data_2F5O
# 
_entry.id   2F5O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2F5O         
NDB   PD0750       
RCSB  RCSB035481   
WWPDB D_1000035481 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2F5N . unspecified 
PDB 1L1T . unspecified 
PDB 1R2Y . unspecified 
PDB 2F5P . unspecified 
PDB 2F5Q . unspecified 
PDB 2F5S . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2F5O 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banerjee, A.'  1 
'Santos, W.L.'  2 
'Verdine, G.L.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structure of a DNA glycosylase searching for lesions.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            311 
_citation.page_first                1153 
_citation.page_last                 1157 
_citation.year                      2006 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16497933 
_citation.pdbx_database_id_DOI      10.1126/science.1120288 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Banerjee, A.'  1 
primary 'Santos, W.L.'  2 
primary 'Verdine, G.L.' 3 
# 
_cell.entry_id           2F5O 
_cell.length_a           45.543 
_cell.length_b           93.253 
_cell.length_c           105.257 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2F5O 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*GP*GP*TP*AP*GP*AP*TP*CP*CP*GP*GP*AP*CP*GP*C)-3'" 4948.217  1   ?        ?     ? ? 
2 polymer     syn "5'-D(*TP*GP*C*GP*TP*CP*CP*GP*GP*AP*TP*CP*TP*AP*CP*C)-3'"  4850.141  1   ?        ?     ? ? 
3 polymer     man 'formamidopyrimidine-DNA glycosidase'                      30714.521 1   3.2.2.23 Q166C ? ? 
4 non-polymer syn 'ZINC ION'                                                 65.409    1   ?        ?     ? ? 
5 non-polymer syn GLYCEROL                                                   92.094    1   ?        ?     ? ? 
6 water       nat water                                                      18.015    142 ?        ?     ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        MutM 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DG)(DG)(DT)(DA)(DG)(DA)(DT)(DC)(DC)(DG)(DG)(DA)(DC)(DG)(DC)' AGGTAGATCCGGACGC B ? 
2 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DT)(DC)(DC)(DG)(DG)(DA)(DT)(DC)(DT)(DA)(DC)(DC)' TGCGTCCGGATCTACC C ? 
3 'polypeptide(L)'        no no 
;MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
;MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DG  n 
1 4   DT  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DG  n 
1 12  DG  n 
1 13  DA  n 
1 14  DC  n 
1 15  DG  n 
1 16  DC  n 
2 1   DT  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DC  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DC  n 
2 13  DT  n 
2 14  DA  n 
2 15  DC  n 
2 16  DC  n 
3 1   MET n 
3 2   PRO n 
3 3   GLU n 
3 4   LEU n 
3 5   PRO n 
3 6   GLU n 
3 7   VAL n 
3 8   GLU n 
3 9   THR n 
3 10  ILE n 
3 11  ARG n 
3 12  ARG n 
3 13  THR n 
3 14  LEU n 
3 15  LEU n 
3 16  PRO n 
3 17  LEU n 
3 18  ILE n 
3 19  VAL n 
3 20  GLY n 
3 21  LYS n 
3 22  THR n 
3 23  ILE n 
3 24  GLU n 
3 25  ASP n 
3 26  VAL n 
3 27  ARG n 
3 28  ILE n 
3 29  PHE n 
3 30  TRP n 
3 31  PRO n 
3 32  ASN n 
3 33  ILE n 
3 34  ILE n 
3 35  ARG n 
3 36  HIS n 
3 37  PRO n 
3 38  ARG n 
3 39  ASP n 
3 40  SER n 
3 41  GLU n 
3 42  ALA n 
3 43  PHE n 
3 44  ALA n 
3 45  ALA n 
3 46  ARG n 
3 47  MET n 
3 48  ILE n 
3 49  GLY n 
3 50  GLN n 
3 51  THR n 
3 52  VAL n 
3 53  ARG n 
3 54  GLY n 
3 55  LEU n 
3 56  GLU n 
3 57  ARG n 
3 58  ARG n 
3 59  GLY n 
3 60  LYS n 
3 61  PHE n 
3 62  LEU n 
3 63  LYS n 
3 64  PHE n 
3 65  LEU n 
3 66  LEU n 
3 67  ASP n 
3 68  ARG n 
3 69  ASP n 
3 70  ALA n 
3 71  LEU n 
3 72  ILE n 
3 73  SER n 
3 74  HIS n 
3 75  LEU n 
3 76  ARG n 
3 77  MET n 
3 78  GLU n 
3 79  GLY n 
3 80  ARG n 
3 81  TYR n 
3 82  ALA n 
3 83  VAL n 
3 84  ALA n 
3 85  SER n 
3 86  ALA n 
3 87  LEU n 
3 88  GLU n 
3 89  PRO n 
3 90  LEU n 
3 91  GLU n 
3 92  PRO n 
3 93  HIS n 
3 94  THR n 
3 95  HIS n 
3 96  VAL n 
3 97  VAL n 
3 98  PHE n 
3 99  CYS n 
3 100 PHE n 
3 101 THR n 
3 102 ASP n 
3 103 GLY n 
3 104 SER n 
3 105 GLU n 
3 106 LEU n 
3 107 ARG n 
3 108 TYR n 
3 109 ARG n 
3 110 ASP n 
3 111 VAL n 
3 112 ARG n 
3 113 LYS n 
3 114 PHE n 
3 115 GLY n 
3 116 THR n 
3 117 MET n 
3 118 HIS n 
3 119 VAL n 
3 120 TYR n 
3 121 ALA n 
3 122 LYS n 
3 123 GLU n 
3 124 GLU n 
3 125 ALA n 
3 126 ASP n 
3 127 ARG n 
3 128 ARG n 
3 129 PRO n 
3 130 PRO n 
3 131 LEU n 
3 132 ALA n 
3 133 GLU n 
3 134 LEU n 
3 135 GLY n 
3 136 PRO n 
3 137 GLU n 
3 138 PRO n 
3 139 LEU n 
3 140 SER n 
3 141 PRO n 
3 142 ALA n 
3 143 PHE n 
3 144 SER n 
3 145 PRO n 
3 146 ALA n 
3 147 VAL n 
3 148 LEU n 
3 149 ALA n 
3 150 GLU n 
3 151 ARG n 
3 152 ALA n 
3 153 VAL n 
3 154 LYS n 
3 155 THR n 
3 156 LYS n 
3 157 ARG n 
3 158 SER n 
3 159 VAL n 
3 160 LYS n 
3 161 ALA n 
3 162 LEU n 
3 163 LEU n 
3 164 LEU n 
3 165 ASP n 
3 166 CYS n 
3 167 THR n 
3 168 VAL n 
3 169 VAL n 
3 170 ALA n 
3 171 GLY n 
3 172 PHE n 
3 173 GLY n 
3 174 ASN n 
3 175 ILE n 
3 176 TYR n 
3 177 VAL n 
3 178 ASP n 
3 179 GLU n 
3 180 SER n 
3 181 LEU n 
3 182 PHE n 
3 183 ARG n 
3 184 ALA n 
3 185 GLY n 
3 186 ILE n 
3 187 LEU n 
3 188 PRO n 
3 189 GLY n 
3 190 ARG n 
3 191 PRO n 
3 192 ALA n 
3 193 ALA n 
3 194 SER n 
3 195 LEU n 
3 196 SER n 
3 197 SER n 
3 198 LYS n 
3 199 GLU n 
3 200 ILE n 
3 201 GLU n 
3 202 ARG n 
3 203 LEU n 
3 204 HIS n 
3 205 GLU n 
3 206 GLU n 
3 207 MET n 
3 208 VAL n 
3 209 ALA n 
3 210 THR n 
3 211 ILE n 
3 212 GLY n 
3 213 GLU n 
3 214 ALA n 
3 215 VAL n 
3 216 MET n 
3 217 LYS n 
3 218 GLY n 
3 219 GLY n 
3 220 SER n 
3 221 THR n 
3 222 VAL n 
3 223 ARG n 
3 224 THR n 
3 225 TYR n 
3 226 VAL n 
3 227 ASN n 
3 228 THR n 
3 229 GLN n 
3 230 GLY n 
3 231 GLU n 
3 232 ALA n 
3 233 GLY n 
3 234 THR n 
3 235 PHE n 
3 236 GLN n 
3 237 HIS n 
3 238 HIS n 
3 239 LEU n 
3 240 TYR n 
3 241 VAL n 
3 242 TYR n 
3 243 GLY n 
3 244 ARG n 
3 245 GLN n 
3 246 GLY n 
3 247 ASN n 
3 248 PRO n 
3 249 CYS n 
3 250 LYS n 
3 251 ARG n 
3 252 CYS n 
3 253 GLY n 
3 254 THR n 
3 255 PRO n 
3 256 ILE n 
3 257 GLU n 
3 258 LYS n 
3 259 THR n 
3 260 VAL n 
3 261 VAL n 
3 262 ALA n 
3 263 GLY n 
3 264 ARG n 
3 265 GLY n 
3 266 THR n 
3 267 HIS n 
3 268 TYR n 
3 269 CYS n 
3 270 PRO n 
3 271 ARG n 
3 272 CYS n 
3 273 GLN n 
3 274 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21 pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       Pet24b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'synthetic DNA'                                                            
2 1 sample ? ? ? ? ? 'synthetic DNA with a backbone modification containiing a dsulfide linker' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP P84131_BACST P84131 3 1 ? ? 
2 PDB 2F5O         2F5O   1 ? ? ? 
3 PDB 2F5O         2F5O   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2F5O A 1 ? 274 ? P84131 1 ? 274 ? 1 274 
2 2 2F5O B 1 ? 16  ? 2F5O   1 ? 16  ? 1 16  
3 3 2F5O C 1 ? 16  ? 2F5O   0 ? 15  ? 0 15  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2F5O 
_struct_ref_seq_dif.mon_id                       CYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      166 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P84131 
_struct_ref_seq_dif.db_mon_id                    GLN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          166 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            166 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                               'Zn 2'            65.409  
# 
_exptl.entry_id          2F5O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_percent_sol   54.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 77K, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-09-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.976 
# 
_reflns.entry_id                     2F5O 
_reflns.observed_criterion_sigma_I   .0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   26907 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.9 
_reflns.pdbx_Rmerge_I_obs            0.125 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.5 
_reflns.B_iso_Wilson_estimate        13.4 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.percent_possible_all   89.4 
_reflns_shell.Rmerge_I_obs           0.514 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2544 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2F5O 
_refine.ls_number_reflns_obs                     25621 
_refine.ls_number_reflns_all                     28918 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          .0 
_refine.pdbx_data_cutoff_high_absF               101313.11 
_refine.pdbx_data_cutoff_low_absF                .000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.63 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    88.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.225 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_R_factor_R_free                       0.24 
_refine.ls_R_factor_R_free_error                 .007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1238 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               35.6 
_refine.aniso_B[1][1]                            -1.17 
_refine.aniso_B[2][2]                            2.19 
_refine.aniso_B[3][3]                            -1.01 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .354177 
_refine.solvent_model_param_bsol                 49.9074 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1R2Y' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2F5O 
_refine_analyze.Luzzati_coordinate_error_obs    .23 
_refine_analyze.Luzzati_sigma_a_obs             .16 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   .29 
_refine_analyze.Luzzati_sigma_a_free            .22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1960 
_refine_hist.pdbx_number_atoms_nucleic_acid   548 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             142 
_refine_hist.number_atoms_total               2657 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        42.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                .017 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.7 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.25 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.04 1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.71 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.17 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.44 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.14 
_refine_ls_shell.number_reflns_R_work             3663 
_refine_ls_shell.R_factor_R_work                  0.24 
_refine_ls_shell.percent_reflns_obs               80.3 
_refine_ls_shell.R_factor_R_free                  0.272 
_refine_ls_shell.R_factor_R_free_error            .023 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2864 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         gol_top.txt 'X-RAY DIFFRACTION' 
5 gol_par.txt       ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2F5O 
_struct.title                     'MutM crosslinked to undamaged DNA sampling G:C base pair IC3' 
_struct.pdbx_descriptor           'formamidopyrimidine-DNA glycosidase (E.C.3.2.2.23)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2F5O 
_struct_keywords.pdbx_keywords   hydrolase/DNA 
_struct_keywords.text            'disulfide crosslink, DNA glycosylase, DNA repair, damage search, hydrolase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU C 3   ? VAL C 19  ? GLU A 3   VAL A 19  1 ? 17 
HELX_P HELX_P2 2 TRP C 30  ? ASN C 32  ? TRP A 30  ASN A 32  5 ? 3  
HELX_P HELX_P3 3 ASP C 39  ? ILE C 48  ? ASP A 39  ILE A 48  1 ? 10 
HELX_P HELX_P4 4 GLU C 123 ? ARG C 128 ? GLU A 123 ARG A 128 5 ? 6  
HELX_P HELX_P5 5 SER C 144 ? LYS C 154 ? SER A 144 LYS A 154 1 ? 11 
HELX_P HELX_P6 6 SER C 158 ? ASP C 165 ? SER A 158 ASP A 165 1 ? 8  
HELX_P HELX_P7 7 GLY C 173 ? GLY C 185 ? GLY A 173 GLY A 185 1 ? 13 
HELX_P HELX_P8 8 PRO C 191 ? LEU C 195 ? PRO A 191 LEU A 195 5 ? 5  
HELX_P HELX_P9 9 SER C 196 ? MET C 216 ? SER A 196 MET A 216 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 272 SG ? ? A ZN 300 A CYS 272 1_555 ? ? ? ? ? ? ?            2.733 ? 
metalc2  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 249 SG ? ? A ZN 300 A CYS 249 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc3  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 252 SG ? ? A ZN 300 A CYS 252 1_555 ? ? ? ? ? ? ?            2.388 ? 
metalc4  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 269 SG ? ? A ZN 300 A CYS 269 1_555 ? ? ? ? ? ? ?            2.304 ? 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC  16  N3 ? ? B DG 2   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC  16  O2 ? ? B DG 2   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC  16  N4 ? ? B DG 2   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC  15  N3 ? ? B DG 3   C DC  14  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog5  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA  14  N1 ? ? B DT 4   C DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA  14  N6 ? ? B DT 4   C DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT  13  N3 ? ? B DA 5   C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT  13  O4 ? ? B DA 5   C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC  12  N3 ? ? B DG 6   C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC  12  O2 ? ? B DG 6   C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC  12  N4 ? ? B DG 6   C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  11  N3 ? ? B DA 7   C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  11  O4 ? ? B DA 7   C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA  10  N1 ? ? B DT 8   C DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA  10  N6 ? ? B DT 8   C DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG  9   N1 ? ? B DC 9   C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG  9   O6 ? ? B DC 9   C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG  9   N2 ? ? B DC 9   C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG  8   N1 ? ? B DC 10  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG  8   O6 ? ? B DC 10  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG  8   N2 ? ? B DC 10  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC  7   N3 ? ? B DG 11  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC  7   O2 ? ? B DG 11  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC  7   N4 ? ? B DG 11  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC  6   N3 ? ? B DG 12  C DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC  6   O2 ? ? B DG 12  C DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC  6   N4 ? ? B DG 12  C DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT  5   N3 ? ? B DA 13  C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT  5   O4 ? ? B DA 13  C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 14 N4 ? ? ? 1_555 B DG  4   O6 ? ? B DC 14  C DG  3   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 36  C . ? HIS 36  A PRO 37  C ? PRO 37  A 1 -0.95 
2 PRO 129 C . ? PRO 129 A PRO 130 C ? PRO 130 A 1 0.23  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 23  ? ILE C 28  ? ILE A 23  ILE A 28  
A 2 THR C 94  ? PHE C 100 ? THR A 94  PHE A 100 
A 3 SER C 104 ? ARG C 109 ? SER A 104 ARG A 109 
A 4 ARG C 80  ? SER C 85  ? ARG A 80  SER A 85  
B 1 ILE C 34  ? HIS C 36  ? ILE A 34  HIS A 36  
B 2 THR C 116 ? ALA C 121 ? THR A 116 ALA A 121 
B 3 ASP C 69  ? HIS C 74  ? ASP A 69  HIS A 74  
B 4 PHE C 61  ? LEU C 65  ? PHE A 61  LEU A 65  
B 5 GLY C 54  ? ARG C 58  ? GLY A 54  ARG A 58  
C 1 GLU C 257 ? VAL C 261 ? GLU A 257 VAL A 261 
C 2 ARG C 264 ? TYR C 268 ? ARG A 264 TYR A 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 24  ? N GLU A 24  O CYS C 99  ? O CYS A 99  
A 2 3 N VAL C 96  ? N VAL A 96  O TYR C 108 ? O TYR A 108 
A 3 4 O ARG C 107 ? O ARG A 107 N ALA C 82  ? N ALA A 82  
B 1 2 N ARG C 35  ? N ARG A 35  O MET C 117 ? O MET A 117 
B 2 3 O HIS C 118 ? O HIS A 118 N ILE C 72  ? N ILE A 72  
B 3 4 O LEU C 71  ? O LEU A 71  N PHE C 64  ? N PHE A 64  
B 4 5 O LYS C 63  ? O LYS A 63  N GLU C 56  ? N GLU A 56  
C 1 2 N GLU C 257 ? N GLU A 257 O TYR C 268 ? O TYR A 268 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 300'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS C 249 ? CYS A 249 . ? 1_555 ? 
2  AC1 4 CYS C 252 ? CYS A 252 . ? 1_555 ? 
3  AC1 4 CYS C 269 ? CYS A 269 . ? 1_555 ? 
4  AC1 4 CYS C 272 ? CYS A 272 . ? 1_555 ? 
5  AC2 7 ASP C 25  ? ASP A 25  . ? 1_555 ? 
6  AC2 7 ALA C 44  ? ALA A 44  . ? 1_555 ? 
7  AC2 7 ALA C 45  ? ALA A 45  . ? 1_555 ? 
8  AC2 7 ILE C 48  ? ILE A 48  . ? 1_555 ? 
9  AC2 7 HOH H .   ? HOH A 318 . ? 1_555 ? 
10 AC2 7 HOH H .   ? HOH A 325 . ? 1_555 ? 
11 AC2 7 HOH H .   ? HOH A 422 . ? 4_565 ? 
# 
_database_PDB_matrix.entry_id          2F5O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    2F5O 
_atom_sites.fract_transf_matrix[1][1]   .021957 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .010724 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .009501 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DA  A 1 1   ? 18.579  53.566 15.540 1.00 103.88 ? 1   DA  B "O5'" 1 
ATOM   2    C  "C5'" . DA  A 1 1   ? 18.794  52.333 14.840 1.00 105.30 ? 1   DA  B "C5'" 1 
ATOM   3    C  "C4'" . DA  A 1 1   ? 17.962  51.173 15.341 1.00 106.26 ? 1   DA  B "C4'" 1 
ATOM   4    O  "O4'" . DA  A 1 1   ? 18.156  50.990 16.767 1.00 107.56 ? 1   DA  B "O4'" 1 
ATOM   5    C  "C3'" . DA  A 1 1   ? 16.454  51.320 15.138 1.00 106.17 ? 1   DA  B "C3'" 1 
ATOM   6    O  "O3'" . DA  A 1 1   ? 15.894  50.056 14.773 1.00 104.88 ? 1   DA  B "O3'" 1 
ATOM   7    C  "C2'" . DA  A 1 1   ? 15.947  51.768 16.498 1.00 106.15 ? 1   DA  B "C2'" 1 
ATOM   8    C  "C1'" . DA  A 1 1   ? 16.921  51.115 17.469 1.00 106.87 ? 1   DA  B "C1'" 1 
ATOM   9    N  N9    . DA  A 1 1   ? 17.169  51.941 18.653 1.00 107.03 ? 1   DA  B N9    1 
ATOM   10   C  C8    . DA  A 1 1   ? 17.295  53.313 18.680 1.00 107.75 ? 1   DA  B C8    1 
ATOM   11   N  N7    . DA  A 1 1   ? 17.514  53.804 19.877 1.00 107.52 ? 1   DA  B N7    1 
ATOM   12   C  C5    . DA  A 1 1   ? 17.533  52.684 20.696 1.00 106.21 ? 1   DA  B C5    1 
ATOM   13   C  C6    . DA  A 1 1   ? 17.710  52.536 22.082 1.00 105.19 ? 1   DA  B C6    1 
ATOM   14   N  N6    . DA  A 1 1   ? 17.907  53.568 22.916 1.00 103.05 ? 1   DA  B N6    1 
ATOM   15   N  N1    . DA  A 1 1   ? 17.672  51.281 22.587 1.00 104.93 ? 1   DA  B N1    1 
ATOM   16   C  C2    . DA  A 1 1   ? 17.465  50.253 21.744 1.00 105.22 ? 1   DA  B C2    1 
ATOM   17   N  N3    . DA  A 1 1   ? 17.280  50.267 20.424 1.00 105.44 ? 1   DA  B N3    1 
ATOM   18   C  C4    . DA  A 1 1   ? 17.325  51.526 19.955 1.00 106.24 ? 1   DA  B C4    1 
ATOM   19   P  P     . DG  A 1 2   ? 14.336  49.948 14.388 1.00 104.79 ? 2   DG  B P     1 
ATOM   20   O  OP1   . DG  A 1 2   ? 14.154  48.615 13.743 1.00 104.87 ? 2   DG  B OP1   1 
ATOM   21   O  OP2   . DG  A 1 2   ? 13.911  51.181 13.656 1.00 103.01 ? 2   DG  B OP2   1 
ATOM   22   O  "O5'" . DG  A 1 2   ? 13.618  49.925 15.816 1.00 101.45 ? 2   DG  B "O5'" 1 
ATOM   23   C  "C5'" . DG  A 1 2   ? 13.827  48.834 16.728 1.00 94.78  ? 2   DG  B "C5'" 1 
ATOM   24   C  "C4'" . DG  A 1 2   ? 12.876  48.932 17.902 1.00 89.99  ? 2   DG  B "C4'" 1 
ATOM   25   O  "O4'" . DG  A 1 2   ? 13.378  49.852 18.906 1.00 87.21  ? 2   DG  B "O4'" 1 
ATOM   26   C  "C3'" . DG  A 1 2   ? 11.462  49.410 17.540 1.00 88.17  ? 2   DG  B "C3'" 1 
ATOM   27   O  "O3'" . DG  A 1 2   ? 10.477  48.737 18.339 1.00 85.08  ? 2   DG  B "O3'" 1 
ATOM   28   C  "C2'" . DG  A 1 2   ? 11.495  50.871 17.953 1.00 86.80  ? 2   DG  B "C2'" 1 
ATOM   29   C  "C1'" . DG  A 1 2   ? 12.364  50.793 19.197 1.00 85.33  ? 2   DG  B "C1'" 1 
ATOM   30   N  N9    . DG  A 1 2   ? 12.990  52.047 19.591 1.00 82.84  ? 2   DG  B N9    1 
ATOM   31   C  C8    . DG  A 1 2   ? 13.230  53.147 18.803 1.00 81.70  ? 2   DG  B C8    1 
ATOM   32   N  N7    . DG  A 1 2   ? 13.720  54.154 19.471 1.00 81.14  ? 2   DG  B N7    1 
ATOM   33   C  C5    . DG  A 1 2   ? 13.825  53.684 20.774 1.00 80.57  ? 2   DG  B C5    1 
ATOM   34   C  C6    . DG  A 1 2   ? 14.271  54.334 21.955 1.00 80.62  ? 2   DG  B C6    1 
ATOM   35   O  O6    . DG  A 1 2   ? 14.663  55.502 22.094 1.00 81.80  ? 2   DG  B O6    1 
ATOM   36   N  N1    . DG  A 1 2   ? 14.222  53.484 23.053 1.00 79.78  ? 2   DG  B N1    1 
ATOM   37   C  C2    . DG  A 1 2   ? 13.797  52.177 23.023 1.00 79.36  ? 2   DG  B C2    1 
ATOM   38   N  N2    . DG  A 1 2   ? 13.828  51.523 24.190 1.00 79.50  ? 2   DG  B N2    1 
ATOM   39   N  N3    . DG  A 1 2   ? 13.373  51.562 21.932 1.00 78.62  ? 2   DG  B N3    1 
ATOM   40   C  C4    . DG  A 1 2   ? 13.408  52.373 20.855 1.00 80.81  ? 2   DG  B C4    1 
ATOM   41   P  P     . DG  A 1 3   ? 9.763   47.398 17.798 1.00 83.34  ? 3   DG  B P     1 
ATOM   42   O  OP1   . DG  A 1 3   ? 10.604  46.681 16.797 1.00 84.92  ? 3   DG  B OP1   1 
ATOM   43   O  OP2   . DG  A 1 3   ? 8.366   47.761 17.446 1.00 82.91  ? 3   DG  B OP2   1 
ATOM   44   O  "O5'" . DG  A 1 3   ? 9.738   46.502 19.109 1.00 79.94  ? 3   DG  B "O5'" 1 
ATOM   45   C  "C5'" . DG  A 1 3   ? 8.761   46.736 20.104 1.00 75.93  ? 3   DG  B "C5'" 1 
ATOM   46   C  "C4'" . DG  A 1 3   ? 9.372   46.716 21.487 1.00 70.84  ? 3   DG  B "C4'" 1 
ATOM   47   O  "O4'" . DG  A 1 3   ? 10.202  47.881 21.706 1.00 68.13  ? 3   DG  B "O4'" 1 
ATOM   48   C  "C3'" . DG  A 1 3   ? 8.260   46.824 22.515 1.00 67.36  ? 3   DG  B "C3'" 1 
ATOM   49   O  "O3'" . DG  A 1 3   ? 8.535   46.065 23.674 1.00 62.23  ? 3   DG  B "O3'" 1 
ATOM   50   C  "C2'" . DG  A 1 3   ? 8.184   48.302 22.832 1.00 67.43  ? 3   DG  B "C2'" 1 
ATOM   51   C  "C1'" . DG  A 1 3   ? 9.616   48.747 22.674 1.00 66.03  ? 3   DG  B "C1'" 1 
ATOM   52   N  N9    . DG  A 1 3   ? 9.707   50.103 22.157 1.00 63.02  ? 3   DG  B N9    1 
ATOM   53   C  C8    . DG  A 1 3   ? 9.519   50.496 20.856 1.00 61.96  ? 3   DG  B C8    1 
ATOM   54   N  N7    . DG  A 1 3   ? 9.737   51.769 20.673 1.00 64.72  ? 3   DG  B N7    1 
ATOM   55   C  C5    . DG  A 1 3   ? 10.077  52.247 21.936 1.00 61.96  ? 3   DG  B C5    1 
ATOM   56   C  C6    . DG  A 1 3   ? 10.457  53.559 22.361 1.00 60.21  ? 3   DG  B C6    1 
ATOM   57   O  O6    . DG  A 1 3   ? 10.599  54.577 21.675 1.00 59.77  ? 3   DG  B O6    1 
ATOM   58   N  N1    . DG  A 1 3   ? 10.694  53.607 23.736 1.00 57.44  ? 3   DG  B N1    1 
ATOM   59   C  C2    . DG  A 1 3   ? 10.591  52.532 24.589 1.00 59.91  ? 3   DG  B C2    1 
ATOM   60   N  N2    . DG  A 1 3   ? 10.835  52.776 25.886 1.00 58.50  ? 3   DG  B N2    1 
ATOM   61   N  N3    . DG  A 1 3   ? 10.266  51.301 24.200 1.00 61.98  ? 3   DG  B N3    1 
ATOM   62   C  C4    . DG  A 1 3   ? 10.027  51.236 22.869 1.00 61.72  ? 3   DG  B C4    1 
ATOM   63   P  P     . DT  A 1 4   ? 7.320   45.690 24.633 1.00 58.48  ? 4   DT  B P     1 
ATOM   64   O  OP1   . DT  A 1 4   ? 7.820   44.636 25.563 1.00 56.16  ? 4   DT  B OP1   1 
ATOM   65   O  OP2   . DT  A 1 4   ? 6.203   45.417 23.714 1.00 52.24  ? 4   DT  B OP2   1 
ATOM   66   O  "O5'" . DT  A 1 4   ? 7.046   47.034 25.432 1.00 55.54  ? 4   DT  B "O5'" 1 
ATOM   67   C  "C5'" . DT  A 1 4   ? 7.948   47.439 26.450 1.00 60.99  ? 4   DT  B "C5'" 1 
ATOM   68   C  "C4'" . DT  A 1 4   ? 7.453   48.685 27.141 1.00 63.64  ? 4   DT  B "C4'" 1 
ATOM   69   O  "O4'" . DT  A 1 4   ? 7.762   49.878 26.379 1.00 63.79  ? 4   DT  B "O4'" 1 
ATOM   70   C  "C3'" . DT  A 1 4   ? 5.950   48.713 27.393 1.00 66.26  ? 4   DT  B "C3'" 1 
ATOM   71   O  "O3'" . DT  A 1 4   ? 5.736   49.198 28.707 1.00 71.40  ? 4   DT  B "O3'" 1 
ATOM   72   C  "C2'" . DT  A 1 4   ? 5.442   49.725 26.376 1.00 65.07  ? 4   DT  B "C2'" 1 
ATOM   73   C  "C1'" . DT  A 1 4   ? 6.609   50.696 26.294 1.00 60.98  ? 4   DT  B "C1'" 1 
ATOM   74   N  N1    . DT  A 1 4   ? 6.710   51.490 25.052 1.00 58.75  ? 4   DT  B N1    1 
ATOM   75   C  C2    . DT  A 1 4   ? 7.168   52.800 25.148 1.00 56.01  ? 4   DT  B C2    1 
ATOM   76   O  O2    . DT  A 1 4   ? 7.468   53.329 26.209 1.00 54.20  ? 4   DT  B O2    1 
ATOM   77   N  N3    . DT  A 1 4   ? 7.264   53.463 23.953 1.00 51.15  ? 4   DT  B N3    1 
ATOM   78   C  C4    . DT  A 1 4   ? 6.954   52.969 22.697 1.00 54.69  ? 4   DT  B C4    1 
ATOM   79   O  O4    . DT  A 1 4   ? 7.099   53.681 21.697 1.00 50.95  ? 4   DT  B O4    1 
ATOM   80   C  C5    . DT  A 1 4   ? 6.470   51.598 22.672 1.00 54.85  ? 4   DT  B C5    1 
ATOM   81   C  C7    . DT  A 1 4   ? 6.113   50.984 21.358 1.00 53.66  ? 4   DT  B C7    1 
ATOM   82   C  C6    . DT  A 1 4   ? 6.371   50.940 23.834 1.00 55.85  ? 4   DT  B C6    1 
ATOM   83   P  P     . DA  A 1 5   ? 4.305   49.010 29.402 1.00 74.14  ? 5   DA  B P     1 
ATOM   84   O  OP1   . DA  A 1 5   ? 4.269   47.675 30.050 1.00 73.61  ? 5   DA  B OP1   1 
ATOM   85   O  OP2   . DA  A 1 5   ? 3.264   49.384 28.414 1.00 74.16  ? 5   DA  B OP2   1 
ATOM   86   O  "O5'" . DA  A 1 5   ? 4.360   50.102 30.549 1.00 75.92  ? 5   DA  B "O5'" 1 
ATOM   87   C  "C5'" . DA  A 1 5   ? 5.622   50.459 31.112 1.00 76.60  ? 5   DA  B "C5'" 1 
ATOM   88   C  "C4'" . DA  A 1 5   ? 5.693   51.952 31.324 1.00 75.27  ? 5   DA  B "C4'" 1 
ATOM   89   O  "O4'" . DA  A 1 5   ? 5.861   52.677 30.083 1.00 73.30  ? 5   DA  B "O4'" 1 
ATOM   90   C  "C3'" . DA  A 1 5   ? 4.440   52.514 31.971 1.00 75.48  ? 5   DA  B "C3'" 1 
ATOM   91   O  "O3'" . DA  A 1 5   ? 4.839   53.476 32.921 1.00 78.93  ? 5   DA  B "O3'" 1 
ATOM   92   C  "C2'" . DA  A 1 5   ? 3.684   53.153 30.818 1.00 71.97  ? 5   DA  B "C2'" 1 
ATOM   93   C  "C1'" . DA  A 1 5   ? 4.805   53.619 29.911 1.00 69.45  ? 5   DA  B "C1'" 1 
ATOM   94   N  N9    . DA  A 1 5   ? 4.489   53.648 28.481 1.00 65.65  ? 5   DA  B N9    1 
ATOM   95   C  C8    . DA  A 1 5   ? 3.917   52.659 27.713 1.00 62.68  ? 5   DA  B C8    1 
ATOM   96   N  N7    . DA  A 1 5   ? 3.869   52.945 26.433 1.00 61.39  ? 5   DA  B N7    1 
ATOM   97   C  C5    . DA  A 1 5   ? 4.417   54.217 26.356 1.00 60.66  ? 5   DA  B C5    1 
ATOM   98   C  C6    . DA  A 1 5   ? 4.655   55.071 25.283 1.00 58.37  ? 5   DA  B C6    1 
ATOM   99   N  N6    . DA  A 1 5   ? 4.390   54.755 24.025 1.00 54.95  ? 5   DA  B N6    1 
ATOM   100  N  N1    . DA  A 1 5   ? 5.195   56.282 25.547 1.00 59.34  ? 5   DA  B N1    1 
ATOM   101  C  C2    . DA  A 1 5   ? 5.484   56.590 26.814 1.00 59.83  ? 5   DA  B C2    1 
ATOM   102  N  N3    . DA  A 1 5   ? 5.323   55.865 27.911 1.00 61.23  ? 5   DA  B N3    1 
ATOM   103  C  C4    . DA  A 1 5   ? 4.778   54.674 27.612 1.00 62.68  ? 5   DA  B C4    1 
ATOM   104  P  P     . DG  A 1 6   ? 3.732   54.155 33.836 1.00 84.40  ? 6   DG  B P     1 
ATOM   105  O  OP1   . DG  A 1 6   ? 4.320   54.333 35.193 1.00 85.03  ? 6   DG  B OP1   1 
ATOM   106  O  OP2   . DG  A 1 6   ? 2.483   53.353 33.677 1.00 82.39  ? 6   DG  B OP2   1 
ATOM   107  O  "O5'" . DG  A 1 6   ? 3.574   55.586 33.144 1.00 81.56  ? 6   DG  B "O5'" 1 
ATOM   108  C  "C5'" . DG  A 1 6   ? 4.724   56.398 32.900 1.00 76.71  ? 6   DG  B "C5'" 1 
ATOM   109  C  "C4'" . DG  A 1 6   ? 4.297   57.783 32.475 1.00 75.25  ? 6   DG  B "C4'" 1 
ATOM   110  O  "O4'" . DG  A 1 6   ? 4.082   57.833 31.042 1.00 72.52  ? 6   DG  B "O4'" 1 
ATOM   111  C  "C3'" . DG  A 1 6   ? 2.993   58.253 33.125 1.00 74.94  ? 6   DG  B "C3'" 1 
ATOM   112  O  "O3'" . DG  A 1 6   ? 3.070   59.666 33.400 1.00 77.19  ? 6   DG  B "O3'" 1 
ATOM   113  C  "C2'" . DG  A 1 6   ? 1.952   57.922 32.069 1.00 71.69  ? 6   DG  B "C2'" 1 
ATOM   114  C  "C1'" . DG  A 1 6   ? 2.715   58.133 30.761 1.00 68.92  ? 6   DG  B "C1'" 1 
ATOM   115  N  N9    . DG  A 1 6   ? 2.286   57.249 29.680 1.00 63.07  ? 6   DG  B N9    1 
ATOM   116  C  C8    . DG  A 1 6   ? 1.866   55.945 29.805 1.00 61.87  ? 6   DG  B C8    1 
ATOM   117  N  N7    . DG  A 1 6   ? 1.575   55.390 28.662 1.00 59.44  ? 6   DG  B N7    1 
ATOM   118  C  C5    . DG  A 1 6   ? 1.806   56.387 27.731 1.00 57.30  ? 6   DG  B C5    1 
ATOM   119  C  C6    . DG  A 1 6   ? 1.665   56.366 26.339 1.00 57.56  ? 6   DG  B C6    1 
ATOM   120  O  O6    . DG  A 1 6   ? 1.323   55.424 25.622 1.00 58.51  ? 6   DG  B O6    1 
ATOM   121  N  N1    . DG  A 1 6   ? 1.982   57.597 25.767 1.00 57.23  ? 6   DG  B N1    1 
ATOM   122  C  C2    . DG  A 1 6   ? 2.401   58.703 26.462 1.00 57.88  ? 6   DG  B C2    1 
ATOM   123  N  N2    . DG  A 1 6   ? 2.649   59.795 25.730 1.00 55.19  ? 6   DG  B N2    1 
ATOM   124  N  N3    . DG  A 1 6   ? 2.559   58.729 27.777 1.00 57.73  ? 6   DG  B N3    1 
ATOM   125  C  C4    . DG  A 1 6   ? 2.240   57.543 28.343 1.00 58.89  ? 6   DG  B C4    1 
ATOM   126  P  P     . DA  A 1 7   ? 1.729   60.505 33.733 1.00 77.24  ? 7   DA  B P     1 
ATOM   127  O  OP1   . DA  A 1 7   ? 2.068   61.529 34.752 1.00 77.24  ? 7   DA  B OP1   1 
ATOM   128  O  OP2   . DA  A 1 7   ? 0.608   59.558 34.006 1.00 76.31  ? 7   DA  B OP2   1 
ATOM   129  O  "O5'" . DA  A 1 7   ? 1.470   61.281 32.364 1.00 74.30  ? 7   DA  B "O5'" 1 
ATOM   130  C  "C5'" . DA  A 1 7   ? 2.534   61.958 31.685 1.00 69.25  ? 7   DA  B "C5'" 1 
ATOM   131  C  "C4'" . DA  A 1 7   ? 1.994   62.690 30.474 1.00 67.86  ? 7   DA  B "C4'" 1 
ATOM   132  O  "O4'" . DA  A 1 7   ? 1.601   61.764 29.427 1.00 66.31  ? 7   DA  B "O4'" 1 
ATOM   133  C  "C3'" . DA  A 1 7   ? 0.747   63.525 30.757 1.00 66.13  ? 7   DA  B "C3'" 1 
ATOM   134  O  "O3'" . DA  A 1 7   ? 0.776   64.676 29.915 1.00 66.22  ? 7   DA  B "O3'" 1 
ATOM   135  C  "C2'" . DA  A 1 7   ? -0.392  62.589 30.373 1.00 63.59  ? 7   DA  B "C2'" 1 
ATOM   136  C  "C1'" . DA  A 1 7   ? 0.199   61.877 29.171 1.00 61.29  ? 7   DA  B "C1'" 1 
ATOM   137  N  N9    . DA  A 1 7   ? -0.321  60.538 28.884 1.00 56.55  ? 7   DA  B N9    1 
ATOM   138  C  C8    . DA  A 1 7   ? -0.616  59.510 29.744 1.00 54.20  ? 7   DA  B C8    1 
ATOM   139  N  N7    . DA  A 1 7   ? -1.022  58.418 29.139 1.00 51.06  ? 7   DA  B N7    1 
ATOM   140  C  C5    . DA  A 1 7   ? -1.002  58.755 27.791 1.00 51.04  ? 7   DA  B C5    1 
ATOM   141  C  C6    . DA  A 1 7   ? -1.312  58.023 26.617 1.00 50.62  ? 7   DA  B C6    1 
ATOM   142  N  N6    . DA  A 1 7   ? -1.716  56.757 26.618 1.00 47.61  ? 7   DA  B N6    1 
ATOM   143  N  N1    . DA  A 1 7   ? -1.184  58.653 25.430 1.00 50.80  ? 7   DA  B N1    1 
ATOM   144  C  C2    . DA  A 1 7   ? -0.774  59.933 25.424 1.00 53.03  ? 7   DA  B C2    1 
ATOM   145  N  N3    . DA  A 1 7   ? -0.454  60.725 26.453 1.00 54.03  ? 7   DA  B N3    1 
ATOM   146  C  C4    . DA  A 1 7   ? -0.589  60.061 27.621 1.00 53.42  ? 7   DA  B C4    1 
ATOM   147  P  P     . DT  A 1 8   ? -0.302  65.849 30.129 1.00 67.86  ? 8   DT  B P     1 
ATOM   148  O  OP1   . DT  A 1 8   ? 0.406   67.145 30.322 1.00 67.76  ? 8   DT  B OP1   1 
ATOM   149  O  OP2   . DT  A 1 8   ? -1.278  65.346 31.160 1.00 65.62  ? 8   DT  B OP2   1 
ATOM   150  O  "O5'" . DT  A 1 8   ? -1.021  65.953 28.713 1.00 65.92  ? 8   DT  B "O5'" 1 
ATOM   151  C  "C5'" . DT  A 1 8   ? -1.302  64.775 27.970 1.00 63.12  ? 8   DT  B "C5'" 1 
ATOM   152  C  "C4'" . DT  A 1 8   ? -2.365  65.060 26.943 1.00 58.82  ? 8   DT  B "C4'" 1 
ATOM   153  O  "O4'" . DT  A 1 8   ? -2.749  63.802 26.348 1.00 55.04  ? 8   DT  B "O4'" 1 
ATOM   154  C  "C3'" . DT  A 1 8   ? -3.626  65.645 27.573 1.00 57.55  ? 8   DT  B "C3'" 1 
ATOM   155  O  "O3'" . DT  A 1 8   ? -4.185  66.637 26.716 1.00 59.37  ? 8   DT  B "O3'" 1 
ATOM   156  C  "C2'" . DT  A 1 8   ? -4.537  64.448 27.751 1.00 54.43  ? 8   DT  B "C2'" 1 
ATOM   157  C  "C1'" . DT  A 1 8   ? -4.100  63.490 26.655 1.00 51.17  ? 8   DT  B "C1'" 1 
ATOM   158  N  N1    . DT  A 1 8   ? -4.160  62.057 27.042 1.00 46.50  ? 8   DT  B N1    1 
ATOM   159  C  C2    . DT  A 1 8   ? -4.243  61.131 26.033 1.00 41.09  ? 8   DT  B C2    1 
ATOM   160  O  O2    . DT  A 1 8   ? -4.222  61.436 24.864 1.00 38.49  ? 8   DT  B O2    1 
ATOM   161  N  N3    . DT  A 1 8   ? -4.338  59.835 26.452 1.00 37.18  ? 8   DT  B N3    1 
ATOM   162  C  C4    . DT  A 1 8   ? -4.344  59.383 27.747 1.00 38.26  ? 8   DT  B C4    1 
ATOM   163  O  O4    . DT  A 1 8   ? -4.414  58.179 27.972 1.00 38.93  ? 8   DT  B O4    1 
ATOM   164  C  C5    . DT  A 1 8   ? -4.250  60.406 28.760 1.00 40.24  ? 8   DT  B C5    1 
ATOM   165  C  C7    . DT  A 1 8   ? -4.276  60.001 30.201 1.00 42.82  ? 8   DT  B C7    1 
ATOM   166  C  C6    . DT  A 1 8   ? -4.153  61.672 28.366 1.00 41.36  ? 8   DT  B C6    1 
ATOM   167  P  P     . DC  A 1 9   ? -5.165  67.768 27.321 1.00 60.69  ? 9   DC  B P     1 
ATOM   168  O  OP1   . DC  A 1 9   ? -4.560  69.085 26.987 1.00 55.75  ? 9   DC  B OP1   1 
ATOM   169  O  OP2   . DC  A 1 9   ? -5.563  67.454 28.733 1.00 57.26  ? 9   DC  B OP2   1 
ATOM   170  O  "O5'" . DC  A 1 9   ? -6.481  67.579 26.445 1.00 55.84  ? 9   DC  B "O5'" 1 
ATOM   171  C  "C5'" . DC  A 1 9   ? -6.399  67.346 25.051 1.00 51.27  ? 9   DC  B "C5'" 1 
ATOM   172  C  "C4'" . DC  A 1 9   ? -7.679  66.704 24.577 1.00 48.50  ? 9   DC  B "C4'" 1 
ATOM   173  O  "O4'" . DC  A 1 9   ? -7.633  65.269 24.760 1.00 45.06  ? 9   DC  B "O4'" 1 
ATOM   174  C  "C3'" . DC  A 1 9   ? -8.910  67.209 25.327 1.00 46.35  ? 9   DC  B "C3'" 1 
ATOM   175  O  "O3'" . DC  A 1 9   ? -9.943  67.477 24.398 1.00 47.65  ? 9   DC  B "O3'" 1 
ATOM   176  C  "C2'" . DC  A 1 9   ? -9.292  66.046 26.233 1.00 45.00  ? 9   DC  B "C2'" 1 
ATOM   177  C  "C1'" . DC  A 1 9   ? -8.794  64.835 25.453 1.00 44.60  ? 9   DC  B "C1'" 1 
ATOM   178  N  N1    . DC  A 1 9   ? -8.431  63.662 26.285 1.00 43.46  ? 9   DC  B N1    1 
ATOM   179  C  C2    . DC  A 1 9   ? -8.219  62.410 25.656 1.00 40.14  ? 9   DC  B C2    1 
ATOM   180  O  O2    . DC  A 1 9   ? -8.252  62.334 24.410 1.00 38.37  ? 9   DC  B O2    1 
ATOM   181  N  N3    . DC  A 1 9   ? -7.973  61.327 26.420 1.00 36.65  ? 9   DC  B N3    1 
ATOM   182  C  C4    . DC  A 1 9   ? -7.913  61.442 27.757 1.00 39.61  ? 9   DC  B C4    1 
ATOM   183  N  N4    . DC  A 1 9   ? -7.693  60.334 28.471 1.00 34.05  ? 9   DC  B N4    1 
ATOM   184  C  C5    . DC  A 1 9   ? -8.081  62.697 28.417 1.00 42.03  ? 9   DC  B C5    1 
ATOM   185  C  C6    . DC  A 1 9   ? -8.332  63.773 27.648 1.00 42.38  ? 9   DC  B C6    1 
ATOM   186  P  P     . DC  A 1 10  ? -10.837 68.801 24.554 1.00 52.52  ? 10  DC  B P     1 
ATOM   187  O  OP1   . DC  A 1 10  ? -11.212 69.100 23.141 1.00 49.19  ? 10  DC  B OP1   1 
ATOM   188  O  OP2   . DC  A 1 10  ? -10.159 69.820 25.394 1.00 46.45  ? 10  DC  B OP2   1 
ATOM   189  O  "O5'" . DC  A 1 10  ? -12.129 68.335 25.343 1.00 48.17  ? 10  DC  B "O5'" 1 
ATOM   190  C  "C5'" . DC  A 1 10  ? -12.997 67.391 24.764 1.00 45.77  ? 10  DC  B "C5'" 1 
ATOM   191  C  "C4'" . DC  A 1 10  ? -13.965 66.882 25.799 1.00 43.67  ? 10  DC  B "C4'" 1 
ATOM   192  O  "O4'" . DC  A 1 10  ? -13.376 65.803 26.550 1.00 41.10  ? 10  DC  B "O4'" 1 
ATOM   193  C  "C3'" . DC  A 1 10  ? -14.425 67.913 26.819 1.00 42.07  ? 10  DC  B "C3'" 1 
ATOM   194  O  "O3'" . DC  A 1 10  ? -15.772 68.280 26.563 1.00 43.84  ? 10  DC  B "O3'" 1 
ATOM   195  C  "C2'" . DC  A 1 10  ? -14.298 67.207 28.168 1.00 44.06  ? 10  DC  B "C2'" 1 
ATOM   196  C  "C1'" . DC  A 1 10  ? -13.927 65.764 27.855 1.00 41.72  ? 10  DC  B "C1'" 1 
ATOM   197  N  N1    . DC  A 1 10  ? -12.871 65.220 28.752 1.00 46.06  ? 10  DC  B N1    1 
ATOM   198  C  C2    . DC  A 1 10  ? -12.940 63.866 29.221 1.00 44.78  ? 10  DC  B C2    1 
ATOM   199  O  O2    . DC  A 1 10  ? -13.925 63.157 28.920 1.00 41.51  ? 10  DC  B O2    1 
ATOM   200  N  N3    . DC  A 1 10  ? -11.925 63.386 30.001 1.00 44.54  ? 10  DC  B N3    1 
ATOM   201  C  C4    . DC  A 1 10  ? -10.900 64.189 30.337 1.00 47.88  ? 10  DC  B C4    1 
ATOM   202  N  N4    . DC  A 1 10  ? -9.926  63.696 31.123 1.00 44.18  ? 10  DC  B N4    1 
ATOM   203  C  C5    . DC  A 1 10  ? -10.822 65.549 29.889 1.00 46.55  ? 10  DC  B C5    1 
ATOM   204  C  C6    . DC  A 1 10  ? -11.815 66.016 29.115 1.00 46.08  ? 10  DC  B C6    1 
ATOM   205  P  P     . DG  A 1 11  ? -16.497 69.358 27.504 1.00 44.53  ? 11  DG  B P     1 
ATOM   206  O  OP1   . DG  A 1 11  ? -17.308 70.256 26.631 1.00 46.11  ? 11  DG  B OP1   1 
ATOM   207  O  OP2   . DG  A 1 11  ? -15.523 69.923 28.460 1.00 47.68  ? 11  DG  B OP2   1 
