data_2F8N
# 
_entry.id   2F8N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2F8N         
NDB   PD0764       
RCSB  RCSB035588   
WWPDB D_1000035588 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'Structure of nucleosome containing major core histones from Xenoupus laevis.'                  unspecified 
PDB 1U35 'Structure of homotypic nucleosome containing the histone domain of macroH2A and no major H2A.' unspecified 
PDB 1F66 'Structure of nucleosome containing the histone variant H2A.Z.'                                 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2F8N 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chakravarthy, S.' 1 
'Luger, K.'        2 
# 
_citation.id                        primary 
_citation.title                     'Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chakravarthy, S.' 1 
primary 'Luger, K.'        2 
# 
_cell.entry_id           2F8N 
_cell.length_a           106.145 
_cell.length_b           109.272 
_cell.length_c           176.273 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2F8N 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'alpha-satellite DNA (146 bp)' 45054.844 2   ? ? ?                ? 
2 polymer man 'Histone H3.1'                 15421.101 2   ? ? ?                ? 
3 polymer man 'Histone H4'                   11394.426 2   ? ? ?                ? 
4 polymer man 'Histone 3, H2ba'              14025.280 1   ? ? ?                ? 
5 polymer man 'Histone H2B.1'                13655.948 1   ? ? ?                ? 
6 polymer man 'Core histone macro-H2A.1'     12984.343 1   ? ? 'residues 0-119' ? 
7 polymer man 'Histone H2A type 1'           16198.775 1   ? ? ?                ? 
8 water   nat water                          18.015    120 ? ? ?                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASR
LAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASR
LAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D   ? 
5 'polypeptide(L)'        no no 
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
H   ? 
6 'polypeptide(L)'        no no 
;MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRH
ILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
;
;MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRH
ILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
;
G   ? 
7 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;MGSSHHHHHHSSGLVPRGSMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
K   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   MET n 
2 2   ALA n 
2 3   ARG n 
2 4   THR n 
2 5   LYS n 
2 6   GLN n 
2 7   THR n 
2 8   ALA n 
2 9   ARG n 
2 10  LYS n 
2 11  SER n 
2 12  THR n 
2 13  GLY n 
2 14  GLY n 
2 15  LYS n 
2 16  ALA n 
2 17  PRO n 
2 18  ARG n 
2 19  LYS n 
2 20  GLN n 
2 21  LEU n 
2 22  ALA n 
2 23  THR n 
2 24  LYS n 
2 25  ALA n 
2 26  ALA n 
2 27  ARG n 
2 28  LYS n 
2 29  SER n 
2 30  ALA n 
2 31  PRO n 
2 32  ALA n 
2 33  THR n 
2 34  GLY n 
2 35  GLY n 
2 36  VAL n 
2 37  LYS n 
2 38  LYS n 
2 39  PRO n 
2 40  HIS n 
2 41  ARG n 
2 42  TYR n 
2 43  ARG n 
2 44  PRO n 
2 45  GLY n 
2 46  THR n 
2 47  VAL n 
2 48  ALA n 
2 49  LEU n 
2 50  ARG n 
2 51  GLU n 
2 52  ILE n 
2 53  ARG n 
2 54  ARG n 
2 55  TYR n 
2 56  GLN n 
2 57  LYS n 
2 58  SER n 
2 59  THR n 
2 60  GLU n 
2 61  LEU n 
2 62  LEU n 
2 63  ILE n 
2 64  ARG n 
2 65  LYS n 
2 66  LEU n 
2 67  PRO n 
2 68  PHE n 
2 69  GLN n 
2 70  ARG n 
2 71  LEU n 
2 72  VAL n 
2 73  ARG n 
2 74  GLU n 
2 75  ILE n 
2 76  ALA n 
2 77  GLN n 
2 78  ASP n 
2 79  PHE n 
2 80  LYS n 
2 81  THR n 
2 82  ASP n 
2 83  LEU n 
2 84  ARG n 
2 85  PHE n 
2 86  GLN n 
2 87  SER n 
2 88  SER n 
2 89  ALA n 
2 90  VAL n 
2 91  MET n 
2 92  ALA n 
2 93  LEU n 
2 94  GLN n 
2 95  GLU n 
2 96  ALA n 
2 97  SER n 
2 98  GLU n 
2 99  ALA n 
2 100 TYR n 
2 101 LEU n 
2 102 VAL n 
2 103 GLY n 
2 104 LEU n 
2 105 PHE n 
2 106 GLU n 
2 107 ASP n 
2 108 THR n 
2 109 ASN n 
2 110 LEU n 
2 111 CYS n 
2 112 ALA n 
2 113 ILE n 
2 114 HIS n 
2 115 ALA n 
2 116 LYS n 
2 117 ARG n 
2 118 VAL n 
2 119 THR n 
2 120 ILE n 
2 121 MET n 
2 122 PRO n 
2 123 LYS n 
2 124 ASP n 
2 125 ILE n 
2 126 GLN n 
2 127 LEU n 
2 128 ALA n 
2 129 ARG n 
2 130 ARG n 
2 131 ILE n 
2 132 ARG n 
2 133 GLY n 
2 134 GLU n 
2 135 ARG n 
2 136 ALA n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  GLY n 
3 11  LEU n 
3 12  GLY n 
3 13  LYS n 
3 14  GLY n 
3 15  GLY n 
3 16  ALA n 
3 17  LYS n 
3 18  ARG n 
3 19  HIS n 
3 20  ARG n 
3 21  LYS n 
3 22  VAL n 
3 23  LEU n 
3 24  ARG n 
3 25  ASP n 
3 26  ASN n 
3 27  ILE n 
3 28  GLN n 
3 29  GLY n 
3 30  ILE n 
3 31  THR n 
3 32  LYS n 
3 33  PRO n 
3 34  ALA n 
3 35  ILE n 
3 36  ARG n 
3 37  ARG n 
3 38  LEU n 
3 39  ALA n 
3 40  ARG n 
3 41  ARG n 
3 42  GLY n 
3 43  GLY n 
3 44  VAL n 
3 45  LYS n 
3 46  ARG n 
3 47  ILE n 
3 48  SER n 
3 49  GLY n 
3 50  LEU n 
3 51  ILE n 
3 52  TYR n 
3 53  GLU n 
3 54  GLU n 
3 55  THR n 
3 56  ARG n 
3 57  GLY n 
3 58  VAL n 
3 59  LEU n 
3 60  LYS n 
3 61  VAL n 
3 62  PHE n 
3 63  LEU n 
3 64  GLU n 
3 65  ASN n 
3 66  VAL n 
3 67  ILE n 
3 68  ARG n 
3 69  ASP n 
3 70  ALA n 
3 71  VAL n 
3 72  THR n 
3 73  TYR n 
3 74  THR n 
3 75  GLU n 
3 76  HIS n 
3 77  ALA n 
3 78  LYS n 
3 79  ARG n 
3 80  LYS n 
3 81  THR n 
3 82  VAL n 
3 83  THR n 
3 84  ALA n 
3 85  MET n 
3 86  ASP n 
3 87  VAL n 
3 88  VAL n 
3 89  TYR n 
3 90  ALA n 
3 91  LEU n 
3 92  LYS n 
3 93  ARG n 
3 94  GLN n 
3 95  GLY n 
3 96  ARG n 
3 97  THR n 
3 98  LEU n 
3 99  TYR n 
3 100 GLY n 
3 101 PHE n 
3 102 GLY n 
3 103 GLY n 
4 1   MET n 
4 2   PRO n 
4 3   GLU n 
4 4   PRO n 
4 5   SER n 
4 6   ARG n 
4 7   SER n 
4 8   THR n 
4 9   PRO n 
4 10  ALA n 
4 11  PRO n 
4 12  LYS n 
4 13  LYS n 
4 14  GLY n 
4 15  SER n 
4 16  LYS n 
4 17  LYS n 
4 18  ALA n 
4 19  ILE n 
4 20  THR n 
4 21  LYS n 
4 22  ALA n 
4 23  GLN n 
4 24  LYS n 
4 25  LYS n 
4 26  ASP n 
4 27  GLY n 
4 28  LYS n 
4 29  LYS n 
4 30  ARG n 
4 31  LYS n 
4 32  ARG n 
4 33  GLY n 
4 34  ARG n 
4 35  LYS n 
4 36  GLU n 
4 37  SER n 
4 38  TYR n 
4 39  SER n 
4 40  ILE n 
4 41  TYR n 
4 42  VAL n 
4 43  TYR n 
4 44  LYS n 
4 45  VAL n 
4 46  LEU n 
4 47  LYS n 
4 48  GLN n 
4 49  VAL n 
4 50  HIS n 
4 51  PRO n 
4 52  ASP n 
4 53  THR n 
4 54  GLY n 
4 55  ILE n 
4 56  SER n 
4 57  SER n 
4 58  LYS n 
4 59  ALA n 
4 60  MET n 
4 61  GLY n 
4 62  ILE n 
4 63  MET n 
4 64  ASN n 
4 65  SER n 
4 66  PHE n 
4 67  VAL n 
4 68  ASN n 
4 69  ASP n 
4 70  ILE n 
4 71  PHE n 
4 72  GLU n 
4 73  ARG n 
4 74  ILE n 
4 75  ALA n 
4 76  SER n 
4 77  GLU n 
4 78  ALA n 
4 79  SER n 
4 80  ARG n 
4 81  LEU n 
4 82  ALA n 
4 83  HIS n 
4 84  TYR n 
4 85  ASN n 
4 86  LYS n 
4 87  ARG n 
4 88  SER n 
4 89  THR n 
4 90  ILE n 
4 91  THR n 
4 92  SER n 
4 93  ARG n 
4 94  GLU n 
4 95  VAL n 
4 96  GLN n 
4 97  THR n 
4 98  ALA n 
4 99  VAL n 
4 100 ARG n 
4 101 LEU n 
4 102 LEU n 
4 103 LEU n 
4 104 PRO n 
4 105 GLY n 
4 106 GLU n 
4 107 LEU n 
4 108 ALA n 
4 109 LYS n 
4 110 HIS n 
4 111 ALA n 
4 112 VAL n 
4 113 SER n 
4 114 GLU n 
4 115 GLY n 
4 116 THR n 
4 117 LYS n 
4 118 ALA n 
4 119 VAL n 
4 120 THR n 
4 121 LYS n 
4 122 TYR n 
4 123 THR n 
4 124 SER n 
4 125 SER n 
4 126 LYS n 
5 1   MET n 
5 2   ALA n 
5 3   LYS n 
5 4   SER n 
5 5   ALA n 
5 6   PRO n 
5 7   ALA n 
5 8   PRO n 
5 9   LYS n 
5 10  LYS n 
5 11  GLY n 
5 12  SER n 
5 13  LYS n 
5 14  LYS n 
5 15  ALA n 
5 16  VAL n 
5 17  THR n 
5 18  LYS n 
5 19  THR n 
5 20  GLN n 
5 21  LYS n 
5 22  LYS n 
5 23  ASP n 
5 24  GLY n 
5 25  LYS n 
5 26  LYS n 
5 27  ARG n 
5 28  ARG n 
5 29  LYS n 
5 30  THR n 
5 31  ARG n 
5 32  LYS n 
5 33  GLU n 
5 34  SER n 
5 35  TYR n 
5 36  ALA n 
5 37  ILE n 
5 38  TYR n 
5 39  VAL n 
5 40  TYR n 
5 41  LYS n 
5 42  VAL n 
5 43  LEU n 
5 44  LYS n 
5 45  GLN n 
5 46  VAL n 
5 47  HIS n 
5 48  PRO n 
5 49  ASP n 
5 50  THR n 
5 51  GLY n 
5 52  ILE n 
5 53  SER n 
5 54  SER n 
5 55  LYS n 
5 56  ALA n 
5 57  MET n 
5 58  SER n 
5 59  ILE n 
5 60  MET n 
5 61  ASN n 
5 62  SER n 
5 63  PHE n 
5 64  VAL n 
5 65  ASN n 
5 66  ASP n 
5 67  VAL n 
5 68  PHE n 
5 69  GLU n 
5 70  ARG n 
5 71  ILE n 
5 72  ALA n 
5 73  GLY n 
5 74  GLU n 
5 75  ALA n 
5 76  SER n 
5 77  ARG n 
5 78  LEU n 
5 79  ALA n 
5 80  HIS n 
5 81  TYR n 
5 82  ASN n 
5 83  LYS n 
5 84  ARG n 
5 85  SER n 
5 86  THR n 
5 87  ILE n 
5 88  THR n 
5 89  SER n 
5 90  ARG n 
5 91  GLU n 
5 92  ILE n 
5 93  GLN n 
5 94  THR n 
5 95  ALA n 
5 96  VAL n 
5 97  ARG n 
5 98  LEU n 
5 99  LEU n 
5 100 LEU n 
5 101 PRO n 
5 102 GLY n 
5 103 GLU n 
5 104 LEU n 
5 105 ALA n 
5 106 LYS n 
5 107 HIS n 
5 108 ALA n 
5 109 VAL n 
5 110 SER n 
5 111 GLU n 
5 112 GLY n 
5 113 THR n 
5 114 LYS n 
5 115 ALA n 
5 116 VAL n 
5 117 THR n 
5 118 LYS n 
5 119 TYR n 
5 120 THR n 
5 121 SER n 
5 122 ALA n 
5 123 LYS n 
6 1   MET n 
6 2   SER n 
6 3   SER n 
6 4   ARG n 
6 5   GLY n 
6 6   GLY n 
6 7   LYS n 
6 8   LYS n 
6 9   LYS n 
6 10  SER n 
6 11  THR n 
6 12  LYS n 
6 13  THR n 
6 14  SER n 
6 15  ARG n 
6 16  SER n 
6 17  ALA n 
6 18  LYS n 
6 19  ALA n 
6 20  GLY n 
6 21  VAL n 
6 22  ILE n 
6 23  PHE n 
6 24  PRO n 
6 25  VAL n 
6 26  GLY n 
6 27  ARG n 
6 28  MET n 
6 29  LEU n 
6 30  ARG n 
6 31  TYR n 
6 32  ILE n 
6 33  LYS n 
6 34  LYS n 
6 35  GLY n 
6 36  HIS n 
6 37  PRO n 
6 38  LYS n 
6 39  TYR n 
6 40  ARG n 
6 41  ILE n 
6 42  GLY n 
6 43  VAL n 
6 44  GLY n 
6 45  ALA n 
6 46  PRO n 
6 47  VAL n 
6 48  TYR n 
6 49  MET n 
6 50  ALA n 
6 51  ALA n 
6 52  VAL n 
6 53  LEU n 
6 54  GLU n 
6 55  TYR n 
6 56  LEU n 
6 57  THR n 
6 58  ALA n 
6 59  GLU n 
6 60  ILE n 
6 61  LEU n 
6 62  GLU n 
6 63  LEU n 
6 64  ALA n 
6 65  VAL n 
6 66  ASN n 
6 67  ALA n 
6 68  ALA n 
6 69  ARG n 
6 70  ASP n 
6 71  ASN n 
6 72  LYS n 
6 73  LYS n 
6 74  GLY n 
6 75  ARG n 
6 76  VAL n 
6 77  THR n 
6 78  PRO n 
6 79  ARG n 
6 80  HIS n 
6 81  ILE n 
6 82  LEU n 
6 83  LEU n 
6 84  ALA n 
6 85  VAL n 
6 86  ALA n 
6 87  ASN n 
6 88  ASP n 
6 89  GLU n 
6 90  GLU n 
6 91  LEU n 
6 92  ASN n 
6 93  GLN n 
6 94  LEU n 
6 95  LEU n 
6 96  LYS n 
6 97  GLY n 
6 98  VAL n 
6 99  THR n 
6 100 ILE n 
6 101 ALA n 
6 102 SER n 
6 103 GLY n 
6 104 GLY n 
6 105 VAL n 
6 106 LEU n 
6 107 PRO n 
6 108 ASN n 
6 109 ILE n 
6 110 HIS n 
6 111 PRO n 
6 112 GLU n 
6 113 LEU n 
6 114 LEU n 
6 115 ALA n 
6 116 LYS n 
6 117 LYS n 
6 118 ARG n 
6 119 GLY n 
6 120 SER n 
7 1   MET n 
7 2   GLY n 
7 3   SER n 
7 4   SER n 
7 5   HIS n 
7 6   HIS n 
7 7   HIS n 
7 8   HIS n 
7 9   HIS n 
7 10  HIS n 
7 11  SER n 
7 12  SER n 
7 13  GLY n 
7 14  LEU n 
7 15  VAL n 
7 16  PRO n 
7 17  ARG n 
7 18  GLY n 
7 19  SER n 
7 20  MET n 
7 21  SER n 
7 22  GLY n 
7 23  ARG n 
7 24  GLY n 
7 25  LYS n 
7 26  GLN n 
7 27  GLY n 
7 28  GLY n 
7 29  LYS n 
7 30  ALA n 
7 31  ARG n 
7 32  ALA n 
7 33  LYS n 
7 34  ALA n 
7 35  LYS n 
7 36  THR n 
7 37  ARG n 
7 38  SER n 
7 39  SER n 
7 40  ARG n 
7 41  ALA n 
7 42  GLY n 
7 43  LEU n 
7 44  GLN n 
7 45  PHE n 
7 46  PRO n 
7 47  VAL n 
7 48  GLY n 
7 49  ARG n 
7 50  VAL n 
7 51  HIS n 
7 52  ARG n 
7 53  LEU n 
7 54  LEU n 
7 55  ARG n 
7 56  LYS n 
7 57  GLY n 
7 58  ASN n 
7 59  TYR n 
7 60  SER n 
7 61  GLU n 
7 62  ARG n 
7 63  VAL n 
7 64  GLY n 
7 65  ALA n 
7 66  GLY n 
7 67  ALA n 
7 68  PRO n 
7 69  VAL n 
7 70  TYR n 
7 71  LEU n 
7 72  ALA n 
7 73  ALA n 
7 74  VAL n 
7 75  LEU n 
7 76  GLU n 
7 77  TYR n 
7 78  LEU n 
7 79  THR n 
7 80  ALA n 
7 81  GLU n 
7 82  ILE n 
7 83  LEU n 
7 84  GLU n 
7 85  LEU n 
7 86  ALA n 
7 87  GLY n 
7 88  ASN n 
7 89  ALA n 
7 90  ALA n 
7 91  ARG n 
7 92  ASP n 
7 93  ASN n 
7 94  LYS n 
7 95  LYS n 
7 96  THR n 
7 97  ARG n 
7 98  ILE n 
7 99  ILE n 
7 100 PRO n 
7 101 ARG n 
7 102 HIS n 
7 103 LEU n 
7 104 GLN n 
7 105 LEU n 
7 106 ALA n 
7 107 ILE n 
7 108 ARG n 
7 109 ASN n 
7 110 ASP n 
7 111 GLU n 
7 112 GLU n 
7 113 LEU n 
7 114 ASN n 
7 115 LYS n 
7 116 LEU n 
7 117 LEU n 
7 118 GLY n 
7 119 ARG n 
7 120 VAL n 
7 121 THR n 
7 122 ILE n 
7 123 ALA n 
7 124 GLN n 
7 125 GLY n 
7 126 GLY n 
7 127 VAL n 
7 128 LEU n 
7 129 PRO n 
7 130 ASN n 
7 131 ILE n 
7 132 GLN n 
7 133 ALA n 
7 134 VAL n 
7 135 LEU n 
7 136 LEU n 
7 137 PRO n 
7 138 LYS n 
7 139 LYS n 
7 140 THR n 
7 141 GLU n 
7 142 SER n 
7 143 HIS n 
7 144 HIS n 
7 145 LYS n 
7 146 ALA n 
7 147 LYS n 
7 148 GLY n 
7 149 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ?              ? ? ? ? ? ? ? plasmid ? ? ? puc19  ? ? 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? BL21-DE3-pLysS ? ? ? ? ? ? ? plasmid ? ? ? pet3a  ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? BL21-DE3-pLysS ? ? ? ? ? ? ? plasmid ? ? ? pet3a  ? ? 
4 1 sample ? ? ? 'house mouse'         Mus     ? ? ? ? ? ? ? 'Mus musculus'   10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? BL21-DE3-pLysS ? ? ? ? ? ? ? plasmid ? ? ? pet3a  ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? BL21-DE3-pLysS ? ? ? ? ? ? ? plasmid ? ? ? pet3a  ? ? 
6 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? BL21-DE3-pLysS ? ? ? ? ? ? ? plasmid ? ? ? pet3a  ? ? 
7 1 sample ? ? ? 'house mouse'         Mus     ? ? ? ? ? ? ? 'Mus musculus'   10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? BL21-DE3-pLysS ? ? ? ? ? ? ? plasmid ? ? ? pet15b ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP H31_XENLA   P84233 2 1 ? ? 
2 UNP H4_XENLA    P62799 3 1 ? ? 
3 UNP H2B3A_MOUSE Q9D2U9 4 1 ? ? 
4 UNP H2B1_XENLA  P02281 5 4 ? ? 
5 UNP H2AY_HUMAN  O75367 6 1 ? ? 
6 UNP H2A1H_MOUSE Q8CGP6 7 1 ? ? 
7 PDB 2F8N        2F8N   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2F8N A 1  ? 136 ? P84233 1   ? 135 ? 400  535  
2  2 2F8N B 1  ? 103 ? P62799 1   ? 102 ? 0    102  
3  3 2F8N D 1  ? 126 ? Q9D2U9 1   ? 125 ? 1197 1322 
4  1 2F8N E 1  ? 136 ? P84233 1   ? 135 ? 600  735  
5  2 2F8N F 1  ? 103 ? P62799 1   ? 102 ? 200  302  
6  4 2F8N H 2  ? 123 ? P02281 4   ? 125 ? 1401 1522 
7  5 2F8N G 1  ? 120 ? O75367 1   ? 119 ? 1003 1122 
8  6 2F8N K 20 ? 149 ? Q8CGP6 1   ? 127 ? 0    129  
9  7 2F8N I 1  ? 146 ? 2F8N   1   ? 145 ? 1    145  
10 7 2F8N J 1  ? 146 ? 2F8N   146 ? 290 ? 146  290  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 2F8N MET H 1  ? UNP P02281 ?   ?  'INITIATING METHIONINE' 1400 1  
6 2F8N THR H 30 ? UNP P02281 SER 32 CONFLICT                1429 2  
7 2F8N VAL G 65 ? UNP O75367 GLY 64 CONFLICT                1067 3  
8 2F8N MET K 1  ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -19  4  
8 2F8N GLY K 2  ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -18  5  
8 2F8N SER K 3  ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -17  6  
8 2F8N SER K 4  ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -16  7  
8 2F8N HIS K 5  ? UNP Q8CGP6 ?   ?  'EXPRESSION TAG'        -15  8  
8 2F8N HIS K 6  ? UNP Q8CGP6 ?   ?  'EXPRESSION TAG'        -14  9  
8 2F8N HIS K 7  ? UNP Q8CGP6 ?   ?  'EXPRESSION TAG'        -13  10 
8 2F8N HIS K 8  ? UNP Q8CGP6 ?   ?  'EXPRESSION TAG'        -12  11 
8 2F8N HIS K 9  ? UNP Q8CGP6 ?   ?  'EXPRESSION TAG'        -11  12 
8 2F8N HIS K 10 ? UNP Q8CGP6 ?   ?  'EXPRESSION TAG'        -10  13 
8 2F8N SER K 11 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -9   14 
8 2F8N SER K 12 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -8   15 
8 2F8N GLY K 13 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -7   16 
8 2F8N LEU K 14 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -6   17 
8 2F8N VAL K 15 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -5   18 
8 2F8N PRO K 16 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -4   19 
8 2F8N ARG K 17 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -3   20 
8 2F8N GLY K 18 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -2   21 
8 2F8N SER K 19 ? UNP Q8CGP6 ?   ?  'CLONING ARTIFACT'      -1   22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2F8N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   50.92 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
;34 to 37.5mM KCl and 40-45mM MnCl2, 5mM Potassium Cacodylate, Sample concentration: 8-12 mg/ml, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 KCl                    ? ? ? 
1 2 1 MnCl2                  ? ? ? 
1 3 1 'Potassium Cacodylate' ? ? ? 
1 4 1 H2O                    ? ? ? 
1 5 2 KCl                    ? ? ? 
1 6 2 MnCl2                  ? ? ? 
1 7 2 'Potassium Cacodylate' ? ? ? 
1 8 2 H2O                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2004-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2F8N 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             31.4 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   44768 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.408 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2F8N 
_refine.ls_number_reflns_obs                     43333 
_refine.ls_number_reflns_all                     46170 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.4 
_refine.ls_d_res_high                            2.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.217 
_refine.ls_R_factor_R_free                       0.269 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2184 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;A 73 chain I and T 74 chain I are linked together. A 217 chain J and T 218 chain J are linked together. However there are T 73A chain I and A 217A chain J present in the structure. The electron density for this base pair is lost as a result of a convolution between two stretch conformations on the two halves of the nucleosome on either side of the diad axis.
;
_refine.pdbx_starting_model                      'pdb entry 1U35' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6007 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             120 
_refine_hist.number_atoms_total               12066 
_refine_hist.d_res_high                       2.9 
_refine_hist.d_res_low                        31.4 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006598 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.05529  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2F8N 
_struct.title                     '2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes' 
_struct.pdbx_descriptor           'HISTONE/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2F8N 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'Nucleosome, NCP, macroH2A, Histone variant, chromatin, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 8 ? 
T N N 8 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is an octamer of histones wrapped by 146 basepairs of DNA called the nucleosome core particle, which is also the asymmetric unit. (all of which, the coordinates are given for in the submitted pdb file).
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 45  ? GLN C 56  ? GLY A 444  GLN A 455  1 ? 12 
HELX_P HELX_P2  2  ARG C 64  ? ASP C 78  ? ARG A 463  ASP A 477  1 ? 15 
HELX_P HELX_P3  3  GLN C 86  ? ALA C 115 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 121 ? GLY C 133 ? MET A 520  GLY A 532  1 ? 13 
HELX_P HELX_P5  5  THR D 31  ? GLY D 42  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P6  6  LEU D 50  ? ALA D 77  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P7  7  THR D 83  ? GLN D 94  ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P8  8  TYR E 38  ? HIS E 50  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P9  9  SER E 56  ? ASN E 85  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P10 10 THR E 91  ? LEU E 103 ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P11 11 PRO E 104 ? THR E 123 ? PRO D 1300 THR D 1319 1 ? 20 
HELX_P HELX_P12 12 GLY F 45  ? SER F 58  ? GLY E 644  SER E 657  1 ? 14 
HELX_P HELX_P13 13 ARG F 64  ? ASP F 78  ? ARG E 663  ASP E 677  1 ? 15 
HELX_P HELX_P14 14 GLN F 86  ? ALA F 115 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P15 15 MET F 121 ? ARG F 132 ? MET E 720  ARG E 731  1 ? 12 
HELX_P HELX_P16 16 ASN G 26  ? ILE G 30  ? ASN F 225  ILE F 229  5 ? 5  
HELX_P HELX_P17 17 THR G 31  ? GLY G 42  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P18 18 LEU G 50  ? ALA G 77  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P19 19 THR G 83  ? GLN G 94  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P20 20 TYR H 35  ? GLN H 45  ? TYR H 1434 GLN H 1444 1 ? 11 
HELX_P HELX_P21 21 SER H 53  ? ASN H 82  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P22 22 THR H 88  ? LEU H 100 ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P23 23 PRO H 101 ? SER H 121 ? PRO H 1500 SER H 1520 1 ? 21 
HELX_P HELX_P24 24 SER I 14  ? GLY I 20  ? SER G 1016 GLY G 1022 1 ? 7  
HELX_P HELX_P25 25 PRO I 24  ? HIS I 36  ? PRO G 1026 HIS G 1038 1 ? 13 
HELX_P HELX_P26 26 VAL I 43  ? ASN I 71  ? VAL G 1045 ASN G 1073 1 ? 29 
HELX_P HELX_P27 27 THR I 77  ? ASN I 87  ? THR G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P28 28 ASP I 88  ? LEU I 95  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P29 29 HIS I 110 ? LEU I 114 ? HIS G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P30 30 THR J 36  ? GLY J 42  ? THR K 16   GLY K 22   1 ? 7  
HELX_P HELX_P31 31 PRO J 46  ? GLY J 57  ? PRO K 26   GLY K 37   1 ? 12 
HELX_P HELX_P32 32 GLY J 66  ? ASN J 93  ? GLY K 46   ASN K 73   1 ? 28 
HELX_P HELX_P33 33 ILE J 99  ? ASP J 110 ? ILE K 79   ASP K 90   1 ? 12 
HELX_P HELX_P34 34 ASP J 110 ? LEU J 117 ? ASP K 90   LEU K 97   1 ? 8  
HELX_P HELX_P35 35 GLN J 132 ? LEU J 136 ? GLN K 112  LEU K 116  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA 145 N1 ? ? I DT 2   J DA 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B DA 145 N6 ? ? I DT 2   J DA 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG 144 N1 ? ? I DC 3   J DG 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG 144 N2 ? ? I DC 3   J DG 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 142 O4 ? ? I DA 4   J DT 286 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog9   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 287 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog10  hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 286 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog11  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 285 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog12  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT 140 O4 ? ? I DA 7   J DT 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 282 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog15  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 137 N1 ? ? I DC 10  J DG 281 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog16  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 10  J DG 282 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog17  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 280 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog18  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 12  J DG 279 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog19  hydrog ? ? A DC 13  N3 ? ? ? 1_555 B DG 134 N1 ? ? I DC 13  J DG 278 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DC 13  N4 ? ? ? 1_555 B DG 134 O6 ? ? I DC 13  J DG 278 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 278 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 277 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog23  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DG 131 O6 ? ? I DG 15  J DG 275 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog24  hydrog ? ? A DG 15  N2 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 276 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog25  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DG 131 N1 ? ? I DC 16  J DG 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B DG 131 N2 ? ? I DC 16  J DG 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? A DT 20  N3 ? ? ? 1_555 B DA 127 N1 ? ? I DT 20  J DA 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31  hydrog ? ? A DT 20  O4 ? ? ? 1_555 B DA 127 N6 ? ? I DT 20  J DA 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? A DT 21  N3 ? ? ? 1_555 B DA 126 N1 ? ? I DT 21  J DA 270 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? A DT 21  O4 ? ? ? 1_555 B DA 126 N6 ? ? I DT 21  J DA 270 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? A DT 21  N3 ? ? ? 1_555 B DA 127 N1 ? ? I DT 21  J DA 271 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog35  hydrog ? ? A DC 22  N3 ? ? ? 1_555 B DG 125 N1 ? ? I DC 22  J DG 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B DG 125 O6 ? ? I DC 22  J DG 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B DG 125 N2 ? ? I DC 22  J DG 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DA 24  N6 ? ? ? 1_555 B DT 123 O4 ? ? I DA 24  J DT 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 26  J DG 266 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog41  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DT 120 N3 ? ? I DA 27  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT 120 O4 ? ? I DA 27  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? A DA 28  N1 ? ? ? 1_555 B DT 119 N3 ? ? I DA 28  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? A DA 28  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 28  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 262 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog46  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DC 116 O2 ? ? I DG 31  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B DC 116 N4 ? ? I DG 31  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DT 117 O2 ? ? I DG 31  J DT 261 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
hydrog52  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B DA 115 N1 ? ? I DT 32  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B DA 115 N6 ? ? I DT 32  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 33  J DC 258 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog55  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B DA 113 N1 ? ? I DT 34  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 255 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog60  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B DC 108 N3 ? ? I DG 39  J DC 252 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog63  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 250 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog64  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 249 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog65  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B DT 104 N3 ? ? I DA 43  J DT 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B DT 104 O4 ? ? I DA 43  J DT 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 103 N2 ? ? I DC 44  J DG 247 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog68  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B DA 102 N6 ? ? I DT 45  J DA 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DG 100 O6 ? ? I DG 46  J DG 244 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog71  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 O2 ? ? I DG 46  J DC 245 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog72  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT 48  J DA 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 242 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog75  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT 96  O4 ? ? I DA 51  J DT 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DG 94  N1 ? ? I DA 54  J DG 238 1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? 
