data_2F5Y
# 
_entry.id   2F5Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2F5Y         
RCSB  RCSB035491   
WWPDB D_1000035491 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1I92 'Structural Basis of the Nherf Pdz1-Cftr Interaction'                                         unspecified 
PDB 1QAU 'Unexpected Modes of Pdz Domain Scaffolding Revealed by Structure of Nnos-Syntrophin Complex' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2F5Y 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ugochukwu, E.'                        1  
'Berridge, G.'                         2  
'Johansson, C.'                        3  
'Smee, C.'                             4  
'Savitsky, P.'                         5  
'Burgess, N.'                          6  
'Colebrook, S.'                        7  
'Yang, X.'                             8  
'Elkins, J.'                           9  
'Doyle, D.'                            10 
'Turnbull, A.'                         11 
'Papagrigoriou, E.'                    12 
'Debreczeni, J.'                       13 
'Bunkoczi, G.'                         14 
'Gorrec, F.'                           15 
'von Delft, F.'                        16 
'Arrowsmith, C.'                       17 
'Sundstrom, M.'                        18 
'Weigelt, J.'                          19 
'Edwards, A.'                          20 
'Structural Genomics Consortium (SGC)' 21 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of the PDZ Domain from Human RGS-3' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ugochukwu, E.'     1  
primary 'Berridge, G.'      2  
primary 'Johansson, C.'     3  
primary 'Smee, C.'          4  
primary 'Savitsky, P.'      5  
primary 'Burgess, N.'       6  
primary 'Colebrook, S.'     7  
primary 'Yang, X.'          8  
primary 'Elkins, J.'        9  
primary 'Doyle, D.'         10 
primary 'Turnbull, A.'      11 
primary 'Papagrigoriou, E.' 12 
primary 'Debreczeni, J.'    13 
primary 'Bunkoczi, G.'      14 
primary 'Gorrec, F.'        15 
primary 'von Delft, F.'     16 
primary 'Arrowsmith, C.'    17 
primary 'Sundstrom, M.'     18 
primary 'Weigelt, J.'       19 
primary 'Edwards, A.'       20 
# 
_cell.entry_id           2F5Y 
_cell.length_a           91.110 
_cell.length_b           44.140 
_cell.length_c           49.857 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2F5Y 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'regulator of G-protein signalling 3 isoform 1' 10239.818 2  ? ? 'PDZ Domain (residues 15-103)' ? 
2 non-polymer syn 'SULFATE ION'                                   96.063    2  ? ? ?                              ? 
3 water       nat water                                           18.015    42 ? ? ?                              ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVW
RMVPQVKPGPD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVW
RMVPQVKPGPD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  ARG n 
1 4  TYR n 
1 5  ARG n 
1 6  GLN n 
1 7  ILE n 
1 8  THR n 
1 9  ILE n 
1 10 PRO n 
1 11 ARG n 
1 12 GLY n 
1 13 LYS n 
1 14 ASP n 
1 15 GLY n 
1 16 PHE n 
1 17 GLY n 
1 18 PHE n 
1 19 THR n 
1 20 ILE n 
1 21 CYS n 
1 22 CYS n 
1 23 ASP n 
1 24 SER n 
1 25 PRO n 
1 26 VAL n 
1 27 ARG n 
1 28 VAL n 
1 29 GLN n 
1 30 ALA n 
1 31 VAL n 
1 32 ASP n 
1 33 SER n 
1 34 GLY n 
1 35 GLY n 
1 36 PRO n 
1 37 ALA n 
1 38 GLU n 
1 39 ARG n 
1 40 ALA n 
1 41 GLY n 
1 42 LEU n 
1 43 GLN n 
1 44 GLN n 
1 45 LEU n 
1 46 ASP n 
1 47 THR n 
1 48 VAL n 
1 49 LEU n 
1 50 GLN n 
1 51 LEU n 
1 52 ASN n 
1 53 GLU n 
1 54 ARG n 
1 55 PRO n 
1 56 VAL n 
1 57 GLU n 
1 58 HIS n 
1 59 TRP n 
1 60 LYS n 
1 61 CYS n 
1 62 VAL n 
1 63 GLU n 
1 64 LEU n 
1 65 ALA n 
1 66 HIS n 
1 67 GLU n 
1 68 ILE n 
1 69 ARG n 
1 70 SER n 
1 71 CYS n 
1 72 PRO n 
1 73 SER n 
1 74 GLU n 
1 75 ILE n 
1 76 ILE n 
1 77 LEU n 
1 78 LEU n 
1 79 VAL n 
1 80 TRP n 
1 81 ARG n 
1 82 MET n 
1 83 VAL n 
1 84 PRO n 
1 85 GLN n 
1 86 VAL n 
1 87 LYS n 
1 88 PRO n 
1 89 GLY n 
1 90 PRO n 
1 91 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RGS3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'BL21 (DE3)' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS3_HUMAN 
_struct_ref.pdbx_db_accession          P49796 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRM
VPQVKPGPD
;
_struct_ref.pdbx_align_begin           15 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2F5Y A 3 ? 91 ? P49796 15 ? 103 ? 15 103 
2 1 2F5Y B 3 ? 91 ? P49796 15 ? 103 ? 15 103 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2F5Y SER A 1 ? UNP P49796 ? ? 'CLONING ARTIFACT' 13 1 
1 2F5Y MET A 2 ? UNP P49796 ? ? 'CLONING ARTIFACT' 14 2 
2 2F5Y SER B 1 ? UNP P49796 ? ? 'CLONING ARTIFACT' 13 3 
2 2F5Y MET B 2 ? UNP P49796 ? ? 'CLONING ARTIFACT' 14 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2F5Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'1.6M ammonium sulphate, 0.1M MES, 10% dioxane, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-10-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9788 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9788 
# 
_reflns.entry_id                     2F5Y 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             49.86 
_reflns.d_resolution_high            2.39 
_reflns.number_obs                   8381 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2F5Y 
_refine.ls_number_reflns_obs                     7967 
_refine.ls_number_reflns_all                     7967 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.88 
_refine.ls_d_res_high                            2.39 
_refine.ls_percent_reflns_obs                    99.65 
_refine.ls_R_factor_obs                          0.21698 
_refine.ls_R_factor_all                          0.21698 
_refine.ls_R_factor_R_work                       0.21481 
_refine.ls_R_factor_R_free                       0.26429 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  386 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.899 
_refine.B_iso_mean                               40.859 
_refine.aniso_B[1][1]                            -2.18 
_refine.aniso_B[2][2]                            4.63 
_refine.aniso_B[3][3]                            -2.45 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      '1I92.pdb, 1QAU.pdb' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.369 
_refine.pdbx_overall_ESU_R_Free                  0.263 
_refine.overall_SU_ML                            0.177 
_refine.overall_SU_B                             15.045 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1267 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             42 
_refine_hist.number_atoms_total               1319 
_refine_hist.d_res_high                       2.39 
_refine_hist.d_res_low                        49.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 1310 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.003  0.020  ? 921  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.484  1.968  ? 1779 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.524  3.004  ? 2223 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   10.573 5.000  ? 164  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   36.290 21.964 ? 56   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   15.598 15.000 ? 223  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   13.663 15.000 ? 16   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.203  0.200  ? 201  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 1437 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 268  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.200  0.200  ? 223  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.201  0.200  ? 1020 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.166  0.200  ? 612  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.088  0.200  ? 763  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.147  0.200  ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.137  0.200  ? 18   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.272  0.200  ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.093  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_mcbond_it              3.122  3.000  ? 856  'X-RAY DIFFRACTION' ? 
r_mcbond_other           1.058  3.000  ? 331  'X-RAY DIFFRACTION' ? 
r_mcangle_it             4.152  5.000  ? 1327 'X-RAY DIFFRACTION' ? 
r_scbond_it              6.807  7.000  ? 523  'X-RAY DIFFRACTION' ? 
r_scangle_it             8.990  11.000 ? 451  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1042 0.55 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 1042 0.83 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 2 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.394 
_refine_ls_shell.d_res_low                        2.456 
_refine_ls_shell.number_reflns_R_work             559 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.percent_reflns_obs               97.20 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 14 A 95 1 4 A MET 2 ? A VAL 83 ? 1 ? 
2 B 14 B 95 1 4 B MET 2 ? B VAL 83 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2F5Y 
_struct.title                     'Crystal Structure of the PDZ Domain from Human RGS-3' 
_struct.pdbx_descriptor           'regulator of G-protein signalling 3 isoform 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2F5Y 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'PDZ Domain, RGS-3, Human, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 35 ? GLY A 41 ? GLY A 47 GLY A 53 1 ? 7  
HELX_P HELX_P2 2 LYS A 60 ? SER A 70 ? LYS A 72 SER A 82 1 ? 11 
HELX_P HELX_P3 3 GLY B 35 ? GLY B 41 ? GLY B 47 GLY B 53 1 ? 7  
HELX_P HELX_P4 4 LYS B 60 ? SER B 70 ? LYS B 72 SER B 82 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 B CYS 22 SG ? ? A CYS 33 B CYS 34 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 B CYS 21 SG ? ? A CYS 34 B CYS 33 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 B CYS 22 SG ? ? A CYS 34 B CYS 34 1_555 ? ? ? ? ? ? ? 2.726 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 24 A . ? SER 36 A PRO 25 A ? PRO 37 A 1 -0.18 
2 SER 24 B . ? SER 36 B PRO 25 B ? PRO 37 B 1 -1.41 
3 MET 82 B . ? MET 94 B VAL 83 B ? VAL 95 B 1 -4.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 5 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 3  ? PRO A 10 ? ARG A 15 PRO A 22 
A 2 GLU A 74 ? ARG A 81 ? GLU A 86 ARG A 93 
A 3 THR A 47 ? LEU A 51 ? THR A 59 LEU A 63 
A 4 ARG A 54 ? PRO A 55 ? ARG A 66 PRO A 67 
B 1 PHE A 18 ? CYS A 21 ? PHE A 30 CYS A 33 
B 2 ARG A 27 ? VAL A 31 ? ARG A 39 VAL A 43 
C 1 ARG B 3  ? PRO B 10 ? ARG B 15 PRO B 22 
C 2 GLU B 74 ? ARG B 81 ? GLU B 86 ARG B 93 
C 3 THR B 47 ? LEU B 51 ? THR B 59 LEU B 63 
C 4 VAL B 26 ? VAL B 31 ? VAL B 38 VAL B 43 
C 5 PHE B 18 ? CYS B 21 ? PHE B 30 CYS B 33 
D 1 ARG B 3  ? PRO B 10 ? ARG B 15 PRO B 22 
D 2 GLU B 74 ? ARG B 81 ? GLU B 86 ARG B 93 
D 3 THR B 47 ? LEU B 51 ? THR B 59 LEU B 63 
D 4 ARG B 54 ? PRO B 55 ? ARG B 66 PRO B 67 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 5  ? N ARG A 17 O VAL A 79 ? O VAL A 91 
A 2 3 O TRP A 80 ? O TRP A 92 N THR A 47 ? N THR A 59 
A 3 4 N LEU A 51 ? N LEU A 63 O ARG A 54 ? O ARG A 66 
B 1 2 N CYS A 21 ? N CYS A 33 O ARG A 27 ? O ARG A 39 
C 1 2 N ILE B 9  ? N ILE B 21 O ILE B 75 ? O ILE B 87 
C 2 3 O LEU B 78 ? O LEU B 90 N LEU B 49 ? N LEU B 61 
C 3 4 O VAL B 48 ? O VAL B 60 N VAL B 26 ? N VAL B 38 
C 4 5 O ARG B 27 ? O ARG B 39 N CYS B 21 ? N CYS B 33 
D 1 2 N ILE B 9  ? N ILE B 21 O ILE B 75 ? O ILE B 87 
D 2 3 O LEU B 78 ? O LEU B 90 N LEU B 49 ? N LEU B 61 
D 3 4 N LEU B 51 ? N LEU B 63 O ARG B 54 ? O ARG B 66 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 GLY A 12 ? GLY A 24  . ? 1_555 ? 
2  AC1 7 LYS A 13 ? LYS A 25  . ? 1_555 ? 
3  AC1 7 PRO A 36 ? PRO A 48  . ? 1_555 ? 
4  AC1 7 ARG A 39 ? ARG A 51  . ? 1_555 ? 
5  AC1 7 GLY B 12 ? GLY B 24  . ? 1_556 ? 
6  AC1 7 LYS B 13 ? LYS B 25  . ? 1_556 ? 
7  AC1 7 ASP B 14 ? ASP B 26  . ? 1_556 ? 
8  AC2 6 VAL A 62 ? VAL A 74  . ? 1_555 ? 
9  AC2 6 ALA A 65 ? ALA A 77  . ? 1_555 ? 
10 AC2 6 HIS A 66 ? HIS A 78  . ? 1_555 ? 
11 AC2 6 ARG A 69 ? ARG A 81  . ? 1_555 ? 
12 AC2 6 HOH E .  ? HOH A 122 . ? 1_555 ? 
13 AC2 6 LYS B 60 ? LYS B 72  . ? 3_554 ? 
# 
_database_PDB_matrix.entry_id          2F5Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2F5Y 
_atom_sites.fract_transf_matrix[1][1]   0.010976 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022655 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020057 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2  ? -3.926 -11.140 -28.090 1.00 56.33  ? 14  MET A N   1 
ATOM   2    C CA  . MET A 1 2  ? -2.809 -10.241 -28.522 1.00 61.32  ? 14  MET A CA  1 
ATOM   3    C C   . MET A 1 2  ? -2.815 -8.875  -27.800 1.00 61.64  ? 14  MET A C   1 
ATOM   4    O O   . MET A 1 2  ? -3.172 -7.843  -28.385 1.00 65.75  ? 14  MET A O   1 
ATOM   5    C CB  . MET A 1 2  ? -2.859 -10.052 -30.041 1.00 59.89  ? 14  MET A CB  1 
ATOM   6    C CG  . MET A 1 2  ? -1.562 -9.496  -30.627 1.00 60.98  ? 14  MET A CG  1 
ATOM   7    S SD  . MET A 1 2  ? -0.157 -10.612 -30.384 1.00 65.07  ? 14  MET A SD  1 
ATOM   8    C CE  . MET A 1 2  ? 1.216  -9.469  -30.367 1.00 54.88  ? 14  MET A CE  1 
ATOM   9    N N   . ARG A 1 3  ? -2.367 -8.875  -26.544 1.00 57.72  ? 15  ARG A N   1 
ATOM   10   C CA  . ARG A 1 3  ? -2.684 -7.801  -25.599 1.00 52.69  ? 15  ARG A CA  1 
ATOM   11   C C   . ARG A 1 3  ? -1.495 -6.944  -25.164 1.00 47.39  ? 15  ARG A C   1 
ATOM   12   O O   . ARG A 1 3  ? -0.347 -7.215  -25.520 1.00 47.22  ? 15  ARG A O   1 
ATOM   13   C CB  . ARG A 1 3  ? -3.343 -8.411  -24.360 1.00 53.44  ? 15  ARG A CB  1 
ATOM   14   C CG  . ARG A 1 3  ? -2.365 -8.931  -23.317 1.00 59.84  ? 15  ARG A CG  1 
ATOM   15   C CD  . ARG A 1 3  ? -3.034 -9.159  -21.978 1.00 66.15  ? 15  ARG A CD  1 
ATOM   16   N NE  . ARG A 1 3  ? -4.010 -10.243 -22.022 1.00 76.73  ? 15  ARG A NE  1 
ATOM   17   C CZ  . ARG A 1 3  ? -4.535 -10.822 -20.944 1.00 86.49  ? 15  ARG A CZ  1 
ATOM   18   N NH1 . ARG A 1 3  ? -5.423 -11.801 -21.084 1.00 85.71  ? 15  ARG A NH1 1 
ATOM   19   N NH2 . ARG A 1 3  ? -4.178 -10.435 -19.721 1.00 86.17  ? 15  ARG A NH2 1 
ATOM   20   N N   . TYR A 1 4  ? -1.798 -5.916  -24.373 1.00 39.76  ? 16  TYR A N   1 
ATOM   21   C CA  . TYR A 1 4  ? -0.804 -5.019  -23.808 1.00 39.35  ? 16  TYR A CA  1 
ATOM   22   C C   . TYR A 1 4  ? -0.680 -5.249  -22.302 1.00 39.07  ? 16  TYR A C   1 
ATOM   23   O O   . TYR A 1 4  ? -1.680 -5.283  -21.585 1.00 40.36  ? 16  TYR A O   1 
ATOM   24   C CB  . TYR A 1 4  ? -1.189 -3.557  -24.021 1.00 35.98  ? 16  TYR A CB  1 
ATOM   25   C CG  . TYR A 1 4  ? -1.506 -3.139  -25.437 1.00 37.67  ? 16  TYR A CG  1 
ATOM   26   C CD1 . TYR A 1 4  ? -2.786 -3.302  -25.967 1.00 42.25  ? 16  TYR A CD1 1 
ATOM   27   C CD2 . TYR A 1 4  ? -0.541 -2.533  -26.233 1.00 40.44  ? 16  TYR A CD2 1 
ATOM   28   C CE1 . TYR A 1 4  ? -3.087 -2.894  -27.252 1.00 39.62  ? 16  TYR A CE1 1 
ATOM   29   C CE2 . TYR A 1 4  ? -0.831 -2.118  -27.525 1.00 41.86  ? 16  TYR A CE2 1 
ATOM   30   C CZ  . TYR A 1 4  ? -2.093 -2.303  -28.032 1.00 45.31  ? 16  TYR A CZ  1 
ATOM   31   O OH  . TYR A 1 4  ? -2.355 -1.882  -29.307 1.00 40.48  ? 16  TYR A OH  1 
ATOM   32   N N   . ARG A 1 5  ? 0.553  -5.376  -21.830 1.00 40.62  ? 17  ARG A N   1 
ATOM   33   C CA  . ARG A 1 5  ? 0.837  -5.455  -20.415 1.00 41.51  ? 17  ARG A CA  1 
ATOM   34   C C   . ARG A 1 5  ? 1.872  -4.402  -20.053 1.00 41.63  ? 17  ARG A C   1 
ATOM   35   O O   . ARG A 1 5  ? 2.822  -4.149  -20.797 1.00 42.20  ? 17  ARG A O   1 
ATOM   36   C CB  . ARG A 1 5  ? 1.362  -6.849  -20.038 1.00 48.92  ? 17  ARG A CB  1 
ATOM   37   C CG  . ARG A 1 5  ? 0.364  -8.001  -20.261 1.00 49.60  ? 17  ARG A CG  1 
ATOM   38   C CD  . ARG A 1 5  ? -0.821 -7.982  -19.298 1.00 65.67  ? 17  ARG A CD  1 
ATOM   39   N NE  . ARG A 1 5  ? -0.498 -8.467  -17.954 1.00 75.64  ? 17  ARG A NE  1 
ATOM   40   C CZ  . ARG A 1 5  ? -0.246 -7.703  -16.886 1.00 95.62  ? 17  ARG A CZ  1 
ATOM   41   N NH1 . ARG A 1 5  ? 0.028  -8.287  -15.723 1.00 94.41  ? 17  ARG A NH1 1 
ATOM   42   N NH2 . ARG A 1 5  ? -0.258 -6.367  -16.954 1.00 100.21 ? 17  ARG A NH2 1 
ATOM   43   N N   . GLN A 1 6  ? 1.673  -3.779  -18.903 1.00 36.40  ? 18  GLN A N   1 
ATOM   44   C CA  . GLN A 1 6  ? 2.660  -2.890  -18.343 1.00 36.44  ? 18  GLN A CA  1 
ATOM   45   C C   . GLN A 1 6  ? 3.419  -3.667  -17.260 1.00 38.97  ? 18  GLN A C   1 
ATOM   46   O O   . GLN A 1 6  ? 2.811  -4.144  -16.310 1.00 41.69  ? 18  GLN A O   1 
ATOM   47   C CB  . GLN A 1 6  ? 1.963  -1.678  -17.741 1.00 36.49  ? 18  GLN A CB  1 
ATOM   48   C CG  . GLN A 1 6  ? 2.896  -0.727  -17.022 1.00 38.57  ? 18  GLN A CG  1 
ATOM   49   C CD  . GLN A 1 6  ? 2.144  0.372   -16.337 1.00 45.34  ? 18  GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 6  ? 1.607  0.178   -15.245 1.00 51.75  ? 18  GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 6  ? 2.077  1.533   -16.980 1.00 36.16  ? 18  GLN A NE2 1 
ATOM   52   N N   . ILE A 1 7  ? 4.735  -3.767  -17.403 1.00 41.75  ? 19  ILE A N   1 
ATOM   53   C CA  . ILE A 1 7  ? 5.580  -4.577  -16.528 1.00 43.24  ? 19  ILE A CA  1 
ATOM   54   C C   . ILE A 1 7  ? 6.586  -3.652  -15.837 1.00 46.71  ? 19  ILE A C   1 
ATOM   55   O O   . ILE A 1 7  ? 7.349  -2.951  -16.518 1.00 41.24  ? 19  ILE A O   1 
ATOM   56   C CB  . ILE A 1 7  ? 6.373  -5.625  -17.346 1.00 46.74  ? 19  ILE A CB  1 
