  91  HOH HOH C . 
G 4 HOH 6   34  92  HOH HOH C . 
G 4 HOH 7   35  105 HOH HOH C . 
G 4 HOH 8   36  106 HOH HOH C . 
G 4 HOH 9   37  118 HOH HOH C . 
G 4 HOH 10  38  131 HOH HOH C . 
G 4 HOH 11  39  132 HOH HOH C . 
G 4 HOH 12  40  134 HOH HOH C . 
G 4 HOH 13  41  135 HOH HOH C . 
G 4 HOH 14  42  136 HOH HOH C . 
G 4 HOH 15  43  137 HOH HOH C . 
G 4 HOH 16  44  139 HOH HOH C . 
G 4 HOH 17  45  141 HOH HOH C . 
G 4 HOH 18  46  142 HOH HOH C . 
G 4 HOH 19  47  143 HOH HOH C . 
G 4 HOH 20  48  144 HOH HOH C . 
G 4 HOH 21  49  145 HOH HOH C . 
G 4 HOH 22  50  146 HOH HOH C . 
G 4 HOH 23  51  147 HOH HOH C . 
G 4 HOH 24  52  148 HOH HOH C . 
G 4 HOH 25  53  149 HOH HOH C . 
G 4 HOH 26  54  150 HOH HOH C . 
G 4 HOH 27  55  151 HOH HOH C . 
G 4 HOH 28  56  152 HOH HOH C . 
G 4 HOH 29  57  153 HOH HOH C . 
G 4 HOH 30  58  154 HOH HOH C . 
G 4 HOH 31  59  155 HOH HOH C . 
G 4 HOH 32  60  156 HOH HOH C . 
G 4 HOH 33  61  157 HOH HOH C . 
G 4 HOH 34  62  158 HOH HOH C . 
G 4 HOH 35  63  196 HOH HOH C . 
G 4 HOH 36  64  197 HOH HOH C . 
G 4 HOH 37  65  217 HOH HOH C . 
G 4 HOH 38  66  218 HOH HOH C . 
G 4 HOH 39  67  224 HOH HOH C . 
G 4 HOH 40  68  240 HOH HOH C . 
G 4 HOH 41  69  241 HOH HOH C . 
G 4 HOH 42  70  242 HOH HOH C . 
G 4 HOH 43  71  243 HOH HOH C . 
G 4 HOH 44  72  244 HOH HOH C . 
G 4 HOH 45  73  245 HOH HOH C . 
G 4 HOH 46  74  246 HOH HOH C . 
G 4 HOH 47  75  247 HOH HOH C . 
G 4 HOH 48  76  248 HOH HOH C . 
G 4 HOH 49  77  249 HOH HOH C . 
G 4 HOH 50  78  250 HOH HOH C . 
G 4 HOH 51  79  251 HOH HOH C . 
G 4 HOH 52  80  252 HOH HOH C . 
G 4 HOH 53  81  253 HOH HOH C . 
G 4 HOH 54  82  254 HOH HOH C . 
G 4 HOH 55  83  255 HOH HOH C . 
G 4 HOH 56  84  256 HOH HOH C . 
G 4 HOH 57  85  258 HOH HOH C . 
G 4 HOH 58  86  259 HOH HOH C . 
G 4 HOH 59  87  274 HOH HOH C . 
G 4 HOH 60  88  287 HOH HOH C . 
H 4 HOH 1   29  5   HOH HOH D . 
H 4 HOH 2   30  6   HOH HOH D . 
H 4 HOH 3   31  47  HOH HOH D . 
H 4 HOH 4   32  69  HOH HOH D . 
H 4 HOH 5   33  94  HOH HOH D . 
H 4 HOH 6   34  107 HOH HOH D . 
H 4 HOH 7   35  108 HOH HOH D . 
H 4 HOH 8   36  125 HOH HOH D . 
H 4 HOH 9   37  159 HOH HOH D . 
H 4 HOH 10  38  160 HOH HOH D . 
H 4 HOH 11  39  161 HOH HOH D . 
H 4 HOH 12  40  162 HOH HOH D . 
H 4 HOH 13  41  163 HOH HOH D . 
H 4 HOH 14  42  164 HOH HOH D . 
H 4 HOH 15  43  165 HOH HOH D . 
H 4 HOH 16  44  166 HOH HOH D . 
H 4 HOH 17  45  167 HOH HOH D . 
H 4 HOH 18  46  168 HOH HOH D . 
H 4 HOH 19  47  169 HOH HOH D . 
H 4 HOH 20  48  170 HOH HOH D . 