hydrog80  hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? A DA 55  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA 55  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 56  J DT 234 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog83  hydrog ? ? A DA 56  N1 ? ? ? 1_555 B DT 91  N3 ? ? I DA 56  J DT 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT 91  O4 ? ? I DA 56  J DT 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 234 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog86  hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 88  N3 ? ? I DG 59  J DC 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 88  O2 ? ? I DG 59  J DC 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 88  N4 ? ? I DG 59  J DC 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 89  O2 ? ? I DG 59  J DC 233 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog90  hydrog ? ? A DC 60  N3 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 231 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog91  hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DA 61  N6 ? ? ? 1_555 B DT 86  O4 ? ? I DA 61  J DT 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DT 62  O4 ? ? ? 1_555 B DA 85  N6 ? ? I DT 62  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 68  J DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 68  J DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 222 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog111 hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 77  N3 ? ? I DG 70  J DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DG 70  N2 ? ? ? 1_555 B DC 77  O2 ? ? I DG 70  J DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DG 70  O6 ? ? ? 1_555 B DC 77  N4 ? ? I DG 70  J DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B DT 75  O4 ? ? I DA 72  J DT 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 71  N1 ? ? I DC 75  J DG 216 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog124 hydrog ? ? A DC 77  N3 ? ? ? 1_555 B DG 70  N1 ? ? I DC 76  J DG 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 70  O6 ? ? I DC 76  J DG 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DC 77  O2 ? ? ? 1_555 B DG 70  N2 ? ? I DC 76  J DG 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 77  J DC 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 77  J DC 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 77  J DC 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 78  J DG 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 78  J DG 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 78  J DG 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 79  J DA 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 79  J DA 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 80  J DC 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 80  J DC 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 80  J DC 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 81  J DT 209 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog139 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 81  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 81  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 82  J DT 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 82  J DT 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 83  J DG 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 83  J DG 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 83  J DG 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 84  J DT 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B DT 62  O4 ? ? I DA 84  J DT 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 85  J DA 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 85  J DA 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 86  J DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 86  J DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 86  J DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 87  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 87  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 87  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 88  J DG 203 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog157 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 89  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 89  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA 56  N1 ? ? I DT 90  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B DA 56  N6 ? ? I DT 90  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 91  J DA 200 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog162 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 92  J DA 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 92  J DA 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 93  J DC 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 93  J DC 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 93  J DC 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 94  J DT 197 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog168 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 95  J DA 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 95  J DA 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  O2 ? ? I DG 96  J DC 195 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog171 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 97  J DC 194 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog172 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 98  J DT 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 98  J DT 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 99  J DC 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 99  J DC 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 99  J DC 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B DG 46  N1 ? ? I DC 100 J DG 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B DG 46  O6 ? ? I DC 100 J DG 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 100 J DG 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 44  N3 ? ? I DG 102 J DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DG 103 N2 ? ? ? 1_555 B DC 44  O2 ? ? I DG 102 J DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DG 103 O6 ? ? ? 1_555 B DC 44  N4 ? ? I DG 102 J DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 104 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B DA 42  N6 ? ? I DT 104 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 105 J DA 186 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog186 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 107 J DG 184 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog187 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 108 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 108 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 109 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 109 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 110 J DT 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 110 J DT 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B DA 35  N1 ? ? I DT 111 J DA 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 111 J DA 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 112 J DT 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 112 J DT 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DC 114 N3 ? ? ? 1_555 B DG 33  N1 ? ? I DC 113 J DG 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 113 J DG 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DC 114 O2 ? ? ? 1_555 B DG 33  N2 ? ? I DC 113 J DG 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 114 J DT 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 114 J DT 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B DG 31  N1 ? ? I DC 115 J DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 115 J DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B DG 31  N2 ? ? I DC 115 J DG 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 116 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? A DT 117 O4 ? ? ? 1_555 B DA 30  N6 ? ? I DT 116 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 117 J DA 174 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog208 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 118 J DA 172 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog209 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 118 J DA 173 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog210 hydrog ? ? A DT 120 N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 119 J DA 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 119 J DA 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DG 121 O6 ? ? ? 1_555 B DC 25  N4 ? ? I DG 120 J DC 170 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog213 hydrog ? ? A DG 121 N1 ? ? ? 1_555 B DC 26  N3 ? ? I DG 120 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 120 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? A DG 121 O6 ? ? ? 1_555 B DC 26  N4 ? ? I DG 120 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DT 123 N3 ? ? ? 1_555 B DA 24  N1 ? ? I DT 122 J DA 169 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog217 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 123 J DT 168 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DA 124 N6 ? ? ? 1_555 B DT 23  O4 ? ? I DA 123 J DT 168 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DG 125 N1 ? ? ? 1_555 B DC 22  N3 ? ? I DG 124 J DC 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? A DG 125 N2 ? ? ? 1_555 B DC 22  O2 ? ? I DG 124 J DC 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DG 125 O6 ? ? ? 1_555 B DC 22  N4 ? ? I DG 124 J DC 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DA 126 N1 ? ? ? 1_555 B DT 21  N3 ? ? I DA 125 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B DT 21  O4 ? ? I DA 125 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog224 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 126 J DT 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 126 J DT 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DT 128 N3 ? ? ? 1_555 B DA 19  N1 ? ? I DT 127 J DA 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? A DT 128 O4 ? ? ? 1_555 B DA 19  N6 ? ? I DT 127 J DA 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? A DC 129 N3 ? ? ? 1_555 B DG 18  N1 ? ? I DC 128 J DG 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DC 129 N4 ? ? ? 1_555 B DG 18  O6 ? ? I DC 128 J DG 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 128 J DG 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 129 J DA 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 129 J DA 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DG 15  N1 ? ? I DG 130 J DG 160 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog234 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 130 J DC 161 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog235 hydrog ? ? A DG 134 N2 ? ? ? 1_555 B DC 13  O2 ? ? I DG 133 J DC 158 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog236 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 134 J DC 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 134 J DC 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 134 J DC 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 135 J DA 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 135 J DA 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 136 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 136 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 136 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B DC 9   O2 ? ? I DG 137 J DC 154 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog245 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog246 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 138 J DT 153 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog247 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 139 J DA 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 139 J DA 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 140 J DT 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 140 J DT 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 141 J DA 150 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog252 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 142 J DA 149 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog253 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 143 J DC 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog254 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B DC 3   O2 ? ? I DG 143 J DC 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B DC 3   N4 ? ? I DG 143 J DC 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 144 J DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 144 J DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DC 3   N4 ? ? I DA 144 J DC 148 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog259 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 145 J DA 146 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 145 J DA 146 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 84  ? PHE C 85  ? ARG A 483  PHE A 484  
A 2 THR D 81  ? VAL D 82  ? THR B 80   VAL B 81   
B 1 THR C 119 ? ILE C 120 ? THR A 518  ILE A 519  
B 2 ARG D 46  ? ILE D 47  ? ARG B 45   ILE B 46   
C 1 THR D 97  ? TYR D 99  ? THR B 96   TYR B 98   
C 2 VAL I 98  ? ILE I 100 ? VAL G 1100 ILE G 1102 
D 1 GLY E 54  ? ILE E 55  ? GLY D 1250 ILE D 1251 
D 2 ARG J 97  ? ILE J 98  ? ARG K 77   ILE K 78   
E 1 THR E 89  ? ILE E 90  ? THR D 1285 ILE D 1286 
E 2 ARG J 62  ? VAL J 63  ? ARG K 42   VAL K 43   
F 1 ARG F 84  ? PHE F 85  ? ARG E 683  PHE E 684  
F 2 THR G 81  ? VAL G 82  ? THR F 280  VAL F 281  
G 1 THR F 119 ? ILE F 120 ? THR E 718  ILE E 719  
G 2 ARG G 46  ? ILE G 47  ? ARG F 245  ILE F 246  
H 1 THR G 97  ? TYR G 99  ? THR F 296  TYR F 298  
H 2 VAL J 120 ? ILE J 122 ? VAL K 100  ILE K 102  
I 1 GLY H 51  ? ILE H 52  ? GLY H 1450 ILE H 1451 
I 2 ARG I 75  ? VAL I 76  ? ARG G 1077 VAL G 1078 
J 1 THR H 86  ? ILE H 87  ? THR H 1485 ILE H 1486 
J 2 ARG I 40  ? ILE I 41  ? ARG G 1042 ILE G 1043 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 84  ? N ARG A 483  O VAL D 82  ? O VAL B 81   
B 1 2 N ILE C 120 ? N ILE A 519  O ARG D 46  ? O ARG B 45   
C 1 2 N TYR D 99  ? N TYR B 98   O THR I 99  ? O THR G 1101 
D 1 2 N GLY E 54  ? N GLY D 1250 O ILE J 98  ? O ILE K 78   
E 1 2 N ILE E 90  ? N ILE D 1286 O ARG J 62  ? O ARG K 42   
F 1 2 N ARG F 84  ? N ARG E 683  O VAL G 82  ? O VAL F 281  
G 1 2 N ILE F 120 ? N ILE E 719  O ARG G 46  ? O ARG F 245  
H 1 2 N TYR G 99  ? N TYR F 298  O THR J 121 ? O THR K 101  
I 1 2 N GLY H 51  ? N GLY H 1450 O VAL I 76  ? O VAL G 1078 
J 1 2 N ILE H 87  ? N ILE H 1486 O ARG I 40  ? O ARG G 1042 
# 
_database_PDB_matrix.entry_id          2F8N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2F8N 
_atom_sites.fract_transf_matrix[1][1]   0.009421 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009151 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005673 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DA  A 1 1   ? -55.216  -52.316 -4.948 1.00 160.49 ? 1    DA  I "O5'" 1 
ATOM   2     C "C5'" . DA  A 1 1   ? -54.670  -52.816 -6.167 1.00 160.56 ? 1    DA  I "C5'" 1 
ATOM   3     C "C4'" . DA  A 1 1   ? -53.283  -52.272 -6.420 1.00 160.74 ? 1    DA  I "C4'" 1 
ATOM   4     O "O4'" . DA  A 1 1   ? -53.354  -50.841 -6.642 1.00 160.56 ? 1    DA  I "O4'" 1 
ATOM   5     C "C3'" . DA  A 1 1   ? -52.305  -52.468 -5.260 1.00 160.98 ? 1    DA  I "C3'" 1 
ATOM   6     O "O3'" . DA  A 1 1   ? -50.989  -52.732 -5.758 1.00 161.56 ? 1    DA  I "O3'" 1 
ATOM   7     C "C2'" . DA  A 1 1   ? -52.325  -51.122 -4.561 1.00 161.21 ? 1    DA  I "C2'" 1 
ATOM   8     C "C1'" . DA  A 1 1   ? -52.494  -50.173 -5.731 1.00 160.75 ? 1    DA  I "C1'" 1 
ATOM   9     N N9    . DA  A 1 1   ? -53.104  -48.889 -5.382 1.00 148.13 ? 1    DA  I N9    1 
ATOM   10    C C8    . DA  A 1 1   ? -54.428  -48.610 -5.142 1.00 148.16 ? 1    DA  I C8    1 
ATOM   11    N N7    . DA  A 1 1   ? -54.657  -47.354 -4.844 1.00 148.00 ? 1    DA  I N7    1 
ATOM   12    C C5    . DA  A 1 1   ? -53.400  -46.766 -4.892 1.00 148.13 ? 1    DA  I C5    1 
ATOM   13    C C6    . DA  A 1 1   ? -52.963  -45.451 -4.672 1.00 147.96 ? 1    DA  I C6    1 
ATOM   14    N N6    . DA  A 1 1   ? -53.779  -44.452 -4.347 1.00 148.01 ? 1    DA  I N6    1 
ATOM   15    N N1    . DA  A 1 1   ? -51.644  -45.194 -4.800 1.00 147.61 ? 1    DA  I N1    1 
ATOM   16    C C2    . DA  A 1 1   ? -50.829  -46.198 -5.128 1.00 147.66 ? 1    DA  I C2    1 
ATOM   17    N N3    . DA  A 1 1   ? -51.116  -47.477 -5.359 1.00 147.94 ? 1    DA  I N3    1 
ATOM   18    C C4    . DA  A 1 1   ? -52.435  -47.698 -5.223 1.00 148.18 ? 1    DA  I C4    1 
ATOM   19    P P     . DT  A 1 2   ? -49.851  -53.278 -4.759 1.00 152.41 ? 2    DT  I P     1 
ATOM   20    O OP1   . DT  A 1 2   ? -49.365  -54.574 -5.297 1.00 171.43 ? 2    DT  I OP1   1 
ATOM   21    O OP2   . DT  A 1 2   ? -50.366  -53.207 -3.365 1.00 172.05 ? 2    DT  I OP2   1 
ATOM   22    O "O5'" . DT  A 1 2   ? -48.677  -52.215 -4.912 1.00 151.30 ? 2    DT  I "O5'" 1 
ATOM   23    C "C5'" . DT  A 1 2   ? -48.253  -51.777 -6.201 1.00 148.91 ? 2    DT  I "C5'" 1 
ATOM   24    C "C4'" . DT  A 1 2   ? -47.333  -50.587 -6.068 1.00 147.86 ? 2    DT  I "C4'" 1 
ATOM   25    O "O4'" . DT  A 1 2   ? -48.079  -49.470 -5.530 1.00 148.23 ? 2    DT  I "O4'" 1 
ATOM   26    C "C3'" . DT  A 1 2   ? -46.156  -50.805 -5.117 1.00 146.87 ? 2    DT  I "C3'" 1 
ATOM   27    O "O3'" . DT  A 1 2   ? -44.999  -50.131 -5.613 1.00 144.33 ? 2    DT  I "O3'" 1 
ATOM   28    C "C2'" . DT  A 1 2   ? -46.627  -50.166 -3.824 1.00 148.17 ? 2    DT  I "C2'" 1 
ATOM   29    C "C1'" . DT  A 1 2   ? -47.472  -49.011 -4.329 1.00 149.05 ? 2    DT  I "C1'" 1 
ATOM   30    N N1    . DT  A 1 2   ? -48.545  -48.582 -3.404 1.00 169.35 ? 2    DT  I N1    1 
ATOM   31    C C2    . DT  A 1 2   ? -48.646  -47.239 -3.106 1.00 169.39 ? 2    DT  I C2    1 
ATOM   32    O O2    . DT  A 1 2   ? -47.894  -46.394 -3.568 1.00 168.56 ? 2    DT  I O2    1 
ATOM   33    N N3    . DT  A 1 2   ? -49.666  -46.919 -2.242 1.00 169.43 ? 2    DT  I N3    1 
ATOM   34    C C4    . DT  A 1 2   ? -50.571  -47.786 -1.659 1.00 169.62 ? 2    DT  I C4    1 
ATOM   35    O O4    . DT  A 1 2   ? -51.431  -47.352 -0.899 1.00 169.15 ? 2    DT  I O4    1 
ATOM   36    C C5    . DT  A 1 2   ? -50.408  -49.178 -2.014 1.00 169.56 ? 2    DT  I C5    1 
ATOM   37    C C7    . DT  A 1 2   ? -51.343  -50.190 -1.430 1.00 169.59 ? 2    DT  I C7    1 
ATOM   38    C C6    . DT  A 1 2   ? -49.418  -49.502 -2.858 1.00 169.58 ? 2    DT  I C6    1 
ATOM   39    P P     . DC  A 1 3   ? -43.667  -50.079 -4.721 1.00 182.31 ? 3    DC  I P     1 
ATOM   40    O OP1   . DC  A 1 3   ? -42.508  -50.059 -5.646 1.00 160.40 ? 3    DC  I OP1   1 
ATOM   41    O OP2   . DC  A 1 3   ? -43.758  -51.135 -3.682 1.00 160.42 ? 3    DC  I OP2   1 
ATOM   42    O "O5'" . DC  A 1 3   ? -43.744  -48.655 -4.015 1.00 179.43 ? 3    DC  I "O5'" 1 
ATOM   43    C "C5'" . DC  A 1 3   ? -43.689  -47.459 -4.791 1.00 175.01 ? 3    DC  I "C5'" 1 
ATOM   44    C "C4'" . DC  A 1 3   ? -43.503  -46.258 -3.894 1.00 171.97 ? 3    DC  I "C4'" 1 
ATOM   45    O "O4'" . DC  A 1 3   ? -44.701  -46.047 -3.109 1.00 171.92 ? 3    DC  I "O4'" 1 
ATOM   46    C "C3'" . DC  A 1 3   ? -42.353  -46.383 -2.892 1.00 169.72 ? 3    DC  I "C3'" 1 
ATOM   47    O "O3'" . DC  A 1 3   ? -41.711  -45.116 -2.722 1.00 166.72 ? 3    DC  I "O3'" 1 
ATOM   48    C "C2'" . DC  A 1 3   ? -43.057  -46.778 -1.607 1.00 170.04 ? 3    DC  I "C2'" 1 
ATOM   49    C "C1'" . DC  A 1 3   ? -44.373  -46.028 -1.728 1.00 170.26 ? 3    DC  I "C1'" 1 
ATOM   50    N N1    . DC  A 1 3   ? -45.495  -46.626 -0.989 1.00 146.37 ? 3    DC  I N1    1 
ATOM   51    C C2    . DC  A 1 3   ? -46.581  -45.816 -0.650 1.00 145.29 ? 3    DC  I C2    1 
ATOM   52    O O2    . DC  A 1 3   ? -46.563  -44.620 -0.983 1.00 143.86 ? 3    DC  I O2    1 
ATOM   53    N N3    . DC  A 1 3   ? -47.622  -46.354 0.029  1.00 144.95 ? 3    DC  I N3    1 
ATOM   54    C C4    . DC  A 1 3   ? -47.601  -47.647 0.368  1.00 145.18 ? 3    DC  I C4    1 
ATOM   55    N N4    . DC  A 1 3   ? -48.649  -48.139 1.038  1.00 144.45 ? 3    DC  I N4    1 
ATOM   56    C C5    . DC  A 1 3   ? -46.505  -48.494 0.036  1.00 145.32 ? 3    DC  I C5    1 
ATOM   57    C C6    . DC  A 1 3   ? -45.483  -47.948 -0.636 1.00 145.92 ? 3    DC  I C6    1 
ATOM   58    P P     . DA  A 1 4   ? -40.180  -45.052 -2.230 1.00 152.28 ? 4    DA  I P     1 
ATOM   59    O OP1   . DA  A 1 4   ? -39.310  -45.213 -3.422 1.00 145.24 ? 4    DA  I OP1   1 
ATOM   60    O OP2   . DA  A 1 4   ? -40.006  -45.954 -1.063 1.00 144.24 ? 4    DA  I OP2   1 
ATOM   61    O "O5'" . DA  A 1 4   ? -40.011  -43.556 -1.726 1.00 149.90 ? 4    DA  I "O5'" 1 
ATOM   62    C "C5'" . DA  A 1 4   ? -40.597  -42.479 -2.447 1.00 144.75 ? 4    DA  I "C5'" 1 
ATOM   63    C "C4'" . DA  A 1 4   ? -41.152  -41.461 -1.481 1.00 141.51 ? 4    DA  I "C4'" 1 
ATOM   64    O "O4'" . DA  A 1 4   ? -42.316  -42.000 -0.808 1.00 140.01 ? 4    DA  I "O4'" 1 
ATOM   65    C "C3'" . DA  A 1 4   ? -40.172  -41.072 -0.377 1.00 140.19 ? 4    DA  I "C3'" 1 
ATOM   66    O "O3'" . DA  A 1 4   ? -40.306  -39.680 -0.101 1.00 139.30 ? 4    DA  I "O3'" 1 
ATOM   67    C "C2'" . DA  A 1 4   ? -40.613  -41.920 0.804  1.00 137.93 ? 4    DA  I "C2'" 1 
ATOM   68    C "C1'" . DA  A 1 4   ? -42.117  -41.988 0.600  1.00 138.45 ? 4    DA  I "C1'" 1 
ATOM   69    N N9    . DA  A 1 4   ? -42.778  -43.171 1.155  1.00 130.02 ? 4    DA  I N9    1 
ATOM   70    C C8    . DA  A 1 4   ? -42.394  -44.486 1.057  1.00 130.05 ? 4    DA  I C8    1 
ATOM   71    N N7    . DA  A 1 4   ? -43.224  -45.324 1.633  1.00 129.48 ? 4    DA  I N7    1 
ATOM   72    C C5    . DA  A 1 4   ? -44.217  -44.505 2.153  1.00 129.37 ? 4    DA  I C5    1 
ATOM   73    C C6    . DA  A 1 4   ? -45.395  -44.783 2.876  1.00 128.27 ? 4    DA  I C6    1 
ATOM   74    N N6    . DA  A 1 4   ? -45.783  -46.014 3.217  1.00 126.53 ? 4    DA  I N6    1 
ATOM   75    N N1    . DA  A 1 4   ? -46.169  -43.739 3.241  1.00 128.41 ? 4    DA  I N1    1 
ATOM   76    C C2    . DA  A 1 4   ? -45.776  -42.505 2.905  1.00 128.94 ? 4    DA  I C2    1 
ATOM   77    N N3    . DA  A 1 4   ? -44.693  -42.116 2.231  1.00 128.81 ? 4    DA  I N3    1 
ATOM   78    C C4    . DA  A 1 4   ? -43.949  -43.177 1.876  1.00 129.70 ? 4    DA  I C4    1 
ATOM   79    P P     . DA  A 1 5   ? -39.370  -38.999 1.004  1.00 140.25 ? 5    DA  I P     1 
ATOM   80    O OP1   . DA  A 1 5   ? -38.939  -37.673 0.488  1.00 129.05 ? 5    DA  I OP1   1 
ATOM   81    O OP2   . DA  A 1 5   ? -38.355  -39.995 1.433  1.00 128.92 ? 5    DA  I OP2   1 
ATOM   82    O "O5'" . DA  A 1 5   ? -40.371  -38.751 2.211  1.00 138.51 ? 5    DA  I "O5'" 1 
ATOM   83    C "C5'" . DA  A 1 5   ? -41.560  -37.998 2.011  1.00 132.38 ? 5    DA  I "C5'" 1 
ATOM   84    C "C4'" . DA  A 1 5   ? -42.312  -37.867 3.310  1.00 128.23 ? 5    DA  I "C4'" 1 
ATOM   85    O "O4'" . DA  A 1 5   ? -42.957  -39.121 3.643  1.00 125.81 ? 5    DA  I "O4'" 1 
ATOM   86    C "C3'" . DA  A 1 5   ? -41.416  -37.516 4.494  1.00 125.67 ? 5    DA  I "C3'" 1 
ATOM   87    O "O3'" . DA  A 1 5   ? -42.084  -36.563 5.318  1.00 122.81 ? 5    DA  I "O3'" 1 
ATOM   88    C "C2'" . DA  A 1 5   ? -41.228  -38.849 5.199  1.00 124.36 ? 5    DA  I "C2'" 1 
ATOM   89    C "C1'" . DA  A 1 5   ? -42.547  -39.556 4.928  1.00 123.83 ? 5    DA  I "C1'" 1 
ATOM   90    N N9    . DA  A 1 5   ? -42.473  -41.019 4.900  1.00 110.50 ? 5    DA  I N9    1 
ATOM   91    C C8    . DA  A 1 5   ? -41.477  -41.798 4.367  1.00 110.33 ? 5    DA  I C8    1 
ATOM   92    N N7    . DA  A 1 5   ? -41.686  -43.086 4.495  1.00 109.59 ? 5    DA  I N7    1 
ATOM   93    C C5    . DA  A 1 5   ? -42.902  -43.163 5.157  1.00 108.90 ? 5    DA  I C5    1 
ATOM   94    C C6    . DA  A 1 5   ? -43.667  -44.253 5.599  1.00 108.44 ? 5    DA  I C6    1 
ATOM   95    N N6    . DA  A 1 5   ? -43.303  -45.525 5.437  1.00 107.38 ? 5    DA  I N6    1 
ATOM   96    N N1    . DA  A 1 5   ? -44.833  -43.990 6.226  1.00 108.50 ? 5    DA  I N1    1 
ATOM   97    C C2    . DA  A 1 5   ? -45.194  -42.713 6.396  1.00 108.98 ? 5    DA  I C2    1 
ATOM   98    N N3    . DA  A 1 5   ? -44.556  -41.600 6.031  1.00 108.99 ? 5    DA  I N3    1 
ATOM   99    C C4    . DA  A 1 5   ? -43.401  -41.898 5.410  1.00 109.47 ? 5    DA  I C4    1 
ATOM   100   P P     . DT  A 1 6   ? -41.279  -35.816 6.485  1.00 115.42 ? 6    DT  I P     1 