ATOM   57   C CG1 . ILE A 1 7  ? 5.439  -6.488  -18.207 1.00 39.65  ? 19  ILE A CG1 1 
ATOM   58   C CG2 . ILE A 1 7  ? 7.244  -6.513  -16.424 1.00 50.05  ? 19  ILE A CG2 1 
ATOM   59   C CD1 . ILE A 1 7  ? 4.466  -7.344  -17.428 1.00 38.51  ? 19  ILE A CD1 1 
ATOM   60   N N   . THR A 1 8  ? 6.591  -3.663  -14.499 1.00 46.37  ? 20  THR A N   1 
ATOM   61   C CA  . THR A 1 8  ? 7.453  -2.775  -13.690 1.00 48.48  ? 20  THR A CA  1 
ATOM   62   C C   . THR A 1 8  ? 8.573  -3.607  -13.059 1.00 47.36  ? 20  THR A C   1 
ATOM   63   O O   . THR A 1 8  ? 8.323  -4.479  -12.238 1.00 52.56  ? 20  THR A O   1 
ATOM   64   C CB  . THR A 1 8  ? 6.656  -2.037  -12.556 1.00 46.94  ? 20  THR A CB  1 
ATOM   65   O OG1 . THR A 1 8  ? 5.640  -1.198  -13.129 1.00 53.53  ? 20  THR A OG1 1 
ATOM   66   C CG2 . THR A 1 8  ? 7.575  -1.167  -11.714 1.00 49.40  ? 20  THR A CG2 1 
ATOM   67   N N   . ILE A 1 9  ? 9.810  -3.330  -13.447 1.00 47.30  ? 21  ILE A N   1 
ATOM   68   C CA  . ILE A 1 9  ? 10.933 -4.139  -13.020 1.00 46.44  ? 21  ILE A CA  1 
ATOM   69   C C   . ILE A 1 9  ? 11.908 -3.272  -12.277 1.00 47.31  ? 21  ILE A C   1 
ATOM   70   O O   . ILE A 1 9  ? 12.580 -2.454  -12.892 1.00 48.15  ? 21  ILE A O   1 
ATOM   71   C CB  . ILE A 1 9  ? 11.683 -4.745  -14.195 1.00 46.06  ? 21  ILE A CB  1 
ATOM   72   C CG1 . ILE A 1 9  ? 10.707 -5.379  -15.185 1.00 46.03  ? 21  ILE A CG1 1 
ATOM   73   C CG2 . ILE A 1 9  ? 12.726 -5.755  -13.672 1.00 42.62  ? 21  ILE A CG2 1 
ATOM   74   C CD1 . ILE A 1 9  ? 11.319 -5.640  -16.554 1.00 48.02  ? 21  ILE A CD1 1 
ATOM   75   N N   . PRO A 1 10 ? 11.987 -3.437  -10.950 1.00 48.07  ? 22  PRO A N   1 
ATOM   76   C CA  . PRO A 1 10 ? 13.060 -2.784  -10.192 1.00 46.52  ? 22  PRO A CA  1 
ATOM   77   C C   . PRO A 1 10 ? 14.413 -3.406  -10.525 1.00 48.21  ? 22  PRO A C   1 
ATOM   78   O O   . PRO A 1 10 ? 14.491 -4.585  -10.864 1.00 55.25  ? 22  PRO A O   1 
ATOM   79   C CB  . PRO A 1 10 ? 12.679 -3.021  -8.723  1.00 41.83  ? 22  PRO A CB  1 
ATOM   80   C CG  . PRO A 1 10 ? 11.251 -3.524  -8.750  1.00 47.48  ? 22  PRO A CG  1 
ATOM   81   C CD  . PRO A 1 10 ? 11.080 -4.204  -10.085 1.00 48.28  ? 22  PRO A CD  1 
ATOM   82   N N   . ARG A 1 11 ? 15.454 -2.592  -10.464 1.00 45.01  ? 23  ARG A N   1 
ATOM   83   C CA  . ARG A 1 11 ? 16.808 -3.026  -10.718 1.00 43.55  ? 23  ARG A CA  1 
ATOM   84   C C   . ARG A 1 11 ? 17.247 -4.014  -9.631  1.00 44.37  ? 23  ARG A C   1 
ATOM   85   O O   . ARG A 1 11 ? 17.046 -3.771  -8.439  1.00 45.14  ? 23  ARG A O   1 
ATOM   86   C CB  . ARG A 1 11 ? 17.721 -1.793  -10.753 1.00 45.24  ? 23  ARG A CB  1 
ATOM   87   C CG  . ARG A 1 11 ? 19.186 -2.070  -10.875 1.00 46.96  ? 23  ARG A CG  1 
ATOM   88   C CD  . ARG A 1 11 ? 19.955 -0.780  -11.025 1.00 55.07  ? 23  ARG A CD  1 
ATOM   89   N NE  . ARG A 1 11 ? 19.885 -0.250  -12.384 1.00 57.93  ? 23  ARG A NE  1 
ATOM   90   C CZ  . ARG A 1 11 ? 20.620 -0.692  -13.399 1.00 56.20  ? 23  ARG A CZ  1 
ATOM   91   N NH1 . ARG A 1 11 ? 20.492 -0.141  -14.603 1.00 53.57  ? 23  ARG A NH1 1 
ATOM   92   N NH2 . ARG A 1 11 ? 21.475 -1.690  -13.227 1.00 71.04  ? 23  ARG A NH2 1 
ATOM   93   N N   . GLY A 1 12 ? 17.844 -5.123  -10.053 1.00 40.25  ? 24  GLY A N   1 
ATOM   94   C CA  . GLY A 1 12 ? 18.374 -6.119  -9.146  1.00 39.60  ? 24  GLY A CA  1 
ATOM   95   C C   . GLY A 1 12 ? 19.879 -6.019  -8.981  1.00 40.96  ? 24  GLY A C   1 
ATOM   96   O O   . GLY A 1 12 ? 20.483 -4.990  -9.279  1.00 45.47  ? 24  GLY A O   1 
ATOM   97   N N   . LYS A 1 13 ? 20.478 -7.101  -8.498  1.00 42.67  ? 25  LYS A N   1 
ATOM   98   C CA  . LYS A 1 13 ? 21.911 -7.159  -8.227  1.00 45.51  ? 25  LYS A CA  1 
ATOM   99   C C   . LYS A 1 13 ? 22.759 -7.014  -9.496  1.00 49.68  ? 25  LYS A C   1 
ATOM   100  O O   . LYS A 1 13 ? 23.841 -6.417  -9.456  1.00 52.50  ? 25  LYS A O   1 
ATOM   101  C CB  . LYS A 1 13 ? 22.255 -8.473  -7.511  1.00 42.61  ? 25  LYS A CB  1 
ATOM   102  C CG  . LYS A 1 13 ? 23.728 -8.684  -7.215  1.00 40.14  ? 25  LYS A CG  1 
ATOM   103  C CD  . LYS A 1 13 ? 24.242 -7.711  -6.167  1.00 52.06  ? 25  LYS A CD  1 
ATOM   104  C CE  . LYS A 1 13 ? 25.605 -8.138  -5.627  1.00 52.01  ? 25  LYS A CE  1 
ATOM   105  N NZ  . LYS A 1 13 ? 25.906 -7.514  -4.303  1.00 60.80  ? 25  LYS A NZ  1 
ATOM   106  N N   . ASP A 1 14 ? 22.280 -7.572  -10.604 1.00 50.90  ? 26  ASP A N   1 
ATOM   107  C CA  . ASP A 1 14 ? 22.987 -7.468  -11.876 1.00 54.33  ? 26  ASP A CA  1 
ATOM   108  C C   . ASP A 1 14 ? 22.012 -7.116  -12.994 1.00 55.15  ? 26  ASP A C   1 
ATOM   109  O O   . ASP A 1 14 ? 21.754 -7.909  -13.906 1.00 58.12  ? 26  ASP A O   1 
ATOM   110  C CB  . ASP A 1 14 ? 23.740 -8.768  -12.177 1.00 57.41  ? 26  ASP A CB  1 
ATOM   111  C CG  . ASP A 1 14 ? 24.855 -8.578  -13.202 1.00 70.39  ? 26  ASP A CG  1 
ATOM   112  O OD1 . ASP A 1 14 ? 24.559 -8.203  -14.356 1.00 77.61  ? 26  ASP A OD1 1 
ATOM   113  O OD2 . ASP A 1 14 ? 26.033 -8.813  -12.854 1.00 87.59  ? 26  ASP A OD2 1 
ATOM   114  N N   . GLY A 1 15 ? 21.465 -5.912  -12.919 1.00 50.94  ? 27  GLY A N   1 
ATOM   115  C CA  . GLY A 1 15 ? 20.559 -5.444  -13.946 1.00 47.50  ? 27  GLY A CA  1 
ATOM   116  C C   . GLY A 1 15 ? 19.156 -5.983  -13.758 1.00 43.02  ? 27  GLY A C   1 
ATOM   117  O O   . GLY A 1 15 ? 18.725 -6.214  -12.639 1.00 44.27  ? 27  GLY A O   1 
ATOM   118  N N   . PHE A 1 16 ? 18.462 -6.199  -14.870 1.00 44.67  ? 28  PHE A N   1 
ATOM   119  C CA  . PHE A 1 16 ? 17.029 -6.492  -14.872 1.00 46.63  ? 28  PHE A CA  1 
ATOM   120  C C   . PHE A 1 16 ? 16.671 -7.917  -15.291 1.00 44.92  ? 28  PHE A C   1 
ATOM   121  O O   . PHE A 1 16 ? 15.493 -8.261  -15.336 1.00 50.24  ? 28  PHE A O   1 
ATOM   122  C CB  . PHE A 1 16 ? 16.306 -5.480  -15.782 1.00 45.84  ? 28  PHE A CB  1 
ATOM   123  C CG  . PHE A 1 16 ? 16.533 -4.038  -15.381 1.00 46.46  ? 28  PHE A CG  1 
ATOM   124  C CD1 . PHE A 1 16 ? 17.625 -3.336  -15.863 1.00 46.78  ? 28  PHE A CD1 1 
ATOM   125  C CD2 . PHE A 1 16 ? 15.664 -3.401  -14.503 1.00 48.52  ? 28  PHE A CD2 1 
ATOM   126  C CE1 . PHE A 1 16 ? 17.845 -2.022  -15.490 1.00 41.25  ? 28  PHE A CE1 1 
ATOM   127  C CE2 . PHE A 1 16 ? 15.866 -2.082  -14.127 1.00 46.23  ? 28  PHE A CE2 1 
ATOM   128  C CZ  . PHE A 1 16 ? 16.957 -1.392  -14.614 1.00 49.52  ? 28  PHE A CZ  1 
ATOM   129  N N   . GLY A 1 17 ? 17.667 -8.726  -15.630 1.00 43.79  ? 29  GLY A N   1 
ATOM   130  C CA  . GLY A 1 17 ? 17.479 -10.168 -15.831 1.00 42.71  ? 29  GLY A CA  1 
ATOM   131  C C   . GLY A 1 17 ? 16.720 -10.598 -17.077 1.00 42.59  ? 29  GLY A C   1 
ATOM   132  O O   . GLY A 1 17 ? 15.936 -11.551 -17.037 1.00 39.13  ? 29  GLY A O   1 
ATOM   133  N N   . PHE A 1 18 ? 16.939 -9.898  -18.184 1.00 46.63  ? 30  PHE A N   1 
ATOM   134  C CA  . PHE A 1 18 ? 16.382 -10.316 -19.472 1.00 47.19  ? 30  PHE A CA  1 
ATOM   135  C C   . PHE A 1 18 ? 17.227 -9.882  -20.658 1.00 49.70  ? 30  PHE A C   1 
ATOM   136  O O   . PHE A 1 18 ? 18.049 -8.968  -20.551 1.00 48.39  ? 30  PHE A O   1 
ATOM   137  C CB  . PHE A 1 18 ? 14.944 -9.824  -19.650 1.00 47.26  ? 30  PHE A CB  1 
ATOM   138  C CG  . PHE A 1 18 ? 14.815 -8.339  -19.898 1.00 45.87  ? 30  PHE A CG  1 
ATOM   139  C CD1 . PHE A 1 18 ? 14.788 -7.441  -18.836 1.00 46.98  ? 30  PHE A CD1 1 
ATOM   140  C CD2 . PHE A 1 18 ? 14.677 -7.842  -21.192 1.00 47.15  ? 30  PHE A CD2 1 
ATOM   141  C CE1 . PHE A 1 18 ? 14.654 -6.084  -19.066 1.00 51.84  ? 30  PHE A CE1 1 
ATOM   142  C CE2 . PHE A 1 18 ? 14.552 -6.469  -21.421 1.00 48.73  ? 30  PHE A CE2 1 
ATOM   143  C CZ  . PHE A 1 18 ? 14.523 -5.604  -20.361 1.00 46.38  ? 30  PHE A CZ  1 
ATOM   144  N N   . THR A 1 19 ? 16.972 -10.540 -21.786 1.00 48.73  ? 31  THR A N   1 
ATOM   145  C CA  . THR A 1 19 ? 17.691 -10.325 -23.035 1.00 49.44  ? 31  THR A CA  1 
ATOM   146  C C   . THR A 1 19 ? 16.734 -9.851  -24.117 1.00 44.66  ? 31  THR A C   1 
ATOM   147  O O   . THR A 1 19 ? 15.553 -10.200 -24.107 1.00 46.64  ? 31  THR A O   1 
ATOM   148  C CB  . THR A 1 19 ? 18.383 -11.637 -23.508 1.00 46.03  ? 31  THR A CB  1 
ATOM   149  O OG1 . THR A 1 19 ? 19.555 -11.863 -22.710 1.00 47.04  ? 31  THR A OG1 1 
ATOM   150  C CG2 . THR A 1 19 ? 18.817 -11.520 -24.947 1.00 66.46  ? 31  THR A CG2 1 
ATOM   151  N N   . ILE A 1 20 ? 17.246 -9.052  -25.047 1.00 46.30  ? 32  ILE A N   1 
ATOM   152  C CA  . ILE A 1 20 ? 16.454 -8.564  -26.186 1.00 48.48  ? 32  ILE A CA  1 
ATOM   153  C C   . ILE A 1 20 ? 17.088 -8.928  -27.546 1.00 46.74  ? 32  ILE A C   1 
ATOM   154  O O   . ILE A 1 20 ? 18.244 -9.331  -27.626 1.00 50.42  ? 32  ILE A O   1 
ATOM   155  C CB  . ILE A 1 20 ? 16.213 -7.054  -26.088 1.00 48.07  ? 32  ILE A CB  1 
ATOM   156  C CG1 . ILE A 1 20 ? 17.529 -6.308  -25.861 1.00 56.35  ? 32  ILE A CG1 1 
ATOM   157  C CG2 . ILE A 1 20 ? 15.246 -6.765  -24.955 1.00 47.51  ? 32  ILE A CG2 1 
ATOM   158  C CD1 . ILE A 1 20 ? 17.464 -4.822  -26.127 1.00 52.05  ? 32  ILE A CD1 1 
ATOM   159  N N   . CYS A 1 21 ? 16.296 -8.796  -28.598 1.00 46.74  ? 33  CYS A N   1 
ATOM   160  C CA  . CYS A 1 21 ? 16.728 -9.027  -29.976 1.00 49.20  ? 33  CYS A CA  1 
ATOM   161  C C   . CYS A 1 21 ? 15.843 -8.213  -30.908 1.00 47.16  ? 33  CYS A C   1 
ATOM   162  O O   . CYS A 1 21 ? 14.776 -7.744  -30.496 1.00 48.21  ? 33  CYS A O   1 
ATOM   163  C CB  . CYS A 1 21 ? 16.638 -10.514 -30.363 1.00 49.66  ? 33  CYS A CB  1 
ATOM   164  S SG  . CYS A 1 21 ? 14.949 -11.265 -30.205 1.00 58.43  ? 33  CYS A SG  1 
ATOM   165  N N   . CYS A 1 22 ? 16.306 -8.042  -32.146 1.00 44.73  ? 34  CYS A N   1 
ATOM   166  C CA  . CYS A 1 22 ? 15.603 -7.304  -33.215 1.00 46.56  ? 34  CYS A CA  1 
ATOM   167  C C   . CYS A 1 22 ? 15.590 -5.796  -33.029 1.00 44.52  ? 34  CYS A C   1 
ATOM   168  O O   . CYS A 1 22 ? 15.775 -5.306  -31.928 1.00 39.96  ? 34  CYS A O   1 
ATOM   169  C CB  . CYS A 1 22 ? 14.153 -7.796  -33.421 1.00 46.86  ? 34  CYS A CB  1 
ATOM   170  S SG  . CYS A 1 22 ? 14.017 -9.422  -34.172 1.00 61.45  ? 34  CYS A SG  1 
ATOM   171  N N   . ASP A 1 23 ? 15.361 -5.092  -34.144 1.00 42.11  ? 35  ASP A N   1 
ATOM   172  C CA  . ASP A 1 23 ? 15.208 -3.654  -34.185 1.00 46.51  ? 35  ASP A CA  1 
ATOM   173  C C   . ASP A 1 23 ? 13.804 -3.263  -34.676 1.00 45.67  ? 35  ASP A C   1 
ATOM   174  O O   . ASP A 1 23 ? 13.256 -3.907  -35.575 1.00 39.09  ? 35  ASP A O   1 
ATOM   175  C CB  . ASP A 1 23 ? 16.210 -3.042  -35.172 1.00 47.48  ? 35  ASP A CB  1 
ATOM   176  C CG  . ASP A 1 23 ? 17.666 -3.313  -34.813 1.00 53.87  ? 35  ASP A CG  1 
ATOM   177  O OD1 . ASP A 1 23 ? 18.504 -3.168  -35.727 1.00 60.00  ? 35  ASP A OD1 1 
ATOM   178  O OD2 . ASP A 1 23 ? 17.983 -3.643  -33.649 1.00 51.82  ? 35  ASP A OD2 1 
ATOM   179  N N   . SER A 1 24 ? 13.254 -2.192  -34.101 1.00 41.63  ? 36  SER A N   1 
ATOM   180  C CA  . SER A 1 24 ? 12.105 -1.487  -34.676 1.00 46.91  ? 36  SER A CA  1 
ATOM   181  C C   . SER A 1 24 ? 10.885 -2.368  -35.002 1.00 45.51  ? 36  SER A C   1 
ATOM   182  O O   . SER A 1 24 ? 10.514 -2.498  -36.171 1.00 46.50  ? 36  SER A O   1 
ATOM   183  C CB  . SER A 1 24 ? 12.545 -0.762  -35.961 1.00 45.27  ? 36  SER A CB  1 
ATOM   184  O OG  . SER A 1 24 ? 13.615 0.132   -35.713 1.00 55.41  ? 36  SER A OG  1 
ATOM   185  N N   . PRO A 1 25 ? 10.246 -2.965  -33.982 1.00 45.10  ? 37  PRO A N   1 
ATOM   186  C CA  . PRO A 1 25 ? 10.516 -2.929  -32.551 1.00 43.38  ? 37  PRO A CA  1 
ATOM   187  C C   . PRO A 1 25 ? 11.435 -4.025  -32.027 1.00 43.17  ? 37  PRO A C   1 
ATOM   188  O O   . PRO A 1 25 ? 11.735 -5.007  -32.705 1.00 47.76  ? 37  PRO A O   1 
ATOM   189  C CB  . PRO A 1 25 ? 9.122  -3.101  -31.943 1.00 46.75  ? 37  PRO A CB  1 
ATOM   190  C CG  . PRO A 1 25 ? 8.411  -3.979  -32.912 1.00 45.03  ? 37  PRO A CG  1 
ATOM   191  C CD  . PRO A 1 25 ? 9.040  -3.761  -34.275 1.00 49.42  ? 37  PRO A CD  1 
ATOM   192  N N   . VAL A 1 26 ? 11.858 -3.830  -30.795 1.00 40.21  ? 38  VAL A N   1 
ATOM   193  C CA  . VAL A 1 26 ? 12.726 -4.740  -30.103 1.00 42.21  ? 38  VAL A CA  1 
ATOM   194  C C   . VAL A 1 26 ? 11.848 -5.789  -29.441 1.00 39.84  ? 38  VAL A C   1 
ATOM   195  O O   . VAL A 1 26 ? 10.722 -5.508  -29.047 1.00 45.66  ? 38  VAL A O   1 
ATOM   196  C CB  . VAL A 1 26 ? 13.589 -3.953  -29.076 1.00 47.77  ? 38  VAL A CB  1 
ATOM   197  C CG1 . VAL A 1 26 ? 14.505 -4.882  -28.278 1.00 38.42  ? 38  VAL A CG1 1 
ATOM   198  C CG2 . VAL A 1 26 ? 14.388 -2.828  -29.806 1.00 38.15  ? 38  VAL A CG2 1 
ATOM   199  N N   . ARG A 1 27 ? 12.341 -7.013  -29.372 1.00 43.22  ? 39  ARG A N   1 
ATOM   200  C CA  . ARG A 1 27 ? 11.592 -8.122  -28.752 1.00 47.95  ? 39  ARG A CA  1 
ATOM   201  C C   . ARG A 1 27 ? 12.388 -8.701  -27.590 1.00 44.89  ? 39  ARG A C   1 
ATOM   202  O O   . ARG A 1 27 ? 13.617 -8.655  -27.578 1.00 44.62  ? 39  ARG A O   1 
ATOM   203  C CB  . ARG A 1 27 ? 11.314 -9.219  -29.782 1.00 44.44  ? 39  ARG A CB  1 
ATOM   204  C CG  . ARG A 1 27 ? 10.227 -10.186 -29.356 1.00 55.08  ? 39  ARG A CG  1 
ATOM   205  C CD  . ARG A 1 27 ? 10.068 -11.343 -30.346 1.00 47.76  ? 39  ARG A CD  1 
ATOM   206  N NE  . ARG A 1 27 ? 11.016 -12.416 -30.073 1.00 48.98  ? 39  ARG A NE  1 
ATOM   207  C CZ  . ARG A 1 27 ? 11.308 -13.406 -30.909 1.00 49.37  ? 39  ARG A CZ  1 
ATOM   208  N NH1 . ARG A 1 27 ? 10.719 -13.477 -32.091 1.00 38.29  ? 39  ARG A NH1 1 
ATOM   209  N NH2 . ARG A 1 27 ? 12.195 -14.331 -30.558 1.00 52.10  ? 39  ARG A NH2 1 
ATOM   210  N N   . VAL A 1 28 ? 11.691 -9.246  -26.606 1.00 51.35  ? 40  VAL A N   1 
ATOM   211  C CA  . VAL A 1 28 ? 12.360 -9.923  -25.491 1.00 47.43  ? 40  VAL A CA  1 
ATOM   212  C C   . VAL A 1 28 ? 12.781 -11.311 -25.958 1.00 47.59  ? 40  VAL A C   1 
ATOM   213  O O   . VAL A 1 28 ? 11.952 -12.106 -26.417 1.00 46.63  ? 40  VAL A O   1 
ATOM   214  C CB  . VAL A 1 28 ? 11.452 -10.019 -24.262 1.00 48.86  ? 40  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 28 ? 12.188 -10.715 -23.103 1.00 42.68  ? 40  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 28 ? 10.969 -8.616  -23.843 1.00 37.54  ? 40  VAL A CG2 1 
ATOM   217  N N   . GLN A 1 29 ? 14.083 -11.581 -25.868 1.00 49.16  ? 41  GLN A N   1 
ATOM   218  C CA  . GLN A 1 29 ? 14.637 -12.868 -26.255 1.00 47.47  ? 41  GLN A CA  1 
ATOM   219  C C   . GLN A 1 29 ? 14.340 -13.887 -25.181 1.00 44.14  ? 41  GLN A C   1 
ATOM   220  O O   . GLN A 1 29 ? 13.782 -14.932 -25.451 1.00 46.14  ? 41  GLN A O   1 
ATOM   221  C CB  . GLN A 1 29 ? 16.158 -12.804 -26.417 1.00 49.86  ? 41  GLN A CB  1 
ATOM   222  C CG  . GLN A 1 29 ? 16.676 -12.811 -27.813 1.00 59.11  ? 41  GLN A CG  1 
ATOM   223  C CD  . GLN A 1 29 ? 16.498 -14.120 -28.589 1.00 58.98  ? 41  GLN A CD  1 
ATOM   224  O OE1 . GLN A 1 29 ? 15.617 -14.948 -28.316 1.00 49.32  ? 41  GLN A OE1 1 
ATOM   225  N NE2 . GLN A 1 29 ? 17.342 -14.286 -29.600 1.00 52.57  ? 41  GLN A NE2 1 
ATOM   226  N N   . ALA A 1 30 ? 14.767 -13.571 -23.968 1.00 40.53  ? 42  ALA A N   1 
ATOM   227  C CA  . ALA A 1 30 ? 14.639 -14.468 -22.835 1.00 43.69  ? 42  ALA A CA  1 
ATOM   228  C C   . ALA A 1 30 ? 14.596 -13.663 -21.553 1.00 42.06  ? 42  ALA A C   1 
ATOM   229  O O   . ALA A 1 30 ? 14.823 -12.436 -21.541 1.00 42.93  ? 42  ALA A O   1 
ATOM   230  C CB  . ALA A 1 30 ? 15.807 -15.488 -22.799 1.00 39.51  ? 42  ALA A CB  1 
ATOM   231  N N   . VAL A 1 31 ? 14.291 -14.384 -20.486 1.00 43.49  ? 43  VAL A N   1 
ATOM   232  C CA  . VAL A 1 31 ? 14.105 -13.842 -19.157 1.00 46.40  ? 43  VAL A CA  1 
ATOM   233  C C   . VAL A 1 31 ? 14.835 -14.836 -18.259 1.00 48.09  ? 43  VAL A C   1 
ATOM   234  O O   . VAL A 1 31 ? 14.670 -16.036 -18.431 1.00 41.89  ? 43  VAL A O   1 
ATOM   235  C CB  . VAL A 1 31 ? 12.578 -13.785 -18.823 1.00 49.34  ? 43  VAL A CB  1 
ATOM   236  C CG1 . VAL A 1 31 ? 12.327 -13.931 -17.356 1.00 55.92  ? 43  VAL A CG1 1 
ATOM   237  C CG2 . VAL A 1 31 ? 11.946 -12.484 -19.354 1.00 42.12  ? 43  VAL A CG2 1 
ATOM   238  N N   . ASP A 1 32 ? 15.660 -14.348 -17.336 1.00 46.68  ? 44  ASP A N   1 
ATOM   239  C CA  . ASP A 1 32 ? 16.456 -15.227 -16.486 1.00 48.15  ? 44  ASP A CA  1 
ATOM   240  C C   . ASP A 1 32 ? 15.579 -15.823 -15.399 1.00 48.14  ? 44  ASP A C   1 
ATOM   241  O O   . ASP A 1 32 ? 14.763 -15.126 -14.800 1.00 52.14  ? 44  ASP A O   1 
ATOM   242  C CB  . ASP A 1 32 ? 17.613 -14.460 -15.839 1.00 53.20  ? 44  ASP A CB  1 
ATOM   243  C CG  . ASP A 1 32 ? 18.490 -13.733 -16.857 1.00 57.57  ? 44  ASP A CG  1 
ATOM   244  O OD1 . ASP A 1 32 ? 18.158 -13.731 -18.066 1.00 75.18  ? 44  ASP A OD1 1 
ATOM   245  O OD2 . ASP A 1 32 ? 19.519 -13.163 -16.439 1.00 69.87  ? 44  ASP A OD2 1 
ATOM   246  N N   . SER A 1 33 ? 15.745 -17.109 -15.138 1.00 46.84  ? 45  SER A N   1 
ATOM   247  C CA  . SER A 1 33 ? 14.923 -17.776 -14.129 1.00 51.43  ? 45  SER A CA  1 
ATOM   248  C C   . SER A 1 33 ? 15.165 -17.185 -12.741 1.00 48.23  ? 45  SER A C   1 
ATOM   249  O O   . SER A 1 33 ? 16.276 -17.235 -12.218 1.00 45.15  ? 45  SER A O   1 
ATOM   250  C CB  . SER A 1 33 ? 15.161 -19.288 -14.110 1.00 49.49  ? 45  SER A CB  1 
ATOM   251  O OG  . SER A 1 33 ? 13.921 -19.956 -13.955 1.00 56.57  ? 45  SER A OG  1 
ATOM   252  N N   . GLY A 1 34 ? 14.116 -16.606 -12.169 1.00 49.37  ? 46  GLY A N   1 
ATOM   253  C CA  . GLY A 1 34 ? 14.181 -15.995 -10.850 1.00 50.86  ? 46  GLY A CA  1 
ATOM   254  C C   . GLY A 1 34 ? 14.824 -14.618 -10.804 1.00 49.77  ? 46  GLY A C   1 
ATOM   255  O O   . GLY A 1 34 ? 15.148 -14.141 -9.727  1.00 51.73  ? 46  GLY A O   1 
ATOM   256  N N   . GLY A 1 35 ? 15.014 -13.973 -11.954 1.00 49.71  ? 47  GLY A N   1 
ATOM   257  C CA  . GLY A 1 35 ? 15.598 -12.627 -11.996 1.00 45.01  ? 47  GLY A CA  1 