ATOM   208  O  "O5'" . DG  A 1 11  ? -17.498 68.447 28.326 1.00 41.28  ? 11  DG  B "O5'" 1 
ATOM   209  C  "C5'" . DG  A 1 11  ? -18.280 67.464 27.664 1.00 41.53  ? 11  DG  B "C5'" 1 
ATOM   210  C  "C4'" . DG  A 1 11  ? -18.863 66.540 28.697 1.00 43.09  ? 11  DG  B "C4'" 1 
ATOM   211  O  "O4'" . DG  A 1 11  ? -17.790 65.823 29.363 1.00 44.68  ? 11  DG  B "O4'" 1 
ATOM   212  C  "C3'" . DG  A 1 11  ? -19.570 67.306 29.803 1.00 42.12  ? 11  DG  B "C3'" 1 
ATOM   213  O  "O3'" . DG  A 1 11  ? -20.544 66.424 30.314 1.00 48.41  ? 11  DG  B "O3'" 1 
ATOM   214  C  "C2'" . DG  A 1 11  ? -18.479 67.482 30.844 1.00 43.20  ? 11  DG  B "C2'" 1 
ATOM   215  C  "C1'" . DG  A 1 11  ? -17.821 66.120 30.751 1.00 44.38  ? 11  DG  B "C1'" 1 
ATOM   216  N  N9    . DG  A 1 11  ? -16.462 66.007 31.272 1.00 46.60  ? 11  DG  B N9    1 
ATOM   217  C  C8    . DG  A 1 11  ? -15.563 67.025 31.477 1.00 46.18  ? 11  DG  B C8    1 
ATOM   218  N  N7    . DG  A 1 11  ? -14.417 66.607 31.953 1.00 45.77  ? 11  DG  B N7    1 
ATOM   219  C  C5    . DG  A 1 11  ? -14.565 65.229 32.070 1.00 44.26  ? 11  DG  B C5    1 
ATOM   220  C  C6    . DG  A 1 11  ? -13.649 64.234 32.529 1.00 45.65  ? 11  DG  B C6    1 
ATOM   221  O  O6    . DG  A 1 11  ? -12.492 64.378 32.937 1.00 46.57  ? 11  DG  B O6    1 
ATOM   222  N  N1    . DG  A 1 11  ? -14.203 62.959 32.472 1.00 43.35  ? 11  DG  B N1    1 
ATOM   223  C  C2    . DG  A 1 11  ? -15.471 62.673 32.035 1.00 43.66  ? 11  DG  B C2    1 
ATOM   224  N  N2    . DG  A 1 11  ? -15.811 61.364 32.037 1.00 41.02  ? 11  DG  B N2    1 
ATOM   225  N  N3    . DG  A 1 11  ? -16.341 63.593 31.622 1.00 42.78  ? 11  DG  B N3    1 
ATOM   226  C  C4    . DG  A 1 11  ? -15.820 64.837 31.658 1.00 44.68  ? 11  DG  B C4    1 
ATOM   227  P  P     . DG  A 1 12  ? -22.042 66.938 30.591 1.00 50.14  ? 12  DG  B P     1 
ATOM   228  O  OP1   . DG  A 1 12  ? -22.577 67.687 29.435 1.00 52.51  ? 12  DG  B OP1   1 
ATOM   229  O  OP2   . DG  A 1 12  ? -22.099 67.527 31.953 1.00 52.92  ? 12  DG  B OP2   1 
ATOM   230  O  "O5'" . DG  A 1 12  ? -22.817 65.569 30.589 1.00 54.00  ? 12  DG  B "O5'" 1 
ATOM   231  C  "C5'" . DG  A 1 12  ? -23.285 65.057 31.777 1.00 59.11  ? 12  DG  B "C5'" 1 
ATOM   232  C  "C4'" . DG  A 1 12  ? -22.967 63.595 31.859 1.00 60.94  ? 12  DG  B "C4'" 1 
ATOM   233  O  "O4'" . DG  A 1 12  ? -21.539 63.426 31.964 1.00 61.16  ? 12  DG  B "O4'" 1 
ATOM   234  C  "C3'" . DG  A 1 12  ? -23.546 63.102 33.166 1.00 62.29  ? 12  DG  B "C3'" 1 
ATOM   235  O  "O3'" . DG  A 1 12  ? -24.088 61.807 33.021 1.00 65.67  ? 12  DG  B "O3'" 1 
ATOM   236  C  "C2'" . DG  A 1 12  ? -22.391 63.192 34.141 1.00 62.16  ? 12  DG  B "C2'" 1 
ATOM   237  C  "C1'" . DG  A 1 12  ? -21.194 62.942 33.260 1.00 59.33  ? 12  DG  B "C1'" 1 
ATOM   238  N  N9    . DG  A 1 12  ? -19.999 63.653 33.699 1.00 57.42  ? 12  DG  B N9    1 
ATOM   239  C  C8    . DG  A 1 12  ? -19.751 65.004 33.616 1.00 54.97  ? 12  DG  B C8    1 
ATOM   240  N  N7    . DG  A 1 12  ? -18.550 65.326 34.013 1.00 53.27  ? 12  DG  B N7    1 
ATOM   241  C  C5    . DG  A 1 12  ? -17.979 64.121 34.403 1.00 54.44  ? 12  DG  B C5    1 
ATOM   242  C  C6    . DG  A 1 12  ? -16.685 63.836 34.904 1.00 52.56  ? 12  DG  B C6    1 
ATOM   243  O  O6    . DG  A 1 12  ? -15.752 64.607 35.096 1.00 53.43  ? 12  DG  B O6    1 
ATOM   244  N  N1    . DG  A 1 12  ? -16.526 62.482 35.185 1.00 53.18  ? 12  DG  B N1    1 
ATOM   245  C  C2    . DG  A 1 12  ? -17.486 61.518 34.997 1.00 54.78  ? 12  DG  B C2    1 
ATOM   246  N  N2    . DG  A 1 12  ? -17.141 60.258 35.334 1.00 51.61  ? 12  DG  B N2    1 
ATOM   247  N  N3    . DG  A 1 12  ? -18.699 61.770 34.512 1.00 54.89  ? 12  DG  B N3    1 
ATOM   248  C  C4    . DG  A 1 12  ? -18.871 63.083 34.240 1.00 55.60  ? 12  DG  B C4    1 
ATOM   249  P  P     . DA  A 1 13  ? -25.157 61.301 34.094 1.00 67.13  ? 13  DA  B P     1 
ATOM   250  O  OP1   . DA  A 1 13  ? -26.352 60.769 33.379 1.00 66.59  ? 13  DA  B OP1   1 
ATOM   251  O  OP2   . DA  A 1 13  ? -25.300 62.413 35.076 1.00 65.92  ? 13  DA  B OP2   1 
ATOM   252  O  "O5'" . DA  A 1 13  ? -24.361 60.128 34.802 1.00 69.36  ? 13  DA  B "O5'" 1 
ATOM   253  C  "C5'" . DA  A 1 13  ? -22.985 60.307 35.072 1.00 73.35  ? 13  DA  B "C5'" 1 
ATOM   254  C  "C4'" . DA  A 1 13  ? -22.474 59.214 35.971 1.00 76.12  ? 13  DA  B "C4'" 1 
ATOM   255  O  "O4'" . DA  A 1 13  ? -21.156 59.627 36.367 1.00 75.90  ? 13  DA  B "O4'" 1 
ATOM   256  C  "C3'" . DA  A 1 13  ? -23.257 59.062 37.268 1.00 79.53  ? 13  DA  B "C3'" 1 
ATOM   257  O  "O3'" . DA  A 1 13  ? -23.101 57.716 37.737 1.00 84.47  ? 13  DA  B "O3'" 1 
ATOM   258  C  "C2'" . DA  A 1 13  ? -22.621 60.099 38.177 1.00 77.92  ? 13  DA  B "C2'" 1 
ATOM   259  C  "C1'" . DA  A 1 13  ? -21.178 60.156 37.684 1.00 76.10  ? 13  DA  B "C1'" 1 
ATOM   260  N  N9    . DA  A 1 13  ? -20.615 61.501 37.609 1.00 73.20  ? 13  DA  B N9    1 
ATOM   261  C  C8    . DA  A 1 13  ? -21.214 62.671 37.199 1.00 71.85  ? 13  DA  B C8    1 
ATOM   262  N  N7    . DA  A 1 13  ? -20.416 63.715 37.242 1.00 70.88  ? 13  DA  B N7    1 
ATOM   263  C  C5    . DA  A 1 13  ? -19.212 63.193 37.711 1.00 71.33  ? 13  DA  B C5    1 
ATOM   264  C  C6    . DA  A 1 13  ? -17.959 63.778 37.971 1.00 70.51  ? 13  DA  B C6    1 
ATOM   265  N  N6    . DA  A 1 13  ? -17.695 65.073 37.778 1.00 70.37  ? 13  DA  B N6    1 
ATOM   266  N  N1    . DA  A 1 13  ? -16.973 62.972 38.437 1.00 69.21  ? 13  DA  B N1    1 
ATOM   267  C  C2    . DA  A 1 13  ? -17.236 61.670 38.616 1.00 69.38  ? 13  DA  B C2    1 
ATOM   268  N  N3    . DA  A 1 13  ? -18.363 61.004 38.403 1.00 69.25  ? 13  DA  B N3    1 
ATOM   269  C  C4    . DA  A 1 13  ? -19.325 61.832 37.946 1.00 71.74  ? 13  DA  B C4    1 
ATOM   270  P  P     . DC  A 1 14  ? -23.899 57.218 39.039 1.00 88.24  ? 14  DC  B P     1 
ATOM   271  O  OP1   . DC  A 1 14  ? -24.051 55.746 38.866 1.00 87.34  ? 14  DC  B OP1   1 
ATOM   272  O  OP2   . DC  A 1 14  ? -25.110 58.064 39.262 1.00 87.41  ? 14  DC  B OP2   1 
ATOM   273  O  "O5'" . DC  A 1 14  ? -22.863 57.520 40.210 1.00 88.19  ? 14  DC  B "O5'" 1 
ATOM   274  C  "C5'" . DC  A 1 14  ? -21.610 56.846 40.263 1.00 89.44  ? 14  DC  B "C5'" 1 
ATOM   275  C  "C4'" . DC  A 1 14  ? -20.849 57.274 41.494 1.00 91.01  ? 14  DC  B "C4'" 1 
ATOM   276  O  "O4'" . DC  A 1 14  ? -20.292 58.595 41.269 1.00 91.03  ? 14  DC  B "O4'" 1 
ATOM   277  C  "C3'" . DC  A 1 14  ? -21.709 57.372 42.766 1.00 91.42  ? 14  DC  B "C3'" 1 
ATOM   278  O  "O3'" . DC  A 1 14  ? -21.079 56.843 43.958 1.00 91.63  ? 14  DC  B "O3'" 1 
ATOM   279  C  "C2'" . DC  A 1 14  ? -21.918 58.869 42.930 1.00 90.85  ? 14  DC  B "C2'" 1 
ATOM   280  C  "C1'" . DC  A 1 14  ? -20.608 59.413 42.379 1.00 90.47  ? 14  DC  B "C1'" 1 
ATOM   281  N  N1    . DC  A 1 14  ? -20.622 60.814 41.937 1.00 88.79  ? 14  DC  B N1    1 
ATOM   282  C  C2    . DC  A 1 14  ? -19.398 61.478 41.776 1.00 87.89  ? 14  DC  B C2    1 
ATOM   283  O  O2    . DC  A 1 14  ? -18.340 60.842 41.937 1.00 85.95  ? 14  DC  B O2    1 
ATOM   284  N  N3    . DC  A 1 14  ? -19.399 62.790 41.446 1.00 87.32  ? 14  DC  B N3    1 
ATOM   285  C  C4    . DC  A 1 14  ? -20.557 63.429 41.258 1.00 87.20  ? 14  DC  B C4    1 
ATOM   286  N  N4    . DC  A 1 14  ? -20.511 64.724 40.949 1.00 86.94  ? 14  DC  B N4    1 
ATOM   287  C  C5    . DC  A 1 14  ? -21.814 62.768 41.381 1.00 87.60  ? 14  DC  B C5    1 
ATOM   288  C  C6    . DC  A 1 14  ? -21.800 61.472 41.715 1.00 88.11  ? 14  DC  B C6    1 
ATOM   289  O  "O5'" . DG  B 2 4   ? -12.049 71.445 43.356 1.00 97.88  ? 3   DG  C "O5'" 1 
ATOM   290  C  "C5'" . DG  B 2 4   ? -11.242 70.449 42.703 1.00 100.29 ? 3   DG  C "C5'" 1 
ATOM   291  C  "C4'" . DG  B 2 4   ? -11.134 69.133 43.446 1.00 101.60 ? 3   DG  C "C4'" 1 
ATOM   292  O  "O4'" . DG  B 2 4   ? -12.454 68.575 43.667 1.00 102.71 ? 3   DG  C "O4'" 1 
ATOM   293  C  "C3'" . DG  B 2 4   ? -10.349 68.042 42.714 1.00 101.44 ? 3   DG  C "C3'" 1 
ATOM   294  O  "O3'" . DG  B 2 4   ? -9.673  67.198 43.655 1.00 100.48 ? 3   DG  C "O3'" 1 
ATOM   295  C  "C2'" . DG  B 2 4   ? -11.438 67.251 42.014 1.00 101.99 ? 3   DG  C "C2'" 1 
ATOM   296  C  "C1'" . DG  B 2 4   ? -12.578 67.313 43.015 1.00 101.82 ? 3   DG  C "C1'" 1 
ATOM   297  N  N9    . DG  B 2 4   ? -13.902 67.262 42.405 1.00 101.51 ? 3   DG  C N9    1 
ATOM   298  C  C8    . DG  B 2 4   ? -14.562 68.302 41.794 1.00 101.65 ? 3   DG  C C8    1 
ATOM   299  N  N7    . DG  B 2 4   ? -15.755 67.977 41.376 1.00 101.62 ? 3   DG  C N7    1 
ATOM   300  C  C5    . DG  B 2 4   ? -15.888 66.640 41.719 1.00 101.15 ? 3   DG  C C5    1 
ATOM   301  C  C6    . DG  B 2 4   ? -16.972 65.750 41.527 1.00 101.34 ? 3   DG  C C6    1 
ATOM   302  O  O6    . DG  B 2 4   ? -18.078 65.980 41.014 1.00 102.16 ? 3   DG  C O6    1 
ATOM   303  N  N1    . DG  B 2 4   ? -16.683 64.480 42.012 1.00 100.04 ? 3   DG  C N1    1 
ATOM   304  C  C2    . DG  B 2 4   ? -15.509 64.116 42.616 1.00 99.93  ? 3   DG  C C2    1 
ATOM   305  N  N2    . DG  B 2 4   ? -15.429 62.841 43.013 1.00 99.81  ? 3   DG  C N2    1 
ATOM   306  N  N3    . DG  B 2 4   ? -14.491 64.940 42.815 1.00 100.40 ? 3   DG  C N3    1 
ATOM   307  C  C4    . DG  B 2 4   ? -14.748 66.178 42.344 1.00 101.00 ? 3   DG  C C4    1 
ATOM   308  P  P     . DT  B 2 5   ? -8.753  65.987 43.126 1.00 100.12 ? 4   DT  C P     1 
ATOM   309  O  OP1   . DT  B 2 5   ? -7.967  65.489 44.281 1.00 100.45 ? 4   DT  C OP1   1 
ATOM   310  O  OP2   . DT  B 2 5   ? -8.049  66.409 41.887 1.00 100.30 ? 4   DT  C OP2   1 
ATOM   311  O  "O5'" . DT  B 2 5   ? -9.796  64.849 42.737 1.00 99.53  ? 4   DT  C "O5'" 1 
ATOM   312  C  "C5'" . DT  B 2 5   ? -10.341 63.989 43.740 1.00 96.81  ? 4   DT  C "C5'" 1 
ATOM   313  C  "C4'" . DT  B 2 5   ? -10.776 62.674 43.130 1.00 94.26  ? 4   DT  C "C4'" 1 
ATOM   314  O  "O4'" . DT  B 2 5   ? -12.055 62.816 42.468 1.00 93.05  ? 4   DT  C "O4'" 1 
ATOM   315  C  "C3'" . DT  B 2 5   ? -9.818  62.074 42.097 1.00 92.27  ? 4   DT  C "C3'" 1 
ATOM   316  O  "O3'" . DT  B 2 5   ? -9.732  60.657 42.290 1.00 88.71  ? 4   DT  C "O3'" 1 
ATOM   317  C  "C2'" . DT  B 2 5   ? -10.476 62.414 40.768 1.00 91.76  ? 4   DT  C "C2'" 1 
ATOM   318  C  "C1'" . DT  B 2 5   ? -11.958 62.395 41.113 1.00 91.91  ? 4   DT  C "C1'" 1 
ATOM   319  N  N1    . DT  B 2 5   ? -12.791 63.308 40.311 1.00 90.68  ? 4   DT  C N1    1 
ATOM   320  C  C2    . DT  B 2 5   ? -13.983 62.829 39.817 1.00 89.38  ? 4   DT  C C2    1 
ATOM   321  O  O2    . DT  B 2 5   ? -14.358 61.679 39.976 1.00 87.91  ? 4   DT  C O2    1 
ATOM   322  N  N3    . DT  B 2 5   ? -14.723 63.752 39.123 1.00 88.53  ? 4   DT  C N3    1 
ATOM   323  C  C4    . DT  B 2 5   ? -14.391 65.068 38.869 1.00 88.43  ? 4   DT  C C4    1 
ATOM   324  O  O4    . DT  B 2 5   ? -15.157 65.776 38.231 1.00 88.33  ? 4   DT  C O4    1 
ATOM   325  C  C5    . DT  B 2 5   ? -13.120 65.499 39.401 1.00 89.05  ? 4   DT  C C5    1 
ATOM   326  C  C7    . DT  B 2 5   ? -12.679 66.909 39.171 1.00 88.37  ? 4   DT  C C7    1 
ATOM   327  C  C6    . DT  B 2 5   ? -12.390 64.609 40.083 1.00 89.92  ? 4   DT  C C6    1 
ATOM   328  P  P     . DC  B 2 6   ? -8.692  59.784 41.426 1.00 87.25  ? 5   DC  C P     1 
ATOM   329  O  OP1   . DC  B 2 6   ? -7.969  58.910 42.382 1.00 87.47  ? 5   DC  C OP1   1 
ATOM   330  O  OP2   . DC  B 2 6   ? -7.914  60.638 40.487 1.00 86.42  ? 5   DC  C OP2   1 
ATOM   331  O  "O5'" . DC  B 2 6   ? -9.668  58.865 40.569 1.00 82.42  ? 5   DC  C "O5'" 1 
ATOM   332  C  "C5'" . DC  B 2 6   ? -10.876 58.378 41.141 1.00 75.81  ? 5   DC  C "C5'" 1 
ATOM   333  C  "C4'" . DC  B 2 6   ? -11.750 57.788 40.062 1.00 72.91  ? 5   DC  C "C4'" 1 
ATOM   334  O  "O4'" . DC  B 2 6   ? -12.581 58.797 39.429 1.00 70.94  ? 5   DC  C "O4'" 1 
ATOM   335  C  "C3'" . DC  B 2 6   ? -10.942 57.123 38.947 1.00 69.92  ? 5   DC  C "C3'" 1 
ATOM   336  O  "O3'" . DC  B 2 6   ? -11.486 55.833 38.652 1.00 65.44  ? 5   DC  C "O3'" 1 
ATOM   337  C  "C2'" . DC  B 2 6   ? -11.068 58.087 37.777 1.00 68.99  ? 5   DC  C "C2'" 1 
ATOM   338  C  "C1'" . DC  B 2 6   ? -12.425 58.734 38.018 1.00 68.70  ? 5   DC  C "C1'" 1 
ATOM   339  N  N1    . DC  B 2 6   ? -12.564 60.104 37.484 1.00 66.83  ? 5   DC  C N1    1 
ATOM   340  C  C2    . DC  B 2 6   ? -13.764 60.456 36.853 1.00 65.57  ? 5   DC  C C2    1 
ATOM   341  O  O2    . DC  B 2 6   ? -14.654 59.607 36.753 1.00 64.76  ? 5   DC  C O2    1 
ATOM   342  N  N3    . DC  B 2 6   ? -13.916 61.708 36.362 1.00 64.56  ? 5   DC  C N3    1 
ATOM   343  C  C4    . DC  B 2 6   ? -12.919 62.590 36.468 1.00 65.27  ? 5   DC  C C4    1 
ATOM   344  N  N4    . DC  B 2 6   ? -13.107 63.808 35.951 1.00 63.50  ? 5   DC  C N4    1 
ATOM   345  C  C5    . DC  B 2 6   ? -11.681 62.259 37.105 1.00 65.21  ? 5   DC  C C5    1 
ATOM   346  C  C6    . DC  B 2 6   ? -11.551 61.017 37.596 1.00 65.80  ? 5   DC  C C6    1 
ATOM   347  P  P     . DC  B 2 7   ? -10.605 54.762 37.833 1.00 60.80  ? 6   DC  C P     1 
ATOM   348  O  OP1   . DC  B 2 7   ? -10.938 53.421 38.374 1.00 62.09  ? 6   DC  C OP1   1 
ATOM   349  O  OP2   . DC  B 2 7   ? -9.182  55.183 37.756 1.00 59.57  ? 6   DC  C OP2   1 
ATOM   350  O  "O5'" . DC  B 2 7   ? -11.262 54.893 36.401 1.00 57.00  ? 6   DC  C "O5'" 1 
ATOM   351  C  "C5'" . DC  B 2 7   ? -12.671 54.872 36.285 1.00 51.48  ? 6   DC  C "C5'" 1 
ATOM   352  C  "C4'" . DC  B 2 7   ? -13.055 55.032 34.842 1.00 46.80  ? 6   DC  C "C4'" 1 
ATOM   353  O  "O4'" . DC  B 2 7   ? -13.288 56.433 34.579 1.00 50.15  ? 6   DC  C "O4'" 1 
ATOM   354  C  "C3'" . DC  B 2 7   ? -11.947 54.572 33.898 1.00 45.42  ? 6   DC  C "C3'" 1 
ATOM   355  O  "O3'" . DC  B 2 7   ? -12.406 53.514 33.088 1.00 40.78  ? 6   DC  C "O3'" 1 
ATOM   356  C  "C2'" . DC  B 2 7   ? -11.566 55.816 33.097 1.00 47.03  ? 6   DC  C "C2'" 1 
ATOM   357  C  "C1'" . DC  B 2 7   ? -12.672 56.836 33.371 1.00 48.66  ? 6   DC  C "C1'" 1 
ATOM   358  N  N1    . DC  B 2 7   ? -12.195 58.229 33.561 1.00 49.06  ? 6   DC  C N1    1 
ATOM   359  C  C2    . DC  B 2 7   ? -13.038 59.295 33.214 1.00 48.82  ? 6   DC  C C2    1 
ATOM   360  O  O2    . DC  B 2 7   ? -14.166 59.054 32.783 1.00 50.09  ? 6   DC  C O2    1 
ATOM   361  N  N3    . DC  B 2 7   ? -12.601 60.559 33.363 1.00 48.20  ? 6   DC  C N3    1 
ATOM   362  C  C4    . DC  B 2 7   ? -11.383 60.789 33.843 1.00 47.96  ? 6   DC  C C4    1 
ATOM   363  N  N4    . DC  B 2 7   ? -10.994 62.062 33.974 1.00 46.83  ? 6   DC  C N4    1 
ATOM   364  C  C5    . DC  B 2 7   ? -10.508 59.731 34.213 1.00 48.37  ? 6   DC  C C5    1 
ATOM   365  C  C6    . DC  B 2 7   ? -10.951 58.478 34.059 1.00 48.89  ? 6   DC  C C6    1 
ATOM   366  P  P     . DG  B 2 8   ? -11.367 52.668 32.225 1.00 43.22  ? 7   DG  C P     1 
ATOM   367  O  OP1   . DG  B 2 8   ? -11.814 51.254 32.275 1.00 43.89  ? 7   DG  C OP1   1 
ATOM   368  O  OP2   . DG  B 2 8   ? -9.962  53.022 32.614 1.00 43.20  ? 7   DG  C OP2   1 
ATOM   369  O  "O5'" . DG  B 2 8   ? -11.596 53.219 30.742 1.00 40.91  ? 7   DG  C "O5'" 1 
ATOM   370  C  "C5'" . DG  B 2 8   ? -12.860 53.113 30.097 1.00 39.73  ? 7   DG  C "C5'" 1 
ATOM   371  C  "C4'" . DG  B 2 8   ? -12.838 53.902 28.811 1.00 41.61  ? 7   DG  C "C4'" 1 
ATOM   372  O  "O4'" . DG  B 2 8   ? -12.696 55.324 29.075 1.00 43.96  ? 7   DG  C "O4'" 1 
ATOM   373  C  "C3'" . DG  B 2 8   ? -11.653 53.539 27.917 1.00 42.85  ? 7   DG  C "C3'" 1 
ATOM   374  O  "O3'" . DG  B 2 8   ? -12.067 53.676 26.584 1.00 43.07  ? 7   DG  C "O3'" 1 
ATOM   375  C  "C2'" . DG  B 2 8   ? -10.646 54.632 28.213 1.00 41.86  ? 7   DG  C "C2'" 1 
ATOM   376  C  "C1'" . DG  B 2 8   ? -11.550 55.824 28.403 1.00 38.93  ? 7   DG  C "C1'" 1 
ATOM   377  N  N9    . DG  B 2 8   ? -10.960 56.882 29.210 1.00 39.22  ? 7   DG  C N9    1 
ATOM   378  C  C8    . DG  B 2 8   ? -9.759  56.851 29.880 1.00 40.10  ? 7   DG  C C8    1 
ATOM   379  N  N7    . DG  B 2 8   ? -9.477  57.982 30.482 1.00 41.18  ? 7   DG  C N7    1 
ATOM   380  C  C5    . DG  B 2 8   ? -10.565 58.798 30.201 1.00 40.00  ? 7   DG  C C5    1 
ATOM   381  C  C6    . DG  B 2 8   ? -10.843 60.139 30.599 1.00 44.08  ? 7   DG  C C6    1 
ATOM   382  O  O6    . DG  B 2 8   ? -10.143 60.897 31.287 1.00 41.60  ? 7   DG  C O6    1 
ATOM   383  N  N1    . DG  B 2 8   ? -12.084 60.584 30.107 1.00 41.00  ? 7   DG  C N1    1 
ATOM   384  C  C2    . DG  B 2 8   ? -12.922 59.831 29.316 1.00 41.68  ? 7   DG  C C2    1 
ATOM   385  N  N2    . DG  B 2 8   ? -14.067 60.416 28.931 1.00 42.05  ? 7   DG  C N2    1 
ATOM   386  N  N3    . DG  B 2 8   ? -12.661 58.584 28.930 1.00 42.76  ? 7   DG  C N3    1 
ATOM   387  C  C4    . DG  B 2 8   ? -11.487 58.133 29.418 1.00 40.65  ? 7   DG  C C4    1 
ATOM   388  P  P     . DG  B 2 9   ? -12.651 52.394 25.810 1.00 50.69  ? 8   DG  C P     1 
ATOM   389  O  OP1   . DG  B 2 9   ? -14.131 52.367 25.941 1.00 45.15  ? 8   DG  C OP1   1 
ATOM   390  O  OP2   . DG  B 2 9   ? -11.819 51.157 26.124 1.00 33.64  ? 8   DG  C OP2   1 
ATOM   391  O  "O5'" . DG  B 2 9   ? -12.377 52.802 24.296 1.00 39.33  ? 8   DG  C "O5'" 1 
ATOM   392  C  "C5'" . DG  B 2 9   ? -11.283 52.294 23.626 1.00 28.25  ? 8   DG  C "C5'" 1 
ATOM   393  C  "C4'" . DG  B 2 9   ? -11.080 53.080 22.358 1.00 25.64  ? 8   DG  C "C4'" 1 
ATOM   394  O  "O4'" . DG  B 2 9   ? -10.705 54.454 22.650 1.00 23.24  ? 8   DG  C "O4'" 1 
ATOM   395  C  "C3'" . DG  B 2 9   ? -9.938  52.482 21.578 1.00 21.07  ? 8   DG  C "C3'" 1 
ATOM   396  O  "O3'" . DG  B 2 9   ? -10.274 52.532 20.212 1.00 23.31  ? 8   DG  C "O3'" 1 
ATOM   397  C  "C2'" . DG  B 2 9   ? -8.735  53.301 22.001 1.00 22.89  ? 8   DG  C "C2'" 1 
ATOM   398  C  "C1'" . DG  B 2 9   ? -9.300  54.631 22.478 1.00 21.16  ? 8   DG  C "C1'" 1 
ATOM   399  N  N9    . DG  B 2 9   ? -8.783  55.102 23.755 1.00 23.40  ? 8   DG  C N9    1 
ATOM   400  C  C8    . DG  B 2 9   ? -8.476  54.358 24.870 1.00 23.99  ? 8   DG  C C8    1 
ATOM   401  N  N7    . DG  B 2 9   ? -8.182  55.097 25.915 1.00 24.64  ? 8   DG  C N7    1 
ATOM   402  C  C5    . DG  B 2 9   ? -8.261  56.405 25.446 1.00 24.46  ? 8   DG  C C5    1 
ATOM   403  C  C6    . DG  B 2 9   ? -8.065  57.656 26.112 1.00 27.46  ? 8   DG  C C6    1 
ATOM   404  O  O6    . DG  B 2 9   ? -7.782  57.870 27.293 1.00 30.21  ? 8   DG  C O6    1 
ATOM   405  N  N1    . DG  B 2 9   ? -8.253  58.738 25.244 1.00 26.73  ? 8   DG  C N1    1 
ATOM   406  C  C2    . DG  B 2 9   ? -8.591  58.623 23.904 1.00 27.97  ? 8   DG  C C2    1 
ATOM   407  N  N2    . DG  B 2 9   ? -8.724  59.777 23.192 1.00 24.65  ? 8   DG  C N2    1 
ATOM   408  N  N3    . DG  B 2 9   ? -8.775  57.475 23.293 1.00 24.55  ? 8   DG  C N3    1 
ATOM   409  C  C4    . DG  B 2 9   ? -8.595  56.421 24.105 1.00 25.25  ? 8   DG  C C4    1 
ATOM   410  P  P     . DA  B 2 10  ? -9.342  51.836 19.151 1.00 26.46  ? 9   DA  C P     1 
ATOM   411  O  OP1   . DA  B 2 10  ? -10.166 51.708 17.920 1.00 21.58  ? 9   DA  C OP1   1 
ATOM   412  O  OP2   . DA  B 2 10  ? -8.709  50.621 19.778 1.00 24.40  ? 9   DA  C OP2   1 
ATOM   413  O  "O5'" . DA  B 2 10  ? -8.211  52.924 18.897 1.00 25.41  ? 9   DA  C "O5'" 1 
ATOM   414  C  "C5'" . DA  B 2 10  ? -8.586  54.187 18.391 1.00 29.36  ? 9   DA  C "C5'" 1 
ATOM   415  C  "C4'" . DA  B 2 10  ? -7.424  55.139 18.471 1.00 28.92  ? 9   DA  C "C4'" 1 
ATOM   416  O  "O4'" . DA  B 2 10  ? -7.149  55.508 19.834 1.00 28.92  ? 9   DA  C "O4'" 1 
ATOM   417  C  "C3'" . DA  B 2 10  ? -6.100  54.661 17.874 1.00 30.97  ? 9   DA  C "C3'" 1 
ATOM   418  O  "O3'" . DA  B 2 10  ? -5.665  55.774 17.092 1.00 29.95  ? 9   DA  C "O3'" 1 
ATOM   419  C  "C2'" . DA  B 2 10  ? -5.228  54.409 19.099 1.00 30.52  ? 9   DA  C "C2'" 1 
ATOM   420  C  "C1'" . DA  B 2 10  ? -5.755  55.477 20.056 1.00 31.12  ? 9   DA  C "C1'" 1 
ATOM   421  N  N9    . DA  B 2 10  ? -5.536  55.295 21.491 1.00 28.80  ? 9   DA  C N9    1 
ATOM   422  C  C8    . DA  B 2 10  ? -5.482  54.138 22.209 1.00 29.76  ? 9   DA  C C8    1 
ATOM   423  N  N7    . DA  B 2 10  ? -5.290  54.324 23.502 1.00 31.09  ? 9   DA  C N7    1 
ATOM   424  C  C5    . DA  B 2 10  ? -5.218  55.697 23.638 1.00 30.76  ? 9   DA  C C5    1 
ATOM   425  C  C6    . DA  B 2 10  ? -5.048  56.546 24.775 1.00 31.60  ? 9   DA  C C6    1 
ATOM   426  N  N6    . DA  B 2 10  ? -4.879  56.104 26.029 1.00 27.46  ? 9   DA  C N6    1 
ATOM   427  N  N1    . DA  B 2 10  ? -5.055  57.881 24.559 1.00 31.71  ? 9   DA  C N1    1 
ATOM   428  C  C2    . DA  B 2 10  ? -5.182  58.325 23.290 1.00 29.42  ? 9   DA  C C2    1 
ATOM   429  N  N3    . DA  B 2 10  ? -5.323  57.624 22.155 1.00 26.86  ? 9   DA  C N3    1 
ATOM   430  C  C4    . DA  B 2 10  ? -5.350  56.311 22.402 1.00 27.78  ? 9   DA  C C4    1 
ATOM   431  P  P     . DT  B 2 11  ? -4.455  55.629 16.109 1.00 36.87  ? 10  DT  C P     1 
ATOM   432  O  OP1   . DT  B 2 11  ? -4.217  56.965 15.483 1.00 33.81  ? 10  DT  C OP1   1 
ATOM   433  O  OP2   . DT  B 2 11  ? -4.545  54.385 15.240 1.00 37.01  ? 10  DT  C OP2   1 
ATOM   434  O  "O5'" . DT  B 2 11  ? -3.244  55.443 17.111 1.00 41.57  ? 10  DT  C "O5'" 1 
ATOM   435  C  "C5'" . DT  B 2 11  ? -2.146  56.348 17.072 1.00 43.50  ? 10  DT  C "C5'" 1 
ATOM   436  C  "C4'" . DT  B 2 11  ? -2.621  57.777 17.233 1.00 47.24  ? 10  DT  C "C4'" 1 
ATOM   437  O  "O4'" . DT  B 2 11  ? -3.313  57.949 18.489 1.00 39.10  ? 10  DT  C "O4'" 1 
ATOM   438  C  "C3'" . DT  B 2 11  ? -1.441  58.742 17.264 1.00 48.57  ? 10  DT  C "C3'" 1 
ATOM   439  O  "O3'" . DT  B 2 11  ? -1.709  59.959 16.560 1.00 56.99  ? 10  DT  C "O3'" 1 
ATOM   440  C  "C2'" . DT  B 2 11  ? -1.169  58.948 18.735 1.00 44.66  ? 10  DT  C "C2'" 1 
ATOM   441  C  "C1'" . DT  B 2 11  ? -2.471  58.590 19.434 1.00 39.20  ? 10  DT  C "C1'" 1 
ATOM   442  N  N1    . DT  B 2 11  ? -2.229  57.653 20.545 1.00 36.03  ? 10  DT  C N1    1 
ATOM   443  C  C2    . DT  B 2 11  ? -2.052  58.214 21.759 1.00 36.33  ? 10  DT  C C2    1 
ATOM   444  O  O2    . DT  B 2 11  ? -1.979  59.416 21.905 1.00 40.88  ? 10  DT  C O2    1 
ATOM   445  N  N3    . DT  B 2 11  ? -1.930  57.330 22.794 1.00 33.92  ? 10  DT  C N3    1 
ATOM   446  C  C4    . DT  B 2 11  ? -1.937  55.963 22.720 1.00 34.48  ? 10  DT  C C4    1 
ATOM   447  O  O4    . DT  B 2 11  ? -1.885  55.295 23.749 1.00 31.99  ? 10  DT  C O4    1 
ATOM   448  C  C5    . DT  B 2 11  ? -2.036  55.427 21.384 1.00 35.30  ? 10  DT  C C5    1 
ATOM   449  C  C7    . DT  B 2 11  ? -1.950  53.944 21.188 1.00 29.73  ? 10  DT  C C7    1 
ATOM   450  C  C6    . DT  B 2 11  ? -2.189  56.290 20.376 1.00 32.49  ? 10  DT  C C6    1 
ATOM   451  P  P     . DC  B 2 12  ? -0.508  60.669 15.750 1.00 60.35  ? 11  DC  C P     1 
ATOM   452  O  OP1   . DC  B 2 12  ? -1.082  61.103 14.442 1.00 55.14  ? 11  DC  C OP1   1 
ATOM   453  O  OP2   . DC  B 2 12  ? 0.640   59.699 15.775 1.00 59.05  ? 11  DC  C OP2   1 
ATOM   454  O  "O5'" . DC  B 2 12  ? -0.130  61.889 16.711 1.00 58.05  ? 11  DC  C "O5'" 1 
ATOM   455  C  "C5'" . DC  B 2 12  ? -0.612  61.903 18.058 1.00 61.28  ? 11  DC  C "C5'" 1 
ATOM   456  C  "C4'" . DC  B 2 12  ? 0.406   62.485 19.015 1.00 63.27  ? 11  DC  C "C4'" 1 
ATOM   457  O  "O4'" . DC  B 2 12  ? 0.404   61.653 20.196 1.00 62.27  ? 11  DC  C "O4'" 1 
ATOM   458  C  "C3'" . DC  B 2 12  ? 1.876   62.571 18.583 1.00 66.43  ? 11  DC  C "C3'" 1 
ATOM   459  O  "O3'" . DC  B 2 12  ? 2.479   63.690 19.274 1.00 71.88  ? 11  DC  C "O3'" 1 
ATOM   460  C  "C2'" . DC  B 2 12  ? 2.453   61.279 19.120 1.00 63.49  ? 11  DC  C "C2'" 1 
ATOM   461  C  "C1'" . DC  B 2 12  ? 1.709   61.150 20.431 1.00 60.80  ? 11  DC  C "C1'" 1 
ATOM   462  N  N1    . DC  B 2 12  ? 1.591   59.769 20.922 1.00 56.95  ? 11  DC  C N1    1 
ATOM   463  C  C2    . DC  B 2 12  ? 1.552   59.564 22.302 1.00 53.08  ? 11  DC  C C2    1 
ATOM   464  O  O2    . DC  B 2 12  ? 1.583   60.554 23.041 1.00 53.30  ? 11  DC  C O2    1 
ATOM   465  N  N3    . DC  B 2 12  ? 1.483   58.302 22.787 1.00 50.13  ? 11  DC  C N3    1 
ATOM   466  C  C4    . DC  B 2 12  ? 1.450   57.266 21.942 1.00 48.89  ? 11  DC  C C4    1 
ATOM   467  N  N4    . DC  B 2 12  ? 1.403   56.039 22.458 1.00 45.70  ? 11  DC  C N4    1 
ATOM   468  C  C5    . DC  B 2 12  ? 1.472   57.446 20.526 1.00 50.97  ? 11  DC  C C5    1 
ATOM   469  C  C6    . DC  B 2 12  ? 1.541   58.705 20.062 1.00 53.66  ? 11  DC  C C6    1 
ATOM   470  P  P     . DT  B 2 13  ? 4.015   64.151 18.959 1.00 75.54  ? 12  DT  C P     1 
ATOM   471  O  OP1   . DT  B 2 13  ? 3.904   65.561 18.487 1.00 74.32  ? 12  DT  C OP1   1 
ATOM   472  O  OP2   . DT  B 2 13  ? 4.761   63.155 18.123 1.00 74.64  ? 12  DT  C OP2   1 
ATOM   473  O  "O5'" . DT  B 2 13  ? 4.705   64.142 20.404 1.00 72.85  ? 12  DT  C "O5'" 1 
ATOM   474  C  "C5'" . DT  B 2 13  ? 4.041   64.685 21.549 1.00 72.28  ? 12  DT  C "C5'" 1 
ATOM   475  C  "C4'" . DT  B 2 13  ? 4.739   64.254 22.822 1.00 73.44  ? 12  DT  C "C4'" 1 
ATOM   476  O  "O4'" . DT  B 2 13  ? 4.451   62.869 23.145 1.00 71.28  ? 12  DT  C "O4'" 1 
ATOM   477  C  "C3'" . DT  B 2 13  ? 6.269   64.378 22.827 1.00 75.00  ? 12  DT  C "C3'" 1 
ATOM   478  O  "O3'" . DT  B 2 13  ? 6.718   64.902 24.086 1.00 79.83  ? 12  DT  C "O3'" 1 
ATOM   479  C  "C2'" . DT  B 2 13  ? 6.740   62.937 22.699 1.00 72.73  ? 12  DT  C "C2'" 1 
ATOM   480  C  "C1'" . DT  B 2 13  ? 5.667   62.203 23.479 1.00 69.28  ? 12  DT  C "C1'" 1 
ATOM   481  N  N1    . DT  B 2 13  ? 5.520   60.773 23.146 1.00 64.11  ? 12  DT  C N1    1 
ATOM   482  C  C2    . DT  B 2 13  ? 5.512   59.870 24.181 1.00 61.03  ? 12  DT  C C2    1 
ATOM   483  O  O2    . DT  B 2 13  ? 5.655   60.196 25.347 1.00 59.16  ? 12  DT  C O2    1 
ATOM   484  N  N3    . DT  B 2 13  ? 5.329   58.561 23.797 1.00 60.90  ? 12  DT  C N3    1 
ATOM   485  C  C4    . DT  B 2 13  ? 5.157   58.084 22.508 1.00 59.71  ? 12  DT  C C4    1 
ATOM   486  O  O4    . DT  B 2 13  ? 4.974   56.889 22.321 1.00 58.69  ? 12  DT  C O4    1 
ATOM   487  C  C5    . DT  B 2 13  ? 5.205   59.090 21.465 1.00 60.42  ? 12  DT  C C5    1 
ATOM   488  C  C7    . DT  B 2 13  ? 5.059   58.671 20.036 1.00 59.59  ? 12  DT  C C7    1 
ATOM   489  C  C6    . DT  B 2 13  ? 5.381   60.365 21.833 1.00 62.27  ? 12  DT  C C6    1 
ATOM   490  P  P     . DA  B 2 14  ? 8.255   65.340 24.268 1.00 82.14  ? 13  DA  C P     1 
ATOM   491  O  OP1   . DA  B 2 14  ? 8.227   66.677 24.910 1.00 81.84  ? 13  DA  C OP1   1 
ATOM   492  O  OP2   . DA  B 2 14  ? 8.951   65.153 22.965 1.00 80.46  ? 13  DA  C OP2   1 
ATOM   493  O  "O5'" . DA  B 2 14  ? 8.848   64.290 25.305 1.00 83.69  ? 13  DA  C "O5'" 1 
ATOM   494  C  "C5'" . DA  B 2 14  ? 8.178   64.017 26.530 1.00 88.11  ? 13  DA  C "C5'" 1 
ATOM   495  C  "C4'" . DA  B 2 14  ? 8.719   62.749 27.151 1.00 91.10  ? 13  DA  C "C4'" 1 
ATOM   496  O  "O4'" . DA  B 2 14  ? 8.369   61.588 26.350 1.00 90.81  ? 13  DA  C "O4'" 1 
ATOM   497  C  "C3'" . DA  B 2 14  ? 10.240  62.694 27.332 1.00 93.26  ? 13  DA  C "C3'" 1 
ATOM   498  O  "O3'" . DA  B 2 14  ? 10.518  62.104 28.619 1.00 98.23  ? 13  DA  C "O3'" 1 
ATOM   499  C  "C2'" . DA  B 2 14  ? 10.694  61.787 26.193 1.00 90.71  ? 13  DA  C "C2'" 1 
ATOM   500  C  "C1'" . DA  B 2 14  ? 9.535   60.804 26.127 1.00 88.90  ? 13  DA  C "C1'" 1 
ATOM   501  N  N9    . DA  B 2 14  ? 9.358   60.053 24.878 1.00 85.34  ? 13  DA  C N9    1 
ATOM   502  C  C8    . DA  B 2 14  ? 9.536   60.472 23.582 1.00 84.24  ? 13  DA  C C8    1 
ATOM   503  N  N7    . DA  B 2 14  ? 9.283   59.542 22.683 1.00 82.25  ? 13  DA  C N7    1 
ATOM   504  C  C5    . DA  B 2 14  ? 8.913   58.437 23.437 1.00 80.97  ? 13  DA  C C5    1 
ATOM   505  C  C6    . DA  B 2 14  ? 8.517   57.118 23.078 1.00 79.23  ? 13  DA  C C6    1 
ATOM   506  N  N6    . DA  B 2 14  ? 8.395   56.684 21.822 1.00 76.10  ? 13  DA  C N6    1 
ATOM   507  N  N1    . DA  B 2 14  ? 8.239   56.257 24.078 1.00 78.63  ? 13  DA  C N1    1 
ATOM   508  C  C2    . DA  B 2 14  ? 8.332   56.691 25.347 1.00 80.29  ? 13  DA  C C2    1 
ATOM   509  N  N3    . DA  B 2 14  ? 8.674   57.901 25.810 1.00 81.89  ? 13  DA  C N3    1 
ATOM   510  C  C4    . DA  B 2 14  ? 8.959   58.735 24.792 1.00 82.74  ? 13  DA  C C4    1 
ATOM   511  P  P     . DC  B 2 15  ? 11.928  62.383 29.362 1.00 101.75 ? 14  DC  C P     1 
ATOM   512  O  OP1   . DC  B 2 15  ? 11.712  63.316 30.507 1.00 100.03 ? 14  DC  C OP1   1 
ATOM   513  O  OP2   . DC  B 2 15  ? 12.945  62.715 28.315 1.00 101.06 ? 14  DC  C OP2   1 
ATOM   514  O  "O5'" . DC  B 2 15  ? 12.294  60.958 29.980 1.00 101.53 ? 14  DC  C "O5'" 1 
ATOM   515  C  "C5'" . DC  B 2 15  ? 11.313  60.186 30.672 1.00 101.76 ? 14  DC  C "C5'" 1 
ATOM   516  C  "C4'" . DC  B 2 15  ? 11.639  58.715 30.564 1.00 102.15 ? 14  DC  C "C4'" 1 
ATOM   517  O  "O4'" . DC  B 2 15  ? 11.287  58.203 29.249 1.00 100.21 ? 14  DC  C "O4'" 1 
ATOM   518  C  "C3'" . DC  B 2 15  ? 13.125  58.410 30.762 1.00 103.78 ? 14  DC  C "C3'" 1 
ATOM   519  O  "O3'" . DC  B 2 15  ? 13.305  57.293 31.651 1.00 108.32 ? 14  DC  C "O3'" 1 
ATOM   520  C  "C2'" . DC  B 2 15  ? 13.615  58.102 29.353 1.00 100.90 ? 14  DC  C "C2'" 1 
ATOM   521  C  "C1'" . DC  B 2 15  ? 12.384  57.474 28.729 1.00 97.78  ? 14  DC  C "C1'" 1 
ATOM   522  N  N1    . DC  B 2 15  ? 12.317  57.497 27.254 1.00 94.42  ? 14  DC  C N1    1 
ATOM   523  C  C2    . DC  B 2 15  ? 11.920  56.326 26.593 1.00 92.67  ? 14  DC  C C2    1 
ATOM   524  O  O2    . DC  B 2 15  ? 11.604  55.334 27.272 1.00 91.64  ? 14  DC  C O2    1 
ATOM   525  N  N3    . DC  B 2 15  ? 11.888  56.301 25.239 1.00 90.04  ? 14  DC  C N3    1 
ATOM   526  C  C4    . DC  B 2 15  ? 12.219  57.388 24.546 1.00 89.55  ? 14  DC  C C4    1 
ATOM   527  N  N4    . DC  B 2 15  ? 12.179  57.307 23.210 1.00 87.13  ? 14  DC  C N4    1 
ATOM   528  C  C5    . DC  B 2 15  ? 12.608  58.605 25.192 1.00 90.81  ? 14  DC  C C5    1 
ATOM   529  C  C6    . DC  B 2 15  ? 12.642  58.614 26.536 1.00 92.65  ? 14  DC  C C6    1 
ATOM   530  P  P     . DC  B 2 16  ? 14.767  56.993 32.275 1.00 111.83 ? 15  DC  C P     1 
ATOM   531  O  OP1   . DC  B 2 16  ? 14.651  55.800 33.164 1.00 110.85 ? 15  DC  C OP1   1 
ATOM   532  O  OP2   . DC  B 2 16  ? 15.321  58.268 32.820 1.00 110.56 ? 15  DC  C OP2   1 
ATOM   533  O  "O5'" . DC  B 2 16  ? 15.627  56.585 30.992 1.00 111.79 ? 15  DC  C "O5'" 1 
ATOM   534  C  "C5'" . DC  B 2 16  ? 16.614  55.555 31.045 1.00 111.57 ? 15  DC  C "C5'" 1 
ATOM   535  C  "C4'" . DC  B 2 16  ? 16.068  54.283 30.438 1.00 111.71 ? 15  DC  C "C4'" 1 
ATOM   536  O  "O4'" . DC  B 2 16  ? 15.293  54.593 29.256 1.00 111.52 ? 15  DC  C "O4'" 1 
ATOM   537  C  "C3'" . DC  B 2 16  ? 17.137  53.291 29.982 1.00 112.04 ? 15  DC  C "C3'" 1 
ATOM   538  O  "O3'" . DC  B 2 16  ? 16.596  51.960 29.981 1.00 112.45 ? 15  DC  C "O3'" 1 
ATOM   539  C  "C2'" . DC  B 2 16  ? 17.329  53.672 28.525 1.00 111.60 ? 15  DC  C "C2'" 1 
ATOM   540  C  "C1'" . DC  B 2 16  ? 15.903  54.005 28.114 1.00 111.46 ? 15  DC  C "C1'" 1 
ATOM   541  N  N1    . DC  B 2 16  ? 15.785  54.956 27.001 1.00 110.95 ? 15  DC  C N1    1 
ATOM   542  C  C2    . DC  B 2 16  ? 15.349  54.486 25.762 1.00 110.41 ? 15  DC  C C2    1 
ATOM   543  O  O2    . DC  B 2 16  ? 15.087  53.283 25.637 1.00 109.05 ? 15  DC  C O2    1 
ATOM   544  N  N3    . DC  B 2 16  ? 15.220  55.354 24.735 1.00 110.39 ? 15  DC  C N3    1 
ATOM   545  C  C4    . DC  B 2 16  ? 15.502  56.645 24.915 1.00 110.94 ? 15  DC  C C4    1 
ATOM   546  N  N4    . DC  B 2 16  ? 15.340  57.466 23.881 1.00 111.31 ? 15  DC  C N4    1 
ATOM   547  C  C5    . DC  B 2 16  ? 15.958  57.151 26.167 1.00 111.14 ? 15  DC  C C5    1 
ATOM   548  C  C6    . DC  B 2 16  ? 16.087  56.279 27.173 1.00 111.39 ? 15  DC  C C6    1 
ATOM   549  N  N     . PRO C 3 2   ? -19.242 53.190 20.789 1.00 29.72  ? 2   PRO A N     1 
ATOM   550  C  CA    . PRO C 3 2   ? -19.671 51.841 20.299 1.00 25.62  ? 2   PRO A CA    1 
ATOM   551  C  C     . PRO C 3 2   ? -18.508 50.875 20.029 1.00 25.68  ? 2   PRO A C     1 
ATOM   552  O  O     . PRO C 3 2   ? -17.422 51.288 19.603 1.00 21.69  ? 2   PRO A O     1 
ATOM   553  C  CB    . PRO C 3 2   ? -20.484 52.066 19.028 1.00 29.07  ? 2   PRO A CB    1 
ATOM   554  C  CG    . PRO C 3 2   ? -20.237 53.546 18.699 1.00 30.29  ? 2   PRO A CG    1 
ATOM   555  C  CD    . PRO C 3 2   ? -19.965 54.240 20.040 1.00 30.37  ? 2   PRO A CD    1 
ATOM   556  N  N     . GLU C 3 3   ? -18.748 49.579 20.245 1.00 24.32  ? 3   GLU A N     1 
ATOM   557  C  CA    . GLU C 3 3   ? -17.735 48.553 20.023 1.00 21.90  ? 3   GLU A CA    1 
ATOM   558  C  C     . GLU C 3 3   ? -17.841 48.012 18.584 1.00 22.72  ? 3   GLU A C     1 
ATOM   559  O  O     . GLU C 3 3   ? -18.774 48.347 17.867 1.00 25.85  ? 3   GLU A O     1 
ATOM   560  C  CB    . GLU C 3 3   ? -17.876 47.470 21.119 1.00 23.06  ? 3   GLU A CB    1 
ATOM   561  C  CG    . GLU C 3 3   ? -17.340 47.977 22.485 1.00 31.04  ? 3   GLU A CG    1 
ATOM   562  C  CD    . GLU C 3 3   ? -15.819 48.317 22.462 1.00 33.17  ? 3   GLU A CD    1 
ATOM   563  O  OE1   . GLU C 3 3   ? -15.322 48.989 23.398 1.00 37.19  ? 3   GLU A OE1   1 
ATOM   564  O  OE2   . GLU C 3 3   ? -15.098 47.922 21.516 1.00 34.26  ? 3   GLU A OE2   1 
ATOM   565  N  N     . LEU C 3 4   ? -16.896 47.188 18.144 1.00 21.36  ? 4   LEU A N     1 
ATOM   566  C  CA    . LEU C 3 4   ? -16.863 46.745 16.769 1.00 22.55  ? 4   LEU A CA    1 
ATOM   567  C  C     . LEU C 3 4   ? -18.206 46.276 16.197 1.00 25.54  ? 4   LEU A C     1 
ATOM   568  O  O     . LEU C 3 4   ? -18.589 46.714 15.092 1.00 25.87  ? 4   LEU A O     1 
ATOM   569  C  CB    . LEU C 3 4   ? -15.687 45.737 16.567 1.00 22.57  ? 4   LEU A CB    1 
ATOM   570  C  CG    . LEU C 3 4   ? -15.273 45.243 15.160 1.00 25.55  ? 4   LEU A CG    1 
ATOM   571  C  CD1   . LEU C 3 4   ? -13.792 44.726 15.139 1.00 27.72  ? 4   LEU A CD1   1 
ATOM   572  C  CD2   . LEU C 3 4   ? -16.199 44.102 14.725 1.00 24.72  ? 4   LEU A CD2   1 
ATOM   573  N  N     . PRO C 3 5   ? -18.975 45.443 16.937 1.00 25.76  ? 5   PRO A N     1 
ATOM   574  C  CA    . PRO C 3 5   ? -20.270 44.969 16.435 1.00 25.57  ? 5   PRO A CA    1 
ATOM   575  C  C     . PRO C 3 5   ? -21.227 46.101 16.093 1.00 23.82  ? 5   PRO A C     1 
ATOM   576  O  O     . PRO C 3 5   ? -21.870 46.064 15.033 1.00 25.32  ? 5   PRO A O     1 
ATOM   577  C  CB    . PRO C 3 5   ? -20.798 44.115 17.595 1.00 27.64  ? 5   PRO A CB    1 
ATOM   578  C  CG    . PRO C 3 5   ? -19.487 43.495 18.132 1.00 26.39  ? 5   PRO A CG    1 
ATOM   579  C  CD    . PRO C 3 5   ? -18.624 44.749 18.201 1.00 26.43  ? 5   PRO A CD    1 
ATOM   580  N  N     . GLU C 3 6   ? -21.339 47.082 16.993 1.00 23.34  ? 6   GLU A N     1 
ATOM   581  C  CA    . GLU C 3 6   ? -22.221 48.243 16.785 1.00 26.17  ? 6   GLU A CA    1 
ATOM   582  C  C     . GLU C 3 6   ? -21.748 49.078 15.597 1.00 20.88  ? 6   GLU A C     1 
ATOM   583  O  O     . GLU C 3 6   ? -22.570 49.592 14.856 1.00 23.47  ? 6   GLU A O     1 
ATOM   584  C  CB    . GLU C 3 6   ? -22.259 49.207 17.987 1.00 28.37  ? 6   GLU A CB    1 
ATOM   585  C  CG    . GLU C 3 6   ? -22.894 48.694 19.247 1.00 39.61  ? 6   GLU A CG    1 
ATOM   586  C  CD    . GLU C 3 6   ? -21.864 48.087 20.183 1.00 45.99  ? 6   GLU A CD    1 
ATOM   587  O  OE1   . GLU C 3 6   ? -21.358 46.955 19.880 1.00 46.85  ? 6   GLU A OE1   1 
ATOM   588  O  OE2   . GLU C 3 6   ? -21.555 48.761 21.213 1.00 43.60  ? 6   GLU A OE2   1 
ATOM   589  N  N     . VAL C 3 7   ? -20.433 49.231 15.446 1.00 22.10  ? 7   VAL A N     1 
ATOM   590  C  CA    . VAL C 3 7   ? -19.891 50.017 14.344 1.00 18.97  ? 7   VAL A CA    1 
ATOM   591  C  C     . VAL C 3 7   ? -20.253 49.305 13.058 1.00 21.22  ? 7   VAL A C     1 
ATOM   592  O  O     . VAL C 3 7   ? -20.679 49.941 12.109 1.00 19.34  ? 7   VAL A O     1 
ATOM   593  C  CB    . VAL C 3 7   ? -18.352 50.232 14.436 1.00 17.39  ? 7   VAL A CB    1 
ATOM   594  C  CG1   . VAL C 3 7   ? -17.902 50.979 13.201 1.00 16.72  ? 7   VAL A CG1   1 
ATOM   595  C  CG2   . VAL C 3 7   ? -17.992 51.093 15.677 1.00 15.50  ? 7   VAL A CG2   1 
ATOM   596  N  N     . GLU C 3 8   ? -20.147 47.979 13.025 1.00 20.07  ? 8   GLU A N     1 
ATOM   597  C  CA    . GLU C 3 8   ? -20.539 47.249 11.806 1.00 23.23  ? 8   GLU A CA    1 
ATOM   598  C  C     . GLU C 3 8   ? -22.050 47.453 11.496 1.00 23.79  ? 8   GLU A C     1 
ATOM   599  O  O     . GLU C 3 8   ? -22.470 47.500 10.349 1.00 25.71  ? 8   GLU A O     1 
ATOM   600  C  CB    . GLU C 3 8   ? -20.241 45.758 11.958 1.00 27.67  ? 8   GLU A CB    1 