ATOM   101   O OP1   . DT  A 1 6   ? -41.545  -34.359 6.371  1.00 118.73 ? 6    DT  I OP1   1 
ATOM   102   O OP2   . DT  A 1 6   ? -39.880  -36.319 6.471  1.00 120.36 ? 6    DT  I OP2   1 
ATOM   103   O "O5'" . DT  A 1 6   ? -41.994  -36.361 7.791  1.00 116.71 ? 6    DT  I "O5'" 1 
ATOM   104   C "C5'" . DT  A 1 6   ? -42.416  -37.709 7.827  1.00 113.62 ? 6    DT  I "C5'" 1 
ATOM   105   C "C4'" . DT  A 1 6   ? -43.346  -37.954 8.986  1.00 111.45 ? 6    DT  I "C4'" 1 
ATOM   106   O "O4'" . DT  A 1 6   ? -43.766  -39.330 8.876  1.00 111.96 ? 6    DT  I "O4'" 1 
ATOM   107   C "C3'" . DT  A 1 6   ? -42.683  -37.834 10.353 1.00 111.22 ? 6    DT  I "C3'" 1 
ATOM   108   O "O3'" . DT  A 1 6   ? -43.682  -37.515 11.331 1.00 112.12 ? 6    DT  I "O3'" 1 
ATOM   109   C "C2'" . DT  A 1 6   ? -42.106  -39.222 10.564 1.00 111.64 ? 6    DT  I "C2'" 1 
ATOM   110   C "C1'" . DT  A 1 6   ? -43.095  -40.132 9.836  1.00 111.85 ? 6    DT  I "C1'" 1 
ATOM   111   N N1    . DT  A 1 6   ? -42.470  -41.256 9.109  1.00 115.46 ? 6    DT  I N1    1 
ATOM   112   C C2    . DT  A 1 6   ? -43.110  -42.478 9.114  1.00 115.31 ? 6    DT  I C2    1 
ATOM   113   O O2    . DT  A 1 6   ? -44.181  -42.673 9.671  1.00 113.88 ? 6    DT  I O2    1 
ATOM   114   N N3    . DT  A 1 6   ? -42.449  -43.470 8.428  1.00 117.06 ? 6    DT  I N3    1 
ATOM   115   C C4    . DT  A 1 6   ? -41.253  -43.360 7.744  1.00 117.76 ? 6    DT  I C4    1 
ATOM   116   O O4    . DT  A 1 6   ? -40.784  -44.336 7.169  1.00 117.72 ? 6    DT  I O4    1 
ATOM   117   C C5    . DT  A 1 6   ? -40.649  -42.052 7.768  1.00 117.33 ? 6    DT  I C5    1 
ATOM   118   C C7    . DT  A 1 6   ? -39.361  -41.840 7.040  1.00 116.61 ? 6    DT  I C7    1 
ATOM   119   C C6    . DT  A 1 6   ? -41.276  -41.079 8.442  1.00 116.52 ? 6    DT  I C6    1 
ATOM   120   P P     . DA  A 1 7   ? -43.258  -36.914 12.759 1.00 109.45 ? 7    DA  I P     1 
ATOM   121   O OP1   . DA  A 1 7   ? -43.576  -35.462 12.755 1.00 103.17 ? 7    DA  I OP1   1 
ATOM   122   O OP2   . DA  A 1 7   ? -41.886  -37.365 13.109 1.00 104.16 ? 7    DA  I OP2   1 
ATOM   123   O "O5'" . DA  A 1 7   ? -44.281  -37.633 13.735 1.00 109.25 ? 7    DA  I "O5'" 1 
ATOM   124   C "C5'" . DA  A 1 7   ? -45.601  -37.934 13.295 1.00 111.13 ? 7    DA  I "C5'" 1 
ATOM   125   C "C4'" . DA  A 1 7   ? -46.033  -39.284 13.821 1.00 112.81 ? 7    DA  I "C4'" 1 
ATOM   126   O "O4'" . DA  A 1 7   ? -45.330  -40.339 13.119 1.00 111.46 ? 7    DA  I "O4'" 1 
ATOM   127   C "C3'" . DA  A 1 7   ? -45.759  -39.508 15.312 1.00 115.23 ? 7    DA  I "C3'" 1 
ATOM   128   O "O3'" . DA  A 1 7   ? -46.857  -40.204 15.916 1.00 119.60 ? 7    DA  I "O3'" 1 
ATOM   129   C "C2'" . DA  A 1 7   ? -44.517  -40.380 15.310 1.00 113.15 ? 7    DA  I "C2'" 1 
ATOM   130   C "C1'" . DA  A 1 7   ? -44.749  -41.221 14.070 1.00 112.54 ? 7    DA  I "C1'" 1 
ATOM   131   N N9    . DA  A 1 7   ? -43.546  -41.818 13.481 1.00 105.98 ? 7    DA  I N9    1 
ATOM   132   C C8    . DA  A 1 7   ? -42.331  -41.231 13.202 1.00 106.43 ? 7    DA  I C8    1 
ATOM   133   N N7    . DA  A 1 7   ? -41.462  -42.050 12.654 1.00 105.78 ? 7    DA  I N7    1 
ATOM   134   C C5    . DA  A 1 7   ? -42.148  -43.256 12.572 1.00 105.23 ? 7    DA  I C5    1 
ATOM   135   C C6    . DA  A 1 7   ? -41.782  -44.525 12.081 1.00 104.73 ? 7    DA  I C6    1 
ATOM   136   N N6    . DA  A 1 7   ? -40.588  -44.800 11.550 1.00 103.66 ? 7    DA  I N6    1 
ATOM   137   N N1    . DA  A 1 7   ? -42.699  -45.514 12.153 1.00 104.65 ? 7    DA  I N1    1 
ATOM   138   C C2    . DA  A 1 7   ? -43.899  -45.239 12.685 1.00 104.36 ? 7    DA  I C2    1 
ATOM   139   N N3    . DA  A 1 7   ? -44.362  -44.092 13.176 1.00 104.28 ? 7    DA  I N3    1 
ATOM   140   C C4    . DA  A 1 7   ? -43.428  -43.129 13.086 1.00 105.66 ? 7    DA  I C4    1 
ATOM   141   P P     . DT  A 1 8   ? -46.754  -40.689 17.446 1.00 116.30 ? 8    DT  I P     1 
ATOM   142   O OP1   . DT  A 1 8   ? -48.099  -40.540 18.046 1.00 109.89 ? 8    DT  I OP1   1 
ATOM   143   O OP2   . DT  A 1 8   ? -45.578  -40.058 18.109 1.00 107.95 ? 8    DT  I OP2   1 
ATOM   144   O "O5'" . DT  A 1 8   ? -46.498  -42.247 17.305 1.00 117.09 ? 8    DT  I "O5'" 1 
ATOM   145   C "C5'" . DT  A 1 8   ? -47.427  -43.052 16.598 1.00 119.27 ? 8    DT  I "C5'" 1 
ATOM   146   C "C4'" . DT  A 1 8   ? -47.093  -44.510 16.787 1.00 121.96 ? 8    DT  I "C4'" 1 
ATOM   147   O "O4'" . DT  A 1 8   ? -45.883  -44.826 16.059 1.00 120.56 ? 8    DT  I "O4'" 1 
ATOM   148   C "C3'" . DT  A 1 8   ? -46.836  -44.901 18.242 1.00 125.92 ? 8    DT  I "C3'" 1 
ATOM   149   O "O3'" . DT  A 1 8   ? -47.408  -46.190 18.486 1.00 133.10 ? 8    DT  I "O3'" 1 
ATOM   150   C "C2'" . DT  A 1 8   ? -45.319  -44.937 18.331 1.00 122.43 ? 8    DT  I "C2'" 1 
ATOM   151   C "C1'" . DT  A 1 8   ? -44.932  -45.405 16.937 1.00 119.92 ? 8    DT  I "C1'" 1 
ATOM   152   N N1    . DT  A 1 8   ? -43.590  -44.997 16.479 1.00 110.46 ? 8    DT  I N1    1 
ATOM   153   C C2    . DT  A 1 8   ? -42.805  -45.947 15.854 1.00 109.00 ? 8    DT  I C2    1 
ATOM   154   O O2    . DT  A 1 8   ? -43.158  -47.106 15.695 1.00 106.66 ? 8    DT  I O2    1 
ATOM   155   N N3    . DT  A 1 8   ? -41.582  -45.488 15.427 1.00 107.50 ? 8    DT  I N3    1 
ATOM   156   C C4    . DT  A 1 8   ? -41.074  -44.209 15.570 1.00 106.79 ? 8    DT  I C4    1 
ATOM   157   O O4    . DT  A 1 8   ? -39.957  -43.941 15.129 1.00 104.00 ? 8    DT  I O4    1 
ATOM   158   C C5    . DT  A 1 8   ? -41.943  -43.272 16.249 1.00 107.24 ? 8    DT  I C5    1 
ATOM   159   C C7    . DT  A 1 8   ? -41.473  -41.867 16.456 1.00 106.23 ? 8    DT  I C7    1 
ATOM   160   C C6    . DT  A 1 8   ? -43.142  -43.707 16.663 1.00 108.55 ? 8    DT  I C6    1 
ATOM   161   P P     . DC  A 1 9   ? -47.636  -46.701 19.992 1.00 143.38 ? 9    DC  I P     1 
ATOM   162   O OP1   . DC  A 1 9   ? -49.074  -47.048 20.131 1.00 107.50 ? 9    DC  I OP1   1 
ATOM   163   O OP2   . DC  A 1 9   ? -46.997  -45.771 20.965 1.00 107.58 ? 9    DC  I OP2   1 
ATOM   164   O "O5'" . DC  A 1 9   ? -46.847  -48.075 19.995 1.00 144.55 ? 9    DC  I "O5'" 1 
ATOM   165   C "C5'" . DC  A 1 9   ? -47.070  -49.021 18.959 1.00 147.65 ? 9    DC  I "C5'" 1 
ATOM   166   C "C4'" . DC  A 1 9   ? -45.989  -50.070 18.989 1.00 149.53 ? 9    DC  I "C4'" 1 
ATOM   167   O "O4'" . DC  A 1 9   ? -44.769  -49.550 18.403 1.00 150.02 ? 9    DC  I "O4'" 1 
ATOM   168   C "C3'" . DC  A 1 9   ? -45.641  -50.484 20.415 1.00 151.44 ? 9    DC  I "C3'" 1 
ATOM   169   O "O3'" . DC  A 1 9   ? -45.500  -51.898 20.509 1.00 154.08 ? 9    DC  I "O3'" 1 
ATOM   170   C "C2'" . DC  A 1 9   ? -44.328  -49.769 20.688 1.00 150.27 ? 9    DC  I "C2'" 1 
ATOM   171   C "C1'" . DC  A 1 9   ? -43.692  -49.703 19.313 1.00 149.05 ? 9    DC  I "C1'" 1 
ATOM   172   N N1    . DC  A 1 9   ? -42.772  -48.569 19.125 1.00 114.35 ? 9    DC  I N1    1 
ATOM   173   C C2    . DC  A 1 9   ? -41.522  -48.804 18.538 1.00 113.78 ? 9    DC  I C2    1 
ATOM   174   O O2    . DC  A 1 9   ? -41.240  -49.956 18.171 1.00 114.29 ? 9    DC  I O2    1 
ATOM   175   N N3    . DC  A 1 9   ? -40.657  -47.771 18.386 1.00 113.43 ? 9    DC  I N3    1 
ATOM   176   C C4    . DC  A 1 9   ? -41.002  -46.545 18.792 1.00 113.70 ? 9    DC  I C4    1 
ATOM   177   N N4    . DC  A 1 9   ? -40.113  -45.555 18.636 1.00 113.29 ? 9    DC  I N4    1 
ATOM   178   C C5    . DC  A 1 9   ? -42.273  -46.277 19.381 1.00 113.93 ? 9    DC  I C5    1 
ATOM   179   C C6    . DC  A 1 9   ? -43.119  -47.308 19.525 1.00 113.75 ? 9    DC  I C6    1 
ATOM   180   P P     . DC  A 1 10  ? -45.069  -52.551 21.906 1.00 158.00 ? 10   DC  I P     1 
ATOM   181   O OP1   . DC  A 1 10  ? -45.286  -54.017 21.800 1.00 170.58 ? 10   DC  I OP1   1 
ATOM   182   O OP2   . DC  A 1 10  ? -45.726  -51.786 23.000 1.00 169.71 ? 10   DC  I OP2   1 
ATOM   183   O "O5'" . DC  A 1 10  ? -43.504  -52.264 21.953 1.00 159.73 ? 10   DC  I "O5'" 1 
ATOM   184   C "C5'" . DC  A 1 10  ? -42.651  -52.743 20.915 1.00 162.37 ? 10   DC  I "C5'" 1 
ATOM   185   C "C4'" . DC  A 1 10  ? -41.212  -52.689 21.363 1.00 164.73 ? 10   DC  I "C4'" 1 
ATOM   186   O "O4'" . DC  A 1 10  ? -40.618  -51.414 21.020 1.00 164.68 ? 10   DC  I "O4'" 1 
ATOM   187   C "C3'" . DC  A 1 10  ? -41.042  -52.863 22.872 1.00 166.22 ? 10   DC  I "C3'" 1 
ATOM   188   O "O3'" . DC  A 1 10  ? -39.993  -53.792 23.159 1.00 168.37 ? 10   DC  I "O3'" 1 
ATOM   189   C "C2'" . DC  A 1 10  ? -40.686  -51.466 23.352 1.00 165.78 ? 10   DC  I "C2'" 1 
ATOM   190   C "C1'" . DC  A 1 10  ? -39.956  -50.885 22.153 1.00 164.67 ? 10   DC  I "C1'" 1 
ATOM   191   N N1    . DC  A 1 10  ? -39.973  -49.413 22.049 1.00 177.82 ? 10   DC  I N1    1 
ATOM   192   C C2    . DC  A 1 10  ? -39.015  -48.784 21.239 1.00 178.07 ? 10   DC  I C2    1 
ATOM   193   O O2    . DC  A 1 10  ? -38.207  -49.482 20.610 1.00 178.74 ? 10   DC  I O2    1 
ATOM   194   N N3    . DC  A 1 10  ? -38.999  -47.432 21.160 1.00 178.11 ? 10   DC  I N3    1 
ATOM   195   C C4    . DC  A 1 10  ? -39.892  -46.712 21.844 1.00 178.16 ? 10   DC  I C4    1 
ATOM   196   N N4    . DC  A 1 10  ? -39.834  -45.382 21.741 1.00 178.16 ? 10   DC  I N4    1 
ATOM   197   C C5    . DC  A 1 10  ? -40.886  -47.325 22.663 1.00 177.91 ? 10   DC  I C5    1 
ATOM   198   C C6    . DC  A 1 10  ? -40.891  -48.665 22.735 1.00 177.63 ? 10   DC  I C6    1 
ATOM   199   P P     . DA  A 1 11  ? -40.345  -55.196 23.870 1.00 153.64 ? 11   DA  I P     1 
ATOM   200   O OP1   . DA  A 1 11  ? -41.199  -55.970 22.930 1.00 168.84 ? 11   DA  I OP1   1 
ATOM   201   O OP2   . DA  A 1 11  ? -40.827  -54.939 25.254 1.00 168.47 ? 11   DA  I OP2   1 
ATOM   202   O "O5'" . DA  A 1 11  ? -38.934  -55.925 23.963 1.00 154.10 ? 11   DA  I "O5'" 1 
ATOM   203   C "C5'" . DA  A 1 11  ? -38.284  -56.408 22.793 1.00 155.46 ? 11   DA  I "C5'" 1 
ATOM   204   C "C4'" . DA  A 1 11  ? -36.797  -56.170 22.896 1.00 156.62 ? 11   DA  I "C4'" 1 
ATOM   205   O "O4'" . DA  A 1 11  ? -36.486  -54.790 22.582 1.00 155.78 ? 11   DA  I "O4'" 1 
ATOM   206   C "C3'" . DA  A 1 11  ? -36.228  -56.431 24.292 1.00 158.12 ? 11   DA  I "C3'" 1 
ATOM   207   O "O3'" . DA  A 1 11  ? -34.975  -57.106 24.200 1.00 161.52 ? 11   DA  I "O3'" 1 
ATOM   208   C "C2'" . DA  A 1 11  ? -36.031  -55.038 24.859 1.00 157.50 ? 11   DA  I "C2'" 1 
ATOM   209   C "C1'" . DA  A 1 11  ? -35.691  -54.235 23.618 1.00 156.80 ? 11   DA  I "C1'" 1 
ATOM   210   N N9    . DA  A 1 11  ? -36.003  -52.809 23.726 1.00 173.02 ? 11   DA  I N9    1 
ATOM   211   C C8    . DA  A 1 11  ? -37.108  -52.227 24.300 1.00 173.17 ? 11   DA  I C8    1 
ATOM   212   N N7    . DA  A 1 11  ? -37.093  -50.917 24.269 1.00 173.28 ? 11   DA  I N7    1 
ATOM   213   C C5    . DA  A 1 11  ? -35.902  -50.613 23.626 1.00 173.53 ? 11   DA  I C5    1 
ATOM   214   C C6    . DA  A 1 11  ? -35.299  -49.393 23.288 1.00 174.02 ? 11   DA  I C6    1 
ATOM   215   N N6    . DA  A 1 11  ? -35.834  -48.203 23.565 1.00 174.88 ? 11   DA  I N6    1 
ATOM   216   N N1    . DA  A 1 11  ? -34.110  -49.436 22.650 1.00 174.34 ? 11   DA  I N1    1 
ATOM   217   C C2    . DA  A 1 11  ? -33.572  -50.632 22.378 1.00 174.57 ? 11   DA  I C2    1 
ATOM   218   N N3    . DA  A 1 11  ? -34.041  -51.848 22.647 1.00 174.00 ? 11   DA  I N3    1 
ATOM   219   C C4    . DA  A 1 11  ? -35.223  -51.768 23.280 1.00 173.47 ? 11   DA  I C4    1 
ATOM   220   P P     . DC  A 1 12  ? -34.145  -57.430 25.535 1.00 199.71 ? 12   DC  I P     1 
ATOM   221   O OP1   . DC  A 1 12  ? -33.552  -58.782 25.356 1.00 144.82 ? 12   DC  I OP1   1 
ATOM   222   O OP2   . DC  A 1 12  ? -35.011  -57.160 26.712 1.00 144.39 ? 12   DC  I OP2   1 
ATOM   223   O "O5'" . DC  A 1 12  ? -32.975  -56.349 25.499 1.00 199.71 ? 12   DC  I "O5'" 1 
ATOM   224   C "C5'" . DC  A 1 12  ? -32.182  -56.188 24.324 1.00 199.71 ? 12   DC  I "C5'" 1 
ATOM   225   C "C4'" . DC  A 1 12  ? -31.194  -55.059 24.500 1.00 199.71 ? 12   DC  I "C4'" 1 
ATOM   226   O "O4'" . DC  A 1 12  ? -31.862  -53.773 24.413 1.00 199.71 ? 12   DC  I "O4'" 1 
ATOM   227   C "C3'" . DC  A 1 12  ? -30.440  -55.061 25.832 1.00 199.71 ? 12   DC  I "C3'" 1 
ATOM   228   O "O3'" . DC  A 1 12  ? -29.056  -54.775 25.611 1.00 199.71 ? 12   DC  I "O3'" 1 
ATOM   229   C "C2'" . DC  A 1 12  ? -31.088  -53.925 26.604 1.00 199.71 ? 12   DC  I "C2'" 1 
ATOM   230   C "C1'" . DC  A 1 12  ? -31.425  -52.954 25.487 1.00 199.71 ? 12   DC  I "C1'" 1 
ATOM   231   N N1    . DC  A 1 12  ? -32.481  -51.963 25.795 1.00 151.13 ? 12   DC  I N1    1 
ATOM   232   C C2    . DC  A 1 12  ? -32.247  -50.611 25.488 1.00 151.02 ? 12   DC  I C2    1 
ATOM   233   O O2    . DC  A 1 12  ? -31.177  -50.291 24.946 1.00 150.95 ? 12   DC  I O2    1 
ATOM   234   N N3    . DC  A 1 12  ? -33.192  -49.691 25.792 1.00 150.51 ? 12   DC  I N3    1 
ATOM   235   C C4    . DC  A 1 12  ? -34.332  -50.072 26.374 1.00 150.25 ? 12   DC  I C4    1 
ATOM   236   N N4    . DC  A 1 12  ? -35.231  -49.128 26.661 1.00 150.80 ? 12   DC  I N4    1 
ATOM   237   C C5    . DC  A 1 12  ? -34.600  -51.437 26.687 1.00 150.23 ? 12   DC  I C5    1 
ATOM   238   C C6    . DC  A 1 12  ? -33.659  -52.341 26.380 1.00 151.01 ? 12   DC  I C6    1 
ATOM   239   P P     . DC  A 1 13  ? -28.090  -54.499 26.865 1.00 185.29 ? 13   DC  I P     1 
ATOM   240   O OP1   . DC  A 1 13  ? -26.706  -54.842 26.451 1.00 169.66 ? 13   DC  I OP1   1 
ATOM   241   O OP2   . DC  A 1 13  ? -28.678  -55.140 28.071 1.00 169.40 ? 13   DC  I OP2   1 
ATOM   242   O "O5'" . DC  A 1 13  ? -28.157  -52.919 27.048 1.00 183.01 ? 13   DC  I "O5'" 1 
ATOM   243   C "C5'" . DC  A 1 13  ? -27.440  -52.055 26.169 1.00 180.40 ? 13   DC  I "C5'" 1 
ATOM   244   C "C4'" . DC  A 1 13  ? -26.985  -50.823 26.914 1.00 179.52 ? 13   DC  I "C4'" 1 
ATOM   245   O "O4'" . DC  A 1 13  ? -28.115  -49.950 27.155 1.00 179.52 ? 13   DC  I "O4'" 1 
ATOM   246   C "C3'" . DC  A 1 13  ? -26.376  -51.122 28.283 1.00 179.40 ? 13   DC  I "C3'" 1 
ATOM   247   O "O3'" . DC  A 1 13  ? -25.257  -50.267 28.537 1.00 179.66 ? 13   DC  I "O3'" 1 
ATOM   248   C "C2'" . DC  A 1 13  ? -27.513  -50.833 29.247 1.00 178.29 ? 13   DC  I "C2'" 1 
ATOM   249   C "C1'" . DC  A 1 13  ? -28.272  -49.716 28.548 1.00 177.79 ? 13   DC  I "C1'" 1 
ATOM   250   N N1    . DC  A 1 13  ? -29.715  -49.692 28.840 1.00 159.96 ? 13   DC  I N1    1 
ATOM   251   C C2    . DC  A 1 13  ? -30.281  -48.532 29.386 1.00 158.93 ? 13   DC  I C2    1 
ATOM   252   O O2    . DC  A 1 13  ? -29.548  -47.559 29.619 1.00 158.71 ? 13   DC  I O2    1 
ATOM   253   N N3    . DC  A 1 13  ? -31.611  -48.504 29.647 1.00 158.12 ? 13   DC  I N3    1 
ATOM   254   C C4    . DC  A 1 13  ? -32.365  -49.576 29.385 1.00 157.61 ? 13   DC  I C4    1 
ATOM   255   N N4    . DC  A 1 13  ? -33.671  -49.504 29.652 1.00 157.26 ? 13   DC  I N4    1 
ATOM   256   C C5    . DC  A 1 13  ? -31.813  -50.769 28.836 1.00 157.85 ? 13   DC  I C5    1 
ATOM   257   C C6    . DC  A 1 13  ? -30.498  -50.783 28.581 1.00 158.92 ? 13   DC  I C6    1 
ATOM   258   P P     . DT  A 1 14  ? -24.349  -50.513 29.840 1.00 200.16 ? 14   DT  I P     1 
ATOM   259   O OP1   . DT  A 1 14  ? -22.963  -50.077 29.520 1.00 148.14 ? 14   DT  I OP1   1 
ATOM   260   O OP2   . DT  A 1 14  ? -24.589  -51.896 30.329 1.00 147.29 ? 14   DT  I OP2   1 
ATOM   261   O "O5'" . DT  A 1 14  ? -24.958  -49.499 30.904 1.00 200.16 ? 14   DT  I "O5'" 1 
ATOM   262   C "C5'" . DT  A 1 14  ? -24.952  -48.096 30.656 1.00 200.16 ? 14   DT  I "C5'" 1 
ATOM   263   C "C4'" . DT  A 1 14  ? -25.607  -47.359 31.800 1.00 200.16 ? 14   DT  I "C4'" 1 
ATOM   264   O "O4'" . DT  A 1 14  ? -27.049  -47.475 31.727 1.00 200.16 ? 14   DT  I "O4'" 1 
ATOM   265   C "C3'" . DT  A 1 14  ? -25.203  -47.861 33.188 1.00 200.16 ? 14   DT  I "C3'" 1 
ATOM   266   O "O3'" . DT  A 1 14  ? -24.985  -46.748 34.058 1.00 200.16 ? 14   DT  I "O3'" 1 
ATOM   267   C "C2'" . DT  A 1 14  ? -26.418  -48.653 33.642 1.00 200.16 ? 14   DT  I "C2'" 1 
ATOM   268   C "C1'" . DT  A 1 14  ? -27.551  -47.879 32.990 1.00 200.16 ? 14   DT  I "C1'" 1 
ATOM   269   N N1    . DT  A 1 14  ? -28.802  -48.636 32.773 1.00 144.58 ? 14   DT  I N1    1 
ATOM   270   C C2    . DT  A 1 14  ? -29.998  -47.991 33.021 1.00 144.07 ? 14   DT  I C2    1 
ATOM   271   O O2    . DT  A 1 14  ? -30.068  -46.827 33.380 1.00 143.86 ? 14   DT  I O2    1 
ATOM   272   N N3    . DT  A 1 14  ? -31.116  -48.765 32.828 1.00 143.99 ? 14   DT  I N3    1 
ATOM   273   C C4    . DT  A 1 14  ? -31.161  -50.083 32.411 1.00 143.78 ? 14   DT  I C4    1 
ATOM   274   O O4    . DT  A 1 14  ? -32.242  -50.652 32.294 1.00 143.71 ? 14   DT  I O4    1 
ATOM   275   C C5    . DT  A 1 14  ? -29.876  -50.691 32.147 1.00 143.79 ? 14   DT  I C5    1 
ATOM   276   C C7    . DT  A 1 14  ? -29.831  -52.108 31.666 1.00 144.24 ? 14   DT  I C7    1 
ATOM   277   C C6    . DT  A 1 14  ? -28.775  -49.947 32.342 1.00 143.99 ? 14   DT  I C6    1 
ATOM   278   P P     . DG  A 1 15  ? -23.488  -46.372 34.504 1.00 200.16 ? 15   DG  I P     1 
ATOM   279   O OP1   . DG  A 1 15  ? -22.673  -46.329 33.262 1.00 175.63 ? 15   DG  I OP1   1 
ATOM   280   O OP2   . DG  A 1 15  ? -23.093  -47.279 35.615 1.00 175.37 ? 15   DG  I OP2   1 
ATOM   281   O "O5'" . DG  A 1 15  ? -23.615  -44.886 35.072 1.00 200.16 ? 15   DG  I "O5'" 1 
ATOM   282   C "C5'" . DG  A 1 15  ? -23.984  -43.802 34.215 1.00 200.16 ? 15   DG  I "C5'" 1 
ATOM   283   C "C4'" . DG  A 1 15  ? -25.084  -42.981 34.850 1.00 200.16 ? 15   DG  I "C4'" 1 
ATOM   284   O "O4'" . DG  A 1 15  ? -26.220  -43.839 35.107 1.00 200.16 ? 15   DG  I "O4'" 1 
ATOM   285   C "C3'" . DG  A 1 15  ? -24.736  -42.344 36.192 1.00 200.16 ? 15   DG  I "C3'" 1 
ATOM   286   O "O3'" . DG  A 1 15  ? -25.411  -41.087 36.307 1.00 200.16 ? 15   DG  I "O3'" 1 
ATOM   287   C "C2'" . DG  A 1 15  ? -25.252  -43.349 37.207 1.00 200.16 ? 15   DG  I "C2'" 1 
ATOM   288   C "C1'" . DG  A 1 15  ? -26.445  -43.990 36.505 1.00 200.16 ? 15   DG  I "C1'" 1 
ATOM   289   N N9    . DG  A 1 15  ? -26.581  -45.421 36.766 1.00 168.13 ? 15   DG  I N9    1 
ATOM   290   C C8    . DG  A 1 15  ? -25.587  -46.281 37.172 1.00 168.28 ? 15   DG  I C8    1 
ATOM   291   N N7    . DG  A 1 15  ? -25.988  -47.520 37.270 1.00 167.56 ? 15   DG  I N7    1 
ATOM   292   C C5    . DG  A 1 15  ? -27.332  -47.476 36.922 1.00 166.52 ? 15   DG  I C5    1 
ATOM   293   C C6    . DG  A 1 15  ? -28.290  -48.518 36.836 1.00 164.87 ? 15   DG  I C6    1 
ATOM   294   O O6    . DG  A 1 15  ? -28.136  -49.727 37.044 1.00 163.27 ? 15   DG  I O6    1 
ATOM   295   N N1    . DG  A 1 15  ? -29.537  -48.033 36.456 1.00 164.47 ? 15   DG  I N1    1 
ATOM   296   C C2    . DG  A 1 15  ? -29.825  -46.719 36.186 1.00 165.42 ? 15   DG  I C2    1 
ATOM   297   N N2    . DG  A 1 15  ? -31.091  -46.455 35.837 1.00 164.62 ? 15   DG  I N2    1 
ATOM   298   N N3    . DG  A 1 15  ? -28.938  -45.738 36.253 1.00 166.37 ? 15   DG  I N3    1 
ATOM   299   C C4    . DG  A 1 15  ? -27.719  -46.185 36.624 1.00 167.29 ? 15   DG  I C4    1 
ATOM   300   P P     . DC  A 1 16  ? -25.026  -40.075 37.493 1.00 130.41 ? 16   DC  I P     1 
ATOM   301   O OP1   . DC  A 1 16  ? -24.945  -38.714 36.906 1.00 170.68 ? 16   DC  I OP1   1 
ATOM   302   O OP2   . DC  A 1 16  ? -23.867  -40.622 38.240 1.00 170.20 ? 16   DC  I OP2   1 
ATOM   303   O "O5'" . DC  A 1 16  ? -26.306  -40.115 38.433 1.00 128.77 ? 16   DC  I "O5'" 1 
ATOM   304   C "C5'" . DC  A 1 16  ? -27.551  -39.593 37.978 1.00 125.43 ? 16   DC  I "C5'" 1 
ATOM   305   C "C4'" . DC  A 1 16  ? -28.638  -39.900 38.980 1.00 122.77 ? 16   DC  I "C4'" 1 
ATOM   306   O "O4'" . DC  A 1 16  ? -28.981  -41.307 38.928 1.00 122.83 ? 16   DC  I "O4'" 1 
ATOM   307   C "C3'" . DC  A 1 16  ? -28.252  -39.610 40.433 1.00 120.91 ? 16   DC  I "C3'" 1 
ATOM   308   O "O3'" . DC  A 1 16  ? -29.377  -39.079 41.131 1.00 118.33 ? 16   DC  I "O3'" 1 
ATOM   309   C "C2'" . DC  A 1 16  ? -27.928  -40.984 40.986 1.00 121.08 ? 16   DC  I "C2'" 1 
ATOM   310   C "C1'" . DC  A 1 16  ? -28.927  -41.847 40.238 1.00 121.90 ? 16   DC  I "C1'" 1 
ATOM   311   N N1    . DC  A 1 16  ? -28.591  -43.278 40.136 1.00 161.69 ? 16   DC  I N1    1 
ATOM   312   C C2    . DC  A 1 16  ? -29.534  -44.147 39.580 1.00 161.74 ? 16   DC  I C2    1 
ATOM   313   O O2    . DC  A 1 16  ? -30.604  -43.680 39.160 1.00 160.97 ? 16   DC  I O2    1 
ATOM   314   N N3    . DC  A 1 16  ? -29.256  -45.471 39.512 1.00 161.89 ? 16   DC  I N3    1 
ATOM   315   C C4    . DC  A 1 16  ? -28.091  -45.931 39.972 1.00 161.34 ? 16   DC  I C4    1 
ATOM   316   N N4    . DC  A 1 16  ? -27.866  -47.244 39.902 1.00 160.20 ? 16   DC  I N4    1 
ATOM   317   C C5    . DC  A 1 16  ? -27.105  -45.066 40.527 1.00 161.57 ? 16   DC  I C5    1 
ATOM   318   C C6    . DC  A 1 16  ? -27.393  -43.759 40.588 1.00 161.63 ? 16   DC  I C6    1 
ATOM   319   P P     . DA  A 1 17  ? -29.373  -37.544 41.598 1.00 124.34 ? 17   DA  I P     1 
ATOM   320   O OP1   . DA  A 1 17  ? -28.776  -36.747 40.497 1.00 143.20 ? 17   DA  I OP1   1 
ATOM   321   O OP2   . DA  A 1 17  ? -28.795  -37.469 42.965 1.00 142.41 ? 17   DA  I OP2   1 
ATOM   322   O "O5'" . DA  A 1 17  ? -30.918  -37.174 41.674 1.00 123.38 ? 17   DA  I "O5'" 1 
ATOM   323   C "C5'" . DA  A 1 17  ? -31.749  -37.262 40.517 1.00 121.30 ? 17   DA  I "C5'" 1 
ATOM   324   C "C4'" . DA  A 1 17  ? -32.988  -38.068 40.832 1.00 119.41 ? 17   DA  I "C4'" 1 
ATOM   325   O "O4'" . DA  A 1 17  ? -32.630  -39.459 41.020 1.00 118.52 ? 17   DA  I "O4'" 1 
ATOM   326   C "C3'" . DA  A 1 17  ? -33.690  -37.640 42.118 1.00 118.24 ? 17   DA  I "C3'" 1 
ATOM   327   O "O3'" . DA  A 1 17  ? -35.104  -37.756 41.967 1.00 116.70 ? 17   DA  I "O3'" 1 
ATOM   328   C "C2'" . DA  A 1 17  ? -33.171  -38.624 43.149 1.00 117.62 ? 17   DA  I "C2'" 1 
ATOM   329   C "C1'" . DA  A 1 17  ? -32.975  -39.886 42.329 1.00 117.83 ? 17   DA  I "C1'" 1 
ATOM   330   N N9    . DA  A 1 17  ? -31.902  -40.755 42.814 1.00 136.83 ? 17   DA  I N9    1 
ATOM   331   C C8    . DA  A 1 17  ? -30.819  -40.407 43.583 1.00 137.55 ? 17   DA  I C8    1 
ATOM   332   N N7    . DA  A 1 17  ? -30.038  -41.416 43.882 1.00 137.83 ? 17   DA  I N7    1 
ATOM   333   C C5    . DA  A 1 17  ? -30.643  -42.502 43.267 1.00 137.12 ? 17   DA  I C5    1 
ATOM   334   C C6    . DA  A 1 17  ? -30.310  -43.869 43.215 1.00 136.47 ? 17   DA  I C6    1 
ATOM   335   N N6    . DA  A 1 17  ? -29.251  -44.399 43.828 1.00 136.42 ? 17   DA  I N6    1 
ATOM   336   N N1    . DA  A 1 17  ? -31.120  -44.686 42.509 1.00 136.53 ? 17   DA  I N1    1 
ATOM   337   C C2    . DA  A 1 17  ? -32.193  -44.159 41.908 1.00 137.28 ? 17   DA  I C2    1 
ATOM   338   N N3    . DA  A 1 17  ? -32.616  -42.896 41.891 1.00 137.55 ? 17   DA  I N3    1 
ATOM   339   C C4    . DA  A 1 17  ? -31.787  -42.108 42.597 1.00 137.34 ? 17   DA  I C4    1 
ATOM   340   P P     . DG  A 1 18  ? -36.066  -37.347 43.184 1.00 100.46 ? 18   DG  I P     1 
ATOM   341   O OP1   . DG  A 1 18  ? -37.213  -36.575 42.633 1.00 131.60 ? 18   DG  I OP1   1 
ATOM   342   O OP2   . DG  A 1 18  ? -35.228  -36.754 44.261 1.00 133.73 ? 18   DG  I OP2   1 
ATOM   343   O "O5'" . DG  A 1 18  ? -36.611  -38.753 43.688 1.00 99.80  ? 18   DG  I "O5'" 1 
ATOM   344   C "C5'" . DG  A 1 18  ? -37.101  -39.702 42.754 1.00 99.31  ? 18   DG  I "C5'" 1 
ATOM   345   C "C4'" . DG  A 1 18  ? -37.328  -41.026 43.437 1.00 99.23  ? 18   DG  I "C4'" 1 
ATOM   346   O "O4'" . DG  A 1 18  ? -36.055  -41.614 43.789 1.00 100.17 ? 18   DG  I "O4'" 1 
ATOM   347   C "C3'" . DG  A 1 18  ? -38.121  -40.913 44.735 1.00 98.10  ? 18   DG  I "C3'" 1 
ATOM   348   O "O3'" . DG  A 1 18  ? -38.989  -42.040 44.847 1.00 95.30  ? 18   DG  I "O3'" 1 
ATOM   349   C "C2'" . DG  A 1 18  ? -37.044  -40.930 45.801 1.00 99.47  ? 18   DG  I "C2'" 1 
ATOM   350   C "C1'" . DG  A 1 18  ? -35.989  -41.830 45.188 1.00 102.10 ? 18   DG  I "C1'" 1 
ATOM   351   N N9    . DG  A 1 18  ? -34.630  -41.525 45.625 1.00 136.96 ? 18   DG  I N9    1 
ATOM   352   C C8    . DG  A 1 18  ? -34.115  -40.286 45.931 1.00 138.45 ? 18   DG  I C8    1 
ATOM   353   N N7    . DG  A 1 18  ? -32.867  -40.329 46.311 1.00 139.96 ? 18   DG  I N7    1 
ATOM   354   C C5    . DG  A 1 18  ? -32.536  -41.676 46.249 1.00 140.81 ? 18   DG  I C5    1 
ATOM   355   C C6    . DG  A 1 18  ? -31.319  -42.333 46.546 1.00 142.07 ? 18   DG  I C6    1 
ATOM   356   O O6    . DG  A 1 18  ? -30.255  -41.839 46.936 1.00 144.08 ? 18   DG  I O6    1 
ATOM   357   N N1    . DG  A 1 18  ? -31.418  -43.708 46.347 1.00 140.96 ? 18   DG  I N1    1 
ATOM   358   C C2    . DG  A 1 18  ? -32.545  -44.364 45.917 1.00 139.29 ? 18   DG  I C2    1 
ATOM   359   N N2    . DG  A 1 18  ? -32.441  -45.690 45.791 1.00 139.59 ? 18   DG  I N2    1 
ATOM   360   N N3    . DG  A 1 18  ? -33.686  -43.763 45.636 1.00 138.73 ? 18   DG  I N3    1 