ATOM   258  C C   . GLY A 1 35 ? 14.514 -11.579 -11.858 1.00 44.99  ? 47  GLY A C   1 
ATOM   259  O O   . GLY A 1 35 ? 13.337 -11.923 -11.824 1.00 40.63  ? 47  GLY A O   1 
ATOM   260  N N   . PRO A 1 36 ? 14.898 -10.286 -11.806 1.00 49.29  ? 48  PRO A N   1 
ATOM   261  C CA  . PRO A 1 36 ? 13.914 -9.216  -11.684 1.00 43.59  ? 48  PRO A CA  1 
ATOM   262  C C   . PRO A 1 36 ? 12.779 -9.284  -12.697 1.00 42.59  ? 48  PRO A C   1 
ATOM   263  O O   . PRO A 1 36 ? 11.630 -9.149  -12.314 1.00 45.39  ? 48  PRO A O   1 
ATOM   264  C CB  . PRO A 1 36 ? 14.750 -7.958  -11.884 1.00 44.86  ? 48  PRO A CB  1 
ATOM   265  C CG  . PRO A 1 36 ? 16.102 -8.339  -11.424 1.00 45.35  ? 48  PRO A CG  1 
ATOM   266  C CD  . PRO A 1 36 ? 16.273 -9.747  -11.841 1.00 47.10  ? 48  PRO A CD  1 
ATOM   267  N N   . ALA A 1 37 ? 13.098 -9.504  -13.973 1.00 45.29  ? 49  ALA A N   1 
ATOM   268  C CA  . ALA A 1 37 ? 12.102 -9.483  -15.046 1.00 39.18  ? 49  ALA A CA  1 
ATOM   269  C C   . ALA A 1 37 ? 11.097 -10.645 -14.979 1.00 44.64  ? 49  ALA A C   1 
ATOM   270  O O   . ALA A 1 37 ? 9.906  -10.445 -15.206 1.00 46.82  ? 49  ALA A O   1 
ATOM   271  C CB  . ALA A 1 37 ? 12.790 -9.462  -16.396 1.00 41.74  ? 49  ALA A CB  1 
ATOM   272  N N   . GLU A 1 38 ? 11.561 -11.850 -14.661 1.00 42.55  ? 50  GLU A N   1 
ATOM   273  C CA  . GLU A 1 38 ? 10.667 -13.001 -14.609 1.00 44.73  ? 50  GLU A CA  1 
ATOM   274  C C   . GLU A 1 38 ? 9.582  -12.790 -13.563 1.00 43.61  ? 50  GLU A C   1 
ATOM   275  O O   . GLU A 1 38 ? 8.396  -12.988 -13.820 1.00 42.29  ? 50  GLU A O   1 
ATOM   276  C CB  . GLU A 1 38 ? 11.426 -14.287 -14.262 1.00 45.48  ? 50  GLU A CB  1 
ATOM   277  C CG  . GLU A 1 38 ? 10.590 -15.563 -14.481 1.00 51.60  ? 50  GLU A CG  1 
ATOM   278  C CD  . GLU A 1 38 ? 11.118 -16.767 -13.724 1.00 55.68  ? 50  GLU A CD  1 
ATOM   279  O OE1 . GLU A 1 38 ? 11.384 -16.637 -12.508 1.00 69.47  ? 50  GLU A OE1 1 
ATOM   280  O OE2 . GLU A 1 38 ? 11.262 -17.847 -14.335 1.00 69.52  ? 50  GLU A OE2 1 
ATOM   281  N N   . ARG A 1 39 ? 9.986  -12.417 -12.359 1.00 45.96  ? 51  ARG A N   1 
ATOM   282  C CA  . ARG A 1 39 ? 9.011  -12.334 -11.286 1.00 44.32  ? 51  ARG A CA  1 
ATOM   283  C C   . ARG A 1 39 ? 8.144  -11.078 -11.385 1.00 42.66  ? 51  ARG A C   1 
ATOM   284  O O   . ARG A 1 39 ? 7.019  -11.073 -10.893 1.00 44.12  ? 51  ARG A O   1 
ATOM   285  C CB  . ARG A 1 39 ? 9.660  -12.527 -9.925  1.00 43.45  ? 51  ARG A CB  1 
ATOM   286  C CG  . ARG A 1 39 ? 10.624 -11.492 -9.576  1.00 46.00  ? 51  ARG A CG  1 
ATOM   287  C CD  . ARG A 1 39 ? 11.216 -11.755 -8.242  1.00 33.56  ? 51  ARG A CD  1 
ATOM   288  N NE  . ARG A 1 39 ? 12.169 -10.690 -7.977  1.00 44.45  ? 51  ARG A NE  1 
ATOM   289  C CZ  . ARG A 1 39 ? 13.489 -10.801 -8.065  1.00 38.87  ? 51  ARG A CZ  1 
ATOM   290  N NH1 . ARG A 1 39 ? 14.075 -11.963 -8.346  1.00 46.12  ? 51  ARG A NH1 1 
ATOM   291  N NH2 . ARG A 1 39 ? 14.229 -9.737  -7.834  1.00 44.07  ? 51  ARG A NH2 1 
ATOM   292  N N   . ALA A 1 40 ? 8.646  -10.052 -12.068 1.00 41.71  ? 52  ALA A N   1 
ATOM   293  C CA  . ALA A 1 40 ? 7.825  -8.917  -12.510 1.00 44.10  ? 52  ALA A CA  1 
ATOM   294  C C   . ALA A 1 40 ? 6.726  -9.321  -13.509 1.00 48.13  ? 52  ALA A C   1 
ATOM   295  O O   . ALA A 1 40 ? 5.689  -8.650  -13.589 1.00 51.76  ? 52  ALA A O   1 
ATOM   296  C CB  . ALA A 1 40 ? 8.710  -7.807  -13.133 1.00 36.84  ? 52  ALA A CB  1 
ATOM   297  N N   . GLY A 1 41 ? 6.962  -10.384 -14.283 1.00 45.79  ? 53  GLY A N   1 
ATOM   298  C CA  . GLY A 1 41 ? 5.988  -10.866 -15.276 1.00 41.01  ? 53  GLY A CA  1 
ATOM   299  C C   . GLY A 1 41 ? 6.396  -10.744 -16.752 1.00 41.71  ? 53  GLY A C   1 
ATOM   300  O O   . GLY A 1 41 ? 5.647  -11.145 -17.632 1.00 40.76  ? 53  GLY A O   1 
ATOM   301  N N   . LEU A 1 42 ? 7.581  -10.216 -17.047 1.00 41.77  ? 54  LEU A N   1 
ATOM   302  C CA  . LEU A 1 42 ? 8.075  -10.213 -18.428 1.00 40.93  ? 54  LEU A CA  1 
ATOM   303  C C   . LEU A 1 42 ? 8.219  -11.652 -18.934 1.00 42.34  ? 54  LEU A C   1 
ATOM   304  O O   . LEU A 1 42 ? 8.440  -12.572 -18.157 1.00 43.65  ? 54  LEU A O   1 
ATOM   305  C CB  . LEU A 1 42 ? 9.423  -9.500  -18.502 1.00 41.31  ? 54  LEU A CB  1 
ATOM   306  C CG  . LEU A 1 42 ? 9.870  -8.898  -19.829 1.00 45.31  ? 54  LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 42 ? 8.970  -7.749  -20.218 1.00 40.24  ? 54  LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 42 ? 11.308 -8.446  -19.715 1.00 40.06  ? 54  LEU A CD2 1 
ATOM   309  N N   . GLN A 1 43 ? 8.053  -11.849 -20.230 1.00 44.69  ? 55  GLN A N   1 
ATOM   310  C CA  . GLN A 1 43 ? 8.237  -13.164 -20.808 1.00 48.30  ? 55  GLN A CA  1 
ATOM   311  C C   . GLN A 1 43 ? 8.718  -13.045 -22.237 1.00 46.60  ? 55  GLN A C   1 
ATOM   312  O O   . GLN A 1 43 ? 8.565  -12.008 -22.873 1.00 40.08  ? 55  GLN A O   1 
ATOM   313  C CB  . GLN A 1 43 ? 6.950  -13.992 -20.726 1.00 52.38  ? 55  GLN A CB  1 
ATOM   314  C CG  . GLN A 1 43 ? 5.806  -13.468 -21.555 1.00 55.62  ? 55  GLN A CG  1 
ATOM   315  C CD  . GLN A 1 43 ? 4.543  -14.267 -21.343 1.00 52.87  ? 55  GLN A CD  1 
ATOM   316  O OE1 . GLN A 1 43 ? 4.178  -14.564 -20.212 1.00 49.39  ? 55  GLN A OE1 1 
ATOM   317  N NE2 . GLN A 1 43 ? 3.865  -14.617 -22.435 1.00 48.52  ? 55  GLN A NE2 1 
ATOM   318  N N   . GLN A 1 44 ? 9.316  -14.126 -22.722 1.00 47.93  ? 56  GLN A N   1 
ATOM   319  C CA  . GLN A 1 44 ? 9.864  -14.158 -24.062 1.00 47.36  ? 56  GLN A CA  1 
ATOM   320  C C   . GLN A 1 44 ? 8.770  -13.903 -25.098 1.00 46.53  ? 56  GLN A C   1 
ATOM   321  O O   . GLN A 1 44 ? 7.604  -14.225 -24.858 1.00 43.07  ? 56  GLN A O   1 
ATOM   322  C CB  . GLN A 1 44 ? 10.564 -15.494 -24.311 1.00 42.60  ? 56  GLN A CB  1 
ATOM   323  C CG  . GLN A 1 44 ? 9.644  -16.680 -24.355 1.00 52.92  ? 56  GLN A CG  1 
ATOM   324  C CD  . GLN A 1 44 ? 10.402 -17.995 -24.262 1.00 58.75  ? 56  GLN A CD  1 
ATOM   325  O OE1 . GLN A 1 44 ? 11.021 -18.301 -23.237 1.00 66.73  ? 56  GLN A OE1 1 
ATOM   326  N NE2 . GLN A 1 44 ? 10.352 -18.782 -25.333 1.00 47.05  ? 56  GLN A NE2 1 
ATOM   327  N N   . LEU A 1 45 ? 9.176  -13.331 -26.240 1.00 47.35  ? 57  LEU A N   1 
ATOM   328  C CA  . LEU A 1 45 ? 8.284  -12.911 -27.338 1.00 49.42  ? 57  LEU A CA  1 
ATOM   329  C C   . LEU A 1 45 ? 7.563  -11.594 -27.070 1.00 47.03  ? 57  LEU A C   1 
ATOM   330  O O   . LEU A 1 45 ? 6.926  -11.045 -27.979 1.00 51.51  ? 57  LEU A O   1 
ATOM   331  C CB  . LEU A 1 45 ? 7.257  -13.987 -27.739 1.00 54.46  ? 57  LEU A CB  1 
ATOM   332  C CG  . LEU A 1 45 ? 7.615  -15.008 -28.823 1.00 59.86  ? 57  LEU A CG  1 
ATOM   333  C CD1 . LEU A 1 45 ? 7.991  -14.326 -30.126 1.00 52.90  ? 57  LEU A CD1 1 
ATOM   334  C CD2 . LEU A 1 45 ? 8.730  -15.905 -28.337 1.00 58.28  ? 57  LEU A CD2 1 
ATOM   335  N N   . ASP A 1 46 ? 7.649  -11.072 -25.850 1.00 46.69  ? 58  ASP A N   1 
ATOM   336  C CA  . ASP A 1 46 ? 7.076  -9.757  -25.577 1.00 47.96  ? 58  ASP A CA  1 
ATOM   337  C C   . ASP A 1 46 ? 7.710  -8.710  -26.498 1.00 44.64  ? 58  ASP A C   1 
ATOM   338  O O   . ASP A 1 46 ? 8.931  -8.585  -26.549 1.00 47.61  ? 58  ASP A O   1 
ATOM   339  C CB  . ASP A 1 46 ? 7.313  -9.348  -24.127 1.00 51.42  ? 58  ASP A CB  1 
ATOM   340  C CG  . ASP A 1 46 ? 6.405  -10.064 -23.152 1.00 48.89  ? 58  ASP A CG  1 
ATOM   341  O OD1 . ASP A 1 46 ? 5.458  -10.758 -23.583 1.00 48.71  ? 58  ASP A OD1 1 
ATOM   342  O OD2 . ASP A 1 46 ? 6.654  -9.913  -21.939 1.00 50.64  ? 58  ASP A OD2 1 
ATOM   343  N N   . THR A 1 47 ? 6.886  -7.962  -27.220 1.00 46.03  ? 59  THR A N   1 
ATOM   344  C CA  . THR A 1 47 ? 7.392  -6.885  -28.079 1.00 47.34  ? 59  THR A CA  1 
ATOM   345  C C   . THR A 1 47 ? 7.294  -5.589  -27.284 1.00 47.28  ? 59  THR A C   1 
ATOM   346  O O   . THR A 1 47 ? 6.282  -5.327  -26.655 1.00 50.81  ? 59  THR A O   1 
ATOM   347  C CB  . THR A 1 47 ? 6.626  -6.804  -29.431 1.00 46.61  ? 59  THR A CB  1 
ATOM   348  O OG1 . THR A 1 47 ? 6.739  -8.058  -30.116 1.00 49.79  ? 59  THR A OG1 1 
ATOM   349  C CG2 . THR A 1 47 ? 7.180  -5.716  -30.339 1.00 42.80  ? 59  THR A CG2 1 
ATOM   350  N N   . VAL A 1 48 ? 8.363  -4.799  -27.315 1.00 47.94  ? 60  VAL A N   1 
ATOM   351  C CA  . VAL A 1 48 ? 8.507  -3.627  -26.468 1.00 40.68  ? 60  VAL A CA  1 
ATOM   352  C C   . VAL A 1 48 ? 8.038  -2.374  -27.198 1.00 46.06  ? 60  VAL A C   1 
ATOM   353  O O   . VAL A 1 48 ? 8.565  -2.004  -28.253 1.00 47.52  ? 60  VAL A O   1 
ATOM   354  C CB  . VAL A 1 48 ? 9.964  -3.438  -26.006 1.00 44.89  ? 60  VAL A CB  1 
ATOM   355  C CG1 . VAL A 1 48 ? 10.032 -2.363  -24.917 1.00 46.68  ? 60  VAL A CG1 1 
ATOM   356  C CG2 . VAL A 1 48 ? 10.546 -4.751  -25.487 1.00 39.63  ? 60  VAL A CG2 1 
ATOM   357  N N   . LEU A 1 49 ? 7.039  -1.719  -26.616 1.00 49.32  ? 61  LEU A N   1 
ATOM   358  C CA  . LEU A 1 49 ? 6.430  -0.541  -27.205 1.00 46.64  ? 61  LEU A CA  1 
ATOM   359  C C   . LEU A 1 49 ? 6.886  0.731   -26.519 1.00 42.46  ? 61  LEU A C   1 
ATOM   360  O O   . LEU A 1 49 ? 7.026  1.763   -27.166 1.00 48.58  ? 61  LEU A O   1 
ATOM   361  C CB  . LEU A 1 49 ? 4.908  -0.669  -27.146 1.00 48.30  ? 61  LEU A CB  1 
ATOM   362  C CG  . LEU A 1 49 ? 4.337  -1.979  -27.707 1.00 54.02  ? 61  LEU A CG  1 
ATOM   363  C CD1 . LEU A 1 49 ? 2.823  -2.043  -27.449 1.00 40.58  ? 61  LEU A CD1 1 
ATOM   364  C CD2 . LEU A 1 49 ? 4.680  -2.158  -29.207 1.00 39.74  ? 61  LEU A CD2 1 
ATOM   365  N N   . GLN A 1 50 ? 7.107  0.656   -25.211 1.00 43.86  ? 62  GLN A N   1 
ATOM   366  C CA  . GLN A 1 50 ? 7.442  1.818   -24.389 1.00 42.38  ? 62  GLN A CA  1 
ATOM   367  C C   . GLN A 1 50 ? 8.379  1.439   -23.247 1.00 46.59  ? 62  GLN A C   1 
ATOM   368  O O   . GLN A 1 50 ? 8.232  0.371   -22.626 1.00 44.13  ? 62  GLN A O   1 
ATOM   369  C CB  . GLN A 1 50 ? 6.179  2.449   -23.794 1.00 44.12  ? 62  GLN A CB  1 
ATOM   370  C CG  . GLN A 1 50 ? 6.373  3.878   -23.304 1.00 40.13  ? 62  GLN A CG  1 
ATOM   371  C CD  . GLN A 1 50 ? 5.066  4.609   -23.083 1.00 44.76  ? 62  GLN A CD  1 
ATOM   372  O OE1 . GLN A 1 50 ? 4.478  4.524   -22.012 1.00 48.19  ? 62  GLN A OE1 1 
ATOM   373  N NE2 . GLN A 1 50 ? 4.611  5.345   -24.094 1.00 34.03  ? 62  GLN A NE2 1 
ATOM   374  N N   . LEU A 1 51 ? 9.341  2.328   -22.993 1.00 45.93  ? 63  LEU A N   1 
ATOM   375  C CA  . LEU A 1 51 ? 10.233 2.252   -21.850 1.00 49.28  ? 63  LEU A CA  1 
ATOM   376  C C   . LEU A 1 51 ? 10.057 3.543   -21.035 1.00 48.26  ? 63  LEU A C   1 
ATOM   377  O O   . LEU A 1 51 ? 10.363 4.637   -21.510 1.00 40.96  ? 63  LEU A O   1 
ATOM   378  C CB  . LEU A 1 51 ? 11.679 2.130   -22.322 1.00 51.06  ? 63  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 51 ? 12.740 2.316   -21.246 1.00 47.47  ? 63  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 51 ? 12.727 1.106   -20.363 1.00 38.70  ? 63  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 51 ? 14.104 2.532   -21.874 1.00 51.23  ? 63  LEU A CD2 1 
ATOM   382  N N   . ASN A 1 52 ? 9.569  3.402   -19.811 1.00 48.58  ? 64  ASN A N   1 
ATOM   383  C CA  . ASN A 1 52 ? 9.265  4.564   -18.958 1.00 50.20  ? 64  ASN A CA  1 
ATOM   384  C C   . ASN A 1 52 ? 8.345  5.538   -19.713 1.00 50.62  ? 64  ASN A C   1 
ATOM   385  O O   . ASN A 1 52 ? 7.299  5.113   -20.190 1.00 53.36  ? 64  ASN A O   1 
ATOM   386  C CB  . ASN A 1 52 ? 10.574 5.173   -18.409 1.00 42.39  ? 64  ASN A CB  1 
ATOM   387  C CG  . ASN A 1 52 ? 11.348 4.167   -17.528 1.00 55.54  ? 64  ASN A CG  1 
ATOM   388  O OD1 . ASN A 1 52 ? 10.757 3.230   -16.983 1.00 52.23  ? 64  ASN A OD1 1 
ATOM   389  N ND2 . ASN A 1 52 ? 12.663 4.341   -17.415 1.00 45.18  ? 64  ASN A ND2 1 
ATOM   390  N N   . GLU A 1 53 ? 8.708  6.808   -19.859 1.00 51.69  ? 65  GLU A N   1 
ATOM   391  C CA  . GLU A 1 53 ? 7.816  7.751   -20.551 1.00 58.48  ? 65  GLU A CA  1 
ATOM   392  C C   . GLU A 1 53 ? 7.910  7.678   -22.086 1.00 57.19  ? 65  GLU A C   1 
ATOM   393  O O   . GLU A 1 53 ? 7.028  8.180   -22.786 1.00 57.89  ? 65  GLU A O   1 
ATOM   394  C CB  . GLU A 1 53 ? 8.098  9.193   -20.090 1.00 56.07  ? 65  GLU A CB  1 
ATOM   395  N N   . ARG A 1 54 ? 8.944  7.008   -22.591 1.00 56.74  ? 66  ARG A N   1 
ATOM   396  C CA  A ARG A 1 54 ? 9.320  7.113   -23.998 0.50 55.40  ? 66  ARG A CA  1 
ATOM   397  C CA  B ARG A 1 54 ? 9.350  7.108   -24.000 0.50 56.15  ? 66  ARG A CA  1 
ATOM   398  C C   . ARG A 1 54 ? 8.870  5.945   -24.872 1.00 49.80  ? 66  ARG A C   1 
ATOM   399  O O   . ARG A 1 54 ? 9.238  4.805   -24.624 1.00 47.35  ? 66  ARG A O   1 
ATOM   400  C CB  A ARG A 1 54 ? 10.834 7.276   -24.099 0.50 56.93  ? 66  ARG A CB  1 
ATOM   401  C CB  B ARG A 1 54 ? 10.883 7.187   -24.086 0.50 56.78  ? 66  ARG A CB  1 
ATOM   402  C CG  A ARG A 1 54 ? 11.319 8.541   -23.403 0.50 60.63  ? 66  ARG A CG  1 
ATOM   403  C CG  B ARG A 1 54 ? 11.467 8.451   -23.455 0.50 60.34  ? 66  ARG A CG  1 
ATOM   404  C CD  A ARG A 1 54 ? 12.661 8.999   -23.925 0.50 65.01  ? 66  ARG A CD  1 
ATOM   405  C CD  B ARG A 1 54 ? 13.001 8.487   -23.479 0.50 60.60  ? 66  ARG A CD  1 
ATOM   406  N NE  A ARG A 1 54 ? 13.773 8.292   -23.300 0.50 61.29  ? 66  ARG A NE  1 
ATOM   407  N NE  B ARG A 1 54 ? 13.569 8.523   -24.833 0.50 65.78  ? 66  ARG A NE  1 
ATOM   408  C CZ  A ARG A 1 54 ? 15.028 8.327   -23.738 0.50 56.26  ? 66  ARG A CZ  1 
ATOM   409  C CZ  B ARG A 1 54 ? 13.557 9.582   -25.648 0.50 60.10  ? 66  ARG A CZ  1 
ATOM   410  N NH1 A ARG A 1 54 ? 15.954 7.649   -23.086 0.50 44.66  ? 66  ARG A NH1 1 
ATOM   411  N NH1 B ARG A 1 54 ? 14.109 9.484   -26.851 0.50 47.73  ? 66  ARG A NH1 1 
ATOM   412  N NH2 A ARG A 1 54 ? 15.366 9.030   -24.823 0.50 54.17  ? 66  ARG A NH2 1 
ATOM   413  N NH2 B ARG A 1 54 ? 13.004 10.739  -25.280 0.50 55.67  ? 66  ARG A NH2 1 
ATOM   414  N N   . PRO A 1 55 ? 8.064  6.232   -25.915 1.00 48.58  ? 67  PRO A N   1 
ATOM   415  C CA  . PRO A 1 55 ? 7.767  5.177   -26.886 1.00 50.52  ? 67  PRO A CA  1 
ATOM   416  C C   . PRO A 1 55 ? 9.016  4.760   -27.671 1.00 48.18  ? 67  PRO A C   1 
ATOM   417  O O   . PRO A 1 55 ? 9.795  5.612   -28.109 1.00 53.27  ? 67  PRO A O   1 
ATOM   418  C CB  . PRO A 1 55 ? 6.743  5.829   -27.815 1.00 47.95  ? 67  PRO A CB  1 
ATOM   419  C CG  . PRO A 1 55 ? 6.956  7.248   -27.672 1.00 51.92  ? 67  PRO A CG  1 
ATOM   420  C CD  . PRO A 1 55 ? 7.378  7.485   -26.271 1.00 50.85  ? 67  PRO A CD  1 
ATOM   421  N N   . VAL A 1 56 ? 9.201  3.462   -27.848 1.00 47.01  ? 68  VAL A N   1 
ATOM   422  C CA  . VAL A 1 56 ? 10.429 2.940   -28.417 1.00 46.08  ? 68  VAL A CA  1 
ATOM   423  C C   . VAL A 1 56 ? 10.154 1.940   -29.555 1.00 48.32  ? 68  VAL A C   1 
ATOM   424  O O   . VAL A 1 56 ? 10.960 1.027   -29.789 1.00 49.70  ? 68  VAL A O   1 
ATOM   425  C CB  . VAL A 1 56 ? 11.281 2.289   -27.290 1.00 50.49  ? 68  VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 56 ? 11.591 3.306   -26.170 1.00 46.58  ? 68  VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 56 ? 10.574 1.078   -26.709 1.00 42.93  ? 68  VAL A CG2 1 
ATOM   428  N N   . GLU A 1 57 ? 9.061  2.152   -30.300 1.00 48.55  ? 69  GLU A N   1 
ATOM   429  C CA  . GLU A 1 57 ? 8.581  1.191   -31.324 1.00 52.08  ? 69  GLU A CA  1 
ATOM   430  C C   . GLU A 1 57 ? 9.635  0.742   -32.339 1.00 52.76  ? 69  GLU A C   1 
ATOM   431  O O   . GLU A 1 57 ? 9.472  -0.254  -33.034 1.00 49.37  ? 69  GLU A O   1 
ATOM   432  C CB  . GLU A 1 57 ? 7.266  1.613   -31.963 1.00 56.23  ? 69  GLU A CB  1 
ATOM   433  C CG  . GLU A 1 57 ? 6.073  1.491   -30.994 1.00 56.42  ? 69  GLU A CG  1 
ATOM   434  C CD  . GLU A 1 57 ? 5.771  2.785   -30.240 1.00 67.07  ? 69  GLU A CD  1 
ATOM   435  O OE1 . GLU A 1 57 ? 6.703  3.562   -29.946 1.00 59.16  ? 69  GLU A OE1 1 
ATOM   436  O OE2 . GLU A 1 57 ? 4.585  3.027   -29.946 1.00 68.41  ? 69  GLU A OE2 1 
ATOM   437  N N   . HIS A 1 58 ? 10.718 1.475   -32.471 1.00 55.00  ? 70  HIS A N   1 
ATOM   438  C CA  . HIS A 1 58 ? 11.068 2.383   -33.556 1.00 54.23  ? 70  HIS A CA  1 
ATOM   439  C C   . HIS A 1 58 ? 12.603 2.464   -33.323 1.00 48.00  ? 70  HIS A C   1 
ATOM   440  O O   . HIS A 1 58 ? 13.352 2.811   -34.205 1.00 50.07  ? 70  HIS A O   1 
ATOM   441  C CB  . HIS A 1 58 ? 10.283 3.708   -33.658 1.00 58.35  ? 70  HIS A CB  1 
ATOM   442  C CG  . HIS A 1 58 ? 10.845 4.857   -32.876 1.00 66.95  ? 70  HIS A CG  1 
ATOM   443  N ND1 . HIS A 1 58 ? 11.850 5.668   -33.363 1.00 55.73  ? 70  HIS A ND1 1 
ATOM   444  C CD2 . HIS A 1 58 ? 10.466 5.398   -31.693 1.00 64.25  ? 70  HIS A CD2 1 
ATOM   445  C CE1 . HIS A 1 58 ? 12.103 6.625   -32.488 1.00 59.70  ? 70  HIS A CE1 1 
ATOM   446  N NE2 . HIS A 1 58 ? 11.273 6.488   -31.469 1.00 68.98  ? 70  HIS A NE2 1 
ATOM   447  N N   . TRP A 1 59 ? 13.035 1.998   -32.144 1.00 45.74  ? 71  TRP A N   1 
ATOM   448  C CA  . TRP A 1 59 ? 14.419 1.964   -31.713 1.00 47.21  ? 71  TRP A CA  1 
ATOM   449  C C   . TRP A 1 59 ? 15.076 0.638   -32.080 1.00 48.54  ? 71  TRP A C   1 
ATOM   450  O O   . TRP A 1 59 ? 14.418 -0.408  -32.187 1.00 44.42  ? 71  TRP A O   1 
ATOM   451  C CB  . TRP A 1 59 ? 14.487 2.067   -30.193 1.00 47.75  ? 71  TRP A CB  1 
ATOM   452  C CG  . TRP A 1 59 ? 14.209 3.402   -29.638 1.00 49.14  ? 71  TRP A CG  1 
ATOM   453  C CD1 . TRP A 1 59 ? 13.516 4.417   -30.221 1.00 48.24  ? 71  TRP A CD1 1 
ATOM   454  C CD2 . TRP A 1 59 ? 14.604 3.869   -28.355 1.00 49.86  ? 71  TRP A CD2 1 
ATOM   455  N NE1 . TRP A 1 59 ? 13.466 5.492   -29.388 1.00 43.03  ? 71  TRP A NE1 1 
ATOM   456  C CE2 . TRP A 1 59 ? 14.133 5.188   -28.232 1.00 48.30  ? 71  TRP A CE2 1 