H 4 HOH 21  49  171 HOH HOH D . 
H 4 HOH 22  50  172 HOH HOH D . 
H 4 HOH 23  51  174 HOH HOH D . 
H 4 HOH 24  52  175 HOH HOH D . 
H 4 HOH 25  53  176 HOH HOH D . 
H 4 HOH 26  54  177 HOH HOH D . 
H 4 HOH 27  55  178 HOH HOH D . 
H 4 HOH 28  56  179 HOH HOH D . 
H 4 HOH 29  57  180 HOH HOH D . 
H 4 HOH 30  58  181 HOH HOH D . 
H 4 HOH 31  59  182 HOH HOH D . 
H 4 HOH 32  60  183 HOH HOH D . 
H 4 HOH 33  61  185 HOH HOH D . 
H 4 HOH 34  62  238 HOH HOH D . 
H 4 HOH 35  63  239 HOH HOH D . 
H 4 HOH 36  64  261 HOH HOH D . 
H 4 HOH 37  65  262 HOH HOH D . 
H 4 HOH 38  66  263 HOH HOH D . 
H 4 HOH 39  67  264 HOH HOH D . 
H 4 HOH 40  68  265 HOH HOH D . 
H 4 HOH 41  69  266 HOH HOH D . 
H 4 HOH 42  70  267 HOH HOH D . 
H 4 HOH 43  71  268 HOH HOH D . 
H 4 HOH 44  72  269 HOH HOH D . 
H 4 HOH 45  73  270 HOH HOH D . 
H 4 HOH 46  74  271 HOH HOH D . 
H 4 HOH 47  75  272 HOH HOH D . 
I 4 HOH 1   502 1   HOH HOH A . 
I 4 HOH 2   503 3   HOH HOH A . 
I 4 HOH 3   504 7   HOH HOH A . 
I 4 HOH 4   505 8   HOH HOH A . 
I 4 HOH 5   506 9   HOH HOH A . 
I 4 HOH 6   507 10  HOH HOH A . 
I 4 HOH 7   508 11  HOH HOH A . 
I 4 HOH 8   509 12  HOH HOH A . 
I 4 HOH 9   510 13  HOH HOH A . 
I 4 HOH 10  511 14  HOH HOH A . 
I 4 HOH 11  512 15  HOH HOH A . 
I 4 HOH 12  513 16  HOH HOH A . 
I 4 HOH 13  514 17  HOH HOH A . 
I 4 HOH 14  515 18  HOH HOH A . 
I 4 HOH 15  516 19  HOH HOH A . 
I 4 HOH 16  517 20  HOH HOH A . 
I 4 HOH 17  518 21  HOH HOH A . 
I 4 HOH 18  519 22  HOH HOH A . 
I 4 HOH 19  520 23  HOH HOH A . 
I 4 HOH 20  521 24  HOH HOH A . 
I 4 HOH 21  522 25  HOH HOH A . 
I 4 HOH 22  523 26  HOH HOH A . 
I 4 HOH 23  524 40  HOH HOH A . 
I 4 HOH 24  525 41  HOH HOH A . 
I 4 HOH 25  526 42  HOH HOH A . 
I 4 HOH 26  527 43  HOH HOH A . 
I 4 HOH 27  528 45  HOH HOH A . 
I 4 HOH 28  529 46  HOH HOH A . 
I 4 HOH 29  530 48  HOH HOH A . 
I 4 HOH 30  531 50  HOH HOH A . 
I 4 HOH 31  532 51  HOH HOH A . 
I 4 HOH 32  533 52  HOH HOH A . 
I 4 HOH 33  534 53  HOH HOH A . 
I 4 HOH 34  535 54  HOH HOH A . 
I 4 HOH 35  536 55  HOH HOH A . 
I 4 HOH 36  537 57  HOH HOH A . 
I 4 HOH 37  538 59  HOH HOH A . 
I 4 HOH 38  539 60  HOH HOH A . 
I 4 HOH 39  540 64  HOH HOH A . 
I 4 HOH 40  541 65  HOH HOH A . 
I 4 HOH 41  542 66  HOH HOH A . 
I 4 HOH 42  543 67  HOH HOH A . 
I 4 HOH 43  544 68  HOH HOH A . 
I 4 HOH 44  545 70  HOH HOH A . 
I 4 HOH 45  546 71  HOH HOH A . 
I 4 HOH 46  547 72  HOH HOH A . 
I 4 HOH 47  548 73  HOH HOH A . 
I 4 HOH 48  549 74  HOH HOH A . 
I 4 HOH 49  550 75  HOH HOH A . 