ATOM   361   C C4    . DG  A 1 18  ? -33.613  -42.427 45.823 1.00 138.89 ? 18   DG  I C4    1 
ATOM   362   P P     . DA  A 1 19  ? -39.902  -42.221 46.147 1.00 84.96  ? 19   DA  I P     1 
ATOM   363   O OP1   . DA  A 1 19  ? -41.319  -42.064 45.730 1.00 135.66 ? 19   DA  I OP1   1 
ATOM   364   O OP2   . DA  A 1 19  ? -39.369  -41.398 47.255 1.00 136.67 ? 19   DA  I OP2   1 
ATOM   365   O "O5'" . DA  A 1 19  ? -39.654  -43.744 46.505 1.00 84.67  ? 19   DA  I "O5'" 1 
ATOM   366   C "C5'" . DA  A 1 19  ? -39.513  -44.708 45.468 1.00 85.19  ? 19   DA  I "C5'" 1 
ATOM   367   C "C4'" . DA  A 1 19  ? -38.909  -45.978 46.019 1.00 86.80  ? 19   DA  I "C4'" 1 
ATOM   368   O "O4'" . DA  A 1 19  ? -37.501  -45.760 46.280 1.00 87.86  ? 19   DA  I "O4'" 1 
ATOM   369   C "C3'" . DA  A 1 19  ? -39.530  -46.448 47.339 1.00 87.08  ? 19   DA  I "C3'" 1 
ATOM   370   O "O3'" . DA  A 1 19  ? -39.697  -47.875 47.353 1.00 86.80  ? 19   DA  I "O3'" 1 
ATOM   371   C "C2'" . DA  A 1 19  ? -38.524  -46.002 48.384 1.00 87.54  ? 19   DA  I "C2'" 1 
ATOM   372   C "C1'" . DA  A 1 19  ? -37.204  -46.058 47.635 1.00 88.80  ? 19   DA  I "C1'" 1 
ATOM   373   N N9    . DA  A 1 19  ? -36.245  -45.066 48.104 1.00 140.91 ? 19   DA  I N9    1 
ATOM   374   C C8    . DA  A 1 19  ? -36.473  -43.739 48.357 1.00 140.87 ? 19   DA  I C8    1 
ATOM   375   N N7    . DA  A 1 19  ? -35.417  -43.095 48.782 1.00 140.41 ? 19   DA  I N7    1 
ATOM   376   C C5    . DA  A 1 19  ? -34.424  -44.064 48.807 1.00 140.41 ? 19   DA  I C5    1 
ATOM   377   C C6    . DA  A 1 19  ? -33.068  -44.020 49.170 1.00 140.26 ? 19   DA  I C6    1 
ATOM   378   N N6    . DA  A 1 19  ? -32.455  -42.913 49.595 1.00 139.58 ? 19   DA  I N6    1 
ATOM   379   N N1    . DA  A 1 19  ? -32.355  -45.166 49.080 1.00 140.23 ? 19   DA  I N1    1 
ATOM   380   C C2    . DA  A 1 19  ? -32.975  -46.274 48.656 1.00 140.39 ? 19   DA  I C2    1 
ATOM   381   N N3    . DA  A 1 19  ? -34.243  -46.440 48.289 1.00 141.20 ? 19   DA  I N3    1 
ATOM   382   C C4    . DA  A 1 19  ? -34.921  -45.283 48.389 1.00 140.93 ? 19   DA  I C4    1 
ATOM   383   P P     . DT  A 1 20  ? -40.389  -48.591 48.620 1.00 128.19 ? 20   DT  I P     1 
ATOM   384   O OP1   . DT  A 1 20  ? -41.346  -49.601 48.095 1.00 135.77 ? 20   DT  I OP1   1 
ATOM   385   O OP2   . DT  A 1 20  ? -40.870  -47.556 49.571 1.00 135.03 ? 20   DT  I OP2   1 
ATOM   386   O "O5'" . DT  A 1 20  ? -39.162  -49.349 49.290 1.00 129.25 ? 20   DT  I "O5'" 1 
ATOM   387   C "C5'" . DT  A 1 20  ? -38.253  -50.102 48.490 1.00 132.04 ? 20   DT  I "C5'" 1 
ATOM   388   C "C4'" . DT  A 1 20  ? -37.115  -50.614 49.339 1.00 134.42 ? 20   DT  I "C4'" 1 
ATOM   389   O "O4'" . DT  A 1 20  ? -36.160  -49.550 49.583 1.00 133.95 ? 20   DT  I "O4'" 1 
ATOM   390   C "C3'" . DT  A 1 20  ? -37.559  -51.124 50.714 1.00 135.85 ? 20   DT  I "C3'" 1 
ATOM   391   O "O3'" . DT  A 1 20  ? -36.904  -52.351 51.055 1.00 139.18 ? 20   DT  I "O3'" 1 
ATOM   392   C "C2'" . DT  A 1 20  ? -37.131  -50.016 51.658 1.00 134.56 ? 20   DT  I "C2'" 1 
ATOM   393   C "C1'" . DT  A 1 20  ? -35.889  -49.475 50.972 1.00 135.39 ? 20   DT  I "C1'" 1 
ATOM   394   N N1    . DT  A 1 20  ? -35.568  -48.073 51.313 1.00 143.08 ? 20   DT  I N1    1 
ATOM   395   C C2    . DT  A 1 20  ? -34.275  -47.780 51.686 1.00 143.19 ? 20   DT  I C2    1 
ATOM   396   O O2    . DT  A 1 20  ? -33.381  -48.612 51.702 1.00 142.66 ? 20   DT  I O2    1 
ATOM   397   N N3    . DT  A 1 20  ? -34.064  -46.469 52.037 1.00 142.70 ? 20   DT  I N3    1 
ATOM   398   C C4    . DT  A 1 20  ? -34.991  -45.444 52.040 1.00 143.48 ? 20   DT  I C4    1 
ATOM   399   O O4    . DT  A 1 20  ? -34.654  -44.316 52.393 1.00 144.99 ? 20   DT  I O4    1 
ATOM   400   C C5    . DT  A 1 20  ? -36.323  -45.816 51.612 1.00 143.59 ? 20   DT  I C5    1 
ATOM   401   C C7    . DT  A 1 20  ? -37.391  -44.770 51.561 1.00 143.86 ? 20   DT  I C7    1 
ATOM   402   C C6    . DT  A 1 20  ? -36.541  -47.095 51.276 1.00 143.34 ? 20   DT  I C6    1 
ATOM   403   P P     . DT  A 1 21  ? -37.590  -53.347 52.114 1.00 158.23 ? 21   DT  I P     1 
ATOM   404   O OP1   . DT  A 1 21  ? -36.874  -54.644 52.036 1.00 169.57 ? 21   DT  I OP1   1 
ATOM   405   O OP2   . DT  A 1 21  ? -39.063  -53.310 51.923 1.00 171.03 ? 21   DT  I OP2   1 
ATOM   406   O "O5'" . DT  A 1 21  ? -37.255  -52.679 53.517 1.00 160.46 ? 21   DT  I "O5'" 1 
ATOM   407   C "C5'" . DT  A 1 21  ? -36.610  -53.421 54.545 1.00 163.58 ? 21   DT  I "C5'" 1 
ATOM   408   C "C4'" . DT  A 1 21  ? -35.111  -53.279 54.425 1.00 164.50 ? 21   DT  I "C4'" 1 
ATOM   409   O "O4'" . DT  A 1 21  ? -34.797  -51.931 54.001 1.00 164.16 ? 21   DT  I "O4'" 1 
ATOM   410   C "C3'" . DT  A 1 21  ? -34.371  -53.493 55.745 1.00 165.47 ? 21   DT  I "C3'" 1 
ATOM   411   O "O3'" . DT  A 1 21  ? -33.074  -54.078 55.520 1.00 166.31 ? 21   DT  I "O3'" 1 
ATOM   412   C "C2'" . DT  A 1 21  ? -34.260  -52.079 56.286 1.00 165.80 ? 21   DT  I "C2'" 1 
ATOM   413   C "C1'" . DT  A 1 21  ? -34.066  -51.260 55.018 1.00 165.49 ? 21   DT  I "C1'" 1 
ATOM   414   N N1    . DT  A 1 21  ? -34.575  -49.875 55.101 1.00 178.13 ? 21   DT  I N1    1 
ATOM   415   C C2    . DT  A 1 21  ? -33.662  -48.848 55.220 1.00 179.41 ? 21   DT  I C2    1 
ATOM   416   O O2    . DT  A 1 21  ? -32.455  -49.030 55.284 1.00 180.69 ? 21   DT  I O2    1 
ATOM   417   N N3    . DT  A 1 21  ? -34.219  -47.591 55.268 1.00 179.02 ? 21   DT  I N3    1 
ATOM   418   C C4    . DT  A 1 21  ? -35.563  -47.269 55.215 1.00 178.32 ? 21   DT  I C4    1 
ATOM   419   O O4    . DT  A 1 21  ? -35.914  -46.093 55.260 1.00 178.17 ? 21   DT  I O4    1 
ATOM   420   C C5    . DT  A 1 21  ? -36.461  -48.395 55.105 1.00 177.85 ? 21   DT  I C5    1 
ATOM   421   C C7    . DT  A 1 21  ? -37.934  -48.144 55.054 1.00 176.64 ? 21   DT  I C7    1 
ATOM   422   C C6    . DT  A 1 21  ? -35.930  -49.624 55.051 1.00 177.97 ? 21   DT  I C6    1 
ATOM   423   P P     . DC  A 1 22  ? -32.365  -54.937 56.690 1.00 146.61 ? 22   DC  I P     1 
ATOM   424   O OP1   . DC  A 1 22  ? -31.647  -56.071 56.045 1.00 148.95 ? 22   DC  I OP1   1 
ATOM   425   O OP2   . DC  A 1 22  ? -33.389  -55.216 57.733 1.00 148.02 ? 22   DC  I OP2   1 
ATOM   426   O "O5'" . DC  A 1 22  ? -31.271  -53.944 57.300 1.00 147.65 ? 22   DC  I "O5'" 1 
ATOM   427   C "C5'" . DC  A 1 22  ? -31.532  -52.542 57.388 1.00 151.86 ? 22   DC  I "C5'" 1 
ATOM   428   C "C4'" . DC  A 1 22  ? -30.566  -51.866 58.334 1.00 155.75 ? 22   DC  I "C4'" 1 
ATOM   429   O "O4'" . DC  A 1 22  ? -30.975  -50.481 58.457 1.00 156.35 ? 22   DC  I "O4'" 1 
ATOM   430   C "C3'" . DC  A 1 22  ? -30.583  -52.424 59.754 1.00 158.32 ? 22   DC  I "C3'" 1 
ATOM   431   O "O3'" . DC  A 1 22  ? -29.296  -52.277 60.357 1.00 161.31 ? 22   DC  I "O3'" 1 
ATOM   432   C "C2'" . DC  A 1 22  ? -31.605  -51.556 60.461 1.00 158.55 ? 22   DC  I "C2'" 1 
ATOM   433   C "C1'" . DC  A 1 22  ? -31.435  -50.210 59.778 1.00 158.67 ? 22   DC  I "C1'" 1 
ATOM   434   N N1    . DC  A 1 22  ? -32.698  -49.459 59.675 1.00 162.80 ? 22   DC  I N1    1 
ATOM   435   C C2    . DC  A 1 22  ? -32.824  -48.248 60.361 1.00 163.74 ? 22   DC  I C2    1 
ATOM   436   O O2    . DC  A 1 22  ? -31.862  -47.831 61.027 1.00 163.97 ? 22   DC  I O2    1 
ATOM   437   N N3    . DC  A 1 22  ? -33.989  -47.562 60.283 1.00 164.58 ? 22   DC  I N3    1 
ATOM   438   C C4    . DC  A 1 22  ? -35.000  -48.043 59.554 1.00 164.39 ? 22   DC  I C4    1 
ATOM   439   N N4    . DC  A 1 22  ? -36.133  -47.336 59.510 1.00 164.93 ? 22   DC  I N4    1 
ATOM   440   C C5    . DC  A 1 22  ? -34.896  -49.271 58.840 1.00 164.24 ? 22   DC  I C5    1 
ATOM   441   C C6    . DC  A 1 22  ? -33.738  -49.940 58.927 1.00 163.60 ? 22   DC  I C6    1 
ATOM   442   P P     . DT  A 1 23  ? -29.091  -52.674 61.899 1.00 166.81 ? 23   DT  I P     1 
ATOM   443   O OP1   . DT  A 1 23  ? -27.638  -52.902 62.099 1.00 145.93 ? 23   DT  I OP1   1 
ATOM   444   O OP2   . DT  A 1 23  ? -30.058  -53.750 62.237 1.00 145.17 ? 23   DT  I OP2   1 
ATOM   445   O "O5'" . DT  A 1 23  ? -29.513  -51.359 62.692 1.00 167.13 ? 23   DT  I "O5'" 1 
ATOM   446   C "C5'" . DT  A 1 23  ? -29.806  -51.407 64.087 1.00 169.80 ? 23   DT  I "C5'" 1 
ATOM   447   C "C4'" . DT  A 1 23  ? -29.873  -50.009 64.658 1.00 172.54 ? 23   DT  I "C4'" 1 
ATOM   448   O "O4'" . DT  A 1 23  ? -30.839  -49.227 63.916 1.00 173.03 ? 23   DT  I "O4'" 1 
ATOM   449   C "C3'" . DT  A 1 23  ? -30.316  -49.947 66.121 1.00 174.72 ? 23   DT  I "C3'" 1 
ATOM   450   O "O3'" . DT  A 1 23  ? -29.632  -48.889 66.801 1.00 177.07 ? 23   DT  I "O3'" 1 
ATOM   451   C "C2'" . DT  A 1 23  ? -31.796  -49.630 66.021 1.00 174.75 ? 23   DT  I "C2'" 1 
ATOM   452   C "C1'" . DT  A 1 23  ? -31.858  -48.751 64.784 1.00 174.44 ? 23   DT  I "C1'" 1 
ATOM   453   N N1    . DT  A 1 23  ? -33.136  -48.834 64.058 1.00 154.30 ? 23   DT  I N1    1 
ATOM   454   C C2    . DT  A 1 23  ? -33.832  -47.670 63.825 1.00 154.48 ? 23   DT  I C2    1 
ATOM   455   O O2    . DT  A 1 23  ? -33.437  -46.571 64.186 1.00 154.63 ? 23   DT  I O2    1 
ATOM   456   N N3    . DT  A 1 23  ? -35.015  -47.841 63.145 1.00 154.52 ? 23   DT  I N3    1 
ATOM   457   C C4    . DT  A 1 23  ? -35.553  -49.031 62.687 1.00 154.38 ? 23   DT  I C4    1 
ATOM   458   O O4    . DT  A 1 23  ? -36.628  -49.028 62.092 1.00 154.59 ? 23   DT  I O4    1 
ATOM   459   C C5    . DT  A 1 23  ? -34.763  -50.210 62.965 1.00 153.91 ? 23   DT  I C5    1 
ATOM   460   C C7    . DT  A 1 23  ? -35.257  -51.544 62.502 1.00 152.97 ? 23   DT  I C7    1 
ATOM   461   C C6    . DT  A 1 23  ? -33.614  -50.054 63.630 1.00 154.23 ? 23   DT  I C6    1 
ATOM   462   P P     . DA  A 1 24  ? -28.930  -49.176 68.217 1.00 200.16 ? 24   DA  I P     1 
ATOM   463   O OP1   . DA  A 1 24  ? -27.544  -49.633 67.928 1.00 172.98 ? 24   DA  I OP1   1 
ATOM   464   O OP2   . DA  A 1 24  ? -29.836  -50.036 69.020 1.00 172.47 ? 24   DA  I OP2   1 
ATOM   465   O "O5'" . DA  A 1 24  ? -28.858  -47.740 68.903 1.00 200.16 ? 24   DA  I "O5'" 1 
ATOM   466   C "C5'" . DA  A 1 24  ? -29.664  -47.421 70.040 1.00 200.16 ? 24   DA  I "C5'" 1 
ATOM   467   C "C4'" . DA  A 1 24  ? -30.538  -46.224 69.740 1.00 200.16 ? 24   DA  I "C4'" 1 
ATOM   468   O "O4'" . DA  A 1 24  ? -31.458  -46.558 68.670 1.00 200.16 ? 24   DA  I "O4'" 1 
ATOM   469   C "C3'" . DA  A 1 24  ? -31.411  -45.751 70.904 1.00 200.16 ? 24   DA  I "C3'" 1 
ATOM   470   O "O3'" . DA  A 1 24  ? -31.569  -44.330 70.831 1.00 200.16 ? 24   DA  I "O3'" 1 
ATOM   471   C "C2'" . DA  A 1 24  ? -32.749  -46.403 70.614 1.00 200.16 ? 24   DA  I "C2'" 1 
ATOM   472   C "C1'" . DA  A 1 24  ? -32.790  -46.311 69.102 1.00 200.16 ? 24   DA  I "C1'" 1 
ATOM   473   N N9    . DA  A 1 24  ? -33.675  -47.267 68.435 1.00 181.48 ? 24   DA  I N9    1 
ATOM   474   C C8    . DA  A 1 24  ? -33.763  -48.628 68.604 1.00 181.69 ? 24   DA  I C8    1 
ATOM   475   N N7    . DA  A 1 24  ? -34.666  -49.198 67.841 1.00 180.91 ? 24   DA  I N7    1 
ATOM   476   C C5    . DA  A 1 24  ? -35.209  -48.141 67.124 1.00 181.02 ? 24   DA  I C5    1 
ATOM   477   C C6    . DA  A 1 24  ? -36.215  -48.079 66.144 1.00 180.71 ? 24   DA  I C6    1 
ATOM   478   N N6    . DA  A 1 24  ? -36.875  -49.147 65.692 1.00 180.32 ? 24   DA  I N6    1 
ATOM   479   N N1    . DA  A 1 24  ? -36.521  -46.865 65.634 1.00 180.84 ? 24   DA  I N1    1 
ATOM   480   C C2    . DA  A 1 24  ? -35.853  -45.794 66.082 1.00 181.59 ? 24   DA  I C2    1 
ATOM   481   N N3    . DA  A 1 24  ? -34.886  -45.725 66.993 1.00 181.68 ? 24   DA  I N3    1 
ATOM   482   C C4    . DA  A 1 24  ? -34.609  -46.947 67.481 1.00 181.39 ? 24   DA  I C4    1 
ATOM   483   P P     . DC  A 1 25  ? -30.921  -43.395 71.961 1.00 167.42 ? 25   DC  I P     1 
ATOM   484   O OP1   . DC  A 1 25  ? -29.538  -43.069 71.521 1.00 123.56 ? 25   DC  I OP1   1 
ATOM   485   O OP2   . DC  A 1 25  ? -31.143  -44.045 73.277 1.00 123.53 ? 25   DC  I OP2   1 
ATOM   486   O "O5'" . DC  A 1 25  ? -31.798  -42.066 71.912 1.00 166.67 ? 25   DC  I "O5'" 1 
ATOM   487   C "C5'" . DC  A 1 25  ? -32.814  -41.830 72.882 1.00 166.05 ? 25   DC  I "C5'" 1 
ATOM   488   C "C4'" . DC  A 1 25  ? -33.958  -41.062 72.265 1.00 165.58 ? 25   DC  I "C4'" 1 
ATOM   489   O "O4'" . DC  A 1 25  ? -34.517  -41.854 71.188 1.00 165.98 ? 25   DC  I "O4'" 1 
ATOM   490   C "C3'" . DC  A 1 25  ? -35.112  -40.768 73.223 1.00 164.73 ? 25   DC  I "C3'" 1 
ATOM   491   O "O3'" . DC  A 1 25  ? -35.623  -39.453 72.994 1.00 163.82 ? 25   DC  I "O3'" 1 
ATOM   492   C "C2'" . DC  A 1 25  ? -36.150  -41.821 72.878 1.00 164.85 ? 25   DC  I "C2'" 1 
ATOM   493   C "C1'" . DC  A 1 25  ? -35.906  -42.078 71.399 1.00 165.71 ? 25   DC  I "C1'" 1 
ATOM   494   N N1    . DC  A 1 25  ? -36.211  -43.460 70.975 1.00 121.30 ? 25   DC  I N1    1 
ATOM   495   C C2    . DC  A 1 25  ? -35.931  -43.850 69.657 1.00 121.50 ? 25   DC  I C2    1 
ATOM   496   O O2    . DC  A 1 25  ? -35.439  -43.021 68.871 1.00 122.03 ? 25   DC  I O2    1 
ATOM   497   N N3    . DC  A 1 25  ? -36.200  -45.119 69.276 1.00 120.68 ? 25   DC  I N3    1 
ATOM   498   C C4    . DC  A 1 25  ? -36.722  -45.982 70.149 1.00 119.69 ? 25   DC  I C4    1 
ATOM   499   N N4    . DC  A 1 25  ? -36.953  -47.222 69.737 1.00 119.05 ? 25   DC  I N4    1 
ATOM   500   C C5    . DC  A 1 25  ? -37.024  -45.612 71.485 1.00 119.79 ? 25   DC  I C5    1 
ATOM   501   C C6    . DC  A 1 25  ? -36.757  -44.354 71.854 1.00 120.69 ? 25   DC  I C6    1 
ATOM   502   P P     . DC  A 1 26  ? -36.670  -38.816 74.033 1.00 163.05 ? 26   DC  I P     1 
ATOM   503   O OP1   . DC  A 1 26  ? -36.679  -37.343 73.823 1.00 129.84 ? 26   DC  I OP1   1 
ATOM   504   O OP2   . DC  A 1 26  ? -36.397  -39.364 75.388 1.00 130.06 ? 26   DC  I OP2   1 
ATOM   505   O "O5'" . DC  A 1 26  ? -38.071  -39.388 73.542 1.00 160.71 ? 26   DC  I "O5'" 1 
ATOM   506   C "C5'" . DC  A 1 26  ? -38.667  -38.908 72.341 1.00 155.81 ? 26   DC  I "C5'" 1 
ATOM   507   C "C4'" . DC  A 1 26  ? -40.122  -39.303 72.292 1.00 151.85 ? 26   DC  I "C4'" 1 
ATOM   508   O "O4'" . DC  A 1 26  ? -40.222  -40.723 72.038 1.00 150.42 ? 26   DC  I "O4'" 1 
ATOM   509   C "C3'" . DC  A 1 26  ? -40.884  -39.044 73.592 1.00 149.52 ? 26   DC  I "C3'" 1 
ATOM   510   O "O3'" . DC  A 1 26  ? -42.197  -38.556 73.306 1.00 147.64 ? 26   DC  I "O3'" 1 
ATOM   511   C "C2'" . DC  A 1 26  ? -40.940  -40.413 74.247 1.00 149.38 ? 26   DC  I "C2'" 1 
ATOM   512   C "C1'" . DC  A 1 26  ? -41.004  -41.341 73.046 1.00 148.97 ? 26   DC  I "C1'" 1 
ATOM   513   N N1    . DC  A 1 26  ? -40.477  -42.702 73.253 1.00 114.91 ? 26   DC  I N1    1 
ATOM   514   C C2    . DC  A 1 26  ? -40.188  -43.484 72.130 1.00 115.04 ? 26   DC  I C2    1 
ATOM   515   O O2    . DC  A 1 26  ? -40.334  -42.992 71.004 1.00 115.53 ? 26   DC  I O2    1 
ATOM   516   N N3    . DC  A 1 26  ? -39.753  -44.752 72.297 1.00 114.16 ? 26   DC  I N3    1 
ATOM   517   C C4    . DC  A 1 26  ? -39.590  -45.242 73.525 1.00 113.43 ? 26   DC  I C4    1 
ATOM   518   N N4    . DC  A 1 26  ? -39.172  -46.507 73.641 1.00 112.88 ? 26   DC  I N4    1 
ATOM   519   C C5    . DC  A 1 26  ? -39.850  -44.460 74.688 1.00 113.65 ? 26   DC  I C5    1 
ATOM   520   C C6    . DC  A 1 26  ? -40.287  -43.206 74.508 1.00 114.06 ? 26   DC  I C6    1 
ATOM   521   P P     . DA  A 1 27  ? -42.639  -37.113 73.855 1.00 121.47 ? 27   DA  I P     1 
ATOM   522   O OP1   . DA  A 1 27  ? -41.515  -36.178 73.594 1.00 116.68 ? 27   DA  I OP1   1 
ATOM   523   O OP2   . DA  A 1 27  ? -43.159  -37.285 75.233 1.00 118.38 ? 27   DA  I OP2   1 
ATOM   524   O "O5'" . DA  A 1 27  ? -43.869  -36.685 72.944 1.00 121.27 ? 27   DA  I "O5'" 1 
ATOM   525   C "C5'" . DA  A 1 27  ? -45.189  -37.121 73.255 1.00 120.16 ? 27   DA  I "C5'" 1 
ATOM   526   C "C4'" . DA  A 1 27  ? -45.641  -38.160 72.254 1.00 119.49 ? 27   DA  I "C4'" 1 
ATOM   527   O "O4'" . DA  A 1 27  ? -44.810  -39.344 72.357 1.00 118.76 ? 27   DA  I "O4'" 1 
ATOM   528   C "C3'" . DA  A 1 27  ? -47.075  -38.641 72.448 1.00 118.50 ? 27   DA  I "C3'" 1 
ATOM   529   O "O3'" . DA  A 1 27  ? -47.678  -38.851 71.175 1.00 117.37 ? 27   DA  I "O3'" 1 
ATOM   530   C "C2'" . DA  A 1 27  ? -46.919  -39.954 73.189 1.00 118.73 ? 27   DA  I "C2'" 1 
ATOM   531   C "C1'" . DA  A 1 27  ? -45.609  -40.486 72.641 1.00 119.17 ? 27   DA  I "C1'" 1 
ATOM   532   N N9    . DA  A 1 27  ? -44.877  -41.320 73.593 1.00 115.33 ? 27   DA  I N9    1 
ATOM   533   C C8    . DA  A 1 27  ? -44.493  -40.997 74.870 1.00 116.04 ? 27   DA  I C8    1 
ATOM   534   N N7    . DA  A 1 27  ? -43.871  -41.966 75.496 1.00 116.73 ? 27   DA  I N7    1 
ATOM   535   C C5    . DA  A 1 27  ? -43.837  -42.996 74.567 1.00 116.29 ? 27   DA  I C5    1 
ATOM   536   C C6    . DA  A 1 27  ? -43.320  -44.303 74.619 1.00 115.77 ? 27   DA  I C6    1 
ATOM   537   N N6    . DA  A 1 27  ? -42.723  -44.821 75.690 1.00 115.25 ? 27   DA  I N6    1 
ATOM   538   N N1    . DA  A 1 27  ? -43.444  -45.073 73.518 1.00 115.55 ? 27   DA  I N1    1 
ATOM   539   C C2    . DA  A 1 27  ? -44.054  -44.558 72.447 1.00 116.59 ? 27   DA  I C2    1 
ATOM   540   N N3    . DA  A 1 27  ? -44.588  -43.348 72.277 1.00 117.00 ? 27   DA  I N3    1 
ATOM   541   C C4    . DA  A 1 27  ? -44.445  -42.607 73.387 1.00 116.27 ? 27   DA  I C4    1 
ATOM   542   P P     . DA  A 1 28  ? -49.265  -39.029 71.078 1.00 98.07  ? 28   DA  I P     1 
ATOM   543   O OP1   . DA  A 1 28  ? -49.654  -38.682 69.687 1.00 118.67 ? 28   DA  I OP1   1 
ATOM   544   O OP2   . DA  A 1 28  ? -49.883  -38.306 72.219 1.00 118.73 ? 28   DA  I OP2   1 
ATOM   545   O "O5'" . DA  A 1 28  ? -49.477  -40.587 71.317 1.00 95.24  ? 28   DA  I "O5'" 1 
ATOM   546   C "C5'" . DA  A 1 28  ? -48.926  -41.543 70.416 1.00 90.75  ? 28   DA  I "C5'" 1 
ATOM   547   C "C4'" . DA  A 1 28  ? -49.205  -42.938 70.917 1.00 87.63  ? 28   DA  I "C4'" 1 
ATOM   548   O "O4'" . DA  A 1 28  ? -48.222  -43.379 71.887 1.00 87.39  ? 28   DA  I "O4'" 1 
ATOM   549   C "C3'" . DA  A 1 28  ? -50.557  -43.042 71.616 1.00 85.51  ? 28   DA  I "C3'" 1 
ATOM   550   O "O3'" . DA  A 1 28  ? -51.103  -44.316 71.345 1.00 80.70  ? 28   DA  I "O3'" 1 
ATOM   551   C "C2'" . DA  A 1 28  ? -50.182  -43.019 73.083 1.00 87.08  ? 28   DA  I "C2'" 1 
ATOM   552   C "C1'" . DA  A 1 28  ? -48.915  -43.843 73.035 1.00 88.58  ? 28   DA  I "C1'" 1 
ATOM   553   N N9    . DA  A 1 28  ? -48.050  -43.696 74.200 1.00 110.42 ? 28   DA  I N9    1 
ATOM   554   C C8    . DA  A 1 28  ? -47.818  -42.577 74.955 1.00 111.30 ? 28   DA  I C8    1 
ATOM   555   N N7    . DA  A 1 28  ? -47.008  -42.781 75.965 1.00 113.03 ? 28   DA  I N7    1 
ATOM   556   C C5    . DA  A 1 28  ? -46.680  -44.125 75.860 1.00 114.20 ? 28   DA  I C5    1 
ATOM   557   C C6    . DA  A 1 28  ? -45.853  -44.956 76.628 1.00 115.73 ? 28   DA  I C6    1 
ATOM   558   N N6    . DA  A 1 28  ? -45.174  -44.538 77.694 1.00 117.48 ? 28   DA  I N6    1 
ATOM   559   N N1    . DA  A 1 28  ? -45.743  -46.249 76.255 1.00 115.80 ? 28   DA  I N1    1 
ATOM   560   C C2    . DA  A 1 28  ? -46.419  -46.663 75.176 1.00 114.65 ? 28   DA  I C2    1 
ATOM   561   N N3    . DA  A 1 28  ? -47.224  -45.976 74.372 1.00 113.52 ? 28   DA  I N3    1 
ATOM   562   C C4    . DA  A 1 28  ? -47.312  -44.698 74.775 1.00 112.58 ? 28   DA  I C4    1 
ATOM   563   P P     . DA  A 1 29  ? -52.221  -44.472 70.220 1.00 93.83  ? 29   DA  I P     1 
ATOM   564   O OP1   . DA  A 1 29  ? -51.815  -43.678 69.030 1.00 106.93 ? 29   DA  I OP1   1 
ATOM   565   O OP2   . DA  A 1 29  ? -53.549  -44.230 70.856 1.00 105.20 ? 29   DA  I OP2   1 
ATOM   566   O "O5'" . DA  A 1 29  ? -52.093  -46.012 69.868 1.00 92.68  ? 29   DA  I "O5'" 1 
ATOM   567   C "C5'" . DA  A 1 29  ? -52.806  -46.948 70.635 1.00 93.48  ? 29   DA  I "C5'" 1 
ATOM   568   C "C4'" . DA  A 1 29  ? -51.916  -48.091 71.050 1.00 94.74  ? 29   DA  I "C4'" 1 
ATOM   569   O "O4'" . DA  A 1 29  ? -50.853  -47.627 71.916 1.00 94.75  ? 29   DA  I "O4'" 1 
ATOM   570   C "C3'" . DA  A 1 29  ? -52.746  -49.055 71.879 1.00 96.06  ? 29   DA  I "C3'" 1 
ATOM   571   O "O3'" . DA  A 1 29  ? -52.552  -50.385 71.500 1.00 96.44  ? 29   DA  I "O3'" 1 
ATOM   572   C "C2'" . DA  A 1 29  ? -52.309  -48.838 73.308 1.00 96.32  ? 29   DA  I "C2'" 1 
ATOM   573   C "C1'" . DA  A 1 29  ? -50.904  -48.297 73.173 1.00 96.10  ? 29   DA  I "C1'" 1 
ATOM   574   N N9    . DA  A 1 29  ? -50.644  -47.317 74.227 1.00 109.88 ? 29   DA  I N9    1 
ATOM   575   C C8    . DA  A 1 29  ? -51.149  -46.045 74.321 1.00 110.09 ? 29   DA  I C8    1 
ATOM   576   N N7    . DA  A 1 29  ? -50.782  -45.409 75.406 1.00 110.44 ? 29   DA  I N7    1 
ATOM   577   C C5    . DA  A 1 29  ? -49.971  -46.318 76.066 1.00 110.91 ? 29   DA  I C5    1 
ATOM   578   C C6    . DA  A 1 29  ? -49.271  -46.245 77.275 1.00 111.15 ? 29   DA  I C6    1 
ATOM   579   N N6    . DA  A 1 29  ? -49.279  -45.175 78.069 1.00 110.68 ? 29   DA  I N6    1 
ATOM   580   N N1    . DA  A 1 29  ? -48.554  -47.324 77.651 1.00 111.39 ? 29   DA  I N1    1 
ATOM   581   C C2    . DA  A 1 29  ? -48.554  -48.402 76.856 1.00 111.43 ? 29   DA  I C2    1 
ATOM   582   N N3    . DA  A 1 29  ? -49.172  -48.592 75.697 1.00 110.45 ? 29   DA  I N3    1 
ATOM   583   C C4    . DA  A 1 29  ? -49.871  -47.497 75.350 1.00 110.36 ? 29   DA  I C4    1 
ATOM   584   P P     . DA  A 1 30  ? -53.592  -51.460 72.014 1.00 96.28  ? 30   DA  I P     1 
ATOM   585   O OP1   . DA  A 1 30  ? -53.576  -52.604 71.062 1.00 107.95 ? 30   DA  I OP1   1 
ATOM   586   O OP2   . DA  A 1 30  ? -54.866  -50.756 72.310 1.00 106.73 ? 30   DA  I OP2   1 
ATOM   587   O "O5'" . DA  A 1 30  ? -52.949  -51.875 73.402 1.00 97.26  ? 30   DA  I "O5'" 1 
ATOM   588   C "C5'" . DA  A 1 30  ? -51.600  -52.321 73.473 1.00 98.99  ? 30   DA  I "C5'" 1 
ATOM   589   C "C4'" . DA  A 1 30  ? -51.283  -52.728 74.889 1.00 100.03 ? 30   DA  I "C4'" 1 
ATOM   590   O "O4'" . DA  A 1 30  ? -51.008  -51.551 75.688 1.00 99.31  ? 30   DA  I "O4'" 1 
ATOM   591   C "C3'" . DA  A 1 30  ? -52.464  -53.431 75.557 1.00 101.75 ? 30   DA  I "C3'" 1 
ATOM   592   O "O3'" . DA  A 1 30  ? -52.030  -54.527 76.352 1.00 106.28 ? 30   DA  I "O3'" 1 
ATOM   593   C "C2'" . DA  A 1 30  ? -53.054  -52.358 76.449 1.00 100.10 ? 30   DA  I "C2'" 1 
ATOM   594   C "C1'" . DA  A 1 30  ? -51.816  -51.586 76.847 1.00 98.69  ? 30   DA  I "C1'" 1 
ATOM   595   N N9    . DA  A 1 30  ? -52.075  -50.212 77.275 1.00 107.76 ? 30   DA  I N9    1 
ATOM   596   C C8    . DA  A 1 30  ? -53.032  -49.348 76.802 1.00 107.46 ? 30   DA  I C8    1 
ATOM   597   N N7    . DA  A 1 30  ? -53.048  -48.189 77.417 1.00 107.55 ? 30   DA  I N7    1 
ATOM   598   C C5    . DA  A 1 30  ? -52.024  -48.292 78.350 1.00 107.31 ? 30   DA  I C5    1 
ATOM   599   C C6    . DA  A 1 30  ? -51.531  -47.398 79.314 1.00 106.72 ? 30   DA  I C6    1 
ATOM   600   N N6    . DA  A 1 30  ? -52.018  -46.172 79.501 1.00 105.57 ? 30   DA  I N6    1 
ATOM   601   N N1    . DA  A 1 30  ? -50.506  -47.811 80.090 1.00 106.29 ? 30   DA  I N1    1 
ATOM   602   C C2    . DA  A 1 30  ? -50.014  -49.043 79.900 1.00 106.02 ? 30   DA  I C2    1 
ATOM   603   N N3    . DA  A 1 30  ? -50.390  -49.973 79.024 1.00 106.64 ? 30   DA  I N3    1 
ATOM   604   C C4    . DA  A 1 30  ? -51.412  -49.530 78.269 1.00 107.44 ? 30   DA  I C4    1 
ATOM   605   P P     . DG  A 1 31  ? -53.075  -55.681 76.738 1.00 116.26 ? 31   DG  I P     1 
ATOM   606   O OP1   . DG  A 1 31  ? -52.913  -56.800 75.778 1.00 113.87 ? 31   DG  I OP1   1 
ATOM   607   O OP2   . DG  A 1 31  ? -54.417  -55.077 76.953 1.00 114.50 ? 31   DG  I OP2   1 
ATOM   608   O "O5'" . DG  A 1 31  ? -52.537  -56.187 78.138 1.00 121.67 ? 31   DG  I "O5'" 1 
ATOM   609   C "C5'" . DG  A 1 31  ? -53.380  -56.189 79.274 1.00 129.32 ? 31   DG  I "C5'" 1 
ATOM   610   C "C4'" . DG  A 1 31  ? -52.573  -55.879 80.510 1.00 134.27 ? 31   DG  I "C4'" 1 
ATOM   611   O "O4'" . DG  A 1 31  ? -52.122  -54.502 80.479 1.00 134.73 ? 31   DG  I "O4'" 1 
ATOM   612   C "C3'" . DG  A 1 31  ? -53.375  -56.031 81.792 1.00 138.12 ? 31   DG  I "C3'" 1 
ATOM   613   O "O3'" . DG  A 1 31  ? -52.534  -56.594 82.793 1.00 144.75 ? 31   DG  I "O3'" 1 
ATOM   614   C "C2'" . DG  A 1 31  ? -53.804  -54.611 82.115 1.00 137.66 ? 31   DG  I "C2'" 1 
ATOM   615   C "C1'" . DG  A 1 31  ? -52.665  -53.769 81.571 1.00 136.77 ? 31   DG  I "C1'" 1 
ATOM   616   N N9    . DG  A 1 31  ? -53.109  -52.480 81.052 1.00 136.42 ? 31   DG  I N9    1 
ATOM   617   C C8    . DG  A 1 31  ? -53.523  -52.222 79.769 1.00 136.57 ? 31   DG  I C8    1 
ATOM   618   N N7    . DG  A 1 31  ? -53.868  -50.977 79.580 1.00 137.39 ? 31   DG  I N7    1 
ATOM   619   C C5    . DG  A 1 31  ? -53.669  -50.373 80.812 1.00 137.30 ? 31   DG  I C5    1 