ATOM   457  C CE3 . TRP A 1 59 ? 15.312 3.295   -27.290 1.00 52.69  ? 71  TRP A CE3 1 
ATOM   458  C CZ2 . TRP A 1 59 ? 14.342 5.952   -27.088 1.00 49.40  ? 71  TRP A CZ2 1 
ATOM   459  C CZ3 . TRP A 1 59 ? 15.524 4.051   -26.156 1.00 57.32  ? 71  TRP A CZ3 1 
ATOM   460  C CH2 . TRP A 1 59 ? 15.043 5.373   -26.064 1.00 52.17  ? 71  TRP A CH2 1 
ATOM   461  N N   . LYS A 1 60 ? 16.393 0.700   -32.212 1.00 46.94  ? 72  LYS A N   1 
ATOM   462  C CA  . LYS A 1 60 ? 17.213 -0.479  -32.417 1.00 46.81  ? 72  LYS A CA  1 
ATOM   463  C C   . LYS A 1 60 ? 17.470 -1.184  -31.098 1.00 46.34  ? 72  LYS A C   1 
ATOM   464  O O   . LYS A 1 60 ? 17.361 -0.599  -30.019 1.00 44.64  ? 72  LYS A O   1 
ATOM   465  C CB  . LYS A 1 60 ? 18.531 -0.100  -33.092 1.00 45.28  ? 72  LYS A CB  1 
ATOM   466  C CG  . LYS A 1 60 ? 18.330 0.612   -34.436 1.00 42.99  ? 72  LYS A CG  1 
ATOM   467  C CD  . LYS A 1 60 ? 19.549 0.537   -35.342 1.00 52.22  ? 72  LYS A CD  1 
ATOM   468  C CE  . LYS A 1 60 ? 20.576 1.610   -35.010 1.00 52.97  ? 72  LYS A CE  1 
ATOM   469  N N   . CYS A 1 61 ? 17.789 -2.462  -31.208 1.00 48.58  ? 73  CYS A N   1 
ATOM   470  C CA  . CYS A 1 61 ? 18.136 -3.285  -30.059 1.00 49.51  ? 73  CYS A CA  1 
ATOM   471  C C   . CYS A 1 61 ? 19.222 -2.657  -29.198 1.00 46.23  ? 73  CYS A C   1 
ATOM   472  O O   . CYS A 1 61 ? 19.070 -2.555  -28.004 1.00 48.51  ? 73  CYS A O   1 
ATOM   473  C CB  . CYS A 1 61 ? 18.641 -4.644  -30.532 1.00 48.29  ? 73  CYS A CB  1 
ATOM   474  S SG  . CYS A 1 61 ? 18.592 -5.830  -29.238 1.00 57.41  ? 73  CYS A SG  1 
ATOM   475  N N   . VAL A 1 62 ? 20.325 -2.262  -29.821 1.00 52.17  ? 74  VAL A N   1 
ATOM   476  C CA  . VAL A 1 62 ? 21.474 -1.701  -29.104 1.00 51.28  ? 74  VAL A CA  1 
ATOM   477  C C   . VAL A 1 62 ? 21.153 -0.346  -28.433 1.00 50.47  ? 74  VAL A C   1 
ATOM   478  O O   . VAL A 1 62 ? 21.676 -0.046  -27.361 1.00 53.44  ? 74  VAL A O   1 
ATOM   479  C CB  . VAL A 1 62 ? 22.699 -1.552  -30.043 1.00 52.01  ? 74  VAL A CB  1 
ATOM   480  C CG1 . VAL A 1 62 ? 23.908 -1.042  -29.273 1.00 61.71  ? 74  VAL A CG1 1 
ATOM   481  C CG2 . VAL A 1 62 ? 23.035 -2.887  -30.707 1.00 46.09  ? 74  VAL A CG2 1 
ATOM   482  N N   . GLU A 1 63 ? 20.294 0.456   -29.056 1.00 49.08  ? 75  GLU A N   1 
ATOM   483  C CA  . GLU A 1 63 ? 19.832 1.710   -28.447 1.00 51.80  ? 75  GLU A CA  1 
ATOM   484  C C   . GLU A 1 63 ? 19.062 1.393   -27.169 1.00 51.03  ? 75  GLU A C   1 
ATOM   485  O O   . GLU A 1 63 ? 19.342 1.958   -26.117 1.00 50.06  ? 75  GLU A O   1 
ATOM   486  C CB  . GLU A 1 63 ? 18.954 2.528   -29.419 1.00 48.19  ? 75  GLU A CB  1 
ATOM   487  C CG  . GLU A 1 63 ? 19.717 3.096   -30.638 1.00 56.64  ? 75  GLU A CG  1 
ATOM   488  C CD  . GLU A 1 63 ? 18.813 3.712   -31.738 1.00 58.02  ? 75  GLU A CD  1 
ATOM   489  O OE1 . GLU A 1 63 ? 17.618 3.354   -31.852 1.00 55.41  ? 75  GLU A OE1 1 
ATOM   490  O OE2 . GLU A 1 63 ? 19.318 4.550   -32.522 1.00 57.31  ? 75  GLU A OE2 1 
ATOM   491  N N   . LEU A 1 64 ? 18.110 0.466   -27.253 1.00 52.59  ? 76  LEU A N   1 
ATOM   492  C CA  . LEU A 1 64 ? 17.262 0.159   -26.104 1.00 50.70  ? 76  LEU A CA  1 
ATOM   493  C C   . LEU A 1 64 ? 18.066 -0.416  -24.956 1.00 46.11  ? 76  LEU A C   1 
ATOM   494  O O   . LEU A 1 64 ? 17.884 0.000   -23.822 1.00 47.13  ? 76  LEU A O   1 
ATOM   495  C CB  . LEU A 1 64 ? 16.138 -0.803  -26.477 1.00 52.02  ? 76  LEU A CB  1 
ATOM   496  C CG  . LEU A 1 64 ? 15.029 -0.982  -25.425 1.00 50.64  ? 76  LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 64 ? 14.143 0.246   -25.374 1.00 47.73  ? 76  LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 64 ? 14.194 -2.242  -25.728 1.00 49.37  ? 76  LEU A CD2 1 
ATOM   499  N N   . ALA A 1 65 ? 18.950 -1.364  -25.246 1.00 44.69  ? 77  ALA A N   1 
ATOM   500  C CA  . ALA A 1 65 ? 19.834 -1.950  -24.213 1.00 45.14  ? 77  ALA A CA  1 
ATOM   501  C C   . ALA A 1 65 ? 20.613 -0.860  -23.460 1.00 43.59  ? 77  ALA A C   1 
ATOM   502  O O   . ALA A 1 65 ? 20.702 -0.875  -22.244 1.00 48.02  ? 77  ALA A O   1 
ATOM   503  C CB  . ALA A 1 65 ? 20.805 -2.934  -24.841 1.00 38.77  ? 77  ALA A CB  1 
ATOM   504  N N   . HIS A 1 66 ? 21.176 0.077   -24.207 1.00 43.12  ? 78  HIS A N   1 
ATOM   505  C CA  . HIS A 1 66 ? 21.914 1.186   -23.629 1.00 45.34  ? 78  HIS A CA  1 
ATOM   506  C C   . HIS A 1 66 ? 21.045 1.987   -22.669 1.00 47.05  ? 78  HIS A C   1 
ATOM   507  O O   . HIS A 1 66 ? 21.508 2.387   -21.598 1.00 47.93  ? 78  HIS A O   1 
ATOM   508  C CB  . HIS A 1 66 ? 22.439 2.108   -24.735 1.00 43.86  ? 78  HIS A CB  1 
ATOM   509  C CG  . HIS A 1 66 ? 23.157 3.309   -24.217 1.00 48.91  ? 78  HIS A CG  1 
ATOM   510  N ND1 . HIS A 1 66 ? 24.530 3.358   -24.097 1.00 57.56  ? 78  HIS A ND1 1 
ATOM   511  C CD2 . HIS A 1 66 ? 22.694 4.501   -23.768 1.00 45.07  ? 78  HIS A CD2 1 
ATOM   512  C CE1 . HIS A 1 66 ? 24.884 4.532   -23.602 1.00 55.95  ? 78  HIS A CE1 1 
ATOM   513  N NE2 . HIS A 1 66 ? 23.789 5.242   -23.389 1.00 54.80  ? 78  HIS A NE2 1 
ATOM   514  N N   . GLU A 1 67 ? 19.793 2.221   -23.063 1.00 46.84  ? 79  GLU A N   1 
ATOM   515  C CA  . GLU A 1 67 ? 18.875 3.028   -22.264 1.00 48.51  ? 79  GLU A CA  1 
ATOM   516  C C   . GLU A 1 67 ? 18.395 2.278   -21.023 1.00 49.05  ? 79  GLU A C   1 
ATOM   517  O O   . GLU A 1 67 ? 18.295 2.851   -19.933 1.00 48.66  ? 79  GLU A O   1 
ATOM   518  C CB  . GLU A 1 67 ? 17.675 3.475   -23.093 1.00 47.98  ? 79  GLU A CB  1 
ATOM   519  C CG  . GLU A 1 67 ? 17.211 4.874   -22.750 1.00 61.72  ? 79  GLU A CG  1 
ATOM   520  C CD  . GLU A 1 67 ? 18.343 5.902   -22.866 1.00 69.98  ? 79  GLU A CD  1 
ATOM   521  O OE1 . GLU A 1 67 ? 19.022 5.941   -23.916 1.00 67.44  ? 79  GLU A OE1 1 
ATOM   522  O OE2 . GLU A 1 67 ? 18.553 6.666   -21.901 1.00 76.49  ? 79  GLU A OE2 1 
ATOM   523  N N   . ILE A 1 68 ? 18.104 0.998   -21.199 1.00 44.24  ? 80  ILE A N   1 
ATOM   524  C CA  . ILE A 1 68 ? 17.713 0.147   -20.094 1.00 46.37  ? 80  ILE A CA  1 
ATOM   525  C C   . ILE A 1 68 ? 18.806 0.151   -19.037 1.00 44.87  ? 80  ILE A C   1 
ATOM   526  O O   . ILE A 1 68 ? 18.523 0.384   -17.875 1.00 48.95  ? 80  ILE A O   1 
ATOM   527  C CB  . ILE A 1 68 ? 17.426 -1.303  -20.555 1.00 45.16  ? 80  ILE A CB  1 
ATOM   528  C CG1 . ILE A 1 68 ? 16.093 -1.341  -21.297 1.00 51.77  ? 80  ILE A CG1 1 
ATOM   529  C CG2 . ILE A 1 68 ? 17.379 -2.265  -19.358 1.00 39.33  ? 80  ILE A CG2 1 
ATOM   530  C CD1 . ILE A 1 68 ? 15.746 -2.692  -21.934 1.00 45.66  ? 80  ILE A CD1 1 
ATOM   531  N N   . ARG A 1 69 ? 20.053 -0.069  -19.447 1.00 45.18  ? 81  ARG A N   1 
ATOM   532  C CA  . ARG A 1 69 ? 21.160 -0.132  -18.501 1.00 45.32  ? 81  ARG A CA  1 
ATOM   533  C C   . ARG A 1 69 ? 21.433 1.180   -17.783 0.50 42.86  ? 81  ARG A C   1 
ATOM   534  O O   . ARG A 1 69 ? 22.109 1.186   -16.768 1.00 47.08  ? 81  ARG A O   1 
ATOM   535  C CB  . ARG A 1 69 ? 22.428 -0.611  -19.189 1.00 43.80  ? 81  ARG A CB  1 
ATOM   536  C CG  . ARG A 1 69 ? 22.362 -2.063  -19.600 1.00 52.45  ? 81  ARG A CG  1 
ATOM   537  C CD  . ARG A 1 69 ? 23.601 -2.457  -20.357 1.00 50.99  ? 81  ARG A CD  1 
ATOM   538  N NE  . ARG A 1 69 ? 24.793 -2.342  -19.519 1.00 62.14  ? 81  ARG A NE  1 
ATOM   539  C CZ  . ARG A 1 69 ? 26.043 -2.394  -19.971 1.00 63.24  ? 81  ARG A CZ  1 
ATOM   540  N NH1 . ARG A 1 69 ? 27.042 -2.268  -19.121 1.00 56.52  ? 81  ARG A NH1 1 
ATOM   541  N NH2 . ARG A 1 69 ? 26.301 -2.578  -21.264 1.00 74.44  ? 81  ARG A NH2 1 
ATOM   542  N N   . SER A 1 70 ? 20.904 2.279   -18.311 1.00 43.72  ? 82  SER A N   1 
ATOM   543  C CA  . SER A 1 70 ? 21.095 3.614   -17.740 1.00 43.55  ? 82  SER A CA  1 
ATOM   544  C C   . SER A 1 70 ? 19.978 4.065   -16.818 1.00 43.98  ? 82  SER A C   1 
ATOM   545  O O   . SER A 1 70 ? 20.035 5.179   -16.316 1.00 49.93  ? 82  SER A O   1 
ATOM   546  C CB  . SER A 1 70 ? 21.210 4.644   -18.868 1.00 44.24  ? 82  SER A CB  1 
ATOM   547  O OG  . SER A 1 70 ? 22.229 4.279   -19.779 1.00 52.08  ? 82  SER A OG  1 
ATOM   548  N N   . CYS A 1 71 ? 18.954 3.242   -16.605 1.00 44.88  ? 83  CYS A N   1 
ATOM   549  C CA  . CYS A 1 71 ? 17.889 3.604   -15.667 1.00 49.69  ? 83  CYS A CA  1 
ATOM   550  C C   . CYS A 1 71 ? 18.308 3.285   -14.233 1.00 50.87  ? 83  CYS A C   1 
ATOM   551  O O   . CYS A 1 71 ? 18.764 2.193   -13.968 1.00 52.65  ? 83  CYS A O   1 
ATOM   552  C CB  . CYS A 1 71 ? 16.590 2.874   -16.002 1.00 54.70  ? 83  CYS A CB  1 
ATOM   553  S SG  . CYS A 1 71 ? 15.931 3.362   -17.592 1.00 57.79  ? 83  CYS A SG  1 
ATOM   554  N N   . PRO A 1 72 ? 18.155 4.246   -13.310 1.00 51.26  ? 84  PRO A N   1 
ATOM   555  C CA  . PRO A 1 72 ? 18.667 4.042   -11.960 1.00 50.89  ? 84  PRO A CA  1 
ATOM   556  C C   . PRO A 1 72 ? 17.995 2.965   -11.108 1.00 52.77  ? 84  PRO A C   1 
ATOM   557  O O   . PRO A 1 72 ? 18.692 2.167   -10.474 1.00 56.99  ? 84  PRO A O   1 
ATOM   558  C CB  . PRO A 1 72 ? 18.478 5.411   -11.293 1.00 51.32  ? 84  PRO A CB  1 
ATOM   559  C CG  . PRO A 1 72 ? 18.153 6.370   -12.387 1.00 51.51  ? 84  PRO A CG  1 
ATOM   560  C CD  . PRO A 1 72 ? 17.554 5.584   -13.484 1.00 49.34  ? 84  PRO A CD  1 
ATOM   561  N N   . SER A 1 73 ? 16.669 2.949   -11.063 1.00 49.76  ? 85  SER A N   1 
ATOM   562  C CA  . SER A 1 73 ? 15.973 2.245   -9.989  1.00 49.98  ? 85  SER A CA  1 
ATOM   563  C C   . SER A 1 73 ? 15.028 1.170   -10.494 1.00 50.32  ? 85  SER A C   1 
ATOM   564  O O   . SER A 1 73 ? 14.978 0.060   -9.953  0.50 42.78  ? 85  SER A O   1 
ATOM   565  C CB  . SER A 1 73 ? 15.215 3.268   -9.135  1.00 53.93  ? 85  SER A CB  1 
ATOM   566  O OG  . SER A 1 73 ? 16.092 4.292   -8.673  1.00 57.64  ? 85  SER A OG  1 
ATOM   567  N N   . GLU A 1 74 ? 14.270 1.515   -11.527 1.00 55.29  ? 86  GLU A N   1 
ATOM   568  C CA  . GLU A 1 74 ? 13.361 0.575   -12.158 1.00 58.36  ? 86  GLU A CA  1 
ATOM   569  C C   . GLU A 1 74 ? 12.972 1.027   -13.551 1.00 57.09  ? 86  GLU A C   1 
ATOM   570  O O   . GLU A 1 74 ? 12.983 2.227   -13.859 1.00 55.51  ? 86  GLU A O   1 
ATOM   571  C CB  . GLU A 1 74 ? 12.087 0.416   -11.322 1.00 58.94  ? 86  GLU A CB  1 
ATOM   572  C CG  . GLU A 1 74 ? 11.113 1.575   -11.418 1.00 60.90  ? 86  GLU A CG  1 
ATOM   573  C CD  . GLU A 1 74 ? 9.869  1.361   -10.569 1.00 59.80  ? 86  GLU A CD  1 
ATOM   574  O OE1 . GLU A 1 74 ? 9.875  0.433   -9.737  1.00 67.45  ? 86  GLU A OE1 1 
ATOM   575  O OE2 . GLU A 1 74 ? 8.891  2.125   -10.733 1.00 69.19  ? 86  GLU A OE2 1 
ATOM   576  N N   . ILE A 1 75 ? 12.609 0.050   -14.377 1.00 52.71  ? 87  ILE A N   1 
ATOM   577  C CA  . ILE A 1 75 ? 12.042 0.321   -15.676 1.00 50.09  ? 87  ILE A CA  1 
ATOM   578  C C   . ILE A 1 75 ? 10.574 -0.077  -15.633 1.00 54.23  ? 87  ILE A C   1 
ATOM   579  O O   . ILE A 1 75 ? 10.185 -1.003  -14.926 1.00 50.45  ? 87  ILE A O   1 
ATOM   580  C CB  . ILE A 1 75 ? 12.767 -0.436  -16.825 1.00 52.92  ? 87  ILE A CB  1 
ATOM   581  C CG1 . ILE A 1 75 ? 12.795 -1.949  -16.577 1.00 48.27  ? 87  ILE A CG1 1 
ATOM   582  C CG2 . ILE A 1 75 ? 14.181 0.109   -17.019 1.00 48.38  ? 87  ILE A CG2 1 
ATOM   583  C CD1 . ILE A 1 75 ? 13.303 -2.772  -17.792 1.00 45.41  ? 87  ILE A CD1 1 
ATOM   584  N N   . ILE A 1 76 ? 9.758  0.664   -16.370 1.00 57.46  ? 88  ILE A N   1 
ATOM   585  C CA  . ILE A 1 76 ? 8.375  0.292   -16.609 1.00 53.54  ? 88  ILE A CA  1 
ATOM   586  C C   . ILE A 1 76 ? 8.283  0.111   -18.106 1.00 50.79  ? 88  ILE A C   1 
ATOM   587  O O   . ILE A 1 76 ? 8.483  1.066   -18.856 1.00 50.78  ? 88  ILE A O   1 
ATOM   588  C CB  . ILE A 1 76 ? 7.394  1.376   -16.168 1.00 53.39  ? 88  ILE A CB  1 
ATOM   589  C CG1 . ILE A 1 76 ? 7.668  1.781   -14.724 1.00 53.36  ? 88  ILE A CG1 1 
ATOM   590  C CG2 . ILE A 1 76 ? 5.955  0.873   -16.329 1.00 55.34  ? 88  ILE A CG2 1 
ATOM   591  C CD1 . ILE A 1 76 ? 7.070  3.137   -14.354 1.00 62.02  ? 88  ILE A CD1 1 
ATOM   592  N N   . LEU A 1 77 ? 8.036  -1.121  -18.539 1.00 50.12  ? 89  LEU A N   1 
ATOM   593  C CA  . LEU A 1 77 ? 7.918  -1.424  -19.957 1.00 48.60  ? 89  LEU A CA  1 
ATOM   594  C C   . LEU A 1 77 ? 6.472  -1.674  -20.273 1.00 49.75  ? 89  LEU A C   1 
ATOM   595  O O   . LEU A 1 77 ? 5.799  -2.386  -19.541 1.00 54.50  ? 89  LEU A O   1 
ATOM   596  C CB  . LEU A 1 77 ? 8.673  -2.692  -20.313 1.00 47.89  ? 89  LEU A CB  1 
ATOM   597  C CG  . LEU A 1 77 ? 10.168 -2.763  -20.081 1.00 56.10  ? 89  LEU A CG  1 
ATOM   598  C CD1 . LEU A 1 77 ? 10.634 -4.189  -20.482 1.00 49.66  ? 89  LEU A CD1 1 
ATOM   599  C CD2 . LEU A 1 77 ? 10.889 -1.671  -20.887 1.00 48.96  ? 89  LEU A CD2 1 
ATOM   600  N N   . LEU A 1 78 ? 5.991  -1.084  -21.359 1.00 48.48  ? 90  LEU A N   1 
ATOM   601  C CA  . LEU A 1 78 ? 4.730  -1.490  -21.914 1.00 46.69  ? 90  LEU A CA  1 
ATOM   602  C C   . LEU A 1 78 ? 5.034  -2.466  -23.053 1.00 47.64  ? 90  LEU A C   1 
ATOM   603  O O   . LEU A 1 78 ? 5.743  -2.132  -23.995 1.00 45.40  ? 90  LEU A O   1 
ATOM   604  C CB  . LEU A 1 78 ? 3.942  -0.293  -22.417 1.00 49.57  ? 90  LEU A CB  1 
ATOM   605  C CG  . LEU A 1 78 ? 2.539  -0.694  -22.852 1.00 53.47  ? 90  LEU A CG  1 
ATOM   606  C CD1 . LEU A 1 78 ? 1.661  -0.888  -21.627 1.00 41.69  ? 90  LEU A CD1 1 
ATOM   607  C CD2 . LEU A 1 78 ? 1.987  0.343   -23.782 1.00 52.97  ? 90  LEU A CD2 1 
ATOM   608  N N   . VAL A 1 79 ? 4.497  -3.675  -22.952 1.00 48.01  ? 91  VAL A N   1 
ATOM   609  C CA  . VAL A 1 79 ? 4.710  -4.689  -23.966 1.00 46.07  ? 91  VAL A CA  1 
ATOM   610  C C   . VAL A 1 79 ? 3.420  -5.154  -24.611 1.00 46.62  ? 91  VAL A C   1 
ATOM   611  O O   . VAL A 1 79 ? 2.336  -5.026  -24.057 1.00 43.73  ? 91  VAL A O   1 
ATOM   612  C CB  . VAL A 1 79 ? 5.457  -5.912  -23.412 1.00 44.42  ? 91  VAL A CB  1 
ATOM   613  C CG1 . VAL A 1 79 ? 6.796  -5.464  -22.833 1.00 41.23  ? 91  VAL A CG1 1 
ATOM   614  C CG2 . VAL A 1 79 ? 4.621  -6.637  -22.382 1.00 41.99  ? 91  VAL A CG2 1 
ATOM   615  N N   . TRP A 1 80 ? 3.593  -5.705  -25.803 1.00 49.33  ? 92  TRP A N   1 
ATOM   616  C CA  . TRP A 1 80 ? 2.543  -6.292  -26.600 1.00 48.96  ? 92  TRP A CA  1 
ATOM   617  C C   . TRP A 1 80 ? 2.854  -7.779  -26.658 1.00 46.14  ? 92  TRP A C   1 
ATOM   618  O O   . TRP A 1 80 ? 3.964  -8.159  -27.056 1.00 46.42  ? 92  TRP A O   1 
ATOM   619  C CB  . TRP A 1 80 ? 2.622  -5.661  -27.993 1.00 50.78  ? 92  TRP A CB  1 
ATOM   620  C CG  . TRP A 1 80 ? 1.402  -5.733  -28.829 1.00 54.69  ? 92  TRP A CG  1 
ATOM   621  C CD1 . TRP A 1 80 ? 0.119  -5.434  -28.457 1.00 53.94  ? 92  TRP A CD1 1 
ATOM   622  C CD2 . TRP A 1 80 ? 1.349  -6.090  -30.216 1.00 55.99  ? 92  TRP A CD2 1 
ATOM   623  N NE1 . TRP A 1 80 ? -0.731 -5.605  -29.528 1.00 53.63  ? 92  TRP A NE1 1 
ATOM   624  C CE2 . TRP A 1 80 ? -0.002 -6.001  -30.620 1.00 56.87  ? 92  TRP A CE2 1 
ATOM   625  C CE3 . TRP A 1 80 ? 2.315  -6.486  -31.155 1.00 55.09  ? 92  TRP A CE3 1 
ATOM   626  C CZ2 . TRP A 1 80 ? -0.413 -6.285  -31.931 1.00 61.50  ? 92  TRP A CZ2 1 
ATOM   627  C CZ3 . TRP A 1 80 ? 1.913  -6.767  -32.455 1.00 53.93  ? 92  TRP A CZ3 1 
ATOM   628  C CH2 . TRP A 1 80 ? 0.557  -6.673  -32.830 1.00 60.62  ? 92  TRP A CH2 1 
ATOM   629  N N   . ARG A 1 81 ? 1.910  -8.618  -26.243 1.00 43.72  ? 93  ARG A N   1 
ATOM   630  C CA  . ARG A 1 81 ? 2.122  -10.077 -26.271 1.00 46.13  ? 93  ARG A CA  1 
ATOM   631  C C   . ARG A 1 81 ? 0.920  -10.864 -26.758 1.00 48.05  ? 93  ARG A C   1 
ATOM   632  O O   . ARG A 1 81 ? -0.218 -10.415 -26.661 1.00 50.45  ? 93  ARG A O   1 
ATOM   633  C CB  . ARG A 1 81 ? 2.544  -10.613 -24.887 1.00 44.76  ? 93  ARG A CB  1 
ATOM   634  C CG  . ARG A 1 81 ? 1.434  -10.746 -23.856 1.00 44.70  ? 93  ARG A CG  1 
ATOM   635  C CD  . ARG A 1 81 ? 1.867  -11.434 -22.529 1.00 44.75  ? 93  ARG A CD  1 
ATOM   636  N NE  . ARG A 1 81 ? 3.019  -10.794 -21.879 1.00 54.30  ? 93  ARG A NE  1 
ATOM   637  C CZ  . ARG A 1 81 ? 3.256  -10.757 -20.561 1.00 43.10  ? 93  ARG A CZ  1 
ATOM   638  N NH1 . ARG A 1 81 ? 2.424  -11.289 -19.670 1.00 42.30  ? 93  ARG A NH1 1 
ATOM   639  N NH2 . ARG A 1 81 ? 4.352  -10.157 -20.127 1.00 44.92  ? 93  ARG A NH2 1 
ATOM   640  N N   . MET A 1 82 ? 1.193  -12.063 -27.256 1.00 50.23  ? 94  MET A N   1 
ATOM   641  C CA  . MET A 1 82 ? 0.156  -13.012 -27.608 1.00 50.38  ? 94  MET A CA  1 
ATOM   642  C C   . MET A 1 82 ? -0.308 -13.749 -26.356 1.00 52.07  ? 94  MET A C   1 
ATOM   643  O O   . MET A 1 82 ? 0.485  -14.422 -25.713 1.00 52.04  ? 94  MET A O   1 
ATOM   644  C CB  . MET A 1 82 ? 0.707  -14.015 -28.611 1.00 52.07  ? 94  MET A CB  1 
ATOM   645  C CG  . MET A 1 82 ? -0.288 -15.085 -29.040 1.00 60.12  ? 94  MET A CG  1 
ATOM   646  S SD  . MET A 1 82 ? -1.687 -14.346 -29.894 1.00 80.10  ? 94  MET A SD  1 
ATOM   647  N N   . VAL A 1 83 ? -1.590 -13.621 -26.026 1.00 54.57  ? 95  VAL A N   1 
ATOM   648  C CA  . VAL A 1 83 ? -2.191 -14.301 -24.875 1.00 56.98  ? 95  VAL A CA  1 
ATOM   649  C C   . VAL A 1 83 ? -3.477 -15.019 -25.283 1.00 57.05  ? 95  VAL A C   1 
ATOM   650  O O   . VAL A 1 83 ? -3.477 -15.869 -26.176 1.00 58.79  ? 95  VAL A O   1 
ATOM   651  C CB  . VAL A 1 83 ? -2.533 -13.300 -23.744 1.00 57.21  ? 95  VAL A CB  1 
ATOM   652  C CG1 . VAL A 1 83 ? -3.286 -13.990 -22.628 1.00 54.04  ? 95  VAL A CG1 1 
ATOM   653  C CG2 . VAL A 1 83 ? -1.283 -12.665 -23.207 1.00 57.44  ? 95  VAL A CG2 1 
ATOM   654  N N   . MET B 1 2  ? -1.879 -12.760 -35.235 1.00 56.43  ? 14  MET B N   1 
ATOM   655  C CA  . MET B 1 2  ? -3.321 -12.827 -35.612 1.00 59.99  ? 14  MET B CA  1 
ATOM   656  C C   . MET B 1 2  ? -3.577 -13.941 -36.618 1.00 60.73  ? 14  MET B C   1 