I 4 HOH 50  551 76  HOH HOH A . 
I 4 HOH 51  552 77  HOH HOH A . 
I 4 HOH 52  553 78  HOH HOH A . 
I 4 HOH 53  554 79  HOH HOH A . 
I 4 HOH 54  555 80  HOH HOH A . 
I 4 HOH 55  556 81  HOH HOH A . 
I 4 HOH 56  557 82  HOH HOH A . 
I 4 HOH 57  558 83  HOH HOH A . 
I 4 HOH 58  559 84  HOH HOH A . 
I 4 HOH 59  560 85  HOH HOH A . 
I 4 HOH 60  561 86  HOH HOH A . 
I 4 HOH 61  562 87  HOH HOH A . 
I 4 HOH 62  563 88  HOH HOH A . 
I 4 HOH 63  564 89  HOH HOH A . 
I 4 HOH 64  565 93  HOH HOH A . 
I 4 HOH 65  566 119 HOH HOH A . 
I 4 HOH 66  567 133 HOH HOH A . 
I 4 HOH 67  568 138 HOH HOH A . 
I 4 HOH 68  569 140 HOH HOH A . 
I 4 HOH 69  570 186 HOH HOH A . 
I 4 HOH 70  571 187 HOH HOH A . 
I 4 HOH 71  572 188 HOH HOH A . 
I 4 HOH 72  573 189 HOH HOH A . 
I 4 HOH 73  574 190 HOH HOH A . 
I 4 HOH 74  575 191 HOH HOH A . 
I 4 HOH 75  576 192 HOH HOH A . 
I 4 HOH 76  577 193 HOH HOH A . 
I 4 HOH 77  578 194 HOH HOH A . 
I 4 HOH 78  579 195 HOH HOH A . 
I 4 HOH 79  580 198 HOH HOH A . 
I 4 HOH 80  581 199 HOH HOH A . 
I 4 HOH 81  582 200 HOH HOH A . 
I 4 HOH 82  583 201 HOH HOH A . 
I 4 HOH 83  584 202 HOH HOH A . 
I 4 HOH 84  585 203 HOH HOH A . 
I 4 HOH 85  586 204 HOH HOH A . 
I 4 HOH 86  587 205 HOH HOH A . 
I 4 HOH 87  588 206 HOH HOH A . 
I 4 HOH 88  589 207 HOH HOH A . 
I 4 HOH 89  590 208 HOH HOH A . 
I 4 HOH 90  591 209 HOH HOH A . 
I 4 HOH 91  592 210 HOH HOH A . 
I 4 HOH 92  593 211 HOH HOH A . 
I 4 HOH 93  594 212 HOH HOH A . 
I 4 HOH 94  595 213 HOH HOH A . 
I 4 HOH 95  596 214 HOH HOH A . 
I 4 HOH 96  597 215 HOH HOH A . 
I 4 HOH 97  598 216 HOH HOH A . 
I 4 HOH 98  599 219 HOH HOH A . 
I 4 HOH 99  600 220 HOH HOH A . 
I 4 HOH 100 601 221 HOH HOH A . 
I 4 HOH 101 602 222 HOH HOH A . 
I 4 HOH 102 603 223 HOH HOH A . 
I 4 HOH 103 604 227 HOH HOH A . 
I 4 HOH 104 605 260 HOH HOH A . 
I 4 HOH 105 606 273 HOH HOH A . 
I 4 HOH 106 607 276 HOH HOH A . 
I 4 HOH 107 608 277 HOH HOH A . 
I 4 HOH 108 609 278 HOH HOH A . 
I 4 HOH 109 610 279 HOH HOH A . 
I 4 HOH 110 611 280 HOH HOH A . 
I 4 HOH 111 612 281 HOH HOH A . 
I 4 HOH 112 613 282 HOH HOH A . 
I 4 HOH 113 614 283 HOH HOH A . 
I 4 HOH 114 615 284 HOH HOH A . 
I 4 HOH 115 616 285 HOH HOH A . 
I 4 HOH 116 617 286 HOH HOH A . 
I 4 HOH 117 618 288 HOH HOH A . 
I 4 HOH 118 619 296 HOH HOH A . 
I 4 HOH 119 620 297 HOH HOH A . 
J 4 HOH 1   503 4   HOH HOH B . 
J 4 HOH 2   504 27  HOH HOH B . 
J 4 HOH 3   505 28  HOH HOH B . 
J 4 HOH 4   506 29  HOH HOH B . 
J 4 HOH 5   507 30  HOH HOH B . 