ATOM   620   C C6    . DG  A 1 31  ? -53.870  -49.029 81.212 1.00 137.30 ? 31   DG  I C6    1 
ATOM   621   O O6    . DG  A 1 31  ? -54.267  -48.074 80.532 1.00 136.48 ? 31   DG  I O6    1 
ATOM   622   N N1    . DG  A 1 31  ? -53.554  -48.843 82.552 1.00 137.57 ? 31   DG  I N1    1 
ATOM   623   C C2    . DG  A 1 31  ? -53.096  -49.822 83.398 1.00 137.66 ? 31   DG  I C2    1 
ATOM   624   N N2    . DG  A 1 31  ? -52.848  -49.436 84.660 1.00 137.83 ? 31   DG  I N2    1 
ATOM   625   N N3    . DG  A 1 31  ? -52.898  -51.084 83.035 1.00 137.65 ? 31   DG  I N3    1 
ATOM   626   C C4    . DG  A 1 31  ? -53.203  -51.286 81.737 1.00 137.29 ? 31   DG  I C4    1 
ATOM   627   P P     . DT  A 1 32  ? -53.130  -57.687 83.798 1.00 147.70 ? 32   DT  I P     1 
ATOM   628   O OP1   . DT  A 1 32  ? -52.044  -58.665 84.082 1.00 145.63 ? 32   DT  I OP1   1 
ATOM   629   O OP2   . DT  A 1 32  ? -54.420  -58.163 83.234 1.00 145.32 ? 32   DT  I OP2   1 
ATOM   630   O "O5'" . DT  A 1 32  ? -53.428  -56.819 85.098 1.00 150.80 ? 32   DT  I "O5'" 1 
ATOM   631   C "C5'" . DT  A 1 32  ? -53.586  -55.410 84.980 1.00 155.46 ? 32   DT  I "C5'" 1 
ATOM   632   C "C4'" . DT  A 1 32  ? -53.821  -54.776 86.327 1.00 159.43 ? 32   DT  I "C4'" 1 
ATOM   633   O "O4'" . DT  A 1 32  ? -53.989  -53.358 86.100 1.00 161.34 ? 32   DT  I "O4'" 1 
ATOM   634   C "C3'" . DT  A 1 32  ? -55.099  -55.242 87.021 1.00 161.59 ? 32   DT  I "C3'" 1 
ATOM   635   O "O3'" . DT  A 1 32  ? -54.923  -55.205 88.444 1.00 162.83 ? 32   DT  I "O3'" 1 
ATOM   636   C "C2'" . DT  A 1 32  ? -56.128  -54.231 86.553 1.00 162.58 ? 32   DT  I "C2'" 1 
ATOM   637   C "C1'" . DT  A 1 32  ? -55.313  -52.954 86.421 1.00 163.18 ? 32   DT  I "C1'" 1 
ATOM   638   N N1    . DT  A 1 32  ? -55.779  -52.038 85.355 1.00 161.80 ? 32   DT  I N1    1 
ATOM   639   C C2    . DT  A 1 32  ? -55.650  -50.679 85.560 1.00 162.20 ? 32   DT  I C2    1 
ATOM   640   O O2    . DT  A 1 32  ? -55.193  -50.197 86.584 1.00 162.07 ? 32   DT  I O2    1 
ATOM   641   N N3    . DT  A 1 32  ? -56.082  -49.899 84.516 1.00 162.06 ? 32   DT  I N3    1 
ATOM   642   C C4    . DT  A 1 32  ? -56.625  -50.330 83.322 1.00 161.88 ? 32   DT  I C4    1 
ATOM   643   O O4    . DT  A 1 32  ? -56.959  -49.510 82.474 1.00 161.17 ? 32   DT  I O4    1 
ATOM   644   C C5    . DT  A 1 32  ? -56.749  -51.763 83.182 1.00 161.82 ? 32   DT  I C5    1 
ATOM   645   C C7    . DT  A 1 32  ? -57.348  -52.319 81.930 1.00 162.05 ? 32   DT  I C7    1 
ATOM   646   C C6    . DT  A 1 32  ? -56.321  -52.534 84.189 1.00 162.11 ? 32   DT  I C6    1 
ATOM   647   P P     . DG  A 1 33  ? -56.107  -55.700 89.416 1.00 152.54 ? 33   DG  I P     1 
ATOM   648   O OP1   . DG  A 1 33  ? -55.490  -56.506 90.501 1.00 183.93 ? 33   DG  I OP1   1 
ATOM   649   O OP2   . DG  A 1 33  ? -57.193  -56.291 88.592 1.00 184.40 ? 33   DG  I OP2   1 
ATOM   650   O "O5'" . DG  A 1 33  ? -56.644  -54.344 90.054 1.00 153.11 ? 33   DG  I "O5'" 1 
ATOM   651   C "C5'" . DG  A 1 33  ? -55.743  -53.415 90.659 1.00 153.54 ? 33   DG  I "C5'" 1 
ATOM   652   C "C4'" . DG  A 1 33  ? -56.470  -52.138 91.008 1.00 154.11 ? 33   DG  I "C4'" 1 
ATOM   653   O "O4'" . DG  A 1 33  ? -56.785  -51.405 89.800 1.00 154.04 ? 33   DG  I "O4'" 1 
ATOM   654   C "C3'" . DG  A 1 33  ? -57.802  -52.367 91.722 1.00 154.84 ? 33   DG  I "C3'" 1 
ATOM   655   O "O3'" . DG  A 1 33  ? -58.024  -51.351 92.701 1.00 156.05 ? 33   DG  I "O3'" 1 
ATOM   656   C "C2'" . DG  A 1 33  ? -58.822  -52.264 90.604 1.00 154.57 ? 33   DG  I "C2'" 1 
ATOM   657   C "C1'" . DG  A 1 33  ? -58.193  -51.229 89.686 1.00 154.31 ? 33   DG  I "C1'" 1 
ATOM   658   N N9    . DG  A 1 33  ? -58.550  -51.392 88.280 1.00 185.71 ? 33   DG  I N9    1 
ATOM   659   C C8    . DG  A 1 33  ? -58.591  -52.567 87.570 1.00 185.52 ? 33   DG  I C8    1 
ATOM   660   N N7    . DG  A 1 33  ? -58.932  -52.402 86.322 1.00 185.43 ? 33   DG  I N7    1 
ATOM   661   C C5    . DG  A 1 33  ? -59.134  -51.036 86.200 1.00 185.33 ? 33   DG  I C5    1 
ATOM   662   C C6    . DG  A 1 33  ? -59.517  -50.266 85.078 1.00 185.09 ? 33   DG  I C6    1 
ATOM   663   O O6    . DG  A 1 33  ? -59.748  -50.650 83.924 1.00 184.26 ? 33   DG  I O6    1 
ATOM   664   N N1    . DG  A 1 33  ? -59.618  -48.915 85.396 1.00 185.27 ? 33   DG  I N1    1 
ATOM   665   C C2    . DG  A 1 33  ? -59.376  -48.374 86.636 1.00 185.47 ? 33   DG  I C2    1 
ATOM   666   N N2    . DG  A 1 33  ? -59.536  -47.048 86.745 1.00 185.15 ? 33   DG  I N2    1 
ATOM   667   N N3    . DG  A 1 33  ? -59.006  -49.082 87.690 1.00 185.21 ? 33   DG  I N3    1 
ATOM   668   C C4    . DG  A 1 33  ? -58.908  -50.398 87.402 1.00 185.46 ? 33   DG  I C4    1 
ATOM   669   P P     . DT  A 1 34  ? -59.184  -51.544 93.793 1.00 169.74 ? 34   DT  I P     1 
ATOM   670   O OP1   . DT  A 1 34  ? -59.136  -50.369 94.700 1.00 184.65 ? 34   DT  I OP1   1 
ATOM   671   O OP2   . DT  A 1 34  ? -59.081  -52.914 94.356 1.00 183.88 ? 34   DT  I OP2   1 
ATOM   672   O "O5'" . DT  A 1 34  ? -60.522  -51.452 92.938 1.00 171.13 ? 34   DT  I "O5'" 1 
ATOM   673   C "C5'" . DT  A 1 34  ? -61.615  -50.657 93.382 1.00 172.40 ? 34   DT  I "C5'" 1 
ATOM   674   C "C4'" . DT  A 1 34  ? -61.380  -49.209 93.020 1.00 172.40 ? 34   DT  I "C4'" 1 
ATOM   675   O "O4'" . DT  A 1 34  ? -60.983  -49.117 91.630 1.00 172.40 ? 34   DT  I "O4'" 1 
ATOM   676   C "C3'" . DT  A 1 34  ? -62.617  -48.328 93.167 1.00 172.40 ? 34   DT  I "C3'" 1 
ATOM   677   O "O3'" . DT  A 1 34  ? -62.256  -47.021 93.618 1.00 172.40 ? 34   DT  I "O3'" 1 
ATOM   678   C "C2'" . DT  A 1 34  ? -63.178  -48.278 91.759 1.00 172.40 ? 34   DT  I "C2'" 1 
ATOM   679   C "C1'" . DT  A 1 34  ? -61.932  -48.360 90.889 1.00 172.40 ? 34   DT  I "C1'" 1 
ATOM   680   N N1    . DT  A 1 34  ? -62.155  -49.050 89.599 1.00 194.02 ? 34   DT  I N1    1 
ATOM   681   C C2    . DT  A 1 34  ? -62.479  -48.296 88.490 1.00 194.29 ? 34   DT  I C2    1 
ATOM   682   O O2    . DT  A 1 34  ? -62.566  -47.079 88.512 1.00 193.94 ? 34   DT  I O2    1 
ATOM   683   N N3    . DT  A 1 34  ? -62.696  -49.025 87.346 1.00 194.38 ? 34   DT  I N3    1 
ATOM   684   C C4    . DT  A 1 34  ? -62.618  -50.398 87.202 1.00 194.42 ? 34   DT  I C4    1 
ATOM   685   O O4    . DT  A 1 34  ? -62.851  -50.913 86.113 1.00 193.59 ? 34   DT  I O4    1 
ATOM   686   C C5    . DT  A 1 34  ? -62.257  -51.123 88.397 1.00 194.40 ? 34   DT  I C5    1 
ATOM   687   C C7    . DT  A 1 34  ? -62.130  -52.613 88.332 1.00 194.42 ? 34   DT  I C7    1 
ATOM   688   C C6    . DT  A 1 34  ? -62.050  -50.423 89.520 1.00 194.39 ? 34   DT  I C6    1 
ATOM   689   P P     . DA  A 1 35  ? -63.409  -45.971 94.000 1.00 141.45 ? 35   DA  I P     1 
ATOM   690   O OP1   . DA  A 1 35  ? -62.761  -44.781 94.608 1.00 150.26 ? 35   DA  I OP1   1 
ATOM   691   O OP2   . DA  A 1 35  ? -64.472  -46.693 94.744 1.00 150.32 ? 35   DA  I OP2   1 
ATOM   692   O "O5'" . DA  A 1 35  ? -64.007  -45.538 92.590 1.00 140.39 ? 35   DA  I "O5'" 1 
ATOM   693   C "C5'" . DA  A 1 35  ? -63.478  -44.415 91.890 1.00 138.19 ? 35   DA  I "C5'" 1 
ATOM   694   C "C4'" . DA  A 1 35  ? -64.498  -43.877 90.914 1.00 136.57 ? 35   DA  I "C4'" 1 
ATOM   695   O "O4'" . DA  A 1 35  ? -64.558  -44.707 89.727 1.00 137.01 ? 35   DA  I "O4'" 1 
ATOM   696   C "C3'" . DA  A 1 35  ? -65.926  -43.802 91.459 1.00 135.10 ? 35   DA  I "C3'" 1 
ATOM   697   O "O3'" . DA  A 1 35  ? -66.530  -42.561 91.079 1.00 131.64 ? 35   DA  I "O3'" 1 
ATOM   698   C "C2'" . DA  A 1 35  ? -66.615  -44.988 90.806 1.00 136.06 ? 35   DA  I "C2'" 1 
ATOM   699   C "C1'" . DA  A 1 35  ? -65.900  -45.083 89.470 1.00 137.47 ? 35   DA  I "C1'" 1 
ATOM   700   N N9    . DA  A 1 35  ? -65.891  -46.427 88.895 1.00 146.45 ? 35   DA  I N9    1 
ATOM   701   C C8    . DA  A 1 35  ? -65.423  -47.583 89.465 1.00 146.61 ? 35   DA  I C8    1 
ATOM   702   N N7    . DA  A 1 35  ? -65.571  -48.644 88.709 1.00 146.68 ? 35   DA  I N7    1 
ATOM   703   C C5    . DA  A 1 35  ? -66.175  -48.153 87.563 1.00 146.97 ? 35   DA  I C5    1 
ATOM   704   C C6    . DA  A 1 35  ? -66.605  -48.776 86.382 1.00 147.28 ? 35   DA  I C6    1 
ATOM   705   N N6    . DA  A 1 35  ? -66.479  -50.084 86.147 1.00 147.67 ? 35   DA  I N6    1 
ATOM   706   N N1    . DA  A 1 35  ? -67.176  -48.000 85.434 1.00 147.19 ? 35   DA  I N1    1 
ATOM   707   C C2    . DA  A 1 35  ? -67.295  -46.687 85.667 1.00 147.03 ? 35   DA  I C2    1 
ATOM   708   N N3    . DA  A 1 35  ? -66.927  -45.985 86.736 1.00 146.98 ? 35   DA  I N3    1 
ATOM   709   C C4    . DA  A 1 35  ? -66.369  -46.787 87.659 1.00 146.77 ? 35   DA  I C4    1 
ATOM   710   P P     . DT  A 1 36  ? -68.130  -42.418 91.069 1.00 148.71 ? 36   DT  I P     1 
ATOM   711   O OP1   . DT  A 1 36  ? -68.438  -40.996 91.362 1.00 118.76 ? 36   DT  I OP1   1 
ATOM   712   O OP2   . DT  A 1 36  ? -68.740  -43.489 91.903 1.00 119.02 ? 36   DT  I OP2   1 
ATOM   713   O "O5'" . DT  A 1 36  ? -68.499  -42.706 89.546 1.00 146.91 ? 36   DT  I "O5'" 1 
ATOM   714   C "C5'" . DT  A 1 36  ? -67.807  -42.036 88.488 1.00 142.44 ? 36   DT  I "C5'" 1 
ATOM   715   C "C4'" . DT  A 1 36  ? -68.648  -42.032 87.234 1.00 138.93 ? 36   DT  I "C4'" 1 
ATOM   716   O "O4'" . DT  A 1 36  ? -68.662  -43.360 86.660 1.00 139.27 ? 36   DT  I "O4'" 1 
ATOM   717   C "C3'" . DT  A 1 36  ? -70.111  -41.654 87.474 1.00 135.84 ? 36   DT  I "C3'" 1 
ATOM   718   O "O3'" . DT  A 1 36  ? -70.601  -40.825 86.417 1.00 130.05 ? 36   DT  I "O3'" 1 
ATOM   719   C "C2'" . DT  A 1 36  ? -70.826  -42.993 87.510 1.00 137.15 ? 36   DT  I "C2'" 1 
ATOM   720   C "C1'" . DT  A 1 36  ? -69.995  -43.849 86.571 1.00 138.88 ? 36   DT  I "C1'" 1 
ATOM   721   N N1    . DT  A 1 36  ? -69.974  -45.277 86.935 1.00 109.32 ? 36   DT  I N1    1 
ATOM   722   C C2    . DT  A 1 36  ? -70.476  -46.196 86.039 1.00 109.46 ? 36   DT  I C2    1 
ATOM   723   O O2    . DT  A 1 36  ? -70.947  -45.889 84.956 1.00 109.22 ? 36   DT  I O2    1 
ATOM   724   N N3    . DT  A 1 36  ? -70.406  -47.500 86.460 1.00 109.14 ? 36   DT  I N3    1 
ATOM   725   C C4    . DT  A 1 36  ? -69.897  -47.965 87.655 1.00 109.19 ? 36   DT  I C4    1 
ATOM   726   O O4    . DT  A 1 36  ? -69.902  -49.168 87.893 1.00 107.60 ? 36   DT  I O4    1 
ATOM   727   C C5    . DT  A 1 36  ? -69.388  -46.947 88.546 1.00 109.61 ? 36   DT  I C5    1 
ATOM   728   C C7    . DT  A 1 36  ? -68.810  -47.357 89.864 1.00 110.31 ? 36   DT  I C7    1 
ATOM   729   C C6    . DT  A 1 36  ? -69.455  -45.671 88.148 1.00 109.89 ? 36   DT  I C6    1 
ATOM   730   P P     . DT  A 1 37  ? -72.182  -40.619 86.238 1.00 116.61 ? 37   DT  I P     1 
ATOM   731   O OP1   . DT  A 1 37  ? -72.378  -39.352 85.491 1.00 143.95 ? 37   DT  I OP1   1 
ATOM   732   O OP2   . DT  A 1 37  ? -72.856  -40.811 87.544 1.00 144.52 ? 37   DT  I OP2   1 
ATOM   733   O "O5'" . DT  A 1 37  ? -72.593  -41.826 85.289 1.00 113.51 ? 37   DT  I "O5'" 1 
ATOM   734   C "C5'" . DT  A 1 37  ? -71.998  -41.958 84.000 1.00 107.50 ? 37   DT  I "C5'" 1 
ATOM   735   C "C4'" . DT  A 1 37  ? -72.873  -42.799 83.102 1.00 103.09 ? 37   DT  I "C4'" 1 
ATOM   736   O "O4'" . DT  A 1 37  ? -72.723  -44.202 83.412 1.00 102.12 ? 37   DT  I "O4'" 1 
ATOM   737   C "C3'" . DT  A 1 37  ? -74.366  -42.496 83.220 1.00 100.77 ? 37   DT  I "C3'" 1 
ATOM   738   O "O3'" . DT  A 1 37  ? -74.970  -42.605 81.932 1.00 97.11  ? 37   DT  I "O3'" 1 
ATOM   739   C "C2'" . DT  A 1 37  ? -74.872  -43.613 84.114 1.00 101.08 ? 37   DT  I "C2'" 1 
ATOM   740   C "C1'" . DT  A 1 37  ? -73.999  -44.768 83.661 1.00 101.69 ? 37   DT  I "C1'" 1 
ATOM   741   N N1    . DT  A 1 37  ? -73.826  -45.852 84.638 1.00 129.74 ? 37   DT  I N1    1 
ATOM   742   C C2    . DT  A 1 37  ? -73.677  -47.131 84.153 1.00 129.70 ? 37   DT  I C2    1 
ATOM   743   O O2    . DT  A 1 37  ? -73.710  -47.405 82.965 1.00 128.50 ? 37   DT  I O2    1 
ATOM   744   N N3    . DT  A 1 37  ? -73.488  -48.085 85.115 1.00 130.36 ? 37   DT  I N3    1 
ATOM   745   C C4    . DT  A 1 37  ? -73.436  -47.894 86.480 1.00 130.96 ? 37   DT  I C4    1 
ATOM   746   O O4    . DT  A 1 37  ? -73.239  -48.852 87.220 1.00 131.20 ? 37   DT  I O4    1 
ATOM   747   C C5    . DT  A 1 37  ? -73.619  -46.529 86.921 1.00 130.97 ? 37   DT  I C5    1 
ATOM   748   C C7    . DT  A 1 37  ? -73.592  -46.229 88.387 1.00 131.34 ? 37   DT  I C7    1 
ATOM   749   C C6    . DT  A 1 37  ? -73.803  -45.589 85.989 1.00 130.39 ? 37   DT  I C6    1 
ATOM   750   P P     . DT  A 1 38  ? -75.181  -41.290 81.041 1.00 117.41 ? 38   DT  I P     1 
ATOM   751   O OP1   . DT  A 1 38  ? -74.253  -40.247 81.544 1.00 129.46 ? 38   DT  I OP1   1 
ATOM   752   O OP2   . DT  A 1 38  ? -76.638  -41.004 80.960 1.00 128.44 ? 38   DT  I OP2   1 
ATOM   753   O "O5'" . DT  A 1 38  ? -74.669  -41.750 79.611 1.00 115.22 ? 38   DT  I "O5'" 1 
ATOM   754   C "C5'" . DT  A 1 38  ? -75.562  -42.365 78.703 1.00 111.91 ? 38   DT  I "C5'" 1 
ATOM   755   C "C4'" . DT  A 1 38  ? -75.022  -43.700 78.253 1.00 108.96 ? 38   DT  I "C4'" 1 
ATOM   756   O "O4'" . DT  A 1 38  ? -74.808  -44.554 79.405 1.00 107.60 ? 38   DT  I "O4'" 1 
ATOM   757   C "C3'" . DT  A 1 38  ? -76.014  -44.429 77.353 1.00 107.63 ? 38   DT  I "C3'" 1 
ATOM   758   O "O3'" . DT  A 1 38  ? -75.375  -44.979 76.200 1.00 106.78 ? 38   DT  I "O3'" 1 
ATOM   759   C "C2'" . DT  A 1 38  ? -76.657  -45.474 78.253 1.00 106.77 ? 38   DT  I "C2'" 1 
ATOM   760   C "C1'" . DT  A 1 38  ? -75.640  -45.714 79.360 1.00 105.92 ? 38   DT  I "C1'" 1 
ATOM   761   N N1    . DT  A 1 38  ? -76.273  -45.872 80.696 1.00 115.51 ? 38   DT  I N1    1 
ATOM   762   C C2    . DT  A 1 38  ? -76.192  -47.091 81.349 1.00 114.82 ? 38   DT  I C2    1 
ATOM   763   O O2    . DT  A 1 38  ? -75.638  -48.069 80.882 1.00 115.32 ? 38   DT  I O2    1 
ATOM   764   N N3    . DT  A 1 38  ? -76.798  -47.120 82.582 1.00 114.29 ? 38   DT  I N3    1 
ATOM   765   C C4    . DT  A 1 38  ? -77.472  -46.084 83.211 1.00 114.72 ? 38   DT  I C4    1 
ATOM   766   O O4    . DT  A 1 38  ? -77.972  -46.261 84.317 1.00 114.96 ? 38   DT  I O4    1 
ATOM   767   C C5    . DT  A 1 38  ? -77.529  -44.843 82.470 1.00 114.99 ? 38   DT  I C5    1 
ATOM   768   C C7    . DT  A 1 38  ? -78.247  -43.671 83.068 1.00 114.95 ? 38   DT  I C7    1 
ATOM   769   C C6    . DT  A 1 38  ? -76.933  -44.800 81.268 1.00 115.28 ? 38   DT  I C6    1 
ATOM   770   P P     . DG  A 1 39  ? -76.130  -44.917 74.784 1.00 115.37 ? 39   DG  I P     1 
ATOM   771   O OP1   . DG  A 1 39  ? -75.111  -45.131 73.727 1.00 110.94 ? 39   DG  I OP1   1 
ATOM   772   O OP2   . DG  A 1 39  ? -76.980  -43.698 74.748 1.00 110.28 ? 39   DG  I OP2   1 
ATOM   773   O "O5'" . DG  A 1 39  ? -77.089  -46.186 74.842 1.00 116.65 ? 39   DG  I "O5'" 1 
ATOM   774   C "C5'" . DG  A 1 39  ? -76.553  -47.485 75.072 1.00 117.38 ? 39   DG  I "C5'" 1 
ATOM   775   C "C4'" . DG  A 1 39  ? -77.653  -48.438 75.473 1.00 117.67 ? 39   DG  I "C4'" 1 
ATOM   776   O "O4'" . DG  A 1 39  ? -78.081  -48.172 76.830 1.00 116.83 ? 39   DG  I "O4'" 1 
ATOM   777   C "C3'" . DG  A 1 39  ? -78.908  -48.338 74.608 1.00 118.99 ? 39   DG  I "C3'" 1 
ATOM   778   O "O3'" . DG  A 1 39  ? -79.455  -49.640 74.415 1.00 121.73 ? 39   DG  I "O3'" 1 
ATOM   779   C "C2'" . DG  A 1 39  ? -79.853  -47.517 75.465 1.00 117.44 ? 39   DG  I "C2'" 1 
ATOM   780   C "C1'" . DG  A 1 39  ? -79.491  -48.021 76.846 1.00 115.84 ? 39   DG  I "C1'" 1 
ATOM   781   N N9    . DG  A 1 39  ? -79.848  -47.141 77.953 1.00 109.78 ? 39   DG  I N9    1 
ATOM   782   C C8    . DG  A 1 39  ? -80.397  -45.884 77.880 1.00 109.78 ? 39   DG  I C8    1 
ATOM   783   N N7    . DG  A 1 39  ? -80.622  -45.356 79.052 1.00 110.12 ? 39   DG  I N7    1 
ATOM   784   C C5    . DG  A 1 39  ? -80.194  -46.321 79.952 1.00 109.32 ? 39   DG  I C5    1 
ATOM   785   C C6    . DG  A 1 39  ? -80.193  -46.320 81.370 1.00 109.11 ? 39   DG  I C6    1 
ATOM   786   O O6    . DG  A 1 39  ? -80.583  -45.431 82.144 1.00 108.93 ? 39   DG  I O6    1 
ATOM   787   N N1    . DG  A 1 39  ? -79.668  -47.505 81.880 1.00 108.60 ? 39   DG  I N1    1 
ATOM   788   C C2    . DG  A 1 39  ? -79.201  -48.553 81.122 1.00 107.44 ? 39   DG  I C2    1 
ATOM   789   N N2    . DG  A 1 39  ? -78.723  -49.608 81.796 1.00 106.43 ? 39   DG  I N2    1 
ATOM   790   N N3    . DG  A 1 39  ? -79.201  -48.565 79.801 1.00 107.26 ? 39   DG  I N3    1 
ATOM   791   C C4    . DG  A 1 39  ? -79.708  -47.426 79.287 1.00 108.97 ? 39   DG  I C4    1 
ATOM   792   P P     . DG  A 1 40  ? -80.020  -50.059 72.976 1.00 117.77 ? 40   DG  I P     1 
ATOM   793   O OP1   . DG  A 1 40  ? -78.960  -49.754 71.985 1.00 149.40 ? 40   DG  I OP1   1 
ATOM   794   O OP2   . DG  A 1 40  ? -81.378  -49.487 72.802 1.00 148.75 ? 40   DG  I OP2   1 
ATOM   795   O "O5'" . DG  A 1 40  ? -80.151  -51.638 73.097 1.00 120.54 ? 40   DG  I "O5'" 1 
ATOM   796   C "C5'" . DG  A 1 40  ? -79.084  -52.404 73.646 1.00 123.65 ? 40   DG  I "C5'" 1 
ATOM   797   C "C4'" . DG  A 1 40  ? -79.567  -53.194 74.840 1.00 125.91 ? 40   DG  I "C4'" 1 
ATOM   798   O "O4'" . DG  A 1 40  ? -79.875  -52.299 75.938 1.00 126.42 ? 40   DG  I "O4'" 1 
ATOM   799   C "C3'" . DG  A 1 40  ? -80.833  -54.015 74.590 1.00 127.38 ? 40   DG  I "C3'" 1 
ATOM   800   O "O3'" . DG  A 1 40  ? -80.716  -55.296 75.214 1.00 130.19 ? 40   DG  I "O3'" 1 
ATOM   801   C "C2'" . DG  A 1 40  ? -81.926  -53.195 75.251 1.00 126.97 ? 40   DG  I "C2'" 1 
ATOM   802   C "C1'" . DG  A 1 40  ? -81.189  -52.553 76.411 1.00 126.80 ? 40   DG  I "C1'" 1 
ATOM   803   N N9    . DG  A 1 40  ? -81.764  -51.285 76.846 1.00 159.10 ? 40   DG  I N9    1 
ATOM   804   C C8    . DG  A 1 40  ? -82.328  -50.317 76.052 1.00 159.26 ? 40   DG  I C8    1 
ATOM   805   N N7    . DG  A 1 40  ? -82.764  -49.290 76.728 1.00 158.90 ? 40   DG  I N7    1 
ATOM   806   C C5    . DG  A 1 40  ? -82.470  -49.597 78.048 1.00 158.89 ? 40   DG  I C5    1 
ATOM   807   C C6    . DG  A 1 40  ? -82.706  -48.862 79.237 1.00 158.94 ? 40   DG  I C6    1 
ATOM   808   O O6    . DG  A 1 40  ? -83.241  -47.756 79.366 1.00 158.16 ? 40   DG  I O6    1 
ATOM   809   N N1    . DG  A 1 40  ? -82.246  -49.541 80.357 1.00 159.34 ? 40   DG  I N1    1 
ATOM   810   C C2    . DG  A 1 40  ? -81.635  -50.770 80.338 1.00 159.91 ? 40   DG  I C2    1 
ATOM   811   N N2    . DG  A 1 40  ? -81.253  -51.255 81.528 1.00 160.08 ? 40   DG  I N2    1 
ATOM   812   N N3    . DG  A 1 40  ? -81.412  -51.469 79.237 1.00 159.45 ? 40   DG  I N3    1 
ATOM   813   C C4    . DG  A 1 40  ? -81.851  -50.826 78.137 1.00 159.09 ? 40   DG  I C4    1 
ATOM   814   P P     . DA  A 1 41  ? -81.942  -56.331 75.144 1.00 173.96 ? 41   DA  I P     1 
ATOM   815   O OP1   . DA  A 1 41  ? -81.361  -57.693 75.224 1.00 126.45 ? 41   DA  I OP1   1 
ATOM   816   O OP2   . DA  A 1 41  ? -82.830  -55.972 74.010 1.00 125.84 ? 41   DA  I OP2   1 
ATOM   817   O "O5'" . DA  A 1 41  ? -82.732  -56.067 76.496 1.00 174.98 ? 41   DA  I "O5'" 1 
ATOM   818   C "C5'" . DA  A 1 41  ? -82.205  -56.517 77.735 1.00 177.75 ? 41   DA  I "C5'" 1 
ATOM   819   C "C4'" . DA  A 1 41  ? -83.303  -56.577 78.766 1.00 179.91 ? 41   DA  I "C4'" 1 
ATOM   820   O "O4'" . DA  A 1 41  ? -83.690  -55.233 79.137 1.00 180.25 ? 41   DA  I "O4'" 1 
ATOM   821   C "C3'" . DA  A 1 41  ? -84.573  -57.267 78.274 1.00 182.22 ? 41   DA  I "C3'" 1 
ATOM   822   O "O3'" . DA  A 1 41  ? -85.131  -58.042 79.334 1.00 186.17 ? 41   DA  I "O3'" 1 
ATOM   823   C "C2'" . DA  A 1 41  ? -85.480  -56.107 77.898 1.00 181.09 ? 41   DA  I "C2'" 1 
ATOM   824   C "C1'" . DA  A 1 41  ? -85.073  -55.033 78.894 1.00 180.17 ? 41   DA  I "C1'" 1 
ATOM   825   N N9    . DA  A 1 41  ? -85.244  -53.660 78.420 1.00 132.06 ? 41   DA  I N9    1 
ATOM   826   C C8    . DA  A 1 41  ? -85.137  -53.197 77.133 1.00 131.64 ? 41   DA  I C8    1 
ATOM   827   N N7    . DA  A 1 41  ? -85.340  -51.907 77.016 1.00 130.76 ? 41   DA  I N7    1 
ATOM   828   C C5    . DA  A 1 41  ? -85.599  -51.490 78.314 1.00 130.06 ? 41   DA  I C5    1 
ATOM   829   C C6    . DA  A 1 41  ? -85.897  -50.228 78.862 1.00 129.17 ? 41   DA  I C6    1 
ATOM   830   N N6    . DA  A 1 41  ? -85.981  -49.107 78.140 1.00 128.50 ? 41   DA  I N6    1 
ATOM   831   N N1    . DA  A 1 41  ? -86.110  -50.156 80.196 1.00 129.17 ? 41   DA  I N1    1 
ATOM   832   C C2    . DA  A 1 41  ? -86.021  -51.278 80.918 1.00 129.60 ? 41   DA  I C2    1 
ATOM   833   N N3    . DA  A 1 41  ? -85.746  -52.519 80.519 1.00 129.99 ? 41   DA  I N3    1 
ATOM   834   C C4    . DA  A 1 41  ? -85.545  -52.559 79.190 1.00 130.83 ? 41   DA  I C4    1 
ATOM   835   P P     . DA  A 1 42  ? -86.333  -59.060 79.032 1.00 148.29 ? 42   DA  I P     1 
ATOM   836   O OP1   . DA  A 1 42  ? -85.968  -60.376 79.621 1.00 155.96 ? 42   DA  I OP1   1 
ATOM   837   O OP2   . DA  A 1 42  ? -86.701  -58.973 77.596 1.00 156.52 ? 42   DA  I OP2   1 
ATOM   838   O "O5'" . DA  A 1 42  ? -87.525  -58.453 79.887 1.00 149.33 ? 42   DA  I "O5'" 1 
ATOM   839   C "C5'" . DA  A 1 42  ? -87.344  -58.166 81.266 1.00 151.42 ? 42   DA  I "C5'" 1 
ATOM   840   C "C4'" . DA  A 1 42  ? -88.476  -57.302 81.757 1.00 153.12 ? 42   DA  I "C4'" 1 
ATOM   841   O "O4'" . DA  A 1 42  ? -88.296  -55.940 81.299 1.00 152.36 ? 42   DA  I "O4'" 1 
ATOM   842   C "C3'" . DA  A 1 42  ? -89.832  -57.751 81.217 1.00 155.06 ? 42   DA  I "C3'" 1 
ATOM   843   O "O3'" . DA  A 1 42  ? -90.831  -57.602 82.221 1.00 159.73 ? 42   DA  I "O3'" 1 
ATOM   844   C "C2'" . DA  A 1 42  ? -90.094  -56.780 80.083 1.00 153.39 ? 42   DA  I "C2'" 1 
ATOM   845   C "C1'" . DA  A 1 42  ? -89.475  -55.517 80.638 1.00 151.84 ? 42   DA  I "C1'" 1 
ATOM   846   N N9    . DA  A 1 42  ? -89.107  -54.519 79.638 1.00 158.82 ? 42   DA  I N9    1 
ATOM   847   C C8    . DA  A 1 42  ? -88.489  -54.706 78.428 1.00 158.39 ? 42   DA  I C8    1 
ATOM   848   N N7    . DA  A 1 42  ? -88.311  -53.598 77.750 1.00 158.27 ? 42   DA  I N7    1 
ATOM   849   C C5    . DA  A 1 42  ? -88.847  -52.614 78.572 1.00 157.49 ? 42   DA  I C5    1 
ATOM   850   C C6    . DA  A 1 42  ? -88.971  -51.220 78.427 1.00 156.86 ? 42   DA  I C6    1 
ATOM   851   N N6    . DA  A 1 42  ? -88.552  -50.546 77.356 1.00 156.14 ? 42   DA  I N6    1 
ATOM   852   N N1    . DA  A 1 42  ? -89.549  -50.533 79.435 1.00 157.10 ? 42   DA  I N1    1 
ATOM   853   C C2    . DA  A 1 42  ? -89.975  -51.208 80.506 1.00 157.45 ? 42   DA  I C2    1 
ATOM   854   N N3    . DA  A 1 42  ? -89.919  -52.514 80.757 1.00 157.65 ? 42   DA  I N3    1 
ATOM   855   C C4    . DA  A 1 42  ? -89.336  -53.168 79.738 1.00 158.01 ? 42   DA  I C4    1 
ATOM   856   P P     . DA  A 1 43  ? -92.319  -58.119 81.933 1.00 163.53 ? 43   DA  I P     1 
ATOM   857   O OP1   . DA  A 1 43  ? -92.650  -59.124 82.974 1.00 133.17 ? 43   DA  I OP1   1 
ATOM   858   O OP2   . DA  A 1 43  ? -92.412  -58.488 80.501 1.00 133.94 ? 43   DA  I OP2   1 
ATOM   859   O "O5'" . DA  A 1 43  ? -93.209  -56.824 82.165 1.00 166.01 ? 43   DA  I "O5'" 1 
ATOM   860   C "C5'" . DA  A 1 43  ? -93.246  -56.180 83.433 1.00 170.19 ? 43   DA  I "C5'" 1 
ATOM   861   C "C4'" . DA  A 1 43  ? -94.172  -54.991 83.372 1.00 173.08 ? 43   DA  I "C4'" 1 
ATOM   862   O "O4'" . DA  A 1 43  ? -93.575  -53.982 82.520 1.00 174.32 ? 43   DA  I "O4'" 1 
ATOM   863   C "C3'" . DA  A 1 43  ? -95.527  -55.324 82.747 1.00 174.47 ? 43   DA  I "C3'" 1 
ATOM   864   O "O3'" . DA  A 1 43  ? -96.577  -54.590 83.383 1.00 175.38 ? 43   DA  I "O3'" 1 
ATOM   865   C "C2'" . DA  A 1 43  ? -95.362  -54.891 81.304 1.00 175.18 ? 43   DA  I "C2'" 1 
ATOM   866   C "C1'" . DA  A 1 43  ? -94.441  -53.693 81.433 1.00 175.78 ? 43   DA  I "C1'" 1 
ATOM   867   N N9    . DA  A 1 43  ? -93.623  -53.464 80.242 1.00 147.79 ? 43   DA  I N9    1 
ATOM   868   C C8    . DA  A 1 43  ? -92.946  -54.395 79.494 1.00 148.52 ? 43   DA  I C8    1 
ATOM   869   N N7    . DA  A 1 43  ? -92.334  -53.891 78.451 1.00 149.10 ? 43   DA  I N7    1 
ATOM   870   C C5    . DA  A 1 43  ? -92.619  -52.535 78.520 1.00 148.94 ? 43   DA  I C5    1 
ATOM   871   C C6    . DA  A 1 43  ? -92.265  -51.450 77.698 1.00 149.07 ? 43   DA  I C6    1 
ATOM   872   N N6    . DA  A 1 43  ? -91.531  -51.570 76.591 1.00 149.24 ? 43   DA  I N6    1 
ATOM   873   N N1    . DA  A 1 43  ? -92.702  -50.223 78.054 1.00 149.16 ? 43   DA  I N1    1 
ATOM   874   C C2    . DA  A 1 43  ? -93.449  -50.106 79.157 1.00 149.29 ? 43   DA  I C2    1 
ATOM   875   N N3    . DA  A 1 43  ? -93.855  -51.049 80.005 1.00 149.12 ? 43   DA  I N3    1 
ATOM   876   C C4    . DA  A 1 43  ? -93.400  -52.255 79.626 1.00 148.64 ? 43   DA  I C4    1 