ATOM   601  C  CG    . GLU C 3 8   ? -20.664 44.928 10.734 1.00 31.77  ? 8   GLU A CG    1 
ATOM   602  C  CD    . GLU C 3 8   ? -20.046 45.421 9.410  1.00 33.38  ? 8   GLU A CD    1 
ATOM   603  O  OE1   . GLU C 3 8   ? -18.875 45.899 9.385  1.00 28.56  ? 8   GLU A OE1   1 
ATOM   604  O  OE2   . GLU C 3 8   ? -20.747 45.305 8.376  1.00 37.87  ? 8   GLU A OE2   1 
ATOM   605  N  N     . THR C 3 9   ? -22.865 47.582 12.524 1.00 24.59  ? 9   THR A N     1 
ATOM   606  C  CA    . THR C 3 9   ? -24.310 47.787 12.348 1.00 23.90  ? 9   THR A CA    1 
ATOM   607  C  C     . THR C 3 9   ? -24.539 49.214 11.793 1.00 25.32  ? 9   THR A C     1 
ATOM   608  O  O     . THR C 3 9   ? -25.357 49.421 10.902 1.00 24.63  ? 9   THR A O     1 
ATOM   609  C  CB    . THR C 3 9   ? -25.016 47.589 13.718 1.00 26.52  ? 9   THR A CB    1 
ATOM   610  O  OG1   . THR C 3 9   ? -24.913 46.201 14.080 1.00 26.32  ? 9   THR A OG1   1 
ATOM   611  C  CG2   . THR C 3 9   ? -26.466 47.976 13.687 1.00 22.58  ? 9   THR A CG2   1 
ATOM   612  N  N     . ILE C 3 10  ? -23.802 50.182 12.334 1.00 23.34  ? 10  ILE A N     1 
ATOM   613  C  CA    . ILE C 3 10  ? -23.892 51.546 11.869 1.00 24.17  ? 10  ILE A CA    1 
ATOM   614  C  C     . ILE C 3 10  ? -23.459 51.568 10.415 1.00 22.06  ? 10  ILE A C     1 
ATOM   615  O  O     . ILE C 3 10  ? -24.095 52.186 9.595  1.00 23.21  ? 10  ILE A O     1 
ATOM   616  C  CB    . ILE C 3 10  ? -22.982 52.452 12.716 1.00 22.24  ? 10  ILE A CB    1 
ATOM   617  C  CG1   . ILE C 3 10  ? -23.613 52.580 14.107 1.00 22.27  ? 10  ILE A CG1   1 
ATOM   618  C  CG2   . ILE C 3 10  ? -22.798 53.854 12.054 1.00 22.93  ? 10  ILE A CG2   1 
ATOM   619  C  CD1   . ILE C 3 10  ? -22.711 53.125 15.202 1.00 23.28  ? 10  ILE A CD1   1 
ATOM   620  N  N     . ARG C 3 11  ? -22.384 50.882 10.084 1.00 20.73  ? 11  ARG A N     1 
ATOM   621  C  CA    . ARG C 3 11  ? -21.939 50.919 8.709  1.00 22.34  ? 11  ARG A CA    1 
ATOM   622  C  C     . ARG C 3 11  ? -23.007 50.395 7.774  1.00 25.20  ? 11  ARG A C     1 
ATOM   623  O  O     . ARG C 3 11  ? -23.259 50.964 6.726  1.00 24.98  ? 11  ARG A O     1 
ATOM   624  C  CB    . ARG C 3 11  ? -20.709 50.057 8.509  1.00 18.89  ? 11  ARG A CB    1 
ATOM   625  C  CG    . ARG C 3 11  ? -20.188 50.097 7.090  1.00 22.94  ? 11  ARG A CG    1 
ATOM   626  C  CD    . ARG C 3 11  ? -19.376 48.828 6.792  1.00 25.39  ? 11  ARG A CD    1 
ATOM   627  N  NE    . ARG C 3 11  ? -20.288 47.720 6.609  1.00 25.09  ? 11  ARG A NE    1 
ATOM   628  C  CZ    . ARG C 3 11  ? -21.089 47.609 5.553  1.00 30.58  ? 11  ARG A CZ    1 
ATOM   629  N  NH1   . ARG C 3 11  ? -21.058 48.521 4.584  1.00 28.76  ? 11  ARG A NH1   1 
ATOM   630  N  NH2   . ARG C 3 11  ? -21.995 46.656 5.502  1.00 29.43  ? 11  ARG A NH2   1 
ATOM   631  N  N     . ARG C 3 12  ? -23.617 49.277 8.149  1.00 20.52  ? 12  ARG A N     1 
ATOM   632  C  CA    . ARG C 3 12  ? -24.624 48.663 7.308  1.00 22.82  ? 12  ARG A CA    1 
ATOM   633  C  C     . ARG C 3 12  ? -25.902 49.480 7.182  1.00 21.68  ? 12  ARG A C     1 
ATOM   634  O  O     . ARG C 3 12  ? -26.481 49.605 6.110  1.00 23.92  ? 12  ARG A O     1 
ATOM   635  C  CB    . ARG C 3 12  ? -24.955 47.272 7.886  1.00 28.56  ? 12  ARG A CB    1 
ATOM   636  C  CG    . ARG C 3 12  ? -25.896 46.426 7.029  1.00 33.82  ? 12  ARG A CG    1 
ATOM   637  C  CD    . ARG C 3 12  ? -26.188 45.061 7.680  1.00 33.40  ? 12  ARG A CD    1 
ATOM   638  N  NE    . ARG C 3 12  ? -27.155 45.233 8.752  1.00 42.23  ? 12  ARG A NE    1 
ATOM   639  C  CZ    . ARG C 3 12  ? -26.878 45.108 10.049 1.00 44.89  ? 12  ARG A CZ    1 
ATOM   640  N  NH1   . ARG C 3 12  ? -27.859 45.315 10.935 1.00 42.93  ? 12  ARG A NH1   1 
ATOM   641  N  NH2   . ARG C 3 12  ? -25.641 44.751 10.453 1.00 43.13  ? 12  ARG A NH2   1 
ATOM   642  N  N     A THR C 3 13  ? -26.338 50.055 8.286  0.50 22.18  ? 13  THR A N     1 
ATOM   643  N  N     B THR C 3 13  ? -26.354 50.055 8.284  0.50 21.32  ? 13  THR A N     1 
ATOM   644  C  CA    A THR C 3 13  ? -27.562 50.824 8.277  0.50 24.76  ? 13  THR A CA    1 
ATOM   645  C  CA    B THR C 3 13  ? -27.588 50.824 8.258  0.50 22.57  ? 13  THR A CA    1 
ATOM   646  C  C     A THR C 3 13  ? -27.427 52.248 7.718  0.50 24.32  ? 13  THR A C     1 
ATOM   647  C  C     B THR C 3 13  ? -27.453 52.280 7.772  0.50 23.33  ? 13  THR A C     1 
ATOM   648  O  O     A THR C 3 13  ? -28.358 52.765 7.089  0.50 21.41  ? 13  THR A O     1 
ATOM   649  O  O     B THR C 3 13  ? -28.418 52.859 7.257  0.50 20.35  ? 13  THR A O     1 
ATOM   650  C  CB    A THR C 3 13  ? -28.134 50.888 9.697  0.50 25.59  ? 13  THR A CB    1 
ATOM   651  C  CB    B THR C 3 13  ? -28.256 50.783 9.647  0.50 21.88  ? 13  THR A CB    1 
ATOM   652  O  OG1   A THR C 3 13  ? -28.207 49.553 10.230 0.50 31.28  ? 13  THR A OG1   1 
ATOM   653  O  OG1   B THR C 3 13  ? -27.370 51.324 10.628 0.50 17.09  ? 13  THR A OG1   1 
ATOM   654  C  CG2   A THR C 3 13  ? -29.520 51.484 9.675  0.50 27.32  ? 13  THR A CG2   1 
ATOM   655  C  CG2   B THR C 3 13  ? -28.553 49.318 10.031 0.50 24.72  ? 13  THR A CG2   1 
ATOM   656  N  N     . LEU C 3 14  ? -26.273 52.879 7.939  1.00 23.49  ? 14  LEU A N     1 
ATOM   657  C  CA    . LEU C 3 14  ? -26.053 54.267 7.461  1.00 21.79  ? 14  LEU A CA    1 
ATOM   658  C  C     . LEU C 3 14  ? -25.874 54.328 5.971  1.00 17.02  ? 14  LEU A C     1 
ATOM   659  O  O     . LEU C 3 14  ? -26.385 55.223 5.360  1.00 20.24  ? 14  LEU A O     1 
ATOM   660  C  CB    . LEU C 3 14  ? -24.779 54.899 8.044  1.00 23.52  ? 14  LEU A CB    1 
ATOM   661  C  CG    . LEU C 3 14  ? -24.728 56.101 8.969  1.00 25.21  ? 14  LEU A CG    1 
ATOM   662  C  CD1   . LEU C 3 14  ? -23.335 56.694 8.815  1.00 18.99  ? 14  LEU A CD1   1 
ATOM   663  C  CD2   . LEU C 3 14  ? -25.807 57.142 8.705  1.00 22.56  ? 14  LEU A CD2   1 
ATOM   664  N  N     . LEU C 3 15  ? -25.162 53.387 5.372  1.00 18.86  ? 15  LEU A N     1 
ATOM   665  C  CA    . LEU C 3 15  ? -24.872 53.449 3.914  1.00 20.16  ? 15  LEU A CA    1 
ATOM   666  C  C     . LEU C 3 15  ? -26.071 53.816 3.056  1.00 19.80  ? 15  LEU A C     1 
ATOM   667  O  O     . LEU C 3 15  ? -26.013 54.757 2.287  1.00 21.38  ? 15  LEU A O     1 
ATOM   668  C  CB    . LEU C 3 15  ? -24.342 52.123 3.389  1.00 21.39  ? 15  LEU A CB    1 
ATOM   669  C  CG    . LEU C 3 15  ? -23.296 52.088 2.278  1.00 30.77  ? 15  LEU A CG    1 
ATOM   670  C  CD1   . LEU C 3 15  ? -23.425 50.773 1.555  1.00 31.34  ? 15  LEU A CD1   1 
ATOM   671  C  CD2   . LEU C 3 15  ? -23.433 53.199 1.309  1.00 28.65  ? 15  LEU A CD2   1 
ATOM   672  N  N     . PRO C 3 16  ? -27.148 53.031 3.117  1.00 21.63  ? 16  PRO A N     1 
ATOM   673  C  CA    . PRO C 3 16  ? -28.313 53.393 2.284  1.00 20.76  ? 16  PRO A CA    1 
ATOM   674  C  C     . PRO C 3 16  ? -28.892 54.795 2.518  1.00 21.40  ? 16  PRO A C     1 
ATOM   675  O  O     . PRO C 3 16  ? -29.441 55.395 1.594  1.00 25.66  ? 16  PRO A O     1 
ATOM   676  C  CB    . PRO C 3 16  ? -29.353 52.269 2.576  1.00 21.45  ? 16  PRO A CB    1 
ATOM   677  C  CG    . PRO C 3 16  ? -28.889 51.574 3.812  1.00 22.30  ? 16  PRO A CG    1 
ATOM   678  C  CD    . PRO C 3 16  ? -27.328 51.701 3.748  1.00 23.72  ? 16  PRO A CD    1 
ATOM   679  N  N     . LEU C 3 17  ? -28.777 55.329 3.733  1.00 21.11  ? 17  LEU A N     1 
ATOM   680  C  CA    . LEU C 3 17  ? -29.298 56.668 4.043  1.00 19.63  ? 17  LEU A CA    1 
ATOM   681  C  C     . LEU C 3 17  ? -28.451 57.808 3.483  1.00 20.90  ? 17  LEU A C     1 
ATOM   682  O  O     . LEU C 3 17  ? -28.880 58.960 3.496  1.00 19.67  ? 17  LEU A O     1 
ATOM   683  C  CB    . LEU C 3 17  ? -29.429 56.851 5.552  1.00 20.39  ? 17  LEU A CB    1 
ATOM   684  C  CG    . LEU C 3 17  ? -30.125 55.600 6.089  1.00 26.00  ? 17  LEU A CG    1 
ATOM   685  C  CD1   . LEU C 3 17  ? -30.289 55.655 7.651  1.00 22.94  ? 17  LEU A CD1   1 
ATOM   686  C  CD2   . LEU C 3 17  ? -31.514 55.512 5.373  1.00 25.01  ? 17  LEU A CD2   1 
ATOM   687  N  N     . ILE C 3 18  ? -27.266 57.509 2.963  1.00 19.22  ? 18  ILE A N     1 
ATOM   688  C  CA    . ILE C 3 18  ? -26.453 58.595 2.447  1.00 19.30  ? 18  ILE A CA    1 
ATOM   689  C  C     . ILE C 3 18  ? -25.841 58.309 1.103  1.00 17.54  ? 18  ILE A C     1 
ATOM   690  O  O     . ILE C 3 18  ? -25.358 59.209 0.445  1.00 16.90  ? 18  ILE A O     1 
ATOM   691  C  CB    . ILE C 3 18  ? -25.280 58.953 3.424  1.00 19.83  ? 18  ILE A CB    1 
ATOM   692  C  CG1   . ILE C 3 18  ? -24.376 57.730 3.663  1.00 17.95  ? 18  ILE A CG1   1 
ATOM   693  C  CG2   . ILE C 3 18  ? -25.851 59.469 4.724  1.00 18.48  ? 18  ILE A CG2   1 
ATOM   694  C  CD1   . ILE C 3 18  ? -23.121 58.034 4.569  1.00 16.89  ? 18  ILE A CD1   1 
ATOM   695  N  N     . VAL C 3 19  ? -25.833 57.056 0.690  1.00 15.97  ? 19  VAL A N     1 
ATOM   696  C  CA    . VAL C 3 19  ? -25.214 56.768 -0.594 1.00 18.31  ? 19  VAL A CA    1 
ATOM   697  C  C     . VAL C 3 19  ? -25.808 57.606 -1.746 1.00 16.74  ? 19  VAL A C     1 
ATOM   698  O  O     . VAL C 3 19  ? -27.032 57.766 -1.854 1.00 17.46  ? 19  VAL A O     1 
ATOM   699  C  CB    . VAL C 3 19  ? -25.327 55.270 -0.892 1.00 19.10  ? 19  VAL A CB    1 
ATOM   700  C  CG1   . VAL C 3 19  ? -26.767 54.927 -1.235 1.00 20.28  ? 19  VAL A CG1   1 
ATOM   701  C  CG2   . VAL C 3 19  ? -24.291 54.871 -1.937 1.00 23.14  ? 19  VAL A CG2   1 
ATOM   702  N  N     . GLY C 3 20  ? -24.950 58.177 -2.588 1.00 20.52  ? 20  GLY A N     1 
ATOM   703  C  CA    . GLY C 3 20  ? -25.465 58.967 -3.705 1.00 17.85  ? 20  GLY A CA    1 
ATOM   704  C  C     . GLY C 3 20  ? -25.790 60.429 -3.413 1.00 19.12  ? 20  GLY A C     1 
ATOM   705  O  O     . GLY C 3 20  ? -26.083 61.183 -4.340 1.00 17.73  ? 20  GLY A O     1 
ATOM   706  N  N     . LYS C 3 21  ? -25.776 60.846 -2.153 1.00 15.66  ? 21  LYS A N     1 
ATOM   707  C  CA    . LYS C 3 21  ? -26.003 62.268 -1.847 1.00 17.30  ? 21  LYS A CA    1 
ATOM   708  C  C     . LYS C 3 21  ? -24.705 63.099 -2.066 1.00 19.14  ? 21  LYS A C     1 
ATOM   709  O  O     . LYS C 3 21  ? -23.608 62.600 -1.837 1.00 18.90  ? 21  LYS A O     1 
ATOM   710  C  CB    . LYS C 3 21  ? -26.448 62.404 -0.420 1.00 14.04  ? 21  LYS A CB    1 
ATOM   711  C  CG    . LYS C 3 21  ? -27.736 61.587 -0.213 1.00 19.61  ? 21  LYS A CG    1 
ATOM   712  C  CD    . LYS C 3 21  ? -28.496 62.030 1.036  1.00 19.20  ? 21  LYS A CD    1 
ATOM   713  C  CE    . LYS C 3 21  ? -29.861 61.213 1.187  1.00 20.01  ? 21  LYS A CE    1 
ATOM   714  N  NZ    . LYS C 3 21  ? -30.304 61.393 2.610  1.00 22.55  ? 21  LYS A NZ    1 
ATOM   715  N  N     . THR C 3 22  ? -24.841 64.369 -2.461 1.00 16.94  ? 22  THR A N     1 
ATOM   716  C  CA    . THR C 3 22  ? -23.671 65.251 -2.736 1.00 14.29  ? 22  THR A CA    1 
ATOM   717  C  C     . THR C 3 22  ? -23.581 66.297 -1.631 1.00 13.38  ? 22  THR A C     1 
ATOM   718  O  O     . THR C 3 22  ? -24.587 66.850 -1.253 1.00 14.22  ? 22  THR A O     1 
ATOM   719  C  CB    . THR C 3 22  ? -23.909 65.952 -4.083 1.00 14.98  ? 22  THR A CB    1 
ATOM   720  O  OG1   . THR C 3 22  ? -24.026 64.944 -5.105 1.00 16.22  ? 22  THR A OG1   1 
ATOM   721  C  CG2   . THR C 3 22  ? -22.774 66.941 -4.390 1.00 12.41  ? 22  THR A CG2   1 
ATOM   722  N  N     . ILE C 3 23  ? -22.389 66.571 -1.119 1.00 12.91  ? 23  ILE A N     1 
ATOM   723  C  CA    . ILE C 3 23  ? -22.204 67.514 -0.018 1.00 13.68  ? 23  ILE A CA    1 
ATOM   724  C  C     . ILE C 3 23  ? -22.251 68.929 -0.532 1.00 15.21  ? 23  ILE A C     1 
ATOM   725  O  O     . ILE C 3 23  ? -21.544 69.281 -1.481 1.00 15.66  ? 23  ILE A O     1 
ATOM   726  C  CB    . ILE C 3 23  ? -20.850 67.204 0.705  1.00 14.19  ? 23  ILE A CB    1 
ATOM   727  C  CG1   . ILE C 3 23  ? -20.942 65.761 1.295  1.00 17.03  ? 23  ILE A CG1   1 
ATOM   728  C  CG2   . ILE C 3 23  ? -20.577 68.201 1.782  1.00 13.28  ? 23  ILE A CG2   1 
ATOM   729  C  CD1   . ILE C 3 23  ? -19.677 65.293 2.002  1.00 20.92  ? 23  ILE A CD1   1 
ATOM   730  N  N     . GLU C 3 24  ? -23.084 69.745 0.101  1.00 15.53  ? 24  GLU A N     1 
ATOM   731  C  CA    . GLU C 3 24  ? -23.239 71.136 -0.314 1.00 17.90  ? 24  GLU A CA    1 
ATOM   732  C  C     . GLU C 3 24  ? -22.563 71.981 0.755  1.00 17.77  ? 24  GLU A C     1 
ATOM   733  O  O     . GLU C 3 24  ? -22.141 73.081 0.465  1.00 15.54  ? 24  GLU A O     1 
ATOM   734  C  CB    . GLU C 3 24  ? -24.760 71.529 -0.421 1.00 17.60  ? 24  GLU A CB    1 
ATOM   735  C  CG    . GLU C 3 24  ? -24.933 72.667 -1.482 1.00 27.49  ? 24  GLU A CG    1 
ATOM   736  C  CD    . GLU C 3 24  ? -26.361 73.197 -1.704 1.00 31.46  ? 24  GLU A CD    1 
ATOM   737  O  OE1   . GLU C 3 24  ? -27.340 72.541 -1.312 1.00 28.75  ? 24  GLU A OE1   1 
ATOM   738  O  OE2   . GLU C 3 24  ? -26.492 74.302 -2.312 1.00 38.39  ? 24  GLU A OE2   1 
ATOM   739  N  N     . ASP C 3 25  ? -22.505 71.506 2.001  1.00 14.43  ? 25  ASP A N     1 
ATOM   740  C  CA    . ASP C 3 25  ? -21.843 72.333 3.023  1.00 15.83  ? 25  ASP A CA    1 
ATOM   741  C  C     . ASP C 3 25  ? -21.395 71.452 4.187  1.00 16.55  ? 25  ASP A C     1 
ATOM   742  O  O     . ASP C 3 25  ? -21.934 70.364 4.416  1.00 17.15  ? 25  ASP A O     1 
ATOM   743  C  CB    . ASP C 3 25  ? -22.806 73.434 3.535  1.00 19.48  ? 25  ASP A CB    1 
ATOM   744  C  CG    . ASP C 3 25  ? -22.060 74.584 4.301  1.00 24.39  ? 25  ASP A CG    1 
ATOM   745  O  OD1   . ASP C 3 25  ? -22.731 75.477 4.874  1.00 25.10  ? 25  ASP A OD1   1 
ATOM   746  O  OD2   . ASP C 3 25  ? -20.810 74.586 4.311  1.00 25.74  ? 25  ASP A OD2   1 
ATOM   747  N  N     . VAL C 3 26  ? -20.385 71.882 4.918  1.00 16.17  ? 26  VAL A N     1 
ATOM   748  C  CA    . VAL C 3 26  ? -19.934 71.099 6.066  1.00 16.51  ? 26  VAL A CA    1 
ATOM   749  C  C     . VAL C 3 26  ? -19.806 72.149 7.163  1.00 18.24  ? 26  VAL A C     1 
ATOM   750  O  O     . VAL C 3 26  ? -19.097 73.121 6.980  1.00 17.81  ? 26  VAL A O     1 
ATOM   751  C  CB    . VAL C 3 26  ? -18.558 70.458 5.820  1.00 12.30  ? 26  VAL A CB    1 
ATOM   752  C  CG1   . VAL C 3 26  ? -18.048 69.753 7.064  1.00 12.31  ? 26  VAL A CG1   1 
ATOM   753  C  CG2   . VAL C 3 26  ? -18.674 69.378 4.680  1.00 13.09  ? 26  VAL A CG2   1 
ATOM   754  N  N     . ARG C 3 27  ? -20.517 71.960 8.267  1.00 19.07  ? 27  ARG A N     1 
ATOM   755  C  CA    . ARG C 3 27  ? -20.498 72.899 9.401  1.00 18.25  ? 27  ARG A CA    1 
ATOM   756  C  C     . ARG C 3 27  ? -19.875 72.212 10.622 1.00 18.61  ? 27  ARG A C     1 
ATOM   757  O  O     . ARG C 3 27  ? -20.209 71.073 10.976 1.00 19.91  ? 27  ARG A O     1 
ATOM   758  C  CB    . ARG C 3 27  ? -21.946 73.357 9.683  1.00 19.84  ? 27  ARG A CB    1 
ATOM   759  C  CG    . ARG C 3 27  ? -22.543 73.971 8.428  1.00 20.45  ? 27  ARG A CG    1 
ATOM   760  C  CD    . ARG C 3 27  ? -23.929 74.481 8.656  1.00 26.98  ? 27  ARG A CD    1 
ATOM   761  N  NE    . ARG C 3 27  ? -24.535 75.075 7.454  1.00 30.02  ? 27  ARG A NE    1 
ATOM   762  C  CZ    . ARG C 3 27  ? -25.767 75.594 7.437  1.00 33.10  ? 27  ARG A CZ    1 
ATOM   763  N  NH1   . ARG C 3 27  ? -26.494 75.603 8.550  1.00 29.90  ? 27  ARG A NH1   1 
ATOM   764  N  NH2   . ARG C 3 27  ? -26.286 76.070 6.314  1.00 32.09  ? 27  ARG A NH2   1 
ATOM   765  N  N     . ILE C 3 28  ? -18.959 72.905 11.265 1.00 20.45  ? 28  ILE A N     1 
ATOM   766  C  CA    . ILE C 3 28  ? -18.218 72.323 12.403 1.00 22.03  ? 28  ILE A CA    1 
ATOM   767  C  C     . ILE C 3 28  ? -18.435 73.229 13.630 1.00 23.43  ? 28  ILE A C     1 
ATOM   768  O  O     . ILE C 3 28  ? -18.220 74.443 13.569 1.00 22.63  ? 28  ILE A O     1 
ATOM   769  C  CB    . ILE C 3 28  ? -16.723 72.239 12.001 1.00 22.52  ? 28  ILE A CB    1 
ATOM   770  C  CG1   . ILE C 3 28  ? -16.598 71.246 10.816 1.00 23.60  ? 28  ILE A CG1   1 
ATOM   771  C  CG2   . ILE C 3 28  ? -15.846 71.850 13.168 1.00 19.60  ? 28  ILE A CG2   1 
ATOM   772  C  CD1   . ILE C 3 28  ? -15.622 71.704 9.757  1.00 20.08  ? 28  ILE A CD1   1 
ATOM   773  N  N     . PHE C 3 29  ? -18.895 72.641 14.723 1.00 22.44  ? 29  PHE A N     1 
ATOM   774  C  CA    . PHE C 3 29  ? -19.157 73.430 15.918 1.00 24.81  ? 29  PHE A CA    1 
ATOM   775  C  C     . PHE C 3 29  ? -18.097 73.133 17.016 1.00 28.14  ? 29  PHE A C     1 
ATOM   776  O  O     . PHE C 3 29  ? -18.018 73.836 18.024 1.00 27.95  ? 29  PHE A O     1 
ATOM   777  C  CB    . PHE C 3 29  ? -20.610 73.166 16.344 1.00 23.03  ? 29  PHE A CB    1 
ATOM   778  C  CG    . PHE C 3 29  ? -21.616 73.410 15.216 1.00 22.81  ? 29  PHE A CG    1 
ATOM   779  C  CD1   . PHE C 3 29  ? -21.791 74.679 14.700 1.00 24.49  ? 29  PHE A CD1   1 
ATOM   780  C  CD2   . PHE C 3 29  ? -22.256 72.349 14.589 1.00 25.45  ? 29  PHE A CD2   1 
ATOM   781  C  CE1   . PHE C 3 29  ? -22.579 74.892 13.548 1.00 24.26  ? 29  PHE A CE1   1 
ATOM   782  C  CE2   . PHE C 3 29  ? -23.049 72.541 13.446 1.00 27.47  ? 29  PHE A CE2   1 
ATOM   783  C  CZ    . PHE C 3 29  ? -23.204 73.816 12.921 1.00 23.14  ? 29  PHE A CZ    1 
ATOM   784  N  N     . TRP C 3 30  ? -17.267 72.110 16.804 1.00 25.45  ? 30  TRP A N     1 
ATOM   785  C  CA    . TRP C 3 30  ? -16.164 71.817 17.727 1.00 25.21  ? 30  TRP A CA    1 
ATOM   786  C  C     . TRP C 3 30  ? -15.008 71.391 16.863 1.00 25.30  ? 30  TRP A C     1 
ATOM   787  O  O     . TRP C 3 30  ? -14.845 70.210 16.547 1.00 27.13  ? 30  TRP A O     1 
ATOM   788  C  CB    . TRP C 3 30  ? -16.504 70.698 18.716 1.00 28.03  ? 30  TRP A CB    1 
ATOM   789  C  CG    . TRP C 3 30  ? -15.451 70.551 19.788 1.00 32.44  ? 30  TRP A CG    1 
ATOM   790  C  CD1   . TRP C 3 30  ? -14.499 69.533 19.928 1.00 32.40  ? 30  TRP A CD1   1 
ATOM   791  C  CD2   . TRP C 3 30  ? -15.222 71.462 20.859 1.00 34.90  ? 30  TRP A CD2   1 
ATOM   792  N  NE1   . TRP C 3 30  ? -13.711 69.776 21.026 1.00 33.46  ? 30  TRP A NE1   1 
ATOM   793  C  CE2   . TRP C 3 30  ? -14.126 70.954 21.616 1.00 36.98  ? 30  TRP A CE2   1 
ATOM   794  C  CE3   . TRP C 3 30  ? -15.843 72.652 21.262 1.00 35.57  ? 30  TRP A CE3   1 
ATOM   795  C  CZ2   . TRP C 3 30  ? -13.638 71.609 22.756 1.00 37.30  ? 30  TRP A CZ2   1 
ATOM   796  C  CZ3   . TRP C 3 30  ? -15.366 73.304 22.403 1.00 39.87  ? 30  TRP A CZ3   1 
ATOM   797  C  CH2   . TRP C 3 30  ? -14.265 72.772 23.138 1.00 42.19  ? 30  TRP A CH2   1 
ATOM   798  N  N     . PRO C 3 31  ? -14.182 72.353 16.449 1.00 24.61  ? 31  PRO A N     1 
ATOM   799  C  CA    . PRO C 3 31  ? -13.005 72.157 15.596 1.00 26.20  ? 31  PRO A CA    1 
ATOM   800  C  C     . PRO C 3 31  ? -12.063 71.033 15.967 1.00 24.18  ? 31  PRO A C     1 
ATOM   801  O  O     . PRO C 3 31  ? -11.512 70.387 15.091 1.00 25.53  ? 31  PRO A O     1 
ATOM   802  C  CB    . PRO C 3 31  ? -12.304 73.520 15.648 1.00 28.23  ? 31  PRO A CB    1 
ATOM   803  C  CG    . PRO C 3 31  ? -13.444 74.447 15.785 1.00 27.36  ? 31  PRO A CG    1 
ATOM   804  C  CD    . PRO C 3 31  ? -14.274 73.754 16.860 1.00 29.57  ? 31  PRO A CD    1 
ATOM   805  N  N     . ASN C 3 32  ? -11.876 70.793 17.264 1.00 26.00  ? 32  ASN A N     1 
ATOM   806  C  CA    . ASN C 3 32  ? -10.947 69.759 17.721 1.00 25.66  ? 32  ASN A CA    1 
ATOM   807  C  C     . ASN C 3 32  ? -11.203 68.345 17.219 1.00 22.08  ? 32  ASN A C     1 
ATOM   808  O  O     . ASN C 3 32  ? -10.282 67.557 17.215 1.00 18.66  ? 32  ASN A O     1 
ATOM   809  C  CB    . ASN C 3 32  ? -10.870 69.756 19.255 1.00 26.87  ? 32  ASN A CB    1 
ATOM   810  C  CG    . ASN C 3 32  ? -10.053 70.907 19.780 1.00 38.96  ? 32  ASN A CG    1 
ATOM   811  O  OD1   . ASN C 3 32  ? -10.008 71.167 21.015 1.00 43.56  ? 32  ASN A OD1   1 
ATOM   812  N  ND2   . ASN C 3 32  ? -9.383  71.632 18.850 1.00 37.17  ? 32  ASN A ND2   1 
ATOM   813  N  N     . ILE C 3 33  ? -12.444 68.037 16.808 1.00 21.01  ? 33  ILE A N     1 
ATOM   814  C  CA    . ILE C 3 33  ? -12.807 66.697 16.268 1.00 19.63  ? 33  ILE A CA    1 
ATOM   815  C  C     . ILE C 3 33  ? -12.022 66.483 14.992 1.00 17.56  ? 33  ILE A C     1 
ATOM   816  O  O     . ILE C 3 33  ? -11.580 65.373 14.699 1.00 18.72  ? 33  ILE A O     1 
ATOM   817  C  CB    . ILE C 3 33  ? -14.305 66.619 15.868 1.00 22.35  ? 33  ILE A CB    1 
ATOM   818  C  CG1   . ILE C 3 33  ? -15.192 67.023 17.041 1.00 27.57  ? 33  ILE A CG1   1 
ATOM   819  C  CG2   . ILE C 3 33  ? -14.659 65.185 15.407 1.00 17.84  ? 33  ILE A CG2   1 
ATOM   820  C  CD1   . ILE C 3 33  ? -14.879 66.178 18.322 1.00 34.85  ? 33  ILE A CD1   1 
ATOM   821  N  N     . ILE C 3 34  ? -11.805 67.567 14.238 1.00 16.99  ? 34  ILE A N     1 
ATOM   822  C  CA    . ILE C 3 34  ? -11.103 67.498 12.953 1.00 16.67  ? 34  ILE A CA    1 
ATOM   823  C  C     . ILE C 3 34  ? -9.580  67.374 13.165 1.00 17.84  ? 34  ILE A C     1 
ATOM   824  O  O     . ILE C 3 34  ? -8.947  68.317 13.662 1.00 18.70  ? 34  ILE A O     1 
ATOM   825  C  CB    . ILE C 3 34  ? -11.406 68.820 12.066 1.00 20.28  ? 34  ILE A CB    1 
ATOM   826  C  CG1   . ILE C 3 34  ? -12.852 68.897 11.528 1.00 24.13  ? 34  ILE A CG1   1 
ATOM   827  C  CG2   . ILE C 3 34  ? -10.617 68.776 10.796 1.00 18.56  ? 34  ILE A CG2   1 
ATOM   828  C  CD1   . ILE C 3 34  ? -13.893 68.269 12.309 1.00 26.33  ? 34  ILE A CD1   1 
ATOM   829  N  N     . ARG C 3 35  ? -8.977  66.255 12.744 1.00 16.28  ? 35  ARG A N     1 
ATOM   830  C  CA    . ARG C 3 35  ? -7.545  66.019 12.947 1.00 16.89  ? 35  ARG A CA    1 
ATOM   831  C  C     . ARG C 3 35  ? -6.754  66.191 11.675 1.00 21.27  ? 35  ARG A C     1 
ATOM   832  O  O     . ARG C 3 35  ? -5.521  66.466 11.730 1.00 22.47  ? 35  ARG A O     1 
ATOM   833  C  CB    . ARG C 3 35  ? -7.285  64.593 13.498 1.00 17.89  ? 35  ARG A CB    1 
ATOM   834  C  CG    . ARG C 3 35  ? -8.018  64.285 14.818 1.00 23.64  ? 35  ARG A CG    1 
ATOM   835  C  CD    . ARG C 3 35  ? -7.778  65.405 15.801 1.00 24.16  ? 35  ARG A CD    1 
ATOM   836  N  NE    . ARG C 3 35  ? -8.443  65.176 17.068 1.00 30.25  ? 35  ARG A NE    1 
ATOM   837  C  CZ    . ARG C 3 35  ? -7.943  64.414 18.044 1.00 33.28  ? 35  ARG A CZ    1 
ATOM   838  N  NH1   . ARG C 3 35  ? -6.768  63.818 17.877 1.00 27.25  ? 35  ARG A NH1   1 
ATOM   839  N  NH2   . ARG C 3 35  ? -8.619  64.254 19.185 1.00 29.65  ? 35  ARG A NH2   1 
ATOM   840  N  N     . HIS C 3 36  ? -7.395  65.983 10.518 1.00 20.21  ? 36  HIS A N     1 
ATOM   841  C  CA    . HIS C 3 36  ? -6.683  66.251 9.244  1.00 20.76  ? 36  HIS A CA    1 
ATOM   842  C  C     . HIS C 3 36  ? -7.678  66.526 8.152  1.00 19.98  ? 36  HIS A C     1 
ATOM   843  O  O     . HIS C 3 36  ? -8.661  65.832 8.075  1.00 20.60  ? 36  HIS A O     1 
ATOM   844  C  CB    . HIS C 3 36  ? -5.818  65.079 8.776  1.00 19.89  ? 36  HIS A CB    1 
ATOM   845  C  CG    . HIS C 3 36  ? -5.024  65.395 7.541  1.00 23.76  ? 36  HIS A CG    1 
ATOM   846  N  ND1   . HIS C 3 36  ? -5.541  65.268 6.268  1.00 22.67  ? 36  HIS A ND1   1 
ATOM   847  C  CD2   . HIS C 3 36  ? -3.783  65.925 7.389  1.00 28.21  ? 36  HIS A CD2   1 
ATOM   848  C  CE1   . HIS C 3 36  ? -4.658  65.711 5.384  1.00 28.49  ? 36  HIS A CE1   1 
ATOM   849  N  NE2   . HIS C 3 36  ? -3.580  66.113 6.036  1.00 25.53  ? 36  HIS A NE2   1 
ATOM   850  N  N     . PRO C 3 37  ? -7.511  67.609 7.379  1.00 21.81  ? 37  PRO A N     1 
ATOM   851  C  CA    . PRO C 3 37  ? -6.427  68.587 7.518  1.00 23.53  ? 37  PRO A CA    1 
ATOM   852  C  C     . PRO C 3 37  ? -6.562  69.237 8.905  1.00 24.46  ? 37  PRO A C     1 
ATOM   853  O  O     . PRO C 3 37  ? -7.660  69.224 9.509  1.00 26.96  ? 37  PRO A O     1 
ATOM   854  C  CB    . PRO C 3 37  ? -6.644  69.583 6.343  1.00 21.85  ? 37  PRO A CB    1 
ATOM   855  C  CG    . PRO C 3 37  ? -7.949  69.247 5.748  1.00 17.27  ? 37  PRO A CG    1 
ATOM   856  C  CD    . PRO C 3 37  ? -8.283  67.803 6.134  1.00 19.92  ? 37  PRO A CD    1 
ATOM   857  N  N     . ARG C 3 38  ? -5.461  69.763 9.428  1.00 23.60  ? 38  ARG A N     1 
ATOM   858  C  CA    . ARG C 3 38  ? -5.482  70.360 10.759 1.00 28.06  ? 38  ARG A CA    1 
ATOM   859  C  C     . ARG C 3 38  ? -6.451  71.555 10.822 1.00 28.87  ? 38  ARG A C     1 
ATOM   860  O  O     . ARG C 3 38  ? -7.173  71.768 11.819 1.00 34.09  ? 38  ARG A O     1 
ATOM   861  C  CB    . ARG C 3 38  ? -4.030  70.766 11.138 1.00 33.17  ? 38  ARG A CB    1 
ATOM   862  N  N     . ASP C 3 39  ? -6.496  72.327 9.743  1.00 25.95  ? 39  ASP A N     1 
ATOM   863  C  CA    . ASP C 3 39  ? -7.412  73.468 9.653  1.00 26.46  ? 39  ASP A CA    1 
ATOM   864  C  C     . ASP C 3 39  ? -8.875  73.001 9.362  1.00 23.83  ? 39  ASP A C     1 
ATOM   865  O  O     . ASP C 3 39  ? -9.160  72.469 8.293  1.00 23.21  ? 39  ASP A O     1 
ATOM   866  C  CB    . ASP C 3 39  ? -6.945  74.402 8.544  1.00 25.72  ? 39  ASP A CB    1 
ATOM   867  C  CG    . ASP C 3 39  ? -7.825  75.660 8.416  1.00 29.18  ? 39  ASP A CG    1 
ATOM   868  O  OD1   . ASP C 3 39  ? -7.374  76.586 7.726  1.00 35.26  ? 39  ASP A OD1   1 
ATOM   869  O  OD2   . ASP C 3 39  ? -8.943  75.749 9.001  1.00 33.73  ? 39  ASP A OD2   1 
ATOM   870  N  N     . SER C 3 40  ? -9.806  73.199 10.292 1.00 23.70  ? 40  SER A N     1 
ATOM   871  C  CA    . SER C 3 40  ? -11.142 72.744 10.009 1.00 23.42  ? 40  SER A CA    1 
ATOM   872  C  C     . SER C 3 40  ? -11.767 73.456 8.806  1.00 23.92  ? 40  SER A C     1 
ATOM   873  O  O     . SER C 3 40  ? -12.666 72.894 8.173  1.00 21.86  ? 40  SER A O     1 
ATOM   874  C  CB    . SER C 3 40  ? -12.049 72.856 11.227 1.00 24.33  ? 40  SER A CB    1 
ATOM   875  O  OG    . SER C 3 40  ? -12.250 74.210 11.515 1.00 28.62  ? 40  SER A OG    1 
ATOM   876  N  N     . GLU C 3 41  ? -11.321 74.663 8.458  1.00 21.33  ? 41  GLU A N     1 
ATOM   877  C  CA    . GLU C 3 41  ? -11.893 75.289 7.258  1.00 22.28  ? 41  GLU A CA    1 
ATOM   878  C  C     . GLU C 3 41  ? -11.460 74.571 5.949  1.00 18.94  ? 41  GLU A C     1 
ATOM   879  O  O     . GLU C 3 41  ? -12.210 74.557 4.987  1.00 17.23  ? 41  GLU A O     1 
ATOM   880  C  CB    . GLU C 3 41  ? -11.522 76.777 7.177  1.00 23.74  ? 41  GLU A CB    1 
ATOM   881  C  CG    . GLU C 3 41  ? -12.273 77.604 8.208  1.00 32.02  ? 41  GLU A CG    1 
ATOM   882  C  CD    . GLU C 3 41  ? -11.664 78.993 8.416  1.00 36.79  ? 41  GLU A CD    1 
ATOM   883  O  OE1   . GLU C 3 41  ? -10.434 79.091 8.570  1.00 45.64  ? 41  GLU A OE1   1 
ATOM   884  O  OE2   . GLU C 3 41  ? -12.399 79.995 8.431  1.00 44.02  ? 41  GLU A OE2   1 
ATOM   885  N  N     . ALA C 3 42  ? -10.266 73.965 5.923  1.00 16.83  ? 42  ALA A N     1 
ATOM   886  C  CA    . ALA C 3 42  ? -9.798  73.269 4.722  1.00 17.25  ? 42  ALA A CA    1 
ATOM   887  C  C     . ALA C 3 42  ? -10.555 71.939 4.636  1.00 16.28  ? 42  ALA A C     1 
ATOM   888  O  O     . ALA C 3 42  ? -10.871 71.445 3.553  1.00 15.53  ? 42  ALA A O     1 
ATOM   889  C  CB    . ALA C 3 42  ? -8.285  73.021 4.811  1.00 14.33  ? 42  ALA A CB    1 
ATOM   890  N  N     . PHE C 3 43  ? -10.800 71.339 5.796  1.00 17.34  ? 43  PHE A N     1 
ATOM   891  C  CA    . PHE C 3 43  ? -11.552 70.085 5.882  1.00 15.40  ? 43  PHE A CA    1 
ATOM   892  C  C     . PHE C 3 43  ? -12.931 70.295 5.241  1.00 17.34  ? 43  PHE A C     1 
ATOM   893  O  O     . PHE C 3 43  ? -13.362 69.497 4.368  1.00 15.84  ? 43  PHE A O     1 
ATOM   894  C  CB    . PHE C 3 43  ? -11.676 69.657 7.386  1.00 16.75  ? 43  PHE A CB    1 
ATOM   895  C  CG    . PHE C 3 43  ? -12.609 68.457 7.647  1.00 18.89  ? 43  PHE A CG    1 
ATOM   896  C  CD1   . PHE C 3 43  ? -12.086 67.173 7.840  1.00 20.50  ? 43  PHE A CD1   1 
ATOM   897  C  CD2   . PHE C 3 43  ? -13.978 68.652 7.825  1.00 16.11  ? 43  PHE A CD2   1 
ATOM   898  C  CE1   . PHE C 3 43  ? -12.931 66.064 8.236  1.00 21.06  ? 43  PHE A CE1   1 
ATOM   899  C  CE2   . PHE C 3 43  ? -14.838 67.603 8.210  1.00 18.49  ? 43  PHE A CE2   1 
ATOM   900  C  CZ    . PHE C 3 43  ? -14.308 66.284 8.424  1.00 19.31  ? 43  PHE A CZ    1 
ATOM   901  N  N     . ALA C 3 44  ? -13.623 71.358 5.662  1.00 11.95  ? 44  ALA A N     1 
ATOM   902  C  CA    . ALA C 3 44  ? -14.952 71.682 5.166  1.00 11.55  ? 44  ALA A CA    1 
ATOM   903  C  C     . ALA C 3 44  ? -14.890 71.987 3.669  1.00 15.84  ? 44  ALA A C     1 
ATOM   904  O  O     . ALA C 3 44  ? -15.678 71.474 2.876  1.00 15.31  ? 44  ALA A O     1 
ATOM   905  C  CB    . ALA C 3 44  ? -15.507 72.944 5.888  1.00 14.14  ? 44  ALA A CB    1 
ATOM   906  N  N     . ALA C 3 45  ? -13.971 72.858 3.277  1.00 17.07  ? 45  ALA A N     1 
ATOM   907  C  CA    . ALA C 3 45  ? -13.887 73.250 1.866  1.00 14.00  ? 45  ALA A CA    1 
ATOM   908  C  C     . ALA C 3 45  ? -13.649 72.053 0.912  1.00 15.40  ? 45  ALA A C     1 
ATOM   909  O  O     . ALA C 3 45  ? -14.269 71.946 -0.149 1.00 15.15  ? 45  ALA A O     1 
ATOM   910  C  CB    . ALA C 3 45  ? -12.724 74.290 1.700  1.00 13.09  ? 45  ALA A CB    1 
ATOM   911  N  N     . ARG C 3 46  ? -12.765 71.139 1.282  1.00 14.40  ? 46  ARG A N     1 
ATOM   912  C  CA    . ARG C 3 46  ? -12.480 70.055 0.346  1.00 14.61  ? 46  ARG A CA    1 
ATOM   913  C  C     . ARG C 3 46  ? -13.605 69.059 0.115  1.00 16.12  ? 46  ARG A C     1 
ATOM   914  O  O     . ARG C 3 46  ? -13.696 68.439 -0.974 1.00 17.27  ? 46  ARG A O     1 
ATOM   915  C  CB    . ARG C 3 46  ? -11.205 69.302 0.764  1.00 15.54  ? 46  ARG A CB    1 
ATOM   916  C  CG    . ARG C 3 46  ? -11.380 68.374 1.980  1.00 11.82  ? 46  ARG A CG    1 
ATOM   917  C  CD    . ARG C 3 46  ? -9.949  67.900 2.411  1.00 16.54  ? 46  ARG A CD    1 
ATOM   918  N  NE    . ARG C 3 46  ? -9.336  66.985 1.463  1.00 18.68  ? 46  ARG A NE    1 
ATOM   919  C  CZ    . ARG C 3 46  ? -8.024  66.757 1.353  1.00 20.25  ? 46  ARG A CZ    1 
ATOM   920  N  NH1   . ARG C 3 46  ? -7.136  67.404 2.112  1.00 18.02  ? 46  ARG A NH1   1 
ATOM   921  N  NH2   . ARG C 3 46  ? -7.618  65.791 0.549  1.00 16.41  ? 46  ARG A NH2   1 
ATOM   922  N  N     A MET C 3 47  ? -14.452 68.906 1.133  0.50 15.21  ? 47  MET A N     1 
ATOM   923  N  N     B MET C 3 47  ? -14.475 68.878 1.093  0.50 15.33  ? 47  MET A N     1 
ATOM   924  C  CA    A MET C 3 47  ? -15.591 67.974 1.086  0.50 15.67  ? 47  MET A CA    1 
ATOM   925  C  CA    B MET C 3 47  ? -15.547 67.904 0.887  0.50 15.17  ? 47  MET A CA    1 
ATOM   926  C  C     A MET C 3 47  ? -16.721 68.487 0.180  0.50 16.12  ? 47  MET A C     1 
ATOM   927  C  C     B MET C 3 47  ? -16.736 68.437 0.081  0.50 16.13  ? 47  MET A C     1 
ATOM   928  O  O     A MET C 3 47  ? -17.447 67.706 -0.424 0.50 14.37  ? 47  MET A O     1 
ATOM   929  O  O     B MET C 3 47  ? -17.430 67.675 -0.586 0.50 14.94  ? 47  MET A O     1 
ATOM   930  C  CB    A MET C 3 47  ? -16.152 67.764 2.502  0.50 17.74  ? 47  MET A CB    1 
ATOM   931  C  CB    B MET C 3 47  ? -16.013 67.375 2.230  0.50 17.62  ? 47  MET A CB    1 
ATOM   932  C  CG    A MET C 3 47  ? -15.132 67.240 3.545  0.50 19.03  ? 47  MET A CG    1 
ATOM   933  C  CG    B MET C 3 47  ? -14.885 66.683 3.007  0.50 16.01  ? 47  MET A CG    1 
ATOM   934  S  SD    A MET C 3 47  ? -15.227 65.461 3.765  0.50 25.00  ? 47  MET A SD    1 
ATOM   935  S  SD    B MET C 3 47  ? -15.458 66.156 4.598  0.50 25.13  ? 47  MET A SD    1 
ATOM   936  C  CE    A MET C 3 47  ? -14.529 64.986 2.398  0.50 14.85  ? 47  MET A CE    1 
ATOM   937  C  CE    B MET C 3 47  ? -16.374 64.680 4.079  0.50 13.40  ? 47  MET A CE    1 
ATOM   938  N  N     A ILE C 3 48  ? -16.860 69.801 0.071  0.50 15.27  ? 48  ILE A N     1 
ATOM   939  N  N     B ILE C 3 48  ? -16.959 69.742 0.111  0.50 15.04  ? 48  ILE A N     1 
ATOM   940  C  CA    A ILE C 3 48  ? -17.935 70.379 -0.738 0.50 17.57  ? 48  ILE A CA    1 
ATOM   941  C  CA    B ILE C 3 48  ? -18.084 70.312 -0.626 0.50 16.58  ? 48  ILE A CA    1 
ATOM   942  C  C     A ILE C 3 48  ? -17.935 69.889 -2.172 0.50 16.21  ? 48  ILE A C     1 
ATOM   943  C  C     B ILE C 3 48  ? -17.981 69.933 -2.101 0.50 15.65  ? 48  ILE A C     1 
ATOM   944  O  O     A ILE C 3 48  ? -16.901 69.896 -2.831 0.50 18.88  ? 48  ILE A O     1 
ATOM   945  O  O     B ILE C 3 48  ? -16.922 70.058 -2.704 0.50 18.55  ? 48  ILE A O     1 
ATOM   946  C  CB    A ILE C 3 48  ? -17.854 71.952 -0.753 0.50 16.93  ? 48  ILE A CB    1 
ATOM   947  C  CB    B ILE C 3 48  ? -18.137 71.877 -0.414 0.50 14.93  ? 48  ILE A CB    1 
ATOM   948  C  CG1   A ILE C 3 48  ? -17.768 72.475 0.680  0.50 19.59  ? 48  ILE A CG1   1 
ATOM   949  C  CG1   B ILE C 3 48  ? -18.466 72.147 1.058  0.50 13.86  ? 48  ILE A CG1   1 
ATOM   950  C  CG2   A ILE C 3 48  ? -19.063 72.563 -1.508 0.50 18.95  ? 48  ILE A CG2   1 
ATOM   951  C  CG2   B ILE C 3 48  ? -19.159 72.542 -1.372 0.50 17.23  ? 48  ILE A CG2   1 
ATOM   952  C  CD1   A ILE C 3 48  ? -18.863 72.060 1.562  0.50 18.71  ? 48  ILE A CD1   1 
ATOM   953  C  CD1   B ILE C 3 48  ? -18.535 73.593 1.448  0.50 11.64  ? 48  ILE A CD1   1 
ATOM   954  N  N     . GLY C 3 49  ? -19.088 69.446 -2.663 1.00 14.66  ? 49  GLY A N     1 
ATOM   955  C  CA    . GLY C 3 49  ? -19.138 69.015 -4.053 1.00 15.81  ? 49  GLY A CA    1 
ATOM   956  C  C     . GLY C 3 49  ? -18.874 67.523 -4.300 1.00 17.75  ? 49  GLY A C     1 
ATOM   957  O  O     . GLY C 3 49  ? -19.058 67.037 -5.407 1.00 18.16  ? 49  GLY A O     1 
ATOM   958  N  N     . GLN C 3 50  ? -18.473 66.777 -3.274 1.00 15.34  ? 50  GLN A N     1 
ATOM   959  C  CA    . GLN C 3 50  ? -18.244 65.363 -3.461 1.00 14.55  ? 50  GLN A CA    1 
ATOM   960  C  C     . GLN C 3 50  ? -19.514 64.597 -3.113 1.00 15.24  ? 50  GLN A C     1 
ATOM   961  O  O     . GLN C 3 50  ? -20.285 65.014 -2.257 1.00 13.90  ? 50  GLN A O     1 
ATOM   962  C  CB    . GLN C 3 50  ? -17.064 64.879 -2.580 1.00 18.00  ? 50  GLN A CB    1 
ATOM   963  C  CG    . GLN C 3 50  ? -15.737 65.676 -2.856 1.00 15.99  ? 50  GLN A CG    1 
ATOM   964  C  CD    . GLN C 3 50  ? -14.505 65.013 -2.226 1.00 16.55  ? 50  GLN A CD    1 
ATOM   965  O  OE1   . GLN C 3 50  ? -13.731 65.656 -1.488 1.00 18.30  ? 50  GLN A OE1   1 
ATOM   966  N  NE2   . GLN C 3 50  ? -14.312 63.746 -2.528 1.00 8.26   ? 50  GLN A NE2   1 
ATOM   967  N  N     . THR C 3 51  ? -19.713 63.482 -3.798 1.00 13.32  ? 51  THR A N     1 
ATOM   968  C  CA    . THR C 3 51  ? -20.836 62.606 -3.566 1.00 16.21  ? 51  THR A CA    1 
ATOM   969  C  C     . THR C 3 51  ? -20.360 61.418 -2.752 1.00 15.70  ? 51  THR A C     1 
ATOM   970  O  O     . THR C 3 51  ? -19.233 60.925 -2.949 1.00 19.32  ? 51  THR A O     1 
ATOM   971  C  CB    . THR C 3 51  ? -21.374 62.117 -4.924 1.00 22.27  ? 51  THR A CB    1 
ATOM   972  O  OG1   . THR C 3 51  ? -21.843 63.267 -5.638 1.00 22.92  ? 51  THR A OG1   1 
ATOM   973  C  CG2   . THR C 3 51  ? -22.538 61.092 -4.762 1.00 20.91  ? 51  THR A CG2   1 
ATOM   974  N  N     . VAL C 3 52  ? -21.191 60.968 -1.826 1.00 13.49  ? 52  VAL A N     1 
ATOM   975  C  CA    . VAL C 3 52  ? -20.859 59.777 -1.041 1.00 17.38  ? 52  VAL A CA    1 
ATOM   976  C  C     . VAL C 3 52  ? -21.018 58.532 -1.922 1.00 19.52  ? 52  VAL A C     1 
ATOM   977  O  O     . VAL C 3 52  ? -22.110 58.284 -2.487 1.00 18.95  ? 52  VAL A O     1 
ATOM   978  C  CB    . VAL C 3 52  ? -21.835 59.623 0.162  1.00 20.92  ? 52  VAL A CB    1 
ATOM   979  C  CG1   . VAL C 3 52  ? -21.537 58.332 0.929  1.00 17.78  ? 52  VAL A CG1   1 
ATOM   980  C  CG2   . VAL C 3 52  ? -21.672 60.876 1.129  1.00 18.28  ? 52  VAL A CG2   1 
ATOM   981  N  N     . ARG C 3 53  ? -19.957 57.726 -2.045 1.00 18.52  ? 53  ARG A N     1 
ATOM   982  C  CA    . ARG C 3 53  ? -20.079 56.497 -2.848 1.00 19.40  ? 53  ARG A CA    1 
ATOM   983  C  C     . ARG C 3 53  ? -20.090 55.184 -2.005 1.00 20.94  ? 53  ARG A C     1 
ATOM   984  O  O     . ARG C 3 53  ? -20.535 54.154 -2.478 1.00 25.62  ? 53  ARG A O     1 
ATOM   985  C  CB    . ARG C 3 53  ? -18.933 56.404 -3.868 1.00 18.45  ? 53  ARG A CB    1 
ATOM   986  C  CG    . ARG C 3 53  ? -18.768 57.623 -4.752 1.00 23.12  ? 53  ARG A CG    1 
ATOM   987  C  CD    . ARG C 3 53  ? -20.069 57.944 -5.484 1.00 25.07  ? 53  ARG A CD    1 
ATOM   988  N  NE    . ARG C 3 53  ? -19.878 59.044 -6.439 1.00 29.98  ? 53  ARG A NE    1 
ATOM   989  C  CZ    . ARG C 3 53  ? -20.769 59.361 -7.388 1.00 28.72  ? 53  ARG A CZ    1 
ATOM   990  N  NH1   . ARG C 3 53  ? -21.895 58.672 -7.510 1.00 21.83  ? 53  ARG A NH1   1 
ATOM   991  N  NH2   . ARG C 3 53  ? -20.539 60.379 -8.204 1.00 30.15  ? 53  ARG A NH2   1 
ATOM   992  N  N     . GLY C 3 54  ? -19.587 55.182 -0.790 1.00 20.10  ? 54  GLY A N     1 
ATOM   993  C  CA    . GLY C 3 54  ? -19.636 53.929 -0.038 1.00 19.10  ? 54  GLY A CA    1 