J 4 HOH 6   508 31  HOH HOH B . 
J 4 HOH 7   509 32  HOH HOH B . 
J 4 HOH 8   510 33  HOH HOH B . 
J 4 HOH 9   511 34  HOH HOH B . 
J 4 HOH 10  512 35  HOH HOH B . 
J 4 HOH 11  513 36  HOH HOH B . 
J 4 HOH 12  514 37  HOH HOH B . 
J 4 HOH 13  515 38  HOH HOH B . 
J 4 HOH 14  516 39  HOH HOH B . 
J 4 HOH 15  517 44  HOH HOH B . 
J 4 HOH 16  518 49  HOH HOH B . 
J 4 HOH 17  519 61  HOH HOH B . 
J 4 HOH 18  520 62  HOH HOH B . 
J 4 HOH 19  521 63  HOH HOH B . 
J 4 HOH 20  522 95  HOH HOH B . 
J 4 HOH 21  523 96  HOH HOH B . 
J 4 HOH 22  524 97  HOH HOH B . 
J 4 HOH 23  525 98  HOH HOH B . 
J 4 HOH 24  526 99  HOH HOH B . 
J 4 HOH 25  527 100 HOH HOH B . 
J 4 HOH 26  528 101 HOH HOH B . 
J 4 HOH 27  529 102 HOH HOH B . 
J 4 HOH 28  530 103 HOH HOH B . 
J 4 HOH 29  531 104 HOH HOH B . 
J 4 HOH 30  532 109 HOH HOH B . 
J 4 HOH 31  533 110 HOH HOH B . 
J 4 HOH 32  534 111 HOH HOH B . 
J 4 HOH 33  535 112 HOH HOH B . 
J 4 HOH 34  536 113 HOH HOH B . 
J 4 HOH 35  537 114 HOH HOH B . 
J 4 HOH 36  538 115 HOH HOH B . 
J 4 HOH 37  539 116 HOH HOH B . 
J 4 HOH 38  540 117 HOH HOH B . 
J 4 HOH 39  541 120 HOH HOH B . 
J 4 HOH 40  542 121 HOH HOH B . 
J 4 HOH 41  543 122 HOH HOH B . 
J 4 HOH 42  544 123 HOH HOH B . 
J 4 HOH 43  545 124 HOH HOH B . 
J 4 HOH 44  546 126 HOH HOH B . 
J 4 HOH 45  547 127 HOH HOH B . 
J 4 HOH 46  548 128 HOH HOH B . 
J 4 HOH 47  549 129 HOH HOH B . 
J 4 HOH 48  550 130 HOH HOH B . 
J 4 HOH 49  551 173 HOH HOH B . 
J 4 HOH 50  552 184 HOH HOH B . 
J 4 HOH 51  553 225 HOH HOH B . 
J 4 HOH 52  554 226 HOH HOH B . 
J 4 HOH 53  555 228 HOH HOH B . 
J 4 HOH 54  556 229 HOH HOH B . 
J 4 HOH 55  557 230 HOH HOH B . 
J 4 HOH 56  558 231 HOH HOH B . 
J 4 HOH 57  559 232 HOH HOH B . 
J 4 HOH 58  560 233 HOH HOH B . 
J 4 HOH 59  561 234 HOH HOH B . 
J 4 HOH 60  562 235 HOH HOH B . 
J 4 HOH 61  563 236 HOH HOH B . 
J 4 HOH 62  564 237 HOH HOH B . 
J 4 HOH 63  565 257 HOH HOH B . 
J 4 HOH 64  566 275 HOH HOH B . 
J 4 HOH 65  567 289 HOH HOH B . 
J 4 HOH 66  568 290 HOH HOH B . 
J 4 HOH 67  569 291 HOH HOH B . 
J 4 HOH 68  570 292 HOH HOH B . 
J 4 HOH 69  571 293 HOH HOH B . 
J 4 HOH 70  572 294 HOH HOH B . 
J 4 HOH 71  573 295 HOH HOH B . 
J 4 HOH 72  574 298 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? G HOH .   ? C HOH 29  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OE2 ? C GLU 40  ? A GLU 40  ? 1_555 86.9  ? 
2  O   ? G HOH .   ? C HOH 29  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD1 ? C ASP 107 ? A ASP 107 ? 1_555 85.8  ? 
3  OE2 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD1 ? C ASP 107 ? A ASP 107 ? 1_555 80.5  ? 
4  O   ? G HOH .   ? C HOH 29  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OE1 ? C GLU 110 ? A GLU 110 ? 1_555 172.7 ? 