ATOM   877   P P     . DC  A 1 44  ? -97.926  -54.270 82.571 1.00 193.37 ? 44   DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? -98.952  -53.838 83.555 1.00 142.95 ? 44   DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? -98.223  -55.390 81.639 1.00 143.10 ? 44   DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? -97.526  -52.996 81.711 1.00 193.54 ? 44   DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? -97.156  -51.784 82.356 1.00 193.05 ? 44   DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? -97.689  -50.608 81.578 1.00 192.39 ? 44   DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? -96.869  -50.371 80.408 1.00 193.37 ? 44   DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? -99.110  -50.822 81.060 1.00 191.47 ? 44   DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? -99.823  -49.591 81.119 1.00 188.76 ? 44   DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? -98.892  -51.230 79.615 1.00 192.33 ? 44   DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? -97.683  -50.391 79.247 1.00 193.71 ? 44   DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? -96.872  -50.895 78.126 1.00 144.29 ? 44   DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? -96.541  -50.011 77.098 1.00 144.87 ? 44   DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? -96.947  -48.840 77.162 1.00 144.74 ? 44   DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? -95.791  -50.451 76.061 1.00 145.18 ? 44   DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? -95.376  -51.718 76.030 1.00 144.96 ? 44   DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? -94.633  -52.104 74.989 1.00 144.93 ? 44   DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? -95.702  -52.643 77.064 1.00 144.94 ? 44   DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? -96.445  -52.194 78.084 1.00 144.67 ? 44   DC  I C6    1 
ATOM   896   P P     . DT  A 1 45  ? -101.384 -49.559 80.763 1.00 162.76 ? 45   DT  I P     1 
ATOM   897   O OP1   . DT  A 1 45  ? -102.132 -49.417 82.037 1.00 159.44 ? 45   DT  I OP1   1 
ATOM   898   O OP2   . DT  A 1 45  ? -101.690 -50.687 79.849 1.00 159.60 ? 45   DT  I OP2   1 
ATOM   899   O "O5'" . DT  A 1 45  ? -101.536 -48.202 79.952 1.00 160.74 ? 45   DT  I "O5'" 1 
ATOM   900   C "C5'" . DT  A 1 45  ? -100.750 -47.067 80.298 1.00 157.04 ? 45   DT  I "C5'" 1 
ATOM   901   C "C4'" . DT  A 1 45  ? -100.594 -46.160 79.102 1.00 154.61 ? 45   DT  I "C4'" 1 
ATOM   902   O "O4'" . DT  A 1 45  ? -99.702  -46.756 78.126 1.00 153.42 ? 45   DT  I "O4'" 1 
ATOM   903   C "C3'" . DT  A 1 45  ? -101.905 -45.890 78.367 1.00 153.53 ? 45   DT  I "C3'" 1 
ATOM   904   O "O3'" . DT  A 1 45  ? -101.937 -44.531 77.935 1.00 153.05 ? 45   DT  I "O3'" 1 
ATOM   905   C "C2'" . DT  A 1 45  ? -101.835 -46.827 77.175 1.00 152.63 ? 45   DT  I "C2'" 1 
ATOM   906   C "C1'" . DT  A 1 45  ? -100.349 -46.813 76.864 1.00 151.88 ? 45   DT  I "C1'" 1 
ATOM   907   N N1    . DT  A 1 45  ? -99.834  -47.991 76.133 1.00 147.47 ? 45   DT  I N1    1 
ATOM   908   C C2    . DT  A 1 45  ? -99.116  -47.766 74.977 1.00 146.59 ? 45   DT  I C2    1 
ATOM   909   O O2    . DT  A 1 45  ? -98.905  -46.650 74.527 1.00 146.26 ? 45   DT  I O2    1 
ATOM   910   N N3    . DT  A 1 45  ? -98.656  -48.904 74.358 1.00 145.65 ? 45   DT  I N3    1 
ATOM   911   C C4    . DT  A 1 45  ? -98.841  -50.213 74.765 1.00 145.64 ? 45   DT  I C4    1 
ATOM   912   O O4    . DT  A 1 45  ? -98.363  -51.134 74.101 1.00 144.26 ? 45   DT  I O4    1 
ATOM   913   C C5    . DT  A 1 45  ? -99.611  -50.376 75.983 1.00 145.79 ? 45   DT  I C5    1 
ATOM   914   C C7    . DT  A 1 45  ? -99.867  -51.757 76.498 1.00 145.73 ? 45   DT  I C7    1 
ATOM   915   C C6    . DT  A 1 45  ? -100.061 -49.271 76.597 1.00 146.50 ? 45   DT  I C6    1 
ATOM   916   P P     . DG  A 1 46  ? -103.347 -43.815 77.668 1.00 151.29 ? 46   DG  I P     1 
ATOM   917   O OP1   . DG  A 1 46  ? -103.401 -42.599 78.524 1.00 151.95 ? 46   DG  I OP1   1 
ATOM   918   O OP2   . DG  A 1 46  ? -104.421 -44.839 77.771 1.00 152.43 ? 46   DG  I OP2   1 
ATOM   919   O "O5'" . DG  A 1 46  ? -103.239 -43.350 76.150 1.00 150.90 ? 46   DG  I "O5'" 1 
ATOM   920   C "C5'" . DG  A 1 46  ? -102.159 -42.528 75.714 1.00 149.59 ? 46   DG  I "C5'" 1 
ATOM   921   C "C4'" . DG  A 1 46  ? -101.988 -42.650 74.220 1.00 148.54 ? 46   DG  I "C4'" 1 
ATOM   922   O "O4'" . DG  A 1 46  ? -101.417 -43.936 73.879 1.00 149.41 ? 46   DG  I "O4'" 1 
ATOM   923   C "C3'" . DG  A 1 46  ? -103.300 -42.551 73.445 1.00 147.22 ? 46   DG  I "C3'" 1 
ATOM   924   O "O3'" . DG  A 1 46  ? -103.072 -41.841 72.237 1.00 143.50 ? 46   DG  I "O3'" 1 
ATOM   925   C "C2'" . DG  A 1 46  ? -103.626 -43.998 73.127 1.00 148.64 ? 46   DG  I "C2'" 1 
ATOM   926   C "C1'" . DG  A 1 46  ? -102.243 -44.582 72.927 1.00 150.35 ? 46   DG  I "C1'" 1 
ATOM   927   N N9    . DG  A 1 46  ? -102.154 -46.019 73.152 1.00 153.96 ? 46   DG  I N9    1 
ATOM   928   C C8    . DG  A 1 46  ? -102.722 -46.739 74.173 1.00 155.03 ? 46   DG  I C8    1 
ATOM   929   N N7    . DG  A 1 46  ? -102.470 -48.018 74.101 1.00 155.90 ? 46   DG  I N7    1 
ATOM   930   C C5    . DG  A 1 46  ? -101.688 -48.148 72.961 1.00 156.56 ? 46   DG  I C5    1 
ATOM   931   C C6    . DG  A 1 46  ? -101.109 -49.306 72.363 1.00 157.34 ? 46   DG  I C6    1 
ATOM   932   O O6    . DG  A 1 46  ? -101.181 -50.486 72.733 1.00 157.64 ? 46   DG  I O6    1 
ATOM   933   N N1    . DG  A 1 46  ? -100.388 -48.982 71.216 1.00 157.85 ? 46   DG  I N1    1 
ATOM   934   C C2    . DG  A 1 46  ? -100.245 -47.714 70.703 1.00 157.70 ? 46   DG  I C2    1 
ATOM   935   N N2    . DG  A 1 46  ? -99.517  -47.609 69.579 1.00 157.60 ? 46   DG  I N2    1 
ATOM   936   N N3    . DG  A 1 46  ? -100.780 -46.630 71.250 1.00 157.09 ? 46   DG  I N3    1 
ATOM   937   C C4    . DG  A 1 46  ? -101.482 -46.921 72.367 1.00 155.89 ? 46   DG  I C4    1 
ATOM   938   P P     . DC  A 1 47  ? -103.346 -40.265 72.185 1.00 150.96 ? 47   DC  I P     1 
ATOM   939   O OP1   . DC  A 1 47  ? -103.009 -39.706 73.521 1.00 165.16 ? 47   DC  I OP1   1 
ATOM   940   O OP2   . DC  A 1 47  ? -104.700 -40.052 71.614 1.00 164.32 ? 47   DC  I OP2   1 
ATOM   941   O "O5'" . DC  A 1 47  ? -102.266 -39.744 71.141 1.00 148.27 ? 47   DC  I "O5'" 1 
ATOM   942   C "C5'" . DC  A 1 47  ? -100.872 -39.836 71.429 1.00 142.71 ? 47   DC  I "C5'" 1 
ATOM   943   C "C4'" . DC  A 1 47  ? -100.117 -40.339 70.219 1.00 138.86 ? 47   DC  I "C4'" 1 
ATOM   944   O "O4'" . DC  A 1 47  ? -100.245 -41.777 70.083 1.00 136.93 ? 47   DC  I "O4'" 1 
ATOM   945   C "C3'" . DC  A 1 47  ? -100.578 -39.745 68.888 1.00 136.43 ? 47   DC  I "C3'" 1 
ATOM   946   O "O3'" . DC  A 1 47  ? -99.443  -39.427 68.078 1.00 133.87 ? 47   DC  I "O3'" 1 
ATOM   947   C "C2'" . DC  A 1 47  ? -101.396 -40.864 68.265 1.00 135.60 ? 47   DC  I "C2'" 1 
ATOM   948   C "C1'" . DC  A 1 47  ? -100.668 -42.095 68.766 1.00 135.29 ? 47   DC  I "C1'" 1 
ATOM   949   N N1    . DC  A 1 47  ? -101.481 -43.324 68.827 1.00 148.61 ? 47   DC  I N1    1 
ATOM   950   C C2    . DC  A 1 47  ? -101.075 -44.432 68.074 1.00 148.66 ? 47   DC  I C2    1 
ATOM   951   O O2    . DC  A 1 47  ? -100.056 -44.339 67.374 1.00 149.19 ? 47   DC  I O2    1 
ATOM   952   N N3    . DC  A 1 47  ? -101.802 -45.572 68.125 1.00 148.51 ? 47   DC  I N3    1 
ATOM   953   C C4    . DC  A 1 47  ? -102.896 -45.632 68.887 1.00 148.30 ? 47   DC  I C4    1 
ATOM   954   N N4    . DC  A 1 47  ? -103.580 -46.779 68.909 1.00 147.89 ? 47   DC  I N4    1 
ATOM   955   C C5    . DC  A 1 47  ? -103.338 -44.517 69.661 1.00 148.07 ? 47   DC  I C5    1 
ATOM   956   C C6    . DC  A 1 47  ? -102.606 -43.393 69.602 1.00 148.46 ? 47   DC  I C6    1 
ATOM   957   P P     . DT  A 1 48  ? -99.643  -39.114 66.517 1.00 123.14 ? 48   DT  I P     1 
ATOM   958   O OP1   . DT  A 1 48  ? -98.384  -38.521 66.003 1.00 155.86 ? 48   DT  I OP1   1 
ATOM   959   O OP2   . DT  A 1 48  ? -100.924 -38.388 66.335 1.00 155.70 ? 48   DT  I OP2   1 
ATOM   960   O "O5'" . DT  A 1 48  ? -99.803  -40.564 65.889 1.00 120.73 ? 48   DT  I "O5'" 1 
ATOM   961   C "C5'" . DT  A 1 48  ? -100.193 -40.727 64.543 1.00 118.02 ? 48   DT  I "C5'" 1 
ATOM   962   C "C4'" . DT  A 1 48  ? -99.883  -42.132 64.093 1.00 116.82 ? 48   DT  I "C4'" 1 
ATOM   963   O "O4'" . DT  A 1 48  ? -100.584 -43.093 64.921 1.00 119.21 ? 48   DT  I "O4'" 1 
ATOM   964   C "C3'" . DT  A 1 48  ? -100.331 -42.408 62.664 1.00 114.57 ? 48   DT  I "C3'" 1 
ATOM   965   O "O3'" . DT  A 1 48  ? -99.418  -43.307 62.061 1.00 106.56 ? 48   DT  I "O3'" 1 
ATOM   966   C "C2'" . DT  A 1 48  ? -101.662 -43.102 62.849 1.00 118.65 ? 48   DT  I "C2'" 1 
ATOM   967   C "C1'" . DT  A 1 48  ? -101.396 -43.919 64.094 1.00 122.43 ? 48   DT  I "C1'" 1 
ATOM   968   N N1    . DT  A 1 48  ? -102.613 -44.272 64.841 1.00 158.41 ? 48   DT  I N1    1 
ATOM   969   C C2    . DT  A 1 48  ? -103.121 -45.543 64.686 1.00 160.28 ? 48   DT  I C2    1 
ATOM   970   O O2    . DT  A 1 48  ? -102.616 -46.381 63.958 1.00 159.83 ? 48   DT  I O2    1 
ATOM   971   N N3    . DT  A 1 48  ? -104.249 -45.797 65.418 1.00 162.04 ? 48   DT  I N3    1 
ATOM   972   C C4    . DT  A 1 48  ? -104.907 -44.929 66.266 1.00 163.15 ? 48   DT  I C4    1 
ATOM   973   O O4    . DT  A 1 48  ? -105.910 -45.305 66.864 1.00 163.50 ? 48   DT  I O4    1 
ATOM   974   C C5    . DT  A 1 48  ? -104.324 -43.610 66.375 1.00 162.56 ? 48   DT  I C5    1 
ATOM   975   C C7    . DT  A 1 48  ? -104.973 -42.598 67.264 1.00 163.20 ? 48   DT  I C7    1 
ATOM   976   C C6    . DT  A 1 48  ? -103.220 -43.353 65.666 1.00 160.62 ? 48   DT  I C6    1 
ATOM   977   P P     . DC  A 1 49  ? -98.960  -43.064 60.557 1.00 92.38  ? 49   DC  I P     1 
ATOM   978   O OP1   . DC  A 1 49  ? -97.548  -42.618 60.625 1.00 104.96 ? 49   DC  I OP1   1 
ATOM   979   O OP2   . DC  A 1 49  ? -99.974  -42.216 59.882 1.00 105.36 ? 49   DC  I OP2   1 
ATOM   980   O "O5'" . DC  A 1 49  ? -99.021  -44.515 59.916 1.00 89.14  ? 49   DC  I "O5'" 1 
ATOM   981   C "C5'" . DC  A 1 49  ? -98.259  -45.589 60.455 1.00 85.73  ? 49   DC  I "C5'" 1 
ATOM   982   C "C4'" . DC  A 1 49  ? -98.905  -46.904 60.093 1.00 83.12  ? 49   DC  I "C4'" 1 
ATOM   983   O "O4'" . DC  A 1 49  ? -100.111 -47.072 60.879 1.00 82.61  ? 49   DC  I "O4'" 1 
ATOM   984   C "C3'" . DC  A 1 49  ? -99.332  -46.998 58.624 1.00 82.05  ? 49   DC  I "C3'" 1 
ATOM   985   O "O3'" . DC  A 1 49  ? -99.084  -48.299 58.093 1.00 80.08  ? 49   DC  I "O3'" 1 
ATOM   986   C "C2'" . DC  A 1 49  ? -100.828 -46.748 58.667 1.00 81.92  ? 49   DC  I "C2'" 1 
ATOM   987   C "C1'" . DC  A 1 49  ? -101.217 -47.326 60.019 1.00 83.10  ? 49   DC  I "C1'" 1 
ATOM   988   N N1    . DC  A 1 49  ? -102.415 -46.709 60.617 1.00 96.39  ? 49   DC  I N1    1 
ATOM   989   C C2    . DC  A 1 49  ? -103.424 -47.537 61.132 1.00 96.29  ? 49   DC  I C2    1 
ATOM   990   O O2    . DC  A 1 49  ? -103.281 -48.770 61.073 1.00 95.51  ? 49   DC  I O2    1 
ATOM   991   N N3    . DC  A 1 49  ? -104.526 -46.969 61.680 1.00 95.78  ? 49   DC  I N3    1 
ATOM   992   C C4    . DC  A 1 49  ? -104.637 -45.638 61.727 1.00 94.99  ? 49   DC  I C4    1 
ATOM   993   N N4    . DC  A 1 49  ? -105.728 -45.114 62.287 1.00 95.16  ? 49   DC  I N4    1 
ATOM   994   C C5    . DC  A 1 49  ? -103.630 -44.780 61.206 1.00 95.11  ? 49   DC  I C5    1 
ATOM   995   C C6    . DC  A 1 49  ? -102.545 -45.350 60.670 1.00 95.72  ? 49   DC  I C6    1 
ATOM   996   P P     . DC  A 1 50  ? -99.232  -48.546 56.515 1.00 82.40  ? 50   DC  I P     1 
ATOM   997   O OP1   . DC  A 1 50  ? -97.887  -48.907 55.996 1.00 107.10 ? 50   DC  I OP1   1 
ATOM   998   O OP2   . DC  A 1 50  ? -99.969  -47.393 55.930 1.00 108.04 ? 50   DC  I OP2   1 
ATOM   999   O "O5'" . DC  A 1 50  ? -100.163 -49.834 56.415 1.00 86.45  ? 50   DC  I "O5'" 1 
ATOM   1000  C "C5'" . DC  A 1 50  ? -99.992  -50.934 57.311 1.00 90.84  ? 50   DC  I "C5'" 1 
ATOM   1001  C "C4'" . DC  A 1 50  ? -101.295 -51.685 57.487 1.00 92.94  ? 50   DC  I "C4'" 1 
ATOM   1002  O "O4'" . DC  A 1 50  ? -102.266 -50.871 58.198 1.00 92.72  ? 50   DC  I "O4'" 1 
ATOM   1003  C "C3'" . DC  A 1 50  ? -101.985 -52.139 56.198 1.00 95.46  ? 50   DC  I "C3'" 1 
ATOM   1004  O "O3'" . DC  A 1 50  ? -102.492 -53.464 56.373 1.00 99.70  ? 50   DC  I "O3'" 1 
ATOM   1005  C "C2'" . DC  A 1 50  ? -103.125 -51.146 56.039 1.00 93.71  ? 50   DC  I "C2'" 1 
ATOM   1006  C "C1'" . DC  A 1 50  ? -103.491 -50.840 57.479 1.00 92.82  ? 50   DC  I "C1'" 1 
ATOM   1007  N N1    . DC  A 1 50  ? -104.100 -49.519 57.687 1.00 118.69 ? 50   DC  I N1    1 
ATOM   1008  C C2    . DC  A 1 50  ? -105.231 -49.416 58.512 1.00 118.42 ? 50   DC  I C2    1 
ATOM   1009  O O2    . DC  A 1 50  ? -105.688 -50.443 59.036 1.00 118.68 ? 50   DC  I O2    1 
ATOM   1010  N N3    . DC  A 1 50  ? -105.793 -48.199 58.717 1.00 117.48 ? 50   DC  I N3    1 
ATOM   1011  C C4    . DC  A 1 50  ? -105.267 -47.114 58.134 1.00 117.08 ? 50   DC  I C4    1 
ATOM   1012  N N4    . DC  A 1 50  ? -105.846 -45.927 58.368 1.00 115.80 ? 50   DC  I N4    1 
ATOM   1013  C C5    . DC  A 1 50  ? -104.120 -47.195 57.286 1.00 117.27 ? 50   DC  I C5    1 
ATOM   1014  C C6    . DC  A 1 50  ? -103.576 -48.405 57.092 1.00 117.51 ? 50   DC  I C6    1 
ATOM   1015  P P     . DA  A 1 51  ? -103.131 -54.248 55.128 1.00 130.39 ? 51   DA  I P     1 
ATOM   1016  O OP1   . DA  A 1 51  ? -102.559 -55.619 55.113 1.00 140.88 ? 51   DA  I OP1   1 
ATOM   1017  O OP2   . DA  A 1 51  ? -103.019 -53.390 53.922 1.00 141.22 ? 51   DA  I OP2   1 
ATOM   1018  O "O5'" . DA  A 1 51  ? -104.668 -54.359 55.524 1.00 136.98 ? 51   DA  I "O5'" 1 
ATOM   1019  C "C5'" . DA  A 1 51  ? -105.335 -53.257 56.128 1.00 146.75 ? 51   DA  I "C5'" 1 
ATOM   1020  C "C4'" . DA  A 1 51  ? -106.813 -53.532 56.247 1.00 153.48 ? 51   DA  I "C4'" 1 
ATOM   1021  O "O4'" . DA  A 1 51  ? -107.436 -52.350 56.801 1.00 154.68 ? 51   DA  I "O4'" 1 
ATOM   1022  C "C3'" . DA  A 1 51  ? -107.504 -53.787 54.908 1.00 157.48 ? 51   DA  I "C3'" 1 
ATOM   1023  O "O3'" . DA  A 1 51  ? -108.584 -54.709 55.079 1.00 162.58 ? 51   DA  I "O3'" 1 
ATOM   1024  C "C2'" . DA  A 1 51  ? -108.021 -52.416 54.518 1.00 157.09 ? 51   DA  I "C2'" 1 
ATOM   1025  C "C1'" . DA  A 1 51  ? -108.331 -51.773 55.862 1.00 156.26 ? 51   DA  I "C1'" 1 
ATOM   1026  N N9    . DA  A 1 51  ? -108.127 -50.324 55.884 1.00 168.25 ? 51   DA  I N9    1 
ATOM   1027  C C8    . DA  A 1 51  ? -107.402 -49.563 55.000 1.00 168.76 ? 51   DA  I C8    1 
ATOM   1028  N N7    . DA  A 1 51  ? -107.423 -48.280 55.265 1.00 168.90 ? 51   DA  I N7    1 
ATOM   1029  C C5    . DA  A 1 51  ? -108.209 -48.189 56.405 1.00 168.13 ? 51   DA  I C5    1 
ATOM   1030  C C6    . DA  A 1 51  ? -108.617 -47.094 57.187 1.00 167.66 ? 51   DA  I C6    1 
ATOM   1031  N N6    . DA  A 1 51  ? -108.284 -45.829 56.921 1.00 166.36 ? 51   DA  I N6    1 
ATOM   1032  N N1    . DA  A 1 51  ? -109.393 -47.347 58.263 1.00 168.15 ? 51   DA  I N1    1 
ATOM   1033  C C2    . DA  A 1 51  ? -109.731 -48.617 58.525 1.00 168.61 ? 51   DA  I C2    1 
ATOM   1034  N N3    . DA  A 1 51  ? -109.413 -49.728 57.865 1.00 168.77 ? 51   DA  I N3    1 
ATOM   1035  C C4    . DA  A 1 51  ? -108.642 -49.442 56.802 1.00 168.43 ? 51   DA  I C4    1 
ATOM   1036  P P     . DT  A 1 52  ? -108.913 -55.784 53.929 1.00 145.20 ? 52   DT  I P     1 
ATOM   1037  O OP1   . DT  A 1 52  ? -108.175 -57.044 54.216 1.00 110.58 ? 52   DT  I OP1   1 
ATOM   1038  O OP2   . DT  A 1 52  ? -108.779 -55.138 52.596 1.00 110.55 ? 52   DT  I OP2   1 
ATOM   1039  O "O5'" . DT  A 1 52  ? -110.454 -56.074 54.153 1.00 148.02 ? 52   DT  I "O5'" 1 
ATOM   1040  C "C5'" . DT  A 1 52  ? -111.010 -56.113 55.461 1.00 154.14 ? 52   DT  I "C5'" 1 
ATOM   1041  C "C4'" . DT  A 1 52  ? -112.384 -55.492 55.436 1.00 159.33 ? 52   DT  I "C4'" 1 
ATOM   1042  O "O4'" . DT  A 1 52  ? -112.310 -54.084 55.773 1.00 161.00 ? 52   DT  I "O4'" 1 
ATOM   1043  C "C3'" . DT  A 1 52  ? -113.027 -55.566 54.048 1.00 162.04 ? 52   DT  I "C3'" 1 
ATOM   1044  O "O3'" . DT  A 1 52  ? -114.402 -55.941 54.132 1.00 164.98 ? 52   DT  I "O3'" 1 
ATOM   1045  C "C2'" . DT  A 1 52  ? -112.904 -54.146 53.526 1.00 162.59 ? 52   DT  I "C2'" 1 
ATOM   1046  C "C1'" . DT  A 1 52  ? -113.039 -53.349 54.806 1.00 162.61 ? 52   DT  I "C1'" 1 
ATOM   1047  N N1    . DT  A 1 52  ? -112.508 -51.971 54.755 1.00 129.43 ? 52   DT  I N1    1 
ATOM   1048  C C2    . DT  A 1 52  ? -113.111 -51.013 55.551 1.00 129.73 ? 52   DT  I C2    1 
ATOM   1049  O O2    . DT  A 1 52  ? -114.044 -51.258 56.301 1.00 129.54 ? 52   DT  I O2    1 
ATOM   1050  N N3    . DT  A 1 52  ? -112.582 -49.751 55.434 1.00 130.07 ? 52   DT  I N3    1 
ATOM   1051  C C4    . DT  A 1 52  ? -111.536 -49.357 54.625 1.00 130.80 ? 52   DT  I C4    1 
ATOM   1052  O O4    . DT  A 1 52  ? -111.169 -48.183 54.634 1.00 130.54 ? 52   DT  I O4    1 
ATOM   1053  C C5    . DT  A 1 52  ? -110.950 -50.413 53.815 1.00 130.69 ? 52   DT  I C5    1 
ATOM   1054  C C7    . DT  A 1 52  ? -109.821 -50.081 52.891 1.00 130.92 ? 52   DT  I C7    1 
ATOM   1055  C C6    . DT  A 1 52  ? -111.455 -51.649 53.926 1.00 130.29 ? 52   DT  I C6    1 
ATOM   1056  P P     . DC  A 1 53  ? -115.331 -55.838 52.825 1.00 161.34 ? 53   DC  I P     1 
ATOM   1057  O OP1   . DC  A 1 53  ? -116.523 -56.688 53.078 1.00 159.38 ? 53   DC  I OP1   1 
ATOM   1058  O OP2   . DC  A 1 53  ? -114.502 -56.077 51.612 1.00 158.79 ? 53   DC  I OP2   1 
ATOM   1059  O "O5'" . DC  A 1 53  ? -115.797 -54.314 52.833 1.00 162.32 ? 53   DC  I "O5'" 1 
ATOM   1060  C "C5'" . DC  A 1 53  ? -116.477 -53.775 53.967 1.00 163.49 ? 53   DC  I "C5'" 1 
ATOM   1061  C "C4'" . DC  A 1 53  ? -117.300 -52.575 53.564 1.00 164.98 ? 53   DC  I "C4'" 1 
ATOM   1062  O "O4'" . DC  A 1 53  ? -116.453 -51.411 53.416 1.00 165.96 ? 53   DC  I "O4'" 1 
ATOM   1063  C "C3'" . DC  A 1 53  ? -118.031 -52.745 52.235 1.00 165.81 ? 53   DC  I "C3'" 1 
ATOM   1064  O "O3'" . DC  A 1 53  ? -119.335 -52.167 52.313 1.00 166.40 ? 53   DC  I "O3'" 1 
ATOM   1065  C "C2'" . DC  A 1 53  ? -117.159 -51.981 51.257 1.00 166.29 ? 53   DC  I "C2'" 1 
ATOM   1066  C "C1'" . DC  A 1 53  ? -116.611 -50.857 52.121 1.00 166.79 ? 53   DC  I "C1'" 1 
ATOM   1067  N N1    . DC  A 1 53  ? -115.302 -50.329 51.696 1.00 165.47 ? 53   DC  I N1    1 
ATOM   1068  C C2    . DC  A 1 53  ? -114.768 -49.223 52.371 1.00 165.52 ? 53   DC  I C2    1 
ATOM   1069  O O2    . DC  A 1 53  ? -115.407 -48.726 53.312 1.00 164.97 ? 53   DC  I O2    1 
ATOM   1070  N N3    . DC  A 1 53  ? -113.570 -48.729 51.984 1.00 165.62 ? 53   DC  I N3    1 
ATOM   1071  C C4    . DC  A 1 53  ? -112.910 -49.296 50.969 1.00 165.75 ? 53   DC  I C4    1 
ATOM   1072  N N4    . DC  A 1 53  ? -111.731 -48.776 50.620 1.00 166.15 ? 53   DC  I N4    1 
ATOM   1073  C C5    . DC  A 1 53  ? -113.430 -50.421 50.266 1.00 165.55 ? 53   DC  I C5    1 
ATOM   1074  C C6    . DC  A 1 53  ? -114.617 -50.899 50.658 1.00 165.66 ? 53   DC  I C6    1 
ATOM   1075  P P     . DA  A 1 54  ? -120.332 -52.291 51.062 1.00 200.16 ? 54   DA  I P     1 
ATOM   1076  O OP1   . DA  A 1 54  ? -121.721 -52.348 51.589 1.00 164.70 ? 54   DA  I OP1   1 
ATOM   1077  O OP2   . DA  A 1 54  ? -119.834 -53.379 50.177 1.00 164.03 ? 54   DA  I OP2   1 
ATOM   1078  O "O5'" . DA  A 1 54  ? -120.147 -50.903 50.306 1.00 200.16 ? 54   DA  I "O5'" 1 
ATOM   1079  C "C5'" . DA  A 1 54  ? -120.911 -49.758 50.680 1.00 200.16 ? 54   DA  I "C5'" 1 
ATOM   1080  C "C4'" . DA  A 1 54  ? -120.936 -48.767 49.541 1.00 200.16 ? 54   DA  I "C4'" 1 
ATOM   1081  O "O4'" . DA  A 1 54  ? -119.664 -48.074 49.466 1.00 200.16 ? 54   DA  I "O4'" 1 
ATOM   1082  C "C3'" . DA  A 1 54  ? -121.141 -49.435 48.180 1.00 200.16 ? 54   DA  I "C3'" 1 
ATOM   1083  O "O3'" . DA  A 1 54  ? -121.993 -48.650 47.343 1.00 200.16 ? 54   DA  I "O3'" 1 
ATOM   1084  C "C2'" . DA  A 1 54  ? -119.741 -49.487 47.599 1.00 200.16 ? 54   DA  I "C2'" 1 
ATOM   1085  C "C1'" . DA  A 1 54  ? -119.123 -48.220 48.162 1.00 199.99 ? 54   DA  I "C1'" 1 
ATOM   1086  N N9    . DA  A 1 54  ? -117.660 -48.240 48.263 1.00 159.36 ? 54   DA  I N9    1 
ATOM   1087  C C8    . DA  A 1 54  ? -116.801 -49.260 47.923 1.00 159.00 ? 54   DA  I C8    1 
ATOM   1088  N N7    . DA  A 1 54  ? -115.536 -48.968 48.101 1.00 158.82 ? 54   DA  I N7    1 
ATOM   1089  C C5    . DA  A 1 54  ? -115.561 -47.672 48.596 1.00 158.96 ? 54   DA  I C5    1 
ATOM   1090  C C6    . DA  A 1 54  ? -114.539 -46.789 48.982 1.00 158.66 ? 54   DA  I C6    1 
ATOM   1091  N N6    . DA  A 1 54  ? -113.241 -47.089 48.921 1.00 158.61 ? 54   DA  I N6    1 
ATOM   1092  N N1    . DA  A 1 54  ? -114.901 -45.569 49.436 1.00 158.36 ? 54   DA  I N1    1 
ATOM   1093  C C2    . DA  A 1 54  ? -116.204 -45.266 49.490 1.00 158.43 ? 54   DA  I C2    1 
ATOM   1094  N N3    . DA  A 1 54  ? -117.257 -46.008 49.152 1.00 158.94 ? 54   DA  I N3    1 
ATOM   1095  C C4    . DA  A 1 54  ? -116.863 -47.214 48.708 1.00 159.16 ? 54   DA  I C4    1 
ATOM   1096  P P     . DA  A 1 55  ? -122.832 -49.364 46.171 1.00 200.16 ? 55   DA  I P     1 
ATOM   1097  O OP1   . DA  A 1 55  ? -123.874 -50.205 46.814 1.00 181.89 ? 55   DA  I OP1   1 
ATOM   1098  O OP2   . DA  A 1 55  ? -121.885 -49.982 45.207 1.00 181.43 ? 55   DA  I OP2   1 
ATOM   1099  O "O5'" . DA  A 1 55  ? -123.561 -48.151 45.446 1.00 200.16 ? 55   DA  I "O5'" 1 
ATOM   1100  C "C5'" . DA  A 1 55  ? -122.814 -47.135 44.782 1.00 200.16 ? 55   DA  I "C5'" 1 
ATOM   1101  C "C4'" . DA  A 1 55  ? -122.507 -46.006 45.738 1.00 200.16 ? 55   DA  I "C4'" 1 
ATOM   1102  O "O4'" . DA  A 1 55  ? -121.193 -46.209 46.323 1.00 200.16 ? 55   DA  I "O4'" 1 
ATOM   1103  C "C3'" . DA  A 1 55  ? -122.455 -44.633 45.071 1.00 200.16 ? 55   DA  I "C3'" 1 
ATOM   1104  O "O3'" . DA  A 1 55  ? -123.008 -43.648 45.941 1.00 200.16 ? 55   DA  I "O3'" 1 
ATOM   1105  C "C2'" . DA  A 1 55  ? -120.973 -44.381 44.878 1.00 200.16 ? 55   DA  I "C2'" 1 
ATOM   1106  C "C1'" . DA  A 1 55  ? -120.380 -45.064 46.092 1.00 200.16 ? 55   DA  I "C1'" 1 
ATOM   1107  N N9    . DA  A 1 55  ? -118.997 -45.503 45.896 1.00 174.44 ? 55   DA  I N9    1 
ATOM   1108  C C8    . DA  A 1 55  ? -118.534 -46.726 45.474 1.00 173.95 ? 55   DA  I C8    1 
ATOM   1109  N N7    . DA  A 1 55  ? -117.228 -46.798 45.391 1.00 172.94 ? 55   DA  I N7    1 
ATOM   1110  C C5    . DA  A 1 55  ? -116.800 -45.537 45.784 1.00 172.10 ? 55   DA  I C5    1 
ATOM   1111  C C6    . DA  A 1 55  ? -115.522 -44.969 45.910 1.00 170.98 ? 55   DA  I C6    1 
ATOM   1112  N N6    . DA  A 1 55  ? -114.391 -45.626 45.646 1.00 170.23 ? 55   DA  I N6    1 
ATOM   1113  N N1    . DA  A 1 55  ? -115.443 -43.685 46.323 1.00 170.64 ? 55   DA  I N1    1 
ATOM   1114  C C2    . DA  A 1 55  ? -116.577 -43.028 46.592 1.00 170.79 ? 55   DA  I C2    1 
ATOM   1115  N N3    . DA  A 1 55  ? -117.835 -43.453 46.514 1.00 171.31 ? 55   DA  I N3    1 
ATOM   1116  C C4    . DA  A 1 55  ? -117.878 -44.731 46.099 1.00 172.70 ? 55   DA  I C4    1 
ATOM   1117  P P     . DA  A 1 56  ? -123.579 -42.285 45.323 1.00 165.23 ? 56   DA  I P     1 
ATOM   1118  O OP1   . DA  A 1 56  ? -123.920 -41.376 46.453 1.00 168.31 ? 56   DA  I OP1   1 
ATOM   1119  O OP2   . DA  A 1 56  ? -124.618 -42.639 44.322 1.00 168.93 ? 56   DA  I OP2   1 
ATOM   1120  O "O5'" . DA  A 1 56  ? -122.333 -41.682 44.539 1.00 164.72 ? 56   DA  I "O5'" 1 
ATOM   1121  C "C5'" . DA  A 1 56  ? -122.421 -41.413 43.147 1.00 163.66 ? 56   DA  I "C5'" 1 
ATOM   1122  C "C4'" . DA  A 1 56  ? -121.267 -40.545 42.708 1.00 163.07 ? 56   DA  I "C4'" 1 
ATOM   1123  O "O4'" . DA  A 1 56  ? -120.020 -41.261 42.879 1.00 163.26 ? 56   DA  I "O4'" 1 
ATOM   1124  C "C3'" . DA  A 1 56  ? -121.331 -40.171 41.231 1.00 162.39 ? 56   DA  I "C3'" 1 
ATOM   1125  O "O3'" . DA  A 1 56  ? -120.836 -38.852 41.048 1.00 161.03 ? 56   DA  I "O3'" 1 
ATOM   1126  C "C2'" . DA  A 1 56  ? -120.400 -41.168 40.572 1.00 162.86 ? 56   DA  I "C2'" 1 
ATOM   1127  C "C1'" . DA  A 1 56  ? -119.335 -41.332 41.635 1.00 163.78 ? 56   DA  I "C1'" 1 
ATOM   1128  N N9    . DA  A 1 56  ? -118.621 -42.607 41.577 1.00 168.33 ? 56   DA  I N9    1 
ATOM   1129  C C8    . DA  A 1 56  ? -119.075 -43.819 41.114 1.00 168.31 ? 56   DA  I C8    1 
ATOM   1130  N N7    . DA  A 1 56  ? -118.184 -44.779 41.185 1.00 168.40 ? 56   DA  I N7    1 
ATOM   1131  C C5    . DA  A 1 56  ? -117.070 -44.159 41.735 1.00 168.93 ? 56   DA  I C5    1 
ATOM   1132  C C6    . DA  A 1 56  ? -115.789 -44.634 42.067 1.00 169.14 ? 56   DA  I C6    1 
ATOM   1133  N N6    . DA  A 1 56  ? -115.402 -45.898 41.891 1.00 168.91 ? 56   DA  I N6    1 
ATOM   1134  N N1    . DA  A 1 56  ? -114.909 -43.754 42.594 1.00 169.88 ? 56   DA  I N1    1 
ATOM   1135  C C2    . DA  A 1 56  ? -115.300 -42.487 42.774 1.00 170.06 ? 56   DA  I C2    1 
ATOM   1136  N N3    . DA  A 1 56  ? -116.473 -41.920 42.504 1.00 169.53 ? 56   DA  I N3    1 
ATOM   1137  C C4    . DA  A 1 56  ? -117.324 -42.821 41.980 1.00 169.07 ? 56   DA  I C4    1 