ATOM   657  O O   . MET B 1 2  ? -4.443 -14.797 -36.409 1.00 65.49  ? 14  MET B O   1 
ATOM   658  C CB  . MET B 1 2  ? -3.779 -11.492 -36.209 1.00 59.18  ? 14  MET B CB  1 
ATOM   659  C CG  . MET B 1 2  ? -4.601 -10.636 -35.277 1.00 57.88  ? 14  MET B CG  1 
ATOM   660  S SD  . MET B 1 2  ? -6.258 -11.292 -34.971 1.00 70.17  ? 14  MET B SD  1 
ATOM   661  C CE  . MET B 1 2  ? -6.799 -11.793 -36.609 1.00 56.16  ? 14  MET B CE  1 
ATOM   662  N N   . ARG B 1 3  ? -2.810 -13.922 -37.705 1.00 57.43  ? 15  ARG B N   1 
ATOM   663  C CA  . ARG B 1 3  ? -3.058 -14.787 -38.846 1.00 54.46  ? 15  ARG B CA  1 
ATOM   664  C C   . ARG B 1 3  ? -1.808 -15.551 -39.285 1.00 47.46  ? 15  ARG B C   1 
ATOM   665  O O   . ARG B 1 3  ? -0.679 -15.140 -39.026 1.00 47.00  ? 15  ARG B O   1 
ATOM   666  C CB  . ARG B 1 3  ? -3.609 -13.949 -40.011 1.00 53.71  ? 15  ARG B CB  1 
ATOM   667  C CG  . ARG B 1 3  ? -3.485 -14.595 -41.386 1.00 60.99  ? 15  ARG B CG  1 
ATOM   668  C CD  . ARG B 1 3  ? -4.222 -13.841 -42.464 1.00 66.83  ? 15  ARG B CD  1 
ATOM   669  N NE  . ARG B 1 3  ? -3.305 -13.178 -43.382 1.00 77.49  ? 15  ARG B NE  1 
ATOM   670  C CZ  . ARG B 1 3  ? -3.685 -12.572 -44.503 1.00 86.90  ? 15  ARG B CZ  1 
ATOM   671  N NH1 . ARG B 1 3  ? -2.771 -12.004 -45.277 1.00 86.41  ? 15  ARG B NH1 1 
ATOM   672  N NH2 . ARG B 1 3  ? -4.970 -12.524 -44.852 1.00 84.75  ? 15  ARG B NH2 1 
ATOM   673  N N   . TYR B 1 4  ? -2.045 -16.677 -39.948 1.00 40.71  ? 16  TYR B N   1 
ATOM   674  C CA  . TYR B 1 4  ? -1.008 -17.410 -40.642 1.00 40.08  ? 16  TYR B CA  1 
ATOM   675  C C   . TYR B 1 4  ? -1.006 -17.045 -42.117 1.00 39.12  ? 16  TYR B C   1 
ATOM   676  O O   . TYR B 1 4  ? -2.065 -16.909 -42.726 1.00 40.81  ? 16  TYR B O   1 
ATOM   677  C CB  . TYR B 1 4  ? -1.262 -18.900 -40.532 1.00 36.69  ? 16  TYR B CB  1 
ATOM   678  C CG  . TYR B 1 4  ? -1.312 -19.435 -39.128 1.00 36.92  ? 16  TYR B CG  1 
ATOM   679  C CD1 . TYR B 1 4  ? -2.526 -19.607 -38.471 1.00 41.51  ? 16  TYR B CD1 1 
ATOM   680  C CD2 . TYR B 1 4  ? -0.151 -19.811 -38.468 1.00 39.58  ? 16  TYR B CD2 1 
ATOM   681  C CE1 . TYR B 1 4  ? -2.582 -20.127 -37.186 1.00 40.26  ? 16  TYR B CE1 1 
ATOM   682  C CE2 . TYR B 1 4  ? -0.196 -20.337 -37.175 1.00 41.71  ? 16  TYR B CE2 1 
ATOM   683  C CZ  . TYR B 1 4  ? -1.412 -20.491 -36.545 1.00 44.06  ? 16  TYR B CZ  1 
ATOM   684  O OH  . TYR B 1 4  ? -1.453 -21.007 -35.271 1.00 43.89  ? 16  TYR B OH  1 
ATOM   685  N N   . ARG B 1 5  ? 0.185  -16.894 -42.685 1.00 40.75  ? 17  ARG B N   1 
ATOM   686  C CA  . ARG B 1 5  ? 0.345  -16.771 -44.131 1.00 42.84  ? 17  ARG B CA  1 
ATOM   687  C C   . ARG B 1 5  ? 1.443  -17.710 -44.625 1.00 41.39  ? 17  ARG B C   1 
ATOM   688  O O   . ARG B 1 5  ? 2.518  -17.828 -44.014 1.00 41.63  ? 17  ARG B O   1 
ATOM   689  C CB  . ARG B 1 5  ? 0.691  -15.329 -44.541 1.00 45.03  ? 17  ARG B CB  1 
ATOM   690  C CG  . ARG B 1 5  ? -0.478 -14.399 -44.610 1.00 49.61  ? 17  ARG B CG  1 
ATOM   691  C CD  . ARG B 1 5  ? -1.384 -14.729 -45.795 1.00 65.09  ? 17  ARG B CD  1 
ATOM   692  N N   . GLN B 1 6  ? 1.164  -18.361 -45.742 1.00 34.49  ? 18  GLN B N   1 
ATOM   693  C CA  . GLN B 1 6  ? 2.164  -19.108 -46.456 1.00 35.62  ? 18  GLN B CA  1 
ATOM   694  C C   . GLN B 1 6  ? 2.739  -18.266 -47.587 1.00 38.92  ? 18  GLN B C   1 
ATOM   695  O O   . GLN B 1 6  ? 1.998  -17.805 -48.463 1.00 40.45  ? 18  GLN B O   1 
ATOM   696  C CB  . GLN B 1 6  ? 1.567  -20.371 -47.042 1.00 34.12  ? 18  GLN B CB  1 
ATOM   697  C CG  . GLN B 1 6  ? 2.638  -21.304 -47.597 1.00 38.89  ? 18  GLN B CG  1 
ATOM   698  C CD  . GLN B 1 6  ? 2.049  -22.436 -48.383 1.00 42.79  ? 18  GLN B CD  1 
ATOM   699  O OE1 . GLN B 1 6  ? 1.412  -22.226 -49.412 1.00 46.35  ? 18  GLN B OE1 1 
ATOM   700  N NE2 . GLN B 1 6  ? 2.260  -23.644 -47.909 1.00 34.52  ? 18  GLN B NE2 1 
ATOM   701  N N   . ILE B 1 7  ? 4.061  -18.114 -47.582 1.00 40.26  ? 19  ILE B N   1 
ATOM   702  C CA  . ILE B 1 7  ? 4.778  -17.336 -48.585 1.00 43.13  ? 19  ILE B CA  1 
ATOM   703  C C   . ILE B 1 7  ? 5.800  -18.230 -49.289 1.00 44.99  ? 19  ILE B C   1 
ATOM   704  O O   . ILE B 1 7  ? 6.679  -18.794 -48.645 1.00 41.70  ? 19  ILE B O   1 
ATOM   705  C CB  . ILE B 1 7  ? 5.538  -16.134 -47.956 1.00 44.53  ? 19  ILE B CB  1 
ATOM   706  C CG1 . ILE B 1 7  ? 4.647  -15.343 -46.997 1.00 41.24  ? 19  ILE B CG1 1 
ATOM   707  C CG2 . ILE B 1 7  ? 6.073  -15.202 -49.050 1.00 50.65  ? 19  ILE B CG2 1 
ATOM   708  C CD1 . ILE B 1 7  ? 3.431  -14.733 -47.636 1.00 37.48  ? 19  ILE B CD1 1 
ATOM   709  N N   . THR B 1 8  ? 5.673  -18.356 -50.605 1.00 44.91  ? 20  THR B N   1 
ATOM   710  C CA  . THR B 1 8  ? 6.628  -19.097 -51.421 1.00 48.29  ? 20  THR B CA  1 
ATOM   711  C C   . THR B 1 8  ? 7.567  -18.102 -52.088 1.00 47.72  ? 20  THR B C   1 
ATOM   712  O O   . THR B 1 8  ? 7.100  -17.179 -52.746 1.00 50.43  ? 20  THR B O   1 
ATOM   713  C CB  . THR B 1 8  ? 5.909  -19.907 -52.493 1.00 47.98  ? 20  THR B CB  1 
ATOM   714  O OG1 . THR B 1 8  ? 4.938  -20.756 -51.870 1.00 53.90  ? 20  THR B OG1 1 
ATOM   715  C CG2 . THR B 1 8  ? 6.899  -20.753 -53.280 1.00 52.61  ? 20  THR B CG2 1 
ATOM   716  N N   . ILE B 1 9  ? 8.879  -18.272 -51.909 1.00 44.79  ? 21  ILE B N   1 
ATOM   717  C CA  . ILE B 1 9  ? 9.844  -17.303 -52.436 1.00 45.90  ? 21  ILE B CA  1 
ATOM   718  C C   . ILE B 1 9  ? 10.881 -17.929 -53.371 1.00 44.97  ? 21  ILE B C   1 
ATOM   719  O O   . ILE B 1 9  ? 11.691 -18.737 -52.937 1.00 48.08  ? 21  ILE B O   1 
ATOM   720  C CB  . ILE B 1 9  ? 10.623 -16.588 -51.304 1.00 45.08  ? 21  ILE B CB  1 
ATOM   721  C CG1 . ILE B 1 9  ? 9.700  -16.207 -50.141 1.00 46.28  ? 21  ILE B CG1 1 
ATOM   722  C CG2 . ILE B 1 9  ? 11.348 -15.381 -51.864 1.00 46.19  ? 21  ILE B CG2 1 
ATOM   723  C CD1 . ILE B 1 9  ? 10.342 -15.252 -49.104 1.00 46.18  ? 21  ILE B CD1 1 
ATOM   724  N N   . PRO B 1 10 ? 10.910 -17.506 -54.642 1.00 48.25  ? 22  PRO B N   1 
ATOM   725  C CA  . PRO B 1 10 ? 11.935 -18.019 -55.566 1.00 47.24  ? 22  PRO B CA  1 
ATOM   726  C C   . PRO B 1 10 ? 13.253 -17.296 -55.324 1.00 50.39  ? 22  PRO B C   1 
ATOM   727  O O   . PRO B 1 10 ? 13.247 -16.107 -54.990 1.00 57.17  ? 22  PRO B O   1 
ATOM   728  C CB  . PRO B 1 10 ? 11.379 -17.655 -56.937 1.00 46.54  ? 22  PRO B CB  1 
ATOM   729  C CG  . PRO B 1 10 ? 10.583 -16.383 -56.685 1.00 46.03  ? 22  PRO B CG  1 
ATOM   730  C CD  . PRO B 1 10 ? 10.039 -16.495 -55.281 1.00 48.61  ? 22  PRO B CD  1 
ATOM   731  N N   . ARG B 1 11 ? 14.371 -17.998 -55.456 1.00 47.84  ? 23  ARG B N   1 
ATOM   732  C CA  . ARG B 1 11 ? 15.671 -17.373 -55.220 1.00 45.87  ? 23  ARG B CA  1 
ATOM   733  C C   . ARG B 1 11 ? 16.018 -16.414 -56.368 1.00 45.17  ? 23  ARG B C   1 
ATOM   734  O O   . ARG B 1 11 ? 15.907 -16.767 -57.555 1.00 41.38  ? 23  ARG B O   1 
ATOM   735  C CB  . ARG B 1 11 ? 16.761 -18.435 -55.038 1.00 47.09  ? 23  ARG B CB  1 
ATOM   736  C CG  . ARG B 1 11 ? 18.180 -17.938 -55.249 1.00 48.32  ? 23  ARG B CG  1 
ATOM   737  C CD  . ARG B 1 11 ? 19.202 -18.950 -54.760 1.00 52.21  ? 23  ARG B CD  1 
ATOM   738  N NE  . ARG B 1 11 ? 19.467 -18.756 -53.343 1.00 60.92  ? 23  ARG B NE  1 
ATOM   739  C CZ  . ARG B 1 11 ? 20.088 -19.626 -52.553 1.00 61.43  ? 23  ARG B CZ  1 
ATOM   740  N NH1 . ARG B 1 11 ? 20.254 -19.334 -51.268 1.00 56.63  ? 23  ARG B NH1 1 
ATOM   741  N NH2 . ARG B 1 11 ? 20.530 -20.787 -53.027 1.00 76.80  ? 23  ARG B NH2 1 
ATOM   742  N N   . GLY B 1 12 ? 16.413 -15.196 -56.001 1.00 40.65  ? 24  GLY B N   1 
ATOM   743  C CA  . GLY B 1 12 ? 16.925 -14.226 -56.960 1.00 41.50  ? 24  GLY B CA  1 
ATOM   744  C C   . GLY B 1 12 ? 18.394 -14.457 -57.245 1.00 41.57  ? 24  GLY B C   1 
ATOM   745  O O   . GLY B 1 12 ? 18.966 -15.459 -56.829 1.00 43.15  ? 24  GLY B O   1 
ATOM   746  N N   . LYS B 1 13 ? 19.000 -13.519 -57.960 1.00 43.79  ? 25  LYS B N   1 
ATOM   747  C CA  . LYS B 1 13 ? 20.428 -13.553 -58.241 1.00 45.30  ? 25  LYS B CA  1 
ATOM   748  C C   . LYS B 1 13 ? 21.197 -13.380 -56.935 1.00 50.40  ? 25  LYS B C   1 
ATOM   749  O O   . LYS B 1 13 ? 22.145 -14.115 -56.669 1.00 56.00  ? 25  LYS B O   1 
ATOM   750  C CB  . LYS B 1 13 ? 20.802 -12.460 -59.254 1.00 43.06  ? 25  LYS B CB  1 
ATOM   751  N N   . ASP B 1 14 ? 20.749 -12.444 -56.101 1.00 51.12  ? 26  ASP B N   1 
ATOM   752  C CA  . ASP B 1 14 ? 21.400 -12.147 -54.827 1.00 53.23  ? 26  ASP B CA  1 
ATOM   753  C C   . ASP B 1 14 ? 20.666 -12.746 -53.602 1.00 54.98  ? 26  ASP B C   1 
ATOM   754  O O   . ASP B 1 14 ? 20.621 -12.126 -52.533 1.00 54.12  ? 26  ASP B O   1 
ATOM   755  C CB  . ASP B 1 14 ? 21.512 -10.628 -54.674 1.00 54.86  ? 26  ASP B CB  1 
ATOM   756  N N   . GLY B 1 15 ? 20.101 -13.947 -53.753 1.00 52.25  ? 27  GLY B N   1 
ATOM   757  C CA  . GLY B 1 15 ? 19.380 -14.613 -52.655 1.00 46.77  ? 27  GLY B CA  1 
ATOM   758  C C   . GLY B 1 15 ? 17.889 -14.313 -52.665 1.00 44.11  ? 27  GLY B C   1 
ATOM   759  O O   . GLY B 1 15 ? 17.308 -14.099 -53.733 1.00 46.32  ? 27  GLY B O   1 
ATOM   760  N N   . PHE B 1 16 ? 17.278 -14.280 -51.480 1.00 43.05  ? 28  PHE B N   1 
ATOM   761  C CA  . PHE B 1 16 ? 15.814 -14.152 -51.329 1.00 47.56  ? 28  PHE B CA  1 
ATOM   762  C C   . PHE B 1 16 ? 15.290 -12.741 -50.986 1.00 49.06  ? 28  PHE B C   1 
ATOM   763  O O   . PHE B 1 16 ? 14.079 -12.504 -51.033 1.00 49.53  ? 28  PHE B O   1 
ATOM   764  C CB  . PHE B 1 16 ? 15.302 -15.132 -50.282 1.00 45.44  ? 28  PHE B CB  1 
ATOM   765  C CG  . PHE B 1 16 ? 15.528 -16.562 -50.644 1.00 46.74  ? 28  PHE B CG  1 
ATOM   766  C CD1 . PHE B 1 16 ? 16.632 -17.251 -50.156 1.00 49.02  ? 28  PHE B CD1 1 
ATOM   767  C CD2 . PHE B 1 16 ? 14.658 -17.216 -51.490 1.00 47.33  ? 28  PHE B CD2 1 
ATOM   768  C CE1 . PHE B 1 16 ? 16.845 -18.578 -50.501 1.00 44.50  ? 28  PHE B CE1 1 
ATOM   769  C CE2 . PHE B 1 16 ? 14.871 -18.541 -51.839 1.00 49.92  ? 28  PHE B CE2 1 
ATOM   770  C CZ  . PHE B 1 16 ? 15.956 -19.221 -51.347 1.00 45.08  ? 28  PHE B CZ  1 
ATOM   771  N N   . GLY B 1 17 ? 16.190 -11.829 -50.631 1.00 44.18  ? 29  GLY B N   1 
ATOM   772  C CA  . GLY B 1 17 ? 15.831 -10.450 -50.398 1.00 43.27  ? 29  GLY B CA  1 
ATOM   773  C C   . GLY B 1 17 ? 15.101 -10.178 -49.101 1.00 42.74  ? 29  GLY B C   1 
ATOM   774  O O   . GLY B 1 17 ? 14.058 -9.515  -49.083 1.00 43.14  ? 29  GLY B O   1 
ATOM   775  N N   . PHE B 1 18 ? 15.650 -10.669 -48.001 1.00 48.64  ? 30  PHE B N   1 
ATOM   776  C CA  . PHE B 1 18 ? 15.131 -10.312 -46.684 1.00 48.70  ? 30  PHE B CA  1 
ATOM   777  C C   . PHE B 1 18 ? 16.132 -10.645 -45.580 1.00 49.20  ? 30  PHE B C   1 
ATOM   778  O O   . PHE B 1 18 ? 17.057 -11.423 -45.768 1.00 46.89  ? 30  PHE B O   1 
ATOM   779  C CB  . PHE B 1 18 ? 13.761 -10.966 -46.416 1.00 46.90  ? 30  PHE B CB  1 
ATOM   780  C CG  . PHE B 1 18 ? 13.822 -12.438 -46.162 1.00 46.30  ? 30  PHE B CG  1 
ATOM   781  C CD1 . PHE B 1 18 ? 13.875 -13.338 -47.218 1.00 50.85  ? 30  PHE B CD1 1 
ATOM   782  C CD2 . PHE B 1 18 ? 13.807 -12.933 -44.861 1.00 45.33  ? 30  PHE B CD2 1 
ATOM   783  C CE1 . PHE B 1 18 ? 13.924 -14.715 -46.983 1.00 49.08  ? 30  PHE B CE1 1 
ATOM   784  C CE2 . PHE B 1 18 ? 13.859 -14.300 -44.617 1.00 51.82  ? 30  PHE B CE2 1 
ATOM   785  C CZ  . PHE B 1 18 ? 13.902 -15.194 -45.677 1.00 49.28  ? 30  PHE B CZ  1 
ATOM   786  N N   . THR B 1 19 ? 15.912 -10.021 -44.435 1.00 48.75  ? 31  THR B N   1 
ATOM   787  C CA  . THR B 1 19 ? 16.788 -10.091 -43.286 1.00 48.61  ? 31  THR B CA  1 
ATOM   788  C C   . THR B 1 19 ? 15.970 -10.659 -42.144 1.00 45.58  ? 31  THR B C   1 
ATOM   789  O O   . THR B 1 19 ? 14.739 -10.532 -42.134 1.00 46.08  ? 31  THR B O   1 
ATOM   790  C CB  . THR B 1 19 ? 17.350 -8.665  -42.982 1.00 45.54  ? 31  THR B CB  1 
ATOM   791  O OG1 . THR B 1 19 ? 18.411 -8.399  -43.910 1.00 46.47  ? 31  THR B OG1 1 
ATOM   792  C CG2 . THR B 1 19 ? 17.893 -8.547  -41.585 1.00 64.91  ? 31  THR B CG2 1 
ATOM   793  N N   . ILE B 1 20 ? 16.657 -11.314 -41.214 1.00 46.48  ? 32  ILE B N   1 
ATOM   794  C CA  . ILE B 1 20 ? 16.031 -11.955 -40.047 1.00 50.22  ? 32  ILE B CA  1 
ATOM   795  C C   . ILE B 1 20 ? 16.739 -11.552 -38.756 1.00 48.82  ? 32  ILE B C   1 
ATOM   796  O O   . ILE B 1 20 ? 17.894 -11.154 -38.780 1.00 51.32  ? 32  ILE B O   1 
ATOM   797  C CB  . ILE B 1 20 ? 15.997 -13.496 -40.159 1.00 48.29  ? 32  ILE B CB  1 
ATOM   798  C CG1 . ILE B 1 20 ? 17.336 -14.043 -40.683 1.00 59.77  ? 32  ILE B CG1 1 
ATOM   799  C CG2 . ILE B 1 20 ? 14.885 -13.928 -41.100 1.00 48.11  ? 32  ILE B CG2 1 
ATOM   800  C CD1 . ILE B 1 20 ? 17.408 -15.587 -40.810 1.00 49.52  ? 32  ILE B CD1 1 
ATOM   801  N N   . CYS B 1 21 ? 16.017 -11.645 -37.641 1.00 50.96  ? 33  CYS B N   1 
ATOM   802  C CA  . CYS B 1 21 ? 16.542 -11.330 -36.315 1.00 51.59  ? 33  CYS B CA  1 
ATOM   803  C C   . CYS B 1 21 ? 15.768 -12.143 -35.277 1.00 48.52  ? 33  CYS B C   1 
ATOM   804  O O   . CYS B 1 21 ? 14.620 -12.517 -35.519 1.00 48.27  ? 33  CYS B O   1 
ATOM   805  C CB  . CYS B 1 21 ? 16.417 -9.825  -36.019 1.00 50.21  ? 33  CYS B CB  1 
ATOM   806  S SG  . CYS B 1 21 ? 14.702 -9.168  -36.071 1.00 59.60  ? 33  CYS B SG  1 
ATOM   807  N N   . CYS B 1 22 ? 16.406 -12.392 -34.131 1.00 48.96  ? 34  CYS B N   1 
ATOM   808  C CA  . CYS B 1 22 ? 15.839 -13.143 -32.996 1.00 46.08  ? 34  CYS B CA  1 
ATOM   809  C C   . CYS B 1 22 ? 15.904 -14.641 -33.152 1.00 43.97  ? 34  CYS B C   1 
ATOM   810  O O   . CYS B 1 22 ? 16.015 -15.166 -34.255 1.00 47.45  ? 34  CYS B O   1 
ATOM   811  C CB  . CYS B 1 22 ? 14.379 -12.770 -32.716 1.00 49.98  ? 34  CYS B CB  1 
ATOM   812  S SG  . CYS B 1 22 ? 14.136 -11.145 -32.063 1.00 59.16  ? 34  CYS B SG  1 
ATOM   813  N N   . ASP B 1 23 ? 15.768 -15.332 -32.027 1.00 44.48  ? 35  ASP B N   1 
ATOM   814  C CA  . ASP B 1 23 ? 15.819 -16.800 -31.995 1.00 46.53  ? 35  ASP B CA  1 
ATOM   815  C C   . ASP B 1 23 ? 14.539 -17.350 -31.415 1.00 43.94  ? 35  ASP B C   1 
ATOM   816  O O   . ASP B 1 23 ? 13.960 -16.774 -30.484 1.00 42.96  ? 35  ASP B O   1 
ATOM   817  C CB  . ASP B 1 23 ? 16.971 -17.285 -31.101 1.00 46.51  ? 35  ASP B CB  1 
ATOM   818  C CG  . ASP B 1 23 ? 18.324 -16.773 -31.557 1.00 54.27  ? 35  ASP B CG  1 
ATOM   819  O OD1 . ASP B 1 23 ? 18.502 -16.568 -32.770 1.00 61.32  ? 35  ASP B OD1 1 
ATOM   820  O OD2 . ASP B 1 23 ? 19.223 -16.609 -30.704 1.00 53.67  ? 35  ASP B OD2 1 
ATOM   821  N N   . SER B 1 24 ? 14.113 -18.481 -31.953 1.00 44.88  ? 36  SER B N   1 
ATOM   822  C CA  . SER B 1 24 ? 13.130 -19.329 -31.290 1.00 47.71  ? 36  SER B CA  1 
ATOM   823  C C   . SER B 1 24 ? 11.873 -18.588 -30.823 1.00 44.10  ? 36  SER B C   1 
ATOM   824  O O   . SER B 1 24 ? 11.654 -18.446 -29.621 1.00 46.98  ? 36  SER B O   1 
ATOM   825  C CB  . SER B 1 24 ? 13.796 -20.017 -30.094 1.00 46.87  ? 36  SER B CB  1 
ATOM   826  O OG  . SER B 1 24 ? 15.110 -20.414 -30.426 1.00 53.85  ? 36  SER B OG  1 
ATOM   827  N N   . PRO B 1 25 ? 11.046 -18.099 -31.762 1.00 46.01  ? 37  PRO B N   1 
ATOM   828  C CA  . PRO B 1 25 ? 11.150 -18.127 -33.213 1.00 43.46  ? 37  PRO B CA  1 
ATOM   829  C C   . PRO B 1 25 ? 11.881 -16.931 -33.832 1.00 43.26  ? 37  PRO B C   1 
ATOM   830  O O   . PRO B 1 25 ? 12.054 -15.887 -33.209 1.00 46.22  ? 37  PRO B O   1 
ATOM   831  C CB  . PRO B 1 25 ? 9.679  -18.114 -33.644 1.00 47.22  ? 37  PRO B CB  1 
ATOM   832  C CG  . PRO B 1 25 ? 9.017  -17.248 -32.628 1.00 46.60  ? 37  PRO B CG  1 
ATOM   833  C CD  . PRO B 1 25 ? 9.801  -17.428 -31.335 1.00 50.71  ? 37  PRO B CD  1 
ATOM   834  N N   . VAL B 1 26 ? 12.289 -17.105 -35.078 1.00 43.76  ? 38  VAL B N   1 
ATOM   835  C CA  . VAL B 1 26 ? 13.010 -16.092 -35.828 1.00 42.99  ? 38  VAL B CA  1 
ATOM   836  C C   . VAL B 1 26 ? 11.998 -15.160 -36.466 1.00 44.52  ? 38  VAL B C   1 
ATOM   837  O O   . VAL B 1 26 ? 10.934 -15.612 -36.874 1.00 48.04  ? 38  VAL B O   1 
ATOM   838  C CB  . VAL B 1 26 ? 13.838 -16.763 -36.938 1.00 48.07  ? 38  VAL B CB  1 
ATOM   839  C CG1 . VAL B 1 26 ? 14.503 -15.718 -37.833 1.00 41.10  ? 38  VAL B CG1 1 
ATOM   840  C CG2 . VAL B 1 26 ? 14.867 -17.751 -36.322 1.00 35.95  ? 38  VAL B CG2 1 
ATOM   841  N N   . ARG B 1 27 ? 12.336 -13.869 -36.548 1.00 44.12  ? 39  ARG B N   1 
ATOM   842  C CA  . ARG B 1 27 ? 11.450 -12.827 -37.069 1.00 47.42  ? 39  ARG B CA  1 
ATOM   843  C C   . ARG B 1 27 ? 12.028 -12.192 -38.344 1.00 45.98  ? 39  ARG B C   1 
ATOM   844  O O   . ARG B 1 27 ? 13.258 -12.100 -38.509 1.00 45.17  ? 39  ARG B O   1 
ATOM   845  C CB  . ARG B 1 27 ? 11.251 -11.732 -36.004 1.00 47.54  ? 39  ARG B CB  1 
ATOM   846  C CG  . ARG B 1 27 ? 10.057 -10.811 -36.269 1.00 51.62  ? 39  ARG B CG  1 
ATOM   847  C CD  . ARG B 1 27 ? 9.944  -9.698  -35.221 1.00 49.15  ? 39  ARG B CD  1 
ATOM   848  N NE  . ARG B 1 27 ? 10.671 -8.495  -35.609 1.00 47.31  ? 39  ARG B NE  1 
ATOM   849  C CZ  . ARG B 1 27 ? 10.857 -7.435  -34.830 1.00 53.09  ? 39  ARG B CZ  1 
ATOM   850  N NH1 . ARG B 1 27 ? 10.366 -7.419  -33.598 1.00 42.91  ? 39  ARG B NH1 1 
ATOM   851  N NH2 . ARG B 1 27 ? 11.541 -6.384  -35.286 1.00 49.44  ? 39  ARG B NH2 1 
ATOM   852  N N   . VAL B 1 28 ? 11.149 -11.763 -39.248 1.00 46.16  ? 40  VAL B N   1 
ATOM   853  C CA  . VAL B 1 28 ? 11.582 -11.009 -40.421 1.00 45.95  ? 40  VAL B CA  1 
ATOM   854  C C   . VAL B 1 28 ? 11.899 -9.601  -39.978 1.00 45.25  ? 40  VAL B C   1 
ATOM   855  O O   . VAL B 1 28 ? 11.029 -8.911  -39.454 1.00 45.46  ? 40  VAL B O   1 
ATOM   856  C CB  . VAL B 1 28 ? 10.530 -10.989 -41.551 1.00 49.71  ? 40  VAL B CB  1 
ATOM   857  C CG1 . VAL B 1 28 ? 10.964 -10.075 -42.698 1.00 40.18  ? 40  VAL B CG1 1 