5  OE2 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OE1 ? C GLU 110 ? A GLU 110 ? 1_555 86.2  ? 
6  OD1 ? C ASP 107 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OE1 ? C GLU 110 ? A GLU 110 ? 1_555 91.1  ? 
7  O   ? G HOH .   ? C HOH 29  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 502 ? 1_555 93.1  ? 
8  OE2 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 502 ? 1_555 113.1 ? 
9  OD1 ? C ASP 107 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 502 ? 1_555 166.3 ? 
10 OE1 ? C GLU 110 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 502 ? 1_555 91.5  ? 
11 O   ? G HOH .   ? C HOH 29  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 503 ? 1_555 97.3  ? 
12 OE2 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 503 ? 1_555 168.4 ? 
13 OD1 ? C ASP 107 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 503 ? 1_555 88.9  ? 
14 OE1 ? C GLU 110 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 503 ? 1_555 89.2  ? 
15 O   ? I HOH .   ? A HOH 502 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? I HOH .   ? A HOH 503 ? 1_555 77.6  ? 
16 O   ? H HOH .   ? D HOH 29  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 O   ? H HOH .   ? D HOH 30  ? 1_555 94.2  ? 
17 O   ? H HOH .   ? D HOH 29  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OE2 ? D GLU 40  ? B GLU 40  ? 1_555 101.7 ? 
18 O   ? H HOH .   ? D HOH 30  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OE2 ? D GLU 40  ? B GLU 40  ? 1_555 91.2  ? 
19 O   ? H HOH .   ? D HOH 29  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 170.4 ? 
20 O   ? H HOH .   ? D HOH 30  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 88.5  ? 
21 OE2 ? D GLU 40  ? B GLU 40  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 87.5  ? 
22 O   ? H HOH .   ? D HOH 29  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OE1 ? D GLU 110 ? B GLU 110 ? 1_555 90.5  ? 
23 O   ? H HOH .   ? D HOH 30  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OE1 ? D GLU 110 ? B GLU 110 ? 1_555 175.3 ? 
24 OE2 ? D GLU 40  ? B GLU 40  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OE1 ? D GLU 110 ? B GLU 110 ? 1_555 87.8  ? 
25 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 OE1 ? D GLU 110 ? B GLU 110 ? 1_555 86.9  ? 
26 O   ? H HOH .   ? D HOH 29  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 O   ? J HOH .   ? B HOH 503 ? 1_555 90.4  ? 
27 O   ? H HOH .   ? D HOH 30  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 O   ? J HOH .   ? B HOH 503 ? 1_555 99.1  ? 
28 OE2 ? D GLU 40  ? B GLU 40  ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 O   ? J HOH .   ? B HOH 503 ? 1_555 163.5 ? 
29 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 O   ? J HOH .   ? B HOH 503 ? 1_555 80.1  ? 
30 OE1 ? D GLU 110 ? B GLU 110 ? 1_555 MG ? F MG . ? B MG 502 ? 1_555 O   ? J HOH .   ? B HOH 503 ? 1_555 80.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-07 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 4 'Structure model' '_pdbx_struct_conn_angle.value'               
18 4 'Structure model' '_struct_conn.pdbx_dist_value'                
19 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
27 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
28 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
29 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
30 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
32 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
33 4 'Structure model' '_struct_ref_seq_dif.details'                 
34 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
35 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
36 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
PHASES    phasing          .   ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P C A 1 ? ? OP3 C A 1 ? ? 1.520 1.607 -0.087 0.012 N 
2 1 P D A 1 ? ? OP3 D A 1 ? ? 1.520 1.607 -0.087 0.012 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 96  ? ? -115.92 -70.14  
2 1 ARG A 97  ? ? -69.61  82.34   
3 1 ILE A 100 ? ? -66.61  92.69   
4 1 LYS A 181 ? ? -168.52 74.69   
5 1 LYS A 191 ? ? 55.06   -127.26 
6 1 LYS B 96  ? ? -124.48 -72.40  
7 1 ILE B 100 ? ? -67.35  76.04   
8 1 LYS B 181 ? ? -157.41 75.60   
9 1 LYS B 191 ? ? 59.96   -107.40 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 G C 12 ? ? 0.057 'SIDE CHAIN' 
2 1 G D 12 ? ? 0.062 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? C MET 1   
2 1 Y 1 A LYS 2   ? C LYS 2   
3 1 Y 1 A GLU 221 ? C GLU 221 
4 1 Y 1 B MET 1   ? D MET 1   
5 1 Y 1 B LYS 2   ? D LYS 2   
6 1 Y 1 B GLU 221 ? D GLU 221 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2EZ6 'a-form double helix'  
2EZ6 tetraloop              
2EZ6 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A A 15 1_555 A G 12 1_555 -6.914 -5.288 0.569  -16.949 3.463   -12.221 1  C_A15:G12_C C 15 ? C 12 ? ?  ? 