ATOM   994  C  C     . GLY C 3 54  ? -19.276 54.144 1.418  1.00 20.59  ? 54  GLY A C     1 
ATOM   995  O  O     . GLY C 3 54  ? -18.918 55.263 1.811  1.00 15.54  ? 54  GLY A O     1 
ATOM   996  N  N     . LEU C 3 55  ? -19.332 53.076 2.211  1.00 18.11  ? 55  LEU A N     1 
ATOM   997  C  CA    . LEU C 3 55  ? -19.014 53.197 3.614  1.00 18.76  ? 55  LEU A CA    1 
ATOM   998  C  C     . LEU C 3 55  ? -18.460 51.841 4.036  1.00 20.96  ? 55  LEU A C     1 
ATOM   999  O  O     . LEU C 3 55  ? -19.145 50.839 3.912  1.00 18.76  ? 55  LEU A O     1 
ATOM   1000 C  CB    . LEU C 3 55  ? -20.274 53.533 4.417  1.00 20.52  ? 55  LEU A CB    1 
ATOM   1001 C  CG    . LEU C 3 55  ? -20.190 53.724 5.941  1.00 19.40  ? 55  LEU A CG    1 
ATOM   1002 C  CD1   . LEU C 3 55  ? -19.148 54.859 6.299  1.00 19.83  ? 55  LEU A CD1   1 
ATOM   1003 C  CD2   . LEU C 3 55  ? -21.568 54.101 6.460  1.00 21.69  ? 55  LEU A CD2   1 
ATOM   1004 N  N     . GLU C 3 56  ? -17.206 51.846 4.497  1.00 19.13  ? 56  GLU A N     1 
ATOM   1005 C  CA    . GLU C 3 56  ? -16.533 50.652 4.948  1.00 22.21  ? 56  GLU A CA    1 
ATOM   1006 C  C     . GLU C 3 56  ? -16.175 50.803 6.414  1.00 20.73  ? 56  GLU A C     1 
ATOM   1007 O  O     . GLU C 3 56  ? -16.349 51.871 7.027  1.00 18.02  ? 56  GLU A O     1 
ATOM   1008 C  CB    . GLU C 3 56  ? -15.275 50.414 4.088  1.00 22.04  ? 56  GLU A CB    1 
ATOM   1009 C  CG    . GLU C 3 56  ? -15.673 50.124 2.627  1.00 24.11  ? 56  GLU A CG    1 
ATOM   1010 C  CD    . GLU C 3 56  ? -14.522 50.043 1.624  1.00 26.08  ? 56  GLU A CD    1 
ATOM   1011 O  OE1   . GLU C 3 56  ? -13.328 50.211 1.967  1.00 29.48  ? 56  GLU A OE1   1 
ATOM   1012 O  OE2   . GLU C 3 56  ? -14.845 49.828 0.443  1.00 29.69  ? 56  GLU A OE2   1 
ATOM   1013 N  N     . ARG C 3 57  ? -15.669 49.721 6.982  1.00 19.09  ? 57  ARG A N     1 
ATOM   1014 C  CA    . ARG C 3 57  ? -15.271 49.715 8.353  1.00 17.68  ? 57  ARG A CA    1 
ATOM   1015 C  C     . ARG C 3 57  ? -13.926 49.004 8.493  1.00 21.46  ? 57  ARG A C     1 
ATOM   1016 O  O     . ARG C 3 57  ? -13.708 48.017 7.829  1.00 21.01  ? 57  ARG A O     1 
ATOM   1017 C  CB    . ARG C 3 57  ? -16.290 48.954 9.195  1.00 18.23  ? 57  ARG A CB    1 
ATOM   1018 C  CG    . ARG C 3 57  ? -15.843 48.814 10.671 1.00 21.06  ? 57  ARG A CG    1 
ATOM   1019 C  CD    . ARG C 3 57  ? -16.745 47.833 11.433 1.00 18.85  ? 57  ARG A CD    1 
ATOM   1020 N  NE    . ARG C 3 57  ? -16.629 46.448 10.958 1.00 21.30  ? 57  ARG A NE    1 
ATOM   1021 C  CZ    . ARG C 3 57  ? -15.578 45.622 11.123 1.00 22.73  ? 57  ARG A CZ    1 
ATOM   1022 N  NH1   . ARG C 3 57  ? -14.477 45.963 11.752 1.00 20.18  ? 57  ARG A NH1   1 
ATOM   1023 N  NH2   . ARG C 3 57  ? -15.645 44.395 10.652 1.00 23.31  ? 57  ARG A NH2   1 
ATOM   1024 N  N     . ARG C 3 58  ? -13.025 49.527 9.324  1.00 23.99  ? 58  ARG A N     1 
ATOM   1025 C  CA    . ARG C 3 58  ? -11.757 48.832 9.633  1.00 24.04  ? 58  ARG A CA    1 
ATOM   1026 C  C     . ARG C 3 58  ? -11.648 48.945 11.161 1.00 24.49  ? 58  ARG A C     1 
ATOM   1027 O  O     . ARG C 3 58  ? -11.550 50.047 11.685 1.00 21.03  ? 58  ARG A O     1 
ATOM   1028 C  CB    . ARG C 3 58  ? -10.551 49.506 8.940  1.00 25.61  ? 58  ARG A CB    1 
ATOM   1029 C  CG    . ARG C 3 58  ? -10.527 49.229 7.458  1.00 30.38  ? 58  ARG A CG    1 
ATOM   1030 C  CD    . ARG C 3 58  ? -9.155  49.543 6.873  1.00 40.45  ? 58  ARG A CD    1 
ATOM   1031 N  NE    . ARG C 3 58  ? -8.104  48.625 7.324  1.00 34.96  ? 58  ARG A NE    1 
ATOM   1032 C  CZ    . ARG C 3 58  ? -6.800  48.872 7.176  1.00 39.71  ? 58  ARG A CZ    1 
ATOM   1033 N  NH1   . ARG C 3 58  ? -6.388  50.003 6.602  1.00 33.47  ? 58  ARG A NH1   1 
ATOM   1034 N  NH2   . ARG C 3 58  ? -5.898  47.977 7.576  1.00 36.84  ? 58  ARG A NH2   1 
ATOM   1035 N  N     . GLY C 3 59  ? -11.710 47.818 11.889 1.00 23.53  ? 59  GLY A N     1 
ATOM   1036 C  CA    . GLY C 3 59  ? -11.652 47.905 13.332 1.00 15.64  ? 59  GLY A CA    1 
ATOM   1037 C  C     . GLY C 3 59  ? -12.881 48.688 13.749 1.00 15.92  ? 59  GLY A C     1 
ATOM   1038 O  O     . GLY C 3 59  ? -13.983 48.368 13.305 1.00 17.24  ? 59  GLY A O     1 
ATOM   1039 N  N     . LYS C 3 60  ? -12.722 49.685 14.615 1.00 16.32  ? 60  LYS A N     1 
ATOM   1040 C  CA    . LYS C 3 60  ? -13.872 50.519 15.003 1.00 19.11  ? 60  LYS A CA    1 
ATOM   1041 C  C     . LYS C 3 60  ? -13.949 51.853 14.168 1.00 17.93  ? 60  LYS A C     1 
ATOM   1042 O  O     . LYS C 3 60  ? -14.805 52.711 14.423 1.00 17.67  ? 60  LYS A O     1 
ATOM   1043 C  CB    . LYS C 3 60  ? -13.814 50.832 16.498 1.00 17.55  ? 60  LYS A CB    1 
ATOM   1044 C  CG    . LYS C 3 60  ? -14.096 49.552 17.347 1.00 26.31  ? 60  LYS A CG    1 
ATOM   1045 C  CD    . LYS C 3 60  ? -14.224 49.814 18.814 1.00 24.41  ? 60  LYS A CD    1 
ATOM   1046 C  CE    . LYS C 3 60  ? -12.866 49.889 19.459 1.00 28.67  ? 60  LYS A CE    1 
ATOM   1047 N  NZ    . LYS C 3 60  ? -12.982 49.995 20.948 1.00 28.88  ? 60  LYS A NZ    1 
ATOM   1048 N  N     . PHE C 3 61  ? -13.054 52.013 13.194 1.00 17.05  ? 61  PHE A N     1 
ATOM   1049 C  CA    . PHE C 3 61  ? -13.109 53.205 12.311 1.00 17.64  ? 61  PHE A CA    1 
ATOM   1050 C  C     . PHE C 3 61  ? -14.117 53.004 11.161 1.00 18.45  ? 61  PHE A C     1 
ATOM   1051 O  O     . PHE C 3 61  ? -14.177 51.926 10.590 1.00 19.23  ? 61  PHE A O     1 
ATOM   1052 C  CB    . PHE C 3 61  ? -11.786 53.487 11.644 1.00 16.48  ? 61  PHE A CB    1 
ATOM   1053 C  CG    . PHE C 3 61  ? -10.682 53.846 12.591 1.00 18.73  ? 61  PHE A CG    1 
ATOM   1054 C  CD1   . PHE C 3 61  ? -9.775  52.878 13.003 1.00 17.81  ? 61  PHE A CD1   1 
ATOM   1055 C  CD2   . PHE C 3 61  ? -10.555 55.143 13.075 1.00 16.93  ? 61  PHE A CD2   1 
ATOM   1056 C  CE1   . PHE C 3 61  ? -8.749  53.207 13.884 1.00 20.75  ? 61  PHE A CE1   1 
ATOM   1057 C  CE2   . PHE C 3 61  ? -9.539  55.491 13.961 1.00 17.38  ? 61  PHE A CE2   1 
ATOM   1058 C  CZ    . PHE C 3 61  ? -8.624  54.522 14.369 1.00 15.80  ? 61  PHE A CZ    1 
ATOM   1059 N  N     . LEU C 3 62  ? -14.878 54.059 10.808 1.00 16.45  ? 62  LEU A N     1 
ATOM   1060 C  CA    . LEU C 3 62  ? -15.811 54.007 9.664  1.00 17.01  ? 62  LEU A CA    1 
ATOM   1061 C  C     . LEU C 3 62  ? -15.061 54.780 8.572  1.00 19.85  ? 62  LEU A C     1 
ATOM   1062 O  O     . LEU C 3 62  ? -14.440 55.836 8.857  1.00 17.76  ? 62  LEU A O     1 
ATOM   1063 C  CB    . LEU C 3 62  ? -17.076 54.768 10.000 1.00 16.69  ? 62  LEU A CB    1 
ATOM   1064 C  CG    . LEU C 3 62  ? -18.480 54.238 10.253 1.00 25.41  ? 62  LEU A CG    1 
ATOM   1065 C  CD1   . LEU C 3 62  ? -18.558 52.733 10.135 1.00 22.30  ? 62  LEU A CD1   1 
ATOM   1066 C  CD2   . LEU C 3 62  ? -19.018 54.843 11.581 1.00 24.51  ? 62  LEU A CD2   1 
ATOM   1067 N  N     . LYS C 3 63  ? -15.098 54.278 7.338  1.00 17.16  ? 63  LYS A N     1 
ATOM   1068 C  CA    . LYS C 3 63  ? -14.412 54.962 6.275  1.00 16.73  ? 63  LYS A CA    1 
ATOM   1069 C  C     . LYS C 3 63  ? -15.462 55.397 5.254  1.00 15.68  ? 63  LYS A C     1 
ATOM   1070 O  O     . LYS C 3 63  ? -16.009 54.572 4.538  1.00 19.30  ? 63  LYS A O     1 
ATOM   1071 C  CB    . LYS C 3 63  ? -13.368 54.022 5.637  1.00 15.98  ? 63  LYS A CB    1 
ATOM   1072 C  CG    . LYS C 3 63  ? -12.612 54.676 4.456  1.00 23.76  ? 63  LYS A CG    1 
ATOM   1073 C  CD    . LYS C 3 63  ? -11.835 53.659 3.592  1.00 26.20  ? 63  LYS A CD    1 
ATOM   1074 C  CE    . LYS C 3 63  ? -10.584 53.191 4.275  1.00 31.34  ? 63  LYS A CE    1 
ATOM   1075 N  NZ    . LYS C 3 63  ? -9.611  52.551 3.301  1.00 35.22  ? 63  LYS A NZ    1 
ATOM   1076 N  N     . PHE C 3 64  ? -15.744 56.685 5.159  1.00 18.16  ? 64  PHE A N     1 
ATOM   1077 C  CA    . PHE C 3 64  ? -16.735 57.118 4.191  1.00 17.05  ? 64  PHE A CA    1 
ATOM   1078 C  C     . PHE C 3 64  ? -15.981 57.322 2.880  1.00 18.69  ? 64  PHE A C     1 
ATOM   1079 O  O     . PHE C 3 64  ? -14.974 57.990 2.854  1.00 19.07  ? 64  PHE A O     1 
ATOM   1080 C  CB    . PHE C 3 64  ? -17.391 58.434 4.624  1.00 17.50  ? 64  PHE A CB    1 
ATOM   1081 C  CG    . PHE C 3 64  ? -18.235 58.335 5.841  1.00 15.59  ? 64  PHE A CG    1 
ATOM   1082 C  CD1   . PHE C 3 64  ? -19.635 58.321 5.735  1.00 12.82  ? 64  PHE A CD1   1 
ATOM   1083 C  CD2   . PHE C 3 64  ? -17.653 58.275 7.101  1.00 15.62  ? 64  PHE A CD2   1 
ATOM   1084 C  CE1   . PHE C 3 64  ? -20.450 58.246 6.898  1.00 19.57  ? 64  PHE A CE1   1 
ATOM   1085 C  CE2   . PHE C 3 64  ? -18.420 58.196 8.264  1.00 15.07  ? 64  PHE A CE2   1 
ATOM   1086 C  CZ    . PHE C 3 64  ? -19.850 58.178 8.182  1.00 12.30  ? 64  PHE A CZ    1 
ATOM   1087 N  N     . LEU C 3 65  ? -16.439 56.709 1.796  1.00 16.42  ? 65  LEU A N     1 
ATOM   1088 C  CA    . LEU C 3 65  ? -15.775 56.881 0.500  1.00 18.42  ? 65  LEU A CA    1 
ATOM   1089 C  C     . LEU C 3 65  ? -16.529 57.957 -0.296 1.00 18.76  ? 65  LEU A C     1 
ATOM   1090 O  O     . LEU C 3 65  ? -17.726 57.814 -0.533 1.00 16.35  ? 65  LEU A O     1 
ATOM   1091 C  CB    . LEU C 3 65  ? -15.826 55.574 -0.299 1.00 20.77  ? 65  LEU A CB    1 
ATOM   1092 C  CG    . LEU C 3 65  ? -15.099 54.461 0.441  1.00 24.00  ? 65  LEU A CG    1 
ATOM   1093 C  CD1   . LEU C 3 65  ? -15.408 53.173 -0.191 1.00 32.81  ? 65  LEU A CD1   1 
ATOM   1094 C  CD2   . LEU C 3 65  ? -13.637 54.728 0.426  1.00 28.16  ? 65  LEU A CD2   1 
ATOM   1095 N  N     . LEU C 3 66  ? -15.836 59.017 -0.706 1.00 16.80  ? 66  LEU A N     1 
ATOM   1096 C  CA    . LEU C 3 66  ? -16.498 60.101 -1.463 1.00 20.66  ? 66  LEU A CA    1 
ATOM   1097 C  C     . LEU C 3 66  ? -15.951 60.024 -2.882 1.00 21.20  ? 66  LEU A C     1 
ATOM   1098 O  O     . LEU C 3 66  ? -15.540 58.980 -3.265 1.00 23.49  ? 66  LEU A O     1 
ATOM   1099 C  CB    . LEU C 3 66  ? -16.195 61.458 -0.829 1.00 19.57  ? 66  LEU A CB    1 
ATOM   1100 C  CG    . LEU C 3 66  ? -16.703 61.700 0.607  1.00 25.70  ? 66  LEU A CG    1 
ATOM   1101 C  CD1   . LEU C 3 66  ? -18.033 61.163 0.794  1.00 24.00  ? 66  LEU A CD1   1 
ATOM   1102 C  CD2   . LEU C 3 66  ? -15.842 61.007 1.592  1.00 28.12  ? 66  LEU A CD2   1 
ATOM   1103 N  N     . ASP C 3 67  ? -15.894 61.109 -3.649 1.00 22.25  ? 67  ASP A N     1 
ATOM   1104 C  CA    . ASP C 3 67  ? -15.441 61.010 -5.045 1.00 21.55  ? 67  ASP A CA    1 
ATOM   1105 C  C     . ASP C 3 67  ? -13.949 60.923 -5.118 1.00 23.62  ? 67  ASP A C     1 
ATOM   1106 O  O     . ASP C 3 67  ? -13.390 60.060 -5.784 1.00 27.74  ? 67  ASP A O     1 
ATOM   1107 C  CB    . ASP C 3 67  ? -15.895 62.217 -5.893 1.00 24.18  ? 67  ASP A CB    1 
ATOM   1108 C  CG    . ASP C 3 67  ? -17.380 62.202 -6.192 1.00 23.64  ? 67  ASP A CG    1 
ATOM   1109 O  OD1   . ASP C 3 67  ? -17.951 61.144 -6.544 1.00 27.23  ? 67  ASP A OD1   1 
ATOM   1110 O  OD2   . ASP C 3 67  ? -17.997 63.265 -6.075 1.00 29.47  ? 67  ASP A OD2   1 
ATOM   1111 N  N     . ARG C 3 68  ? -13.286 61.842 -4.459 1.00 25.80  ? 68  ARG A N     1 
ATOM   1112 C  CA    . ARG C 3 68  ? -11.840 61.807 -4.466 1.00 26.06  ? 68  ARG A CA    1 
ATOM   1113 C  C     . ARG C 3 68  ? -11.256 61.464 -3.098 1.00 23.54  ? 68  ARG A C     1 
ATOM   1114 O  O     . ARG C 3 68  ? -10.180 60.869 -3.017 1.00 24.72  ? 68  ARG A O     1 
ATOM   1115 C  CB    . ARG C 3 68  ? -11.304 63.138 -4.954 1.00 28.03  ? 68  ARG A CB    1 
ATOM   1116 C  CG    . ARG C 3 68  ? -9.960  63.482 -4.386 1.00 36.37  ? 68  ARG A CG    1 
ATOM   1117 C  CD    . ARG C 3 68  ? -9.393  64.714 -5.030 1.00 40.64  ? 68  ARG A CD    1 
ATOM   1118 N  NE    . ARG C 3 68  ? -8.915  65.653 -4.032 1.00 46.74  ? 68  ARG A NE    1 
ATOM   1119 C  CZ    . ARG C 3 68  ? -7.662  65.742 -3.595 1.00 45.96  ? 68  ARG A CZ    1 
ATOM   1120 N  NH1   . ARG C 3 68  ? -7.362  66.651 -2.681 1.00 46.33  ? 68  ARG A NH1   1 
ATOM   1121 N  NH2   . ARG C 3 68  ? -6.713  64.953 -4.071 1.00 48.21  ? 68  ARG A NH2   1 
ATOM   1122 N  N     . ASP C 3 69  ? -11.986 61.797 -2.029 1.00 23.02  ? 69  ASP A N     1 
ATOM   1123 C  CA    . ASP C 3 69  ? -11.476 61.601 -0.663 1.00 21.22  ? 69  ASP A CA    1 
ATOM   1124 C  C     . ASP C 3 69  ? -12.133 60.465 0.134  1.00 21.81  ? 69  ASP A C     1 
ATOM   1125 O  O     . ASP C 3 69  ? -13.184 59.957 -0.261 1.00 18.71  ? 69  ASP A O     1 
ATOM   1126 C  CB    . ASP C 3 69  ? -11.693 62.905 0.145  1.00 20.08  ? 69  ASP A CB    1 
ATOM   1127 C  CG    . ASP C 3 69  ? -10.731 64.068 -0.297 1.00 23.10  ? 69  ASP A CG    1 
ATOM   1128 O  OD1   . ASP C 3 69  ? -11.126 65.286 -0.260 1.00 21.69  ? 69  ASP A OD1   1 
ATOM   1129 O  OD2   . ASP C 3 69  ? -9.572  63.759 -0.662 1.00 23.35  ? 69  ASP A OD2   1 
ATOM   1130 N  N     . ALA C 3 70  ? -11.502 60.100 1.252  1.00 19.51  ? 70  ALA A N     1 
ATOM   1131 C  CA    . ALA C 3 70  ? -12.093 59.148 2.201  1.00 18.44  ? 70  ALA A CA    1 
ATOM   1132 C  C     . ALA C 3 70  ? -12.198 59.979 3.504  1.00 19.67  ? 70  ALA A C     1 
ATOM   1133 O  O     . ALA C 3 70  ? -11.304 60.748 3.800  1.00 16.37  ? 70  ALA A O     1 
ATOM   1134 C  CB    . ALA C 3 70  ? -11.179 57.957 2.448  1.00 16.69  ? 70  ALA A CB    1 
ATOM   1135 N  N     . LEU C 3 71  ? -13.284 59.859 4.263  1.00 15.22  ? 71  LEU A N     1 
ATOM   1136 C  CA    . LEU C 3 71  ? -13.361 60.556 5.559  1.00 15.64  ? 71  LEU A CA    1 
ATOM   1137 C  C     . LEU C 3 71  ? -13.259 59.370 6.563  1.00 17.22  ? 71  LEU A C     1 
ATOM   1138 O  O     . LEU C 3 71  ? -14.080 58.443 6.502  1.00 19.73  ? 71  LEU A O     1 
ATOM   1139 C  CB    . LEU C 3 71  ? -14.727 61.209 5.672  1.00 16.85  ? 71  LEU A CB    1 
ATOM   1140 C  CG    . LEU C 3 71  ? -15.153 62.129 6.807  1.00 26.14  ? 71  LEU A CG    1 
ATOM   1141 C  CD1   . LEU C 3 71  ? -16.639 61.911 6.876  1.00 27.91  ? 71  LEU A CD1   1 
ATOM   1142 C  CD2   . LEU C 3 71  ? -14.572 61.850 8.134  1.00 28.90  ? 71  LEU A CD2   1 
ATOM   1143 N  N     A ILE C 3 72  ? -12.272 59.381 7.446  0.50 17.81  ? 72  ILE A N     1 
ATOM   1144 N  N     B ILE C 3 72  ? -12.277 59.415 7.453  0.50 17.51  ? 72  ILE A N     1 
ATOM   1145 C  CA    A ILE C 3 72  ? -12.107 58.280 8.411  0.50 16.37  ? 72  ILE A CA    1 
ATOM   1146 C  CA    B ILE C 3 72  ? -12.056 58.344 8.439  0.50 16.07  ? 72  ILE A CA    1 
ATOM   1147 C  C     A ILE C 3 72  ? -12.573 58.803 9.744  0.50 16.90  ? 72  ILE A C     1 
ATOM   1148 C  C     B ILE C 3 72  ? -12.595 58.842 9.755  0.50 16.74  ? 72  ILE A C     1 
ATOM   1149 O  O     A ILE C 3 72  ? -12.047 59.794 10.257 0.50 17.42  ? 72  ILE A O     1 
ATOM   1150 O  O     B ILE C 3 72  ? -12.141 59.866 10.271 0.50 17.03  ? 72  ILE A O     1 
ATOM   1151 C  CB    A ILE C 3 72  ? -10.638 57.843 8.508  0.50 17.73  ? 72  ILE A CB    1 
ATOM   1152 C  CB    B ILE C 3 72  ? -10.554 58.063 8.604  0.50 16.04  ? 72  ILE A CB    1 
ATOM   1153 C  CG1   A ILE C 3 72  ? -10.148 57.372 7.129  0.50 16.55  ? 72  ILE A CG1   1 
ATOM   1154 C  CG1   B ILE C 3 72  ? -9.913  57.851 7.222  0.50 14.44  ? 72  ILE A CG1   1 
ATOM   1155 C  CG2   A ILE C 3 72  ? -10.490 56.729 9.524  0.50 18.78  ? 72  ILE A CG2   1 
ATOM   1156 C  CG2   B ILE C 3 72  ? -10.345 56.843 9.480  0.50 18.00  ? 72  ILE A CG2   1 
ATOM   1157 C  CD1   A ILE C 3 72  ? -9.731  58.504 6.216  0.50 15.39  ? 72  ILE A CD1   1 
ATOM   1158 C  CD1   B ILE C 3 72  ? -10.560 56.754 6.405  0.50 9.18   ? 72  ILE A CD1   1 
ATOM   1159 N  N     . SER C 3 73  ? -13.558 58.130 10.316 1.00 16.14  ? 73  SER A N     1 
ATOM   1160 C  CA    . SER C 3 73  ? -14.167 58.587 11.556 1.00 17.20  ? 73  SER A CA    1 
ATOM   1161 C  C     . SER C 3 73  ? -14.146 57.566 12.719 1.00 16.22  ? 73  SER A C     1 
ATOM   1162 O  O     . SER C 3 73  ? -14.403 56.429 12.484 1.00 18.43  ? 73  SER A O     1 
ATOM   1163 C  CB    . SER C 3 73  ? -15.635 58.967 11.182 1.00 16.66  ? 73  SER A CB    1 
ATOM   1164 O  OG    . SER C 3 73  ? -16.443 59.289 12.279 1.00 21.00  ? 73  SER A OG    1 
ATOM   1165 N  N     . HIS C 3 74  ? -13.874 58.017 13.945 1.00 15.52  ? 74  HIS A N     1 
ATOM   1166 C  CA    . HIS C 3 74  ? -13.898 57.151 15.124 1.00 18.98  ? 74  HIS A CA    1 
ATOM   1167 C  C     . HIS C 3 74  ? -14.829 57.806 16.120 1.00 19.21  ? 74  HIS A C     1 
ATOM   1168 O  O     . HIS C 3 74  ? -14.668 58.983 16.442 1.00 20.88  ? 74  HIS A O     1 
ATOM   1169 C  CB    . HIS C 3 74  ? -12.518 56.979 15.724 1.00 14.66  ? 74  HIS A CB    1 
ATOM   1170 C  CG    . HIS C 3 74  ? -12.411 55.744 16.566 1.00 20.81  ? 74  HIS A CG    1 
ATOM   1171 N  ND1   . HIS C 3 74  ? -12.961 55.663 17.826 1.00 19.87  ? 74  HIS A ND1   1 
ATOM   1172 C  CD2   . HIS C 3 74  ? -11.813 54.546 16.333 1.00 17.86  ? 74  HIS A CD2   1 
ATOM   1173 C  CE1   . HIS C 3 74  ? -12.703 54.471 18.335 1.00 23.20  ? 74  HIS A CE1   1 
ATOM   1174 N  NE2   . HIS C 3 74  ? -12.007 53.776 17.451 1.00 20.24  ? 74  HIS A NE2   1 
ATOM   1175 N  N     . LEU C 3 75  ? -15.836 57.060 16.568 1.00 17.86  ? 75  LEU A N     1 
ATOM   1176 C  CA    . LEU C 3 75  ? -16.872 57.567 17.477 1.00 17.80  ? 75  LEU A CA    1 
ATOM   1177 C  C     . LEU C 3 75  ? -16.480 57.439 18.948 1.00 20.79  ? 75  LEU A C     1 
ATOM   1178 O  O     . LEU C 3 75  ? -17.140 57.967 19.837 1.00 17.86  ? 75  LEU A O     1 
ATOM   1179 C  CB    . LEU C 3 75  ? -18.173 56.754 17.251 1.00 20.84  ? 75  LEU A CB    1 
ATOM   1180 C  CG    . LEU C 3 75  ? -18.689 56.664 15.789 1.00 24.23  ? 75  LEU A CG    1 
ATOM   1181 C  CD1   . LEU C 3 75  ? -20.075 55.989 15.689 1.00 28.76  ? 75  LEU A CD1   1 
ATOM   1182 C  CD2   . LEU C 3 75  ? -18.828 58.023 15.265 1.00 27.10  ? 75  LEU A CD2   1 
ATOM   1183 N  N     . ARG C 3 76  ? -15.386 56.744 19.189 1.00 23.27  ? 76  ARG A N     1 
ATOM   1184 C  CA    . ARG C 3 76  ? -14.942 56.469 20.551 1.00 25.56  ? 76  ARG A CA    1 
ATOM   1185 C  C     . ARG C 3 76  ? -16.102 55.895 21.326 1.00 24.98  ? 76  ARG A C     1 
ATOM   1186 O  O     . ARG C 3 76  ? -16.879 55.123 20.800 1.00 25.15  ? 76  ARG A O     1 
ATOM   1187 C  CB    . ARG C 3 76  ? -14.384 57.711 21.236 1.00 25.57  ? 76  ARG A CB    1 
ATOM   1188 C  CG    . ARG C 3 76  ? -12.991 58.113 20.713 1.00 23.10  ? 76  ARG A CG    1 
ATOM   1189 C  CD    . ARG C 3 76  ? -11.949 57.072 21.000 1.00 27.46  ? 76  ARG A CD    1 
ATOM   1190 N  NE    . ARG C 3 76  ? -10.599 57.600 20.801 1.00 25.20  ? 76  ARG A NE    1 
ATOM   1191 C  CZ    . ARG C 3 76  ? -10.001 57.762 19.619 1.00 27.01  ? 76  ARG A CZ    1 
ATOM   1192 N  NH1   . ARG C 3 76  ? -10.587 57.434 18.481 1.00 27.09  ? 76  ARG A NH1   1 
ATOM   1193 N  NH2   . ARG C 3 76  ? -8.803  58.302 19.563 1.00 31.01  ? 76  ARG A NH2   1 
ATOM   1194 N  N     . MET C 3 77  ? -16.228 56.291 22.569 1.00 26.47  ? 77  MET A N     1 
ATOM   1195 C  CA    . MET C 3 77  ? -17.256 55.755 23.440 1.00 29.06  ? 77  MET A CA    1 
ATOM   1196 C  C     . MET C 3 77  ? -18.691 56.197 23.211 1.00 30.46  ? 77  MET A C     1 
ATOM   1197 O  O     . MET C 3 77  ? -19.606 55.381 23.339 1.00 30.52  ? 77  MET A O     1 
ATOM   1198 C  CB    . MET C 3 77  ? -16.860 56.105 24.871 1.00 34.62  ? 77  MET A CB    1 
ATOM   1199 C  CG    . MET C 3 77  ? -16.125 57.499 24.918 1.00 44.61  ? 77  MET A CG    1 
ATOM   1200 S  SD    . MET C 3 77  ? -14.282 57.289 25.161 1.00 47.27  ? 77  MET A SD    1 
ATOM   1201 C  CE    . MET C 3 77  ? -14.131 58.116 26.750 1.00 50.54  ? 77  MET A CE    1 
ATOM   1202 N  N     . GLU C 3 78  ? -18.919 57.465 22.864 1.00 27.04  ? 78  GLU A N     1 
ATOM   1203 C  CA    . GLU C 3 78  ? -20.301 57.914 22.743 1.00 27.23  ? 78  GLU A CA    1 
ATOM   1204 C  C     . GLU C 3 78  ? -20.690 58.657 21.442 1.00 25.15  ? 78  GLU A C     1 
ATOM   1205 O  O     . GLU C 3 78  ? -21.775 59.200 21.346 1.00 24.05  ? 78  GLU A O     1 
ATOM   1206 C  CB    . GLU C 3 78  ? -20.619 58.786 23.982 1.00 30.68  ? 78  GLU A CB    1 
ATOM   1207 C  CG    . GLU C 3 78  ? -20.322 58.053 25.295 1.00 38.78  ? 78  GLU A CG    1 
ATOM   1208 C  CD    . GLU C 3 78  ? -19.967 58.978 26.475 1.00 41.67  ? 78  GLU A CD    1 
ATOM   1209 O  OE1   . GLU C 3 78  ? -18.758 59.315 26.706 1.00 44.41  ? 78  GLU A OE1   1 
ATOM   1210 O  OE2   . GLU C 3 78  ? -20.920 59.359 27.180 1.00 40.18  ? 78  GLU A OE2   1 
ATOM   1211 N  N     . GLY C 3 79  ? -19.816 58.688 20.449 1.00 24.10  ? 79  GLY A N     1 
ATOM   1212 C  CA    . GLY C 3 79  ? -20.184 59.356 19.215 1.00 18.90  ? 79  GLY A CA    1 
ATOM   1213 C  C     . GLY C 3 79  ? -21.362 58.624 18.578 1.00 20.42  ? 79  GLY A C     1 
ATOM   1214 O  O     . GLY C 3 79  ? -21.554 57.432 18.784 1.00 19.47  ? 79  GLY A O     1 
ATOM   1215 N  N     . ARG C 3 80  ? -22.125 59.320 17.755 1.00 18.63  ? 80  ARG A N     1 
ATOM   1216 C  CA    . ARG C 3 80  ? -23.279 58.725 17.090 1.00 21.50  ? 80  ARG A CA    1 
ATOM   1217 C  C     . ARG C 3 80  ? -23.596 59.535 15.809 1.00 20.26  ? 80  ARG A C     1 
ATOM   1218 O  O     . ARG C 3 80  ? -23.402 60.741 15.788 1.00 19.59  ? 80  ARG A O     1 
ATOM   1219 C  CB    . ARG C 3 80  ? -24.498 58.784 18.050 1.00 23.65  ? 80  ARG A CB    1 
ATOM   1220 N  N     . TYR C 3 81  ? -24.079 58.875 14.768 1.00 18.38  ? 81  TYR A N     1 
ATOM   1221 C  CA    . TYR C 3 81  ? -24.462 59.541 13.536 1.00 18.66  ? 81  TYR A CA    1 
ATOM   1222 C  C     . TYR C 3 81  ? -25.945 59.421 13.304 1.00 19.45  ? 81  TYR A C     1 
ATOM   1223 O  O     . TYR C 3 81  ? -26.548 58.405 13.627 1.00 18.73  ? 81  TYR A O     1 
ATOM   1224 C  CB    . TYR C 3 81  ? -23.827 58.914 12.292 1.00 15.88  ? 81  TYR A CB    1 
ATOM   1225 C  CG    . TYR C 3 81  ? -22.416 59.358 12.027 1.00 18.03  ? 81  TYR A CG    1 
ATOM   1226 C  CD1   . TYR C 3 81  ? -21.356 58.487 12.234 1.00 19.43  ? 81  TYR A CD1   1 
ATOM   1227 C  CD2   . TYR C 3 81  ? -22.158 60.632 11.534 1.00 16.73  ? 81  TYR A CD2   1 
ATOM   1228 C  CE1   . TYR C 3 81  ? -20.031 58.852 11.952 1.00 20.70  ? 81  TYR A CE1   1 
ATOM   1229 C  CE2   . TYR C 3 81  ? -20.861 61.032 11.247 1.00 19.23  ? 81  TYR A CE2   1 
ATOM   1230 C  CZ    . TYR C 3 81  ? -19.794 60.123 11.458 1.00 21.96  ? 81  TYR A CZ    1 
ATOM   1231 O  OH    . TYR C 3 81  ? -18.511 60.490 11.137 1.00 23.02  ? 81  TYR A OH    1 
ATOM   1232 N  N     . ALA C 3 82  ? -26.527 60.433 12.683 1.00 17.19  ? 82  ALA A N     1 
ATOM   1233 C  CA    . ALA C 3 82  ? -27.956 60.349 12.333 1.00 19.81  ? 82  ALA A CA    1 
ATOM   1234 C  C     . ALA C 3 82  ? -28.156 61.125 11.034 1.00 17.11  ? 82  ALA A C     1 
ATOM   1235 O  O     . ALA C 3 82  ? -27.379 62.027 10.719 1.00 16.44  ? 82  ALA A O     1 
ATOM   1236 C  CB    . ALA C 3 82  ? -28.859 60.974 13.456 1.00 19.13  ? 82  ALA A CB    1 
ATOM   1237 N  N     . VAL C 3 83  ? -29.193 60.765 10.287 1.00 16.47  ? 83  VAL A N     1 
ATOM   1238 C  CA    . VAL C 3 83  ? -29.526 61.456 9.056  1.00 18.65  ? 83  VAL A CA    1 
ATOM   1239 C  C     . VAL C 3 83  ? -30.892 62.110 9.312  1.00 20.97  ? 83  VAL A C     1 
ATOM   1240 O  O     . VAL C 3 83  ? -31.842 61.425 9.730  1.00 19.72  ? 83  VAL A O     1 
ATOM   1241 C  CB    . VAL C 3 83  ? -29.649 60.460 7.845  1.00 19.06  ? 83  VAL A CB    1 
ATOM   1242 C  CG1   . VAL C 3 83  ? -30.162 61.206 6.601  1.00 19.32  ? 83  VAL A CG1   1 
ATOM   1243 C  CG2   . VAL C 3 83  ? -28.278 59.856 7.505  1.00 13.81  ? 83  VAL A CG2   1 
ATOM   1244 N  N     . ALA C 3 84  ? -30.999 63.422 9.091  1.00 19.54  ? 84  ALA A N     1 
ATOM   1245 C  CA    . ALA C 3 84  ? -32.298 64.093 9.288  1.00 18.88  ? 84  ALA A CA    1 
ATOM   1246 C  C     . ALA C 3 84  ? -32.411 65.342 8.388  1.00 20.78  ? 84  ALA A C     1 
ATOM   1247 O  O     . ALA C 3 84  ? -31.476 65.707 7.696  1.00 16.87  ? 84  ALA A O     1 
ATOM   1248 C  CB    . ALA C 3 84  ? -32.482 64.496 10.756 1.00 17.85  ? 84  ALA A CB    1 
ATOM   1249 N  N     . SER C 3 85  ? -33.555 66.008 8.465  1.00 18.44  ? 85  SER A N     1 
ATOM   1250 C  CA    . SER C 3 85  ? -33.839 67.173 7.659  1.00 18.62  ? 85  SER A CA    1 
ATOM   1251 C  C     . SER C 3 85  ? -33.147 68.462 8.099  1.00 18.86  ? 85  SER A C     1 
ATOM   1252 O  O     . SER C 3 85  ? -33.064 68.772 9.302  1.00 20.53  ? 85  SER A O     1 
ATOM   1253 C  CB    . SER C 3 85  ? -35.377 67.391 7.646  1.00 17.29  ? 85  SER A CB    1 
ATOM   1254 O  OG    . SER C 3 85  ? -35.638 68.632 6.996  1.00 15.46  ? 85  SER A OG    1 
ATOM   1255 N  N     . ALA C 3 86  ? -32.678 69.259 7.140  1.00 19.50  ? 86  ALA A N     1 
ATOM   1256 C  CA    . ALA C 3 86  ? -32.043 70.529 7.518  1.00 19.54  ? 86  ALA A CA    1 
ATOM   1257 C  C     . ALA C 3 86  ? -33.117 71.500 8.092  1.00 20.83  ? 86  ALA A C     1 
ATOM   1258 O  O     . ALA C 3 86  ? -32.799 72.531 8.712  1.00 20.76  ? 86  ALA A O     1 
ATOM   1259 C  CB    . ALA C 3 86  ? -31.367 71.180 6.266  1.00 17.78  ? 86  ALA A CB    1 
ATOM   1260 N  N     . LEU C 3 87  ? -34.397 71.203 7.904  1.00 19.59  ? 87  LEU A N     1 
ATOM   1261 C  CA    . LEU C 3 87  ? -35.397 72.122 8.437  1.00 20.54  ? 87  LEU A CA    1 
ATOM   1262 C  C     . LEU C 3 87  ? -35.646 71.989 9.951  1.00 22.87  ? 87  LEU A C     1 
ATOM   1263 O  O     . LEU C 3 87  ? -36.234 72.874 10.539 1.00 23.38  ? 87  LEU A O     1 
ATOM   1264 C  CB    . LEU C 3 87  ? -36.746 71.918 7.693  1.00 19.23  ? 87  LEU A CB    1 
ATOM   1265 C  CG    . LEU C 3 87  ? -36.554 71.991 6.170  1.00 24.00  ? 87  LEU A CG    1 
ATOM   1266 C  CD1   . LEU C 3 87  ? -37.890 71.614 5.463  1.00 24.19  ? 87  LEU A CD1   1 
ATOM   1267 C  CD2   . LEU C 3 87  ? -36.040 73.392 5.770  1.00 22.25  ? 87  LEU A CD2   1 
ATOM   1268 N  N     . GLU C 3 88  ? -35.228 70.890 10.571 1.00 22.00  ? 88  GLU A N     1 
ATOM   1269 C  CA    . GLU C 3 88  ? -35.488 70.637 11.997 1.00 23.84  ? 88  GLU A CA    1 
ATOM   1270 C  C     . GLU C 3 88  ? -34.390 71.111 12.951 1.00 23.64  ? 88  GLU A C     1 
ATOM   1271 O  O     . GLU C 3 88  ? -33.222 71.085 12.597 1.00 22.44  ? 88  GLU A O     1 
ATOM   1272 C  CB    . GLU C 3 88  ? -35.711 69.117 12.232 1.00 28.40  ? 88  GLU A CB    1 
ATOM   1273 C  CG    . GLU C 3 88  ? -36.881 68.480 11.451 1.00 35.68  ? 88  GLU A CG    1 
ATOM   1274 C  CD    . GLU C 3 88  ? -38.237 69.209 11.666 1.00 46.36  ? 88  GLU A CD    1 
ATOM   1275 O  OE1   . GLU C 3 88  ? -38.523 69.688 12.793 1.00 47.41  ? 88  GLU A OE1   1 
ATOM   1276 O  OE2   . GLU C 3 88  ? -39.047 69.303 10.709 1.00 51.82  ? 88  GLU A OE2   1 
ATOM   1277 N  N     . PRO C 3 89  ? -34.757 71.507 14.194 1.00 25.14  ? 89  PRO A N     1 
ATOM   1278 C  CA    . PRO C 3 89  ? -33.746 71.967 15.160 1.00 25.27  ? 89  PRO A CA    1 
ATOM   1279 C  C     . PRO C 3 89  ? -32.697 70.874 15.419 1.00 28.29  ? 89  PRO A C     1 
ATOM   1280 O  O     . PRO C 3 89  ? -33.009 69.668 15.416 1.00 24.81  ? 89  PRO A O     1 
ATOM   1281 C  CB    . PRO C 3 89  ? -34.579 72.291 16.423 1.00 25.17  ? 89  PRO A CB    1 
ATOM   1282 C  CG    . PRO C 3 89  ? -35.998 72.609 15.866 1.00 24.60  ? 89  PRO A CG    1 
ATOM   1283 C  CD    . PRO C 3 89  ? -36.110 71.514 14.804 1.00 25.08  ? 89  PRO A CD    1 
ATOM   1284 N  N     . LEU C 3 90  ? -31.454 71.278 15.635 1.00 25.48  ? 90  LEU A N     1 
ATOM   1285 C  CA    . LEU C 3 90  ? -30.373 70.308 15.921 1.00 27.52  ? 90  LEU A CA    1 
ATOM   1286 C  C     . LEU C 3 90  ? -30.451 69.668 17.342 1.00 30.38  ? 90  LEU A C     1 
ATOM   1287 O  O     . LEU C 3 90  ? -30.769 70.339 18.301 1.00 31.41  ? 90  LEU A O     1 
ATOM   1288 C  CB    . LEU C 3 90  ? -29.022 71.025 15.753 1.00 26.38  ? 90  LEU A CB    1 
ATOM   1289 C  CG    . LEU C 3 90  ? -27.972 70.637 14.694 1.00 31.06  ? 90  LEU A CG    1 
ATOM   1290 C  CD1   . LEU C 3 90  ? -28.540 70.072 13.408 1.00 24.62  ? 90  LEU A CD1   1 
ATOM   1291 C  CD2   . LEU C 3 90  ? -27.131 71.861 14.415 1.00 28.06  ? 90  LEU A CD2   1 
ATOM   1292 N  N     . GLU C 3 91  ? -30.224 68.361 17.458 1.00 29.92  ? 91  GLU A N     1 
ATOM   1293 C  CA    . GLU C 3 91  ? -30.210 67.673 18.739 1.00 32.74  ? 91  GLU A CA    1 
ATOM   1294 C  C     . GLU C 3 91  ? -28.988 68.238 19.557 1.00 32.48  ? 91  GLU A C     1 
ATOM   1295 O  O     . GLU C 3 91  ? -28.065 68.852 19.009 1.00 30.28  ? 91  GLU A O     1 
ATOM   1296 C  CB    . GLU C 3 91  ? -30.054 66.149 18.479 1.00 35.90  ? 91  GLU A CB    1 
ATOM   1297 C  CG    . GLU C 3 91  ? -31.059 65.545 17.399 1.00 45.36  ? 91  GLU A CG    1 
ATOM   1298 C  CD    . GLU C 3 91  ? -30.494 64.373 16.453 1.00 52.28  ? 91  GLU A CD    1 
ATOM   1299 O  OE1   . GLU C 3 91  ? -29.582 64.589 15.578 1.00 50.81  ? 91  GLU A OE1   1 
ATOM   1300 O  OE2   . GLU C 3 91  ? -30.994 63.211 16.564 1.00 54.54  ? 91  GLU A OE2   1 
ATOM   1301 N  N     . PRO C 3 92  ? -28.972 68.052 20.885 1.00 32.75  ? 92  PRO A N     1 
ATOM   1302 C  CA    . PRO C 3 92  ? -27.847 68.560 21.683 1.00 30.10  ? 92  PRO A CA    1 
ATOM   1303 C  C     . PRO C 3 92  ? -26.531 67.828 21.365 1.00 26.68  ? 92  PRO A C     1 
ATOM   1304 O  O     . PRO C 3 92  ? -26.550 66.652 20.973 1.00 21.96  ? 92  PRO A O     1 
ATOM   1305 C  CB    . PRO C 3 92  ? -28.285 68.269 23.117 1.00 32.12  ? 92  PRO A CB    1 
ATOM   1306 C  CG    . PRO C 3 92  ? -29.776 68.327 23.025 1.00 35.82  ? 92  PRO A CG    1 
ATOM   1307 C  CD    . PRO C 3 92  ? -30.033 67.537 21.766 1.00 34.17  ? 92  PRO A CD    1 
ATOM   1308 N  N     . HIS C 3 93  ? -25.413 68.540 21.530 1.00 26.72  ? 93  HIS A N     1 
ATOM   1309 C  CA    . HIS C 3 93  ? -24.067 68.000 21.308 1.00 25.32  ? 93  HIS A CA    1 
ATOM   1310 C  C     . HIS C 3 93  ? -23.779 67.598 19.853 1.00 26.81  ? 93  HIS A C     1 
ATOM   1311 O  O     . HIS C 3 93  ? -23.055 66.614 19.613 1.00 26.99  ? 93  HIS A O     1 
ATOM   1312 C  CB    . HIS C 3 93  ? -23.835 66.748 22.172 1.00 27.88  ? 93  HIS A CB    1 
ATOM   1313 C  CG    . HIS C 3 93  ? -24.252 66.912 23.591 1.00 30.98  ? 93  HIS A CG    1 
ATOM   1314 N  ND1   . HIS C 3 93  ? -23.725 67.891 24.411 1.00 32.29  ? 93  HIS A ND1   1 
ATOM   1315 C  CD2   . HIS C 3 93  ? -25.202 66.275 24.319 1.00 31.01  ? 93  HIS A CD2   1 
ATOM   1316 C  CE1   . HIS C 3 93  ? -24.339 67.855 25.580 1.00 33.03  ? 93  HIS A CE1   1 
ATOM   1317 N  NE2   . HIS C 3 93  ? -25.241 66.885 25.549 1.00 31.79  ? 93  HIS A NE2   1 
ATOM   1318 N  N     . THR C 3 94  ? -24.315 68.336 18.884 1.00 24.62  ? 94  THR A N     1 
ATOM   1319 C  CA    . THR C 3 94  ? -24.057 67.993 17.497 1.00 22.20  ? 94  THR A CA    1 
ATOM   1320 C  C     . THR C 3 94  ? -22.813 68.801 17.184 1.00 22.65  ? 94  THR A C     1 
ATOM   1321 O  O     . THR C 3 94  ? -22.839 70.009 17.270 1.00 23.83  ? 94  THR A O     1 
ATOM   1322 C  CB    . THR C 3 94  ? -25.258 68.408 16.628 1.00 21.35  ? 94  THR A CB    1 
ATOM   1323 O  OG1   . THR C 3 94  ? -26.434 67.693 17.067 1.00 18.68  ? 94  THR A OG1   1 
ATOM   1324 C  CG2   . THR C 3 94  ? -24.972 68.136 15.162 1.00 19.14  ? 94  THR A CG2   1 
ATOM   1325 N  N     . HIS C 3 95  ? -21.699 68.163 16.856 1.00 20.92  ? 95  HIS A N     1 
ATOM   1326 C  CA    . HIS C 3 95  ? -20.490 68.944 16.622 1.00 19.85  ? 95  HIS A CA    1 
ATOM   1327 C  C     . HIS C 3 95  ? -20.048 69.140 15.183 1.00 19.42  ? 95  HIS A C     1 
ATOM   1328 O  O     . HIS C 3 95  ? -19.307 70.093 14.919 1.00 22.49  ? 95  HIS A O     1 
ATOM   1329 C  CB    . HIS C 3 95  ? -19.322 68.363 17.417 1.00 20.11  ? 95  HIS A CB    1 
ATOM   1330 C  CG    . HIS C 3 95  ? -19.657 68.130 18.845 1.00 22.85  ? 95  HIS A CG    1 
ATOM   1331 N  ND1   . HIS C 3 95  ? -20.042 69.151 19.689 1.00 24.57  ? 95  HIS A ND1   1 
ATOM   1332 C  CD2   . HIS C 3 95  ? -19.728 66.987 19.573 1.00 24.79  ? 95  HIS A CD2   1 
ATOM   1333 C  CE1   . HIS C 3 95  ? -20.336 68.643 20.876 1.00 25.12  ? 95  HIS A CE1   1 
ATOM   1334 N  NE2   . HIS C 3 95  ? -20.154 67.335 20.830 1.00 22.82  ? 95  HIS A NE2   1 
ATOM   1335 N  N     . VAL C 3 96  ? -20.518 68.269 14.272 1.00 20.00  ? 96  VAL A N     1 
ATOM   1336 C  CA    . VAL C 3 96  ? -20.173 68.301 12.841 1.00 17.42  ? 96  VAL A CA    1 
ATOM   1337 C  C     . VAL C 3 96  ? -21.441 67.911 12.030 1.00 17.77  ? 96  VAL A C     1 
ATOM   1338 O  O     . VAL C 3 96  ? -22.078 66.888 12.321 1.00 16.80  ? 96  VAL A O     1 
ATOM   1339 C  CB    . VAL C 3 96  ? -19.049 67.261 12.501 1.00 18.57  ? 96  VAL A CB    1 
ATOM   1340 C  CG1   . VAL C 3 96  ? -18.678 67.343 11.033 1.00 19.02  ? 96  VAL A CG1   1 
ATOM   1341 C  CG2   . VAL C 3 96  ? -17.787 67.549 13.315 1.00 16.20  ? 96  VAL A CG2   1 
ATOM   1342 N  N     . VAL C 3 97  ? -21.809 68.710 11.031 1.00 13.52  ? 97  VAL A N     1 
ATOM   1343 C  CA    . VAL C 3 97  ? -22.974 68.388 10.211 1.00 11.55  ? 97  VAL A CA    1 
ATOM   1344 C  C     . VAL C 3 97  ? -22.556 68.462 8.733  1.00 16.08  ? 97  VAL A C     1 
ATOM   1345 O  O     . VAL C 3 97  ? -21.920 69.460 8.297  1.00 15.56  ? 97  VAL A O     1 
ATOM   1346 C  CB    . VAL C 3 97  ? -24.082 69.427 10.395 1.00 16.51  ? 97  VAL A CB    1 
ATOM   1347 C  CG1   . VAL C 3 97  ? -25.285 69.156 9.384  1.00 11.30  ? 97  VAL A CG1   1 
ATOM   1348 C  CG2   . VAL C 3 97  ? -24.552 69.413 11.865 1.00 12.12  ? 97  VAL A CG2   1 
ATOM   1349 N  N     . PHE C 3 98  ? -22.871 67.419 7.966  1.00 14.52  ? 98  PHE A N     1 
ATOM   1350 C  CA    . PHE C 3 98  ? -22.572 67.432 6.518  1.00 15.72  ? 98  PHE A CA    1 
ATOM   1351 C  C     . PHE C 3 98  ? -23.953 67.688 5.852  1.00 16.96  ? 98  PHE A C     1 
ATOM   1352 O  O     . PHE C 3 98  ? -24.875 66.858 5.970  1.00 18.37  ? 98  PHE A O     1 
ATOM   1353 C  CB    . PHE C 3 98  ? -21.988 66.068 6.079  1.00 14.52  ? 98  PHE A CB    1 
ATOM   1354 C  CG    . PHE C 3 98  ? -20.707 65.672 6.831  1.00 16.24  ? 98  PHE A CG    1 
ATOM   1355 C  CD1   . PHE C 3 98  ? -20.783 64.997 8.061  1.00 16.51  ? 98  PHE A CD1   1 
ATOM   1356 C  CD2   . PHE C 3 98  ? -19.446 66.020 6.328  1.00 15.99  ? 98  PHE A CD2   1 
ATOM   1357 C  CE1   . PHE C 3 98  ? -19.577 64.672 8.807  1.00 22.69  ? 98  PHE A CE1   1 
ATOM   1358 C  CE2   . PHE C 3 98  ? -18.243 65.711 7.044  1.00 17.13  ? 98  PHE A CE2   1 
ATOM   1359 C  CZ    . PHE C 3 98  ? -18.311 65.030 8.306  1.00 16.16  ? 98  PHE A CZ    1 
ATOM   1360 N  N     . CYS C 3 99  ? -24.094 68.810 5.166  1.00 15.24  ? 99  CYS A N     1 
ATOM   1361 C  CA    . CYS C 3 99  ? -25.360 69.190 4.537  1.00 16.05  ? 99  CYS A CA    1 
ATOM   1362 C  C     . CYS C 3 99  ? -25.350 68.711 3.089  1.00 17.46  ? 99  CYS A C     1 
ATOM   1363 O  O     . CYS C 3 99  ? -24.410 68.991 2.329  1.00 16.36  ? 99  CYS A O     1 
ATOM   1364 C  CB    . CYS C 3 99  ? -25.523 70.707 4.585  1.00 17.73  ? 99  CYS A CB    1 
ATOM   1365 S  SG    . CYS C 3 99  ? -25.387 71.335 6.292  1.00 22.10  ? 99  CYS A SG    1 
ATOM   1366 N  N     . PHE C 3 100 ? -26.361 67.937 2.738  1.00 13.78  ? 100 PHE A N     1 
ATOM   1367 C  CA    . PHE C 3 100 ? -26.470 67.424 1.374  1.00 14.39  ? 100 PHE A CA    1 
ATOM   1368 C  C     . PHE C 3 100 ? -27.401 68.329 0.542  1.00 14.98  ? 100 PHE A C     1 
ATOM   1369 O  O     . PHE C 3 100 ? -28.242 69.063 1.105  1.00 11.45  ? 100 PHE A O     1 
ATOM   1370 C  CB    . PHE C 3 100 ? -27.033 65.984 1.389  1.00 11.40  ? 100 PHE A CB    1 
ATOM   1371 C  CG    . PHE C 3 100 ? -26.180 65.015 2.174  1.00 14.26  ? 100 PHE A CG    1 
ATOM   1372 C  CD1   . PHE C 3 100 ? -24.852 64.762 1.797  1.00 12.97  ? 100 PHE A CD1   1 
ATOM   1373 C  CD2   . PHE C 3 100 ? -26.703 64.365 3.290  1.00 14.96  ? 100 PHE A CD2   1 
ATOM   1374 C  CE1   . PHE C 3 100 ? -24.036 63.857 2.543  1.00 14.31  ? 100 PHE A CE1   1 
ATOM   1375 C  CE2   . PHE C 3 100 ? -25.913 63.451 4.051  1.00 15.86  ? 100 PHE A CE2   1 
ATOM   1376 C  CZ    . PHE C 3 100 ? -24.581 63.200 3.679  1.00 14.47  ? 100 PHE A CZ    1 
ATOM   1377 N  N     . THR C 3 101 ? -27.242 68.250 -0.774 1.00 14.17  ? 101 THR A N     1 
ATOM   1378 C  CA    . THR C 3 101 ? -28.024 69.072 -1.724 1.00 15.58  ? 101 THR A CA    1 
ATOM   1379 C  C     . THR C 3 101 ? -29.518 68.794 -1.730 1.00 17.56  ? 101 THR A C     1 
ATOM   1380 O  O     . THR C 3 101 ? -30.314 69.597 -2.223 1.00 15.13  ? 101 THR A O     1 
ATOM   1381 C  CB    . THR C 3 101 ? -27.536 68.863 -3.185 1.00 11.43  ? 101 THR A CB    1 
ATOM   1382 O  OG1   . THR C 3 101 ? -27.539 67.472 -3.483 1.00 13.26  ? 101 THR A OG1   1 
ATOM   1383 C  CG2   . THR C 3 101 ? -26.074 69.459 -3.404 1.00 12.65  ? 101 THR A CG2   1 
ATOM   1384 N  N     . ASP C 3 102 ? -29.892 67.644 -1.184 1.00 17.11  ? 102 ASP A N     1 
ATOM   1385 C  CA    . ASP C 3 102 ? -31.300 67.231 -1.120 1.00 15.75  ? 102 ASP A CA    1 
ATOM   1386 C  C     . ASP C 3 102 ? -32.035 67.729 0.118  1.00 13.85  ? 102 ASP A C     1 