ATOM   858  C CG2 . VAL B 1 28 ? 10.303 -12.401 -42.078 1.00 42.36  ? 40  VAL B CG2 1 
ATOM   859  N N   . GLN B 1 29 ? 13.156 -9.195  -40.170 1.00 45.52  ? 41  GLN B N   1 
ATOM   860  C CA  . GLN B 1 29 ? 13.613 -7.857  -39.802 1.00 47.76  ? 41  GLN B CA  1 
ATOM   861  C C   . GLN B 1 29 ? 13.266 -6.831  -40.882 1.00 45.43  ? 41  GLN B C   1 
ATOM   862  O O   . GLN B 1 29 ? 12.800 -5.733  -40.588 1.00 46.53  ? 41  GLN B O   1 
ATOM   863  C CB  . GLN B 1 29 ? 15.130 -7.877  -39.564 1.00 48.09  ? 41  GLN B CB  1 
ATOM   864  C CG  . GLN B 1 29 ? 15.768 -6.536  -39.203 1.00 55.05  ? 41  GLN B CG  1 
ATOM   865  C CD  . GLN B 1 29 ? 15.320 -5.989  -37.849 1.00 60.20  ? 41  GLN B CD  1 
ATOM   866  O OE1 . GLN B 1 29 ? 16.015 -6.159  -36.845 1.00 53.64  ? 41  GLN B OE1 1 
ATOM   867  N NE2 . GLN B 1 29 ? 14.165 -5.320  -37.820 1.00 49.42  ? 41  GLN B NE2 1 
ATOM   868  N N   . ALA B 1 30 ? 13.532 -7.186  -42.129 1.00 44.90  ? 42  ALA B N   1 
ATOM   869  C CA  . ALA B 1 30 ? 13.319 -6.283  -43.252 1.00 43.67  ? 42  ALA B CA  1 
ATOM   870  C C   . ALA B 1 30 ? 13.252 -7.087  -44.537 1.00 42.27  ? 42  ALA B C   1 
ATOM   871  O O   . ALA B 1 30 ? 13.685 -8.232  -44.594 1.00 41.14  ? 42  ALA B O   1 
ATOM   872  C CB  . ALA B 1 30 ? 14.449 -5.198  -43.334 1.00 35.91  ? 42  ALA B CB  1 
ATOM   873  N N   . VAL B 1 31 ? 12.707 -6.452  -45.563 1.00 46.26  ? 43  VAL B N   1 
ATOM   874  C CA  . VAL B 1 31 ? 12.520 -7.045  -46.869 1.00 47.71  ? 43  VAL B CA  1 
ATOM   875  C C   . VAL B 1 31 ? 13.061 -6.040  -47.880 1.00 47.87  ? 43  VAL B C   1 
ATOM   876  O O   . VAL B 1 31 ? 12.874 -4.836  -47.717 1.00 42.13  ? 43  VAL B O   1 
ATOM   877  C CB  . VAL B 1 31 ? 11.026 -7.316  -47.097 1.00 50.83  ? 43  VAL B CB  1 
ATOM   878  C CG1 . VAL B 1 31 ? 10.756 -7.716  -48.534 1.00 58.46  ? 43  VAL B CG1 1 
ATOM   879  C CG2 . VAL B 1 31 ? 10.540 -8.410  -46.115 1.00 46.34  ? 43  VAL B CG2 1 
ATOM   880  N N   . ASP B 1 32 ? 13.762 -6.523  -48.902 1.00 48.83  ? 44  ASP B N   1 
ATOM   881  C CA  . ASP B 1 32 ? 14.406 -5.626  -49.872 1.00 49.78  ? 44  ASP B CA  1 
ATOM   882  C C   . ASP B 1 32 ? 13.405 -5.170  -50.922 1.00 48.44  ? 44  ASP B C   1 
ATOM   883  O O   . ASP B 1 32 ? 12.748 -6.000  -51.546 1.00 50.85  ? 44  ASP B O   1 
ATOM   884  C CB  . ASP B 1 32 ? 15.592 -6.321  -50.549 1.00 52.25  ? 44  ASP B CB  1 
ATOM   885  C CG  . ASP B 1 32 ? 16.715 -6.627  -49.583 1.00 58.50  ? 44  ASP B CG  1 
ATOM   886  O OD1 . ASP B 1 32 ? 17.412 -5.681  -49.160 1.00 74.18  ? 44  ASP B OD1 1 
ATOM   887  O OD2 . ASP B 1 32 ? 16.907 -7.808  -49.234 1.00 70.45  ? 44  ASP B OD2 1 
ATOM   888  N N   . SER B 1 33 ? 13.290 -3.853  -51.105 1.00 47.76  ? 45  SER B N   1 
ATOM   889  C CA  . SER B 1 33 ? 12.421 -3.287  -52.140 1.00 51.17  ? 45  SER B CA  1 
ATOM   890  C C   . SER B 1 33 ? 12.798 -3.850  -53.508 1.00 48.84  ? 45  SER B C   1 
ATOM   891  O O   . SER B 1 33 ? 13.965 -3.822  -53.905 1.00 45.55  ? 45  SER B O   1 
ATOM   892  C CB  . SER B 1 33 ? 12.505 -1.750  -52.165 1.00 51.38  ? 45  SER B CB  1 
ATOM   893  O OG  . SER B 1 33 ? 12.132 -1.195  -50.910 1.00 58.37  ? 45  SER B OG  1 
ATOM   894  N N   . GLY B 1 34 ? 11.807 -4.390  -54.208 1.00 50.00  ? 46  GLY B N   1 
ATOM   895  C CA  . GLY B 1 34 ? 12.030 -5.042  -55.488 1.00 50.37  ? 46  GLY B CA  1 
ATOM   896  C C   . GLY B 1 34 ? 12.406 -6.512  -55.386 1.00 50.33  ? 46  GLY B C   1 
ATOM   897  O O   . GLY B 1 34 ? 12.200 -7.269  -56.338 1.00 49.94  ? 46  GLY B O   1 
ATOM   898  N N   . GLY B 1 35 ? 12.934 -6.929  -54.234 1.00 47.97  ? 47  GLY B N   1 
ATOM   899  C CA  . GLY B 1 35 ? 13.453 -8.280  -54.081 1.00 45.59  ? 47  GLY B CA  1 
ATOM   900  C C   . GLY B 1 35 ? 12.388 -9.363  -54.135 1.00 44.07  ? 47  GLY B C   1 
ATOM   901  O O   . GLY B 1 35 ? 11.201 -9.065  -54.204 1.00 36.19  ? 47  GLY B O   1 
ATOM   902  N N   . PRO B 1 36 ? 12.816 -10.639 -54.144 1.00 48.19  ? 48  PRO B N   1 
ATOM   903  C CA  . PRO B 1 36 ? 11.878 -11.770 -54.163 1.00 45.87  ? 48  PRO B CA  1 
ATOM   904  C C   . PRO B 1 36 ? 10.894 -11.787 -52.992 1.00 42.87  ? 48  PRO B C   1 
ATOM   905  O O   . PRO B 1 36 ? 9.694  -11.913 -53.201 1.00 47.42  ? 48  PRO B O   1 
ATOM   906  C CB  . PRO B 1 36 ? 12.798 -12.999 -54.117 1.00 48.01  ? 48  PRO B CB  1 
ATOM   907  C CG  . PRO B 1 36 ? 14.122 -12.514 -54.639 1.00 48.82  ? 48  PRO B CG  1 
ATOM   908  C CD  . PRO B 1 36 ? 14.225 -11.081 -54.206 1.00 48.35  ? 48  PRO B CD  1 
ATOM   909  N N   . ALA B 1 37 ? 11.402 -11.646 -51.776 1.00 46.46  ? 49  ALA B N   1 
ATOM   910  C CA  . ALA B 1 37 ? 10.575 -11.730 -50.570 1.00 42.86  ? 49  ALA B CA  1 
ATOM   911  C C   . ALA B 1 37 ? 9.463  -10.684 -50.575 1.00 46.66  ? 49  ALA B C   1 
ATOM   912  O O   . ALA B 1 37 ? 8.332  -10.979 -50.171 1.00 47.30  ? 49  ALA B O   1 
ATOM   913  C CB  . ALA B 1 37 ? 11.436 -11.589 -49.327 1.00 40.06  ? 49  ALA B CB  1 
ATOM   914  N N   . GLU B 1 38 ? 9.777  -9.476  -51.051 1.00 44.99  ? 50  GLU B N   1 
ATOM   915  C CA  . GLU B 1 38 ? 8.794  -8.405  -51.107 1.00 44.89  ? 50  GLU B CA  1 
ATOM   916  C C   . GLU B 1 38 ? 7.654  -8.794  -52.013 1.00 43.38  ? 50  GLU B C   1 
ATOM   917  O O   . GLU B 1 38 ? 6.499  -8.565  -51.692 1.00 43.94  ? 50  GLU B O   1 
ATOM   918  C CB  . GLU B 1 38 ? 9.397  -7.085  -51.620 1.00 45.81  ? 50  GLU B CB  1 
ATOM   919  C CG  . GLU B 1 38 ? 8.475  -5.866  -51.364 1.00 48.02  ? 50  GLU B CG  1 
ATOM   920  C CD  . GLU B 1 38 ? 8.845  -4.625  -52.168 1.00 55.47  ? 50  GLU B CD  1 
ATOM   921  O OE1 . GLU B 1 38 ? 9.106  -4.740  -53.387 1.00 66.33  ? 50  GLU B OE1 1 
ATOM   922  O OE2 . GLU B 1 38 ? 8.848  -3.520  -51.582 1.00 68.34  ? 50  GLU B OE2 1 
ATOM   923  N N   . ARG B 1 39 ? 7.982  -9.365  -53.162 1.00 45.63  ? 51  ARG B N   1 
ATOM   924  C CA  . ARG B 1 39 ? 6.977  -9.616  -54.184 1.00 44.17  ? 51  ARG B CA  1 
ATOM   925  C C   . ARG B 1 39 ? 6.160  -10.861 -53.853 1.00 42.88  ? 51  ARG B C   1 
ATOM   926  O O   . ARG B 1 39 ? 4.978  -10.951 -54.201 1.00 44.49  ? 51  ARG B O   1 
ATOM   927  C CB  . ARG B 1 39 ? 7.630  -9.748  -55.552 1.00 43.10  ? 51  ARG B CB  1 
ATOM   928  C CG  . ARG B 1 39 ? 6.630  -9.784  -56.672 1.00 47.55  ? 51  ARG B CG  1 
ATOM   929  C CD  . ARG B 1 39 ? 7.304  -9.989  -57.985 1.00 40.25  ? 51  ARG B CD  1 
ATOM   930  N NE  . ARG B 1 39 ? 8.146  -8.859  -58.361 1.00 46.29  ? 51  ARG B NE  1 
ATOM   931  C CZ  . ARG B 1 39 ? 7.718  -7.766  -58.991 1.00 39.75  ? 51  ARG B CZ  1 
ATOM   932  N NH1 . ARG B 1 39 ? 8.579  -6.801  -59.308 1.00 45.26  ? 51  ARG B NH1 1 
ATOM   933  N NH2 . ARG B 1 39 ? 6.437  -7.631  -59.312 1.00 46.25  ? 51  ARG B NH2 1 
ATOM   934  N N   . ALA B 1 40 ? 6.800  -11.814 -53.184 1.00 42.38  ? 52  ALA B N   1 
ATOM   935  C CA  . ALA B 1 40 ? 6.118  -12.989 -52.645 1.00 43.63  ? 52  ALA B CA  1 
ATOM   936  C C   . ALA B 1 40 ? 5.145  -12.606 -51.522 1.00 46.59  ? 52  ALA B C   1 
ATOM   937  O O   . ALA B 1 40 ? 4.250  -13.381 -51.200 1.00 50.42  ? 52  ALA B O   1 
ATOM   938  C CB  . ALA B 1 40 ? 7.145  -14.008 -52.131 1.00 40.08  ? 52  ALA B CB  1 
ATOM   939  N N   . GLY B 1 41 ? 5.342  -11.431 -50.913 1.00 46.94  ? 53  GLY B N   1 
ATOM   940  C CA  . GLY B 1 41 ? 4.426  -10.900 -49.899 1.00 41.45  ? 53  GLY B CA  1 
ATOM   941  C C   . GLY B 1 41 ? 4.943  -10.960 -48.469 1.00 40.99  ? 53  GLY B C   1 
ATOM   942  O O   . GLY B 1 41 ? 4.209  -10.686 -47.532 1.00 40.32  ? 53  GLY B O   1 
ATOM   943  N N   . LEU B 1 42 ? 6.209  -11.307 -48.282 1.00 43.25  ? 54  LEU B N   1 
ATOM   944  C CA  . LEU B 1 42 ? 6.799  -11.305 -46.942 1.00 41.76  ? 54  LEU B CA  1 
ATOM   945  C C   . LEU B 1 42 ? 6.886  -9.853  -46.463 1.00 41.79  ? 54  LEU B C   1 
ATOM   946  O O   . LEU B 1 42 ? 7.019  -8.944  -47.266 1.00 43.01  ? 54  LEU B O   1 
ATOM   947  C CB  . LEU B 1 42 ? 8.208  -11.902 -46.966 1.00 37.96  ? 54  LEU B CB  1 
ATOM   948  C CG  . LEU B 1 42 ? 8.630  -12.954 -45.950 1.00 44.00  ? 54  LEU B CG  1 
ATOM   949  C CD1 . LEU B 1 42 ? 10.127 -12.829 -45.691 1.00 41.46  ? 54  LEU B CD1 1 
ATOM   950  C CD2 . LEU B 1 42 ? 7.847  -12.905 -44.665 1.00 46.69  ? 54  LEU B CD2 1 
ATOM   951  N N   . GLN B 1 43 ? 6.831  -9.644  -45.154 1.00 44.89  ? 55  GLN B N   1 
ATOM   952  C CA  . GLN B 1 43 ? 6.929  -8.303  -44.611 1.00 48.58  ? 55  GLN B CA  1 
ATOM   953  C C   . GLN B 1 43 ? 7.543  -8.300  -43.226 1.00 47.75  ? 55  GLN B C   1 
ATOM   954  O O   . GLN B 1 43 ? 7.628  -9.346  -42.561 1.00 41.56  ? 55  GLN B O   1 
ATOM   955  C CB  . GLN B 1 43 ? 5.556  -7.630  -44.604 1.00 51.79  ? 55  GLN B CB  1 
ATOM   956  C CG  . GLN B 1 43 ? 4.468  -8.452  -43.967 1.00 54.11  ? 55  GLN B CG  1 
ATOM   957  C CD  . GLN B 1 43 ? 3.141  -7.720  -43.953 1.00 53.81  ? 55  GLN B CD  1 
ATOM   958  O OE1 . GLN B 1 43 ? 2.445  -7.644  -44.970 1.00 49.60  ? 55  GLN B OE1 1 
ATOM   959  N NE2 . GLN B 1 43 ? 2.786  -7.171  -42.798 1.00 49.10  ? 55  GLN B NE2 1 
ATOM   960  N N   . GLN B 1 44 ? 8.003  -7.121  -42.814 1.00 45.46  ? 56  GLN B N   1 
ATOM   961  C CA  . GLN B 1 44 ? 8.582  -6.947  -41.487 1.00 46.97  ? 56  GLN B CA  1 
ATOM   962  C C   . GLN B 1 44 ? 7.614  -7.447  -40.404 1.00 46.98  ? 56  GLN B C   1 
ATOM   963  O O   . GLN B 1 44 ? 6.392  -7.384  -40.570 1.00 46.08  ? 56  GLN B O   1 
ATOM   964  C CB  . GLN B 1 44 ? 9.011  -5.483  -41.246 1.00 41.65  ? 56  GLN B CB  1 
ATOM   965  C CG  . GLN B 1 44 ? 7.912  -4.438  -41.226 1.00 54.66  ? 56  GLN B CG  1 
ATOM   966  C CD  . GLN B 1 44 ? 8.446  -3.015  -41.010 1.00 52.94  ? 56  GLN B CD  1 
ATOM   967  N N   . LEU B 1 45 ? 8.187  -7.980  -39.324 1.00 47.64  ? 57  LEU B N   1 
ATOM   968  C CA  . LEU B 1 45 ? 7.451  -8.535  -38.170 1.00 52.07  ? 57  LEU B CA  1 
ATOM   969  C C   . LEU B 1 45 ? 6.805  -9.907  -38.401 1.00 49.01  ? 57  LEU B C   1 
ATOM   970  O O   . LEU B 1 45 ? 6.240  -10.483 -37.463 1.00 50.03  ? 57  LEU B O   1 
ATOM   971  C CB  . LEU B 1 45 ? 6.425  -7.538  -37.596 1.00 53.95  ? 57  LEU B CB  1 
ATOM   972  C CG  . LEU B 1 45 ? 6.978  -6.321  -36.840 1.00 57.50  ? 57  LEU B CG  1 
ATOM   973  C CD1 . LEU B 1 45 ? 5.912  -5.247  -36.710 1.00 57.67  ? 57  LEU B CD1 1 
ATOM   974  C CD2 . LEU B 1 45 ? 7.479  -6.699  -35.464 1.00 54.27  ? 57  LEU B CD2 1 
ATOM   975  N N   . ASP B 1 46 ? 6.901  -10.443 -39.619 1.00 46.43  ? 58  ASP B N   1 
ATOM   976  C CA  . ASP B 1 46 ? 6.435  -11.789 -39.880 1.00 43.41  ? 58  ASP B CA  1 
ATOM   977  C C   . ASP B 1 46 ? 7.313  -12.714 -39.081 1.00 43.69  ? 58  ASP B C   1 
ATOM   978  O O   . ASP B 1 46 ? 8.531  -12.618 -39.168 1.00 45.19  ? 58  ASP B O   1 
ATOM   979  C CB  . ASP B 1 46 ? 6.540  -12.139 -41.364 1.00 49.49  ? 58  ASP B CB  1 
ATOM   980  C CG  . ASP B 1 46 ? 5.416  -11.550 -42.195 1.00 48.58  ? 58  ASP B CG  1 
ATOM   981  O OD1 . ASP B 1 46 ? 4.495  -10.909 -41.638 1.00 44.72  ? 58  ASP B OD1 1 
ATOM   982  O OD2 . ASP B 1 46 ? 5.459  -11.745 -43.424 1.00 45.94  ? 58  ASP B OD2 1 
ATOM   983  N N   . THR B 1 47 ? 6.703  -13.587 -38.283 1.00 44.88  ? 59  THR B N   1 
ATOM   984  C CA  . THR B 1 47 ? 7.444  -14.513 -37.432 1.00 44.76  ? 59  THR B CA  1 
ATOM   985  C C   . THR B 1 47 ? 7.413  -15.868 -38.133 1.00 45.34  ? 59  THR B C   1 
ATOM   986  O O   . THR B 1 47 ? 6.347  -16.332 -38.522 1.00 49.18  ? 59  THR B O   1 
ATOM   987  C CB  . THR B 1 47 ? 6.846  -14.604 -35.998 1.00 45.71  ? 59  THR B CB  1 
ATOM   988  O OG1 . THR B 1 47 ? 6.916  -13.329 -35.338 1.00 46.19  ? 59  THR B OG1 1 
ATOM   989  C CG2 . THR B 1 47 ? 7.590  -15.615 -35.156 1.00 46.38  ? 59  THR B CG2 1 
ATOM   990  N N   . VAL B 1 48 ? 8.584  -16.478 -38.314 1.00 43.54  ? 60  VAL B N   1 
ATOM   991  C CA  . VAL B 1 48 ? 8.724  -17.687 -39.118 1.00 41.99  ? 60  VAL B CA  1 
ATOM   992  C C   . VAL B 1 48 ? 8.459  -18.905 -38.250 1.00 46.33  ? 60  VAL B C   1 
ATOM   993  O O   . VAL B 1 48 ? 9.135  -19.112 -37.246 1.00 50.09  ? 60  VAL B O   1 
ATOM   994  C CB  . VAL B 1 48 ? 10.139 -17.806 -39.723 1.00 48.82  ? 60  VAL B CB  1 
ATOM   995  C CG1 . VAL B 1 48 ? 10.256 -19.084 -40.626 1.00 38.98  ? 60  VAL B CG1 1 
ATOM   996  C CG2 . VAL B 1 48 ? 10.509 -16.518 -40.495 1.00 40.83  ? 60  VAL B CG2 1 
ATOM   997  N N   . LEU B 1 49 ? 7.456  -19.692 -38.630 1.00 48.01  ? 61  LEU B N   1 
ATOM   998  C CA  . LEU B 1 49 ? 7.101  -20.901 -37.903 1.00 48.02  ? 61  LEU B CA  1 
ATOM   999  C C   . LEU B 1 49 ? 7.588  -22.164 -38.625 1.00 45.74  ? 61  LEU B C   1 
ATOM   1000 O O   . LEU B 1 49 ? 7.840  -23.189 -37.989 1.00 48.70  ? 61  LEU B O   1 
ATOM   1001 C CB  . LEU B 1 49 ? 5.583  -20.990 -37.734 1.00 48.95  ? 61  LEU B CB  1 
ATOM   1002 C CG  . LEU B 1 49 ? 4.810  -19.776 -37.207 1.00 55.14  ? 61  LEU B CG  1 
ATOM   1003 C CD1 . LEU B 1 49 ? 3.300  -20.077 -37.276 1.00 38.97  ? 61  LEU B CD1 1 
ATOM   1004 C CD2 . LEU B 1 49 ? 5.227  -19.397 -35.789 1.00 41.85  ? 61  LEU B CD2 1 
ATOM   1005 N N   . GLN B 1 50 ? 7.704  -22.096 -39.949 1.00 45.55  ? 62  GLN B N   1 
ATOM   1006 C CA  . GLN B 1 50 ? 7.924  -23.295 -40.770 1.00 43.36  ? 62  GLN B CA  1 
ATOM   1007 C C   . GLN B 1 50 ? 8.717  -22.954 -42.042 1.00 47.72  ? 62  GLN B C   1 
ATOM   1008 O O   . GLN B 1 50 ? 8.465  -21.917 -42.676 1.00 41.62  ? 62  GLN B O   1 
ATOM   1009 C CB  . GLN B 1 50 ? 6.573  -23.928 -41.121 1.00 41.12  ? 62  GLN B CB  1 
ATOM   1010 C CG  . GLN B 1 50 ? 6.537  -25.413 -40.898 1.00 45.07  ? 62  GLN B CG  1 
ATOM   1011 C CD  . GLN B 1 50 ? 5.204  -26.045 -41.203 1.00 46.75  ? 62  GLN B CD  1 
ATOM   1012 O OE1 . GLN B 1 50 ? 4.636  -26.742 -40.358 1.00 48.42  ? 62  GLN B OE1 1 
ATOM   1013 N NE2 . GLN B 1 50 ? 4.713  -25.850 -42.429 1.00 36.50  ? 62  GLN B NE2 1 
ATOM   1014 N N   . LEU B 1 51 ? 9.697  -23.806 -42.375 1.00 49.03  ? 63  LEU B N   1 
ATOM   1015 C CA  . LEU B 1 51 ? 10.506 -23.676 -43.600 1.00 49.03  ? 63  LEU B CA  1 
ATOM   1016 C C   . LEU B 1 51 ? 10.426 -24.968 -44.382 1.00 48.42  ? 63  LEU B C   1 
ATOM   1017 O O   . LEU B 1 51 ? 10.768 -26.032 -43.854 1.00 47.91  ? 63  LEU B O   1 
ATOM   1018 C CB  . LEU B 1 51 ? 11.978 -23.382 -43.295 1.00 50.56  ? 63  LEU B CB  1 
ATOM   1019 C CG  . LEU B 1 51 ? 12.907 -23.276 -44.528 1.00 49.51  ? 63  LEU B CG  1 
ATOM   1020 C CD1 . LEU B 1 51 ? 12.623 -21.997 -45.354 1.00 37.61  ? 63  LEU B CD1 1 
ATOM   1021 C CD2 . LEU B 1 51 ? 14.354 -23.288 -44.098 1.00 52.10  ? 63  LEU B CD2 1 
ATOM   1022 N N   . ASN B 1 52 ? 9.979  -24.877 -45.633 1.00 48.58  ? 64  ASN B N   1 
ATOM   1023 C CA  . ASN B 1 52 ? 9.792  -26.051 -46.495 1.00 48.92  ? 64  ASN B CA  1 
ATOM   1024 C C   . ASN B 1 52 ? 9.107  -27.196 -45.755 1.00 51.58  ? 64  ASN B C   1 
ATOM   1025 O O   . ASN B 1 52 ? 9.578  -28.348 -45.755 1.00 53.16  ? 64  ASN B O   1 
ATOM   1026 C CB  . ASN B 1 52 ? 11.125 -26.508 -47.081 1.00 42.82  ? 64  ASN B CB  1 
ATOM   1027 C CG  . ASN B 1 52 ? 11.838 -25.406 -47.821 1.00 54.84  ? 64  ASN B CG  1 
ATOM   1028 O OD1 . ASN B 1 52 ? 11.214 -24.501 -48.409 1.00 49.21  ? 64  ASN B OD1 1 
ATOM   1029 N ND2 . ASN B 1 52 ? 13.159 -25.462 -47.792 1.00 46.68  ? 64  ASN B ND2 1 
ATOM   1030 N N   . GLU B 1 53 ? 7.989  -26.851 -45.120 1.00 53.22  ? 65  GLU B N   1 
ATOM   1031 C CA  . GLU B 1 53 ? 7.154  -27.807 -44.409 1.00 58.11  ? 65  GLU B CA  1 
ATOM   1032 C C   . GLU B 1 53 ? 7.874  -28.407 -43.204 1.00 57.80  ? 65  GLU B C   1 
ATOM   1033 O O   . GLU B 1 53 ? 7.537  -29.498 -42.764 1.00 58.75  ? 65  GLU B O   1 
ATOM   1034 C CB  . GLU B 1 53 ? 6.669  -28.916 -45.359 1.00 54.65  ? 65  GLU B CB  1 
ATOM   1035 N N   . ARG B 1 54 ? 8.850  -27.687 -42.662 1.00 58.04  ? 66  ARG B N   1 
ATOM   1036 C CA  . ARG B 1 54 ? 9.553  -28.140 -41.464 1.00 61.48  ? 66  ARG B CA  1 
ATOM   1037 C C   . ARG B 1 54 ? 9.437  -27.080 -40.379 1.00 50.40  ? 66  ARG B C   1 
ATOM   1038 O O   . ARG B 1 54 ? 9.764  -25.932 -40.618 1.00 51.44  ? 66  ARG B O   1 
ATOM   1039 C CB  . ARG B 1 54 ? 11.021 -28.421 -41.761 1.00 60.95  ? 66  ARG B CB  1 
ATOM   1040 C CG  . ARG B 1 54 ? 11.230 -29.352 -42.938 1.00 69.79  ? 66  ARG B CG  1 
ATOM   1041 C CD  . ARG B 1 54 ? 12.720 -29.547 -43.223 1.00 76.26  ? 66  ARG B CD  1 
ATOM   1042 N NE  . ARG B 1 54 ? 12.964 -30.195 -44.516 1.00 82.75  ? 66  ARG B NE  1 
ATOM   1043 C CZ  . ARG B 1 54 ? 12.725 -31.477 -44.784 1.00 78.33  ? 66  ARG B CZ  1 
ATOM   1044 N NH1 . ARG B 1 54 ? 12.209 -32.286 -43.860 1.00 76.92  ? 66  ARG B NH1 1 
ATOM   1045 N NH2 . ARG B 1 54 ? 12.991 -31.955 -45.995 1.00 85.39  ? 66  ARG B NH2 1 
ATOM   1046 N N   . PRO B 1 55 ? 8.949  -27.464 -39.186 1.00 50.02  ? 67  PRO B N   1 
ATOM   1047 C CA  . PRO B 1 55 ? 8.841  -26.532 -38.074 1.00 49.52  ? 67  PRO B CA  1 
ATOM   1048 C C   . PRO B 1 55 ? 10.191 -25.994 -37.627 1.00 48.41  ? 67  PRO B C   1 
ATOM   1049 O O   . PRO B 1 55 ? 11.105 -26.762 -37.378 1.00 53.44  ? 67  PRO B O   1 
ATOM   1050 C CB  . PRO B 1 55 ? 8.198  -27.373 -36.962 1.00 48.82  ? 67  PRO B CB  1 
ATOM   1051 C CG  . PRO B 1 55 ? 8.371  -28.771 -37.353 1.00 52.61  ? 67  PRO B CG  1 
ATOM   1052 C CD  . PRO B 1 55 ? 8.448  -28.807 -38.829 1.00 52.46  ? 67  PRO B CD  1 
ATOM   1053 N N   . VAL B 1 56 ? 10.290 -24.676 -37.525 1.00 47.39  ? 68  VAL B N   1 
ATOM   1054 C CA  . VAL B 1 56 ? 11.526 -24.010 -37.181 1.00 46.76  ? 68  VAL B CA  1 
ATOM   1055 C C   . VAL B 1 56 ? 11.269 -23.038 -36.045 1.00 48.94  ? 68  VAL B C   1 
ATOM   1056 O O   . VAL B 1 56 ? 12.027 -22.094 -35.859 1.00 52.53  ? 68  VAL B O   1 
ATOM   1057 C CB  . VAL B 1 56 ? 12.117 -23.243 -38.409 1.00 48.53  ? 68  VAL B CB  1 