1 A G 16 1_555 A C 11 1_555 0.042  -0.142 -0.105 -4.844  9.148   4.067   2  C_G16:C11_C C 16 ? C 11 ? 19 1 
1 A A 17 1_555 A U 10 1_555 -0.340 -0.373 -0.015 2.318   -8.480  1.198   3  C_A17:U10_C C 17 ? C 10 ? 20 1 
1 A G 18 1_555 A U 9  1_555 -1.980 -0.466 0.269  2.505   -12.849 1.184   4  C_G18:U9_C  C 18 ? C 9  ? 28 1 
1 A U 19 1_555 A A 8  1_555 -0.030 -0.203 0.004  1.477   -13.694 0.466   5  C_U19:A8_C  C 19 ? C 8  ? 20 1 
1 A G 20 1_555 A C 7  1_555 -0.152 -0.267 -0.106 -4.425  -8.098  -2.158  6  C_G20:C7_C  C 20 ? C 7  ? 19 1 
1 A G 21 1_555 A U 6  1_555 -2.356 -0.578 -0.067 -0.762  -5.585  -0.608  7  C_G21:U6_C  C 21 ? C 6  ? 28 ? 
1 A C 22 1_555 A G 5  1_555 0.264  -0.213 0.053  -1.758  -7.821  1.468   8  C_C22:G5_C  C 22 ? C 5  ? 19 1 
1 A C 23 1_555 A G 4  1_555 0.455  -0.138 -0.129 -2.904  -7.461  1.075   9  C_C23:G4_C  C 23 ? C 4  ? 19 1 
1 A U 24 1_555 A A 3  1_555 0.251  -0.171 0.008  6.193   -1.162  3.556   10 C_U24:A3_C  C 24 ? C 3  ? 20 1 
1 A U 25 1_555 A A 2  1_555 -0.117 -0.107 -0.301 0.217   -9.629  -2.256  11 C_U25:A2_C  C 25 ? C 2  ? 20 1 
1 A U 26 1_555 A A 1  1_555 -0.224 -0.156 0.148  -4.115  -1.554  5.165   12 C_U26:A1_C  C 26 ? C 1  ? 20 1 
1 A A 27 1_555 B U 28 1_555 0.089  -0.193 0.133  -3.246  -9.251  -0.398  13 C_A27:U28_D C 27 ? D 28 ? 20 1 
1 A U 28 1_555 B A 27 1_555 0.036  -0.237 0.087  0.849   -9.316  0.162   14 C_U28:A27_D C 28 ? D 27 ? 20 1 
1 B A 1  1_555 B U 26 1_555 0.282  -0.002 0.065  -2.021  -3.432  7.250   15 D_A1:U26_D  D 1  ? D 26 ? 20 1 
1 B A 2  1_555 B U 25 1_555 0.233  -0.084 -0.142 0.438   -7.516  -1.499  16 D_A2:U25_D  D 2  ? D 25 ? 20 1 
1 B A 3  1_555 B U 24 1_555 -0.267 -0.186 0.021  -1.839  -5.990  4.116   17 D_A3:U24_D  D 3  ? D 24 ? 20 1 
1 B G 4  1_555 B C 23 1_555 -0.230 -0.094 -0.117 -0.405  -7.601  -0.150  18 D_G4:C23_D  D 4  ? D 23 ? 19 1 
1 B G 5  1_555 B C 22 1_555 -0.326 -0.146 -0.115 0.280   -3.781  -0.998  19 D_G5:C22_D  D 5  ? D 22 ? 19 1 
1 B U 6  1_555 B G 21 1_555 2.230  -0.511 -0.209 2.429   -8.231  3.609   20 D_U6:G21_D  D 6  ? D 21 ? 28 1 
1 B C 7  1_555 B G 20 1_555 0.354  -0.275 -0.027 5.933   -9.867  2.162   21 D_C7:G20_D  D 7  ? D 20 ? 19 1 
1 B A 8  1_555 B U 19 1_555 0.113  -0.103 0.070  -1.628  -12.464 2.716   22 D_A8:U19_D  D 8  ? D 19 ? 20 1 
1 B U 9  1_555 B G 18 1_555 2.181  -0.607 0.286  -2.551  -9.265  1.314   23 D_U9:G18_D  D 9  ? D 18 ? 28 1 
1 B U 10 1_555 B A 17 1_555 -0.067 -0.141 -0.256 4.266   -7.252  4.124   24 D_U10:A17_D D 10 ? D 17 ? 20 1 
1 B C 11 1_555 B G 16 1_555 0.254  -0.155 -0.199 6.070   9.695   2.611   25 D_C11:G16_D D 11 ? D 16 ? 19 1 
1 B G 12 1_555 B A 15 1_555 6.832  -5.134 0.726  19.128  6.899   -9.680  26 D_G12:A15_D D 12 ? D 15 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A A 15 1_555 A G 12 1_555 A G 16 1_555 A C 11 1_555 1.547  -1.046 2.885 3.193  4.610  50.747 -1.496 -1.600 2.872 5.361  -3.712  
51.036 1  CC_A15G16:C11G12_CC C 15 ? C 12 ? C 16 ? C 11 ? 