ATOM   1387 O  O     . ASP C 3 102 ? -33.225 67.418 0.311  1.00 13.11  ? 102 ASP A O     1 
ATOM   1388 C  CB    . ASP C 3 102 ? -31.379 65.694 -1.267 1.00 16.35  ? 102 ASP A CB    1 
ATOM   1389 C  CG    . ASP C 3 102 ? -30.995 64.952 0.014  1.00 18.22  ? 102 ASP A CG    1 
ATOM   1390 O  OD1   . ASP C 3 102 ? -30.386 65.579 0.923  1.00 16.95  ? 102 ASP A OD1   1 
ATOM   1391 O  OD2   . ASP C 3 102 ? -31.313 63.732 0.110  1.00 23.44  ? 102 ASP A OD2   1 
ATOM   1392 N  N     . GLY C 3 103 ? -31.355 68.570 0.916  1.00 16.36  ? 103 GLY A N     1 
ATOM   1393 C  CA    . GLY C 3 103 ? -31.967 69.137 2.132  1.00 16.21  ? 103 GLY A CA    1 
ATOM   1394 C  C     . GLY C 3 103 ? -31.834 68.225 3.357  1.00 19.58  ? 103 GLY A C     1 
ATOM   1395 O  O     . GLY C 3 103 ? -32.387 68.541 4.432  1.00 18.25  ? 103 GLY A O     1 
ATOM   1396 N  N     . SER C 3 104 ? -31.207 67.056 3.186  1.00 14.34  ? 104 SER A N     1 
ATOM   1397 C  CA    . SER C 3 104 ? -30.972 66.173 4.364  1.00 17.16  ? 104 SER A CA    1 
ATOM   1398 C  C     . SER C 3 104 ? -29.572 66.452 4.891  1.00 15.95  ? 104 SER A C     1 
ATOM   1399 O  O     . SER C 3 104 ? -28.781 67.168 4.234  1.00 15.59  ? 104 SER A O     1 
ATOM   1400 C  CB    . SER C 3 104 ? -31.133 64.690 3.990  1.00 13.76  ? 104 SER A CB    1 
ATOM   1401 O  OG    . SER C 3 104 ? -30.108 64.284 3.088  1.00 17.88  ? 104 SER A OG    1 
ATOM   1402 N  N     . GLU C 3 105 ? -29.250 65.938 6.084  1.00 15.24  ? 105 GLU A N     1 
ATOM   1403 C  CA    . GLU C 3 105 ? -27.939 66.170 6.687  1.00 17.30  ? 105 GLU A CA    1 
ATOM   1404 C  C     . GLU C 3 105 ? -27.468 64.914 7.413  1.00 16.73  ? 105 GLU A C     1 
ATOM   1405 O  O     . GLU C 3 105 ? -28.295 64.119 7.940  1.00 15.86  ? 105 GLU A O     1 
ATOM   1406 C  CB    . GLU C 3 105 ? -27.993 67.282 7.766  1.00 16.85  ? 105 GLU A CB    1 
ATOM   1407 C  CG    . GLU C 3 105 ? -28.624 68.556 7.361  1.00 19.51  ? 105 GLU A CG    1 
ATOM   1408 C  CD    . GLU C 3 105 ? -28.761 69.515 8.531  1.00 23.18  ? 105 GLU A CD    1 
ATOM   1409 O  OE1   . GLU C 3 105 ? -29.130 69.046 9.622  1.00 23.93  ? 105 GLU A OE1   1 
ATOM   1410 O  OE2   . GLU C 3 105 ? -28.522 70.725 8.352  1.00 22.13  ? 105 GLU A OE2   1 
ATOM   1411 N  N     . LEU C 3 106 ? -26.151 64.727 7.457  1.00 15.58  ? 106 LEU A N     1 
ATOM   1412 C  CA    . LEU C 3 106 ? -25.606 63.603 8.230  1.00 17.39  ? 106 LEU A CA    1 
ATOM   1413 C  C     . LEU C 3 106 ? -25.054 64.381 9.444  1.00 19.20  ? 106 LEU A C     1 
ATOM   1414 O  O     . LEU C 3 106 ? -24.180 65.265 9.305  1.00 15.85  ? 106 LEU A O     1 
ATOM   1415 C  CB    . LEU C 3 106 ? -24.465 62.888 7.481  1.00 17.82  ? 106 LEU A CB    1 
ATOM   1416 C  CG    . LEU C 3 106 ? -23.696 61.872 8.351  1.00 20.35  ? 106 LEU A CG    1 
ATOM   1417 C  CD1   . LEU C 3 106 ? -24.619 60.743 8.747  1.00 18.25  ? 106 LEU A CD1   1 
ATOM   1418 C  CD2   . LEU C 3 106 ? -22.451 61.334 7.574  1.00 19.53  ? 106 LEU A CD2   1 
ATOM   1419 N  N     . ARG C 3 107 ? -25.541 64.040 10.627 1.00 16.34  ? 107 ARG A N     1 
ATOM   1420 C  CA    . ARG C 3 107 ? -25.150 64.764 11.830 1.00 18.19  ? 107 ARG A CA    1 
ATOM   1421 C  C     . ARG C 3 107 ? -24.299 63.924 12.735 1.00 19.88  ? 107 ARG A C     1 
ATOM   1422 O  O     . ARG C 3 107 ? -24.629 62.767 12.988 1.00 20.81  ? 107 ARG A O     1 
ATOM   1423 C  CB    . ARG C 3 107 ? -26.405 65.191 12.604 1.00 17.62  ? 107 ARG A CB    1 
ATOM   1424 C  CG    . ARG C 3 107 ? -27.202 66.254 11.857 1.00 19.01  ? 107 ARG A CG    1 
ATOM   1425 C  CD    . ARG C 3 107 ? -28.609 65.847 11.884 1.00 27.72  ? 107 ARG A CD    1 
ATOM   1426 N  NE    . ARG C 3 107 ? -29.510 66.908 11.500 1.00 28.82  ? 107 ARG A NE    1 
ATOM   1427 C  CZ    . ARG C 3 107 ? -30.658 67.135 12.120 1.00 30.48  ? 107 ARG A CZ    1 
ATOM   1428 N  NH1   . ARG C 3 107 ? -31.000 66.372 13.153 1.00 32.11  ? 107 ARG A NH1   1 
ATOM   1429 N  NH2   . ARG C 3 107 ? -31.478 68.075 11.689 1.00 24.38  ? 107 ARG A NH2   1 
ATOM   1430 N  N     . TYR C 3 108 ? -23.230 64.510 13.245 1.00 17.54  ? 108 TYR A N     1 
ATOM   1431 C  CA    . TYR C 3 108 ? -22.369 63.778 14.170 1.00 19.68  ? 108 TYR A CA    1 
ATOM   1432 C  C     . TYR C 3 108 ? -22.580 64.373 15.565 1.00 20.21  ? 108 TYR A C     1 
ATOM   1433 O  O     . TYR C 3 108 ? -22.337 65.583 15.746 1.00 15.96  ? 108 TYR A O     1 
ATOM   1434 C  CB    . TYR C 3 108 ? -20.893 63.931 13.802 1.00 19.71  ? 108 TYR A CB    1 
ATOM   1435 C  CG    . TYR C 3 108 ? -19.993 63.278 14.820 1.00 20.93  ? 108 TYR A CG    1 
ATOM   1436 C  CD1   . TYR C 3 108 ? -19.242 64.037 15.699 1.00 19.51  ? 108 TYR A CD1   1 
ATOM   1437 C  CD2   . TYR C 3 108 ? -19.923 61.892 14.908 1.00 22.66  ? 108 TYR A CD2   1 
ATOM   1438 C  CE1   . TYR C 3 108 ? -18.429 63.421 16.670 1.00 22.72  ? 108 TYR A CE1   1 
ATOM   1439 C  CE2   . TYR C 3 108 ? -19.125 61.264 15.856 1.00 25.20  ? 108 TYR A CE2   1 
ATOM   1440 C  CZ    . TYR C 3 108 ? -18.385 62.014 16.737 1.00 26.21  ? 108 TYR A CZ    1 
ATOM   1441 O  OH    . TYR C 3 108 ? -17.605 61.357 17.682 1.00 30.66  ? 108 TYR A OH    1 
ATOM   1442 N  N     . ARG C 3 109 ? -22.958 63.527 16.534 1.00 18.49  ? 109 ARG A N     1 
ATOM   1443 C  CA    . ARG C 3 109 ? -23.230 63.978 17.935 1.00 24.44  ? 109 ARG A CA    1 
ATOM   1444 C  C     . ARG C 3 109 ? -22.294 63.196 18.851 1.00 22.78  ? 109 ARG A C     1 
ATOM   1445 O  O     . ARG C 3 109 ? -22.016 62.017 18.589 1.00 22.19  ? 109 ARG A O     1 
ATOM   1446 C  CB    . ARG C 3 109 ? -24.660 63.611 18.387 1.00 25.25  ? 109 ARG A CB    1 
ATOM   1447 C  CG    . ARG C 3 109 ? -25.786 64.293 17.683 1.00 34.03  ? 109 ARG A CG    1 
ATOM   1448 C  CD    . ARG C 3 109 ? -27.096 63.768 18.283 1.00 37.19  ? 109 ARG A CD    1 
ATOM   1449 N  NE    . ARG C 3 109 ? -27.297 64.302 19.633 1.00 44.52  ? 109 ARG A NE    1 
ATOM   1450 C  CZ    . ARG C 3 109 ? -28.307 63.972 20.451 1.00 44.82  ? 109 ARG A CZ    1 
ATOM   1451 N  NH1   . ARG C 3 109 ? -29.227 63.085 20.080 1.00 42.93  ? 109 ARG A NH1   1 
ATOM   1452 N  NH2   . ARG C 3 109 ? -28.413 64.565 21.631 1.00 44.06  ? 109 ARG A NH2   1 
ATOM   1453 N  N     . ASP C 3 110 ? -21.836 63.821 19.925 1.00 22.96  ? 110 ASP A N     1 
ATOM   1454 C  CA    . ASP C 3 110 ? -20.914 63.139 20.837 1.00 22.09  ? 110 ASP A CA    1 
ATOM   1455 C  C     . ASP C 3 110 ? -20.895 63.966 22.111 1.00 25.34  ? 110 ASP A C     1 
ATOM   1456 O  O     . ASP C 3 110 ? -20.293 65.017 22.125 1.00 22.26  ? 110 ASP A O     1 
ATOM   1457 C  CB    . ASP C 3 110 ? -19.530 63.144 20.231 1.00 19.73  ? 110 ASP A CB    1 
ATOM   1458 C  CG    . ASP C 3 110 ? -18.507 62.273 20.989 1.00 27.40  ? 110 ASP A CG    1 
ATOM   1459 O  OD1   . ASP C 3 110 ? -18.699 61.948 22.185 1.00 24.91  ? 110 ASP A OD1   1 
ATOM   1460 O  OD2   . ASP C 3 110 ? -17.459 61.950 20.354 1.00 28.64  ? 110 ASP A OD2   1 
ATOM   1461 N  N     . VAL C 3 111 ? -21.576 63.513 23.159 1.00 26.00  ? 111 VAL A N     1 
ATOM   1462 C  CA    . VAL C 3 111 ? -21.542 64.231 24.431 1.00 27.46  ? 111 VAL A CA    1 
ATOM   1463 C  C     . VAL C 3 111 ? -20.083 64.433 24.928 1.00 26.33  ? 111 VAL A C     1 
ATOM   1464 O  O     . VAL C 3 111 ? -19.708 65.503 25.371 1.00 23.75  ? 111 VAL A O     1 
ATOM   1465 C  CB    . VAL C 3 111 ? -22.282 63.440 25.565 1.00 30.72  ? 111 VAL A CB    1 
ATOM   1466 C  CG1   . VAL C 3 111 ? -22.336 64.273 26.843 1.00 34.75  ? 111 VAL A CG1   1 
ATOM   1467 C  CG2   . VAL C 3 111 ? -23.714 63.100 25.137 1.00 36.08  ? 111 VAL A CG2   1 
ATOM   1468 N  N     . ARG C 3 112 ? -19.250 63.406 24.826 1.00 29.14  ? 112 ARG A N     1 
ATOM   1469 C  CA    . ARG C 3 112 ? -17.879 63.504 25.356 1.00 29.51  ? 112 ARG A CA    1 
ATOM   1470 C  C     . ARG C 3 112 ? -16.867 64.256 24.497 1.00 30.02  ? 112 ARG A C     1 
ATOM   1471 O  O     . ARG C 3 112 ? -15.826 64.710 24.992 1.00 28.95  ? 112 ARG A O     1 
ATOM   1472 C  CB    . ARG C 3 112 ? -17.380 62.083 25.660 1.00 28.31  ? 112 ARG A CB    1 
ATOM   1473 C  CG    . ARG C 3 112 ? -16.366 61.947 26.821 1.00 30.08  ? 112 ARG A CG    1 
ATOM   1474 C  CD    . ARG C 3 112 ? -16.984 62.320 28.167 1.00 30.17  ? 112 ARG A CD    1 
ATOM   1475 N  NE    . ARG C 3 112 ? -18.239 61.609 28.317 1.00 30.08  ? 112 ARG A NE    1 
ATOM   1476 C  CZ    . ARG C 3 112 ? -19.188 61.877 29.218 1.00 33.22  ? 112 ARG A CZ    1 
ATOM   1477 N  NH1   . ARG C 3 112 ? -20.297 61.150 29.233 1.00 28.51  ? 112 ARG A NH1   1 
ATOM   1478 N  NH2   . ARG C 3 112 ? -19.056 62.870 30.099 1.00 36.38  ? 112 ARG A NH2   1 
ATOM   1479 N  N     . LYS C 3 113 ? -17.198 64.414 23.214 1.00 33.01  ? 113 LYS A N     1 
ATOM   1480 C  CA    . LYS C 3 113 ? -16.336 65.087 22.239 1.00 32.12  ? 113 LYS A CA    1 
ATOM   1481 C  C     . LYS C 3 113 ? -15.033 64.379 22.029 1.00 33.82  ? 113 LYS A C     1 
ATOM   1482 O  O     . LYS C 3 113 ? -14.027 65.028 21.743 1.00 36.03  ? 113 LYS A O     1 
ATOM   1483 C  CB    . LYS C 3 113 ? -16.008 66.510 22.680 1.00 34.98  ? 113 LYS A CB    1 
ATOM   1484 C  CG    . LYS C 3 113 ? -17.169 67.447 22.663 1.00 32.69  ? 113 LYS A CG    1 
ATOM   1485 C  CD    . LYS C 3 113 ? -16.680 68.833 23.015 1.00 37.25  ? 113 LYS A CD    1 
ATOM   1486 C  CE    . LYS C 3 113 ? -17.804 69.821 23.179 1.00 36.44  ? 113 LYS A CE    1 
ATOM   1487 N  NZ    . LYS C 3 113 ? -17.252 71.029 23.843 1.00 41.14  ? 113 LYS A NZ    1 
ATOM   1488 N  N     . PHE C 3 114 ? -15.034 63.058 22.144 1.00 31.20  ? 114 PHE A N     1 
ATOM   1489 C  CA    . PHE C 3 114 ? -13.808 62.311 21.987 1.00 27.95  ? 114 PHE A CA    1 
ATOM   1490 C  C     . PHE C 3 114 ? -13.496 61.792 20.591 1.00 27.89  ? 114 PHE A C     1 
ATOM   1491 O  O     . PHE C 3 114 ? -12.362 61.409 20.311 1.00 27.50  ? 114 PHE A O     1 
ATOM   1492 C  CB    . PHE C 3 114 ? -13.842 61.116 22.950 1.00 30.53  ? 114 PHE A CB    1 
ATOM   1493 C  CG    . PHE C 3 114 ? -13.023 61.313 24.185 1.00 28.58  ? 114 PHE A CG    1 
ATOM   1494 C  CD1   . PHE C 3 114 ? -12.957 62.571 24.800 1.00 28.99  ? 114 PHE A CD1   1 
ATOM   1495 C  CD2   . PHE C 3 114 ? -12.303 60.256 24.719 1.00 26.28  ? 114 PHE A CD2   1 
ATOM   1496 C  CE1   . PHE C 3 114 ? -12.170 62.782 25.938 1.00 31.26  ? 114 PHE A CE1   1 
ATOM   1497 C  CE2   . PHE C 3 114 ? -11.531 60.452 25.833 1.00 28.51  ? 114 PHE A CE2   1 
ATOM   1498 C  CZ    . PHE C 3 114 ? -11.458 61.724 26.449 1.00 29.49  ? 114 PHE A CZ    1 
ATOM   1499 N  N     . GLY C 3 115 ? -14.505 61.775 19.729 1.00 24.50  ? 115 GLY A N     1 
ATOM   1500 C  CA    . GLY C 3 115 ? -14.346 61.223 18.393 1.00 21.55  ? 115 GLY A CA    1 
ATOM   1501 C  C     . GLY C 3 115 ? -13.392 61.997 17.534 1.00 17.91  ? 115 GLY A C     1 
ATOM   1502 O  O     . GLY C 3 115 ? -13.070 63.122 17.836 1.00 16.73  ? 115 GLY A O     1 
ATOM   1503 N  N     . THR C 3 116 ? -12.967 61.401 16.443 1.00 15.84  ? 116 THR A N     1 
ATOM   1504 C  CA    . THR C 3 116 ? -12.014 62.063 15.556 1.00 18.30  ? 116 THR A CA    1 
ATOM   1505 C  C     . THR C 3 116 ? -12.463 61.872 14.090 1.00 17.35  ? 116 THR A C     1 
ATOM   1506 O  O     . THR C 3 116 ? -13.234 60.940 13.782 1.00 17.36  ? 116 THR A O     1 
ATOM   1507 C  CB    . THR C 3 116 ? -10.636 61.414 15.706 1.00 17.78  ? 116 THR A CB    1 
ATOM   1508 O  OG1   . THR C 3 116 ? -10.731 60.033 15.295 1.00 17.92  ? 116 THR A OG1   1 
ATOM   1509 C  CG2   . THR C 3 116 ? -10.166 61.514 17.133 1.00 19.53  ? 116 THR A CG2   1 
ATOM   1510 N  N     . MET C 3 117 ? -12.015 62.794 13.241 1.00 15.91  ? 117 MET A N     1 
ATOM   1511 C  CA    . MET C 3 117 ? -12.248 62.796 11.806 1.00 15.63  ? 117 MET A CA    1 
ATOM   1512 C  C     . MET C 3 117 ? -10.964 63.171 11.076 1.00 15.50  ? 117 MET A C     1 
ATOM   1513 O  O     . MET C 3 117 ? -10.320 64.142 11.413 1.00 15.45  ? 117 MET A O     1 
ATOM   1514 C  CB    . MET C 3 117 ? -13.336 63.790 11.430 1.00 13.64  ? 117 MET A CB    1 
ATOM   1515 C  CG    . MET C 3 117 ? -14.684 63.269 11.889 1.00 16.34  ? 117 MET A CG    1 
ATOM   1516 S  SD    . MET C 3 117 ? -15.992 64.454 11.390 1.00 19.43  ? 117 MET A SD    1 
ATOM   1517 C  CE    . MET C 3 117 ? -17.485 63.802 12.262 1.00 16.75  ? 117 MET A CE    1 
ATOM   1518 N  N     . HIS C 3 118 ? -10.591 62.382 10.079 1.00 15.48  ? 118 HIS A N     1 
ATOM   1519 C  CA    . HIS C 3 118 ? -9.406  62.668 9.263  1.00 15.78  ? 118 HIS A CA    1 
ATOM   1520 C  C     . HIS C 3 118 ? -9.907  62.529 7.848  1.00 15.71  ? 118 HIS A C     1 
ATOM   1521 O  O     . HIS C 3 118 ? -10.675 61.598 7.563  1.00 17.36  ? 118 HIS A O     1 
ATOM   1522 C  CB    . HIS C 3 118 ? -8.312  61.585 9.420  1.00 15.89  ? 118 HIS A CB    1 
ATOM   1523 C  CG    . HIS C 3 118 ? -7.645  61.562 10.754 1.00 15.66  ? 118 HIS A CG    1 
ATOM   1524 N  ND1   . HIS C 3 118 ? -8.283  61.139 11.902 1.00 17.26  ? 118 HIS A ND1   1 
ATOM   1525 C  CD2   . HIS C 3 118 ? -6.374  61.887 11.117 1.00 18.82  ? 118 HIS A CD2   1 
ATOM   1526 C  CE1   . HIS C 3 118 ? -7.434  61.205 12.921 1.00 20.97  ? 118 HIS A CE1   1 
ATOM   1527 N  NE2   . HIS C 3 118 ? -6.266  61.651 12.467 1.00 21.01  ? 118 HIS A NE2   1 
ATOM   1528 N  N     . VAL C 3 119 ? -9.489  63.428 6.968  1.00 17.04  ? 119 VAL A N     1 
ATOM   1529 C  CA    . VAL C 3 119 ? -9.858  63.334 5.547  1.00 16.50  ? 119 VAL A CA    1 
ATOM   1530 C  C     . VAL C 3 119 ? -8.572  63.333 4.703  1.00 19.72  ? 119 VAL A C     1 
ATOM   1531 O  O     . VAL C 3 119 ? -7.694  64.185 4.893  1.00 17.49  ? 119 VAL A O     1 
ATOM   1532 C  CB    . VAL C 3 119 ? -10.736 64.497 5.109  1.00 17.87  ? 119 VAL A CB    1 
ATOM   1533 C  CG1   . VAL C 3 119 ? -10.906 64.441 3.608  1.00 14.36  ? 119 VAL A CG1   1 
ATOM   1534 C  CG2   . VAL C 3 119 ? -12.133 64.368 5.743  1.00 15.71  ? 119 VAL A CG2   1 
ATOM   1535 N  N     . TYR C 3 120 ? -8.479  62.371 3.788  1.00 19.64  ? 120 TYR A N     1 
ATOM   1536 C  CA    . TYR C 3 120 ? -7.322  62.239 2.907  1.00 21.26  ? 120 TYR A CA    1 
ATOM   1537 C  C     . TYR C 3 120 ? -7.821  61.772 1.538  1.00 19.93  ? 120 TYR A C     1 
ATOM   1538 O  O     . TYR C 3 120 ? -8.905  61.182 1.425  1.00 18.78  ? 120 TYR A O     1 
ATOM   1539 C  CB    . TYR C 3 120 ? -6.342  61.123 3.414  1.00 22.54  ? 120 TYR A CB    1 
ATOM   1540 C  CG    . TYR C 3 120 ? -5.652  61.397 4.716  1.00 22.03  ? 120 TYR A CG    1 
ATOM   1541 C  CD1   . TYR C 3 120 ? -4.564  62.282 4.799  1.00 20.13  ? 120 TYR A CD1   1 
ATOM   1542 C  CD2   . TYR C 3 120 ? -6.061  60.755 5.876  1.00 22.91  ? 120 TYR A CD2   1 
ATOM   1543 C  CE1   . TYR C 3 120 ? -3.923  62.497 5.990  1.00 21.28  ? 120 TYR A CE1   1 
ATOM   1544 C  CE2   . TYR C 3 120 ? -5.427  60.973 7.052  1.00 22.69  ? 120 TYR A CE2   1 
ATOM   1545 C  CZ    . TYR C 3 120 ? -4.376  61.823 7.109  1.00 24.89  ? 120 TYR A CZ    1 
ATOM   1546 O  OH    . TYR C 3 120 ? -3.778  61.979 8.321  1.00 34.07  ? 120 TYR A OH    1 
ATOM   1547 N  N     . ALA C 3 121 ? -7.003  61.979 0.518  1.00 17.04  ? 121 ALA A N     1 
ATOM   1548 C  CA    . ALA C 3 121 ? -7.329  61.473 -0.813 1.00 16.92  ? 121 ALA A CA    1 
ATOM   1549 C  C     . ALA C 3 121 ? -7.474  59.963 -0.553 1.00 18.99  ? 121 ALA A C     1 
ATOM   1550 O  O     . ALA C 3 121 ? -6.726  59.428 0.264  1.00 19.09  ? 121 ALA A O     1 
ATOM   1551 C  CB    . ALA C 3 121 ? -6.139  61.708 -1.785 1.00 16.38  ? 121 ALA A CB    1 
ATOM   1552 N  N     . LYS C 3 122 ? -8.438  59.296 -1.197 1.00 18.25  ? 122 LYS A N     1 
ATOM   1553 C  CA    . LYS C 3 122 ? -8.635  57.868 -0.989 1.00 24.30  ? 122 LYS A CA    1 
ATOM   1554 C  C     . LYS C 3 122 ? -7.409  56.961 -1.073 1.00 25.70  ? 122 LYS A C     1 
ATOM   1555 O  O     . LYS C 3 122 ? -7.197  56.122 -0.193 1.00 25.59  ? 122 LYS A O     1 
ATOM   1556 C  CB    . LYS C 3 122 ? -9.693  57.321 -1.962 1.00 25.54  ? 122 LYS A CB    1 
ATOM   1557 C  CG    . LYS C 3 122 ? -11.033 57.829 -1.656 1.00 30.81  ? 122 LYS A CG    1 
ATOM   1558 C  CD    . LYS C 3 122 ? -12.121 57.134 -2.440 1.00 34.19  ? 122 LYS A CD    1 
ATOM   1559 C  CE    . LYS C 3 122 ? -11.979 57.303 -3.911 1.00 31.57  ? 122 LYS A CE    1 
ATOM   1560 N  NZ    . LYS C 3 122 ? -13.369 57.253 -4.453 1.00 35.36  ? 122 LYS A NZ    1 
ATOM   1561 N  N     . GLU C 3 123 ? -6.622  57.082 -2.135 1.00 25.47  ? 123 GLU A N     1 
ATOM   1562 C  CA    . GLU C 3 123 ? -5.453  56.217 -2.288 1.00 27.31  ? 123 GLU A CA    1 
ATOM   1563 C  C     . GLU C 3 123 ? -4.414  56.364 -1.184 1.00 28.02  ? 123 GLU A C     1 
ATOM   1564 O  O     . GLU C 3 123 ? -3.448  55.627 -1.126 1.00 29.80  ? 123 GLU A O     1 
ATOM   1565 C  CB    . GLU C 3 123 ? -4.776  56.496 -3.630 1.00 26.83  ? 123 GLU A CB    1 
ATOM   1566 C  CG    . GLU C 3 123 ? -4.240  57.928 -3.784 1.00 27.69  ? 123 GLU A CG    1 
ATOM   1567 C  CD    . GLU C 3 123 ? -5.299  58.904 -4.353 1.00 27.16  ? 123 GLU A CD    1 
ATOM   1568 O  OE1   . GLU C 3 123 ? -4.893  60.040 -4.792 1.00 27.92  ? 123 GLU A OE1   1 
ATOM   1569 O  OE2   . GLU C 3 123 ? -6.519  58.522 -4.374 1.00 23.61  ? 123 GLU A OE2   1 
ATOM   1570 N  N     . GLU C 3 124 ? -4.618  57.325 -0.311 1.00 25.98  ? 124 GLU A N     1 
ATOM   1571 C  CA    . GLU C 3 124 ? -3.651  57.601 0.731  1.00 29.16  ? 124 GLU A CA    1 
ATOM   1572 C  C     . GLU C 3 124 ? -4.119  57.228 2.144  1.00 27.10  ? 124 GLU A C     1 
ATOM   1573 O  O     . GLU C 3 124 ? -3.307  56.989 3.023  1.00 25.76  ? 124 GLU A O     1 
ATOM   1574 C  CB    . GLU C 3 124 ? -3.362  59.090 0.700  1.00 31.19  ? 124 GLU A CB    1 
ATOM   1575 C  CG    . GLU C 3 124 ? -2.118  59.494 1.312  1.00 44.02  ? 124 GLU A CG    1 
ATOM   1576 C  CD    . GLU C 3 124 ? -1.979  60.986 1.192  1.00 50.77  ? 124 GLU A CD    1 
ATOM   1577 O  OE1   . GLU C 3 124 ? -2.296  61.487 0.087  1.00 53.66  ? 124 GLU A OE1   1 
ATOM   1578 O  OE2   . GLU C 3 124 ? -1.571  61.660 2.171  1.00 53.36  ? 124 GLU A OE2   1 
ATOM   1579 N  N     . ALA C 3 125 ? -5.430  57.174 2.349  1.00 25.45  ? 125 ALA A N     1 
ATOM   1580 C  CA    . ALA C 3 125 ? -5.954  56.919 3.685  1.00 24.70  ? 125 ALA A CA    1 
ATOM   1581 C  C     . ALA C 3 125 ? -5.361  55.679 4.419  1.00 23.04  ? 125 ALA A C     1 
ATOM   1582 O  O     . ALA C 3 125 ? -5.060  55.767 5.587  1.00 20.26  ? 125 ALA A O     1 
ATOM   1583 C  CB    . ALA C 3 125 ? -7.490  56.855 3.628  1.00 21.76  ? 125 ALA A CB    1 
ATOM   1584 N  N     . ASP C 3 126 ? -5.192  54.561 3.726  1.00 20.24  ? 126 ASP A N     1 
ATOM   1585 C  CA    . ASP C 3 126 ? -4.666  53.375 4.370  1.00 27.65  ? 126 ASP A CA    1 
ATOM   1586 C  C     . ASP C 3 126 ? -3.206  53.497 4.777  1.00 27.43  ? 126 ASP A C     1 
ATOM   1587 O  O     . ASP C 3 126 ? -2.756  52.715 5.581  1.00 29.69  ? 126 ASP A O     1 
ATOM   1588 C  CB    . ASP C 3 126 ? -4.855  52.160 3.458  1.00 27.38  ? 126 ASP A CB    1 
ATOM   1589 C  CG    . ASP C 3 126 ? -6.321  51.783 3.288  1.00 33.77  ? 126 ASP A CG    1 
ATOM   1590 O  OD1   . ASP C 3 126 ? -6.637  51.027 2.335  1.00 39.75  ? 126 ASP A OD1   1 
ATOM   1591 O  OD2   . ASP C 3 126 ? -7.177  52.224 4.100  1.00 33.68  ? 126 ASP A OD2   1 
ATOM   1592 N  N     . ARG C 3 127 ? -2.491  54.497 4.262  1.00 25.54  ? 127 ARG A N     1 
ATOM   1593 C  CA    . ARG C 3 127 ? -1.067  54.676 4.578  1.00 28.27  ? 127 ARG A CA    1 
ATOM   1594 C  C     . ARG C 3 127 ? -0.826  55.816 5.554  1.00 26.40  ? 127 ARG A C     1 
ATOM   1595 O  O     . ARG C 3 127 ? 0.314   56.148 5.855  1.00 28.83  ? 127 ARG A O     1 
ATOM   1596 C  CB    . ARG C 3 127 ? -0.274  54.944 3.261  1.00 34.83  ? 127 ARG A CB    1 
ATOM   1597 C  CG    . ARG C 3 127 ? -0.944  54.304 1.989  1.00 43.38  ? 127 ARG A CG    1 
ATOM   1598 C  CD    . ARG C 3 127 ? -0.106  54.254 0.648  1.00 47.75  ? 127 ARG A CD    1 
ATOM   1599 N  NE    . ARG C 3 127 ? 0.086   55.533 -0.059 1.00 51.53  ? 127 ARG A NE    1 
ATOM   1600 C  CZ    . ARG C 3 127 ? 0.863   56.522 0.388  1.00 54.20  ? 127 ARG A CZ    1 
ATOM   1601 N  NH1   . ARG C 3 127 ? 0.992   57.659 -0.297 1.00 55.34  ? 127 ARG A NH1   1 
ATOM   1602 N  NH2   . ARG C 3 127 ? 1.521   56.373 1.531  1.00 57.23  ? 127 ARG A NH2   1 
ATOM   1603 N  N     . ARG C 3 128 ? -1.886  56.427 6.054  1.00 23.36  ? 128 ARG A N     1 
ATOM   1604 C  CA    . ARG C 3 128 ? -1.758  57.562 6.984  1.00 23.44  ? 128 ARG A CA    1 
ATOM   1605 C  C     . ARG C 3 128 ? -2.522  57.265 8.264  1.00 24.40  ? 128 ARG A C     1 
ATOM   1606 O  O     . ARG C 3 128 ? -3.310  56.303 8.327  1.00 21.97  ? 128 ARG A O     1 
ATOM   1607 C  CB    . ARG C 3 128 ? -2.443  58.807 6.385  1.00 29.57  ? 128 ARG A CB    1 
ATOM   1608 C  CG    . ARG C 3 128 ? -1.926  59.266 5.049  1.00 31.67  ? 128 ARG A CG    1 
ATOM   1609 C  CD    . ARG C 3 128 ? -0.600  59.884 5.220  1.00 34.93  ? 128 ARG A CD    1 
ATOM   1610 N  NE    . ARG C 3 128 ? -0.206  60.534 3.983  1.00 40.88  ? 128 ARG A NE    1 
ATOM   1611 C  CZ    . ARG C 3 128 ? 0.936   61.197 3.835  1.00 45.02  ? 128 ARG A CZ    1 
ATOM   1612 N  NH1   . ARG C 3 128 ? 1.777   61.283 4.867  1.00 44.31  ? 128 ARG A NH1   1 
ATOM   1613 N  NH2   . ARG C 3 128 ? 1.249   61.756 2.661  1.00 46.54  ? 128 ARG A NH2   1 
ATOM   1614 N  N     . PRO C 3 129 ? -2.358  58.127 9.266  1.00 24.63  ? 129 PRO A N     1 
ATOM   1615 C  CA    . PRO C 3 129 ? -3.065  57.936 10.523 1.00 27.52  ? 129 PRO A CA    1 
ATOM   1616 C  C     . PRO C 3 129 ? -4.527  58.256 10.218 1.00 27.75  ? 129 PRO A C     1 
ATOM   1617 O  O     . PRO C 3 129 ? -4.816  59.049 9.323  1.00 27.50  ? 129 PRO A O     1 
ATOM   1618 C  CB    . PRO C 3 129 ? -2.394  58.932 11.475 1.00 31.29  ? 129 PRO A CB    1 
ATOM   1619 C  CG    . PRO C 3 129 ? -1.683  59.904 10.599 1.00 31.66  ? 129 PRO A CG    1 
ATOM   1620 C  CD    . PRO C 3 129 ? -1.381  59.233 9.324  1.00 29.03  ? 129 PRO A CD    1 
ATOM   1621 N  N     . PRO C 3 130 ? -5.473  57.644 10.949 1.00 25.35  ? 130 PRO A N     1 
ATOM   1622 C  CA    . PRO C 3 130 ? -5.327  56.679 12.044 1.00 24.62  ? 130 PRO A CA    1 
ATOM   1623 C  C     . PRO C 3 130 ? -5.332  55.240 11.588 1.00 25.86  ? 130 PRO A C     1 
ATOM   1624 O  O     . PRO C 3 130 ? -5.341  54.349 12.421 1.00 26.53  ? 130 PRO A O     1 
ATOM   1625 C  CB    . PRO C 3 130 ? -6.562  56.952 12.897 1.00 24.26  ? 130 PRO A CB    1 
ATOM   1626 C  CG    . PRO C 3 130 ? -7.628  57.215 11.810 1.00 22.94  ? 130 PRO A CG    1 
ATOM   1627 C  CD    . PRO C 3 130 ? -6.886  58.001 10.730 1.00 21.54  ? 130 PRO A CD    1 
ATOM   1628 N  N     . LEU C 3 131 ? -5.335  55.007 10.281 1.00 23.19  ? 131 LEU A N     1 
ATOM   1629 C  CA    . LEU C 3 131 ? -5.408  53.642 9.771  1.00 24.24  ? 131 LEU A CA    1 
ATOM   1630 C  C     . LEU C 3 131 ? -4.077  52.951 9.536  1.00 23.08  ? 131 LEU A C     1 
ATOM   1631 O  O     . LEU C 3 131 ? -4.005  51.730 9.489  1.00 21.62  ? 131 LEU A O     1 
ATOM   1632 C  CB    . LEU C 3 131 ? -6.183  53.606 8.437  1.00 20.25  ? 131 LEU A CB    1 
ATOM   1633 C  CG    . LEU C 3 131 ? -7.652  54.085 8.399  1.00 23.99  ? 131 LEU A CG    1 
ATOM   1634 C  CD1   . LEU C 3 131 ? -8.185  53.860 6.998  1.00 19.97  ? 131 LEU A CD1   1 
ATOM   1635 C  CD2   . LEU C 3 131 ? -8.523  53.268 9.389  1.00 23.49  ? 131 LEU A CD2   1 
ATOM   1636 N  N     . ALA C 3 132 ? -3.038  53.737 9.386  1.00 21.66  ? 132 ALA A N     1 
ATOM   1637 C  CA    . ALA C 3 132 ? -1.733  53.195 9.027  1.00 28.54  ? 132 ALA A CA    1 
ATOM   1638 C  C     . ALA C 3 132 ? -1.221  51.858 9.649  1.00 29.39  ? 132 ALA A C     1 
ATOM   1639 O  O     . ALA C 3 132 ? -0.896  50.907 8.946  1.00 34.46  ? 132 ALA A O     1 
ATOM   1640 C  CB    . ALA C 3 132 ? -0.649  54.342 9.196  1.00 26.65  ? 132 ALA A CB    1 
ATOM   1641 N  N     . GLU C 3 133 ? -1.131  51.762 10.948 1.00 30.92  ? 133 GLU A N     1 
ATOM   1642 C  CA    . GLU C 3 133 ? -0.569  50.534 11.497 1.00 33.58  ? 133 GLU A CA    1 
ATOM   1643 C  C     . GLU C 3 133 ? -1.622  49.604 12.055 1.00 32.61  ? 133 GLU A C     1 
ATOM   1644 O  O     . GLU C 3 133 ? -1.316  48.732 12.875 1.00 32.61  ? 133 GLU A O     1 
ATOM   1645 C  CB    . GLU C 3 133 ? 0.424   50.866 12.612 1.00 40.24  ? 133 GLU A CB    1 
ATOM   1646 C  CG    . GLU C 3 133 ? 1.540   51.901 12.271 1.00 46.88  ? 133 GLU A CG    1 
ATOM   1647 C  CD    . GLU C 3 133 ? 2.350   51.549 11.009 1.00 52.22  ? 133 GLU A CD    1 
ATOM   1648 O  OE1   . GLU C 3 133 ? 2.405   50.343 10.613 1.00 53.13  ? 133 GLU A OE1   1 
ATOM   1649 O  OE2   . GLU C 3 133 ? 2.943   52.500 10.417 1.00 56.09  ? 133 GLU A OE2   1 
ATOM   1650 N  N     . LEU C 3 134 ? -2.860  49.766 11.599 1.00 30.38  ? 134 LEU A N     1 
ATOM   1651 C  CA    . LEU C 3 134 ? -3.960  48.934 12.097 1.00 29.29  ? 134 LEU A CA    1 
ATOM   1652 C  C     . LEU C 3 134 ? -3.713  47.462 11.836 1.00 26.73  ? 134 LEU A C     1 
ATOM   1653 O  O     . LEU C 3 134 ? -3.328  47.109 10.735 1.00 25.60  ? 134 LEU A O     1 
ATOM   1654 C  CB    . LEU C 3 134 ? -5.275  49.331 11.421 1.00 30.00  ? 134 LEU A CB    1 
ATOM   1655 C  CG    . LEU C 3 134 ? -6.577  48.931 12.129 1.00 31.56  ? 134 LEU A CG    1 
ATOM   1656 C  CD1   . LEU C 3 134 ? -6.554  49.478 13.548 1.00 22.14  ? 134 LEU A CD1   1 
ATOM   1657 C  CD2   . LEU C 3 134 ? -7.771  49.480 11.352 1.00 25.29  ? 134 LEU A CD2   1 
ATOM   1658 N  N     . GLY C 3 135 ? -3.931  46.610 12.849 1.00 26.10  ? 135 GLY A N     1 
ATOM   1659 C  CA    . GLY C 3 135 ? -3.773  45.170 12.668 1.00 24.55  ? 135 GLY A CA    1 
ATOM   1660 C  C     . GLY C 3 135 ? -4.951  44.560 11.914 1.00 25.65  ? 135 GLY A C     1 
ATOM   1661 O  O     . GLY C 3 135 ? -5.906  45.283 11.562 1.00 25.32  ? 135 GLY A O     1 
ATOM   1662 N  N     . PRO C 3 136 ? -4.936  43.233 11.663 1.00 23.87  ? 136 PRO A N     1 
ATOM   1663 C  CA    . PRO C 3 136 ? -5.962  42.455 10.946 1.00 24.96  ? 136 PRO A CA    1 
ATOM   1664 C  C     . PRO C 3 136 ? -7.313  42.438 11.611 1.00 23.69  ? 136 PRO A C     1 
ATOM   1665 O  O     . PRO C 3 136 ? -7.396  42.537 12.824 1.00 28.48  ? 136 PRO A O     1 
ATOM   1666 C  CB    . PRO C 3 136 ? -5.350  41.051 10.874 1.00 26.92  ? 136 PRO A CB    1 
ATOM   1667 C  CG    . PRO C 3 136 ? -4.519  40.989 12.131 1.00 25.30  ? 136 PRO A CG    1 
ATOM   1668 C  CD    . PRO C 3 136 ? -3.843  42.353 12.130 1.00 26.40  ? 136 PRO A CD    1 
ATOM   1669 N  N     . GLU C 3 137 ? -8.382  42.334 10.826 1.00 24.27  ? 137 GLU A N     1 
ATOM   1670 C  CA    . GLU C 3 137 ? -9.723  42.290 11.377 1.00 21.25  ? 137 GLU A CA    1 
ATOM   1671 C  C     . GLU C 3 137 ? -9.785  40.989 12.233 1.00 26.16  ? 137 GLU A C     1 
ATOM   1672 O  O     . GLU C 3 137 ? -9.310  39.943 11.791 1.00 22.42  ? 137 GLU A O     1 
ATOM   1673 C  CB    . GLU C 3 137 ? -10.707 42.192 10.248 1.00 26.71  ? 137 GLU A CB    1 
ATOM   1674 C  CG    . GLU C 3 137 ? -10.973 43.509 9.545  1.00 29.30  ? 137 GLU A CG    1 
ATOM   1675 C  CD    . GLU C 3 137 ? -11.633 44.497 10.465 1.00 27.68  ? 137 GLU A CD    1 
ATOM   1676 O  OE1   . GLU C 3 137 ? -11.179 45.646 10.541 1.00 28.91  ? 137 GLU A OE1   1 
ATOM   1677 O  OE2   . GLU C 3 137 ? -12.619 44.122 11.137 1.00 35.42  ? 137 GLU A OE2   1 
ATOM   1678 N  N     . PRO C 3 138 ? -10.358 41.043 13.458 1.00 29.27  ? 138 PRO A N     1 
ATOM   1679 C  CA    . PRO C 3 138 ? -10.427 39.819 14.289 1.00 27.87  ? 138 PRO A CA    1 
ATOM   1680 C  C     . PRO C 3 138 ? -11.152 38.650 13.639 1.00 28.81  ? 138 PRO A C     1 
ATOM   1681 O  O     . PRO C 3 138 ? -10.843 37.512 13.920 1.00 29.77  ? 138 PRO A O     1 
ATOM   1682 C  CB    . PRO C 3 138 ? -11.114 40.302 15.582 1.00 26.84  ? 138 PRO A CB    1 
ATOM   1683 C  CG    . PRO C 3 138 ? -11.856 41.571 15.152 1.00 26.94  ? 138 PRO A CG    1 
ATOM   1684 C  CD    . PRO C 3 138 ? -10.818 42.220 14.236 1.00 26.37  ? 138 PRO A CD    1 
ATOM   1685 N  N     . LEU C 3 139 ? -12.110 38.924 12.759 1.00 30.27  ? 139 LEU A N     1 
ATOM   1686 C  CA    . LEU C 3 139 ? -12.829 37.844 12.094 1.00 32.21  ? 139 LEU A CA    1 
ATOM   1687 C  C     . LEU C 3 139 ? -12.269 37.467 10.725 1.00 34.10  ? 139 LEU A C     1 
ATOM   1688 O  O     . LEU C 3 139 ? -12.932 36.802 9.969  1.00 34.49  ? 139 LEU A O     1 
ATOM   1689 C  CB    . LEU C 3 139 ? -14.312 38.189 11.938 1.00 28.83  ? 139 LEU A CB    1 
ATOM   1690 C  CG    . LEU C 3 139 ? -15.023 38.377 13.272 1.00 28.82  ? 139 LEU A CG    1 
ATOM   1691 C  CD1   . LEU C 3 139 ? -16.441 38.819 12.990 1.00 30.42  ? 139 LEU A CD1   1 
ATOM   1692 C  CD2   . LEU C 3 139 ? -15.015 37.080 14.075 1.00 29.94  ? 139 LEU A CD2   1 
ATOM   1693 N  N     . SER C 3 140 ? -11.051 37.875 10.416 1.00 36.75  ? 140 SER A N     1 
ATOM   1694 C  CA    . SER C 3 140 ? -10.471 37.547 9.128  1.00 37.93  ? 140 SER A CA    1 
ATOM   1695 C  C     . SER C 3 140 ? -9.377  36.466 9.235  1.00 40.47  ? 140 SER A C     1 
ATOM   1696 O  O     . SER C 3 140 ? -8.727  36.323 10.278 1.00 39.94  ? 140 SER A O     1 
ATOM   1697 C  CB    . SER C 3 140 ? -9.841  38.800 8.527  1.00 38.25  ? 140 SER A CB    1 
ATOM   1698 O  OG    . SER C 3 140 ? -8.545  39.030 9.067  1.00 39.00  ? 140 SER A OG    1 
ATOM   1699 N  N     . PRO C 3 141 ? -9.107  35.736 8.130  1.00 41.29  ? 141 PRO A N     1 
ATOM   1700 C  CA    . PRO C 3 141 ? -8.062  34.722 8.264  1.00 39.60  ? 141 PRO A CA    1 
ATOM   1701 C  C     . PRO C 3 141 ? -6.711  35.340 8.548  1.00 39.07  ? 141 PRO A C     1 
ATOM   1702 O  O     . PRO C 3 141 ? -5.827  34.646 9.008  1.00 39.98  ? 141 PRO A O     1 
ATOM   1703 C  CB    . PRO C 3 141 ? -8.092  34.005 6.919  1.00 42.34  ? 141 PRO A CB    1 
ATOM   1704 C  CG    . PRO C 3 141 ? -9.536  34.164 6.474  1.00 41.50  ? 141 PRO A CG    1 
ATOM   1705 C  CD    . PRO C 3 141 ? -9.785  35.621 6.825  1.00 40.75  ? 141 PRO A CD    1 
ATOM   1706 N  N     . ALA C 3 142 ? -6.541  36.640 8.301  1.00 36.97  ? 142 ALA A N     1 
ATOM   1707 C  CA    . ALA C 3 142 ? -5.234  37.270 8.551  1.00 37.03  ? 142 ALA A CA    1 
ATOM   1708 C  C     . ALA C 3 142 ? -4.936  37.354 10.052 1.00 35.26  ? 142 ALA A C     1 
ATOM   1709 O  O     . ALA C 3 142 ? -3.790  37.548 10.464 1.00 36.17  ? 142 ALA A O     1 
ATOM   1710 C  CB    . ALA C 3 142 ? -5.181  38.680 7.915  1.00 40.03  ? 142 ALA A CB    1 
ATOM   1711 N  N     . PHE C 3 143 ? -5.976  37.267 10.876 1.00 32.94  ? 143 PHE A N     1 
ATOM   1712 C  CA    . PHE C 3 143 ? -5.750  37.263 12.322 1.00 31.60  ? 143 PHE A CA    1 
ATOM   1713 C  C     . PHE C 3 143 ? -5.714  35.746 12.646 1.00 32.96  ? 143 PHE A C     1 
ATOM   1714 O  O     . PHE C 3 143 ? -6.764  35.102 12.694 1.00 31.37  ? 143 PHE A O     1 
ATOM   1715 C  CB    . PHE C 3 143 ? -6.918  37.909 13.071 1.00 27.02  ? 143 PHE A CB    1 
ATOM   1716 C  CG    . PHE C 3 143 ? -6.731  37.894 14.558 1.00 25.39  ? 143 PHE A CG    1 
ATOM   1717 C  CD1   . PHE C 3 143 ? -7.673  37.295 15.387 1.00 27.23  ? 143 PHE A CD1   1 
ATOM   1718 C  CD2   . PHE C 3 143 ? -5.573  38.420 15.122 1.00 26.66  ? 143 PHE A CD2   1 
ATOM   1719 C  CE1   . PHE C 3 143 ? -7.463  37.216 16.750 1.00 27.68  ? 143 PHE A CE1   1 
ATOM   1720 C  CE2   . PHE C 3 143 ? -5.356  38.344 16.502 1.00 29.43  ? 143 PHE A CE2   1 
ATOM   1721 C  CZ    . PHE C 3 143 ? -6.301  37.741 17.311 1.00 28.06  ? 143 PHE A CZ    1 
ATOM   1722 N  N     . SER C 3 144 ? -4.532  35.180 12.846 1.00 31.42  ? 144 SER A N     1 
ATOM   1723 C  CA    . SER C 3 144 ? -4.448  33.743 13.085 1.00 32.11  ? 144 SER A CA    1 
ATOM   1724 C  C     . SER C 3 144 ? -3.776  33.417 14.413 1.00 31.02  ? 144 SER A C     1 
ATOM   1725 O  O     . SER C 3 144 ? -3.147  34.276 15.041 1.00 32.62  ? 144 SER A O     1 
ATOM   1726 C  CB    . SER C 3 144 ? -3.621  33.099 11.959 1.00 31.43  ? 144 SER A CB    1 
ATOM   1727 O  OG    . SER C 3 144 ? -2.289  33.644 11.987 1.00 31.40  ? 144 SER A OG    1 
ATOM   1728 N  N     . PRO C 3 145 ? -3.903  32.152 14.869 1.00 32.99  ? 145 PRO A N     1 
ATOM   1729 C  CA    . PRO C 3 145 ? -3.259  31.781 16.137 1.00 31.65  ? 145 PRO A CA    1 
ATOM   1730 C  C     . PRO C 3 145 ? -1.777  32.091 15.993 1.00 29.54  ? 145 PRO A C     1 
ATOM   1731 O  O     . PRO C 3 145 ? -1.117  32.602 16.914 1.00 32.17  ? 145 PRO A O     1 
ATOM   1732 C  CB    . PRO C 3 145 ? -3.548  30.282 16.232 1.00 31.26  ? 145 PRO A CB    1 
ATOM   1733 C  CG    . PRO C 3 145 ? -4.907  30.191 15.655 1.00 31.46  ? 145 PRO A CG    1 
ATOM   1734 C  CD    . PRO C 3 145 ? -4.829  31.089 14.425 1.00 32.14  ? 145 PRO A CD    1 
ATOM   1735 N  N     . ALA C 3 146 ? -1.250  31.801 14.810 1.00 31.71  ? 146 ALA A N     1 
ATOM   1736 C  CA    . ALA C 3 146 ? 0.170   32.044 14.540 1.00 30.88  ? 146 ALA A CA    1 
ATOM   1737 C  C     . ALA C 3 146 ? 0.564   33.506 14.728 1.00 33.06  ? 146 ALA A C     1 
ATOM   1738 O  O     . ALA C 3 146 ? 1.604   33.820 15.349 1.00 34.86  ? 146 ALA A O     1 
ATOM   1739 C  CB    . ALA C 3 146 ? 0.501   31.591 13.108 1.00 33.52  ? 146 ALA A CB    1 
ATOM   1740 N  N     . VAL C 3 147 ? -0.276  34.403 14.204 1.00 32.79  ? 147 VAL A N     1 
ATOM   1741 C  CA    . VAL C 3 147 ? -0.004  35.834 14.278 1.00 32.74  ? 147 VAL A CA    1 
ATOM   1742 C  C     . VAL C 3 147 ? -0.064  36.289 15.729 1.00 32.47  ? 147 VAL A C     1 
ATOM   1743 O  O     . VAL C 3 147 ? 0.758   37.097 16.176 1.00 32.43  ? 147 VAL A O     1 
ATOM   1744 C  CB    . VAL C 3 147 ? -1.025  36.649 13.419 1.00 36.46  ? 147 VAL A CB    1 
ATOM   1745 C  CG1   . VAL C 3 147 ? -0.857  38.161 13.675 1.00 34.29  ? 147 VAL A CG1   1 
ATOM   1746 C  CG2   . VAL C 3 147 ? -0.815  36.343 11.939 1.00 36.65  ? 147 VAL A CG2   1 
ATOM   1747 N  N     . LEU C 3 148 ? -1.021  35.748 16.471 1.00 30.95  ? 148 LEU A N     1 
ATOM   1748 C  CA    . LEU C 3 148 ? -1.160  36.120 17.865 1.00 30.87  ? 148 LEU A CA    1 
ATOM   1749 C  C     . LEU C 3 148 ? 0.097   35.627 18.612 1.00 30.45  ? 148 LEU A C     1 
ATOM   1750 O  O     . LEU C 3 148 ? 0.715   36.363 19.403 1.00 30.07  ? 148 LEU A O     1 
ATOM   1751 C  CB    . LEU C 3 148 ? -2.448  35.473 18.417 1.00 31.30  ? 148 LEU A CB    1 
ATOM   1752 C  CG    . LEU C 3 148 ? -3.322  36.203 19.441 1.00 32.68  ? 148 LEU A CG    1 
ATOM   1753 C  CD1   . LEU C 3 148 ? -4.007  35.183 20.320 1.00 33.38  ? 148 LEU A CD1   1 
ATOM   1754 C  CD2   . LEU C 3 148 ? -2.486  37.143 20.305 1.00 32.21  ? 148 LEU A CD2   1 
ATOM   1755 N  N     . ALA C 3 149 ? 0.475   34.377 18.327 1.00 31.62  ? 149 ALA A N     1 
ATOM   1756 C  CA    . ALA C 3 149 ? 1.666   33.744 18.937 1.00 33.54  ? 149 ALA A CA    1 
ATOM   1757 C  C     . ALA C 3 149 ? 2.907   34.579 18.683 1.00 34.21  ? 149 ALA A C     1 
ATOM   1758 O  O     . ALA C 3 149 ? 3.699   34.829 19.589 1.00 35.07  ? 149 ALA A O     1 
ATOM   1759 C  CB    . ALA C 3 149 ? 1.871   32.342 18.345 1.00 33.35  ? 149 ALA A CB    1 
ATOM   1760 N  N     . GLU C 3 150 ? 3.084   35.016 17.441 1.00 36.21  ? 150 GLU A N     1 
ATOM   1761 C  CA    . GLU C 3 150 ? 4.254   35.825 17.112 1.00 37.65  ? 150 GLU A CA    1 
ATOM   1762 C  C     . GLU C 3 150 ? 4.305   37.079 17.976 1.00 38.83  ? 150 GLU A C     1 
ATOM   1763 O  O     . GLU C 3 150 ? 5.363   37.433 18.531 1.00 37.66  ? 150 GLU A O     1 
ATOM   1764 C  CB    . GLU C 3 150 ? 4.238   36.220 15.621 1.00 40.39  ? 150 GLU A CB    1 
ATOM   1765 N  N     . ARG C 3 151 ? 3.172   37.771 18.086 1.00 35.21  ? 151 ARG A N     1 
ATOM   1766 C  CA    . ARG C 3 151 ? 3.159   38.996 18.881 1.00 33.95  ? 151 ARG A CA    1 
ATOM   1767 C  C     . ARG C 3 151 ? 3.316   38.725 20.379 1.00 32.73  ? 151 ARG A C     1 
ATOM   1768 O  O     . ARG C 3 151 ? 3.969   39.493 21.100 1.00 31.01  ? 151 ARG A O     1 
ATOM   1769 C  CB    . ARG C 3 151 ? 1.868   39.792 18.646 1.00 31.80  ? 151 ARG A CB    1 
ATOM   1770 C  CG    . ARG C 3 151 ? 1.708   40.378 17.232 1.00 32.78  ? 151 ARG A CG    1 
ATOM   1771 C  CD    . ARG C 3 151 ? 2.915   41.198 16.863 1.00 30.78  ? 151 ARG A CD    1 
ATOM   1772 N  NE    . ARG C 3 151 ? 3.022   42.445 17.606 1.00 32.35  ? 151 ARG A NE    1 
ATOM   1773 C  CZ    . ARG C 3 151 ? 2.339   43.544 17.274 1.00 35.86  ? 151 ARG A CZ    1 
ATOM   1774 N  NH1   . ARG C 3 151 ? 1.502   43.527 16.224 1.00 34.51  ? 151 ARG A NH1   1 
ATOM   1775 N  NH2   . ARG C 3 151 ? 2.511   44.657 17.957 1.00 34.33  ? 151 ARG A NH2   1 
ATOM   1776 N  N     . ALA C 3 152 ? 2.713   37.640 20.851 1.00 32.04  ? 152 ALA A N     1 
ATOM   1777 C  CA    . ALA C 3 152 ? 2.792   37.343 22.282 1.00 35.32  ? 152 ALA A CA    1 
ATOM   1778 C  C     . ALA C 3 152 ? 4.215   37.032 22.709 1.00 37.31  ? 152 ALA A C     1 
ATOM   1779 O  O     . ALA C 3 152 ? 4.698   37.569 23.717 1.00 38.24  ? 152 ALA A O     1 