ATOM   1138  P P     . DA  A 1 57  ? -121.501 -37.917 39.935 1.00 163.70 ? 57   DA  I P     1 
ATOM   1139  O OP1   . DA  A 1 57  ? -122.668 -37.252 40.565 1.00 172.56 ? 57   DA  I OP1   1 
ATOM   1140  O OP2   . DA  A 1 57  ? -121.687 -38.740 38.711 1.00 172.61 ? 57   DA  I OP2   1 
ATOM   1141  O "O5'" . DA  A 1 57  ? -120.392 -36.814 39.646 1.00 162.98 ? 57   DA  I "O5'" 1 
ATOM   1142  C "C5'" . DA  A 1 57  ? -119.583 -36.307 40.697 1.00 159.78 ? 57   DA  I "C5'" 1 
ATOM   1143  C "C4'" . DA  A 1 57  ? -118.122 -36.412 40.326 1.00 157.14 ? 57   DA  I "C4'" 1 
ATOM   1144  O "O4'" . DA  A 1 57  ? -117.704 -37.801 40.278 1.00 157.02 ? 57   DA  I "O4'" 1 
ATOM   1145  C "C3'" . DA  A 1 57  ? -117.749 -35.813 38.969 1.00 154.94 ? 57   DA  I "C3'" 1 
ATOM   1146  O "O3'" . DA  A 1 57  ? -116.494 -35.150 39.095 1.00 151.45 ? 57   DA  I "O3'" 1 
ATOM   1147  C "C2'" . DA  A 1 57  ? -117.595 -37.032 38.078 1.00 154.97 ? 57   DA  I "C2'" 1 
ATOM   1148  C "C1'" . DA  A 1 57  ? -117.042 -38.055 39.049 1.00 156.51 ? 57   DA  I "C1'" 1 
ATOM   1149  N N9    . DA  A 1 57  ? -117.293 -39.445 38.675 1.00 165.92 ? 57   DA  I N9    1 
ATOM   1150  C C8    . DA  A 1 57  ? -118.424 -39.982 38.111 1.00 165.70 ? 57   DA  I C8    1 
ATOM   1151  N N7    . DA  A 1 57  ? -118.339 -41.270 37.880 1.00 165.84 ? 57   DA  I N7    1 
ATOM   1152  C C5    . DA  A 1 57  ? -117.066 -41.604 38.323 1.00 166.58 ? 57   DA  I C5    1 
ATOM   1153  C C6    . DA  A 1 57  ? -116.362 -42.824 38.353 1.00 167.19 ? 57   DA  I C6    1 
ATOM   1154  N N6    . DA  A 1 57  ? -116.860 -43.980 37.910 1.00 166.96 ? 57   DA  I N6    1 
ATOM   1155  N N1    . DA  A 1 57  ? -115.110 -42.813 38.862 1.00 168.03 ? 57   DA  I N1    1 
ATOM   1156  C C2    . DA  A 1 57  ? -114.610 -41.653 39.307 1.00 168.19 ? 57   DA  I C2    1 
ATOM   1157  N N3    . DA  A 1 57  ? -115.172 -40.446 39.330 1.00 167.49 ? 57   DA  I N3    1 
ATOM   1158  C C4    . DA  A 1 57  ? -116.413 -40.490 38.818 1.00 166.70 ? 57   DA  I C4    1 
ATOM   1159  P P     . DG  A 1 58  ? -115.861 -34.382 37.838 1.00 160.41 ? 58   DG  I P     1 
ATOM   1160  O OP1   . DG  A 1 58  ? -116.214 -32.945 37.964 1.00 167.29 ? 58   DG  I OP1   1 
ATOM   1161  O OP2   . DG  A 1 58  ? -116.198 -35.114 36.591 1.00 166.44 ? 58   DG  I OP2   1 
ATOM   1162  O "O5'" . DG  A 1 58  ? -114.302 -34.536 38.106 1.00 157.59 ? 58   DG  I "O5'" 1 
ATOM   1163  C "C5'" . DG  A 1 58  ? -113.829 -34.837 39.417 1.00 151.80 ? 58   DG  I "C5'" 1 
ATOM   1164  C "C4'" . DG  A 1 58  ? -112.706 -35.844 39.346 1.00 147.98 ? 58   DG  I "C4'" 1 
ATOM   1165  O "O4'" . DG  A 1 58  ? -113.217 -37.115 38.876 1.00 147.22 ? 58   DG  I "O4'" 1 
ATOM   1166  C "C3'" . DG  A 1 58  ? -111.594 -35.450 38.379 1.00 144.99 ? 58   DG  I "C3'" 1 
ATOM   1167  O "O3'" . DG  A 1 58  ? -110.317 -35.773 38.933 1.00 139.89 ? 58   DG  I "O3'" 1 
ATOM   1168  C "C2'" . DG  A 1 58  ? -111.886 -36.278 37.140 1.00 145.44 ? 58   DG  I "C2'" 1 
ATOM   1169  C "C1'" . DG  A 1 58  ? -112.510 -37.533 37.720 1.00 146.89 ? 58   DG  I "C1'" 1 
ATOM   1170  N N9    . DG  A 1 58  ? -113.464 -38.177 36.824 1.00 154.01 ? 58   DG  I N9    1 
ATOM   1171  C C8    . DG  A 1 58  ? -114.495 -37.571 36.151 1.00 154.61 ? 58   DG  I C8    1 
ATOM   1172  N N7    . DG  A 1 58  ? -115.183 -38.400 35.414 1.00 154.62 ? 58   DG  I N7    1 
ATOM   1173  C C5    . DG  A 1 58  ? -114.569 -39.629 35.612 1.00 154.24 ? 58   DG  I C5    1 
ATOM   1174  C C6    . DG  A 1 58  ? -114.871 -40.909 35.068 1.00 154.17 ? 58   DG  I C6    1 
ATOM   1175  O O6    . DG  A 1 58  ? -115.770 -41.220 34.274 1.00 153.88 ? 58   DG  I O6    1 
ATOM   1176  N N1    . DG  A 1 58  ? -113.994 -41.882 35.536 1.00 153.62 ? 58   DG  I N1    1 
ATOM   1177  C C2    . DG  A 1 58  ? -112.962 -41.658 36.411 1.00 153.02 ? 58   DG  I C2    1 
ATOM   1178  N N2    . DG  A 1 58  ? -112.232 -42.730 36.742 1.00 152.06 ? 58   DG  I N2    1 
ATOM   1179  N N3    . DG  A 1 58  ? -112.667 -40.471 36.924 1.00 153.38 ? 58   DG  I N3    1 
ATOM   1180  C C4    . DG  A 1 58  ? -113.506 -39.509 36.484 1.00 153.95 ? 58   DG  I C4    1 
ATOM   1181  P P     . DG  A 1 59  ? -108.994 -35.175 38.257 1.00 112.33 ? 59   DG  I P     1 
ATOM   1182  O OP1   . DG  A 1 59  ? -107.825 -35.875 38.847 1.00 174.16 ? 59   DG  I OP1   1 
ATOM   1183  O OP2   . DG  A 1 59  ? -109.060 -33.692 38.295 1.00 174.35 ? 59   DG  I OP2   1 
ATOM   1184  O "O5'" . DG  A 1 59  ? -109.151 -35.638 36.750 1.00 108.28 ? 59   DG  I "O5'" 1 
ATOM   1185  C "C5'" . DG  A 1 59  ? -108.018 -35.971 35.977 1.00 101.90 ? 59   DG  I "C5'" 1 
ATOM   1186  C "C4'" . DG  A 1 59  ? -107.736 -37.448 36.092 1.00 96.33  ? 59   DG  I "C4'" 1 
ATOM   1187  O "O4'" . DG  A 1 59  ? -108.982 -38.180 36.024 1.00 93.94  ? 59   DG  I "O4'" 1 
ATOM   1188  C "C3'" . DG  A 1 59  ? -106.869 -37.959 34.946 1.00 93.57  ? 59   DG  I "C3'" 1 
ATOM   1189  O "O3'" . DG  A 1 59  ? -105.944 -38.950 35.378 1.00 89.34  ? 59   DG  I "O3'" 1 
ATOM   1190  C "C2'" . DG  A 1 59  ? -107.869 -38.543 33.970 1.00 93.68  ? 59   DG  I "C2'" 1 
ATOM   1191  C "C1'" . DG  A 1 59  ? -109.019 -38.993 34.855 1.00 93.58  ? 59   DG  I "C1'" 1 
ATOM   1192  N N9    . DG  A 1 59  ? -110.312 -38.797 34.205 1.00 155.98 ? 59   DG  I N9    1 
ATOM   1193  C C8    . DG  A 1 59  ? -110.978 -37.609 34.014 1.00 155.81 ? 59   DG  I C8    1 
ATOM   1194  N N7    . DG  A 1 59  ? -112.104 -37.750 33.369 1.00 156.15 ? 59   DG  I N7    1 
ATOM   1195  C C5    . DG  A 1 59  ? -112.192 -39.114 33.124 1.00 156.74 ? 59   DG  I C5    1 
ATOM   1196  C C6    . DG  A 1 59  ? -113.197 -39.872 32.458 1.00 156.75 ? 59   DG  I C6    1 
ATOM   1197  O O6    . DG  A 1 59  ? -114.242 -39.473 31.928 1.00 156.33 ? 59   DG  I O6    1 
ATOM   1198  N N1    . DG  A 1 59  ? -112.888 -41.228 32.445 1.00 156.87 ? 59   DG  I N1    1 
ATOM   1199  C C2    . DG  A 1 59  ? -111.759 -41.788 32.994 1.00 156.95 ? 59   DG  I C2    1 
ATOM   1200  N N2    . DG  A 1 59  ? -111.641 -43.120 32.879 1.00 157.00 ? 59   DG  I N2    1 
ATOM   1201  N N3    . DG  A 1 59  ? -110.815 -41.095 33.611 1.00 157.13 ? 59   DG  I N3    1 
ATOM   1202  C C4    . DG  A 1 59  ? -111.095 -39.774 33.640 1.00 156.77 ? 59   DG  I C4    1 
ATOM   1203  P P     . DC  A 1 60  ? -104.571 -39.139 34.576 1.00 93.29  ? 60   DC  I P     1 
ATOM   1204  O OP1   . DC  A 1 60  ? -103.512 -39.336 35.599 1.00 134.29 ? 60   DC  I OP1   1 
ATOM   1205  O OP2   . DC  A 1 60  ? -104.449 -38.032 33.589 1.00 133.46 ? 60   DC  I OP2   1 
ATOM   1206  O "O5'" . DC  A 1 60  ? -104.764 -40.506 33.784 1.00 91.27  ? 60   DC  I "O5'" 1 
ATOM   1207  C "C5'" . DC  A 1 60  ? -104.742 -41.738 34.488 1.00 88.88  ? 60   DC  I "C5'" 1 
ATOM   1208  C "C4'" . DC  A 1 60  ? -105.228 -42.866 33.610 1.00 87.66  ? 60   DC  I "C4'" 1 
ATOM   1209  O "O4'" . DC  A 1 60  ? -106.577 -42.587 33.170 1.00 87.04  ? 60   DC  I "O4'" 1 
ATOM   1210  C "C3'" . DC  A 1 60  ? -104.412 -43.141 32.347 1.00 86.65  ? 60   DC  I "C3'" 1 
ATOM   1211  O "O3'" . DC  A 1 60  ? -104.217 -44.543 32.224 1.00 85.53  ? 60   DC  I "O3'" 1 
ATOM   1212  C "C2'" . DC  A 1 60  ? -105.300 -42.644 31.220 1.00 86.93  ? 60   DC  I "C2'" 1 
ATOM   1213  C "C1'" . DC  A 1 60  ? -106.688 -42.867 31.785 1.00 88.26  ? 60   DC  I "C1'" 1 
ATOM   1214  N N1    . DC  A 1 60  ? -107.754 -42.009 31.236 1.00 130.25 ? 60   DC  I N1    1 
ATOM   1215  C C2    . DC  A 1 60  ? -108.722 -42.585 30.398 1.00 130.56 ? 60   DC  I C2    1 
ATOM   1216  O O2    . DC  A 1 60  ? -108.645 -43.797 30.131 1.00 129.46 ? 60   DC  I O2    1 
ATOM   1217  N N3    . DC  A 1 60  ? -109.714 -41.807 29.903 1.00 130.08 ? 60   DC  I N3    1 
ATOM   1218  C C4    . DC  A 1 60  ? -109.757 -40.507 30.208 1.00 131.01 ? 60   DC  I C4    1 
ATOM   1219  N N4    . DC  A 1 60  ? -110.751 -39.779 29.696 1.00 132.21 ? 60   DC  I N4    1 
ATOM   1220  C C5    . DC  A 1 60  ? -108.784 -39.896 31.054 1.00 130.38 ? 60   DC  I C5    1 
ATOM   1221  C C6    . DC  A 1 60  ? -107.809 -40.677 31.540 1.00 130.08 ? 60   DC  I C6    1 
ATOM   1222  P P     . DA  A 1 61  ? -103.082 -45.099 31.243 1.00 95.62  ? 61   DA  I P     1 
ATOM   1223  O OP1   . DA  A 1 61  ? -102.362 -46.180 31.963 1.00 122.57 ? 61   DA  I OP1   1 
ATOM   1224  O OP2   . DA  A 1 61  ? -102.323 -43.956 30.678 1.00 124.19 ? 61   DA  I OP2   1 
ATOM   1225  O "O5'" . DA  A 1 61  ? -103.915 -45.767 30.067 1.00 98.92  ? 61   DA  I "O5'" 1 
ATOM   1226  C "C5'" . DA  A 1 61  ? -104.813 -46.836 30.347 1.00 101.57 ? 61   DA  I "C5'" 1 
ATOM   1227  C "C4'" . DA  A 1 61  ? -105.616 -47.194 29.119 1.00 102.37 ? 61   DA  I "C4'" 1 
ATOM   1228  O "O4'" . DA  A 1 61  ? -106.610 -46.176 28.844 1.00 101.96 ? 61   DA  I "O4'" 1 
ATOM   1229  C "C3'" . DA  A 1 61  ? -104.793 -47.351 27.845 1.00 103.95 ? 61   DA  I "C3'" 1 
ATOM   1230  O "O3'" . DA  A 1 61  ? -105.188 -48.537 27.161 1.00 108.12 ? 61   DA  I "O3'" 1 
ATOM   1231  C "C2'" . DA  A 1 61  ? -105.121 -46.102 27.044 1.00 102.82 ? 61   DA  I "C2'" 1 
ATOM   1232  C "C1'" . DA  A 1 61  ? -106.533 -45.775 27.489 1.00 102.38 ? 61   DA  I "C1'" 1 
ATOM   1233  N N9    . DA  A 1 61  ? -106.867 -44.355 27.432 1.00 131.56 ? 61   DA  I N9    1 
ATOM   1234  C C8    . DA  A 1 61  ? -106.042 -43.283 27.665 1.00 132.34 ? 61   DA  I C8    1 
ATOM   1235  N N7    . DA  A 1 61  ? -106.634 -42.120 27.535 1.00 133.17 ? 61   DA  I N7    1 
ATOM   1236  C C5    . DA  A 1 61  ? -107.938 -42.448 27.193 1.00 133.78 ? 61   DA  I C5    1 
ATOM   1237  C C6    . DA  A 1 61  ? -109.070 -41.659 26.916 1.00 134.79 ? 61   DA  I C6    1 
ATOM   1238  N N6    . DA  A 1 61  ? -109.064 -40.324 26.935 1.00 135.01 ? 61   DA  I N6    1 
ATOM   1239  N N1    . DA  A 1 61  ? -110.222 -42.298 26.613 1.00 136.00 ? 61   DA  I N1    1 
ATOM   1240  C C2    . DA  A 1 61  ? -110.223 -43.640 26.589 1.00 136.07 ? 61   DA  I C2    1 
ATOM   1241  N N3    . DA  A 1 61  ? -109.223 -44.490 26.828 1.00 135.28 ? 61   DA  I N3    1 
ATOM   1242  C C4    . DA  A 1 61  ? -108.096 -43.821 27.128 1.00 133.43 ? 61   DA  I C4    1 
ATOM   1243  P P     . DT  A 1 62  ? -104.868 -48.692 25.603 1.00 151.36 ? 62   DT  I P     1 
ATOM   1244  O OP1   . DT  A 1 62  ? -105.085 -50.114 25.241 1.00 133.07 ? 62   DT  I OP1   1 
ATOM   1245  O OP2   . DT  A 1 62  ? -103.560 -48.054 25.318 1.00 131.93 ? 62   DT  I OP2   1 
ATOM   1246  O "O5'" . DT  A 1 62  ? -106.016 -47.818 24.940 1.00 153.30 ? 62   DT  I "O5'" 1 
ATOM   1247  C "C5'" . DT  A 1 62  ? -107.380 -48.159 25.151 1.00 155.17 ? 62   DT  I "C5'" 1 
ATOM   1248  C "C4'" . DT  A 1 62  ? -108.165 -47.916 23.887 1.00 156.61 ? 62   DT  I "C4'" 1 
ATOM   1249  O "O4'" . DT  A 1 62  ? -108.572 -46.530 23.834 1.00 157.52 ? 62   DT  I "O4'" 1 
ATOM   1250  C "C3'" . DT  A 1 62  ? -107.346 -48.181 22.625 1.00 156.77 ? 62   DT  I "C3'" 1 
ATOM   1251  O "O3'" . DT  A 1 62  ? -108.129 -48.860 21.644 1.00 157.35 ? 62   DT  I "O3'" 1 
ATOM   1252  C "C2'" . DT  A 1 62  ? -106.933 -46.794 22.167 1.00 156.82 ? 62   DT  I "C2'" 1 
ATOM   1253  C "C1'" . DT  A 1 62  ? -108.064 -45.905 22.668 1.00 156.90 ? 62   DT  I "C1'" 1 
ATOM   1254  N N1    . DT  A 1 62  ? -107.639 -44.545 23.049 1.00 137.85 ? 62   DT  I N1    1 
ATOM   1255  C C2    . DT  A 1 62  ? -108.498 -43.490 22.805 1.00 137.62 ? 62   DT  I C2    1 
ATOM   1256  O O2    . DT  A 1 62  ? -109.587 -43.623 22.270 1.00 137.08 ? 62   DT  I O2    1 
ATOM   1257  N N3    . DT  A 1 62  ? -108.028 -42.265 23.208 1.00 137.71 ? 62   DT  I N3    1 
ATOM   1258  C C4    . DT  A 1 62  ? -106.811 -41.994 23.806 1.00 138.57 ? 62   DT  I C4    1 
ATOM   1259  O O4    . DT  A 1 62  ? -106.530 -40.840 24.117 1.00 138.56 ? 62   DT  I O4    1 
ATOM   1260  C C5    . DT  A 1 62  ? -105.954 -43.145 24.016 1.00 138.85 ? 62   DT  I C5    1 
ATOM   1261  C C7    . DT  A 1 62  ? -104.606 -42.947 24.633 1.00 139.33 ? 62   DT  I C7    1 
ATOM   1262  C C6    . DT  A 1 62  ? -106.409 -44.345 23.638 1.00 137.80 ? 62   DT  I C6    1 
ATOM   1263  P P     . DG  A 1 63  ? -107.455 -49.308 20.256 1.00 131.10 ? 63   DG  I P     1 
ATOM   1264  O OP1   . DG  A 1 63  ? -108.069 -50.606 19.869 1.00 123.95 ? 63   DG  I OP1   1 
ATOM   1265  O OP2   . DG  A 1 63  ? -105.980 -49.198 20.358 1.00 125.29 ? 63   DG  I OP2   1 
ATOM   1266  O "O5'" . DG  A 1 63  ? -107.962 -48.177 19.262 1.00 132.19 ? 63   DG  I "O5'" 1 
ATOM   1267  C "C5'" . DG  A 1 63  ? -109.323 -47.758 19.285 1.00 133.31 ? 63   DG  I "C5'" 1 
ATOM   1268  C "C4'" . DG  A 1 63  ? -109.492 -46.517 18.445 1.00 134.59 ? 63   DG  I "C4'" 1 
ATOM   1269  O "O4'" . DG  A 1 63  ? -109.051 -45.347 19.178 1.00 134.62 ? 63   DG  I "O4'" 1 
ATOM   1270  C "C3'" . DG  A 1 63  ? -108.669 -46.552 17.157 1.00 136.07 ? 63   DG  I "C3'" 1 
ATOM   1271  O "O3'" . DG  A 1 63  ? -109.414 -45.998 16.075 1.00 137.50 ? 63   DG  I "O3'" 1 
ATOM   1272  C "C2'" . DG  A 1 63  ? -107.490 -45.652 17.476 1.00 135.41 ? 63   DG  I "C2'" 1 
ATOM   1273  C "C1'" . DG  A 1 63  ? -108.138 -44.618 18.375 1.00 134.78 ? 63   DG  I "C1'" 1 
ATOM   1274  N N9    . DG  A 1 63  ? -107.209 -43.911 19.251 1.00 128.96 ? 63   DG  I N9    1 
ATOM   1275  C C8    . DG  A 1 63  ? -106.131 -44.441 19.920 1.00 129.05 ? 63   DG  I C8    1 
ATOM   1276  N N7    . DG  A 1 63  ? -105.459 -43.549 20.598 1.00 128.96 ? 63   DG  I N7    1 
ATOM   1277  C C5    . DG  A 1 63  ? -106.139 -42.359 20.369 1.00 128.60 ? 63   DG  I C5    1 
ATOM   1278  C C6    . DG  A 1 63  ? -105.875 -41.039 20.838 1.00 128.40 ? 63   DG  I C6    1 
ATOM   1279  O O6    . DG  A 1 63  ? -104.953 -40.647 21.569 1.00 128.03 ? 63   DG  I O6    1 
ATOM   1280  N N1    . DG  A 1 63  ? -106.819 -40.131 20.367 1.00 127.95 ? 63   DG  I N1    1 
ATOM   1281  C C2    . DG  A 1 63  ? -107.876 -40.445 19.549 1.00 127.55 ? 63   DG  I C2    1 
ATOM   1282  N N2    . DG  A 1 63  ? -108.672 -39.426 19.206 1.00 125.98 ? 63   DG  I N2    1 
ATOM   1283  N N3    . DG  A 1 63  ? -108.132 -41.667 19.102 1.00 127.41 ? 63   DG  I N3    1 
ATOM   1284  C C4    . DG  A 1 63  ? -107.229 -42.568 19.548 1.00 128.18 ? 63   DG  I C4    1 
ATOM   1285  P P     . DT  A 1 64  ? -108.994 -46.335 14.561 1.00 155.05 ? 64   DT  I P     1 
ATOM   1286  O OP1   . DT  A 1 64  ? -109.865 -47.449 14.101 1.00 124.04 ? 64   DT  I OP1   1 
ATOM   1287  O OP2   . DT  A 1 64  ? -107.514 -46.467 14.461 1.00 123.79 ? 64   DT  I OP2   1 
ATOM   1288  O "O5'" . DT  A 1 64  ? -109.404 -45.012 13.785 1.00 153.46 ? 64   DT  I "O5'" 1 
ATOM   1289  C "C5'" . DT  A 1 64  ? -110.500 -44.221 14.229 1.00 151.21 ? 64   DT  I "C5'" 1 
ATOM   1290  C "C4'" . DT  A 1 64  ? -110.273 -42.777 13.857 1.00 150.41 ? 64   DT  I "C4'" 1 
ATOM   1291  O "O4'" . DT  A 1 64  ? -109.437 -42.112 14.838 1.00 150.25 ? 64   DT  I "O4'" 1 
ATOM   1292  C "C3'" . DT  A 1 64  ? -109.568 -42.613 12.510 1.00 149.98 ? 64   DT  I "C3'" 1 
ATOM   1293  O "O3'" . DT  A 1 64  ? -110.187 -41.573 11.753 1.00 148.86 ? 64   DT  I "O3'" 1 
ATOM   1294  C "C2'" . DT  A 1 64  ? -108.149 -42.231 12.896 1.00 149.86 ? 64   DT  I "C2'" 1 
ATOM   1295  C "C1'" . DT  A 1 64  ? -108.378 -41.443 14.170 1.00 149.93 ? 64   DT  I "C1'" 1 
ATOM   1296  N N1    . DT  A 1 64  ? -107.215 -41.356 15.090 1.00 118.56 ? 64   DT  I N1    1 
ATOM   1297  C C2    . DT  A 1 64  ? -106.898 -40.116 15.607 1.00 118.67 ? 64   DT  I C2    1 
ATOM   1298  O O2    . DT  A 1 64  ? -107.521 -39.099 15.338 1.00 118.19 ? 64   DT  I O2    1 
ATOM   1299  N N3    . DT  A 1 64  ? -105.815 -40.107 16.454 1.00 118.55 ? 64   DT  I N3    1 
ATOM   1300  C C4    . DT  A 1 64  ? -105.032 -41.184 16.822 1.00 117.51 ? 64   DT  I C4    1 
ATOM   1301  O O4    . DT  A 1 64  ? -104.090 -41.019 17.597 1.00 116.35 ? 64   DT  I O4    1 
ATOM   1302  C C5    . DT  A 1 64  ? -105.413 -42.450 16.238 1.00 117.25 ? 64   DT  I C5    1 
ATOM   1303  C C7    . DT  A 1 64  ? -104.615 -43.670 16.573 1.00 117.02 ? 64   DT  I C7    1 
ATOM   1304  C C6    . DT  A 1 64  ? -106.474 -42.474 15.415 1.00 117.91 ? 64   DT  I C6    1 
ATOM   1305  P P     . DT  A 1 65  ? -109.640 -41.225 10.286 1.00 151.65 ? 65   DT  I P     1 
ATOM   1306  O OP1   . DT  A 1 65  ? -110.817 -40.964 9.419  1.00 131.54 ? 65   DT  I OP1   1 
ATOM   1307  O OP2   . DT  A 1 65  ? -108.640 -42.246 9.880  1.00 131.02 ? 65   DT  I OP2   1 
ATOM   1308  O "O5'" . DT  A 1 65  ? -108.889 -39.846 10.515 1.00 149.92 ? 65   DT  I "O5'" 1 
ATOM   1309  C "C5'" . DT  A 1 65  ? -109.612 -38.703 10.950 1.00 147.21 ? 65   DT  I "C5'" 1 
ATOM   1310  C "C4'" . DT  A 1 65  ? -108.753 -37.474 10.804 1.00 145.82 ? 65   DT  I "C4'" 1 
ATOM   1311  O "O4'" . DT  A 1 65  ? -107.764 -37.449 11.862 1.00 145.28 ? 65   DT  I "O4'" 1 
ATOM   1312  C "C3'" . DT  A 1 65  ? -107.975 -37.443 9.490  1.00 145.13 ? 65   DT  I "C3'" 1 
ATOM   1313  O "O3'" . DT  A 1 65  ? -107.945 -36.112 8.969  1.00 144.59 ? 65   DT  I "O3'" 1 
ATOM   1314  C "C2'" . DT  A 1 65  ? -106.589 -37.921 9.889  1.00 144.34 ? 65   DT  I "C2'" 1 
ATOM   1315  C "C1'" . DT  A 1 65  ? -106.461 -37.388 11.306 1.00 144.19 ? 65   DT  I "C1'" 1 
ATOM   1316  N N1    . DT  A 1 65  ? -105.558 -38.150 12.188 1.00 123.13 ? 65   DT  I N1    1 
ATOM   1317  C C2    . DT  A 1 65  ? -105.193 -37.570 13.382 1.00 122.41 ? 65   DT  I C2    1 
ATOM   1318  O O2    . DT  A 1 65  ? -105.601 -36.479 13.742 1.00 121.68 ? 65   DT  I O2    1 
ATOM   1319  N N3    . DT  A 1 65  ? -104.334 -38.324 14.146 1.00 120.94 ? 65   DT  I N3    1 
ATOM   1320  C C4    . DT  A 1 65  ? -103.823 -39.576 13.843 1.00 120.63 ? 65   DT  I C4    1 
ATOM   1321  O O4    . DT  A 1 65  ? -103.055 -40.134 14.623 1.00 118.08 ? 65   DT  I O4    1 
ATOM   1322  C C5    . DT  A 1 65  ? -104.259 -40.130 12.582 1.00 121.95 ? 65   DT  I C5    1 
ATOM   1323  C C7    . DT  A 1 65  ? -103.766 -41.484 12.177 1.00 122.47 ? 65   DT  I C7    1 
ATOM   1324  C C6    . DT  A 1 65  ? -105.094 -39.398 11.827 1.00 122.18 ? 65   DT  I C6    1 
ATOM   1325  P P     . DC  A 1 66  ? -106.946 -35.751 7.767  1.00 115.07 ? 66   DC  I P     1 
ATOM   1326  O OP1   . DC  A 1 66  ? -107.536 -34.616 7.000  1.00 107.00 ? 66   DC  I OP1   1 
ATOM   1327  O OP2   . DC  A 1 66  ? -106.570 -37.011 7.063  1.00 105.69 ? 66   DC  I OP2   1 
ATOM   1328  O "O5'" . DC  A 1 66  ? -105.656 -35.201 8.521  1.00 115.17 ? 66   DC  I "O5'" 1 
ATOM   1329  C "C5'" . DC  A 1 66  ? -105.720 -34.014 9.312  1.00 110.99 ? 66   DC  I "C5'" 1 
ATOM   1330  C "C4'" . DC  A 1 66  ? -104.326 -33.505 9.583  1.00 107.61 ? 66   DC  I "C4'" 1 
ATOM   1331  O "O4'" . DC  A 1 66  ? -103.635 -34.453 10.427 1.00 107.72 ? 66   DC  I "O4'" 1 
ATOM   1332  C "C3'" . DC  A 1 66  ? -103.462 -33.357 8.328  1.00 105.63 ? 66   DC  I "C3'" 1 
ATOM   1333  O "O3'" . DC  A 1 66  ? -102.592 -32.239 8.490  1.00 104.52 ? 66   DC  I "O3'" 1 
ATOM   1334  C "C2'" . DC  A 1 66  ? -102.637 -34.632 8.331  1.00 105.22 ? 66   DC  I "C2'" 1 
ATOM   1335  C "C1'" . DC  A 1 66  ? -102.405 -34.801 9.817  1.00 106.43 ? 66   DC  I "C1'" 1 
ATOM   1336  N N1    . DC  A 1 66  ? -102.018 -36.138 10.293 1.00 98.61  ? 66   DC  I N1    1 
ATOM   1337  C C2    . DC  A 1 66  ? -101.545 -36.261 11.604 1.00 99.59  ? 66   DC  I C2    1 
ATOM   1338  O O2    . DC  A 1 66  ? -101.469 -35.250 12.307 1.00 100.41 ? 66   DC  I O2    1 
ATOM   1339  N N3    . DC  A 1 66  ? -101.186 -37.476 12.072 1.00 98.74  ? 66   DC  I N3    1 
ATOM   1340  C C4    . DC  A 1 66  ? -101.290 -38.546 11.286 1.00 98.77  ? 66   DC  I C4    1 
ATOM   1341  N N4    . DC  A 1 66  ? -100.937 -39.726 11.796 1.00 99.02  ? 66   DC  I N4    1 
ATOM   1342  C C5    . DC  A 1 66  ? -101.764 -38.452 9.942  1.00 98.61  ? 66   DC  I C5    1 
ATOM   1343  C C6    . DC  A 1 66  ? -102.113 -37.237 9.491  1.00 97.82  ? 66   DC  I C6    1 
ATOM   1344  P P     . DA  A 1 67  ? -103.106 -30.765 8.119  1.00 103.48 ? 67   DA  I P     1 
ATOM   1345  O OP1   . DA  A 1 67  ? -104.563 -30.707 8.410  1.00 102.53 ? 67   DA  I OP1   1 
ATOM   1346  O OP2   . DA  A 1 67  ? -102.602 -30.409 6.769  1.00 102.56 ? 67   DA  I OP2   1 
ATOM   1347  O "O5'" . DA  A 1 67  ? -102.366 -29.832 9.173  1.00 102.62 ? 67   DA  I "O5'" 1 
ATOM   1348  C "C5'" . DA  A 1 67  ? -102.732 -29.840 10.557 1.00 97.56  ? 67   DA  I "C5'" 1 
ATOM   1349  C "C4'" . DA  A 1 67  ? -101.498 -29.720 11.422 1.00 93.03  ? 67   DA  I "C4'" 1 
ATOM   1350  O "O4'" . DA  A 1 67  ? -100.848 -31.005 11.568 1.00 91.29  ? 67   DA  I "O4'" 1 
ATOM   1351  C "C3'" . DA  A 1 67  ? -100.440 -28.772 10.862 1.00 91.72  ? 67   DA  I "C3'" 1 
ATOM   1352  O "O3'" . DA  A 1 67  ? -99.876  -27.977 11.904 1.00 91.80  ? 67   DA  I "O3'" 1 
ATOM   1353  C "C2'" . DA  A 1 67  ? -99.407  -29.705 10.249 1.00 89.19  ? 67   DA  I "C2'" 1 
ATOM   1354  C "C1'" . DA  A 1 67  ? -99.497  -30.938 11.134 1.00 89.36  ? 67   DA  I "C1'" 1 
ATOM   1355  N N9    . DA  A 1 67  ? -99.193  -32.197 10.456 1.00 87.07  ? 67   DA  I N9    1 
ATOM   1356  C C8    . DA  A 1 67  ? -99.290  -32.463 9.117  1.00 85.64  ? 67   DA  I C8    1 
ATOM   1357  N N7    . DA  A 1 67  ? -99.005  -33.704 8.801  1.00 84.50  ? 67   DA  I N7    1 
ATOM   1358  C C5    . DA  A 1 67  ? -98.692  -34.297 10.014 1.00 84.56  ? 67   DA  I C5    1 
ATOM   1359  C C6    . DA  A 1 67  ? -98.318  -35.618 10.363 1.00 83.93  ? 67   DA  I C6    1 
ATOM   1360  N N6    . DA  A 1 67  ? -98.219  -36.624 9.490  1.00 82.64  ? 67   DA  I N6    1 
ATOM   1361  N N1    . DA  A 1 67  ? -98.054  -35.871 11.661 1.00 85.49  ? 67   DA  I N1    1 
ATOM   1362  C C2    . DA  A 1 67  ? -98.167  -34.869 12.544 1.00 86.01  ? 67   DA  I C2    1 
ATOM   1363  N N3    . DA  A 1 67  ? -98.522  -33.596 12.342 1.00 86.27  ? 67   DA  I N3    1 
ATOM   1364  C C4    . DA  A 1 67  ? -98.778  -33.375 11.041 1.00 86.14  ? 67   DA  I C4    1 
ATOM   1365  P P     . DG  A 1 68  ? -98.928  -26.745 11.524 1.00 108.27 ? 68   DG  I P     1 
ATOM   1366  O OP1   . DG  A 1 68  ? -99.258  -25.627 12.444 1.00 116.78 ? 68   DG  I OP1   1 
ATOM   1367  O OP2   . DG  A 1 68  ? -98.995  -26.535 10.056 1.00 117.34 ? 68   DG  I OP2   1 
ATOM   1368  O "O5'" . DG  A 1 68  ? -97.474  -27.297 11.853 1.00 107.60 ? 68   DG  I "O5'" 1 
ATOM   1369  C "C5'" . DG  A 1 68  ? -97.237  -28.056 13.032 1.00 104.42 ? 68   DG  I "C5'" 1 
ATOM   1370  C "C4'" . DG  A 1 68  ? -95.959  -28.848 12.890 1.00 103.39 ? 68   DG  I "C4'" 1 
ATOM   1371  O "O4'" . DG  A 1 68  ? -96.167  -30.032 12.080 1.00 103.18 ? 68   DG  I "O4'" 1 
ATOM   1372  C "C3'" . DG  A 1 68  ? -94.812  -28.076 12.230 1.00 101.80 ? 68   DG  I "C3'" 1 
ATOM   1373  O "O3'" . DG  A 1 68  ? -93.570  -28.435 12.848 1.00 100.56 ? 68   DG  I "O3'" 1 
ATOM   1374  C "C2'" . DG  A 1 68  ? -94.809  -28.637 10.821 1.00 101.31 ? 68   DG  I "C2'" 1 
ATOM   1375  C "C1'" . DG  A 1 68  ? -95.130  -30.086 11.122 1.00 102.52 ? 68   DG  I "C1'" 1 
ATOM   1376  N N9    . DG  A 1 68  ? -95.570  -30.900 9.995  1.00 111.49 ? 68   DG  I N9    1 
ATOM   1377  C C8    . DG  A 1 68  ? -96.166  -30.473 8.835  1.00 112.34 ? 68   DG  I C8    1 
ATOM   1378  N N7    . DG  A 1 68  ? -96.407  -31.446 7.997  1.00 111.64 ? 68   DG  I N7    1 
ATOM   1379  C C5    . DG  A 1 68  ? -95.951  -32.581 8.650  1.00 110.38 ? 68   DG  I C5    1 
ATOM   1380  C C6    . DG  A 1 68  ? -95.950  -33.938 8.240  1.00 110.79 ? 68   DG  I C6    1 
ATOM   1381  O O6    . DG  A 1 68  ? -96.359  -34.423 7.179  1.00 111.66 ? 68   DG  I O6    1 
ATOM   1382  N N1    . DG  A 1 68  ? -95.403  -34.765 9.212  1.00 110.06 ? 68   DG  I N1    1 
ATOM   1383  C C2    . DG  A 1 68  ? -94.919  -34.344 10.421 1.00 109.17 ? 68   DG  I C2    1 
ATOM   1384  N N2    . DG  A 1 68  ? -94.441  -35.301 11.225 1.00 110.03 ? 68   DG  I N2    1 
ATOM   1385  N N3    . DG  A 1 68  ? -94.909  -33.080 10.814 1.00 108.13 ? 68   DG  I N3    1 
ATOM   1386  C C4    . DG  A 1 68  ? -95.438  -32.261 9.886  1.00 109.79 ? 68   DG  I C4    1 
ATOM   1387  P P     . DC  A 1 69  ? -92.944  -27.506 14.000 1.00 90.09  ? 69   DC  I P     1 
ATOM   1388  O OP1   . DC  A 1 69  ? -94.029  -27.168 14.956 1.00 88.15  ? 69   DC  I OP1   1 
ATOM   1389  O OP2   . DC  A 1 69  ? -92.115  -26.427 13.411 1.00 88.18  ? 69   DC  I OP2   1 
ATOM   1390  O "O5'" . DC  A 1 69  ? -91.981  -28.505 14.754 1.00 88.22  ? 69   DC  I "O5'" 1 
ATOM   1391  C "C5'" . DC  A 1 69  ? -92.516  -29.625 15.422 1.00 83.95  ? 69   DC  I "C5'" 1 
ATOM   1392  C "C4'" . DC  A 1 69  ? -91.689  -30.838 15.098 1.00 82.39  ? 69   DC  I "C4'" 1 
ATOM   1393  O "O4'" . DC  A 1 69  ? -92.050  -31.381 13.803 1.00 83.91  ? 69   DC  I "O4'" 1 
ATOM   1394  C "C3'" . DC  A 1 69  ? -90.197  -30.523 15.037 1.00 82.03  ? 69   DC  I "C3'" 1 
ATOM   1395  O "O3'" . DC  A 1 69  ? -89.487  -31.506 15.774 1.00 80.53  ? 69   DC  I "O3'" 1 
ATOM   1396  C "C2'" . DC  A 1 69  ? -89.872  -30.620 13.555 1.00 83.44  ? 69   DC  I "C2'" 1 