1 A G 16 1_555 A C 11 1_555 A A 17 1_555 A U 10 1_555 0.096  -2.037 3.298 2.768  1.732  25.240 -5.117 0.568  3.145 3.943  -6.300  
25.447 2  CC_G16A17:U10C11_CC C 16 ? C 11 ? C 17 ? C 10 ? 
1 A A 17 1_555 A U 10 1_555 A G 18 1_555 A U 9  1_555 0.025  -1.997 3.024 -4.081 7.791  26.861 -5.617 -0.850 2.335 16.228 8.501   
28.239 3  CC_A17G18:U9U10_CC  C 17 ? C 10 ? C 18 ? C 9  ? 
1 A G 18 1_555 A U 9  1_555 A U 19 1_555 A A 8  1_555 -0.128 -1.347 3.296 0.613  5.322  38.261 -2.680 0.267  3.086 8.072  -0.930  
38.620 4  CC_G18U19:A8U9_CC   C 18 ? C 9  ? C 19 ? C 8  ? 
1 A U 19 1_555 A A 8  1_555 A G 20 1_555 A C 7  1_555 -0.275 -1.652 3.243 -0.205 13.521 30.512 -4.888 0.449  2.325 24.251 0.367   
33.309 5  CC_U19G20:C7A8_CC   C 19 ? C 8  ? C 20 ? C 7  ? 
1 A G 20 1_555 A C 7  1_555 A G 21 1_555 A U 6  1_555 0.443  -2.145 2.918 -3.552 10.796 24.967 -6.538 -1.596 1.775 23.481 7.725   
27.395 6  CC_G20G21:U6C7_CC   C 20 ? C 7  ? C 21 ? C 6  ? 
1 A G 21 1_555 A U 6  1_555 A C 22 1_555 A G 5  1_555 -0.066 -1.684 3.395 -0.842 3.032  39.106 -2.878 -0.004 3.261 4.520  1.255   
39.227 7  CC_G21C22:G5U6_CC   C 21 ? C 6  ? C 22 ? C 5  ? 
1 A C 22 1_555 A G 5  1_555 A C 23 1_555 A G 4  1_555 -0.185 -1.771 3.278 1.510  7.342  32.525 -4.235 0.559  2.811 12.895 -2.652  
33.355 8  CC_C22C23:G4G5_CC   C 22 ? C 5  ? C 23 ? C 4  ? 
1 A C 23 1_555 A G 4  1_555 A U 24 1_555 A A 3  1_555 0.464  -1.707 3.122 -1.949 6.599  27.762 -4.791 -1.333 2.617 13.492 3.985   
28.586 9  CC_C23U24:A3G4_CC   C 23 ? C 4  ? C 24 ? C 3  ? 
1 A U 24 1_555 A A 3  1_555 A U 25 1_555 A A 2  1_555 -0.312 -1.880 3.459 2.251  4.897  32.543 -4.155 0.938  3.123 8.664  -3.983  
32.974 10 CC_U24U25:A2A3_CC   C 24 ? C 3  ? C 25 ? C 2  ? 
1 A U 25 1_555 A A 2  1_555 A U 26 1_555 A A 1  1_555 0.415  -1.685 3.480 -2.969 6.272  27.642 -4.862 -1.524 2.973 12.872 6.093   
28.484 11 CC_U25U26:A1A2_CC   C 25 ? C 2  ? C 26 ? C 1  ? 
1 A U 26 1_555 A A 1  1_555 A A 27 1_555 B U 28 1_555 0.310  -1.229 3.252 0.705  8.933  39.128 -2.766 -0.375 2.918 13.129 -1.036  
40.101 12 CC_U26A27:U28A1_DC  C 26 ? C 1  ? C 27 ? D 28 ? 