ATOM   1780 C  CB    . ALA C 3 152 ? 1.866   36.165 22.634 1.00 35.75  ? 152 ALA A CB    1 
ATOM   1781 N  N     . VAL C 3 153 ? 4.883   36.182 21.927 1.00 39.72  ? 153 VAL A N     1 
ATOM   1782 C  CA    . VAL C 3 153 ? 6.250   35.765 22.239 1.00 42.48  ? 153 VAL A CA    1 
ATOM   1783 C  C     . VAL C 3 153 ? 7.206   36.935 22.348 1.00 44.81  ? 153 VAL A C     1 
ATOM   1784 O  O     . VAL C 3 153 ? 8.043   36.957 23.247 1.00 47.03  ? 153 VAL A O     1 
ATOM   1785 C  CB    . VAL C 3 153 ? 6.758   34.782 21.188 1.00 41.55  ? 153 VAL A CB    1 
ATOM   1786 N  N     . LYS C 3 154 ? 7.058   37.927 21.471 1.00 44.49  ? 154 LYS A N     1 
ATOM   1787 C  CA    . LYS C 3 154 ? 7.969   39.078 21.434 1.00 45.55  ? 154 LYS A CA    1 
ATOM   1788 C  C     . LYS C 3 154 ? 7.750   40.255 22.376 1.00 45.27  ? 154 LYS A C     1 
ATOM   1789 O  O     . LYS C 3 154 ? 8.452   41.262 22.251 1.00 46.34  ? 154 LYS A O     1 
ATOM   1790 C  CB    . LYS C 3 154 ? 8.068   39.617 19.976 1.00 45.77  ? 154 LYS A CB    1 
ATOM   1791 N  N     . THR C 3 155 ? 6.818   40.160 23.321 1.00 43.78  ? 155 THR A N     1 
ATOM   1792 C  CA    . THR C 3 155 ? 6.567   41.302 24.222 1.00 40.54  ? 155 THR A CA    1 
ATOM   1793 C  C     . THR C 3 155 ? 6.605   40.871 25.679 1.00 40.71  ? 155 THR A C     1 
ATOM   1794 O  O     . THR C 3 155 ? 6.388   39.703 25.978 1.00 40.67  ? 155 THR A O     1 
ATOM   1795 C  CB    . THR C 3 155 ? 5.174   41.942 23.935 1.00 38.73  ? 155 THR A CB    1 
ATOM   1796 O  OG1   . THR C 3 155 ? 4.943   43.044 24.826 1.00 37.64  ? 155 THR A OG1   1 
ATOM   1797 C  CG2   . THR C 3 155 ? 4.069   40.912 24.146 1.00 37.70  ? 155 THR A CG2   1 
ATOM   1798 N  N     . LYS C 3 156 ? 6.874   41.826 26.570 1.00 40.86  ? 156 LYS A N     1 
ATOM   1799 C  CA    . LYS C 3 156 ? 6.913   41.587 28.009 1.00 39.43  ? 156 LYS A CA    1 
ATOM   1800 C  C     . LYS C 3 156 ? 5.624   42.077 28.678 1.00 40.65  ? 156 LYS A C     1 
ATOM   1801 O  O     . LYS C 3 156 ? 5.516   42.080 29.911 1.00 40.68  ? 156 LYS A O     1 
ATOM   1802 C  CB    . LYS C 3 156 ? 8.085   42.322 28.610 1.00 41.88  ? 156 LYS A CB    1 
ATOM   1803 N  N     . ARG C 3 157 ? 4.654   42.514 27.876 1.00 37.12  ? 157 ARG A N     1 
ATOM   1804 C  CA    . ARG C 3 157 ? 3.401   43.045 28.411 1.00 34.30  ? 157 ARG A CA    1 
ATOM   1805 C  C     . ARG C 3 157 ? 2.401   41.944 28.744 1.00 31.38  ? 157 ARG A C     1 
ATOM   1806 O  O     . ARG C 3 157 ? 2.567   40.798 28.308 1.00 30.99  ? 157 ARG A O     1 
ATOM   1807 C  CB    . ARG C 3 157 ? 2.748   43.966 27.378 1.00 32.39  ? 157 ARG A CB    1 
ATOM   1808 C  CG    . ARG C 3 157 ? 3.468   45.259 27.127 1.00 36.59  ? 157 ARG A CG    1 
ATOM   1809 C  CD    . ARG C 3 157 ? 2.660   46.071 26.137 1.00 35.84  ? 157 ARG A CD    1 
ATOM   1810 N  NE    . ARG C 3 157 ? 2.603   45.406 24.833 1.00 32.45  ? 157 ARG A NE    1 
ATOM   1811 C  CZ    . ARG C 3 157 ? 1.912   45.883 23.808 1.00 31.97  ? 157 ARG A CZ    1 
ATOM   1812 N  NH1   . ARG C 3 157 ? 1.920   45.233 22.645 1.00 32.05  ? 157 ARG A NH1   1 
ATOM   1813 N  NH2   . ARG C 3 157 ? 1.214   47.007 23.972 1.00 27.29  ? 157 ARG A NH2   1 
ATOM   1814 N  N     . SER C 3 158 ? 1.338   42.318 29.459 1.00 30.90  ? 158 SER A N     1 
ATOM   1815 C  CA    . SER C 3 158 ? 0.272   41.366 29.822 1.00 30.24  ? 158 SER A CA    1 
ATOM   1816 C  C     . SER C 3 158 ? -0.560  40.945 28.590 1.00 29.78  ? 158 SER A C     1 
ATOM   1817 O  O     . SER C 3 158 ? -0.577  41.664 27.576 1.00 24.00  ? 158 SER A O     1 
ATOM   1818 C  CB    . SER C 3 158 ? -0.657  42.024 30.805 1.00 30.37  ? 158 SER A CB    1 
ATOM   1819 O  OG    . SER C 3 158 ? -1.534  42.865 30.093 1.00 33.40  ? 158 SER A OG    1 
ATOM   1820 N  N     . VAL C 3 159 ? -1.258  39.795 28.672 1.00 27.95  ? 159 VAL A N     1 
ATOM   1821 C  CA    . VAL C 3 159 ? -2.100  39.361 27.571 1.00 26.53  ? 159 VAL A CA    1 
ATOM   1822 C  C     . VAL C 3 159 ? -3.175  40.402 27.323 1.00 24.26  ? 159 VAL A C     1 
ATOM   1823 O  O     . VAL C 3 159 ? -3.518  40.640 26.189 1.00 23.39  ? 159 VAL A O     1 
ATOM   1824 C  CB    . VAL C 3 159 ? -2.866  38.029 27.793 1.00 30.59  ? 159 VAL A CB    1 
ATOM   1825 C  CG1   . VAL C 3 159 ? -2.028  36.904 27.375 1.00 36.87  ? 159 VAL A CG1   1 
ATOM   1826 C  CG2   . VAL C 3 159 ? -3.311  37.887 29.253 1.00 30.05  ? 159 VAL A CG2   1 
ATOM   1827 N  N     . LYS C 3 160 ? -3.679  41.044 28.364 1.00 25.66  ? 160 LYS A N     1 
ATOM   1828 C  CA    . LYS C 3 160 ? -4.714  42.062 28.144 1.00 27.58  ? 160 LYS A CA    1 
ATOM   1829 C  C     . LYS C 3 160 ? -4.178  43.253 27.348 1.00 28.44  ? 160 LYS A C     1 
ATOM   1830 O  O     . LYS C 3 160 ? -4.806  43.708 26.391 1.00 27.65  ? 160 LYS A O     1 
ATOM   1831 C  CB    . LYS C 3 160 ? -5.293  42.588 29.438 1.00 26.71  ? 160 LYS A CB    1 
ATOM   1832 C  CG    . LYS C 3 160 ? -6.303  43.696 29.164 1.00 30.29  ? 160 LYS A CG    1 
ATOM   1833 C  CD    . LYS C 3 160 ? -7.448  43.785 30.184 1.00 31.09  ? 160 LYS A CD    1 
ATOM   1834 C  CE    . LYS C 3 160 ? -8.398  44.921 29.827 1.00 26.57  ? 160 LYS A CE    1 
ATOM   1835 N  NZ    . LYS C 3 160 ? -9.612  45.052 30.732 1.00 27.96  ? 160 LYS A NZ    1 
ATOM   1836 N  N     . ALA C 3 161 ? -3.012  43.729 27.738 1.00 26.49  ? 161 ALA A N     1 
ATOM   1837 C  CA    . ALA C 3 161 ? -2.409  44.844 27.049 1.00 28.42  ? 161 ALA A CA    1 
ATOM   1838 C  C     . ALA C 3 161 ? -2.202  44.482 25.581 1.00 29.21  ? 161 ALA A C     1 
ATOM   1839 O  O     . ALA C 3 161 ? -2.412  45.317 24.705 1.00 31.62  ? 161 ALA A O     1 
ATOM   1840 C  CB    . ALA C 3 161 ? -1.072  45.228 27.720 1.00 27.49  ? 161 ALA A CB    1 
ATOM   1841 N  N     . LEU C 3 162 ? -1.829  43.242 25.298 1.00 27.20  ? 162 LEU A N     1 
ATOM   1842 C  CA    . LEU C 3 162 ? -1.614  42.841 23.918 1.00 27.47  ? 162 LEU A CA    1 
ATOM   1843 C  C     . LEU C 3 162 ? -2.889  42.920 23.073 1.00 30.07  ? 162 LEU A C     1 
ATOM   1844 O  O     . LEU C 3 162 ? -2.876  43.450 21.979 1.00 27.11  ? 162 LEU A O     1 
ATOM   1845 C  CB    . LEU C 3 162 ? -1.071  41.408 23.846 1.00 25.84  ? 162 LEU A CB    1 
ATOM   1846 C  CG    . LEU C 3 162 ? -0.706  40.812 22.488 1.00 26.98  ? 162 LEU A CG    1 
ATOM   1847 C  CD1   . LEU C 3 162 ? 0.580   41.439 21.961 1.00 25.10  ? 162 LEU A CD1   1 
ATOM   1848 C  CD2   . LEU C 3 162 ? -0.485  39.290 22.623 1.00 28.78  ? 162 LEU A CD2   1 
ATOM   1849 N  N     . LEU C 3 163 ? -3.977  42.346 23.582 1.00 28.50  ? 163 LEU A N     1 
ATOM   1850 C  CA    . LEU C 3 163 ? -5.241  42.323 22.874 1.00 26.43  ? 163 LEU A CA    1 
ATOM   1851 C  C     . LEU C 3 163 ? -5.874  43.697 22.657 1.00 25.67  ? 163 LEU A C     1 
ATOM   1852 O  O     . LEU C 3 163 ? -6.665  43.885 21.741 1.00 23.81  ? 163 LEU A O     1 
ATOM   1853 C  CB    . LEU C 3 163 ? -6.207  41.392 23.614 1.00 29.29  ? 163 LEU A CB    1 
ATOM   1854 C  CG    . LEU C 3 163 ? -6.051  39.883 23.292 1.00 29.19  ? 163 LEU A CG    1 
ATOM   1855 C  CD1   . LEU C 3 163 ? -4.637  39.519 23.035 1.00 28.64  ? 163 LEU A CD1   1 
ATOM   1856 C  CD2   . LEU C 3 163 ? -6.647  39.061 24.400 1.00 30.04  ? 163 LEU A CD2   1 
ATOM   1857 N  N     . LEU C 3 164 ? -5.523  44.646 23.504 1.00 26.16  ? 164 LEU A N     1 
ATOM   1858 C  CA    . LEU C 3 164 ? -6.043  46.013 23.402 1.00 27.00  ? 164 LEU A CA    1 
ATOM   1859 C  C     . LEU C 3 164 ? -5.231  46.835 22.367 1.00 27.52  ? 164 LEU A C     1 
ATOM   1860 O  O     . LEU C 3 164 ? -5.650  47.905 21.941 1.00 28.28  ? 164 LEU A O     1 
ATOM   1861 C  CB    . LEU C 3 164 ? -5.935  46.676 24.782 1.00 26.53  ? 164 LEU A CB    1 
ATOM   1862 C  CG    . LEU C 3 164 ? -6.951  46.246 25.850 1.00 26.49  ? 164 LEU A CG    1 
ATOM   1863 C  CD1   . LEU C 3 164 ? -6.632  46.938 27.164 1.00 26.26  ? 164 LEU A CD1   1 
ATOM   1864 C  CD2   . LEU C 3 164 ? -8.370  46.599 25.363 1.00 26.10  ? 164 LEU A CD2   1 
ATOM   1865 N  N     . ASP C 3 165 ? -4.056  46.324 22.010 1.00 22.72  ? 165 ASP A N     1 
ATOM   1866 C  CA    . ASP C 3 165 ? -3.153  46.971 21.064 1.00 24.94  ? 165 ASP A CA    1 
ATOM   1867 C  C     . ASP C 3 165 ? -3.697  46.923 19.615 1.00 25.16  ? 165 ASP A C     1 
ATOM   1868 O  O     . ASP C 3 165 ? -3.737  45.860 19.018 1.00 26.13  ? 165 ASP A O     1 
ATOM   1869 C  CB    . ASP C 3 165 ? -1.794  46.258 21.184 1.00 24.51  ? 165 ASP A CB    1 
ATOM   1870 C  CG    . ASP C 3 165 ? -0.685  46.937 20.380 1.00 29.31  ? 165 ASP A CG    1 
ATOM   1871 O  OD1   . ASP C 3 165 ? 0.509   46.696 20.688 1.00 29.17  ? 165 ASP A OD1   1 
ATOM   1872 O  OD2   . ASP C 3 165 ? -1.003  47.681 19.431 1.00 30.82  ? 165 ASP A OD2   1 
ATOM   1873 N  N     . CYS C 3 166 ? -4.130  48.061 19.056 1.00 25.12  ? 166 CYS A N     1 
ATOM   1874 C  CA    . CYS C 3 166 ? -4.688  48.078 17.686 1.00 25.78  ? 166 CYS A CA    1 
ATOM   1875 C  C     . CYS C 3 166 ? -3.774  47.568 16.566 1.00 26.47  ? 166 CYS A C     1 
ATOM   1876 O  O     . CYS C 3 166 ? -4.262  47.242 15.483 1.00 27.09  ? 166 CYS A O     1 
ATOM   1877 C  CB    . CYS C 3 166 ? -5.210  49.485 17.317 1.00 29.73  ? 166 CYS A CB    1 
ATOM   1878 S  SG    . CYS C 3 166 ? -3.916  50.739 17.314 1.00 42.23  ? 166 CYS A SG    1 
ATOM   1879 N  N     . THR C 3 167 ? -2.461  47.501 16.798 1.00 26.72  ? 167 THR A N     1 
ATOM   1880 C  CA    . THR C 3 167 ? -1.550  46.947 15.789 1.00 25.78  ? 167 THR A CA    1 
ATOM   1881 C  C     . THR C 3 167 ? -1.564  45.417 15.882 1.00 26.83  ? 167 THR A C     1 
ATOM   1882 O  O     . THR C 3 167 ? -1.108  44.731 14.961 1.00 27.79  ? 167 THR A O     1 
ATOM   1883 C  CB    . THR C 3 167 ? -0.083  47.426 15.966 1.00 29.83  ? 167 THR A CB    1 
ATOM   1884 O  OG1   . THR C 3 167 ? 0.432   46.987 17.236 1.00 30.51  ? 167 THR A OG1   1 
ATOM   1885 C  CG2   . THR C 3 167 ? -0.009  48.966 15.898 1.00 27.31  ? 167 THR A CG2   1 
ATOM   1886 N  N     . VAL C 3 168 ? -2.088  44.850 16.976 1.00 25.35  ? 168 VAL A N     1 
ATOM   1887 C  CA    . VAL C 3 168 ? -2.145  43.382 17.079 1.00 22.50  ? 168 VAL A CA    1 
ATOM   1888 C  C     . VAL C 3 168 ? -3.409  42.852 16.400 1.00 21.93  ? 168 VAL A C     1 
ATOM   1889 O  O     . VAL C 3 168 ? -3.364  41.949 15.571 1.00 20.70  ? 168 VAL A O     1 
ATOM   1890 C  CB    . VAL C 3 168 ? -2.165  42.924 18.547 1.00 25.06  ? 168 VAL A CB    1 
ATOM   1891 C  CG1   . VAL C 3 168 ? -2.359  41.363 18.606 1.00 22.90  ? 168 VAL A CG1   1 
ATOM   1892 C  CG2   . VAL C 3 168 ? -0.868  43.354 19.224 1.00 24.68  ? 168 VAL A CG2   1 
ATOM   1893 N  N     . VAL C 3 169 ? -4.554  43.420 16.763 1.00 23.28  ? 169 VAL A N     1 
ATOM   1894 C  CA    . VAL C 3 169 ? -5.813  43.020 16.160 1.00 23.01  ? 169 VAL A CA    1 
ATOM   1895 C  C     . VAL C 3 169 ? -6.674  44.304 16.144 1.00 24.36  ? 169 VAL A C     1 
ATOM   1896 O  O     . VAL C 3 169 ? -6.649  45.104 17.086 1.00 23.67  ? 169 VAL A O     1 
ATOM   1897 C  CB    . VAL C 3 169 ? -6.445  41.891 16.968 1.00 23.63  ? 169 VAL A CB    1 
ATOM   1898 C  CG1   . VAL C 3 169 ? -6.670  42.359 18.388 1.00 23.03  ? 169 VAL A CG1   1 
ATOM   1899 C  CG2   . VAL C 3 169 ? -7.726  41.422 16.293 1.00 21.58  ? 169 VAL A CG2   1 
ATOM   1900 N  N     . ALA C 3 170 ? -7.433  44.512 15.061 1.00 24.08  ? 170 ALA A N     1 
ATOM   1901 C  CA    . ALA C 3 170 ? -8.201  45.759 14.926 1.00 25.53  ? 170 ALA A CA    1 
ATOM   1902 C  C     . ALA C 3 170 ? -9.453  45.944 15.782 1.00 23.28  ? 170 ALA A C     1 
ATOM   1903 O  O     . ALA C 3 170 ? -10.352 45.130 15.752 1.00 26.82  ? 170 ALA A O     1 
ATOM   1904 C  CB    . ALA C 3 170 ? -8.559  45.994 13.423 1.00 20.13  ? 170 ALA A CB    1 
ATOM   1905 N  N     . GLY C 3 171 ? -9.496  47.008 16.561 1.00 23.40  ? 171 GLY A N     1 
ATOM   1906 C  CA    . GLY C 3 171 ? -10.712 47.311 17.326 1.00 25.09  ? 171 GLY A CA    1 
ATOM   1907 C  C     . GLY C 3 171 ? -11.374 46.314 18.284 1.00 26.51  ? 171 GLY A C     1 
ATOM   1908 O  O     . GLY C 3 171 ? -12.599 46.340 18.458 1.00 21.67  ? 171 GLY A O     1 
ATOM   1909 N  N     . PHE C 3 172 ? -10.578 45.454 18.922 1.00 25.40  ? 172 PHE A N     1 
ATOM   1910 C  CA    . PHE C 3 172 ? -11.109 44.483 19.880 1.00 27.04  ? 172 PHE A CA    1 
ATOM   1911 C  C     . PHE C 3 172 ? -11.247 45.244 21.235 1.00 27.81  ? 172 PHE A C     1 
ATOM   1912 O  O     . PHE C 3 172 ? -10.265 45.529 21.944 1.00 33.05  ? 172 PHE A O     1 
ATOM   1913 C  CB    . PHE C 3 172 ? -10.119 43.305 19.982 1.00 27.82  ? 172 PHE A CB    1 
ATOM   1914 C  CG    . PHE C 3 172 ? -10.762 41.997 20.351 1.00 25.89  ? 172 PHE A CG    1 
ATOM   1915 C  CD1   . PHE C 3 172 ? -11.374 41.212 19.391 1.00 26.02  ? 172 PHE A CD1   1 
ATOM   1916 C  CD2   . PHE C 3 172 ? -10.786 41.572 21.679 1.00 27.40  ? 172 PHE A CD2   1 
ATOM   1917 C  CE1   . PHE C 3 172 ? -12.021 40.009 19.737 1.00 26.84  ? 172 PHE A CE1   1 
ATOM   1918 C  CE2   . PHE C 3 172 ? -11.427 40.370 22.031 1.00 28.81  ? 172 PHE A CE2   1 
ATOM   1919 C  CZ    . PHE C 3 172 ? -12.054 39.588 21.037 1.00 27.10  ? 172 PHE A CZ    1 
ATOM   1920 N  N     . GLY C 3 173 ? -12.453 45.606 21.620 1.00 29.31  ? 173 GLY A N     1 
ATOM   1921 C  CA    . GLY C 3 173 ? -12.557 46.377 22.862 1.00 27.53  ? 173 GLY A CA    1 
ATOM   1922 C  C     . GLY C 3 173 ? -12.408 45.680 24.230 1.00 28.70  ? 173 GLY A C     1 
ATOM   1923 O  O     . GLY C 3 173 ? -12.373 44.436 24.351 1.00 24.28  ? 173 GLY A O     1 
ATOM   1924 N  N     . ASN C 3 174 ? -12.337 46.515 25.265 1.00 23.43  ? 174 ASN A N     1 
ATOM   1925 C  CA    . ASN C 3 174 ? -12.186 46.089 26.633 1.00 24.59  ? 174 ASN A CA    1 
ATOM   1926 C  C     . ASN C 3 174 ? -13.220 45.004 27.004 1.00 23.84  ? 174 ASN A C     1 
ATOM   1927 O  O     . ASN C 3 174 ? -12.903 43.957 27.542 1.00 24.08  ? 174 ASN A O     1 
ATOM   1928 C  CB    . ASN C 3 174 ? -12.307 47.338 27.516 1.00 29.09  ? 174 ASN A CB    1 
ATOM   1929 C  CG    . ASN C 3 174 ? -11.516 47.239 28.800 1.00 32.67  ? 174 ASN A CG    1 
ATOM   1930 O  OD1   . ASN C 3 174 ? -10.352 46.824 28.813 1.00 31.73  ? 174 ASN A OD1   1 
ATOM   1931 N  ND2   . ASN C 3 174 ? -12.136 47.654 29.894 1.00 33.99  ? 174 ASN A ND2   1 
ATOM   1932 N  N     . ILE C 3 175 ? -14.466 45.234 26.672 1.00 23.51  ? 175 ILE A N     1 
ATOM   1933 C  CA    . ILE C 3 175 ? -15.468 44.274 27.009 1.00 25.19  ? 175 ILE A CA    1 
ATOM   1934 C  C     . ILE C 3 175 ? -15.214 42.931 26.364 1.00 23.42  ? 175 ILE A C     1 
ATOM   1935 O  O     . ILE C 3 175 ? -15.372 41.880 27.026 1.00 23.88  ? 175 ILE A O     1 
ATOM   1936 C  CB    . ILE C 3 175 ? -16.878 44.764 26.613 1.00 28.97  ? 175 ILE A CB    1 
ATOM   1937 C  CG1   . ILE C 3 175 ? -17.912 43.738 27.037 1.00 29.60  ? 175 ILE A CG1   1 
ATOM   1938 C  CG2   . ILE C 3 175 ? -16.971 44.937 25.099 1.00 31.68  ? 175 ILE A CG2   1 
ATOM   1939 C  CD1   . ILE C 3 175 ? -19.322 44.240 26.908 1.00 36.93  ? 175 ILE A CD1   1 
ATOM   1940 N  N     . TYR C 3 176 ? -14.814 42.931 25.104 1.00 21.14  ? 176 TYR A N     1 
ATOM   1941 C  CA    . TYR C 3 176 ? -14.592 41.669 24.418 1.00 21.01  ? 176 TYR A CA    1 
ATOM   1942 C  C     . TYR C 3 176 ? -13.310 40.993 24.904 1.00 22.09  ? 176 TYR A C     1 
ATOM   1943 O  O     . TYR C 3 176 ? -13.235 39.773 24.899 1.00 19.99  ? 176 TYR A O     1 
ATOM   1944 C  CB    . TYR C 3 176 ? -14.605 41.860 22.890 1.00 25.35  ? 176 TYR A CB    1 
ATOM   1945 C  CG    . TYR C 3 176 ? -15.996 42.221 22.387 1.00 23.95  ? 176 TYR A CG    1 
ATOM   1946 C  CD1   . TYR C 3 176 ? -16.273 43.444 21.792 1.00 23.21  ? 176 TYR A CD1   1 
ATOM   1947 C  CD2   . TYR C 3 176 ? -17.064 41.380 22.660 1.00 26.71  ? 176 TYR A CD2   1 
ATOM   1948 C  CE1   . TYR C 3 176 ? -17.601 43.812 21.513 1.00 21.22  ? 176 TYR A CE1   1 
ATOM   1949 C  CE2   . TYR C 3 176 ? -18.381 41.734 22.387 1.00 28.04  ? 176 TYR A CE2   1 
ATOM   1950 C  CZ    . TYR C 3 176 ? -18.641 42.949 21.823 1.00 29.85  ? 176 TYR A CZ    1 
ATOM   1951 O  OH    . TYR C 3 176 ? -19.961 43.281 21.629 1.00 32.19  ? 176 TYR A OH    1 
ATOM   1952 N  N     . VAL C 3 177 ? -12.311 41.792 25.307 1.00 21.85  ? 177 VAL A N     1 
ATOM   1953 C  CA    . VAL C 3 177 ? -11.057 41.234 25.819 1.00 23.25  ? 177 VAL A CA    1 
ATOM   1954 C  C     . VAL C 3 177 ? -11.330 40.452 27.108 1.00 23.27  ? 177 VAL A C     1 
ATOM   1955 O  O     . VAL C 3 177 ? -10.872 39.321 27.249 1.00 24.15  ? 177 VAL A O     1 
ATOM   1956 C  CB    . VAL C 3 177 ? -10.037 42.359 26.097 1.00 25.08  ? 177 VAL A CB    1 
ATOM   1957 C  CG1   . VAL C 3 177 ? -8.846  41.835 26.936 1.00 24.56  ? 177 VAL A CG1   1 
ATOM   1958 C  CG2   . VAL C 3 177 ? -9.512  42.931 24.735 1.00 22.14  ? 177 VAL A CG2   1 
ATOM   1959 N  N     . ASP C 3 178 ? -12.073 41.055 28.042 1.00 22.73  ? 178 ASP A N     1 
ATOM   1960 C  CA    . ASP C 3 178 ? -12.387 40.414 29.325 1.00 21.71  ? 178 ASP A CA    1 
ATOM   1961 C  C     . ASP C 3 178 ? -13.282 39.180 29.116 1.00 22.43  ? 178 ASP A C     1 
ATOM   1962 O  O     . ASP C 3 178 ? -13.052 38.152 29.744 1.00 22.56  ? 178 ASP A O     1 
ATOM   1963 C  CB    . ASP C 3 178 ? -13.094 41.381 30.278 1.00 19.75  ? 178 ASP A CB    1 
ATOM   1964 C  CG    . ASP C 3 178 ? -12.165 42.457 30.846 1.00 24.02  ? 178 ASP A CG    1 
ATOM   1965 O  OD1   . ASP C 3 178 ? -12.625 43.251 31.686 1.00 24.79  ? 178 ASP A OD1   1 
ATOM   1966 O  OD2   . ASP C 3 178 ? -10.956 42.495 30.504 1.00 27.77  ? 178 ASP A OD2   1 
ATOM   1967 N  N     . GLU C 3 179 ? -14.309 39.286 28.278 1.00 21.63  ? 179 GLU A N     1 
ATOM   1968 C  CA    . GLU C 3 179 ? -15.187 38.139 28.029 1.00 23.89  ? 179 GLU A CA    1 
ATOM   1969 C  C     . GLU C 3 179 ? -14.419 37.011 27.344 1.00 22.98  ? 179 GLU A C     1 
ATOM   1970 O  O     . GLU C 3 179 ? -14.629 35.849 27.702 1.00 22.50  ? 179 GLU A O     1 
ATOM   1971 C  CB    . GLU C 3 179 ? -16.403 38.538 27.175 1.00 26.12  ? 179 GLU A CB    1 
ATOM   1972 C  CG    . GLU C 3 179 ? -17.368 39.533 27.876 1.00 30.38  ? 179 GLU A CG    1 
ATOM   1973 C  CD    . GLU C 3 179 ? -18.106 38.876 29.037 1.00 31.88  ? 179 GLU A CD    1 
ATOM   1974 O  OE1   . GLU C 3 179 ? -18.609 37.749 28.819 1.00 31.50  ? 179 GLU A OE1   1 
ATOM   1975 O  OE2   . GLU C 3 179 ? -18.174 39.469 30.138 1.00 29.16  ? 179 GLU A OE2   1 
ATOM   1976 N  N     . SER C 3 180 ? -13.513 37.337 26.402 1.00 19.03  ? 180 SER A N     1 
ATOM   1977 C  CA    . SER C 3 180 ? -12.707 36.315 25.682 1.00 19.21  ? 180 SER A CA    1 
ATOM   1978 C  C     . SER C 3 180 ? -11.695 35.605 26.584 1.00 22.02  ? 180 SER A C     1 
ATOM   1979 O  O     . SER C 3 180 ? -11.466 34.393 26.451 1.00 18.04  ? 180 SER A O     1 
ATOM   1980 C  CB    . SER C 3 180 ? -11.944 36.931 24.486 1.00 21.30  ? 180 SER A CB    1 
ATOM   1981 O  OG    . SER C 3 180 ? -12.839 37.504 23.499 1.00 26.51  ? 180 SER A OG    1 
ATOM   1982 N  N     . LEU C 3 181 ? -11.081 36.355 27.490 1.00 21.07  ? 181 LEU A N     1 
ATOM   1983 C  CA    . LEU C 3 181 ? -10.126 35.769 28.410 1.00 22.49  ? 181 LEU A CA    1 
ATOM   1984 C  C     . LEU C 3 181 ? -10.872 34.823 29.358 1.00 23.73  ? 181 LEU A C     1 
ATOM   1985 O  O     . LEU C 3 181 ? -10.373 33.727 29.660 1.00 24.56  ? 181 LEU A O     1 
ATOM   1986 C  CB    . LEU C 3 181 ? -9.386  36.869 29.207 1.00 21.80  ? 181 LEU A CB    1 
ATOM   1987 C  CG    . LEU C 3 181 ? -8.415  37.684 28.339 1.00 19.23  ? 181 LEU A CG    1 
ATOM   1988 C  CD1   . LEU C 3 181 ? -7.829  38.868 29.112 1.00 22.29  ? 181 LEU A CD1   1 
ATOM   1989 C  CD2   . LEU C 3 181 ? -7.328  36.729 27.880 1.00 22.32  ? 181 LEU A CD2   1 
ATOM   1990 N  N     . PHE C 3 182 ? -12.029 35.254 29.857 1.00 22.75  ? 182 PHE A N     1 
ATOM   1991 C  CA    . PHE C 3 182 ? -12.856 34.403 30.743 1.00 21.78  ? 182 PHE A CA    1 
ATOM   1992 C  C     . PHE C 3 182 ? -13.223 33.108 29.986 1.00 24.66  ? 182 PHE A C     1 
ATOM   1993 O  O     . PHE C 3 182 ? -13.028 32.009 30.462 1.00 25.55  ? 182 PHE A O     1 
ATOM   1994 C  CB    . PHE C 3 182 ? -14.168 35.102 31.119 1.00 22.03  ? 182 PHE A CB    1 
ATOM   1995 C  CG    . PHE C 3 182 ? -15.147 34.187 31.807 1.00 20.30  ? 182 PHE A CG    1 
ATOM   1996 C  CD1   . PHE C 3 182 ? -15.012 33.917 33.183 1.00 22.43  ? 182 PHE A CD1   1 
ATOM   1997 C  CD2   . PHE C 3 182 ? -16.105 33.494 31.076 1.00 16.62  ? 182 PHE A CD2   1 
ATOM   1998 C  CE1   . PHE C 3 182 ? -15.829 32.934 33.835 1.00 23.29  ? 182 PHE A CE1   1 
ATOM   1999 C  CE2   . PHE C 3 182 ? -16.919 32.517 31.704 1.00 22.56  ? 182 PHE A CE2   1 
ATOM   2000 C  CZ    . PHE C 3 182 ? -16.770 32.241 33.092 1.00 23.35  ? 182 PHE A CZ    1 
ATOM   2001 N  N     . ARG C 3 183 ? -13.708 33.216 28.766 1.00 25.82  ? 183 ARG A N     1 
ATOM   2002 C  CA    . ARG C 3 183 ? -14.078 31.988 28.039 1.00 26.10  ? 183 ARG A CA    1 
ATOM   2003 C  C     . ARG C 3 183 ? -12.911 31.080 27.729 1.00 26.13  ? 183 ARG A C     1 
ATOM   2004 O  O     . ARG C 3 183 ? -13.088 29.853 27.586 1.00 23.08  ? 183 ARG A O     1 
ATOM   2005 C  CB    . ARG C 3 183 ? -14.840 32.354 26.763 1.00 25.57  ? 183 ARG A CB    1 
ATOM   2006 C  CG    . ARG C 3 183 ? -16.235 32.941 27.099 1.00 28.91  ? 183 ARG A CG    1 
ATOM   2007 C  CD    . ARG C 3 183 ? -16.856 33.706 25.942 1.00 34.64  ? 183 ARG A CD    1 
ATOM   2008 N  NE    . ARG C 3 183 ? -16.979 32.899 24.733 1.00 37.01  ? 183 ARG A NE    1 
ATOM   2009 C  CZ    . ARG C 3 183 ? -17.998 32.997 23.887 1.00 39.56  ? 183 ARG A CZ    1 
ATOM   2010 N  NH1   . ARG C 3 183 ? -18.997 33.860 24.118 1.00 34.26  ? 183 ARG A NH1   1 
ATOM   2011 N  NH2   . ARG C 3 183 ? -17.992 32.250 22.793 1.00 40.26  ? 183 ARG A NH2   1 
ATOM   2012 N  N     . ALA C 3 184 ? -11.723 31.675 27.625 1.00 23.93  ? 184 ALA A N     1 
ATOM   2013 C  CA    . ALA C 3 184 ? -10.505 30.908 27.362 1.00 27.48  ? 184 ALA A CA    1 
ATOM   2014 C  C     . ALA C 3 184 ? -9.816  30.407 28.649 1.00 27.54  ? 184 ALA A C     1 
ATOM   2015 O  O     . ALA C 3 184 ? -8.876  29.632 28.562 1.00 26.25  ? 184 ALA A O     1 
ATOM   2016 C  CB    . ALA C 3 184 ? -9.498  31.743 26.528 1.00 25.80  ? 184 ALA A CB    1 
ATOM   2017 N  N     . GLY C 3 185 ? -10.263 30.866 29.819 1.00 26.93  ? 185 GLY A N     1 
ATOM   2018 C  CA    . GLY C 3 185 ? -9.682  30.424 31.089 1.00 25.55  ? 185 GLY A CA    1 
ATOM   2019 C  C     . GLY C 3 185 ? -8.334  31.029 31.375 1.00 26.36  ? 185 GLY A C     1 
ATOM   2020 O  O     . GLY C 3 185 ? -7.517  30.430 32.089 1.00 27.13  ? 185 GLY A O     1 
ATOM   2021 N  N     . ILE C 3 186 ? -8.105  32.243 30.881 1.00 25.58  ? 186 ILE A N     1 
ATOM   2022 C  CA    . ILE C 3 186 ? -6.806  32.929 31.028 1.00 22.48  ? 186 ILE A CA    1 
ATOM   2023 C  C     . ILE C 3 186 ? -6.921  34.216 31.832 1.00 25.92  ? 186 ILE A C     1 
ATOM   2024 O  O     . ILE C 3 186 ? -7.784  35.057 31.552 1.00 27.16  ? 186 ILE A O     1 
ATOM   2025 C  CB    . ILE C 3 186 ? -6.240  33.225 29.632 1.00 23.65  ? 186 ILE A CB    1 
ATOM   2026 C  CG1   . ILE C 3 186 ? -6.013  31.886 28.921 1.00 28.75  ? 186 ILE A CG1   1 
ATOM   2027 C  CG2   . ILE C 3 186 ? -4.969  34.019 29.709 1.00 19.98  ? 186 ILE A CG2   1 
ATOM   2028 C  CD1   . ILE C 3 186 ? -5.695  31.995 27.431 1.00 26.47  ? 186 ILE A CD1   1 
ATOM   2029 N  N     . LEU C 3 187 ? -6.075  34.366 32.850 1.00 23.70  ? 187 LEU A N     1 
ATOM   2030 C  CA    . LEU C 3 187 ? -6.123  35.563 33.670 1.00 25.60  ? 187 LEU A CA    1 
ATOM   2031 C  C     . LEU C 3 187 ? -5.613  36.727 32.828 1.00 27.27  ? 187 LEU A C     1 
ATOM   2032 O  O     . LEU C 3 187 ? -4.645  36.593 32.079 1.00 25.35  ? 187 LEU A O     1 
ATOM   2033 C  CB    . LEU C 3 187 ? -5.236  35.412 34.899 1.00 25.01  ? 187 LEU A CB    1 
ATOM   2034 C  CG    . LEU C 3 187 ? -5.865  34.684 36.110 1.00 29.06  ? 187 LEU A CG    1 
ATOM   2035 C  CD1   . LEU C 3 187 ? -4.820  34.505 37.251 1.00 28.31  ? 187 LEU A CD1   1 
ATOM   2036 C  CD2   . LEU C 3 187 ? -7.009  35.537 36.623 1.00 28.60  ? 187 LEU A CD2   1 
ATOM   2037 N  N     . PRO C 3 188 ? -6.260  37.885 32.945 1.00 28.70  ? 188 PRO A N     1 
ATOM   2038 C  CA    . PRO C 3 188 ? -5.863  39.083 32.180 1.00 29.44  ? 188 PRO A CA    1 
ATOM   2039 C  C     . PRO C 3 188 ? -4.444  39.602 32.497 1.00 31.54  ? 188 PRO A C     1 
ATOM   2040 O  O     . PRO C 3 188 ? -3.737  40.079 31.582 1.00 29.69  ? 188 PRO A O     1 
ATOM   2041 C  CB    . PRO C 3 188 ? -6.978  40.100 32.500 1.00 32.36  ? 188 PRO A CB    1 
ATOM   2042 C  CG    . PRO C 3 188 ? -7.644  39.548 33.767 1.00 32.91  ? 188 PRO A CG    1 
ATOM   2043 C  CD    . PRO C 3 188 ? -7.536  38.058 33.647 1.00 28.43  ? 188 PRO A CD    1 
ATOM   2044 N  N     . GLY C 3 189 ? -4.013  39.471 33.763 1.00 30.22  ? 189 GLY A N     1 
ATOM   2045 C  CA    . GLY C 3 189 ? -2.682  39.936 34.141 1.00 31.58  ? 189 GLY A CA    1 
ATOM   2046 C  C     . GLY C 3 189 ? -1.526  39.010 33.750 1.00 34.37  ? 189 GLY A C     1 
ATOM   2047 O  O     . GLY C 3 189 ? -0.379  39.288 34.082 1.00 37.05  ? 189 GLY A O     1 
ATOM   2048 N  N     . ARG C 3 190 ? -1.817  37.907 33.055 1.00 33.93  ? 190 ARG A N     1 
ATOM   2049 C  CA    . ARG C 3 190 ? -0.800  36.948 32.610 1.00 31.75  ? 190 ARG A CA    1 
ATOM   2050 C  C     . ARG C 3 190 ? 0.124   37.551 31.534 1.00 35.09  ? 190 ARG A C     1 
ATOM   2051 O  O     . ARG C 3 190 ? -0.343  38.133 30.566 1.00 32.19  ? 190 ARG A O     1 
ATOM   2052 C  CB    . ARG C 3 190 ? -1.446  35.708 31.960 1.00 28.16  ? 190 ARG A CB    1 
ATOM   2053 C  CG    . ARG C 3 190 ? -2.209  34.715 32.865 1.00 32.76  ? 190 ARG A CG    1 
ATOM   2054 C  CD    . ARG C 3 190 ? -1.271  33.760 33.576 1.00 31.30  ? 190 ARG A CD    1 
ATOM   2055 N  NE    . ARG C 3 190 ? -0.428  32.985 32.660 1.00 27.43  ? 190 ARG A NE    1 
ATOM   2056 C  CZ    . ARG C 3 190 ? -0.831  31.947 31.915 1.00 29.30  ? 190 ARG A CZ    1 
ATOM   2057 N  NH1   . ARG C 3 190 ? -2.084  31.501 31.937 1.00 27.54  ? 190 ARG A NH1   1 
ATOM   2058 N  NH2   . ARG C 3 190 ? 0.037   31.331 31.131 1.00 27.25  ? 190 ARG A NH2   1 
ATOM   2059 N  N     . PRO C 3 191 ? 1.453   37.386 31.684 1.00 37.56  ? 191 PRO A N     1 
ATOM   2060 C  CA    . PRO C 3 191 ? 2.388   37.911 30.682 1.00 34.41  ? 191 PRO A CA    1 
ATOM   2061 C  C     . PRO C 3 191 ? 2.066   37.183 29.385 1.00 32.41  ? 191 PRO A C     1 
ATOM   2062 O  O     . PRO C 3 191 ? 1.915   35.947 29.391 1.00 26.15  ? 191 PRO A O     1 
ATOM   2063 C  CB    . PRO C 3 191 ? 3.757   37.530 31.262 1.00 37.90  ? 191 PRO A CB    1 
ATOM   2064 C  CG    . PRO C 3 191 ? 3.502   37.730 32.766 1.00 38.87  ? 191 PRO A CG    1 
ATOM   2065 C  CD    . PRO C 3 191 ? 2.166   36.985 32.919 1.00 37.92  ? 191 PRO A CD    1 
ATOM   2066 N  N     . ALA C 3 192 ? 1.905   37.947 28.292 1.00 28.89  ? 192 ALA A N     1 
ATOM   2067 C  CA    . ALA C 3 192 ? 1.561   37.379 26.990 1.00 28.34  ? 192 ALA A CA    1 
ATOM   2068 C  C     . ALA C 3 192 ? 2.510   36.277 26.602 1.00 28.52  ? 192 ALA A C     1 
ATOM   2069 O  O     . ALA C 3 192 ? 2.135   35.288 25.951 1.00 26.77  ? 192 ALA A O     1 
ATOM   2070 C  CB    . ALA C 3 192 ? 1.591   38.470 25.904 1.00 27.30  ? 192 ALA A CB    1 
ATOM   2071 N  N     . ALA C 3 193 ? 3.765   36.483 26.963 1.00 31.42  ? 193 ALA A N     1 
ATOM   2072 C  CA    . ALA C 3 193 ? 4.801   35.520 26.633 1.00 33.87  ? 193 ALA A CA    1 
ATOM   2073 C  C     . ALA C 3 193 ? 4.695   34.235 27.457 1.00 33.76  ? 193 ALA A C     1 
ATOM   2074 O  O     . ALA C 3 193 ? 5.339   33.248 27.121 1.00 34.28  ? 193 ALA A O     1 
ATOM   2075 C  CB    . ALA C 3 193 ? 6.207   36.173 26.813 1.00 31.25  ? 193 ALA A CB    1 
ATOM   2076 N  N     . SER C 3 194 ? 3.902   34.235 28.529 1.00 34.25  ? 194 SER A N     1 
ATOM   2077 C  CA    . SER C 3 194 ? 3.765   33.006 29.327 1.00 34.77  ? 194 SER A CA    1 
ATOM   2078 C  C     . SER C 3 194 ? 2.697   32.048 28.771 1.00 36.56  ? 194 SER A C     1 
ATOM   2079 O  O     . SER C 3 194 ? 2.629   30.913 29.209 1.00 35.59  ? 194 SER A O     1 
ATOM   2080 C  CB    . SER C 3 194 ? 3.467   33.330 30.800 1.00 33.03  ? 194 SER A CB    1 
ATOM   2081 O  OG    . SER C 3 194 ? 2.138   33.796 31.006 1.00 34.40  ? 194 SER A OG    1 
ATOM   2082 N  N     . LEU C 3 195 ? 1.882   32.476 27.799 1.00 33.57  ? 195 LEU A N     1 
ATOM   2083 C  CA    . LEU C 3 195 ? 0.861   31.580 27.262 1.00 34.84  ? 195 LEU A CA    1 
ATOM   2084 C  C     . LEU C 3 195 ? 1.461   30.453 26.434 1.00 35.14  ? 195 LEU A C     1 
ATOM   2085 O  O     . LEU C 3 195 ? 2.386   30.678 25.650 1.00 33.87  ? 195 LEU A O     1 
ATOM   2086 C  CB    . LEU C 3 195 ? -0.165  32.303 26.363 1.00 33.69  ? 195 LEU A CB    1 
ATOM   2087 C  CG    . LEU C 3 195 ? -0.944  33.519 26.877 1.00 39.11  ? 195 LEU A CG    1 
ATOM   2088 C  CD1   . LEU C 3 195 ? -2.169  33.724 26.000 1.00 38.77  ? 195 LEU A CD1   1 
ATOM   2089 C  CD2   . LEU C 3 195 ? -1.349  33.342 28.319 1.00 38.97  ? 195 LEU A CD2   1 
ATOM   2090 N  N     . SER C 3 196 ? 0.900   29.260 26.573 1.00 33.24  ? 196 SER A N     1 
ATOM   2091 C  CA    . SER C 3 196 ? 1.396   28.105 25.819 1.00 34.78  ? 196 SER A CA    1 
ATOM   2092 C  C     . SER C 3 196 ? 0.728   28.158 24.463 1.00 34.58  ? 196 SER A C     1 
ATOM   2093 O  O     . SER C 3 196 ? -0.178  28.953 24.261 1.00 35.14  ? 196 SER A O     1 
ATOM   2094 C  CB    . SER C 3 196 ? 0.996   26.816 26.514 1.00 30.67  ? 196 SER A CB    1 
ATOM   2095 O  OG    . SER C 3 196 ? -0.382  26.581 26.385 1.00 29.00  ? 196 SER A OG    1 
ATOM   2096 N  N     . SER C 3 197 ? 1.135   27.321 23.523 1.00 35.18  ? 197 SER A N     1 
ATOM   2097 C  CA    . SER C 3 197 ? 0.469   27.412 22.241 1.00 36.53  ? 197 SER A CA    1 
ATOM   2098 C  C     . SER C 3 197 ? -0.949  26.880 22.382 1.00 36.62  ? 197 SER A C     1 
ATOM   2099 O  O     . SER C 3 197 ? -1.845  27.267 21.629 1.00 35.71  ? 197 SER A O     1 
ATOM   2100 C  CB    . SER C 3 197 ? 1.264   26.692 21.126 1.00 39.33  ? 197 SER A CB    1 
ATOM   2101 O  OG    . SER C 3 197 ? 1.704   25.407 21.513 1.00 41.30  ? 197 SER A OG    1 
ATOM   2102 N  N     . LYS C 3 198 ? -1.180  26.007 23.360 1.00 34.24  ? 198 LYS A N     1 
ATOM   2103 C  CA    . LYS C 3 198 ? -2.526  25.493 23.533 1.00 34.52  ? 198 LYS A CA    1 
ATOM   2104 C  C     . LYS C 3 198 ? -3.411  26.653 24.008 1.00 33.18  ? 198 LYS A C     1 
ATOM   2105 O  O     . LYS C 3 198 ? -4.569  26.778 23.597 1.00 32.29  ? 198 LYS A O     1 
ATOM   2106 C  CB    . LYS C 3 198 ? -2.563  24.378 24.582 1.00 37.10  ? 198 LYS A CB    1 
ATOM   2107 C  CG    . LYS C 3 198 ? -3.921  23.724 24.724 1.00 40.09  ? 198 LYS A CG    1 
ATOM   2108 C  CD    . LYS C 3 198 ? -3.916  22.692 25.873 1.00 47.16  ? 198 LYS A CD    1 
ATOM   2109 C  CE    . LYS C 3 198 ? -5.145  21.755 25.820 1.00 48.03  ? 198 LYS A CE    1 
ATOM   2110 N  NZ    . LYS C 3 198 ? -5.390  20.999 27.113 1.00 51.59  ? 198 LYS A NZ    1 
ATOM   2111 N  N     . GLU C 3 199 ? -2.877  27.472 24.907 1.00 29.05  ? 199 GLU A N     1 
ATOM   2112 C  CA    . GLU C 3 199 ? -3.658  28.592 25.391 1.00 31.84  ? 199 GLU A CA    1 
ATOM   2113 C  C     . GLU C 3 199 ? -3.852  29.610 24.262 1.00 31.41  ? 199 GLU A C     1 
ATOM   2114 O  O     . GLU C 3 199 ? -4.968  30.118 24.078 1.00 30.15  ? 199 GLU A O     1 
ATOM   2115 C  CB    . GLU C 3 199 ? -2.976  29.281 26.575 1.00 29.02  ? 199 GLU A CB    1 
ATOM   2116 C  CG    . GLU C 3 199 ? -3.049  28.483 27.870 1.00 34.89  ? 199 GLU A CG    1 
ATOM   2117 C  CD    . GLU C 3 199 ? -2.199  29.089 28.965 1.00 40.93  ? 199 GLU A CD    1 
ATOM   2118 O  OE1   . GLU C 3 199 ? -0.994  29.371 28.683 1.00 41.46  ? 199 GLU A OE1   1 
ATOM   2119 O  OE2   . GLU C 3 199 ? -2.724  29.291 30.105 1.00 37.94  ? 199 GLU A OE2   1 
ATOM   2120 N  N     . ILE C 3 200 ? -2.783  29.903 23.518 1.00 29.00  ? 200 ILE A N     1 
ATOM   2121 C  CA    . ILE C 3 200 ? -2.890  30.883 22.431 1.00 30.73  ? 200 ILE A CA    1 
ATOM   2122 C  C     . ILE C 3 200 ? -3.991  30.444 21.482 1.00 30.41  ? 200 ILE A C     1 
ATOM   2123 O  O     . ILE C 3 200 ? -4.828  31.243 21.100 1.00 29.30  ? 200 ILE A O     1 
ATOM   2124 C  CB    . ILE C 3 200 ? -1.580  31.033 21.652 1.00 30.86  ? 200 ILE A CB    1 
ATOM   2125 C  CG1   . ILE C 3 200 ? -0.634  31.922 22.428 1.00 32.99  ? 200 ILE A CG1   1 
ATOM   2126 C  CG2   . ILE C 3 200 ? -1.861  31.621 20.256 1.00 33.14  ? 200 ILE A CG2   1 
ATOM   2127 C  CD1   . ILE C 3 200 ? -1.052  33.404 22.446 1.00 34.27  ? 200 ILE A CD1   1 
ATOM   2128 N  N     . GLU C 3 201 ? -4.008  29.175 21.099 1.00 29.15  ? 201 GLU A N     1 
ATOM   2129 C  CA    . GLU C 3 201 ? -5.064  28.707 20.220 1.00 33.73  ? 201 GLU A CA    1 
ATOM   2130 C  C     . GLU C 3 201 ? -6.457  28.830 20.819 1.00 32.93  ? 201 GLU A C     1 
ATOM   2131 O  O     . GLU C 3 201 ? -7.441  29.152 20.126 1.00 33.00  ? 201 GLU A O     1 
ATOM   2132 C  CB    . GLU C 3 201 ? -4.851  27.255 19.892 1.00 41.95  ? 201 GLU A CB    1 
ATOM   2133 C  CG    . GLU C 3 201 ? -4.740  27.011 18.436 1.00 52.85  ? 201 GLU A CG    1 
ATOM   2134 C  CD    . GLU C 3 201 ? -3.971  25.758 18.201 1.00 60.06  ? 201 GLU A CD    1 
ATOM   2135 O  OE1   . GLU C 3 201 ? -2.808  25.675 18.684 1.00 61.86  ? 201 GLU A OE1   1 
ATOM   2136 O  OE2   . GLU C 3 201 ? -4.545  24.853 17.547 1.00 66.86  ? 201 GLU A OE2   1 
ATOM   2137 N  N     . ARG C 3 202 ? -6.567  28.503 22.100 1.00 31.01  ? 202 ARG A N     1 
ATOM   2138 C  CA    . ARG C 3 202 ? -7.857  28.586 22.746 1.00 28.85  ? 202 ARG A CA    1 
ATOM   2139 C  C     . ARG C 3 202 ? -8.302  30.089 22.787 1.00 26.78  ? 202 ARG A C     1 
ATOM   2140 O  O     . ARG C 3 202 ? -9.465  30.404 22.500 1.00 27.89  ? 202 ARG A O     1 
ATOM   2141 C  CB    . ARG C 3 202 ? -7.747  28.009 24.156 1.00 31.16  ? 202 ARG A CB    1 
ATOM   2142 C  CG    . ARG C 3 202 ? -8.936  27.189 24.549 1.00 37.93  ? 202 ARG A CG    1 
ATOM   2143 C  CD    . ARG C 3 202 ? -10.202 27.923 24.187 1.00 42.67  ? 202 ARG A CD    1 
ATOM   2144 N  NE    . ARG C 3 202 ? -11.379 27.499 24.924 1.00 43.99  ? 202 ARG A NE    1 
ATOM   2145 C  CZ    . ARG C 3 202 ? -11.337 27.047 26.163 1.00 47.05  ? 202 ARG A CZ    1 
ATOM   2146 N  NH1   . ARG C 3 202 ? -10.172 26.939 26.798 1.00 48.42  ? 202 ARG A NH1   1 
ATOM   2147 N  NH2   . ARG C 3 202 ? -12.458 26.744 26.786 1.00 49.66  ? 202 ARG A NH2   1 
ATOM   2148 N  N     . LEU C 3 203 ? -7.378  30.979 23.153 1.00 23.47  ? 203 LEU A N     1 
ATOM   2149 C  CA    . LEU C 3 203 ? -7.650  32.424 23.227 1.00 25.83  ? 203 LEU A CA    1 
ATOM   2150 C  C     . LEU C 3 203 ? -8.121  32.897 21.829 1.00 26.13  ? 203 LEU A C     1 
ATOM   2151 O  O     . LEU C 3 203 ? -9.174  33.528 21.680 1.00 24.65  ? 203 LEU A O     1 
ATOM   2152 C  CB    . LEU C 3 203 ? -6.388  33.190 23.660 1.00 24.55  ? 203 LEU A CB    1 
ATOM   2153 C  CG    . LEU C 3 203 ? -6.532  34.731 23.738 1.00 25.03  ? 203 LEU A CG    1 
ATOM   2154 C  CD1   . LEU C 3 203 ? -7.732  35.080 24.602 1.00 24.78  ? 203 LEU A CD1   1 
ATOM   2155 C  CD2   . LEU C 3 203 ? -5.304  35.342 24.370 1.00 23.99  ? 203 LEU A CD2   1 
ATOM   2156 N  N     . HIS C 3 204 ? -7.370  32.540 20.798 1.00 24.42  ? 204 HIS A N     1 
ATOM   2157 C  CA    . HIS C 3 204 ? -7.770  32.918 19.462 1.00 26.97  ? 204 HIS A CA    1 
ATOM   2158 C  C     . HIS C 3 204 ? -9.162  32.458 19.146 1.00 29.92  ? 204 HIS A C     1 
ATOM   2159 O  O     . HIS C 3 204 ? -9.950  33.260 18.607 1.00 29.27  ? 204 HIS A O     1 
ATOM   2160 C  CB    . HIS C 3 204 ? -6.802  32.392 18.415 1.00 25.69  ? 204 HIS A CB    1 
ATOM   2161 C  CG    . HIS C 3 204 ? -7.224  32.697 17.016 1.00 30.65  ? 204 HIS A CG    1 
ATOM   2162 N  ND1   . HIS C 3 204 ? -8.151  31.930 16.339 1.00 31.79  ? 204 HIS A ND1   1 
ATOM   2163 C  CD2   . HIS C 3 204 ? -6.909  33.729 16.188 1.00 30.61  ? 204 HIS A CD2   1 
ATOM   2164 C  CE1   . HIS C 3 204 ? -8.393  32.477 15.156 1.00 32.82  ? 204 HIS A CE1   1 
ATOM   2165 N  NE2   . HIS C 3 204 ? -7.655  33.570 15.041 1.00 30.95  ? 204 HIS A NE2   1 
ATOM   2166 N  N     . GLU C 3 205 ? -9.506  31.189 19.467 1.00 28.78  ? 205 GLU A N     1 
ATOM   2167 C  CA    . GLU C 3 205 ? -10.868 30.684 19.183 1.00 26.12  ? 205 GLU A CA    1 
ATOM   2168 C  C     . GLU C 3 205 ? -11.940 31.426 19.976 1.00 26.68  ? 205 GLU A C     1 
ATOM   2169 O  O     . GLU C 3 205 ? -12.992 31.762 19.447 1.00 27.49  ? 205 GLU A O     1 
ATOM   2170 C  CB    . GLU C 3 205 ? -10.990 29.105 19.480 1.00 28.95  ? 205 GLU A CB    1 
ATOM   2171 N  N     . GLU C 3 206 ? -11.702 31.680 21.261 1.00 27.40  ? 206 GLU A N     1 
ATOM   2172 C  CA    . GLU C 3 206 ? -12.704 32.376 22.039 1.00 24.59  ? 206 GLU A CA    1 