ATOM   1058 C CG1 . VAL B 1 56 ? 12.574 -24.226 -39.500 1.00 48.04  ? 68  VAL B CG1 1 
ATOM   1059 C CG2 . VAL B 1 56 ? 11.100 -22.273 -38.980 1.00 44.79  ? 68  VAL B CG2 1 
ATOM   1060 N N   . GLU B 1 57 ? 10.210 -23.280 -35.276 1.00 48.05  ? 69  GLU B N   1 
ATOM   1061 C CA  . GLU B 1 57 ? 9.796  -22.371 -34.204 1.00 52.35  ? 69  GLU B CA  1 
ATOM   1062 C C   . GLU B 1 57 ? 10.878 -22.242 -33.126 1.00 53.65  ? 69  GLU B C   1 
ATOM   1063 O O   . GLU B 1 57 ? 11.047 -21.178 -32.523 1.00 48.18  ? 69  GLU B O   1 
ATOM   1064 C CB  . GLU B 1 57 ? 8.489  -22.852 -33.548 1.00 54.40  ? 69  GLU B CB  1 
ATOM   1065 C CG  . GLU B 1 57 ? 7.244  -22.832 -34.466 1.00 56.59  ? 69  GLU B CG  1 
ATOM   1066 C CD  . GLU B 1 57 ? 6.998  -24.159 -35.188 1.00 68.87  ? 69  GLU B CD  1 
ATOM   1067 O OE1 . GLU B 1 57 ? 5.940  -24.304 -35.849 1.00 63.56  ? 69  GLU B OE1 1 
ATOM   1068 O OE2 . GLU B 1 57 ? 7.857  -25.064 -35.085 1.00 69.38  ? 69  GLU B OE2 1 
ATOM   1069 N N   . HIS B 1 58 ? 11.599 -23.337 -32.909 1.00 49.16  ? 70  HIS B N   1 
ATOM   1070 C CA  . HIS B 1 58 ? 12.625 -23.440 -31.875 1.00 51.50  ? 70  HIS B CA  1 
ATOM   1071 C C   . HIS B 1 58 ? 14.034 -23.092 -32.372 1.00 48.39  ? 70  HIS B C   1 
ATOM   1072 O O   . HIS B 1 58 ? 14.991 -23.176 -31.613 1.00 48.95  ? 70  HIS B O   1 
ATOM   1073 C CB  . HIS B 1 58 ? 12.619 -24.863 -31.297 1.00 53.35  ? 70  HIS B CB  1 
ATOM   1074 C CG  . HIS B 1 58 ? 12.855 -25.938 -32.320 1.00 67.00  ? 70  HIS B CG  1 
ATOM   1075 N ND1 . HIS B 1 58 ? 12.030 -26.130 -33.411 1.00 58.49  ? 70  HIS B ND1 1 
ATOM   1076 C CD2 . HIS B 1 58 ? 13.815 -26.892 -32.403 1.00 67.03  ? 70  HIS B CD2 1 
ATOM   1077 C CE1 . HIS B 1 58 ? 12.474 -27.151 -34.122 1.00 63.56  ? 70  HIS B CE1 1 
ATOM   1078 N NE2 . HIS B 1 58 ? 13.557 -27.630 -33.533 1.00 69.97  ? 70  HIS B NE2 1 
ATOM   1079 N N   . TRP B 1 59 ? 14.155 -22.685 -33.634 1.00 46.51  ? 71  TRP B N   1 
ATOM   1080 C CA  . TRP B 1 59 ? 15.446 -22.448 -34.249 1.00 46.01  ? 71  TRP B CA  1 
ATOM   1081 C C   . TRP B 1 59 ? 15.992 -21.060 -33.967 1.00 49.97  ? 71  TRP B C   1 
ATOM   1082 O O   . TRP B 1 59 ? 15.241 -20.087 -33.842 1.00 47.13  ? 71  TRP B O   1 
ATOM   1083 C CB  . TRP B 1 59 ? 15.373 -22.617 -35.760 1.00 46.74  ? 71  TRP B CB  1 
ATOM   1084 C CG  . TRP B 1 59 ? 15.258 -24.017 -36.246 1.00 47.66  ? 71  TRP B CG  1 
ATOM   1085 C CD1 . TRP B 1 59 ? 14.651 -25.062 -35.618 1.00 49.16  ? 71  TRP B CD1 1 
ATOM   1086 C CD2 . TRP B 1 59 ? 15.736 -24.525 -37.500 1.00 47.83  ? 71  TRP B CD2 1 
ATOM   1087 N NE1 . TRP B 1 59 ? 14.742 -26.195 -36.389 1.00 42.18  ? 71  TRP B NE1 1 
ATOM   1088 C CE2 . TRP B 1 59 ? 15.396 -25.895 -37.552 1.00 45.90  ? 71  TRP B CE2 1 
ATOM   1089 C CE3 . TRP B 1 59 ? 16.436 -23.959 -38.573 1.00 50.63  ? 71  TRP B CE3 1 
ATOM   1090 C CZ2 . TRP B 1 59 ? 15.726 -26.709 -38.636 1.00 50.51  ? 71  TRP B CZ2 1 
ATOM   1091 C CZ3 . TRP B 1 59 ? 16.760 -24.764 -39.657 1.00 55.43  ? 71  TRP B CZ3 1 
ATOM   1092 C CH2 . TRP B 1 59 ? 16.406 -26.123 -39.683 1.00 53.74  ? 71  TRP B CH2 1 
ATOM   1093 N N   . LYS B 1 60 ? 17.320 -20.999 -33.890 1.00 48.07  ? 72  LYS B N   1 
ATOM   1094 C CA  . LYS B 1 60 ? 18.046 -19.757 -33.814 1.00 46.76  ? 72  LYS B CA  1 
ATOM   1095 C C   . LYS B 1 60 ? 18.080 -19.086 -35.185 1.00 47.51  ? 72  LYS B C   1 
ATOM   1096 O O   . LYS B 1 60 ? 18.000 -19.728 -36.216 1.00 49.34  ? 72  LYS B O   1 
ATOM   1097 C CB  . LYS B 1 60 ? 19.476 -20.004 -33.351 1.00 45.45  ? 72  LYS B CB  1 
ATOM   1098 C CG  . LYS B 1 60 ? 19.579 -20.724 -32.023 1.00 46.65  ? 72  LYS B CG  1 
ATOM   1099 C CD  . LYS B 1 60 ? 19.876 -19.802 -30.877 1.00 50.68  ? 72  LYS B CD  1 
ATOM   1100 C CE  . LYS B 1 60 ? 19.941 -20.595 -29.577 1.00 51.24  ? 72  LYS B CE  1 
ATOM   1101 N NZ  . LYS B 1 60 ? 20.626 -19.829 -28.524 1.00 51.10  ? 72  LYS B NZ  1 
ATOM   1102 N N   . CYS B 1 61 ? 18.205 -17.773 -35.162 1.00 49.01  ? 73  CYS B N   1 
ATOM   1103 C CA  . CYS B 1 61 ? 18.367 -16.981 -36.358 1.00 51.11  ? 73  CYS B CA  1 
ATOM   1104 C C   . CYS B 1 61 ? 19.409 -17.573 -37.325 1.00 49.59  ? 73  CYS B C   1 
ATOM   1105 O O   . CYS B 1 61 ? 19.147 -17.819 -38.512 1.00 49.09  ? 73  CYS B O   1 
ATOM   1106 C CB  . CYS B 1 61 ? 18.809 -15.577 -35.956 1.00 48.72  ? 73  CYS B CB  1 
ATOM   1107 S SG  . CYS B 1 61 ? 18.646 -14.466 -37.283 1.00 57.47  ? 73  CYS B SG  1 
ATOM   1108 N N   . VAL B 1 62 ? 20.589 -17.791 -36.770 1.00 53.94  ? 74  VAL B N   1 
ATOM   1109 C CA  . VAL B 1 62 ? 21.765 -18.266 -37.484 1.00 50.00  ? 74  VAL B CA  1 
ATOM   1110 C C   . VAL B 1 62 ? 21.615 -19.698 -38.035 1.00 48.85  ? 74  VAL B C   1 
ATOM   1111 O O   . VAL B 1 62 ? 22.225 -20.036 -39.053 1.00 53.72  ? 74  VAL B O   1 
ATOM   1112 C CB  . VAL B 1 62 ? 22.996 -18.116 -36.545 1.00 50.62  ? 74  VAL B CB  1 
ATOM   1113 C CG1 . VAL B 1 62 ? 23.973 -19.243 -36.721 1.00 61.34  ? 74  VAL B CG1 1 
ATOM   1114 C CG2 . VAL B 1 62 ? 23.649 -16.745 -36.756 1.00 41.68  ? 74  VAL B CG2 1 
ATOM   1115 N N   . GLU B 1 63 ? 20.794 -20.520 -37.384 1.00 47.93  ? 75  GLU B N   1 
ATOM   1116 C CA  . GLU B 1 63 ? 20.460 -21.858 -37.890 1.00 51.00  ? 75  GLU B CA  1 
ATOM   1117 C C   . GLU B 1 63 ? 19.499 -21.774 -39.082 1.00 51.29  ? 75  GLU B C   1 
ATOM   1118 O O   . GLU B 1 63 ? 19.648 -22.508 -40.058 1.00 47.11  ? 75  GLU B O   1 
ATOM   1119 C CB  . GLU B 1 63 ? 19.866 -22.729 -36.774 1.00 46.29  ? 75  GLU B CB  1 
ATOM   1120 C CG  . GLU B 1 63 ? 20.879 -23.071 -35.685 1.00 58.50  ? 75  GLU B CG  1 
ATOM   1121 C CD  . GLU B 1 63 ? 20.282 -23.591 -34.352 1.00 55.93  ? 75  GLU B CD  1 
ATOM   1122 O OE1 . GLU B 1 63 ? 19.056 -23.538 -34.141 1.00 51.84  ? 75  GLU B OE1 1 
ATOM   1123 O OE2 . GLU B 1 63 ? 21.074 -24.055 -33.505 1.00 51.85  ? 75  GLU B OE2 1 
ATOM   1124 N N   . LEU B 1 64 ? 18.521 -20.869 -39.011 1.00 51.96  ? 76  LEU B N   1 
ATOM   1125 C CA  . LEU B 1 64 ? 17.558 -20.699 -40.115 1.00 50.78  ? 76  LEU B CA  1 
ATOM   1126 C C   . LEU B 1 64 ? 18.262 -20.163 -41.357 1.00 47.39  ? 76  LEU B C   1 
ATOM   1127 O O   . LEU B 1 64 ? 18.040 -20.642 -42.482 1.00 46.73  ? 76  LEU B O   1 
ATOM   1128 C CB  . LEU B 1 64 ? 16.455 -19.724 -39.702 1.00 53.14  ? 76  LEU B CB  1 
ATOM   1129 C CG  . LEU B 1 64 ? 15.244 -19.667 -40.627 1.00 51.06  ? 76  LEU B CG  1 
ATOM   1130 C CD1 . LEU B 1 64 ? 14.527 -21.005 -40.652 1.00 47.94  ? 76  LEU B CD1 1 
ATOM   1131 C CD2 . LEU B 1 64 ? 14.307 -18.559 -40.186 1.00 45.61  ? 76  LEU B CD2 1 
ATOM   1132 N N   . ALA B 1 65 ? 19.107 -19.159 -41.125 1.00 42.85  ? 77  ALA B N   1 
ATOM   1133 C CA  . ALA B 1 65 ? 19.954 -18.565 -42.152 1.00 46.13  ? 77  ALA B CA  1 
ATOM   1134 C C   . ALA B 1 65 ? 20.821 -19.599 -42.869 1.00 45.26  ? 77  ALA B C   1 
ATOM   1135 O O   . ALA B 1 65 ? 20.960 -19.536 -44.083 1.00 54.35  ? 77  ALA B O   1 
ATOM   1136 C CB  . ALA B 1 65 ? 20.836 -17.486 -41.539 1.00 40.94  ? 77  ALA B CB  1 
ATOM   1137 N N   . HIS B 1 66 ? 21.408 -20.539 -42.127 1.00 44.55  ? 78  HIS B N   1 
ATOM   1138 C CA  . HIS B 1 66 ? 22.291 -21.541 -42.733 1.00 45.62  ? 78  HIS B CA  1 
ATOM   1139 C C   . HIS B 1 66 ? 21.495 -22.474 -43.664 1.00 46.33  ? 78  HIS B C   1 
ATOM   1140 O O   . HIS B 1 66 ? 21.943 -22.817 -44.761 1.00 50.61  ? 78  HIS B O   1 
ATOM   1141 C CB  . HIS B 1 66 ? 23.020 -22.352 -41.644 1.00 42.14  ? 78  HIS B CB  1 
ATOM   1142 C CG  . HIS B 1 66 ? 24.022 -23.326 -42.181 1.00 43.04  ? 78  HIS B CG  1 
ATOM   1143 N ND1 . HIS B 1 66 ? 25.292 -22.951 -42.566 1.00 57.40  ? 78  HIS B ND1 1 
ATOM   1144 C CD2 . HIS B 1 66 ? 23.941 -24.659 -42.403 1.00 42.03  ? 78  HIS B CD2 1 
ATOM   1145 C CE1 . HIS B 1 66 ? 25.950 -24.013 -42.996 1.00 52.46  ? 78  HIS B CE1 1 
ATOM   1146 N NE2 . HIS B 1 66 ? 25.156 -25.063 -42.901 1.00 50.33  ? 78  HIS B NE2 1 
ATOM   1147 N N   . GLU B 1 67 ? 20.318 -22.877 -43.206 1.00 46.21  ? 79  GLU B N   1 
ATOM   1148 C CA  . GLU B 1 67 ? 19.454 -23.773 -43.946 1.00 48.49  ? 79  GLU B CA  1 
ATOM   1149 C C   . GLU B 1 67 ? 18.909 -23.086 -45.201 1.00 48.98  ? 79  GLU B C   1 
ATOM   1150 O O   . GLU B 1 67 ? 18.841 -23.694 -46.281 1.00 48.26  ? 79  GLU B O   1 
ATOM   1151 C CB  . GLU B 1 67 ? 18.291 -24.220 -43.053 1.00 47.22  ? 79  GLU B CB  1 
ATOM   1152 C CG  . GLU B 1 67 ? 17.361 -25.260 -43.688 1.00 57.76  ? 79  GLU B CG  1 
ATOM   1153 C CD  . GLU B 1 67 ? 18.054 -26.583 -43.984 1.00 70.13  ? 79  GLU B CD  1 
ATOM   1154 O OE1 . GLU B 1 67 ? 19.038 -26.919 -43.286 1.00 72.06  ? 79  GLU B OE1 1 
ATOM   1155 O OE2 . GLU B 1 67 ? 17.611 -27.295 -44.912 1.00 74.50  ? 79  GLU B OE2 1 
ATOM   1156 N N   . ILE B 1 68 ? 18.504 -21.828 -45.048 1.00 47.43  ? 80  ILE B N   1 
ATOM   1157 C CA  . ILE B 1 68 ? 17.982 -21.058 -46.183 1.00 47.70  ? 80  ILE B CA  1 
ATOM   1158 C C   . ILE B 1 68 ? 19.032 -20.889 -47.296 1.00 46.31  ? 80  ILE B C   1 
ATOM   1159 O O   . ILE B 1 68 ? 18.693 -20.924 -48.476 1.00 47.66  ? 80  ILE B O   1 
ATOM   1160 C CB  . ILE B 1 68 ? 17.465 -19.674 -45.725 1.00 48.25  ? 80  ILE B CB  1 
ATOM   1161 C CG1 . ILE B 1 68 ? 16.099 -19.826 -45.062 1.00 51.22  ? 80  ILE B CG1 1 
ATOM   1162 C CG2 . ILE B 1 68 ? 17.397 -18.670 -46.917 1.00 44.63  ? 80  ILE B CG2 1 
ATOM   1163 C CD1 . ILE B 1 68 ? 15.674 -18.584 -44.229 1.00 41.97  ? 80  ILE B CD1 1 
ATOM   1164 N N   . ARG B 1 69 ? 20.300 -20.713 -46.917 1.00 47.12  ? 81  ARG B N   1 
ATOM   1165 C CA  . ARG B 1 69 ? 21.369 -20.484 -47.901 1.00 46.61  ? 81  ARG B CA  1 
ATOM   1166 C C   . ARG B 1 69 ? 21.628 -21.700 -48.766 0.50 42.77  ? 81  ARG B C   1 
ATOM   1167 O O   . ARG B 1 69 ? 22.129 -21.577 -49.867 1.00 48.08  ? 81  ARG B O   1 
ATOM   1168 C CB  . ARG B 1 69 ? 22.680 -20.089 -47.214 1.00 44.11  ? 81  ARG B CB  1 
ATOM   1169 C CG  . ARG B 1 69 ? 22.666 -18.677 -46.643 1.00 56.73  ? 81  ARG B CG  1 
ATOM   1170 C CD  . ARG B 1 69 ? 24.076 -18.187 -46.331 1.00 53.37  ? 81  ARG B CD  1 
ATOM   1171 N NE  . ARG B 1 69 ? 24.037 -17.025 -45.448 1.00 63.46  ? 81  ARG B NE  1 
ATOM   1172 C CZ  . ARG B 1 69 ? 24.097 -17.070 -44.117 1.00 65.84  ? 81  ARG B CZ  1 
ATOM   1173 N NH1 . ARG B 1 69 ? 24.215 -18.232 -43.465 1.00 61.96  ? 81  ARG B NH1 1 
ATOM   1174 N NH2 . ARG B 1 69 ? 24.045 -15.938 -43.426 1.00 74.44  ? 81  ARG B NH2 1 
ATOM   1175 N N   . SER B 1 70 ? 21.310 -22.873 -48.249 1.00 41.98  ? 82  SER B N   1 
ATOM   1176 C CA  . SER B 1 70 ? 21.522 -24.129 -48.978 1.00 45.73  ? 82  SER B CA  1 
ATOM   1177 C C   . SER B 1 70 ? 20.356 -24.511 -49.905 1.00 45.90  ? 82  SER B C   1 
ATOM   1178 O O   . SER B 1 70 ? 20.478 -25.466 -50.662 1.00 46.74  ? 82  SER B O   1 
ATOM   1179 C CB  . SER B 1 70 ? 21.784 -25.280 -47.987 1.00 42.67  ? 82  SER B CB  1 
ATOM   1180 O OG  . SER B 1 70 ? 20.675 -25.453 -47.114 1.00 50.78  ? 82  SER B OG  1 
ATOM   1181 N N   . CYS B 1 71 ? 19.231 -23.793 -49.831 1.00 47.77  ? 83  CYS B N   1 
ATOM   1182 C CA  . CYS B 1 71 ? 18.099 -24.068 -50.717 1.00 50.11  ? 83  CYS B CA  1 
ATOM   1183 C C   . CYS B 1 71 ? 18.357 -23.405 -52.062 1.00 51.66  ? 83  CYS B C   1 
ATOM   1184 O O   . CYS B 1 71 ? 18.453 -22.181 -52.138 1.00 52.45  ? 83  CYS B O   1 
ATOM   1185 C CB  . CYS B 1 71 ? 16.790 -23.567 -50.128 1.00 52.05  ? 83  CYS B CB  1 
ATOM   1186 S SG  . CYS B 1 71 ? 16.320 -24.446 -48.631 1.00 56.26  ? 83  CYS B SG  1 
ATOM   1187 N N   . PRO B 1 72 ? 18.491 -24.216 -53.124 1.00 50.77  ? 84  PRO B N   1 
ATOM   1188 C CA  . PRO B 1 72 ? 18.940 -23.689 -54.406 1.00 51.96  ? 84  PRO B CA  1 
ATOM   1189 C C   . PRO B 1 72 ? 17.884 -22.974 -55.269 1.00 50.88  ? 84  PRO B C   1 
ATOM   1190 O O   . PRO B 1 72 ? 18.237 -22.057 -56.008 1.00 54.36  ? 84  PRO B O   1 
ATOM   1191 C CB  . PRO B 1 72 ? 19.487 -24.936 -55.115 1.00 51.11  ? 84  PRO B CB  1 
ATOM   1192 C CG  . PRO B 1 72 ? 18.692 -26.067 -54.555 1.00 52.42  ? 84  PRO B CG  1 
ATOM   1193 C CD  . PRO B 1 72 ? 18.279 -25.676 -53.166 1.00 49.78  ? 84  PRO B CD  1 
ATOM   1194 N N   . SER B 1 73 ? 16.622 -23.389 -55.201 1.00 49.80  ? 85  SER B N   1 
ATOM   1195 C CA  . SER B 1 73 ? 15.597 -22.852 -56.108 1.00 52.57  ? 85  SER B CA  1 
ATOM   1196 C C   . SER B 1 73 ? 14.611 -21.924 -55.412 1.00 51.82  ? 85  SER B C   1 
ATOM   1197 O O   . SER B 1 73 ? 14.487 -20.749 -55.773 0.50 44.46  ? 85  SER B O   1 
ATOM   1198 C CB  . SER B 1 73 ? 14.836 -23.989 -56.803 1.00 54.20  ? 85  SER B CB  1 
ATOM   1199 O OG  . SER B 1 73 ? 15.591 -24.510 -57.879 1.00 55.47  ? 85  SER B OG  1 
ATOM   1200 N N   . GLU B 1 74 ? 13.890 -22.466 -54.439 1.00 55.60  ? 86  GLU B N   1 
ATOM   1201 C CA  . GLU B 1 74 ? 12.930 -21.670 -53.682 1.00 58.28  ? 86  GLU B CA  1 
ATOM   1202 C C   . GLU B 1 74 ? 12.773 -22.181 -52.256 1.00 56.88  ? 86  GLU B C   1 
ATOM   1203 O O   . GLU B 1 74 ? 13.201 -23.288 -51.915 1.00 56.77  ? 86  GLU B O   1 
ATOM   1204 C CB  . GLU B 1 74 ? 11.564 -21.616 -54.397 1.00 57.86  ? 86  GLU B CB  1 
ATOM   1205 C CG  . GLU B 1 74 ? 10.623 -22.791 -54.133 1.00 59.21  ? 86  GLU B CG  1 
ATOM   1206 C CD  . GLU B 1 74 ? 9.285  -22.639 -54.843 1.00 56.38  ? 86  GLU B CD  1 
ATOM   1207 N N   . ILE B 1 75 ? 12.165 -21.338 -51.435 1.00 52.64  ? 87  ILE B N   1 
ATOM   1208 C CA  . ILE B 1 75 ? 11.760 -21.705 -50.103 1.00 50.42  ? 87  ILE B CA  1 
ATOM   1209 C C   . ILE B 1 75 ? 10.298 -21.308 -49.933 1.00 53.91  ? 87  ILE B C   1 
ATOM   1210 O O   . ILE B 1 75 ? 9.815  -20.372 -50.579 1.00 51.74  ? 87  ILE B O   1 
ATOM   1211 C CB  . ILE B 1 75 ? 12.620 -21.010 -49.011 1.00 54.19  ? 87  ILE B CB  1 
ATOM   1212 C CG1 . ILE B 1 75 ? 12.567 -19.489 -49.141 1.00 46.92  ? 87  ILE B CG1 1 
ATOM   1213 C CG2 . ILE B 1 75 ? 14.075 -21.498 -49.062 1.00 51.01  ? 87  ILE B CG2 1 
ATOM   1214 C CD1 . ILE B 1 75 ? 13.190 -18.762 -47.975 1.00 45.49  ? 87  ILE B CD1 1 
ATOM   1215 N N   . ILE B 1 76 ? 9.606  -22.036 -49.064 1.00 55.47  ? 88  ILE B N   1 
ATOM   1216 C CA  . ILE B 1 76 ? 8.252  -21.709 -48.658 1.00 52.17  ? 88  ILE B CA  1 
ATOM   1217 C C   . ILE B 1 76 ? 8.280  -21.495 -47.150 1.00 50.57  ? 88  ILE B C   1 
ATOM   1218 O O   . ILE B 1 76 ? 8.648  -22.395 -46.399 1.00 53.34  ? 88  ILE B O   1 
ATOM   1219 C CB  . ILE B 1 76 ? 7.263  -22.845 -48.997 1.00 54.02  ? 88  ILE B CB  1 
ATOM   1220 C CG1 . ILE B 1 76 ? 7.316  -23.197 -50.490 1.00 54.25  ? 88  ILE B CG1 1 
ATOM   1221 C CG2 . ILE B 1 76 ? 5.848  -22.444 -48.609 1.00 55.71  ? 88  ILE B CG2 1 
ATOM   1222 C CD1 . ILE B 1 76 ? 6.830  -24.594 -50.796 1.00 57.55  ? 88  ILE B CD1 1 
ATOM   1223 N N   . LEU B 1 77 ? 7.916  -20.294 -46.717 1.00 49.84  ? 89  LEU B N   1 
ATOM   1224 C CA  . LEU B 1 77 ? 7.811  -19.962 -45.301 1.00 47.51  ? 89  LEU B CA  1 
ATOM   1225 C C   . LEU B 1 77 ? 6.356  -19.957 -44.853 1.00 50.57  ? 89  LEU B C   1 
ATOM   1226 O O   . LEU B 1 77 ? 5.499  -19.410 -45.552 1.00 56.09  ? 89  LEU B O   1 
ATOM   1227 C CB  . LEU B 1 77 ? 8.403  -18.583 -45.059 1.00 51.19  ? 89  LEU B CB  1 
ATOM   1228 C CG  . LEU B 1 77 ? 9.828  -18.371 -45.575 1.00 54.64  ? 89  LEU B CG  1 
ATOM   1229 C CD1 . LEU B 1 77 ? 10.246 -16.940 -45.333 1.00 45.48  ? 89  LEU B CD1 1 
ATOM   1230 C CD2 . LEU B 1 77 ? 10.791 -19.326 -44.900 1.00 50.33  ? 89  LEU B CD2 1 
ATOM   1231 N N   . LEU B 1 78 ? 6.064  -20.590 -43.715 1.00 49.43  ? 90  LEU B N   1 
ATOM   1232 C CA  . LEU B 1 78 ? 4.809  -20.324 -43.010 1.00 48.19  ? 90  LEU B CA  1 
ATOM   1233 C C   . LEU B 1 78 ? 5.084  -19.324 -41.897 1.00 46.49  ? 90  LEU B C   1 
ATOM   1234 O O   . LEU B 1 78 ? 5.950  -19.553 -41.061 1.00 45.99  ? 90  LEU B O   1 
ATOM   1235 C CB  . LEU B 1 78 ? 4.200  -21.578 -42.405 1.00 48.53  ? 90  LEU B CB  1 
ATOM   1236 C CG  . LEU B 1 78 ? 2.754  -21.310 -41.967 1.00 51.56  ? 90  LEU B CG  1 
ATOM   1237 C CD1 . LEU B 1 78 ? 1.777  -21.502 -43.142 1.00 39.14  ? 90  LEU B CD1 1 
ATOM   1238 C CD2 . LEU B 1 78 ? 2.388  -22.175 -40.787 1.00 50.77  ? 90  LEU B CD2 1 
ATOM   1239 N N   . VAL B 1 79 ? 4.337  -18.225 -41.891 1.00 46.18  ? 91  VAL B N   1 
ATOM   1240 C CA  . VAL B 1 79 ? 4.579  -17.127 -40.959 1.00 42.83  ? 91  VAL B CA  1 
ATOM   1241 C C   . VAL B 1 79 ? 3.341  -16.753 -40.121 1.00 44.37  ? 91  VAL B C   1 
ATOM   1242 O O   . VAL B 1 79 ? 2.205  -16.842 -40.585 1.00 43.26  ? 91  VAL B O   1 
ATOM   1243 C CB  . VAL B 1 79 ? 5.121  -15.879 -41.715 1.00 43.83  ? 91  VAL B CB  1 
ATOM   1244 C CG1 . VAL B 1 79 ? 6.329  -16.268 -42.589 1.00 38.03  ? 91  VAL B CG1 1 
ATOM   1245 C CG2 . VAL B 1 79 ? 4.019  -15.181 -42.548 1.00 38.89  ? 91  VAL B CG2 1 
ATOM   1246 N N   . TRP B 1 80 ? 3.578  -16.366 -38.870 1.00 48.61  ? 92  TRP B N   1 
ATOM   1247 C CA  . TRP B 1 80 ? 2.553  -15.762 -38.027 1.00 47.63  ? 92  TRP B CA  1 
ATOM   1248 C C   . TRP B 1 80 ? 2.654  -14.260 -38.229 1.00 48.44  ? 92  TRP B C   1 
ATOM   1249 O O   . TRP B 1 80 ? 3.740  -13.675 -38.078 1.00 47.69  ? 92  TRP B O   1 
ATOM   1250 C CB  . TRP B 1 80 ? 2.773  -16.111 -36.554 1.00 46.93  ? 92  TRP B CB  1 
ATOM   1251 N N   . ARG B 1 81 ? 1.527  -13.635 -38.568 1.00 45.14  ? 93  ARG B N   1 
ATOM   1252 C CA  . ARG B 1 81 ? 1.518  -12.228 -38.945 1.00 45.23  ? 93  ARG B CA  1 
ATOM   1253 C C   . ARG B 1 81 ? 0.473  -11.378 -38.225 1.00 47.51  ? 93  ARG B C   1 
ATOM   1254 O O   . ARG B 1 81 ? -0.681 -11.772 -38.067 1.00 48.81  ? 93  ARG B O   1 
ATOM   1255 C CB  . ARG B 1 81 ? 1.284  -12.109 -40.453 1.00 43.31  ? 93  ARG B CB  1 
ATOM   1256 C CG  . ARG B 1 81 ? 1.096  -10.678 -40.945 1.00 43.89  ? 93  ARG B CG  1 
ATOM   1257 C CD  . ARG B 1 81 ? 0.876  -10.576 -42.430 1.00 42.43  ? 93  ARG B CD  1 
ATOM   1258 N NE  . ARG B 1 81 ? 2.020  -11.053 -43.193 1.00 52.99  ? 93  ARG B NE  1 