1 A A 27 1_555 B U 28 1_555 A U 28 1_555 B A 27 1_555 -0.022 -1.153 3.363 0.358  9.774  30.807 -3.768 0.103  2.872 17.844 -0.654  
32.286 13 CC_A27U28:A27U28_DD C 27 ? D 28 ? C 28 ? D 27 ? 
1 A U 28 1_555 B A 27 1_555 B A 1  1_555 B U 26 1_555 -0.408 -1.021 3.328 -1.533 9.258  39.675 -2.477 0.419  3.038 13.414 2.221   
40.726 14 CD_U28A1:U26A27_DD  C 28 ? D 27 ? D 1  ? D 26 ? 
1 B A 1  1_555 B U 26 1_555 B A 2  1_555 B U 25 1_555 -0.503 -1.604 3.257 1.681  4.066  26.490 -4.455 1.496  2.945 8.795  -3.635  
26.847 15 DD_A1A2:U25U26_DD   D 1  ? D 26 ? D 2  ? D 25 ? 
1 B A 2  1_555 B U 25 1_555 B A 3  1_555 B U 24 1_555 0.430  -1.860 3.320 -0.075 6.018  32.980 -4.181 -0.757 2.944 10.492 0.131   
33.510 16 DD_A2A3:U24U25_DD   D 2  ? D 25 ? D 3  ? D 24 ? 
1 B A 3  1_555 B U 24 1_555 B G 4  1_555 B C 23 1_555 -0.651 -1.677 3.283 0.741  8.316  27.533 -5.110 1.466  2.655 16.984 -1.514  
28.747 17 DD_A3G4:C23U24_DD   D 3  ? D 24 ? D 4  ? D 23 ? 
1 B G 4  1_555 B C 23 1_555 B G 5  1_555 B C 22 1_555 0.029  -1.778 3.301 -1.495 6.119  31.675 -4.240 -0.306 2.911 11.073 2.705   
32.279 18 DD_G4G5:C22C23_DD   D 4  ? D 23 ? D 5  ? D 22 ? 
1 B G 5  1_555 B C 22 1_555 B U 6  1_555 B G 21 1_555 0.219  -1.530 3.273 1.786  3.824  39.792 -2.667 -0.119 3.125 5.598  -2.616  
40.006 19 DD_G5U6:G21C22_DD   D 5  ? D 22 ? D 6  ? D 21 ? 
1 B U 6  1_555 B G 21 1_555 B C 7  1_555 B G 20 1_555 -0.459 -2.035 2.970 1.950  11.857 25.750 -6.260 1.284  1.833 24.948 -4.102  
28.373 20 DD_U6C7:G20G21_DD   D 6  ? D 21 ? D 7  ? D 20 ? 
1 B C 7  1_555 B G 20 1_555 B A 8  1_555 B U 19 1_555 0.169  -1.582 3.251 -0.098 13.054 30.067 -4.835 -0.315 2.377 23.802 0.178   
32.719 21 DD_C7A8:U19G20_DD   D 7  ? D 20 ? D 8  ? D 19 ? 
1 B A 8  1_555 B U 19 1_555 B U 9  1_555 B G 18 1_555 0.002  -1.289 3.287 -1.612 5.935  40.772 -2.457 -0.172 3.076 8.461  2.299   
41.214 22 DD_A8U9:G18U19_DD   D 8  ? D 19 ? D 9  ? D 18 ? 
1 B U 9  1_555 B G 18 1_555 B U 10 1_555 B A 17 1_555 0.066  -1.882 2.815 6.940  5.926  23.943 -5.586 1.420  2.224 13.665 -16.004 
25.599 23 DD_U9U10:A17G18_DD  D 9  ? D 18 ? D 10 ? D 17 ? 
1 B U 10 1_555 B A 17 1_555 B C 11 1_555 B G 16 1_555 -0.033 -1.798 3.404 -2.227 7.482  28.321 -5.112 -0.401 2.840 14.936 4.446   
29.356 24 DD_U10C11:G16A17_DD D 10 ? D 17 ? D 11 ? D 16 ? 
1 B C 11 1_555 B G 16 1_555 B G 12 1_555 B A 15 1_555 -1.387 -1.170 2.822 -3.795 7.426  50.250 -1.804 1.388  2.726 8.676  4.433   
50.893 25 DD_C11G12:A15G16_DD D 11 ? D 16 ? D 12 ? D 15 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION' MG  
4 water           HOH 
#