ATOM   2173 C  C     . GLU C 3 206 ? -12.873 33.844 21.545 1.00 26.83  ? 206 GLU A C     1 
ATOM   2174 O  O     . GLU C 3 206 ? -13.981 34.385 21.585 1.00 28.83  ? 206 GLU A O     1 
ATOM   2175 C  CB    . GLU C 3 206 ? -12.321 32.376 23.516 1.00 24.76  ? 206 GLU A CB    1 
ATOM   2176 C  CG    . GLU C 3 206 ? -12.540 31.069 24.275 1.00 26.92  ? 206 GLU A CG    1 
ATOM   2177 C  CD    . GLU C 3 206 ? -13.814 30.317 23.886 1.00 32.05  ? 206 GLU A CD    1 
ATOM   2178 O  OE1   . GLU C 3 206 ? -14.910 30.916 23.702 1.00 31.09  ? 206 GLU A OE1   1 
ATOM   2179 O  OE2   . GLU C 3 206 ? -13.708 29.084 23.774 1.00 39.16  ? 206 GLU A OE2   1 
ATOM   2180 N  N     . MET C 3 207 ? -11.778 34.506 21.142 1.00 26.39  ? 207 MET A N     1 
ATOM   2181 C  CA    . MET C 3 207 ? -11.884 35.867 20.618 1.00 26.26  ? 207 MET A CA    1 
ATOM   2182 C  C     . MET C 3 207 ? -12.838 35.901 19.399 1.00 26.94  ? 207 MET A C     1 
ATOM   2183 O  O     . MET C 3 207 ? -13.722 36.759 19.309 1.00 28.42  ? 207 MET A O     1 
ATOM   2184 C  CB    . MET C 3 207 ? -10.517 36.376 20.198 1.00 22.88  ? 207 MET A CB    1 
ATOM   2185 C  CG    . MET C 3 207 ? -9.609  36.736 21.371 1.00 23.05  ? 207 MET A CG    1 
ATOM   2186 S  SD    . MET C 3 207 ? -7.931  37.223 20.869 1.00 26.11  ? 207 MET A SD    1 
ATOM   2187 C  CE    . MET C 3 207 ? -8.359  38.922 20.185 1.00 21.07  ? 207 MET A CE    1 
ATOM   2188 N  N     . VAL C 3 208 ? -12.630 34.975 18.462 1.00 26.56  ? 208 VAL A N     1 
ATOM   2189 C  CA    . VAL C 3 208 ? -13.456 34.883 17.268 1.00 28.26  ? 208 VAL A CA    1 
ATOM   2190 C  C     . VAL C 3 208 ? -14.911 34.542 17.547 1.00 29.67  ? 208 VAL A C     1 
ATOM   2191 O  O     . VAL C 3 208 ? -15.811 35.176 17.007 1.00 32.67  ? 208 VAL A O     1 
ATOM   2192 C  CB    . VAL C 3 208 ? -12.865 33.863 16.266 1.00 28.48  ? 208 VAL A CB    1 
ATOM   2193 C  CG1   . VAL C 3 208 ? -13.838 33.630 15.124 1.00 29.58  ? 208 VAL A CG1   1 
ATOM   2194 C  CG2   . VAL C 3 208 ? -11.583 34.385 15.735 1.00 24.81  ? 208 VAL A CG2   1 
ATOM   2195 N  N     . ALA C 3 209 ? -15.168 33.559 18.410 1.00 30.07  ? 209 ALA A N     1 
ATOM   2196 C  CA    . ALA C 3 209 ? -16.549 33.224 18.713 1.00 27.77  ? 209 ALA A CA    1 
ATOM   2197 C  C     . ALA C 3 209 ? -17.216 34.390 19.437 1.00 29.40  ? 209 ALA A C     1 
ATOM   2198 O  O     . ALA C 3 209 ? -18.363 34.734 19.136 1.00 27.59  ? 209 ALA A O     1 
ATOM   2199 C  CB    . ALA C 3 209 ? -16.636 31.948 19.590 1.00 28.25  ? 209 ALA A CB    1 
ATOM   2200 N  N     . THR C 3 210 ? -16.499 35.022 20.370 1.00 28.78  ? 210 THR A N     1 
ATOM   2201 C  CA    . THR C 3 210 ? -17.088 36.112 21.129 1.00 28.22  ? 210 THR A CA    1 
ATOM   2202 C  C     . THR C 3 210 ? -17.462 37.298 20.271 1.00 28.20  ? 210 THR A C     1 
ATOM   2203 O  O     . THR C 3 210 ? -18.593 37.792 20.306 1.00 29.50  ? 210 THR A O     1 
ATOM   2204 C  CB    . THR C 3 210 ? -16.142 36.584 22.224 1.00 28.30  ? 210 THR A CB    1 
ATOM   2205 O  OG1   . THR C 3 210 ? -15.942 35.517 23.154 1.00 29.95  ? 210 THR A OG1   1 
ATOM   2206 C  CG2   . THR C 3 210 ? -16.733 37.822 22.943 1.00 29.50  ? 210 THR A CG2   1 
ATOM   2207 N  N     . ILE C 3 211 ? -16.518 37.772 19.482 1.00 29.35  ? 211 ILE A N     1 
ATOM   2208 C  CA    . ILE C 3 211 ? -16.845 38.924 18.679 1.00 30.39  ? 211 ILE A CA    1 
ATOM   2209 C  C     . ILE C 3 211 ? -17.723 38.496 17.505 1.00 30.08  ? 211 ILE A C     1 
ATOM   2210 O  O     . ILE C 3 211 ? -18.593 39.240 17.078 1.00 31.05  ? 211 ILE A O     1 
ATOM   2211 C  CB    . ILE C 3 211 ? -15.547 39.691 18.258 1.00 30.33  ? 211 ILE A CB    1 
ATOM   2212 C  CG1   . ILE C 3 211 ? -15.891 41.167 18.075 1.00 31.74  ? 211 ILE A CG1   1 
ATOM   2213 C  CG2   . ILE C 3 211 ? -15.015 39.142 16.981 1.00 30.91  ? 211 ILE A CG2   1 
ATOM   2214 C  CD1   . ILE C 3 211 ? -14.941 42.155 18.669 1.00 30.23  ? 211 ILE A CD1   1 
ATOM   2215 N  N     . GLY C 3 212 ? -17.529 37.277 17.005 1.00 33.75  ? 212 GLY A N     1 
ATOM   2216 C  CA    . GLY C 3 212 ? -18.349 36.771 15.915 1.00 33.29  ? 212 GLY A CA    1 
ATOM   2217 C  C     . GLY C 3 212 ? -19.841 36.674 16.274 1.00 36.65  ? 212 GLY A C     1 
ATOM   2218 O  O     . GLY C 3 212 ? -20.693 37.073 15.474 1.00 34.36  ? 212 GLY A O     1 
ATOM   2219 N  N     . GLU C 3 213 ? -20.145 36.141 17.465 1.00 38.17  ? 213 GLU A N     1 
ATOM   2220 C  CA    . GLU C 3 213 ? -21.505 36.019 17.999 1.00 41.27  ? 213 GLU A CA    1 
ATOM   2221 C  C     . GLU C 3 213 ? -22.106 37.416 18.104 1.00 42.24  ? 213 GLU A C     1 
ATOM   2222 O  O     . GLU C 3 213 ? -23.256 37.630 17.754 1.00 40.13  ? 213 GLU A O     1 
ATOM   2223 C  CB    . GLU C 3 213 ? -21.499 35.442 19.418 1.00 42.90  ? 213 GLU A CB    1 
ATOM   2224 C  CG    . GLU C 3 213 ? -20.884 34.051 19.544 1.00 52.27  ? 213 GLU A CG    1 
ATOM   2225 C  CD    . GLU C 3 213 ? -20.804 33.532 21.011 1.00 56.42  ? 213 GLU A CD    1 
ATOM   2226 O  OE1   . GLU C 3 213 ? -20.680 32.286 21.195 1.00 58.52  ? 213 GLU A OE1   1 
ATOM   2227 O  OE2   . GLU C 3 213 ? -20.864 34.361 21.963 1.00 56.95  ? 213 GLU A OE2   1 
ATOM   2228 N  N     . ALA C 3 214 ? -21.322 38.368 18.609 1.00 41.90  ? 214 ALA A N     1 
ATOM   2229 C  CA    . ALA C 3 214 ? -21.808 39.731 18.765 1.00 42.68  ? 214 ALA A CA    1 
ATOM   2230 C  C     . ALA C 3 214 ? -22.089 40.435 17.442 1.00 43.02  ? 214 ALA A C     1 
ATOM   2231 O  O     . ALA C 3 214 ? -23.105 41.104 17.312 1.00 40.84  ? 214 ALA A O     1 
ATOM   2232 C  CB    . ALA C 3 214 ? -20.829 40.539 19.582 1.00 41.34  ? 214 ALA A CB    1 
ATOM   2233 N  N     . VAL C 3 215 ? -21.204 40.281 16.461 1.00 46.08  ? 215 VAL A N     1 
ATOM   2234 C  CA    . VAL C 3 215 ? -21.400 40.956 15.171 1.00 49.92  ? 215 VAL A CA    1 
ATOM   2235 C  C     . VAL C 3 215 ? -22.617 40.380 14.461 1.00 53.31  ? 215 VAL A C     1 
ATOM   2236 O  O     . VAL C 3 215 ? -23.357 41.099 13.776 1.00 54.03  ? 215 VAL A O     1 
ATOM   2237 C  CB    . VAL C 3 215 ? -20.150 40.839 14.266 1.00 49.04  ? 215 VAL A CB    1 
ATOM   2238 C  CG1   . VAL C 3 215 ? -20.045 39.458 13.696 1.00 53.67  ? 215 VAL A CG1   1 
ATOM   2239 C  CG2   . VAL C 3 215 ? -20.231 41.826 13.153 1.00 52.11  ? 215 VAL A CG2   1 
ATOM   2240 N  N     . MET C 3 216 ? -22.827 39.084 14.671 1.00 54.23  ? 216 MET A N     1 
ATOM   2241 C  CA    . MET C 3 216 ? -23.932 38.333 14.109 1.00 57.22  ? 216 MET A CA    1 
ATOM   2242 C  C     . MET C 3 216 ? -25.154 38.524 15.001 1.00 56.90  ? 216 MET A C     1 
ATOM   2243 O  O     . MET C 3 216 ? -26.227 38.908 14.529 1.00 58.07  ? 216 MET A O     1 
ATOM   2244 C  CB    . MET C 3 216 ? -23.537 36.852 14.042 1.00 60.29  ? 216 MET A CB    1 
ATOM   2245 C  CG    . MET C 3 216 ? -24.692 35.869 13.989 1.00 66.70  ? 216 MET A CG    1 
ATOM   2246 S  SD    . MET C 3 216 ? -24.144 34.107 14.041 1.00 71.77  ? 216 MET A SD    1 
ATOM   2247 C  CE    . MET C 3 216 ? -24.405 33.666 15.859 1.00 70.85  ? 216 MET A CE    1 
ATOM   2248 N  N     . HIS C 3 238 ? -25.983 36.592 28.142 1.00 61.98  ? 238 HIS A N     1 
ATOM   2249 C  CA    . HIS C 3 238 ? -25.495 37.953 28.395 1.00 61.34  ? 238 HIS A CA    1 
ATOM   2250 C  C     . HIS C 3 238 ? -23.936 37.986 28.514 1.00 58.66  ? 238 HIS A C     1 
ATOM   2251 O  O     . HIS C 3 238 ? -23.202 37.347 27.734 1.00 58.48  ? 238 HIS A O     1 
ATOM   2252 C  CB    . HIS C 3 238 ? -26.138 38.496 29.690 1.00 64.16  ? 238 HIS A CB    1 
ATOM   2253 C  CG    . HIS C 3 238 ? -25.964 39.974 29.888 1.00 69.71  ? 238 HIS A CG    1 
ATOM   2254 N  ND1   . HIS C 3 238 ? -25.964 40.566 31.138 1.00 71.20  ? 238 HIS A ND1   1 
ATOM   2255 C  CD2   . HIS C 3 238 ? -25.811 40.985 28.994 1.00 70.46  ? 238 HIS A CD2   1 
ATOM   2256 C  CE1   . HIS C 3 238 ? -25.818 41.874 31.003 1.00 71.55  ? 238 HIS A CE1   1 
ATOM   2257 N  NE2   . HIS C 3 238 ? -25.723 42.154 29.714 1.00 70.78  ? 238 HIS A NE2   1 
ATOM   2258 N  N     . LEU C 3 239 ? -23.448 38.729 29.502 1.00 50.89  ? 239 LEU A N     1 
ATOM   2259 C  CA    . LEU C 3 239 ? -22.027 38.857 29.750 1.00 45.44  ? 239 LEU A CA    1 
ATOM   2260 C  C     . LEU C 3 239 ? -21.607 37.959 30.915 1.00 41.81  ? 239 LEU A C     1 
ATOM   2261 O  O     . LEU C 3 239 ? -22.387 37.755 31.844 1.00 41.25  ? 239 LEU A O     1 
ATOM   2262 C  CB    . LEU C 3 239 ? -21.736 40.311 30.082 1.00 42.14  ? 239 LEU A CB    1 
ATOM   2263 C  CG    . LEU C 3 239 ? -22.044 41.132 28.839 1.00 41.99  ? 239 LEU A CG    1 
ATOM   2264 C  CD1   . LEU C 3 239 ? -22.073 42.613 29.169 1.00 42.49  ? 239 LEU A CD1   1 
ATOM   2265 C  CD2   . LEU C 3 239 ? -20.961 40.804 27.811 1.00 40.76  ? 239 LEU A CD2   1 
ATOM   2266 N  N     . TYR C 3 240 ? -20.389 37.424 30.877 1.00 37.38  ? 240 TYR A N     1 
ATOM   2267 C  CA    . TYR C 3 240 ? -19.927 36.561 31.979 1.00 35.12  ? 240 TYR A CA    1 
ATOM   2268 C  C     . TYR C 3 240 ? -19.267 37.324 33.118 1.00 33.26  ? 240 TYR A C     1 
ATOM   2269 O  O     . TYR C 3 240 ? -19.534 37.055 34.314 1.00 30.70  ? 240 TYR A O     1 
ATOM   2270 C  CB    . TYR C 3 240 ? -18.930 35.524 31.492 1.00 34.72  ? 240 TYR A CB    1 
ATOM   2271 C  CG    . TYR C 3 240 ? -19.559 34.471 30.651 1.00 38.80  ? 240 TYR A CG    1 
ATOM   2272 C  CD1   . TYR C 3 240 ? -19.517 34.545 29.253 1.00 39.98  ? 240 TYR A CD1   1 
ATOM   2273 C  CD2   . TYR C 3 240 ? -20.217 33.395 31.249 1.00 42.02  ? 240 TYR A CD2   1 
ATOM   2274 C  CE1   . TYR C 3 240 ? -20.109 33.575 28.464 1.00 43.77  ? 240 TYR A CE1   1 
ATOM   2275 C  CE2   . TYR C 3 240 ? -20.823 32.403 30.472 1.00 44.79  ? 240 TYR A CE2   1 
ATOM   2276 C  CZ    . TYR C 3 240 ? -20.764 32.495 29.082 1.00 46.44  ? 240 TYR A CZ    1 
ATOM   2277 O  OH    . TYR C 3 240 ? -21.332 31.493 28.327 1.00 47.58  ? 240 TYR A OH    1 
ATOM   2278 N  N     . VAL C 3 241 ? -18.410 38.274 32.743 1.00 28.33  ? 241 VAL A N     1 
ATOM   2279 C  CA    . VAL C 3 241 ? -17.661 39.048 33.714 1.00 25.02  ? 241 VAL A CA    1 
ATOM   2280 C  C     . VAL C 3 241 ? -17.702 40.583 33.608 1.00 27.59  ? 241 VAL A C     1 
ATOM   2281 O  O     . VAL C 3 241 ? -17.697 41.279 34.636 1.00 22.90  ? 241 VAL A O     1 
ATOM   2282 C  CB    . VAL C 3 241 ? -16.174 38.587 33.708 1.00 27.60  ? 241 VAL A CB    1 
ATOM   2283 C  CG1   . VAL C 3 241 ? -16.115 37.046 33.932 1.00 25.59  ? 241 VAL A CG1   1 
ATOM   2284 C  CG2   . VAL C 3 241 ? -15.507 38.933 32.382 1.00 23.50  ? 241 VAL A CG2   1 
ATOM   2285 N  N     . TYR C 3 242 ? -17.710 41.106 32.381 1.00 28.88  ? 242 TYR A N     1 
ATOM   2286 C  CA    . TYR C 3 242 ? -17.713 42.563 32.189 1.00 30.57  ? 242 TYR A CA    1 
ATOM   2287 C  C     . TYR C 3 242 ? -18.870 43.294 32.914 1.00 28.00  ? 242 TYR A C     1 
ATOM   2288 O  O     . TYR C 3 242 ? -20.049 43.046 32.665 1.00 27.81  ? 242 TYR A O     1 
ATOM   2289 C  CB    . TYR C 3 242 ? -17.736 42.886 30.704 1.00 35.30  ? 242 TYR A CB    1 
ATOM   2290 C  CG    . TYR C 3 242 ? -17.355 44.322 30.404 1.00 39.19  ? 242 TYR A CG    1 
ATOM   2291 C  CD1   . TYR C 3 242 ? -16.025 44.735 30.409 1.00 39.29  ? 242 TYR A CD1   1 
ATOM   2292 C  CD2   . TYR C 3 242 ? -18.343 45.262 30.142 1.00 44.62  ? 242 TYR A CD2   1 
ATOM   2293 C  CE1   . TYR C 3 242 ? -15.688 46.055 30.163 1.00 47.48  ? 242 TYR A CE1   1 
ATOM   2294 C  CE2   . TYR C 3 242 ? -18.022 46.597 29.888 1.00 47.52  ? 242 TYR A CE2   1 
ATOM   2295 C  CZ    . TYR C 3 242 ? -16.708 46.988 29.900 1.00 49.39  ? 242 TYR A CZ    1 
ATOM   2296 O  OH    . TYR C 3 242 ? -16.432 48.319 29.662 1.00 56.02  ? 242 TYR A OH    1 
ATOM   2297 N  N     . GLY C 3 243 ? -18.479 44.171 33.830 1.00 29.93  ? 243 GLY A N     1 
ATOM   2298 C  CA    . GLY C 3 243 ? -19.413 44.939 34.634 1.00 31.15  ? 243 GLY A CA    1 
ATOM   2299 C  C     . GLY C 3 243 ? -20.140 44.111 35.682 1.00 33.73  ? 243 GLY A C     1 
ATOM   2300 O  O     . GLY C 3 243 ? -21.051 44.640 36.319 1.00 35.18  ? 243 GLY A O     1 
ATOM   2301 N  N     . ARG C 3 244 ? -19.787 42.828 35.878 1.00 32.07  ? 244 ARG A N     1 
ATOM   2302 C  CA    . ARG C 3 244 ? -20.516 42.006 36.873 1.00 32.35  ? 244 ARG A CA    1 
ATOM   2303 C  C     . ARG C 3 244 ? -19.778 41.871 38.198 1.00 34.40  ? 244 ARG A C     1 
ATOM   2304 O  O     . ARG C 3 244 ? -20.043 40.935 38.961 1.00 34.27  ? 244 ARG A O     1 
ATOM   2305 C  CB    . ARG C 3 244 ? -20.830 40.610 36.314 1.00 33.06  ? 244 ARG A CB    1 
ATOM   2306 C  CG    . ARG C 3 244 ? -21.450 40.638 34.922 1.00 31.63  ? 244 ARG A CG    1 
ATOM   2307 C  CD    . ARG C 3 244 ? -21.964 39.286 34.478 1.00 34.66  ? 244 ARG A CD    1 
ATOM   2308 N  NE    . ARG C 3 244 ? -22.935 38.730 35.431 1.00 37.28  ? 244 ARG A NE    1 
ATOM   2309 C  CZ    . ARG C 3 244 ? -22.675 37.740 36.297 1.00 39.92  ? 244 ARG A CZ    1 
ATOM   2310 N  NH1   . ARG C 3 244 ? -21.468 37.179 36.348 1.00 34.98  ? 244 ARG A NH1   1 
ATOM   2311 N  NH2   . ARG C 3 244 ? -23.629 37.290 37.120 1.00 41.10  ? 244 ARG A NH2   1 
ATOM   2312 N  N     . GLN C 3 245 ? -18.847 42.806 38.435 1.00 33.95  ? 245 GLN A N     1 
ATOM   2313 C  CA    . GLN C 3 245 ? -18.026 42.913 39.641 1.00 37.13  ? 245 GLN A CA    1 
ATOM   2314 C  C     . GLN C 3 245 ? -18.919 42.621 40.856 1.00 38.33  ? 245 GLN A C     1 
ATOM   2315 O  O     . GLN C 3 245 ? -20.015 43.191 40.969 1.00 36.88  ? 245 GLN A O     1 
ATOM   2316 C  CB    . GLN C 3 245 ? -17.478 44.350 39.727 1.00 40.59  ? 245 GLN A CB    1 
ATOM   2317 C  CG    . GLN C 3 245 ? -17.866 45.178 38.482 1.00 45.10  ? 245 GLN A CG    1 
ATOM   2318 C  CD    . GLN C 3 245 ? -17.854 46.676 38.719 1.00 52.92  ? 245 GLN A CD    1 
ATOM   2319 O  OE1   . GLN C 3 245 ? -18.509 47.450 37.990 1.00 55.88  ? 245 GLN A OE1   1 
ATOM   2320 N  NE2   . GLN C 3 245 ? -17.106 47.108 39.732 1.00 54.83  ? 245 GLN A NE2   1 
ATOM   2321 N  N     . GLY C 3 246 ? -18.474 41.736 41.751 1.00 38.01  ? 246 GLY A N     1 
ATOM   2322 C  CA    . GLY C 3 246 ? -19.277 41.412 42.919 1.00 38.06  ? 246 GLY A CA    1 
ATOM   2323 C  C     . GLY C 3 246 ? -20.470 40.468 42.740 1.00 38.31  ? 246 GLY A C     1 
ATOM   2324 O  O     . GLY C 3 246 ? -21.110 40.057 43.727 1.00 39.85  ? 246 GLY A O     1 
ATOM   2325 N  N     . ASN C 3 247 ? -20.822 40.143 41.505 1.00 35.63  ? 247 ASN A N     1 
ATOM   2326 C  CA    . ASN C 3 247 ? -21.918 39.224 41.308 1.00 35.52  ? 247 ASN A CA    1 
ATOM   2327 C  C     . ASN C 3 247 ? -21.320 37.827 41.130 1.00 32.65  ? 247 ASN A C     1 
ATOM   2328 O  O     . ASN C 3 247 ? -20.156 37.684 40.796 1.00 28.22  ? 247 ASN A O     1 
ATOM   2329 C  CB    . ASN C 3 247 ? -22.729 39.609 40.087 1.00 38.32  ? 247 ASN A CB    1 
ATOM   2330 C  CG    . ASN C 3 247 ? -23.354 40.953 40.239 1.00 44.76  ? 247 ASN A CG    1 
ATOM   2331 O  OD1   . ASN C 3 247 ? -24.097 41.206 41.207 1.00 45.98  ? 247 ASN A OD1   1 
ATOM   2332 N  ND2   . ASN C 3 247 ? -23.055 41.845 39.301 1.00 42.58  ? 247 ASN A ND2   1 
ATOM   2333 N  N     . PRO C 3 248 ? -22.120 36.789 41.359 1.00 32.84  ? 248 PRO A N     1 
ATOM   2334 C  CA    . PRO C 3 248 ? -21.546 35.453 41.197 1.00 31.10  ? 248 PRO A CA    1 
ATOM   2335 C  C     . PRO C 3 248 ? -21.222 35.164 39.728 1.00 30.96  ? 248 PRO A C     1 
ATOM   2336 O  O     . PRO C 3 248 ? -21.915 35.646 38.827 1.00 26.76  ? 248 PRO A O     1 
ATOM   2337 C  CB    . PRO C 3 248 ? -22.635 34.538 41.742 1.00 30.55  ? 248 PRO A CB    1 
ATOM   2338 C  CG    . PRO C 3 248 ? -23.907 35.301 41.500 1.00 34.34  ? 248 PRO A CG    1 
ATOM   2339 C  CD    . PRO C 3 248 ? -23.553 36.747 41.719 1.00 33.81  ? 248 PRO A CD    1 
ATOM   2340 N  N     . CYS C 3 249 ? -20.154 34.401 39.505 1.00 27.64  ? 249 CYS A N     1 
ATOM   2341 C  CA    . CYS C 3 249 ? -19.752 33.985 38.176 1.00 23.05  ? 249 CYS A CA    1 
ATOM   2342 C  C     . CYS C 3 249 ? -20.873 33.071 37.720 1.00 25.19  ? 249 CYS A C     1 
ATOM   2343 O  O     . CYS C 3 249 ? -21.387 32.250 38.502 1.00 24.66  ? 249 CYS A O     1 
ATOM   2344 C  CB    . CYS C 3 249 ? -18.446 33.198 38.249 1.00 25.07  ? 249 CYS A CB    1 
ATOM   2345 S  SG    . CYS C 3 249 ? -18.028 32.271 36.740 1.00 22.46  ? 249 CYS A SG    1 
ATOM   2346 N  N     . LYS C 3 250 ? -21.259 33.210 36.458 1.00 24.10  ? 250 LYS A N     1 
ATOM   2347 C  CA    . LYS C 3 250 ? -22.344 32.423 35.881 1.00 25.67  ? 250 LYS A CA    1 
ATOM   2348 C  C     . LYS C 3 250 ? -22.004 30.974 35.683 1.00 25.46  ? 250 LYS A C     1 
ATOM   2349 O  O     . LYS C 3 250 ? -22.896 30.136 35.522 1.00 24.11  ? 250 LYS A O     1 
ATOM   2350 C  CB    . LYS C 3 250 ? -22.775 33.047 34.547 1.00 27.80  ? 250 LYS A CB    1 
ATOM   2351 C  CG    . LYS C 3 250 ? -23.207 34.490 34.747 1.00 36.29  ? 250 LYS A CG    1 
ATOM   2352 C  CD    . LYS C 3 250 ? -24.169 34.962 33.653 1.00 45.78  ? 250 LYS A CD    1 
ATOM   2353 C  CE    . LYS C 3 250 ? -24.530 36.469 33.816 1.00 48.79  ? 250 LYS A CE    1 
ATOM   2354 N  NZ    . LYS C 3 250 ? -25.538 36.977 32.801 1.00 51.77  ? 250 LYS A NZ    1 
ATOM   2355 N  N     . ARG C 3 251 ? -20.714 30.659 35.708 1.00 21.92  ? 251 ARG A N     1 
ATOM   2356 C  CA    . ARG C 3 251 ? -20.314 29.287 35.517 1.00 21.32  ? 251 ARG A CA    1 
ATOM   2357 C  C     . ARG C 3 251 ? -20.003 28.566 36.840 1.00 24.55  ? 251 ARG A C     1 
ATOM   2358 O  O     . ARG C 3 251 ? -20.206 27.351 36.934 1.00 22.16  ? 251 ARG A O     1 
ATOM   2359 C  CB    . ARG C 3 251 ? -19.094 29.282 34.571 1.00 25.95  ? 251 ARG A CB    1 
ATOM   2360 C  CG    . ARG C 3 251 ? -18.237 28.064 34.553 1.00 30.64  ? 251 ARG A CG    1 
ATOM   2361 C  CD    . ARG C 3 251 ? -17.795 27.780 33.132 1.00 36.31  ? 251 ARG A CD    1 
ATOM   2362 N  NE    . ARG C 3 251 ? -16.495 28.344 32.784 1.00 42.67  ? 251 ARG A NE    1 
ATOM   2363 C  CZ    . ARG C 3 251 ? -16.195 28.845 31.579 1.00 46.30  ? 251 ARG A CZ    1 
ATOM   2364 N  NH1   . ARG C 3 251 ? -14.971 29.319 31.341 1.00 45.68  ? 251 ARG A NH1   1 
ATOM   2365 N  NH2   . ARG C 3 251 ? -17.133 28.914 30.618 1.00 46.13  ? 251 ARG A NH2   1 
ATOM   2366 N  N     . CYS C 3 252 ? -19.508 29.278 37.868 1.00 22.69  ? 252 CYS A N     1 
ATOM   2367 C  CA    . CYS C 3 252 ? -19.163 28.604 39.113 1.00 22.19  ? 252 CYS A CA    1 
ATOM   2368 C  C     . CYS C 3 252 ? -19.662 29.264 40.366 1.00 23.92  ? 252 CYS A C     1 
ATOM   2369 O  O     . CYS C 3 252 ? -19.456 28.744 41.447 1.00 21.99  ? 252 CYS A O     1 
ATOM   2370 C  CB    . CYS C 3 252 ? -17.619 28.454 39.236 1.00 25.72  ? 252 CYS A CB    1 
ATOM   2371 S  SG    . CYS C 3 252 ? -16.757 30.020 39.679 1.00 20.69  ? 252 CYS A SG    1 
ATOM   2372 N  N     . GLY C 3 253 ? -20.264 30.436 40.257 1.00 20.97  ? 253 GLY A N     1 
ATOM   2373 C  CA    . GLY C 3 253 ? -20.779 31.078 41.440 1.00 19.26  ? 253 GLY A CA    1 
ATOM   2374 C  C     . GLY C 3 253 ? -19.795 31.890 42.245 1.00 24.16  ? 253 GLY A C     1 
ATOM   2375 O  O     . GLY C 3 253 ? -20.206 32.586 43.164 1.00 23.98  ? 253 GLY A O     1 
ATOM   2376 N  N     . THR C 3 254 ? -18.497 31.796 41.950 1.00 22.49  ? 254 THR A N     1 
ATOM   2377 C  CA    . THR C 3 254 ? -17.505 32.585 42.661 1.00 23.14  ? 254 THR A CA    1 
ATOM   2378 C  C     . THR C 3 254 ? -17.712 34.084 42.306 1.00 24.35  ? 254 THR A C     1 
ATOM   2379 O  O     . THR C 3 254 ? -17.999 34.435 41.147 1.00 19.49  ? 254 THR A O     1 
ATOM   2380 C  CB    . THR C 3 254 ? -16.104 32.163 42.203 1.00 27.75  ? 254 THR A CB    1 
ATOM   2381 O  OG1   . THR C 3 254 ? -15.851 30.819 42.633 1.00 24.91  ? 254 THR A OG1   1 
ATOM   2382 C  CG2   . THR C 3 254 ? -15.040 33.097 42.741 1.00 26.37  ? 254 THR A CG2   1 
ATOM   2383 N  N     . PRO C 3 255 ? -17.600 34.987 43.294 1.00 23.23  ? 255 PRO A N     1 
ATOM   2384 C  CA    . PRO C 3 255 ? -17.780 36.406 42.944 1.00 22.00  ? 255 PRO A CA    1 
ATOM   2385 C  C     . PRO C 3 255 ? -16.763 36.931 41.908 1.00 20.36  ? 255 PRO A C     1 
ATOM   2386 O  O     . PRO C 3 255 ? -15.541 36.747 42.027 1.00 21.05  ? 255 PRO A O     1 
ATOM   2387 C  CB    . PRO C 3 255 ? -17.609 37.114 44.288 1.00 20.19  ? 255 PRO A CB    1 
ATOM   2388 C  CG    . PRO C 3 255 ? -18.165 36.112 45.259 1.00 25.76  ? 255 PRO A CG    1 
ATOM   2389 C  CD    . PRO C 3 255 ? -17.523 34.823 44.759 1.00 23.68  ? 255 PRO A CD    1 
ATOM   2390 N  N     . ILE C 3 256 ? -17.273 37.618 40.900 1.00 23.84  ? 256 ILE A N     1 
ATOM   2391 C  CA    . ILE C 3 256 ? -16.396 38.189 39.882 1.00 23.01  ? 256 ILE A CA    1 
ATOM   2392 C  C     . ILE C 3 256 ? -15.572 39.330 40.501 1.00 25.43  ? 256 ILE A C     1 
ATOM   2393 O  O     . ILE C 3 256 ? -16.091 40.142 41.258 1.00 28.62  ? 256 ILE A O     1 
ATOM   2394 C  CB    . ILE C 3 256 ? -17.263 38.730 38.743 1.00 24.21  ? 256 ILE A CB    1 
ATOM   2395 C  CG1   . ILE C 3 256 ? -17.901 37.525 38.030 1.00 23.20  ? 256 ILE A CG1   1 
ATOM   2396 C  CG2   . ILE C 3 256 ? -16.438 39.616 37.767 1.00 20.21  ? 256 ILE A CG2   1 
ATOM   2397 C  CD1   . ILE C 3 256 ? -16.802 36.434 37.724 1.00 19.87  ? 256 ILE A CD1   1 
ATOM   2398 N  N     . GLU C 3 257 ? -14.292 39.384 40.209 1.00 25.77  ? 257 GLU A N     1 
ATOM   2399 C  CA    . GLU C 3 257 ? -13.476 40.468 40.710 1.00 29.88  ? 257 GLU A CA    1 
ATOM   2400 C  C     . GLU C 3 257 ? -13.106 41.501 39.636 1.00 31.50  ? 257 GLU A C     1 
ATOM   2401 O  O     . GLU C 3 257 ? -13.028 41.190 38.431 1.00 31.14  ? 257 GLU A O     1 
ATOM   2402 C  CB    . GLU C 3 257 ? -12.222 39.904 41.334 1.00 31.88  ? 257 GLU A CB    1 
ATOM   2403 C  CG    . GLU C 3 257 ? -12.467 39.577 42.801 1.00 35.87  ? 257 GLU A CG    1 
ATOM   2404 C  CD    . GLU C 3 257 ? -11.469 38.623 43.346 1.00 42.28  ? 257 GLU A CD    1 
ATOM   2405 O  OE1   . GLU C 3 257 ? -11.754 38.076 44.449 1.00 42.67  ? 257 GLU A OE1   1 
ATOM   2406 O  OE2   . GLU C 3 257 ? -10.413 38.412 42.681 1.00 43.48  ? 257 GLU A OE2   1 
ATOM   2407 N  N     . LYS C 3 258 ? -12.890 42.732 40.089 1.00 32.69  ? 258 LYS A N     1 
ATOM   2408 C  CA    . LYS C 3 258 ? -12.496 43.840 39.216 1.00 33.74  ? 258 LYS A CA    1 
ATOM   2409 C  C     . LYS C 3 258 ? -11.198 44.497 39.727 1.00 36.57  ? 258 LYS A C     1 
ATOM   2410 O  O     . LYS C 3 258 ? -11.035 44.799 40.920 1.00 35.89  ? 258 LYS A O     1 
ATOM   2411 C  CB    . LYS C 3 258 ? -13.607 44.889 39.117 1.00 34.09  ? 258 LYS A CB    1 
ATOM   2412 C  CG    . LYS C 3 258 ? -13.207 46.132 38.275 1.00 31.13  ? 258 LYS A CG    1 
ATOM   2413 C  CD    . LYS C 3 258 ? -14.418 46.987 37.944 1.00 36.93  ? 258 LYS A CD    1 
ATOM   2414 C  CE    . LYS C 3 258 ? -14.009 48.205 37.073 1.00 36.65  ? 258 LYS A CE    1 
ATOM   2415 N  NZ    . LYS C 3 258 ? -15.225 48.941 36.593 1.00 39.78  ? 258 LYS A NZ    1 
ATOM   2416 N  N     . THR C 3 259 ? -10.252 44.647 38.821 1.00 36.57  ? 259 THR A N     1 
ATOM   2417 C  CA    . THR C 3 259 ? -8.975  45.279 39.139 1.00 38.01  ? 259 THR A CA    1 
ATOM   2418 C  C     . THR C 3 259 ? -8.535  46.090 37.918 1.00 35.79  ? 259 THR A C     1 
ATOM   2419 O  O     . THR C 3 259 ? -9.235  46.125 36.918 1.00 33.57  ? 259 THR A O     1 
ATOM   2420 C  CB    . THR C 3 259 ? -7.896  44.267 39.418 1.00 37.29  ? 259 THR A CB    1 
ATOM   2421 O  OG1   . THR C 3 259 ? -7.650  43.515 38.227 1.00 40.37  ? 259 THR A OG1   1 
ATOM   2422 C  CG2   . THR C 3 259 ? -8.318  43.344 40.531 1.00 45.40  ? 259 THR A CG2   1 
ATOM   2423 N  N     . VAL C 3 260 ? -7.378  46.739 38.025 1.00 37.29  ? 260 VAL A N     1 
ATOM   2424 C  CA    . VAL C 3 260 ? -6.830  47.558 36.948 1.00 33.76  ? 260 VAL A CA    1 
ATOM   2425 C  C     . VAL C 3 260 ? -5.685  46.765 36.335 1.00 34.35  ? 260 VAL A C     1 
ATOM   2426 O  O     . VAL C 3 260 ? -4.742  46.417 37.043 1.00 31.45  ? 260 VAL A O     1 
ATOM   2427 C  CB    . VAL C 3 260 ? -6.259  48.934 37.493 1.00 33.67  ? 260 VAL A CB    1 
ATOM   2428 C  CG1   . VAL C 3 260 ? -5.582  49.744 36.333 1.00 29.05  ? 260 VAL A CG1   1 
ATOM   2429 C  CG2   . VAL C 3 260 ? -7.371  49.756 38.126 1.00 32.90  ? 260 VAL A CG2   1 
ATOM   2430 N  N     . VAL C 3 261 ? -5.799  46.437 35.042 1.00 33.41  ? 261 VAL A N     1 
ATOM   2431 C  CA    . VAL C 3 261 ? -4.746  45.723 34.287 1.00 32.01  ? 261 VAL A CA    1 
ATOM   2432 C  C     . VAL C 3 261 ? -4.578  46.519 32.976 1.00 32.51  ? 261 VAL A C     1 
ATOM   2433 O  O     . VAL C 3 261 ? -5.580  46.940 32.344 1.00 33.64  ? 261 VAL A O     1 
ATOM   2434 C  CB    . VAL C 3 261 ? -5.133  44.238 33.962 1.00 34.50  ? 261 VAL A CB    1 
ATOM   2435 C  CG1   . VAL C 3 261 ? -4.131  43.631 32.968 1.00 33.55  ? 261 VAL A CG1   1 
ATOM   2436 C  CG2   . VAL C 3 261 ? -5.122  43.374 35.259 1.00 31.05  ? 261 VAL A CG2   1 
ATOM   2437 N  N     . ALA C 3 262 ? -3.343  46.749 32.565 1.00 30.10  ? 262 ALA A N     1 
ATOM   2438 C  CA    . ALA C 3 262 ? -3.103  47.545 31.348 1.00 31.82  ? 262 ALA A CA    1 
ATOM   2439 C  C     . ALA C 3 262 ? -3.785  48.931 31.436 1.00 33.52  ? 262 ALA A C     1 
ATOM   2440 O  O     . ALA C 3 262 ? -4.235  49.470 30.418 1.00 34.23  ? 262 ALA A O     1 
ATOM   2441 C  CB    . ALA C 3 262 ? -3.607  46.765 30.068 1.00 29.54  ? 262 ALA A CB    1 
ATOM   2442 N  N     . GLY C 3 263 ? -3.888  49.473 32.656 1.00 32.75  ? 263 GLY A N     1 
ATOM   2443 C  CA    . GLY C 3 263 ? -4.488  50.774 32.875 1.00 33.27  ? 263 GLY A CA    1 
ATOM   2444 C  C     . GLY C 3 263 ? -5.998  50.859 32.710 1.00 34.16  ? 263 GLY A C     1 
ATOM   2445 O  O     . GLY C 3 263 ? -6.552  51.955 32.770 1.00 32.83  ? 263 GLY A O     1 
ATOM   2446 N  N     . ARG C 3 264 ? -6.677  49.726 32.538 1.00 32.99  ? 264 ARG A N     1 
ATOM   2447 C  CA    . ARG C 3 264 ? -8.137  49.752 32.340 1.00 33.98  ? 264 ARG A CA    1 
ATOM   2448 C  C     . ARG C 3 264 ? -8.912  48.886 33.360 1.00 33.76  ? 264 ARG A C     1 
ATOM   2449 O  O     . ARG C 3 264 ? -8.344  47.947 33.948 1.00 36.53  ? 264 ARG A O     1 
ATOM   2450 C  CB    . ARG C 3 264 ? -8.479  49.251 30.909 1.00 34.74  ? 264 ARG A CB    1 
ATOM   2451 C  CG    . ARG C 3 264 ? -8.002  50.168 29.779 1.00 38.14  ? 264 ARG A CG    1 
ATOM   2452 C  CD    . ARG C 3 264 ? -8.767  51.478 29.768 1.00 42.78  ? 264 ARG A CD    1 
ATOM   2453 N  NE    . ARG C 3 264 ? -8.126  52.535 28.970 1.00 46.71  ? 264 ARG A NE    1 
ATOM   2454 C  CZ    . ARG C 3 264 ? -7.671  53.690 29.483 1.00 52.26  ? 264 ARG A CZ    1 
ATOM   2455 N  NH1   . ARG C 3 264 ? -7.104  54.620 28.692 1.00 49.14  ? 264 ARG A NH1   1 
ATOM   2456 N  NH2   . ARG C 3 264 ? -7.778  53.923 30.801 1.00 52.71  ? 264 ARG A NH2   1 
ATOM   2457 N  N     . GLY C 3 265 ? -10.188 49.217 33.574 1.00 32.79  ? 265 GLY A N     1 
ATOM   2458 C  CA    . GLY C 3 265 ? -11.041 48.399 34.447 1.00 32.15  ? 265 GLY A CA    1 
ATOM   2459 C  C     . GLY C 3 265 ? -11.017 46.976 33.842 1.00 30.96  ? 265 GLY A C     1 
ATOM   2460 O  O     . GLY C 3 265 ? -11.230 46.817 32.627 1.00 29.42  ? 265 GLY A O     1 
ATOM   2461 N  N     . THR C 3 266 ? -10.760 45.965 34.673 1.00 27.07  ? 266 THR A N     1 
ATOM   2462 C  CA    . THR C 3 266 ? -10.621 44.563 34.247 1.00 26.70  ? 266 THR A CA    1 
ATOM   2463 C  C     . THR C 3 266 ? -11.395 43.577 35.168 1.00 26.09  ? 266 THR A C     1 
ATOM   2464 O  O     . THR C 3 266 ? -11.215 43.588 36.373 1.00 26.81  ? 266 THR A O     1 
ATOM   2465 C  CB    . THR C 3 266 ? -9.134  44.196 34.253 1.00 27.84  ? 266 THR A CB    1 
ATOM   2466 O  OG1   . THR C 3 266 ? -8.445  45.072 33.345 1.00 33.26  ? 266 THR A OG1   1 
ATOM   2467 C  CG2   . THR C 3 266 ? -8.908  42.731 33.814 1.00 24.03  ? 266 THR A CG2   1 
ATOM   2468 N  N     . HIS C 3 267 ? -12.264 42.760 34.580 1.00 23.92  ? 267 HIS A N     1 
ATOM   2469 C  CA    . HIS C 3 267 ? -13.103 41.819 35.317 1.00 25.51  ? 267 HIS A CA    1 
ATOM   2470 C  C     . HIS C 3 267 ? -12.712 40.406 35.017 1.00 22.80  ? 267 HIS A C     1 
ATOM   2471 O  O     . HIS C 3 267 ? -12.373 40.069 33.875 1.00 25.31  ? 267 HIS A O     1 
ATOM   2472 C  CB    . HIS C 3 267 ? -14.575 42.001 34.938 1.00 28.64  ? 267 HIS A CB    1 
ATOM   2473 C  CG    . HIS C 3 267 ? -14.982 43.431 34.875 1.00 35.93  ? 267 HIS A CG    1 
ATOM   2474 N  ND1   . HIS C 3 267 ? -14.480 44.296 33.923 1.00 39.49  ? 267 HIS A ND1   1 
ATOM   2475 C  CD2   . HIS C 3 267 ? -15.825 44.158 35.647 1.00 37.45  ? 267 HIS A CD2   1 
ATOM   2476 C  CE1   . HIS C 3 267 ? -15.006 45.496 34.110 1.00 41.16  ? 267 HIS A CE1   1 
ATOM   2477 N  NE2   . HIS C 3 267 ? -15.824 45.438 35.147 1.00 37.95  ? 267 HIS A NE2   1 
ATOM   2478 N  N     . TYR C 3 268 ? -12.748 39.566 36.037 1.00 20.83  ? 268 TYR A N     1 
ATOM   2479 C  CA    . TYR C 3 268 ? -12.377 38.171 35.816 1.00 21.66  ? 268 TYR A CA    1 
ATOM   2480 C  C     . TYR C 3 268 ? -12.890 37.284 36.967 1.00 21.02  ? 268 TYR A C     1 
ATOM   2481 O  O     . TYR C 3 268 ? -13.251 37.782 38.032 1.00 20.03  ? 268 TYR A O     1 
ATOM   2482 C  CB    . TYR C 3 268 ? -10.841 38.036 35.696 1.00 19.17  ? 268 TYR A CB    1 
ATOM   2483 C  CG    . TYR C 3 268 ? -10.093 38.471 36.942 1.00 27.99  ? 268 TYR A CG    1 
ATOM   2484 C  CD1   . TYR C 3 268 ? -9.888  37.578 37.990 1.00 32.95  ? 268 TYR A CD1   1 
ATOM   2485 C  CD2   . TYR C 3 268 ? -9.716  39.809 37.130 1.00 31.08  ? 268 TYR A CD2   1 
ATOM   2486 C  CE1   . TYR C 3 268 ? -9.366  37.986 39.173 1.00 38.35  ? 268 TYR A CE1   1 
ATOM   2487 C  CE2   . TYR C 3 268 ? -9.179  40.236 38.333 1.00 34.61  ? 268 TYR A CE2   1 
ATOM   2488 C  CZ    . TYR C 3 268 ? -9.020  39.309 39.349 1.00 38.20  ? 268 TYR A CZ    1 
ATOM   2489 O  OH    . TYR C 3 268 ? -8.558  39.679 40.577 1.00 46.59  ? 268 TYR A OH    1 
ATOM   2490 N  N     . CYS C 3 269 ? -12.954 35.983 36.710 1.00 22.29  ? 269 CYS A N     1 
ATOM   2491 C  CA    . CYS C 3 269 ? -13.350 34.995 37.738 1.00 21.93  ? 269 CYS A CA    1 
ATOM   2492 C  C     . CYS C 3 269 ? -12.026 34.416 38.246 1.00 20.30  ? 269 CYS A C     1 
ATOM   2493 O  O     . CYS C 3 269 ? -11.269 33.832 37.497 1.00 20.81  ? 269 CYS A O     1 
ATOM   2494 C  CB    . CYS C 3 269 ? -14.199 33.860 37.135 1.00 20.54  ? 269 CYS A CB    1 
ATOM   2495 S  SG    . CYS C 3 269 ? -14.442 32.497 38.354 1.00 23.31  ? 269 CYS A SG    1 
ATOM   2496 N  N     . PRO C 3 270 ? -11.721 34.601 39.539 1.00 23.47  ? 270 PRO A N     1 
ATOM   2497 C  CA    . PRO C 3 270 ? -10.476 34.078 40.089 1.00 23.46  ? 270 PRO A CA    1 
ATOM   2498 C  C     . PRO C 3 270 ? -10.351 32.576 40.106 1.00 23.30  ? 270 PRO A C     1 
ATOM   2499 O  O     . PRO C 3 270 ? -9.248  32.034 40.096 1.00 25.34  ? 270 PRO A O     1 
ATOM   2500 C  CB    . PRO C 3 270 ? -10.418 34.669 41.499 1.00 24.90  ? 270 PRO A CB    1 
ATOM   2501 C  CG    . PRO C 3 270 ? -11.798 34.995 41.818 1.00 26.66  ? 270 PRO A CG    1 
ATOM   2502 C  CD    . PRO C 3 270 ? -12.440 35.430 40.516 1.00 23.17  ? 270 PRO A CD    1 
ATOM   2503 N  N     . ARG C 3 271 ? -11.472 31.894 40.132 1.00 23.64  ? 271 ARG A N     1 
ATOM   2504 C  CA    . ARG C 3 271 ? -11.451 30.423 40.141 1.00 24.28  ? 271 ARG A CA    1 
ATOM   2505 C  C     . ARG C 3 271 ? -11.249 29.840 38.754 1.00 26.96  ? 271 ARG A C     1 
ATOM   2506 O  O     . ARG C 3 271 ? -10.414 28.958 38.550 1.00 30.49  ? 271 ARG A O     1 
ATOM   2507 C  CB    . ARG C 3 271 ? -12.779 29.881 40.697 1.00 21.76  ? 271 ARG A CB    1 
ATOM   2508 C  CG    . ARG C 3 271 ? -12.851 28.367 40.709 1.00 19.15  ? 271 ARG A CG    1 
ATOM   2509 C  CD    . ARG C 3 271 ? -14.192 27.848 41.176 1.00 21.90  ? 271 ARG A CD    1 
ATOM   2510 N  NE    . ARG C 3 271 ? -14.147 26.393 41.133 1.00 22.58  ? 271 ARG A NE    1 
ATOM   2511 C  CZ    . ARG C 3 271 ? -15.010 25.585 41.747 1.00 20.95  ? 271 ARG A CZ    1 
ATOM   2512 N  NH1   . ARG C 3 271 ? -14.822 24.274 41.632 1.00 21.15  ? 271 ARG A NH1   1 
ATOM   2513 N  NH2   . ARG C 3 271 ? -16.032 26.050 42.470 1.00 15.72  ? 271 ARG A NH2   1 
ATOM   2514 N  N     . CYS C 3 272 ? -12.007 30.332 37.783 1.00 26.28  ? 272 CYS A N     1 
ATOM   2515 C  CA    . CYS C 3 272 ? -11.937 29.782 36.427 1.00 26.20  ? 272 CYS A CA    1 
ATOM   2516 C  C     . CYS C 3 272 ? -10.833 30.269 35.480 1.00 27.00  ? 272 CYS A C     1 
ATOM   2517 O  O     . CYS C 3 272 ? -10.546 29.634 34.492 1.00 23.68  ? 272 CYS A O     1 
ATOM   2518 C  CB    . CYS C 3 272 ? -13.286 29.958 35.756 1.00 27.86  ? 272 CYS A CB    1 
ATOM   2519 S  SG    . CYS C 3 272 ? -14.703 29.088 36.667 1.00 36.82  ? 272 CYS A SG    1 
ATOM   2520 N  N     . GLN C 3 273 ? -10.250 31.418 35.746 1.00 25.44  ? 273 GLN A N     1 
ATOM   2521 C  CA    . GLN C 3 273 ? -9.190  31.885 34.894 1.00 25.56  ? 273 GLN A CA    1 
ATOM   2522 C  C     . GLN C 3 273 ? -7.907  31.666 35.670 1.00 28.85  ? 273 GLN A C     1 
ATOM   2523 O  O     . GLN C 3 273 ? -7.860  31.952 36.852 1.00 29.81  ? 273 GLN A O     1 
ATOM   2524 C  CB    . GLN C 3 273 ? -9.392  33.375 34.548 1.00 21.93  ? 273 GLN A CB    1 
ATOM   2525 C  CG    . GLN C 3 273 ? -10.575 33.591 33.627 1.00 18.95  ? 273 GLN A CG    1 
ATOM   2526 C  CD    . GLN C 3 273 ? -10.959 35.019 33.507 1.00 20.32  ? 273 GLN A CD    1 
ATOM   2527 O  OE1   . GLN C 3 273 ? -11.974 35.420 34.010 1.00 22.30  ? 273 GLN A OE1   1 
ATOM   2528 N  NE2   . GLN C 3 273 ? -10.136 35.804 32.827 1.00 21.75  ? 273 GLN A NE2   1 
ATOM   2529 N  N     . ARG C 3 274 ? -6.881  31.196 34.966 1.00 29.37  ? 274 ARG A N     1 
ATOM   2530 C  CA    . ARG C 3 274 ? -5.576  30.865 35.510 1.00 36.57  ? 274 ARG A CA    1 
ATOM   2531 C  C     . ARG C 3 274 ? -4.427  31.645 34.815 1.00 38.34  ? 274 ARG A C     1 
ATOM   2532 O  O     . ARG C 3 274 ? -4.446  31.839 33.582 1.00 37.57  ? 274 ARG A O     1 
ATOM   2533 C  CB    . ARG C 3 274 ? -5.364  29.372 35.290 1.00 40.40  ? 274 ARG A CB    1 
ATOM   2534 C  CG    . ARG C 3 274 ? -5.120  28.579 36.526 1.00 47.40  ? 274 ARG A CG    1 
ATOM   2535 C  CD    . ARG C 3 274 ? -6.261  28.551 37.505 1.00 48.14  ? 274 ARG A CD    1 
ATOM   2536 N  NE    . ARG C 3 274 ? -5.979  27.430 38.402 1.00 52.57  ? 274 ARG A NE    1 
ATOM   2537 C  CZ    . ARG C 3 274 ? -6.691  27.086 39.473 1.00 54.34  ? 274 ARG A CZ    1 
ATOM   2538 N  NH1   . ARG C 3 274 ? -6.290  26.016 40.181 1.00 55.72  ? 274 ARG A NH1   1 
ATOM   2539 N  NH2   . ARG C 3 274 ? -7.771  27.796 39.841 1.00 47.02  ? 274 ARG A NH2   1 
HETATM 2540 ZN ZN    . ZN  D 4 .   ? -16.185 31.159 37.660 1.00 22.31  ? 300 ZN  A ZN    1 
HETATM 2541 C  C1    . GOL E 5 .   ? -17.743 76.911 2.727  1.00 58.43  ? 301 GOL A C1    1 
HETATM 2542 O  O1    . GOL E 5 .   ? -19.090 76.626 3.603  1.00 56.11  ? 301 GOL A O1    1 
HETATM 2543 C  C2    . GOL E 5 .   ? -16.569 76.101 2.709  1.00 55.70  ? 301 GOL A C2    1 
HETATM 2544 O  O2    . GOL E 5 .   ? -16.395 75.493 3.880  1.00 55.38  ? 301 GOL A O2    1 
HETATM 2545 C  C3    . GOL E 5 .   ? -16.022 76.128 1.609  1.00 56.06  ? 301 GOL A C3    1 
HETATM 2546 O  O3    . GOL E 5 .   ? -15.710 76.462 0.105  1.00 47.84  ? 301 GOL A O3    1 
HETATM 2547 O  O     . HOH F 6 .   ? -7.279  65.787 30.395 1.00 43.78  ? 84  HOH B O     1 
HETATM 2548 O  O     . HOH G 6 .   ? -10.147 50.393 15.630 1.00 23.02  ? 16  HOH C O     1 
HETATM 2549 O  O     . HOH G 6 .   ? -12.533 49.462 24.518 1.00 32.34  ? 17  HOH C O     1 
HETATM 2550 O  O     . HOH G 6 .   ? -8.158  48.298 18.723 1.00 35.21  ? 18  HOH C O     1 
HETATM 2551 O  O     . HOH G 6 .   ? -10.444 49.132 21.162 1.00 39.88  ? 19  HOH C O     1 
HETATM 2552 O  O     . HOH G 6 .   ? -3.857  62.098 14.170 1.00 40.89  ? 20  HOH C O     1 
HETATM 2553 O  O     . HOH G 6 .   ? -8.944  51.932 34.983 1.00 34.14  ? 21  HOH C O     1 
HETATM 2554 O  O     . HOH G 6 .   ? -11.028 51.151 36.494 1.00 35.40  ? 22  HOH C O     1 
HETATM 2555 O  O     . HOH G 6 .   ? -14.059 49.251 32.735 1.00 47.60  ? 23  HOH C O     1 
HETATM 2556 O  O     . HOH G 6 .   ? -8.727  56.894 35.417 1.00 42.28  ? 24  HOH C O     1 
HETATM 2557 O  O     . HOH G 6 .   ? -7.032  53.216 36.863 1.00 45.53  ? 25  HOH C O     1 
HETATM 2558 O  O     . HOH G 6 .   ? -6.355  51.115 20.813 1.00 32.69  ? 26  HOH C O     1 
HETATM 2559 O  O     . HOH G 6 .   ? 8.234   57.265 28.919 1.00 51.15  ? 27  HOH C O     1 
HETATM 2560 O  O     . HOH G 6 .   ? -9.556  51.150 26.493 1.00 34.43  ? 28  HOH C O     1 
HETATM 2561 O  O     . HOH G 6 .   ? -8.120  50.770 24.616 1.00 36.38  ? 29  HOH C O     1 
HETATM 2562 O  O     . HOH H 6 .   ? -10.523 59.638 12.537 1.00 16.21  ? 302 HOH A O     1 
HETATM 2563 O  O     . HOH H 6 .   ? -27.790 65.165 -2.190 1.00 13.24  ? 303 HOH A O     1 
HETATM 2564 O  O     . HOH H 6 .   ? -29.112 57.689 -0.204 1.00 18.55  ? 304 HOH A O     1 
HETATM 2565 O  O     . HOH H 6 .   ? -27.848 71.957 6.094  1.00 24.10  ? 305 HOH A O     1 