ATOM   1259 C CZ  . ARG B 1 81 ? 2.074  -11.061 -44.517 1.00 42.35  ? 93  ARG B CZ  1 
ATOM   1260 N NH1 . ARG B 1 81 ? 1.046  -10.639 -45.248 1.00 43.10  ? 93  ARG B NH1 1 
ATOM   1261 N NH2 . ARG B 1 81 ? 3.162  -11.508 -45.112 1.00 44.05  ? 93  ARG B NH2 1 
ATOM   1262 N N   . MET B 1 82 ? 0.898  -10.193 -37.809 1.00 50.01  ? 94  MET B N   1 
ATOM   1263 C CA  . MET B 1 82 ? -0.031 -9.062  -37.648 1.00 55.30  ? 94  MET B CA  1 
ATOM   1264 C C   . MET B 1 82 ? -0.063 -7.885  -38.666 1.00 54.64  ? 94  MET B C   1 
ATOM   1265 O O   . MET B 1 82 ? 0.970  -7.224  -38.839 1.00 56.27  ? 94  MET B O   1 
ATOM   1266 C CB  . MET B 1 82 ? -0.561 -8.830  -36.221 1.00 51.78  ? 94  MET B CB  1 
ATOM   1267 C CG  . MET B 1 82 ? -1.230 -7.492  -35.995 1.00 57.87  ? 94  MET B CG  1 
ATOM   1268 S SD  . MET B 1 82 ? -2.390 -7.606  -34.632 1.00 76.69  ? 94  MET B SD  1 
ATOM   1269 N N   . VAL B 1 83 ? -1.172 -7.612  -39.366 1.00 55.41  ? 95  VAL B N   1 
ATOM   1270 C CA  . VAL B 1 83 ? -2.450 -8.367  -39.399 1.00 57.14  ? 95  VAL B CA  1 
ATOM   1271 C C   . VAL B 1 83 ? -3.592 -8.243  -38.387 1.00 57.48  ? 95  VAL B C   1 
ATOM   1272 O O   . VAL B 1 83 ? -4.436 -7.341  -38.504 1.00 58.45  ? 95  VAL B O   1 
ATOM   1273 C CB  . VAL B 1 83 ? -2.568 -9.497  -40.468 1.00 58.26  ? 95  VAL B CB  1 
ATOM   1274 C CG1 . VAL B 1 83 ? -2.556 -10.855 -39.814 1.00 56.00  ? 95  VAL B CG1 1 
ATOM   1275 C CG2 . VAL B 1 83 ? -3.832 -9.310  -41.309 1.00 57.81  ? 95  VAL B CG2 1 
HETATM 1276 S S   . SO4 C 2 .  ? 18.066 -10.080 -8.176  1.00 61.64  ? 1   SO4 A S   1 
HETATM 1277 O O1  . SO4 C 2 .  ? 18.967 -9.380  -9.093  1.00 65.44  ? 1   SO4 A O1  1 
HETATM 1278 O O2  . SO4 C 2 .  ? 17.368 -11.102 -8.952  1.00 56.85  ? 1   SO4 A O2  1 
HETATM 1279 O O3  . SO4 C 2 .  ? 18.850 -10.686 -7.104  1.00 78.14  ? 1   SO4 A O3  1 
HETATM 1280 O O4  . SO4 C 2 .  ? 17.100 -9.190  -7.538  1.00 53.06  ? 1   SO4 A O4  1 
HETATM 1281 S S   . SO4 D 2 .  ? 24.942 -0.593  -24.308 1.00 111.71 ? 2   SO4 A S   1 
HETATM 1282 O O1  . SO4 D 2 .  ? 26.245 -1.254  -24.312 1.00 107.95 ? 2   SO4 A O1  1 
HETATM 1283 O O2  . SO4 D 2 .  ? 24.450 -0.469  -25.684 1.00 104.11 ? 2   SO4 A O2  1 
HETATM 1284 O O3  . SO4 D 2 .  ? 24.012 -1.412  -23.536 1.00 104.52 ? 2   SO4 A O3  1 
HETATM 1285 O O4  . SO4 D 2 .  ? 25.071 0.731   -23.697 1.00 83.91  ? 2   SO4 A O4  1 
HETATM 1286 O O   . HOH E 3 .  ? 14.636 -12.367 -15.057 1.00 27.14  ? 104 HOH A O   1 
HETATM 1287 O O   . HOH E 3 .  ? 11.064 -1.582  -29.306 1.00 36.91  ? 105 HOH A O   1 
HETATM 1288 O O   . HOH E 3 .  ? 20.034 -8.572  -24.628 1.00 36.63  ? 106 HOH A O   1 
HETATM 1289 O O   . HOH E 3 .  ? 5.054  -13.122 -24.930 1.00 35.36  ? 107 HOH A O   1 
HETATM 1290 O O   . HOH E 3 .  ? 9.336  -16.520 -20.745 1.00 31.77  ? 108 HOH A O   1 
HETATM 1291 O O   . HOH E 3 .  ? 12.601 -17.169 -21.376 1.00 42.22  ? 109 HOH A O   1 
HETATM 1292 O O   . HOH E 3 .  ? 11.670 -14.619 -27.779 1.00 35.95  ? 110 HOH A O   1 
HETATM 1293 O O   . HOH E 3 .  ? 4.750  -9.725  -29.052 1.00 46.46  ? 111 HOH A O   1 
HETATM 1294 O O   . HOH E 3 .  ? 20.717 -5.190  -17.253 1.00 37.80  ? 112 HOH A O   1 
HETATM 1295 O O   . HOH E 3 .  ? 18.908 -9.376  -32.665 1.00 40.21  ? 113 HOH A O   1 
HETATM 1296 O O   . HOH E 3 .  ? 26.349 -4.939  -13.211 1.00 57.35  ? 114 HOH A O   1 
HETATM 1297 O O   . HOH E 3 .  ? 27.038 -5.399  -15.782 1.00 62.57  ? 115 HOH A O   1 
HETATM 1298 O O   . HOH E 3 .  ? 20.380 -3.045  -32.885 1.00 39.93  ? 116 HOH A O   1 
HETATM 1299 O O   . HOH E 3 .  ? -0.640 -11.830 -19.944 1.00 57.48  ? 117 HOH A O   1 
HETATM 1300 O O   . HOH E 3 .  ? 23.155 -5.874  -18.088 1.00 44.85  ? 118 HOH A O   1 
HETATM 1301 O O   . HOH E 3 .  ? 3.974  -12.647 -27.333 1.00 41.83  ? 119 HOH A O   1 
HETATM 1302 O O   . HOH E 3 .  ? 6.463  2.562   -19.732 1.00 36.59  ? 120 HOH A O   1 
HETATM 1303 O O   . HOH E 3 .  ? 8.522  -12.423 -33.089 1.00 42.94  ? 121 HOH A O   1 
HETATM 1304 O O   . HOH E 3 .  ? 23.888 -4.429  -22.885 1.00 47.95  ? 122 HOH A O   1 
HETATM 1305 O O   . HOH E 3 .  ? 5.034  -6.039  -13.278 1.00 38.10  ? 123 HOH A O   1 
HETATM 1306 O O   . HOH E 3 .  ? 19.149 -6.606  -18.043 1.00 46.74  ? 124 HOH A O   1 
HETATM 1307 O O   . HOH F 3 .  ? 11.684 -19.457 -36.348 1.00 28.00  ? 104 HOH B O   1 
HETATM 1308 O O   . HOH F 3 .  ? 12.559 -8.546  -51.088 1.00 43.35  ? 105 HOH B O   1 
HETATM 1309 O O   . HOH F 3 .  ? 10.851 -3.840  -44.705 1.00 42.47  ? 106 HOH B O   1 
HETATM 1310 O O   . HOH F 3 .  ? 19.106 -11.592 -33.777 1.00 44.12  ? 107 HOH B O   1 
HETATM 1311 O O   . HOH F 3 .  ? 21.230 -16.682 -33.801 1.00 31.13  ? 108 HOH B O   1 
HETATM 1312 O O   . HOH F 3 .  ? 15.330 -24.744 -53.508 1.00 38.80  ? 109 HOH B O   1 
HETATM 1313 O O   . HOH F 3 .  ? 18.860 -14.572 -48.597 1.00 34.33  ? 110 HOH B O   1 
HETATM 1314 O O   . HOH F 3 .  ? 19.607 -11.465 -41.910 1.00 30.37  ? 111 HOH B O   1 
HETATM 1315 O O   . HOH F 3 .  ? 19.886 -13.420 -45.921 1.00 52.10  ? 112 HOH B O   1 
HETATM 1316 O O   . HOH F 3 .  ? 19.697 -15.914 -45.288 1.00 43.45  ? 113 HOH B O   1 
HETATM 1317 O O   . HOH F 3 .  ? 7.440  -5.011  -44.884 1.00 32.96  ? 114 HOH B O   1 
HETATM 1318 O O   . HOH F 3 .  ? 20.735 -13.450 -41.863 1.00 43.60  ? 115 HOH B O   1 
HETATM 1319 O O   . HOH F 3 .  ? 4.070  -8.564  -40.476 1.00 41.06  ? 116 HOH B O   1 
HETATM 1320 O O   . HOH F 3 .  ? 24.444 -19.137 -40.182 1.00 40.33  ? 117 HOH B O   1 
HETATM 1321 O O   . HOH F 3 .  ? 11.289 -16.924 -27.582 1.00 51.80  ? 118 HOH B O   1 
HETATM 1322 O O   . HOH F 3 .  ? -2.211 -9.604  -44.912 1.00 45.79  ? 119 HOH B O   1 
HETATM 1323 O O   . HOH F 3 .  ? 21.609 -11.032 -45.723 1.00 69.05  ? 120 HOH B O   1 
HETATM 1324 O O   . HOH F 3 .  ? 23.843 -10.810 -53.226 1.00 61.36  ? 121 HOH B O   1 
HETATM 1325 O O   . HOH F 3 .  ? 21.352 -16.710 -55.116 1.00 50.63  ? 122 HOH B O   1 
HETATM 1326 O O   . HOH F 3 .  ? 10.824 -6.550  -38.103 1.00 44.13  ? 123 HOH B O   1 
HETATM 1327 O O   . HOH F 3 .  ? 15.114 -26.106 -51.304 1.00 61.72  ? 124 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  13  ?  ?   ?   A . n 
A 1 2  MET 2  14  14 MET MET A . n 
A 1 3  ARG 3  15  15 ARG ARG A . n 
A 1 4  TYR 4  16  16 TYR TYR A . n 
A 1 5  ARG 5  17  17 ARG ARG A . n 
A 1 6  GLN 6  18  18 GLN GLN A . n 
A 1 7  ILE 7  19  19 ILE ILE A . n 
A 1 8  THR 8  20  20 THR THR A . n 
A 1 9  ILE 9  21  21 ILE ILE A . n 
A 1 10 PRO 10 22  22 PRO PRO A . n 
A 1 11 ARG 11 23  23 ARG ARG A . n 
A 1 12 GLY 12 24  24 GLY GLY A . n 
A 1 13 LYS 13 25  25 LYS LYS A . n 
A 1 14 ASP 14 26  26 ASP ASP A . n 
A 1 15 GLY 15 27  27 GLY GLY A . n 
A 1 16 PHE 16 28  28 PHE PHE A . n 
A 1 17 GLY 17 29  29 GLY GLY A . n 
A 1 18 PHE 18 30  30 PHE PHE A . n 
A 1 19 THR 19 31  31 THR THR A . n 
A 1 20 ILE 20 32  32 ILE ILE A . n 
A 1 21 CYS 21 33  33 CYS CYS A . n 
A 1 22 CYS 22 34  34 CYS CYS A . n 
A 1 23 ASP 23 35  35 ASP ASP A . n 
A 1 24 SER 24 36  36 SER SER A . n 
A 1 25 PRO 25 37  37 PRO PRO A . n 
A 1 26 VAL 26 38  38 VAL VAL A . n 
A 1 27 ARG 27 39  39 ARG ARG A . n 
A 1 28 VAL 28 40  40 VAL VAL A . n 
A 1 29 GLN 29 41  41 GLN GLN A . n 
A 1 30 ALA 30 42  42 ALA ALA A . n 
A 1 31 VAL 31 43  43 VAL VAL A . n 
A 1 32 ASP 32 44  44 ASP ASP A . n 
A 1 33 SER 33 45  45 SER SER A . n 
A 1 34 GLY 34 46  46 GLY GLY A . n 
A 1 35 GLY 35 47  47 GLY GLY A . n 
A 1 36 PRO 36 48  48 PRO PRO A . n 
A 1 37 ALA 37 49  49 ALA ALA A . n 
A 1 38 GLU 38 50  50 GLU GLU A . n 
A 1 39 ARG 39 51  51 ARG ARG A . n 
A 1 40 ALA 40 52  52 ALA ALA A . n 
A 1 41 GLY 41 53  53 GLY GLY A . n 
A 1 42 LEU 42 54  54 LEU LEU A . n 
A 1 43 GLN 43 55  55 GLN GLN A . n 
A 1 44 GLN 44 56  56 GLN GLN A . n 
A 1 45 LEU 45 57  57 LEU LEU A . n 
A 1 46 ASP 46 58  58 ASP ASP A . n 
A 1 47 THR 47 59  59 THR THR A . n 
A 1 48 VAL 48 60  60 VAL VAL A . n 
A 1 49 LEU 49 61  61 LEU LEU A . n 
A 1 50 GLN 50 62  62 GLN GLN A . n 
A 1 51 LEU 51 63  63 LEU LEU A . n 
A 1 52 ASN 52 64  64 ASN ASN A . n 
A 1 53 GLU 53 65  65 GLU GLU A . n 
A 1 54 ARG 54 66  66 ARG ARG A . n 
A 1 55 PRO 55 67  67 PRO PRO A . n 
A 1 56 VAL 56 68  68 VAL VAL A . n 
A 1 57 GLU 57 69  69 GLU GLU A . n 
A 1 58 HIS 58 70  70 HIS HIS A . n 
A 1 59 TRP 59 71  71 TRP TRP A . n 
A 1 60 LYS 60 72  72 LYS LYS A . n 
A 1 61 CYS 61 73  73 CYS CYS A . n 
A 1 62 VAL 62 74  74 VAL VAL A . n 
A 1 63 GLU 63 75  75 GLU GLU A . n 
A 1 64 LEU 64 76  76 LEU LEU A . n 
A 1 65 ALA 65 77  77 ALA ALA A . n 
A 1 66 HIS 66 78  78 HIS HIS A . n 
A 1 67 GLU 67 79  79 GLU GLU A . n 
A 1 68 ILE 68 80  80 ILE ILE A . n 
A 1 69 ARG 69 81  81 ARG ARG A . n 
A 1 70 SER 70 82  82 SER SER A . n 
A 1 71 CYS 71 83  83 CYS CYS A . n 
A 1 72 PRO 72 84  84 PRO PRO A . n 
A 1 73 SER 73 85  85 SER SER A . n 
A 1 74 GLU 74 86  86 GLU GLU A . n 
A 1 75 ILE 75 87  87 ILE ILE A . n 
A 1 76 ILE 76 88  88 ILE ILE A . n 
A 1 77 LEU 77 89  89 LEU LEU A . n 
A 1 78 LEU 78 90  90 LEU LEU A . n 
A 1 79 VAL 79 91  91 VAL VAL A . n 
A 1 80 TRP 80 92  92 TRP TRP A . n 
A 1 81 ARG 81 93  93 ARG ARG A . n 
A 1 82 MET 82 94  94 MET MET A . n 
A 1 83 VAL 83 95  95 VAL VAL A . n 
A 1 84 PRO 84 96  ?  ?   ?   A . n 
A 1 85 GLN 85 97  ?  ?   ?   A . n 
A 1 86 VAL 86 98  ?  ?   ?   A . n 
A 1 87 LYS 87 99  ?  ?   ?   A . n 
A 1 88 PRO 88 100 ?  ?   ?   A . n 
A 1 89 GLY 89 101 ?  ?   ?   A . n 
A 1 90 PRO 90 102 ?  ?   ?   A . n 
A 1 91 ASP 91 103 ?  ?   ?   A . n 
B 1 1  SER 1  13  ?  ?   ?   B . n 
B 1 2  MET 2  14  14 MET MET B . n 
B 1 3  ARG 3  15  15 ARG ARG B . n 
B 1 4  TYR 4  16  16 TYR TYR B . n 
B 1 5  ARG 5  17  17 ARG ARG B . n 
B 1 6  GLN 6  18  18 GLN GLN B . n 
B 1 7  ILE 7  19  19 ILE ILE B . n 
B 1 8  THR 8  20  20 THR THR B . n 
B 1 9  ILE 9  21  21 ILE ILE B . n 
B 1 10 PRO 10 22  22 PRO PRO B . n 
B 1 11 ARG 11 23  23 ARG ARG B . n 
B 1 12 GLY 12 24  24 GLY GLY B . n 
B 1 13 LYS 13 25  25 LYS LYS B . n 
B 1 14 ASP 14 26  26 ASP ASP B . n 
B 1 15 GLY 15 27  27 GLY GLY B . n 
B 1 16 PHE 16 28  28 PHE PHE B . n 
B 1 17 GLY 17 29  29 GLY GLY B . n 
B 1 18 PHE 18 30  30 PHE PHE B . n 
B 1 19 THR 19 31  31 THR THR B . n 
B 1 20 ILE 20 32  32 ILE ILE B . n 
B 1 21 CYS 21 33  33 CYS CYS B . n 
B 1 22 CYS 22 34  34 CYS CYS B . n 
B 1 23 ASP 23 35  35 ASP ASP B . n 
B 1 24 SER 24 36  36 SER SER B . n 
B 1 25 PRO 25 37  37 PRO PRO B . n 
B 1 26 VAL 26 38  38 VAL VAL B . n 
B 1 27 ARG 27 39  39 ARG ARG B . n 
B 1 28 VAL 28 40  40 VAL VAL B . n 
B 1 29 GLN 29 41  41 GLN GLN B . n 
B 1 30 ALA 30 42  42 ALA ALA B . n 
B 1 31 VAL 31 43  43 VAL VAL B . n 
B 1 32 ASP 32 44  44 ASP ASP B . n 
B 1 33 SER 33 45  45 SER SER B . n 
B 1 34 GLY 34 46  46 GLY GLY B . n 
B 1 35 GLY 35 47  47 GLY GLY B . n 
B 1 36 PRO 36 48  48 PRO PRO B . n 
B 1 37 ALA 37 49  49 ALA ALA B . n 
B 1 38 GLU 38 50  50 GLU GLU B . n 
B 1 39 ARG 39 51  51 ARG ARG B . n 
B 1 40 ALA 40 52  52 ALA ALA B . n 
B 1 41 GLY 41 53  53 GLY GLY B . n 
B 1 42 LEU 42 54  54 LEU LEU B . n 
B 1 43 GLN 43 55  55 GLN GLN B . n 
B 1 44 GLN 44 56  56 GLN GLN B . n 
B 1 45 LEU 45 57  57 LEU LEU B . n 
B 1 46 ASP 46 58  58 ASP ASP B . n 
B 1 47 THR 47 59  59 THR THR B . n 
B 1 48 VAL 48 60  60 VAL VAL B . n 
B 1 49 LEU 49 61  61 LEU LEU B . n 
B 1 50 GLN 50 62  62 GLN GLN B . n 
B 1 51 LEU 51 63  63 LEU LEU B . n 
B 1 52 ASN 52 64  64 ASN ASN B . n 
B 1 53 GLU 53 65  65 GLU GLU B . n 
B 1 54 ARG 54 66  66 ARG ARG B . n 
B 1 55 PRO 55 67  67 PRO PRO B . n 
B 1 56 VAL 56 68  68 VAL VAL B . n 
B 1 57 GLU 57 69  69 GLU GLU B . n 
B 1 58 HIS 58 70  70 HIS HIS B . n 
B 1 59 TRP 59 71  71 TRP TRP B . n 
B 1 60 LYS 60 72  72 LYS LYS B . n 
B 1 61 CYS 61 73  73 CYS CYS B . n 
B 1 62 VAL 62 74  74 VAL VAL B . n 
B 1 63 GLU 63 75  75 GLU GLU B . n 
B 1 64 LEU 64 76  76 LEU LEU B . n 
B 1 65 ALA 65 77  77 ALA ALA B . n 
B 1 66 HIS 66 78  78 HIS HIS B . n 
B 1 67 GLU 67 79  79 GLU GLU B . n 
B 1 68 ILE 68 80  80 ILE ILE B . n 
B 1 69 ARG 69 81  81 ARG ARG B . n 
B 1 70 SER 70 82  82 SER SER B . n 
B 1 71 CYS 71 83  83 CYS CYS B . n 
B 1 72 PRO 72 84  84 PRO PRO B . n 
B 1 73 SER 73 85  85 SER SER B . n 
B 1 74 GLU 74 86  86 GLU GLU B . n 
B 1 75 ILE 75 87  87 ILE ILE B . n 
B 1 76 ILE 76 88  88 ILE ILE B . n 
B 1 77 LEU 77 89  89 LEU LEU B . n 
B 1 78 LEU 78 90  90 LEU LEU B . n 
B 1 79 VAL 79 91  91 VAL VAL B . n 
B 1 80 TRP 80 92  92 TRP TRP B . n 
B 1 81 ARG 81 93  93 ARG ARG B . n 
B 1 82 MET 82 94  94 MET MET B . n 
B 1 83 VAL 83 95  95 VAL VAL B . n 
B 1 84 PRO 84 96  ?  ?   ?   B . n 
B 1 85 GLN 85 97  ?  ?   ?   B . n 
B 1 86 VAL 86 98  ?  ?   ?   B . n 
B 1 87 LYS 87 99  ?  ?   ?   B . n 
B 1 88 PRO 88 100 ?  ?   ?   B . n 
B 1 89 GLY 89 101 ?  ?   ?   B . n 
B 1 90 PRO 90 102 ?  ?   ?   B . n 
B 1 91 ASP 91 103 ?  ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1  1   1  SO4 SO4 A . 
D 2 SO4 1  2   2  SO4 SO4 A . 
E 3 HOH 1  104 4  HOH HOH A . 
E 3 HOH 2  105 8  HOH HOH A . 
E 3 HOH 3  106 9  HOH HOH A . 
E 3 HOH 4  107 11 HOH HOH A . 
E 3 HOH 5  108 13 HOH HOH A . 
E 3 HOH 6  109 16 HOH HOH A . 
E 3 HOH 7  110 17 HOH HOH A . 
E 3 HOH 8  111 19 HOH HOH A . 
E 3 HOH 9  112 21 HOH HOH A . 
E 3 HOH 10 113 22 HOH HOH A . 
E 3 HOH 11 114 24 HOH HOH A . 
E 3 HOH 12 115 26 HOH HOH A . 
E 3 HOH 13 116 28 HOH HOH A . 
E 3 HOH 14 117 31 HOH HOH A . 
E 3 HOH 15 118 32 HOH HOH A . 
E 3 HOH 16 119 33 HOH HOH A . 
E 3 HOH 17 120 36 HOH HOH A . 
E 3 HOH 18 121 37 HOH HOH A . 
E 3 HOH 19 122 39 HOH HOH A . 
E 3 HOH 20 123 40 HOH HOH A . 
E 3 HOH 21 124 47 HOH HOH A . 
F 3 HOH 1  104 5  HOH HOH B . 
F 3 HOH 2  105 6  HOH HOH B . 
F 3 HOH 3  106 7  HOH HOH B . 
F 3 HOH 4  107 10 HOH HOH B . 
F 3 HOH 5  108 12 HOH HOH B . 
F 3 HOH 6  109 14 HOH HOH B . 
F 3 HOH 7  110 15 HOH HOH B . 
F 3 HOH 8  111 18 HOH HOH B . 
F 3 HOH 9  112 20 HOH HOH B . 
F 3 HOH 10 113 23 HOH HOH B . 
F 3 HOH 11 114 25 HOH HOH B . 
F 3 HOH 12 115 27 HOH HOH B . 
F 3 HOH 13 116 29 HOH HOH B . 
F 3 HOH 14 117 30 HOH HOH B . 
F 3 HOH 15 118 34 HOH HOH B . 
F 3 HOH 16 119 35 HOH HOH B . 
F 3 HOH 17 120 38 HOH HOH B . 
F 3 HOH 18 121 41 HOH HOH B . 
F 3 HOH 19 122 42 HOH HOH B . 
F 3 HOH 20 123 44 HOH HOH B . 
F 3 HOH 21 124 48 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E 
2 1 B,F     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-12-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 11.5012 -4.6324  -21.7192 -0.2384 -0.1788 -0.1983 -0.0032 -0.0152 0.0170  3.3408 5.4178 6.5406 0.8394  1.0520 2.0034 
0.1600  -0.1435 -0.0045 0.1205  -0.2332 -0.0215 0.1048  0.0070  0.0732 'X-RAY DIFFRACTION' 
2 ? refined 11.1807 -16.5929 -43.8321 -0.1728 -0.1803 -0.1289 -0.0071 -0.0487 -0.0110 4.5605 6.6532 6.0421 -1.2058 0.3362 1.5861 
-0.0224 0.3398  -0.0193 -0.3723 -0.1232 0.6764  -0.0952 -0.2881 0.1456 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 14 A 2 A 95 A 83 ? 'X-RAY DIFFRACTION' ? 
2 2 B 14 B 2 B 95 B 83 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0019 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PHASER    phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 34 ? ? 72.56   159.42  
2 1 LEU A 57 ? ? 78.19   -9.31   
3 1 ASN A 64 ? ? 53.20   -124.76 
4 1 HIS A 70 ? ? -160.35 -14.28  
5 1 CYS B 34 ? ? 80.97   161.48  
6 1 LEU B 57 ? ? 75.27   -3.28   
7 1 SER B 85 ? ? -108.14 -61.50  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    69 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    70 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -105.46 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    VAL 
_pdbx_validate_chiral.auth_seq_id     95 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 65 ? CG  ? A GLU 53 CG  
2  1 Y 1 A GLU 65 ? CD  ? A GLU 53 CD  
3  1 Y 1 A GLU 65 ? OE1 ? A GLU 53 OE1 
4  1 Y 1 A GLU 65 ? OE2 ? A GLU 53 OE2 
5  1 Y 1 A LYS 72 ? NZ  ? A LYS 60 NZ  
6  1 Y 1 A MET 94 ? CE  ? A MET 82 CE  
7  1 Y 1 B ARG 17 ? NE  ? B ARG 5  NE  
8  1 Y 1 B ARG 17 ? CZ  ? B ARG 5  CZ  
9  1 Y 1 B ARG 17 ? NH1 ? B ARG 5  NH1 
10 1 Y 1 B ARG 17 ? NH2 ? B ARG 5  NH2 
11 1 Y 1 B LYS 25 ? CG  ? B LYS 13 CG  
12 1 Y 1 B LYS 25 ? CD  ? B LYS 13 CD  
13 1 Y 1 B LYS 25 ? CE  ? B LYS 13 CE  
14 1 Y 1 B LYS 25 ? NZ  ? B LYS 13 NZ  
15 1 Y 1 B ASP 26 ? CG  ? B ASP 14 CG  
16 1 Y 1 B ASP 26 ? OD1 ? B ASP 14 OD1 
17 1 Y 1 B ASP 26 ? OD2 ? B ASP 14 OD2 
18 1 Y 1 B GLN 56 ? OE1 ? B GLN 44 OE1 
19 1 Y 1 B GLN 56 ? NE2 ? B GLN 44 NE2 
20 1 Y 1 B GLU 65 ? CG  ? B GLU 53 CG  
21 1 Y 1 B GLU 65 ? CD  ? B GLU 53 CD  
22 1 Y 1 B GLU 65 ? OE1 ? B GLU 53 OE1 
23 1 Y 1 B GLU 65 ? OE2 ? B GLU 53 OE2 
24 1 Y 1 B GLU 86 ? OE1 ? B GLU 74 OE1 
25 1 Y 1 B GLU 86 ? OE2 ? B GLU 74 OE2 
26 1 Y 1 B TRP 92 ? CG  ? B TRP 80 CG  
27 1 Y 1 B TRP 92 ? CD1 ? B TRP 80 CD1 
28 1 Y 1 B TRP 92 ? CD2 ? B TRP 80 CD2 
29 1 Y 1 B TRP 92 ? NE1 ? B TRP 80 NE1 
30 1 Y 1 B TRP 92 ? CE2 ? B TRP 80 CE2 
31 1 Y 1 B TRP 92 ? CE3 ? B TRP 80 CE3 
32 1 Y 1 B TRP 92 ? CZ2 ? B TRP 80 CZ2 
33 1 Y 1 B TRP 92 ? CZ3 ? B TRP 80 CZ3 
34 1 Y 1 B TRP 92 ? CH2 ? B TRP 80 CH2 
35 1 Y 1 B MET 94 ? CE  ? B MET 82 CE  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 13  ? A SER 1  
2  1 Y 1 A PRO 96  ? A PRO 84 
3  1 Y 1 A GLN 97  ? A GLN 85 
4  1 Y 1 A VAL 98  ? A VAL 86 
5  1 Y 1 A LYS 99  ? A LYS 87 
6  1 Y 1 A PRO 100 ? A PRO 88 
7  1 Y 1 A GLY 101 ? A GLY 89 
8  1 Y 1 A PRO 102 ? A PRO 90 
9  1 Y 1 A ASP 103 ? A ASP 91 
10 1 Y 1 B SER 13  ? B SER 1  
11 1 Y 1 B PRO 96  ? B PRO 84 
12 1 Y 1 B GLN 97  ? B GLN 85 
13 1 Y 1 B VAL 98  ? B VAL 86 
14 1 Y 1 B LYS 99  ? B LYS 87 
15 1 Y 1 B PRO 100 ? B PRO 88 
16 1 Y 1 B GLY 101 ? B GLY 89 
17 1 Y 1 B PRO 102 ? B PRO 90 
18 1 Y 1 B ASP 103 ? B ASP 91 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#