HETATM 2566 O  O     . HOH H 6 .   ? -6.297  57.111 7.749  1.00 20.59  ? 306 HOH A O     1 
HETATM 2567 O  O     . HOH H 6 .   ? -4.924  63.712 0.731  1.00 28.11  ? 307 HOH A O     1 
HETATM 2568 O  O     . HOH H 6 .   ? -17.178 59.529 22.377 1.00 24.94  ? 308 HOH A O     1 
HETATM 2569 O  O     . HOH H 6 .   ? -7.501  45.642 19.723 1.00 21.28  ? 309 HOH A O     1 
HETATM 2570 O  O     . HOH H 6 .   ? -19.534 50.598 0.610  1.00 22.03  ? 310 HOH A O     1 
HETATM 2571 O  O     . HOH H 6 .   ? -30.849 51.900 6.925  1.00 26.07  ? 311 HOH A O     1 
HETATM 2572 O  O     . HOH H 6 .   ? -11.242 38.290 32.059 1.00 24.31  ? 312 HOH A O     1 
HETATM 2573 O  O     . HOH H 6 .   ? -23.140 61.252 22.466 1.00 28.41  ? 313 HOH A O     1 
HETATM 2574 O  O     . HOH H 6 .   ? -15.958 53.372 18.872 1.00 21.65  ? 314 HOH A O     1 
HETATM 2575 O  O     . HOH H 6 .   ? -13.890 36.359 44.264 1.00 25.62  ? 315 HOH A O     1 
HETATM 2576 O  O     . HOH H 6 .   ? -15.917 60.728 14.290 1.00 24.52  ? 316 HOH A O     1 
HETATM 2577 O  O     . HOH H 6 .   ? -27.551 67.049 -6.073 1.00 30.32  ? 317 HOH A O     1 
HETATM 2578 O  O     . HOH H 6 .   ? -14.180 76.343 4.710  1.00 23.14  ? 318 HOH A O     1 
HETATM 2579 O  O     . HOH H 6 .   ? -10.276 67.006 -2.259 1.00 26.41  ? 319 HOH A O     1 
HETATM 2580 O  O     . HOH H 6 .   ? -24.275 31.709 39.451 1.00 31.14  ? 320 HOH A O     1 
HETATM 2581 O  O     . HOH H 6 .   ? -24.329 72.331 17.570 1.00 26.24  ? 321 HOH A O     1 
HETATM 2582 O  O     . HOH H 6 .   ? -14.819 46.029 19.825 1.00 27.57  ? 322 HOH A O     1 
HETATM 2583 O  O     . HOH H 6 .   ? -15.974 54.243 16.446 1.00 19.58  ? 323 HOH A O     1 
HETATM 2584 O  O     . HOH H 6 .   ? -14.475 71.385 -2.713 1.00 22.32  ? 324 HOH A O     1 
HETATM 2585 O  O     . HOH H 6 .   ? -14.713 74.478 -1.437 1.00 28.50  ? 325 HOH A O     1 
HETATM 2586 O  O     . HOH H 6 .   ? -34.423 65.715 2.183  1.00 25.47  ? 326 HOH A O     1 
HETATM 2587 O  O     . HOH H 6 .   ? -11.137 64.977 19.159 1.00 32.08  ? 327 HOH A O     1 
HETATM 2588 O  O     . HOH H 6 .   ? -13.501 41.504 11.994 1.00 28.31  ? 328 HOH A O     1 
HETATM 2589 O  O     . HOH H 6 .   ? -20.311 71.929 19.826 1.00 32.73  ? 329 HOH A O     1 
HETATM 2590 O  O     . HOH H 6 .   ? -18.644 75.816 10.314 1.00 27.92  ? 330 HOH A O     1 
HETATM 2591 O  O     . HOH H 6 .   ? -16.187 47.278 5.476  1.00 28.59  ? 331 HOH A O     1 
HETATM 2592 O  O     . HOH H 6 .   ? -17.320 50.509 -0.970 1.00 38.35  ? 332 HOH A O     1 
HETATM 2593 O  O     . HOH H 6 .   ? -32.802 62.662 -2.492 1.00 33.99  ? 333 HOH A O     1 
HETATM 2594 O  O     . HOH H 6 .   ? -8.569  60.085 -5.033 1.00 25.00  ? 334 HOH A O     1 
HETATM 2595 O  O     . HOH H 6 .   ? -30.560 58.294 10.911 1.00 26.67  ? 335 HOH A O     1 
HETATM 2596 O  O     . HOH H 6 .   ? -22.303 70.800 -3.730 1.00 26.93  ? 336 HOH A O     1 
HETATM 2597 O  O     . HOH H 6 .   ? -21.407 44.814 39.369 1.00 35.58  ? 337 HOH A O     1 
HETATM 2598 O  O     . HOH H 6 .   ? -11.849 68.762 -3.174 1.00 23.81  ? 338 HOH A O     1 
HETATM 2599 O  O     . HOH H 6 .   ? -21.951 54.290 -5.010 1.00 31.48  ? 339 HOH A O     1 
HETATM 2600 O  O     . HOH H 6 .   ? -28.899 70.414 3.512  1.00 30.82  ? 340 HOH A O     1 
HETATM 2601 O  O     . HOH H 6 .   ? -35.462 68.554 4.556  1.00 34.11  ? 341 HOH A O     1 
HETATM 2602 O  O     . HOH H 6 .   ? -19.570 34.464 34.824 1.00 27.41  ? 342 HOH A O     1 
HETATM 2603 O  O     . HOH H 6 .   ? -30.449 54.001 -0.798 1.00 29.90  ? 343 HOH A O     1 
HETATM 2604 O  O     . HOH H 6 .   ? -6.707  46.497 9.261  1.00 39.76  ? 344 HOH A O     1 
HETATM 2605 O  O     . HOH H 6 .   ? 2.986   33.289 24.581 1.00 32.52  ? 345 HOH A O     1 
HETATM 2606 O  O     . HOH H 6 .   ? -9.903  61.237 20.879 1.00 30.03  ? 346 HOH A O     1 
HETATM 2607 O  O     . HOH H 6 .   ? 4.804   38.973 28.103 1.00 36.62  ? 347 HOH A O     1 
HETATM 2608 O  O     . HOH H 6 .   ? -14.010 30.341 17.101 1.00 34.67  ? 348 HOH A O     1 
HETATM 2609 O  O     . HOH H 6 .   ? -25.800 70.871 19.609 1.00 30.46  ? 349 HOH A O     1 
HETATM 2610 O  O     . HOH H 6 .   ? -19.603 36.686 26.117 1.00 39.73  ? 350 HOH A O     1 
HETATM 2611 O  O     . HOH H 6 .   ? -9.917  35.138 12.598 1.00 36.07  ? 351 HOH A O     1 
HETATM 2612 O  O     . HOH H 6 .   ? -8.955  57.992 16.296 1.00 31.15  ? 352 HOH A O     1 
HETATM 2613 O  O     . HOH H 6 .   ? -11.299 49.765 3.757  1.00 49.23  ? 353 HOH A O     1 
HETATM 2614 O  O     . HOH H 6 .   ? -12.299 57.270 -6.816 1.00 31.72  ? 354 HOH A O     1 
HETATM 2615 O  O     . HOH H 6 .   ? -5.142  39.112 36.510 1.00 40.82  ? 355 HOH A O     1 
HETATM 2616 O  O     . HOH H 6 .   ? -15.532 47.945 25.923 1.00 29.22  ? 356 HOH A O     1 
HETATM 2617 O  O     . HOH H 6 .   ? -4.565  63.778 15.842 1.00 34.58  ? 357 HOH A O     1 
HETATM 2618 O  O     . HOH H 6 .   ? -32.832 61.607 3.593  1.00 38.29  ? 358 HOH A O     1 
HETATM 2619 O  O     . HOH H 6 .   ? -24.299 75.662 -2.738 1.00 33.19  ? 359 HOH A O     1 
HETATM 2620 O  O     . HOH H 6 .   ? -21.610 51.402 -1.829 1.00 33.92  ? 360 HOH A O     1 
HETATM 2621 O  O     . HOH H 6 .   ? -7.724  56.504 -5.665 1.00 30.14  ? 361 HOH A O     1 
HETATM 2622 O  O     . HOH H 6 .   ? -16.888 28.539 43.170 1.00 40.52  ? 362 HOH A O     1 
HETATM 2623 O  O     . HOH H 6 .   ? -7.751  68.200 17.707 1.00 40.51  ? 363 HOH A O     1 
HETATM 2624 O  O     . HOH H 6 .   ? -2.827  63.387 10.383 1.00 37.67  ? 364 HOH A O     1 
HETATM 2625 O  O     . HOH H 6 .   ? -20.581 37.660 22.375 1.00 34.46  ? 365 HOH A O     1 
HETATM 2626 O  O     . HOH H 6 .   ? -24.082 56.051 14.813 1.00 30.36  ? 366 HOH A O     1 
HETATM 2627 O  O     . HOH H 6 .   ? -26.357 62.647 15.410 1.00 27.86  ? 367 HOH A O     1 
HETATM 2628 O  O     . HOH H 6 .   ? -16.675 65.353 -7.048 1.00 33.85  ? 368 HOH A O     1 
HETATM 2629 O  O     . HOH H 6 .   ? -20.818 67.768 24.084 1.00 34.21  ? 369 HOH A O     1 
HETATM 2630 O  O     . HOH H 6 .   ? -9.520  54.654 0.880  1.00 30.07  ? 370 HOH A O     1 
HETATM 2631 O  O     . HOH H 6 .   ? -14.202 52.663 21.165 1.00 30.77  ? 371 HOH A O     1 
HETATM 2632 O  O     . HOH H 6 .   ? -26.360 48.232 4.170  1.00 32.61  ? 372 HOH A O     1 
HETATM 2633 O  O     . HOH H 6 .   ? -19.907 64.696 -6.771 1.00 39.37  ? 373 HOH A O     1 
HETATM 2634 O  O     . HOH H 6 .   ? -14.519 54.668 -3.723 1.00 30.99  ? 374 HOH A O     1 
HETATM 2635 O  O     . HOH H 6 .   ? -3.055  69.902 7.819  1.00 38.88  ? 375 HOH A O     1 
HETATM 2636 O  O     . HOH H 6 .   ? -13.293 50.975 35.422 1.00 41.86  ? 376 HOH A O     1 
HETATM 2637 O  O     . HOH H 6 .   ? -5.703  54.076 1.216  1.00 31.84  ? 377 HOH A O     1 
HETATM 2638 O  O     . HOH H 6 .   ? -2.113  55.443 12.581 1.00 35.12  ? 378 HOH A O     1 
HETATM 2639 O  O     . HOH H 6 .   ? -15.291 25.466 27.344 1.00 45.28  ? 379 HOH A O     1 
HETATM 2640 O  O     . HOH H 6 .   ? -9.112  74.339 12.729 1.00 41.23  ? 380 HOH A O     1 
HETATM 2641 O  O     . HOH H 6 .   ? -1.596  39.474 9.946  1.00 44.23  ? 381 HOH A O     1 
HETATM 2642 O  O     . HOH H 6 .   ? -2.440  47.978 25.102 1.00 31.49  ? 382 HOH A O     1 
HETATM 2643 O  O     . HOH H 6 .   ? -33.278 67.347 13.779 1.00 41.17  ? 383 HOH A O     1 
HETATM 2644 O  O     . HOH H 6 .   ? -10.837 51.272 1.048  1.00 44.22  ? 384 HOH A O     1 
HETATM 2645 O  O     . HOH H 6 .   ? -1.091  24.821 28.222 1.00 34.32  ? 385 HOH A O     1 
HETATM 2646 O  O     . HOH H 6 .   ? -5.369  75.638 5.930  1.00 42.83  ? 386 HOH A O     1 
HETATM 2647 O  O     . HOH H 6 .   ? -28.931 67.004 15.959 1.00 34.95  ? 387 HOH A O     1 
HETATM 2648 O  O     . HOH H 6 .   ? -0.904  41.400 14.552 1.00 43.12  ? 388 HOH A O     1 
HETATM 2649 O  O     . HOH H 6 .   ? -22.008 74.426 -1.983 1.00 31.34  ? 389 HOH A O     1 
HETATM 2650 O  O     . HOH H 6 .   ? -25.429 46.149 16.898 1.00 46.79  ? 390 HOH A O     1 
HETATM 2651 O  O     . HOH H 6 .   ? -9.102  46.444 8.660  1.00 40.91  ? 391 HOH A O     1 
HETATM 2652 O  O     . HOH H 6 .   ? -23.379 56.760 -5.963 1.00 46.31  ? 392 HOH A O     1 
HETATM 2653 O  O     . HOH H 6 .   ? -12.348 66.925 20.343 1.00 35.90  ? 393 HOH A O     1 
HETATM 2654 O  O     . HOH H 6 .   ? -3.851  50.498 20.630 1.00 32.27  ? 394 HOH A O     1 
HETATM 2655 O  O     . HOH H 6 .   ? -25.910 63.337 -5.889 1.00 41.14  ? 395 HOH A O     1 
HETATM 2656 O  O     . HOH H 6 .   ? -13.900 45.245 7.933  1.00 49.16  ? 396 HOH A O     1 
HETATM 2657 O  O     . HOH H 6 .   ? -5.401  28.721 31.159 1.00 43.57  ? 397 HOH A O     1 
HETATM 2658 O  O     . HOH H 6 .   ? -33.483 62.950 1.551  1.00 36.50  ? 398 HOH A O     1 
HETATM 2659 O  O     . HOH H 6 .   ? -22.828 43.577 13.596 1.00 32.91  ? 399 HOH A O     1 
HETATM 2660 O  O     . HOH H 6 .   ? 4.087   63.737 2.505  1.00 51.37  ? 400 HOH A O     1 
HETATM 2661 O  O     . HOH H 6 .   ? -18.337 75.650 7.389  1.00 39.40  ? 401 HOH A O     1 
HETATM 2662 O  O     . HOH H 6 .   ? -12.073 28.125 32.673 1.00 37.34  ? 402 HOH A O     1 
HETATM 2663 O  O     . HOH H 6 .   ? -12.935 61.497 -8.175 1.00 52.34  ? 403 HOH A O     1 
HETATM 2664 O  O     . HOH H 6 .   ? -6.041  62.036 -5.920 1.00 48.35  ? 404 HOH A O     1 
HETATM 2665 O  O     . HOH H 6 .   ? -28.071 72.327 1.443  1.00 36.52  ? 405 HOH A O     1 
HETATM 2666 O  O     . HOH H 6 .   ? -3.007  66.000 10.648 1.00 53.24  ? 406 HOH A O     1 
HETATM 2667 O  O     . HOH H 6 .   ? 1.284   44.862 30.160 1.00 44.53  ? 407 HOH A O     1 
HETATM 2668 O  O     . HOH H 6 .   ? -3.495  53.068 -1.938 1.00 45.83  ? 408 HOH A O     1 
HETATM 2669 O  O     . HOH H 6 .   ? -16.587 72.099 -5.158 1.00 44.80  ? 409 HOH A O     1 
HETATM 2670 O  O     . HOH H 6 .   ? -6.847  32.851 39.795 1.00 36.19  ? 410 HOH A O     1 
HETATM 2671 O  O     . HOH H 6 .   ? -26.205 60.332 -6.802 1.00 41.09  ? 411 HOH A O     1 
HETATM 2672 O  O     . HOH H 6 .   ? -13.605 43.389 42.763 1.00 43.62  ? 412 HOH A O     1 
HETATM 2673 O  O     . HOH H 6 .   ? 4.326   42.752 20.699 1.00 46.30  ? 413 HOH A O     1 
HETATM 2674 O  O     . HOH H 6 .   ? -18.897 51.877 23.088 1.00 46.20  ? 414 HOH A O     1 
HETATM 2675 O  O     . HOH H 6 .   ? -12.261 72.637 19.290 1.00 31.86  ? 415 HOH A O     1 
HETATM 2676 O  O     . HOH H 6 .   ? -4.005  50.410 7.027  1.00 46.90  ? 416 HOH A O     1 
HETATM 2677 O  O     . HOH H 6 .   ? -32.559 59.300 1.853  1.00 42.97  ? 417 HOH A O     1 
HETATM 2678 O  O     . HOH H 6 .   ? -20.598 48.423 1.314  1.00 40.13  ? 418 HOH A O     1 
HETATM 2679 O  O     . HOH H 6 .   ? -24.397 51.064 -1.821 1.00 33.98  ? 419 HOH A O     1 
HETATM 2680 O  O     . HOH H 6 .   ? -26.403 51.337 -0.200 1.00 33.48  ? 420 HOH A O     1 
HETATM 2681 O  O     . HOH H 6 .   ? -29.135 51.885 -1.581 1.00 46.08  ? 421 HOH A O     1 
HETATM 2682 O  O     . HOH H 6 .   ? -35.817 62.156 -0.587 1.00 49.28  ? 422 HOH A O     1 
HETATM 2683 O  O     . HOH H 6 .   ? -29.596 63.383 -3.507 1.00 35.44  ? 423 HOH A O     1 
HETATM 2684 O  O     . HOH H 6 .   ? -34.663 65.452 4.855  1.00 26.72  ? 424 HOH A O     1 
HETATM 2685 O  O     . HOH H 6 .   ? -2.832  48.154 8.166  1.00 44.63  ? 425 HOH A O     1 
HETATM 2686 O  O     . HOH H 6 .   ? -1.637  53.315 12.100 1.00 41.84  ? 426 HOH A O     1 
HETATM 2687 O  O     . HOH H 6 .   ? -12.614 34.285 45.298 1.00 28.56  ? 427 HOH A O     1 
HETATM 2688 O  O     . HOH H 6 .   ? -4.844  38.980 38.953 1.00 39.08  ? 428 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  ADE B . n 
A 1 2   DG  2   2   2   DG  GUA B . n 
A 1 3   DG  3   3   3   DG  GUA B . n 
A 1 4   DT  4   4   4   DT  THY B . n 
A 1 5   DA  5   5   5   DA  ADE B . n 
A 1 6   DG  6   6   6   DG  GUA B . n 
A 1 7   DA  7   7   7   DA  ADE B . n 
A 1 8   DT  8   8   8   DT  THY B . n 
A 1 9   DC  9   9   9   DC  CYT B . n 
A 1 10  DC  10  10  10  DC  CYT B . n 
A 1 11  DG  11  11  11  DG  GUA B . n 
A 1 12  DG  12  12  12  DG  GUA B . n 
A 1 13  DA  13  13  13  DA  ADE B . n 
A 1 14  DC  14  14  14  DC  CYT B . n 
A 1 15  DG  15  15  ?   ?   ?   B . n 
A 1 16  DC  16  16  ?   ?   ?   B . n 
B 2 1   DT  1   0   ?   ?   ?   C . n 
B 2 2   DG  2   1   ?   ?   ?   C . n 
B 2 3   DC  3   2   ?   ?   ?   C . n 
B 2 4   DG  4   3   3   DG  GUA C . n 
B 2 5   DT  5   4   4   DT  THY C . n 
B 2 6   DC  6   5   5   DC  CYT C . n 
B 2 7   DC  7   6   6   DC  CYT C . n 
B 2 8   DG  8   7   7   DG  GUA C . n 
B 2 9   DG  9   8   8   DG  GUA C . n 
B 2 10  DA  10  9   9   DA  ADE C . n 
B 2 11  DT  11  10  10  DT  THY C . n 
B 2 12  DC  12  11  11  DC  CYT C . n 
B 2 13  DT  13  12  12  DT  THY C . n 
B 2 14  DA  14  13  13  DA  ADE C . n 
B 2 15  DC  15  14  14  DC  CYT C . n 
B 2 16  DC  16  15  15  DC  CYT C . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   PRO 2   2   2   PRO PRO A . n 
C 3 3   GLU 3   3   3   GLU GLU A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   PRO 5   5   5   PRO PRO A . n 
C 3 6   GLU 6   6   6   GLU GLU A . n 
C 3 7   VAL 7   7   7   VAL VAL A . n 
C 3 8   GLU 8   8   8   GLU GLU A . n 
C 3 9   THR 9   9   9   THR THR A . n 
C 3 10  ILE 10  10  10  ILE ILE A . n 
C 3 11  ARG 11  11  11  ARG ARG A . n 
C 3 12  ARG 12  12  12  ARG ARG A . n 
C 3 13  THR 13  13  13  THR THR A . n 
C 3 14  LEU 14  14  14  LEU LEU A . n 
C 3 15  LEU 15  15  15  LEU LEU A . n 
C 3 16  PRO 16  16  16  PRO PRO A . n 
C 3 17  LEU 17  17  17  LEU LEU A . n 
C 3 18  ILE 18  18  18  ILE ILE A . n 
C 3 19  VAL 19  19  19  VAL VAL A . n 
C 3 20  GLY 20  20  20  GLY GLY A . n 
C 3 21  LYS 21  21  21  LYS LYS A . n 
C 3 22  THR 22  22  22  THR THR A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  GLU 24  24  24  GLU GLU A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  VAL 26  26  26  VAL VAL A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  ILE 28  28  28  ILE ILE A . n 
C 3 29  PHE 29  29  29  PHE PHE A . n 
C 3 30  TRP 30  30  30  TRP TRP A . n 
C 3 31  PRO 31  31  31  PRO PRO A . n 
C 3 32  ASN 32  32  32  ASN ASN A . n 
C 3 33  ILE 33  33  33  ILE ILE A . n 
C 3 34  ILE 34  34  34  ILE ILE A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  HIS 36  36  36  HIS HIS A . n 
C 3 37  PRO 37  37  37  PRO PRO A . n 
C 3 38  ARG 38  38  38  ARG ALA A . n 
C 3 39  ASP 39  39  39  ASP ASP A . n 
C 3 40  SER 40  40  40  SER SER A . n 
C 3 41  GLU 41  41  41  GLU GLU A . n 
C 3 42  ALA 42  42  42  ALA ALA A . n 
C 3 43  PHE 43  43  43  PHE PHE A . n 
C 3 44  ALA 44  44  44  ALA ALA A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  ARG 46  46  46  ARG ARG A . n 
C 3 47  MET 47  47  47  MET MET A . n 
C 3 48  ILE 48  48  48  ILE ILE A . n 
C 3 49  GLY 49  49  49  GLY GLY A . n 
C 3 50  GLN 50  50  50  GLN GLN A . n 
C 3 51  THR 51  51  51  THR THR A . n 
C 3 52  VAL 52  52  52  VAL VAL A . n 
C 3 53  ARG 53  53  53  ARG ARG A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  GLU 56  56  56  GLU GLU A . n 
C 3 57  ARG 57  57  57  ARG ARG A . n 
C 3 58  ARG 58  58  58  ARG ARG A . n 
C 3 59  GLY 59  59  59  GLY GLY A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  PHE 61  61  61  PHE PHE A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  PHE 64  64  64  PHE PHE A . n 
C 3 65  LEU 65  65  65  LEU LEU A . n 
C 3 66  LEU 66  66  66  LEU LEU A . n 
C 3 67  ASP 67  67  67  ASP ASP A . n 
C 3 68  ARG 68  68  68  ARG ARG A . n 
C 3 69  ASP 69  69  69  ASP ASP A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  ILE 72  72  72  ILE ILE A . n 
C 3 73  SER 73  73  73  SER SER A . n 
C 3 74  HIS 74  74  74  HIS HIS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  ARG 76  76  76  ARG ARG A . n 
C 3 77  MET 77  77  77  MET MET A . n 
C 3 78  GLU 78  78  78  GLU GLU A . n 
C 3 79  GLY 79  79  79  GLY GLY A . n 
C 3 80  ARG 80  80  80  ARG ALA A . n 
C 3 81  TYR 81  81  81  TYR TYR A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  VAL 83  83  83  VAL VAL A . n 
C 3 84  ALA 84  84  84  ALA ALA A . n 
C 3 85  SER 85  85  85  SER SER A . n 
C 3 86  ALA 86  86  86  ALA ALA A . n 
C 3 87  LEU 87  87  87  LEU LEU A . n 
C 3 88  GLU 88  88  88  GLU GLU A . n 
C 3 89  PRO 89  89  89  PRO PRO A . n 
C 3 90  LEU 90  90  90  LEU LEU A . n 
C 3 91  GLU 91  91  91  GLU GLU A . n 
C 3 92  PRO 92  92  92  PRO PRO A . n 
C 3 93  HIS 93  93  93  HIS HIS A . n 
C 3 94  THR 94  94  94  THR THR A . n 
C 3 95  HIS 95  95  95  HIS HIS A . n 
C 3 96  VAL 96  96  96  VAL VAL A . n 
C 3 97  VAL 97  97  97  VAL VAL A . n 
C 3 98  PHE 98  98  98  PHE PHE A . n 
C 3 99  CYS 99  99  99  CYS CYS A . n 
C 3 100 PHE 100 100 100 PHE PHE A . n 
C 3 101 THR 101 101 101 THR THR A . n 
C 3 102 ASP 102 102 102 ASP ASP A . n 
C 3 103 GLY 103 103 103 GLY GLY A . n 
C 3 104 SER 104 104 104 SER SER A . n 
C 3 105 GLU 105 105 105 GLU GLU A . n 
C 3 106 LEU 106 106 106 LEU LEU A . n 
C 3 107 ARG 107 107 107 ARG ARG A . n 
C 3 108 TYR 108 108 108 TYR TYR A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 ASP 110 110 110 ASP ASP A . n 
C 3 111 VAL 111 111 111 VAL VAL A . n 
C 3 112 ARG 112 112 112 ARG ARG A . n 
C 3 113 LYS 113 113 113 LYS LYS A . n 
C 3 114 PHE 114 114 114 PHE PHE A . n 
C 3 115 GLY 115 115 115 GLY GLY A . n 
C 3 116 THR 116 116 116 THR THR A . n 
C 3 117 MET 117 117 117 MET MET A . n 
C 3 118 HIS 118 118 118 HIS HIS A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 TYR 120 120 120 TYR TYR A . n 
C 3 121 ALA 121 121 121 ALA ALA A . n 
C 3 122 LYS 122 122 122 LYS LYS A . n 
C 3 123 GLU 123 123 123 GLU GLU A . n 
C 3 124 GLU 124 124 124 GLU GLU A . n 
C 3 125 ALA 125 125 125 ALA ALA A . n 
C 3 126 ASP 126 126 126 ASP ASP A . n 
C 3 127 ARG 127 127 127 ARG ARG A . n 
C 3 128 ARG 128 128 128 ARG ARG A . n 
C 3 129 PRO 129 129 129 PRO PRO A . n 
C 3 130 PRO 130 130 130 PRO PRO A . n 
C 3 131 LEU 131 131 131 LEU LEU A . n 
C 3 132 ALA 132 132 132 ALA ALA A . n 
C 3 133 GLU 133 133 133 GLU GLU A . n 
C 3 134 LEU 134 134 134 LEU LEU A . n 
C 3 135 GLY 135 135 135 GLY GLY A . n 
C 3 136 PRO 136 136 136 PRO PRO A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 PRO 138 138 138 PRO PRO A . n 
C 3 139 LEU 139 139 139 LEU LEU A . n 
C 3 140 SER 140 140 140 SER SER A . n 
C 3 141 PRO 141 141 141 PRO PRO A . n 
C 3 142 ALA 142 142 142 ALA ALA A . n 
C 3 143 PHE 143 143 143 PHE PHE A . n 
C 3 144 SER 144 144 144 SER SER A . n 
C 3 145 PRO 145 145 145 PRO PRO A . n 
C 3 146 ALA 146 146 146 ALA ALA A . n 
C 3 147 VAL 147 147 147 VAL VAL A . n 
C 3 148 LEU 148 148 148 LEU LEU A . n 
C 3 149 ALA 149 149 149 ALA ALA A . n 
C 3 150 GLU 150 150 150 GLU ALA A . n 
C 3 151 ARG 151 151 151 ARG ARG A . n 
C 3 152 ALA 152 152 152 ALA ALA A . n 
C 3 153 VAL 153 153 153 VAL ALA A . n 
C 3 154 LYS 154 154 154 LYS ALA A . n 
C 3 155 THR 155 155 155 THR THR A . n 
C 3 156 LYS 156 156 156 LYS ALA A . n 
C 3 157 ARG 157 157 157 ARG ARG A . n 
C 3 158 SER 158 158 158 SER SER A . n 
C 3 159 VAL 159 159 159 VAL VAL A . n 
C 3 160 LYS 160 160 160 LYS LYS A . n 
C 3 161 ALA 161 161 161 ALA ALA A . n 
C 3 162 LEU 162 162 162 LEU LEU A . n 
C 3 163 LEU 163 163 163 LEU LEU A . n 
C 3 164 LEU 164 164 164 LEU LEU A . n 
C 3 165 ASP 165 165 165 ASP ASP A . n 
C 3 166 CYS 166 166 166 CYS CYS A . n 
C 3 167 THR 167 167 167 THR THR A . n 
C 3 168 VAL 168 168 168 VAL VAL A . n 
C 3 169 VAL 169 169 169 VAL VAL A . n 
C 3 170 ALA 170 170 170 ALA ALA A . n 
C 3 171 GLY 171 171 171 GLY GLY A . n 
C 3 172 PHE 172 172 172 PHE PHE A . n 
C 3 173 GLY 173 173 173 GLY GLY A . n 
C 3 174 ASN 174 174 174 ASN ASN A . n 
C 3 175 ILE 175 175 175 ILE ILE A . n 
C 3 176 TYR 176 176 176 TYR TYR A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 ASP 178 178 178 ASP ASP A . n 
C 3 179 GLU 179 179 179 GLU GLU A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 LEU 181 181 181 LEU LEU A . n 
C 3 182 PHE 182 182 182 PHE PHE A . n 
C 3 183 ARG 183 183 183 ARG ARG A . n 
C 3 184 ALA 184 184 184 ALA ALA A . n 
C 3 185 GLY 185 185 185 GLY GLY A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 LEU 187 187 187 LEU LEU A . n 
C 3 188 PRO 188 188 188 PRO PRO A . n 
C 3 189 GLY 189 189 189 GLY GLY A . n 
C 3 190 ARG 190 190 190 ARG ARG A . n 
C 3 191 PRO 191 191 191 PRO PRO A . n 
C 3 192 ALA 192 192 192 ALA ALA A . n 
C 3 193 ALA 193 193 193 ALA ALA A . n 
C 3 194 SER 194 194 194 SER SER A . n 
C 3 195 LEU 195 195 195 LEU LEU A . n 
C 3 196 SER 196 196 196 SER SER A . n 
C 3 197 SER 197 197 197 SER SER A . n 
C 3 198 LYS 198 198 198 LYS LYS A . n 
C 3 199 GLU 199 199 199 GLU GLU A . n 
C 3 200 ILE 200 200 200 ILE ILE A . n 
C 3 201 GLU 201 201 201 GLU GLU A . n 
C 3 202 ARG 202 202 202 ARG ARG A . n 
C 3 203 LEU 203 203 203 LEU LEU A . n 
C 3 204 HIS 204 204 204 HIS HIS A . n 
C 3 205 GLU 205 205 205 GLU ALA A . n 
C 3 206 GLU 206 206 206 GLU GLU A . n 
C 3 207 MET 207 207 207 MET MET A . n 
C 3 208 VAL 208 208 208 VAL VAL A . n 
C 3 209 ALA 209 209 209 ALA ALA A . n 
C 3 210 THR 210 210 210 THR THR A . n 
C 3 211 ILE 211 211 211 ILE ILE A . n 
C 3 212 GLY 212 212 212 GLY GLY A . n 
C 3 213 GLU 213 213 213 GLU GLU A . n 
C 3 214 ALA 214 214 214 ALA ALA A . n 
C 3 215 VAL 215 215 215 VAL VAL A . n 
C 3 216 MET 216 216 216 MET MET A . n 
C 3 217 LYS 217 217 ?   ?   ?   A . n 
C 3 218 GLY 218 218 ?   ?   ?   A . n 
C 3 219 GLY 219 219 ?   ?   ?   A . n 
C 3 220 SER 220 220 ?   ?   ?   A . n 
C 3 221 THR 221 221 ?   ?   ?   A . n 
C 3 222 VAL 222 222 ?   ?   ?   A . n 
C 3 223 ARG 223 223 ?   ?   ?   A . n 
C 3 224 THR 224 224 ?   ?   ?   A . n 
C 3 225 TYR 225 225 ?   ?   ?   A . n 
C 3 226 VAL 226 226 ?   ?   ?   A . n 
C 3 227 ASN 227 227 ?   ?   ?   A . n 
C 3 228 THR 228 228 ?   ?   ?   A . n 
C 3 229 GLN 229 229 ?   ?   ?   A . n 
C 3 230 GLY 230 230 ?   ?   ?   A . n 
C 3 231 GLU 231 231 ?   ?   ?   A . n 
C 3 232 ALA 232 232 ?   ?   ?   A . n 
C 3 233 GLY 233 233 ?   ?   ?   A . n 
C 3 234 THR 234 234 ?   ?   ?   A . n 
C 3 235 PHE 235 235 ?   ?   ?   A . n 
C 3 236 GLN 236 236 ?   ?   ?   A . n 
C 3 237 HIS 237 237 ?   ?   ?   A . n 
C 3 238 HIS 238 238 238 HIS HIS A . n 
C 3 239 LEU 239 239 239 LEU LEU A . n 
C 3 240 TYR 240 240 240 TYR TYR A . n 
C 3 241 VAL 241 241 241 VAL VAL A . n 
C 3 242 TYR 242 242 242 TYR TYR A . n 
C 3 243 GLY 243 243 243 GLY GLY A . n 
C 3 244 ARG 244 244 244 ARG ARG A . n 
C 3 245 GLN 245 245 245 GLN GLN A . n 
C 3 246 GLY 246 246 246 GLY GLY A . n 
C 3 247 ASN 247 247 247 ASN ASN A . n 
C 3 248 PRO 248 248 248 PRO PRO A . n 
C 3 249 CYS 249 249 249 CYS CYS A . n 
C 3 250 LYS 250 250 250 LYS LYS A . n 
C 3 251 ARG 251 251 251 ARG ARG A . n 
C 3 252 CYS 252 252 252 CYS CYS A . n 
C 3 253 GLY 253 253 253 GLY GLY A . n 
C 3 254 THR 254 254 254 THR THR A . n 
C 3 255 PRO 255 255 255 PRO PRO A . n 
C 3 256 ILE 256 256 256 ILE ILE A . n 
C 3 257 GLU 257 257 257 GLU GLU A . n 
C 3 258 LYS 258 258 258 LYS LYS A . n 
C 3 259 THR 259 259 259 THR THR A . n 
C 3 260 VAL 260 260 260 VAL VAL A . n 
C 3 261 VAL 261 261 261 VAL VAL A . n 
C 3 262 ALA 262 262 262 ALA ALA A . n 
C 3 263 GLY 263 263 263 GLY GLY A . n 
C 3 264 ARG 264 264 264 ARG ARG A . n 
C 3 265 GLY 265 265 265 GLY GLY A . n 
C 3 266 THR 266 266 266 THR THR A . n 
C 3 267 HIS 267 267 267 HIS HIS A . n 
C 3 268 TYR 268 268 268 TYR TYR A . n 
C 3 269 CYS 269 269 269 CYS CYS A . n 
C 3 270 PRO 270 270 270 PRO PRO A . n 
C 3 271 ARG 271 271 271 ARG ARG A . n 
C 3 272 CYS 272 272 272 CYS CYS A . n 
C 3 273 GLN 273 273 273 GLN GLN A . n 
C 3 274 ARG 274 274 274 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   300 300 ZN  ZN  A . 
E 5 GOL 1   301 1   GOL GOL A . 
F 6 HOH 1   84  84  HOH HOH B . 
G 6 HOH 1   16  7   HOH HOH C . 
G 6 HOH 2   17  36  HOH HOH C . 
G 6 HOH 3   18  40  HOH HOH C . 
G 6 HOH 4   19  72  HOH HOH C . 
G 6 HOH 5   20  75  HOH HOH C . 
G 6 HOH 6   21  93  HOH HOH C . 
G 6 HOH 7   22  94  HOH HOH C . 
G 6 HOH 8   23  103 HOH HOH C . 
G 6 HOH 9   24  113 HOH HOH C . 
G 6 HOH 10  25  116 HOH HOH C . 
G 6 HOH 11  26  118 HOH HOH C . 
G 6 HOH 12  27  122 HOH HOH C . 
G 6 HOH 13  28  129 HOH HOH C . 
G 6 HOH 14  29  131 HOH HOH C . 
H 6 HOH 1   302 1   HOH HOH A . 
H 6 HOH 2   303 2   HOH HOH A . 
H 6 HOH 3   304 3   HOH HOH A . 
H 6 HOH 4   305 4   HOH HOH A . 
H 6 HOH 5   306 5   HOH HOH A . 
H 6 HOH 6   307 6   HOH HOH A . 
H 6 HOH 7   308 8   HOH HOH A . 
H 6 HOH 8   309 9   HOH HOH A . 
H 6 HOH 9   310 10  HOH HOH A . 
H 6 HOH 10  311 11  HOH HOH A . 
H 6 HOH 11  312 12  HOH HOH A . 
H 6 HOH 12  313 13  HOH HOH A . 
H 6 HOH 13  314 14  HOH HOH A . 
H 6 HOH 14  315 15  HOH HOH A . 
H 6 HOH 15  316 16  HOH HOH A . 
H 6 HOH 16  317 17  HOH HOH A . 
H 6 HOH 17  318 18  HOH HOH A . 
H 6 HOH 18  319 19  HOH HOH A . 
H 6 HOH 19  320 20  HOH HOH A . 
H 6 HOH 20  321 21  HOH HOH A . 
H 6 HOH 21  322 22  HOH HOH A . 
H 6 HOH 22  323 23  HOH HOH A . 
H 6 HOH 23  324 24  HOH HOH A . 
H 6 HOH 24  325 25  HOH HOH A . 
H 6 HOH 25  326 26  HOH HOH A . 
H 6 HOH 26  327 27  HOH HOH A . 
H 6 HOH 27  328 28  HOH HOH A . 
H 6 HOH 28  329 29  HOH HOH A . 
H 6 HOH 29  330 30  HOH HOH A . 
H 6 HOH 30  331 31  HOH HOH A . 
H 6 HOH 31  332 32  HOH HOH A . 
H 6 HOH 32  333 33  HOH HOH A . 
H 6 HOH 33  334 34  HOH HOH A . 
H 6 HOH 34  335 35  HOH HOH A . 
H 6 HOH 35  336 37  HOH HOH A . 
H 6 HOH 36  337 38  HOH HOH A . 
H 6 HOH 37  338 39  HOH HOH A . 
H 6 HOH 38  339 41  HOH HOH A . 
H 6 HOH 39  340 42  HOH HOH A . 
H 6 HOH 40  341 43  HOH HOH A . 
H 6 HOH 41  342 44  HOH HOH A . 
H 6 HOH 42  343 45  HOH HOH A . 
H 6 HOH 43  344 46  HOH HOH A . 
H 6 HOH 44  345 47  HOH HOH A . 
H 6 HOH 45  346 48  HOH HOH A . 
H 6 HOH 46  347 49  HOH HOH A . 
H 6 HOH 47  348 50  HOH HOH A . 
H 6 HOH 48  349 51  HOH HOH A . 
H 6 HOH 49  350 52  HOH HOH A . 
H 6 HOH 50  351 53  HOH HOH A . 
H 6 HOH 51  352 54  HOH HOH A . 
H 6 HOH 52  353 55  HOH HOH A . 
H 6 HOH 53  354 56  HOH HOH A . 
H 6 HOH 54  355 57  HOH HOH A . 
H 6 HOH 55  356 58  HOH HOH A . 
H 6 HOH 56  357 59  HOH HOH A . 
H 6 HOH 57  358 60  HOH HOH A . 
H 6 HOH 58  359 61  HOH HOH A . 
H 6 HOH 59  360 62  HOH HOH A . 
H 6 HOH 60  361 63  HOH HOH A . 
H 6 HOH 61  362 64  HOH HOH A . 
H 6 HOH 62  363 65  HOH HOH A . 
H 6 HOH 63  364 66  HOH HOH A . 
H 6 HOH 64  365 67  HOH HOH A . 
H 6 HOH 65  366 68  HOH HOH A . 
H 6 HOH 66  367 69  HOH HOH A . 
H 6 HOH 67  368 70  HOH HOH A . 
H 6 HOH 68  369 71  HOH HOH A . 
H 6 HOH 69  370 73  HOH HOH A . 
H 6 HOH 70  371 74  HOH HOH A . 
H 6 HOH 71  372 76  HOH HOH A . 
H 6 HOH 72  373 77  HOH HOH A . 
H 6 HOH 73  374 78  HOH HOH A . 
H 6 HOH 74  375 79  HOH HOH A . 
H 6 HOH 75  376 80  HOH HOH A . 
H 6 HOH 76  377 81  HOH HOH A . 
H 6 HOH 77  378 82  HOH HOH A . 
H 6 HOH 78  379 83  HOH HOH A . 
H 6 HOH 79  380 85  HOH HOH A . 
H 6 HOH 80  381 86  HOH HOH A . 
H 6 HOH 81  382 87  HOH HOH A . 
H 6 HOH 82  383 88  HOH HOH A . 
H 6 HOH 83  384 89  HOH HOH A . 
H 6 HOH 84  385 90  HOH HOH A . 
H 6 HOH 85  386 91  HOH HOH A . 
H 6 HOH 86  387 92  HOH HOH A . 
H 6 HOH 87  388 95  HOH HOH A . 
H 6 HOH 88  389 96  HOH HOH A . 
H 6 HOH 89  390 97  HOH HOH A . 
H 6 HOH 90  391 98  HOH HOH A . 
H 6 HOH 91  392 99  HOH HOH A . 
H 6 HOH 92  393 100 HOH HOH A . 
H 6 HOH 93  394 101 HOH HOH A . 
H 6 HOH 94  395 102 HOH HOH A . 
H 6 HOH 95  396 104 HOH HOH A . 
H 6 HOH 96  397 105 HOH HOH A . 
H 6 HOH 97  398 106 HOH HOH A . 
H 6 HOH 98  399 107 HOH HOH A . 
H 6 HOH 99  400 108 HOH HOH A . 
H 6 HOH 100 401 109 HOH HOH A . 
H 6 HOH 101 402 110 HOH HOH A . 
H 6 HOH 102 403 111 HOH HOH A . 
H 6 HOH 103 404 112 HOH HOH A . 
H 6 HOH 104 405 114 HOH HOH A . 
H 6 HOH 105 406 115 HOH HOH A . 
H 6 HOH 106 407 117 HOH HOH A . 
H 6 HOH 107 408 119 HOH HOH A . 
H 6 HOH 108 409 120 HOH HOH A . 
H 6 HOH 109 410 121 HOH HOH A . 
H 6 HOH 110 411 123 HOH HOH A . 
H 6 HOH 111 412 124 HOH HOH A . 
H 6 HOH 112 413 125 HOH HOH A . 
H 6 HOH 113 414 126 HOH HOH A . 
H 6 HOH 114 415 127 HOH HOH A . 
H 6 HOH 115 416 128 HOH HOH A . 
H 6 HOH 116 417 130 HOH HOH A . 
H 6 HOH 117 418 132 HOH HOH A . 
H 6 HOH 118 419 133 HOH HOH A . 
H 6 HOH 119 420 134 HOH HOH A . 
H 6 HOH 120 421 135 HOH HOH A . 
H 6 HOH 121 422 136 HOH HOH A . 
H 6 HOH 122 423 137 HOH HOH A . 
H 6 HOH 123 424 138 HOH HOH A . 
H 6 HOH 124 425 139 HOH HOH A . 
H 6 HOH 125 426 140 HOH HOH A . 
H 6 HOH 126 427 141 HOH HOH A . 
H 6 HOH 127 428 142 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 272 ? A CYS 272 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 130.1 ? 
2 SG ? C CYS 272 ? A CYS 272 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 252 ? A CYS 252 ? 1_555 94.3  ? 
3 SG ? C CYS 249 ? A CYS 249 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 252 ? A CYS 252 ? 1_555 111.7 ? 
4 SG ? C CYS 272 ? A CYS 272 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 269 ? A CYS 269 ? 1_555 98.0  ? 
5 SG ? C CYS 249 ? A CYS 249 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 269 ? A CYS 269 ? 1_555 116.0 ? 
6 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 269 ? A CYS 269 ? 1_555 101.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-07 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
_software.name             CNS 
_software.classification   refinement 
_software.version          1.1 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    133 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    426 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.00 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             91 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             91 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.609 
_pdbx_validate_rmsd_bond.bond_target_value         1.515 
_pdbx_validate_rmsd_bond.bond_deviation            0.094 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.015 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 123.62 120.30 3.32  0.50 N 
2 1 CA A LEU 62 ? ? CB A LEU 62 ? ? CG  A LEU 62 ? ? 129.25 115.30 13.95 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 66  ? ? -110.67 -152.42 
2 1 ARG A 76  ? ? 50.94   -140.80 
3 1 ASP A 110 ? ? -165.00 103.44  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DG 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     8 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.050 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DG  3   ? P   ? B DG  4   P   
2  1 Y 1 C DG  3   ? OP1 ? B DG  4   OP1 
3  1 Y 1 C DG  3   ? OP2 ? B DG  4   OP2 
4  1 Y 1 A ARG 38  ? CG  ? C ARG 38  CG  
5  1 Y 1 A ARG 38  ? CD  ? C ARG 38  CD  
6  1 Y 1 A ARG 38  ? NE  ? C ARG 38  NE  
7  1 Y 1 A ARG 38  ? CZ  ? C ARG 38  CZ  
8  1 Y 1 A ARG 38  ? NH1 ? C ARG 38  NH1 
9  1 Y 1 A ARG 38  ? NH2 ? C ARG 38  NH2 
10 1 Y 1 A ARG 80  ? CG  ? C ARG 80  CG  
11 1 Y 1 A ARG 80  ? CD  ? C ARG 80  CD  
12 1 Y 1 A ARG 80  ? NE  ? C ARG 80  NE  
13 1 Y 1 A ARG 80  ? CZ  ? C ARG 80  CZ  
14 1 Y 1 A ARG 80  ? NH1 ? C ARG 80  NH1 
15 1 Y 1 A ARG 80  ? NH2 ? C ARG 80  NH2 
16 1 Y 1 A GLU 150 ? CG  ? C GLU 150 CG  
17 1 Y 1 A GLU 150 ? CD  ? C GLU 150 CD  
18 1 Y 1 A GLU 150 ? OE1 ? C GLU 150 OE1 
19 1 Y 1 A GLU 150 ? OE2 ? C GLU 150 OE2 
20 1 Y 1 A VAL 153 ? CG1 ? C VAL 153 CG1 
21 1 Y 1 A VAL 153 ? CG2 ? C VAL 153 CG2 
22 1 Y 1 A LYS 154 ? CG  ? C LYS 154 CG  
23 1 Y 1 A LYS 154 ? CD  ? C LYS 154 CD  
24 1 Y 1 A LYS 154 ? CE  ? C LYS 154 CE  
25 1 Y 1 A LYS 154 ? NZ  ? C LYS 154 NZ  
26 1 Y 1 A LYS 156 ? CG  ? C LYS 156 CG  
27 1 Y 1 A LYS 156 ? CD  ? C LYS 156 CD  
28 1 Y 1 A LYS 156 ? CE  ? C LYS 156 CE  
29 1 Y 1 A LYS 156 ? NZ  ? C LYS 156 NZ  
30 1 Y 1 A GLU 205 ? CG  ? C GLU 205 CG  
31 1 Y 1 A GLU 205 ? CD  ? C GLU 205 CD  
32 1 Y 1 A GLU 205 ? OE1 ? C GLU 205 OE1 
33 1 Y 1 A GLU 205 ? OE2 ? C GLU 205 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B DG  15  ? A DG  15  
2  1 Y 1 B DC  16  ? A DC  16  
3  1 Y 1 C DT  0   ? B DT  1   
4  1 Y 1 C DG  1   ? B DG  2   
5  1 Y 1 C DC  2   ? B DC  3   
6  1 Y 1 A MET 1   ? C MET 1   
7  1 Y 1 A LYS 217 ? C LYS 217 
8  1 Y 1 A GLY 218 ? C GLY 218 
9  1 Y 1 A GLY 219 ? C GLY 219 
10 1 Y 1 A SER 220 ? C SER 220 
11 1 Y 1 A THR 221 ? C THR 221 
12 1 Y 1 A VAL 222 ? C VAL 222 
13 1 Y 1 A ARG 223 ? C ARG 223 
14 1 Y 1 A THR 224 ? C THR 224 
15 1 Y 1 A TYR 225 ? C TYR 225 
16 1 Y 1 A VAL 226 ? C VAL 226 
17 1 Y 1 A ASN 227 ? C ASN 227 
18 1 Y 1 A THR 228 ? C THR 228 
19 1 Y 1 A GLN 229 ? C GLN 229 
20 1 Y 1 A GLY 230 ? C GLY 230 
21 1 Y 1 A GLU 231 ? C GLU 231 
22 1 Y 1 A ALA 232 ? C ALA 232 
23 1 Y 1 A GLY 233 ? C GLY 233 
24 1 Y 1 A THR 234 ? C THR 234 
25 1 Y 1 A PHE 235 ? C PHE 235 
26 1 Y 1 A GLN 236 ? C GLN 236 
27 1 Y 1 A HIS 237 ? C HIS 237 
# 
_ndb_struct_conf_na.entry_id   2F5O 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 16 1_555 -1.180 -0.715 -0.037 -1.996  8.647   0.819   1  B_DG2:DC15_C B 2  ? C 15 ? 19 1 
1 A DG 3  1_555 B DC 15 1_555 -0.086 0.344  0.442  0.125   -10.113 3.982   2  B_DG3:DC14_C B 3  ? C 14 ? ?  1 
1 A DT 4  1_555 B DA 14 1_555 -0.119 0.090  0.091  2.205   -7.925  5.777   3  B_DT4:DA13_C B 4  ? C 13 ? 20 1 
1 A DA 5  1_555 B DT 13 1_555 0.530  -0.107 -0.008 10.987  -12.549 -4.663  4  B_DA5:DT12_C B 5  ? C 12 ? 20 1 
1 A DG 6  1_555 B DC 12 1_555 0.092  0.103  -0.368 -2.569  -15.936 3.431   5  B_DG6:DC11_C B 6  ? C 11 ? 19 1 
1 A DA 7  1_555 B DT 11 1_555 -0.127 0.083  -0.185 -3.725  -19.132 2.878   6  B_DA7:DT10_C B 7  ? C 10 ? 20 1 
1 A DT 8  1_555 B DA 10 1_555 -0.176 -0.149 -0.429 2.255   -6.020  0.755   7  B_DT8:DA9_C  B 8  ? C 9  ? 20 1 
1 A DC 9  1_555 B DG 9  1_555 0.110  -0.155 -0.426 14.659  -6.538  -2.331  8  B_DC9:DG8_C  B 9  ? C 8  ? 19 1 
1 A DC 10 1_555 B DG 8  1_555 0.533  -0.142 0.241  -36.154 8.078   -1.035  9  B_DC10:DG7_C B 10 ? C 7  ? 19 1 
1 A DG 11 1_555 B DC 7  1_555 0.084  0.014  -0.197 -3.914  4.280   -1.864  10 B_DG11:DC6_C B 11 ? C 6  ? 19 1 
1 A DG 12 1_555 B DC 6  1_555 -0.122 -0.072 0.208  6.215   -7.500  -2.489  11 B_DG12:DC5_C B 12 ? C 5  ? 19 1 
1 A DA 13 1_555 B DT 5  1_555 0.092  -0.447 0.261  9.268   -7.861  1.969   12 B_DA13:DT4_C B 13 ? C 4  ? 20 1 
1 A DC 14 1_555 B DG 4  1_555 0.413  0.043  -0.507 14.020  -15.553 -12.358 13 B_DC14:DG3_C B 14 ? C 3  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 16 1_555 A DG 3  1_555 B DC 15 1_555 -0.830 0.592  3.371 -6.363 4.936  39.618 0.268  0.442  3.504 7.192  
9.272   40.396 1  BB_DG2DG3:DC14DC15_CC B 2  ? C 15 ? B 3  ? C 14 ? 
1 A DG 3  1_555 B DC 15 1_555 A DT 4  1_555 B DA 14 1_555 0.342  -0.151 3.221 2.249  4.106  33.996 -0.890 -0.233 3.197 6.981  
-3.823  34.307 2  BB_DG3DT4:DA13DC14_CC B 3  ? C 14 ? B 4  ? C 13 ? 
1 A DT 4  1_555 B DA 14 1_555 A DA 5  1_555 B DT 13 1_555 -1.133 0.588  3.081 -4.218 -2.355 39.879 1.111  1.191  3.141 -3.437 
6.157   40.158 3  BB_DT4DA5:DT12DA13_CC B 4  ? C 13 ? B 5  ? C 12 ? 
1 A DA 5  1_555 B DT 13 1_555 A DG 6  1_555 B DC 12 1_555 0.172  -0.171 3.642 0.464  5.730  35.942 -1.160 -0.205 3.575 9.213  
-0.747  36.384 4  BB_DA5DG6:DC11DT12_CC B 5  ? C 12 ? B 6  ? C 11 ? 
1 A DG 6  1_555 B DC 12 1_555 A DA 7  1_555 B DT 11 1_555 -0.120 0.018  3.208 -2.759 1.940  34.097 -0.270 -0.222 3.204 3.298  
4.691   34.258 5  BB_DG6DA7:DT10DC11_CC B 6  ? C 11 ? B 7  ? C 10 ? 
1 A DA 7  1_555 B DT 11 1_555 A DT 8  1_555 B DA 10 1_555 0.169  -0.341 3.139 3.837  3.635  30.267 -1.327 0.402  3.076 6.896  
-7.278  30.715 6  BB_DA7DT8:DA9DT10_CC  B 7  ? C 10 ? B 8  ? C 9  ? 
1 A DT 8  1_555 B DA 10 1_555 A DC 9  1_555 B DG 9  1_555 -0.248 1.346  3.135 4.205  8.124  24.564 0.729  1.707  3.315 18.303 
-9.474  26.188 7  BB_DT8DC9:DG8DA9_CC   B 8  ? C 9  ? B 9  ? C 8  ? 
1 A DC 9  1_555 B DG 9  1_555 A DC 10 1_555 B DG 8  1_555 1.783  2.552  5.703 -3.162 50.273 29.158 -3.592 -2.239 5.052 61.719 
3.881   57.722 8  BB_DC9DC10:DG7DG8_CC  B 9  ? C 8  ? B 10 ? C 7  ? 
1 A DC 10 1_555 B DG 8  1_555 A DG 11 1_555 B DC 7  1_555 -0.120 1.541  2.688 -0.661 10.553 16.687 -0.357 0.045  3.099 32.461 
2.033   19.735 9  BB_DC10DG11:DC6DG7_CC B 10 ? C 7  ? B 11 ? C 6  ? 
1 A DG 11 1_555 B DC 7  1_555 A DG 12 1_555 B DC 6  1_555 -1.048 0.682  3.068 -6.567 6.694  33.316 0.125  0.760  3.281 11.397 
11.181  34.575 10 BB_DG11DG12:DC5DC6_CC B 11 ? C 6  ? B 12 ? C 5  ? 
1 A DG 12 1_555 B DC 6  1_555 A DA 13 1_555 B DT 5  1_555 0.012  -0.076 3.178 -1.023 0.365  37.464 -0.165 -0.149 3.176 0.569  
1.593   37.479 11 BB_DG12DA13:DT4DC5_CC B 12 ? C 5  ? B 13 ? C 4  ? 
1 A DA 13 1_555 B DT 5  1_555 A DC 14 1_555 B DG 4  1_555 -0.057 -0.031 3.366 9.254  -3.551 35.607 0.444  1.376  3.239 -5.672 
-14.782 36.918 12 BB_DA13DC14:DG3DT4_CC B 13 ? C 4  ? B 14 ? C 3  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 GLYCEROL   GOL 
6 water      HOH 
#