ATOM   1397  C "C1'" . DC  A 1 69  ? -90.867  -31.665 13.083 1.00 83.58  ? 69   DC  I "C1'" 1 
ATOM   1398  N N1    . DC  A 1 69  ? -91.179  -31.656 11.637 1.00 83.94  ? 69   DC  I N1    1 
ATOM   1399  C C2    . DC  A 1 69  ? -91.153  -32.878 10.931 1.00 83.77  ? 69   DC  I C2    1 
ATOM   1400  O O2    . DC  A 1 69  ? -90.879  -33.921 11.542 1.00 82.84  ? 69   DC  I O2    1 
ATOM   1401  N N3    . DC  A 1 69  ? -91.421  -32.888 9.608  1.00 82.44  ? 69   DC  I N3    1 
ATOM   1402  C C4    . DC  A 1 69  ? -91.705  -31.747 8.979  1.00 82.97  ? 69   DC  I C4    1 
ATOM   1403  N N4    . DC  A 1 69  ? -91.958  -31.809 7.666  1.00 83.05  ? 69   DC  I N4    1 
ATOM   1404  C C5    . DC  A 1 69  ? -91.741  -30.490 9.667  1.00 83.03  ? 69   DC  I C5    1 
ATOM   1405  C C6    . DC  A 1 69  ? -91.480  -30.493 10.984 1.00 82.22  ? 69   DC  I C6    1 
ATOM   1406  P P     . DG  A 1 70  ? -88.058  -31.155 16.410 1.00 65.01  ? 70   DG  I P     1 
ATOM   1407  O OP1   . DG  A 1 70  ? -88.256  -30.988 17.873 1.00 84.33  ? 70   DG  I OP1   1 
ATOM   1408  O OP2   . DG  A 1 70  ? -87.430  -30.058 15.626 1.00 86.20  ? 70   DG  I OP2   1 
ATOM   1409  O "O5'" . DG  A 1 70  ? -87.293  -32.514 16.140 1.00 64.30  ? 70   DG  I "O5'" 1 
ATOM   1410  C "C5'" . DG  A 1 70  ? -87.996  -33.740 16.298 1.00 68.08  ? 70   DG  I "C5'" 1 
ATOM   1411  C "C4'" . DG  A 1 70  ? -87.570  -34.733 15.246 1.00 71.68  ? 70   DG  I "C4'" 1 
ATOM   1412  O "O4'" . DG  A 1 70  ? -87.993  -34.303 13.929 1.00 71.69  ? 70   DG  I "O4'" 1 
ATOM   1413  C "C3'" . DG  A 1 70  ? -86.058  -34.905 15.161 1.00 72.37  ? 70   DG  I "C3'" 1 
ATOM   1414  O "O3'" . DG  A 1 70  ? -85.761  -36.275 14.899 1.00 75.52  ? 70   DG  I "O3'" 1 
ATOM   1415  C "C2'" . DG  A 1 70  ? -85.669  -34.015 13.992 1.00 70.99  ? 70   DG  I "C2'" 1 
ATOM   1416  C "C1'" . DG  A 1 70  ? -86.861  -34.200 13.072 1.00 69.35  ? 70   DG  I "C1'" 1 
ATOM   1417  N N9    . DG  A 1 70  ? -87.118  -33.119 12.130 1.00 89.05  ? 70   DG  I N9    1 
ATOM   1418  C C8    . DG  A 1 70  ? -87.009  -31.762 12.344 1.00 89.25  ? 70   DG  I C8    1 
ATOM   1419  N N7    . DG  A 1 70  ? -87.387  -31.048 11.316 1.00 87.11  ? 70   DG  I N7    1 
ATOM   1420  C C5    . DG  A 1 70  ? -87.753  -31.992 10.365 1.00 89.28  ? 70   DG  I C5    1 
ATOM   1421  C C6    . DG  A 1 70  ? -88.267  -31.825 9.056  1.00 90.00  ? 70   DG  I C6    1 
ATOM   1422  O O6    . DG  A 1 70  ? -88.543  -30.773 8.464  1.00 92.03  ? 70   DG  I O6    1 
ATOM   1423  N N1    . DG  A 1 70  ? -88.476  -33.052 8.431  1.00 88.67  ? 70   DG  I N1    1 
ATOM   1424  C C2    . DG  A 1 70  ? -88.241  -34.281 9.001  1.00 89.64  ? 70   DG  I C2    1 
ATOM   1425  N N2    . DG  A 1 70  ? -88.495  -35.352 8.241  1.00 91.96  ? 70   DG  I N2    1 
ATOM   1426  N N3    . DG  A 1 70  ? -87.787  -34.449 10.227 1.00 89.75  ? 70   DG  I N3    1 
ATOM   1427  C C4    . DG  A 1 70  ? -87.565  -33.272 10.845 1.00 90.05  ? 70   DG  I C4    1 
ATOM   1428  P P     . DG  A 1 71  ? -84.240  -36.758 14.879 1.00 105.21 ? 71   DG  I P     1 
ATOM   1429  O OP1   . DG  A 1 71  ? -84.229  -38.115 15.487 1.00 83.28  ? 71   DG  I OP1   1 
ATOM   1430  O OP2   . DG  A 1 71  ? -83.362  -35.681 15.422 1.00 84.52  ? 71   DG  I OP2   1 
ATOM   1431  O "O5'" . DG  A 1 71  ? -83.920  -36.900 13.334 1.00 106.71 ? 71   DG  I "O5'" 1 
ATOM   1432  C "C5'" . DG  A 1 71  ? -84.529  -37.928 12.569 1.00 109.29 ? 71   DG  I "C5'" 1 
ATOM   1433  C "C4'" . DG  A 1 71  ? -84.035  -37.866 11.147 1.00 111.42 ? 71   DG  I "C4'" 1 
ATOM   1434  O "O4'" . DG  A 1 71  ? -84.552  -36.679 10.501 1.00 112.48 ? 71   DG  I "O4'" 1 
ATOM   1435  C "C3'" . DG  A 1 71  ? -82.516  -37.779 11.027 1.00 113.52 ? 71   DG  I "C3'" 1 
ATOM   1436  O "O3'" . DG  A 1 71  ? -82.135  -38.496 9.868  1.00 117.75 ? 71   DG  I "O3'" 1 
ATOM   1437  C "C2'" . DG  A 1 71  ? -82.268  -36.298 10.809 1.00 111.86 ? 71   DG  I "C2'" 1 
ATOM   1438  C "C1'" . DG  A 1 71  ? -83.473  -35.933 9.971  1.00 111.38 ? 71   DG  I "C1'" 1 
ATOM   1439  N N9    . DG  A 1 71  ? -83.857  -34.530 9.981  1.00 91.07  ? 71   DG  I N9    1 
ATOM   1440  C C8    . DG  A 1 71  ? -83.786  -33.638 11.023 1.00 91.51  ? 71   DG  I C8    1 
ATOM   1441  N N7    . DG  A 1 71  ? -84.203  -32.443 10.699 1.00 91.79  ? 71   DG  I N7    1 
ATOM   1442  C C5    . DG  A 1 71  ? -84.569  -32.561 9.365  1.00 91.07  ? 71   DG  I C5    1 
ATOM   1443  C C6    . DG  A 1 71  ? -85.086  -31.601 8.467  1.00 89.94  ? 71   DG  I C6    1 
ATOM   1444  O O6    . DG  A 1 71  ? -85.328  -30.408 8.673  1.00 88.62  ? 71   DG  I O6    1 
ATOM   1445  N N1    . DG  A 1 71  ? -85.319  -32.150 7.210  1.00 90.56  ? 71   DG  I N1    1 
ATOM   1446  C C2    . DG  A 1 71  ? -85.077  -33.455 6.863  1.00 91.14  ? 71   DG  I C2    1 
ATOM   1447  N N2    . DG  A 1 71  ? -85.345  -33.796 5.598  1.00 93.44  ? 71   DG  I N2    1 
ATOM   1448  N N3    . DG  A 1 71  ? -84.599  -34.359 7.692  1.00 89.44  ? 71   DG  I N3    1 
ATOM   1449  C C4    . DG  A 1 71  ? -84.367  -33.846 8.915  1.00 90.56  ? 71   DG  I C4    1 
ATOM   1450  P P     . DA  A 1 72  ? -80.698  -39.188 9.796  1.00 115.29 ? 72   DA  I P     1 
ATOM   1451  O OP1   . DA  A 1 72  ? -80.810  -40.521 10.443 1.00 102.06 ? 72   DA  I OP1   1 
ATOM   1452  O OP2   . DA  A 1 72  ? -79.669  -38.217 10.256 1.00 102.58 ? 72   DA  I OP2   1 
ATOM   1453  O "O5'" . DA  A 1 72  ? -80.529  -39.411 8.235  1.00 114.87 ? 72   DA  I "O5'" 1 
ATOM   1454  C "C5'" . DA  A 1 72  ? -81.655  -39.770 7.444  1.00 112.69 ? 72   DA  I "C5'" 1 
ATOM   1455  C "C4'" . DA  A 1 72  ? -81.633  -39.021 6.135  1.00 110.92 ? 72   DA  I "C4'" 1 
ATOM   1456  O "O4'" . DA  A 1 72  ? -82.146  -37.675 6.286  1.00 108.43 ? 72   DA  I "O4'" 1 
ATOM   1457  C "C3'" . DA  A 1 72  ? -80.239  -38.885 5.527  1.00 111.47 ? 72   DA  I "C3'" 1 
ATOM   1458  O "O3'" . DA  A 1 72  ? -80.287  -39.200 4.136  1.00 114.79 ? 72   DA  I "O3'" 1 
ATOM   1459  C "C2'" . DA  A 1 72  ? -79.901  -37.418 5.735  1.00 108.59 ? 72   DA  I "C2'" 1 
ATOM   1460  C "C1'" . DA  A 1 72  ? -81.267  -36.771 5.643  1.00 106.58 ? 72   DA  I "C1'" 1 
ATOM   1461  N N9    . DA  A 1 72  ? -81.387  -35.465 6.295  1.00 91.70  ? 72   DA  I N9    1 
ATOM   1462  C C8    . DA  A 1 72  ? -81.079  -35.124 7.588  1.00 91.35  ? 72   DA  I C8    1 
ATOM   1463  N N7    . DA  A 1 72  ? -81.293  -33.860 7.867  1.00 91.13  ? 72   DA  I N7    1 
ATOM   1464  C C5    . DA  A 1 72  ? -81.776  -33.333 6.678  1.00 90.88  ? 72   DA  I C5    1 
ATOM   1465  C C6    . DA  A 1 72  ? -82.183  -32.036 6.312  1.00 90.65  ? 72   DA  I C6    1 
ATOM   1466  N N6    . DA  A 1 72  ? -82.166  -30.992 7.141  1.00 89.52  ? 72   DA  I N6    1 
ATOM   1467  N N1    . DA  A 1 72  ? -82.610  -31.844 5.044  1.00 90.93  ? 72   DA  I N1    1 
ATOM   1468  C C2    . DA  A 1 72  ? -82.620  -32.887 4.211  1.00 91.54  ? 72   DA  I C2    1 
ATOM   1469  N N3    . DA  A 1 72  ? -82.261  -34.151 4.436  1.00 92.13  ? 72   DA  I N3    1 
ATOM   1470  C C4    . DA  A 1 72  ? -81.842  -34.309 5.703  1.00 91.37  ? 72   DA  I C4    1 
ATOM   1471  P P     . DA  A 1 73  ? -78.936  -39.593 3.365  1.00 112.93 ? 73   DA  I P     1 
ATOM   1472  O OP1   . DA  A 1 73  ? -79.168  -40.907 2.714  1.00 99.77  ? 73   DA  I OP1   1 
ATOM   1473  O OP2   . DA  A 1 73  ? -77.777  -39.427 4.290  1.00 99.94  ? 73   DA  I OP2   1 
ATOM   1474  O "O5'" . DA  A 1 73  ? -78.856  -38.461 2.251  1.00 112.28 ? 73   DA  I "O5'" 1 
ATOM   1475  C "C5'" . DA  A 1 73  ? -80.038  -37.984 1.618  1.00 113.62 ? 73   DA  I "C5'" 1 
ATOM   1476  C "C4'" . DA  A 1 73  ? -79.759  -36.668 0.934  1.00 116.32 ? 73   DA  I "C4'" 1 
ATOM   1477  O "O4'" . DA  A 1 73  ? -80.013  -35.557 1.825  1.00 116.88 ? 73   DA  I "O4'" 1 
ATOM   1478  C "C3'" . DA  A 1 73  ? -78.313  -36.524 0.464  1.00 118.01 ? 73   DA  I "C3'" 1 
ATOM   1479  O "O3'" . DA  A 1 73  ? -78.259  -35.975 -0.848 1.00 120.47 ? 73   DA  I "O3'" 1 
ATOM   1480  C "C2'" . DA  A 1 73  ? -77.706  -35.551 1.459  1.00 116.86 ? 73   DA  I "C2'" 1 
ATOM   1481  C "C1'" . DA  A 1 73  ? -78.890  -34.687 1.846  1.00 115.80 ? 73   DA  I "C1'" 1 
ATOM   1482  N N9    . DA  A 1 73  ? -78.793  -34.107 3.189  1.00 101.62 ? 73   DA  I N9    1 
ATOM   1483  C C8    . DA  A 1 73  ? -78.357  -34.723 4.344  1.00 101.39 ? 73   DA  I C8    1 
ATOM   1484  N N7    . DA  A 1 73  ? -78.370  -33.942 5.398  1.00 100.53 ? 73   DA  I N7    1 
ATOM   1485  C C5    . DA  A 1 73  ? -78.847  -32.733 4.911  1.00 100.48 ? 73   DA  I C5    1 
ATOM   1486  C C6    . DA  A 1 73  ? -79.098  -31.498 5.534  1.00 99.68  ? 73   DA  I C6    1 
ATOM   1487  N N6    . DA  A 1 73  ? -78.889  -31.271 6.835  1.00 99.16  ? 73   DA  I N6    1 
ATOM   1488  N N1    . DA  A 1 73  ? -79.581  -30.493 4.768  1.00 98.81  ? 73   DA  I N1    1 
ATOM   1489  C C2    . DA  A 1 73  ? -79.794  -30.728 3.466  1.00 99.87  ? 73   DA  I C2    1 
ATOM   1490  N N3    . DA  A 1 73  ? -79.597  -31.845 2.763  1.00 99.68  ? 73   DA  I N3    1 
ATOM   1491  C C4    . DA  A 1 73  ? -79.116  -32.821 3.553  1.00 100.50 ? 73   DA  I C4    1 
ATOM   1492  P P     . DT  A 1 75  ? -76.886  -36.046 -1.675 1.00 138.57 ? 74   DT  I P     1 
ATOM   1493  O OP1   . DT  A 1 75  ? -77.090  -36.979 -2.811 1.00 94.07  ? 74   DT  I OP1   1 
ATOM   1494  O OP2   . DT  A 1 75  ? -75.770  -36.285 -0.724 1.00 95.07  ? 74   DT  I OP2   1 
ATOM   1495  O "O5'" . DT  A 1 75  ? -76.747  -34.567 -2.234 1.00 137.47 ? 74   DT  I "O5'" 1 
ATOM   1496  C "C5'" . DT  A 1 75  ? -77.887  -33.865 -2.714 1.00 137.85 ? 74   DT  I "C5'" 1 
ATOM   1497  C "C4'" . DT  A 1 75  ? -77.585  -32.388 -2.789 1.00 138.22 ? 74   DT  I "C4'" 1 
ATOM   1498  O "O4'" . DT  A 1 75  ? -77.766  -31.761 -1.492 1.00 137.52 ? 74   DT  I "O4'" 1 
ATOM   1499  C "C3'" . DT  A 1 75  ? -76.145  -32.094 -3.212 1.00 138.92 ? 74   DT  I "C3'" 1 
ATOM   1500  O "O3'" . DT  A 1 75  ? -76.096  -31.051 -4.186 1.00 140.12 ? 74   DT  I "O3'" 1 
ATOM   1501  C "C2'" . DT  A 1 75  ? -75.474  -31.658 -1.920 1.00 137.64 ? 74   DT  I "C2'" 1 
ATOM   1502  C "C1'" . DT  A 1 75  ? -76.615  -30.993 -1.175 1.00 136.54 ? 74   DT  I "C1'" 1 
ATOM   1503  N N1    . DT  A 1 75  ? -76.462  -30.974 0.294  1.00 92.74  ? 74   DT  I N1    1 
ATOM   1504  C C2    . DT  A 1 75  ? -76.613  -29.769 0.955  1.00 92.98  ? 74   DT  I C2    1 
ATOM   1505  O O2    . DT  A 1 75  ? -76.846  -28.716 0.382  1.00 93.95  ? 74   DT  I O2    1 
ATOM   1506  N N3    . DT  A 1 75  ? -76.476  -29.843 2.322  1.00 91.50  ? 74   DT  I N3    1 
ATOM   1507  C C4    . DT  A 1 75  ? -76.199  -30.967 3.073  1.00 89.49  ? 74   DT  I C4    1 
ATOM   1508  O O4    . DT  A 1 75  ? -76.127  -30.882 4.292  1.00 88.59  ? 74   DT  I O4    1 
ATOM   1509  C C5    . DT  A 1 75  ? -76.025  -32.187 2.315  1.00 89.34  ? 74   DT  I C5    1 
ATOM   1510  C C7    . DT  A 1 75  ? -75.679  -33.447 3.039  1.00 89.67  ? 74   DT  I C7    1 
ATOM   1511  C C6    . DT  A 1 75  ? -76.173  -32.132 0.984  1.00 90.88  ? 74   DT  I C6    1 
ATOM   1512  P P     . DC  A 1 76  ? -74.679  -30.419 -4.590 1.00 131.15 ? 75   DC  I P     1 
ATOM   1513  O OP1   . DC  A 1 76  ? -74.832  -29.727 -5.891 1.00 116.27 ? 75   DC  I OP1   1 
ATOM   1514  O OP2   . DC  A 1 76  ? -73.632  -31.459 -4.434 1.00 115.00 ? 75   DC  I OP2   1 
ATOM   1515  O "O5'" . DC  A 1 76  ? -74.474  -29.300 -3.482 1.00 129.05 ? 75   DC  I "O5'" 1 
ATOM   1516  C "C5'" . DC  A 1 76  ? -75.419  -28.244 -3.347 1.00 125.96 ? 75   DC  I "C5'" 1 
ATOM   1517  C "C4'" . DC  A 1 76  ? -74.796  -27.100 -2.588 1.00 125.01 ? 75   DC  I "C4'" 1 
ATOM   1518  O "O4'" . DC  A 1 76  ? -74.728  -27.409 -1.175 1.00 124.42 ? 75   DC  I "O4'" 1 
ATOM   1519  C "C3'" . DC  A 1 76  ? -73.363  -26.821 -3.025 1.00 124.57 ? 75   DC  I "C3'" 1 
ATOM   1520  O "O3'" . DC  A 1 76  ? -73.128  -25.422 -2.960 1.00 126.01 ? 75   DC  I "O3'" 1 
ATOM   1521  C "C2'" . DC  A 1 76  ? -72.533  -27.552 -1.983 1.00 123.06 ? 75   DC  I "C2'" 1 
ATOM   1522  C "C1'" . DC  A 1 76  ? -73.378  -27.369 -0.734 1.00 120.85 ? 75   DC  I "C1'" 1 
ATOM   1523  N N1    . DC  A 1 76  ? -73.214  -28.403 0.303  1.00 99.76  ? 75   DC  I N1    1 
ATOM   1524  C C2    . DC  A 1 76  ? -73.345  -28.031 1.651  1.00 96.57  ? 75   DC  I C2    1 
ATOM   1525  O O2    . DC  A 1 76  ? -73.570  -26.840 1.927  1.00 93.54  ? 75   DC  I O2    1 
ATOM   1526  N N3    . DC  A 1 76  ? -73.222  -28.975 2.613  1.00 94.88  ? 75   DC  I N3    1 
ATOM   1527  C C4    . DC  A 1 76  ? -72.978  -30.243 2.273  1.00 94.62  ? 75   DC  I C4    1 
ATOM   1528  N N4    . DC  A 1 76  ? -72.878  -31.143 3.250  1.00 92.98  ? 75   DC  I N4    1 
ATOM   1529  C C5    . DC  A 1 76  ? -72.829  -30.645 0.913  1.00 95.92  ? 75   DC  I C5    1 
ATOM   1530  C C6    . DC  A 1 76  ? -72.951  -29.702 -0.030 1.00 97.88  ? 75   DC  I C6    1 
ATOM   1531  P P     . DC  A 1 77  ? -72.265  -24.712 -4.104 1.00 151.53 ? 76   DC  I P     1 
ATOM   1532  O OP1   . DC  A 1 77  ? -73.220  -23.997 -4.986 1.00 123.21 ? 76   DC  I OP1   1 
ATOM   1533  O OP2   . DC  A 1 77  ? -71.334  -25.713 -4.684 1.00 121.90 ? 76   DC  I OP2   1 
ATOM   1534  O "O5'" . DC  A 1 77  ? -71.415  -23.636 -3.297 1.00 152.35 ? 76   DC  I "O5'" 1 
ATOM   1535  C "C5'" . DC  A 1 77  ? -72.057  -22.658 -2.481 1.00 150.59 ? 76   DC  I "C5'" 1 
ATOM   1536  C "C4'" . DC  A 1 77  ? -71.143  -22.251 -1.350 1.00 148.42 ? 76   DC  I "C4'" 1 
ATOM   1537  O "O4'" . DC  A 1 77  ? -71.145  -23.248 -0.302 1.00 148.08 ? 76   DC  I "O4'" 1 
ATOM   1538  C "C3'" . DC  A 1 77  ? -69.683  -22.081 -1.770 1.00 147.43 ? 76   DC  I "C3'" 1 
ATOM   1539  O "O3'" . DC  A 1 77  ? -69.124  -20.994 -1.053 1.00 146.48 ? 76   DC  I "O3'" 1 
ATOM   1540  C "C2'" . DC  A 1 77  ? -69.035  -23.365 -1.294 1.00 146.93 ? 76   DC  I "C2'" 1 
ATOM   1541  C "C1'" . DC  A 1 77  ? -69.805  -23.617 -0.014 1.00 146.44 ? 76   DC  I "C1'" 1 
ATOM   1542  N N1    . DC  A 1 77  ? -69.802  -25.010 0.455  1.00 116.85 ? 76   DC  I N1    1 
ATOM   1543  C C2    . DC  A 1 77  ? -70.137  -25.261 1.780  1.00 115.70 ? 76   DC  I C2    1 
ATOM   1544  O O2    . DC  A 1 77  ? -70.436  -24.305 2.510  1.00 114.89 ? 76   DC  I O2    1 
ATOM   1545  N N3    . DC  A 1 77  ? -70.127  -26.534 2.235  1.00 115.61 ? 76   DC  I N3    1 
ATOM   1546  C C4    . DC  A 1 77  ? -69.794  -27.532 1.414  1.00 116.04 ? 76   DC  I C4    1 
ATOM   1547  N N4    . DC  A 1 77  ? -69.785  -28.770 1.906  1.00 117.19 ? 76   DC  I N4    1 
ATOM   1548  C C5    . DC  A 1 77  ? -69.454  -27.304 0.052  1.00 115.77 ? 76   DC  I C5    1 
ATOM   1549  C C6    . DC  A 1 77  ? -69.472  -26.039 -0.382 1.00 115.95 ? 76   DC  I C6    1 
ATOM   1550  P P     . DG  A 1 78  ? -69.333  -19.513 -1.601 1.00 118.43 ? 77   DG  I P     1 
ATOM   1551  O OP1   . DG  A 1 78  ? -70.741  -19.431 -2.070 1.00 120.24 ? 77   DG  I OP1   1 
ATOM   1552  O OP2   . DG  A 1 78  ? -68.221  -19.198 -2.525 1.00 121.39 ? 77   DG  I OP2   1 
ATOM   1553  O "O5'" . DG  A 1 78  ? -69.201  -18.609 -0.304 1.00 118.56 ? 77   DG  I "O5'" 1 
ATOM   1554  C "C5'" . DG  A 1 78  ? -70.280  -18.507 0.616  1.00 113.58 ? 77   DG  I "C5'" 1 
ATOM   1555  C "C4'" . DG  A 1 78  ? -69.757  -18.588 2.029  1.00 109.33 ? 77   DG  I "C4'" 1 
ATOM   1556  O "O4'" . DG  A 1 78  ? -69.394  -19.954 2.351  1.00 108.23 ? 77   DG  I "O4'" 1 
ATOM   1557  C "C3'" . DG  A 1 78  ? -68.501  -17.752 2.255  1.00 107.84 ? 77   DG  I "C3'" 1 
ATOM   1558  O "O3'" . DG  A 1 78  ? -68.583  -17.086 3.511  1.00 110.22 ? 77   DG  I "O3'" 1 
ATOM   1559  C "C2'" . DG  A 1 78  ? -67.377  -18.776 2.238  1.00 104.50 ? 77   DG  I "C2'" 1 
ATOM   1560  C "C1'" . DG  A 1 78  ? -68.052  -20.008 2.813  1.00 103.66 ? 77   DG  I "C1'" 1 
ATOM   1561  N N9    . DG  A 1 78  ? -67.487  -21.283 2.383  1.00 101.72 ? 77   DG  I N9    1 
ATOM   1562  C C8    . DG  A 1 78  ? -67.017  -21.594 1.133  1.00 100.18 ? 77   DG  I C8    1 
ATOM   1563  N N7    . DG  A 1 78  ? -66.604  -22.829 1.031  1.00 98.55  ? 77   DG  I N7    1 
ATOM   1564  C C5    . DG  A 1 78  ? -66.806  -23.366 2.293  1.00 97.97  ? 77   DG  I C5    1 
ATOM   1565  C C6    . DG  A 1 78  ? -66.555  -24.677 2.785  1.00 96.61  ? 77   DG  I C6    1 
ATOM   1566  O O6    . DG  A 1 78  ? -66.104  -25.655 2.175  1.00 91.86  ? 77   DG  I O6    1 
ATOM   1567  N N1    . DG  A 1 78  ? -66.895  -24.794 4.131  1.00 95.88  ? 77   DG  I N1    1 
ATOM   1568  C C2    . DG  A 1 78  ? -67.415  -23.785 4.906  1.00 96.35  ? 77   DG  I C2    1 
ATOM   1569  N N2    . DG  A 1 78  ? -67.664  -24.094 6.191  1.00 93.51  ? 77   DG  I N2    1 
ATOM   1570  N N3    . DG  A 1 78  ? -67.667  -22.559 4.454  1.00 98.20  ? 77   DG  I N3    1 
ATOM   1571  C C4    . DG  A 1 78  ? -67.339  -22.423 3.147  1.00 100.29 ? 77   DG  I C4    1 
ATOM   1572  P P     . DC  A 1 79  ? -67.480  -15.990 3.896  1.00 98.94  ? 78   DC  I P     1 
ATOM   1573  O OP1   . DC  A 1 79  ? -68.175  -14.820 4.508  1.00 105.54 ? 78   DC  I OP1   1 
ATOM   1574  O OP2   . DC  A 1 79  ? -66.576  -15.786 2.732  1.00 103.76 ? 78   DC  I OP2   1 
ATOM   1575  O "O5'" . DC  A 1 79  ? -66.630  -16.723 5.021  1.00 99.06  ? 78   DC  I "O5'" 1 
ATOM   1576  C "C5'" . DC  A 1 79  ? -67.271  -17.429 6.080  1.00 95.85  ? 78   DC  I "C5'" 1 
ATOM   1577  C "C4'" . DC  A 1 79  ? -66.252  -18.240 6.840  1.00 93.08  ? 78   DC  I "C4'" 1 
ATOM   1578  O "O4'" . DC  A 1 79  ? -65.928  -19.453 6.118  1.00 92.16  ? 78   DC  I "O4'" 1 
ATOM   1579  C "C3'" . DC  A 1 79  ? -64.929  -17.501 7.048  1.00 92.00  ? 78   DC  I "C3'" 1 
ATOM   1580  O "O3'" . DC  A 1 79  ? -64.425  -17.796 8.343  1.00 90.63  ? 78   DC  I "O3'" 1 
ATOM   1581  C "C2'" . DC  A 1 79  ? -64.018  -18.130 6.012  1.00 91.36  ? 78   DC  I "C2'" 1 
ATOM   1582  C "C1'" . DC  A 1 79  ? -64.521  -19.557 6.014  1.00 92.29  ? 78   DC  I "C1'" 1 
ATOM   1583  N N1    . DC  A 1 79  ? -64.208  -20.338 4.815  1.00 99.33  ? 78   DC  I N1    1 
ATOM   1584  C C2    . DC  A 1 79  ? -64.155  -21.728 4.919  1.00 98.90  ? 78   DC  I C2    1 
ATOM   1585  O O2    . DC  A 1 79  ? -64.373  -22.254 6.021  1.00 98.99  ? 78   DC  I O2    1 
ATOM   1586  N N3    . DC  A 1 79  ? -63.866  -22.463 3.820  1.00 97.36  ? 78   DC  I N3    1 
ATOM   1587  C C4    . DC  A 1 79  ? -63.635  -21.856 2.655  1.00 98.95  ? 78   DC  I C4    1 
ATOM   1588  N N4    . DC  A 1 79  ? -63.347  -22.612 1.600  1.00 99.96  ? 78   DC  I N4    1 
ATOM   1589  C C5    . DC  A 1 79  ? -63.686  -20.441 2.522  1.00 100.67 ? 78   DC  I C5    1 
ATOM   1590  C C6    . DC  A 1 79  ? -63.973  -19.726 3.617  1.00 99.48  ? 78   DC  I C6    1 
ATOM   1591  P P     . DT  A 1 80  ? -64.745  -16.808 9.558  1.00 105.22 ? 79   DT  I P     1 
ATOM   1592  O OP1   . DT  A 1 80  ? -66.095  -16.224 9.348  1.00 97.35  ? 79   DT  I OP1   1 
ATOM   1593  O OP2   . DT  A 1 80  ? -63.566  -15.924 9.735  1.00 98.19  ? 79   DT  I OP2   1 
ATOM   1594  O "O5'" . DT  A 1 80  ? -64.848  -17.781 10.805 1.00 103.67 ? 79   DT  I "O5'" 1 
ATOM   1595  C "C5'" . DT  A 1 80  ? -65.743  -18.884 10.785 1.00 97.17  ? 79   DT  I "C5'" 1 
ATOM   1596  C "C4'" . DT  A 1 80  ? -64.994  -20.161 11.086 1.00 91.95  ? 79   DT  I "C4'" 1 
ATOM   1597  O "O4'" . DT  A 1 80  ? -64.292  -20.686 9.930  1.00 91.16  ? 79   DT  I "O4'" 1 
ATOM   1598  C "C3'" . DT  A 1 80  ? -63.947  -20.050 12.194 1.00 89.77  ? 79   DT  I "C3'" 1 
ATOM   1599  O "O3'" . DT  A 1 80  ? -64.041  -21.243 12.958 1.00 89.33  ? 79   DT  I "O3'" 1 
ATOM   1600  C "C2'" . DT  A 1 80  ? -62.633  -20.045 11.428 1.00 89.34  ? 79   DT  I "C2'" 1 
ATOM   1601  C "C1'" . DT  A 1 80  ? -62.969  -21.017 10.319 1.00 90.27  ? 79   DT  I "C1'" 1 
ATOM   1602  N N1    . DT  A 1 80  ? -62.125  -20.993 9.121  1.00 85.33  ? 79   DT  I N1    1 
ATOM   1603  C C2    . DT  A 1 80  ? -61.730  -22.204 8.609  1.00 87.62  ? 79   DT  I C2    1 
ATOM   1604  O O2    . DT  A 1 80  ? -61.988  -23.266 9.144  1.00 88.68  ? 79   DT  I O2    1 
ATOM   1605  N N3    . DT  A 1 80  ? -61.014  -22.132 7.446  1.00 89.16  ? 79   DT  I N3    1 
ATOM   1606  C C4    . DT  A 1 80  ? -60.646  -20.995 6.765  1.00 88.72  ? 79   DT  I C4    1 
ATOM   1607  O O4    . DT  A 1 80  ? -60.029  -21.093 5.709  1.00 90.41  ? 79   DT  I O4    1 
ATOM   1608  C C5    . DT  A 1 80  ? -61.051  -19.749 7.384  1.00 89.13  ? 79   DT  I C5    1 
ATOM   1609  C C7    . DT  A 1 80  ? -60.657  -18.456 6.741  1.00 90.07  ? 79   DT  I C7    1 
ATOM   1610  C C6    . DT  A 1 80  ? -61.765  -19.812 8.518  1.00 87.47  ? 79   DT  I C6    1 
ATOM   1611  P P     . DG  A 1 81  ? -63.536  -21.278 14.475 1.00 75.17  ? 80   DG  I P     1 
ATOM   1612  O OP1   . DG  A 1 81  ? -64.686  -21.059 15.387 1.00 63.64  ? 80   DG  I OP1   1 
ATOM   1613  O OP2   . DG  A 1 81  ? -62.280  -20.471 14.634 1.00 58.59  ? 80   DG  I OP2   1 
ATOM   1614  O "O5'" . DG  A 1 81  ? -63.162  -22.803 14.623 1.00 73.14  ? 80   DG  I "O5'" 1 
ATOM   1615  C "C5'" . DG  A 1 81  ? -61.898  -23.144 15.100 1.00 73.35  ? 80   DG  I "C5'" 1 
ATOM   1616  C "C4'" . DG  A 1 81  ? -61.218  -24.105 14.164 1.00 69.78  ? 80   DG  I "C4'" 1 
ATOM   1617  O "O4'" . DG  A 1 81  ? -60.971  -23.544 12.848 1.00 70.05  ? 80   DG  I "O4'" 1 
ATOM   1618  C "C3'" . DG  A 1 81  ? -59.850  -24.396 14.755 1.00 67.73  ? 80   DG  I "C3'" 1 
ATOM   1619  O "O3'" . DG  A 1 81  ? -59.579  -25.763 14.630 1.00 63.69  ? 80   DG  I "O3'" 1 
ATOM   1620  C "C2'" . DG  A 1 81  ? -58.900  -23.570 13.916 1.00 69.07  ? 80   DG  I "C2'" 1 
ATOM   1621  C "C1'" . DG  A 1 81  ? -59.573  -23.631 12.572 1.00 73.77  ? 80   DG  I "C1'" 1 
ATOM   1622  N N9    . DG  A 1 81  ? -59.187  -22.539 11.688 1.00 70.14  ? 80   DG  I N9    1 
ATOM   1623  C C8    . DG  A 1 81  ? -59.340  -21.188 11.903 1.00 72.64  ? 80   DG  I C8    1 
ATOM   1624  N N7    . DG  A 1 81  ? -58.919  -20.458 10.906 1.00 70.99  ? 80   DG  I N7    1 
ATOM   1625  C C5    . DG  A 1 81  ? -58.457  -21.383 9.981  1.00 73.65  ? 80   DG  I C5    1 
ATOM   1626  C C6    . DG  A 1 81  ? -57.903  -21.190 8.696  1.00 75.68  ? 80   DG  I C6    1 
ATOM   1627  O O6    . DG  A 1 81  ? -57.729  -20.128 8.089  1.00 77.46  ? 80   DG  I O6    1 
ATOM   1628  N N1    . DG  A 1 81  ? -57.543  -22.397 8.104  1.00 76.85  ? 80   DG  I N1    1 
ATOM   1629  C C2    . DG  A 1 81  ? -57.711  -23.635 8.674  1.00 76.76  ? 80   DG  I C2    1 
ATOM   1630  N N2    . DG  A 1 81  ? -57.286  -24.689 7.953  1.00 78.57  ? 80   DG  I N2    1 
ATOM   1631  N N3    . DG  A 1 81  ? -58.251  -23.829 9.868  1.00 74.61  ? 80   DG  I N3    1 
ATOM   1632  C C4    . DG  A 1 81  ? -58.597  -22.668 10.458 1.00 72.41  ? 80   DG  I C4    1 
ATOM   1633  P P     . DA  A 1 82  ? -58.535  -26.423 15.614 1.00 62.24  ? 81   DA  I P     1 
ATOM   1634  O OP1   . DA  A 1 82  ? -59.305  -27.312 16.514 1.00 74.15  ? 81   DA  I OP1   1 
ATOM   1635  O OP2   . DA  A 1 82  ? -57.681  -25.347 16.183 1.00 67.17  ? 81   DA  I OP2   1 
ATOM   1636  O "O5'" . DA  A 1 82  ? -57.701  -27.328 14.622 1.00 61.85  ? 81   DA  I "O5'" 1 
ATOM   1637  C "C5'" . DA  A 1 82  ? -58.371  -28.199 13.729 1.00 59.79  ? 81   DA  I "C5'" 1 
ATOM   1638  C "C4'" . DA  A 1 82  ? -57.376  -28.767 12.751 1.00 60.76  ? 81   DA  I "C4'" 1 
ATOM   1639  O "O4'" . DA  A 1 82  ? -57.045  -27.760 11.767 1.00 60.98  ? 81   DA  I "O4'" 1 
ATOM   1640  C "C3'" . DA  A 1 82  ? -56.067  -29.160 13.425 1.00 58.82  ? 81   DA  I "C3'" 1 
ATOM   1641  O "O3'" . DA  A 1 82  ? -55.569  -30.364 12.851 1.00 57.38  ? 81   DA  I "O3'" 1 
ATOM   1642  C "C2'" . DA  A 1 82  ? -55.168  -27.959 13.185 1.00 58.41  ? 81   DA  I "C2'" 1 
ATOM   1643  C "C1'" . DA  A 1 82  ? -55.682  -27.381 11.873 1.00 59.10  ? 81   DA  I "C1'" 1 
ATOM   1644  N N9    . DA  A 1 82  ? -55.633  -25.921 11.779 1.00 66.02  ? 81   DA  I N9    1 
ATOM   1645  C C8    . DA  A 1 82  ? -56.091  -25.011 12.697 1.00 66.59  ? 81   DA  I C8    1 
ATOM   1646  N N7    . DA  A 1 82  ? -55.946  -23.762 12.323 1.00 66.99  ? 81   DA  I N7    1 
ATOM   1647  C C5    . DA  A 1 82  ? -55.340  -23.857 11.082 1.00 67.15  ? 81   DA  I C5    1 
ATOM   1648  C C6    . DA  A 1 82  ? -54.919  -22.887 10.169 1.00 67.65  ? 81   DA  I C6    1 
ATOM   1649  N N6    . DA  A 1 82  ? -55.052  -21.575 10.373 1.00 66.80  ? 81   DA  I N6    1 
ATOM   1650  N N1    . DA  A 1 82  ? -54.345  -23.312 9.024  1.00 67.35  ? 81   DA  I N1    1 
ATOM   1651  C C2    . DA  A 1 82  ? -54.209  -24.627 8.825  1.00 65.99  ? 81   DA  I C2    1 
ATOM   1652  N N3    . DA  A 1 82  ? -54.569  -25.637 9.610  1.00 66.09  ? 81   DA  I N3    1 
ATOM   1653  C C4    . DA  A 1 82  ? -55.135  -25.179 10.736 1.00 66.85  ? 81   DA  I C4    1 
ATOM   1654  P P     . DA  A 1 83  ? -54.294  -31.082 13.496 1.00 59.55  ? 82   DA  I P     1 
ATOM   1655  O OP1   . DA  A 1 83  ? -54.508  -32.559 13.388 1.00 61.07  ? 82   DA  I OP1   1 
ATOM   1656  O OP2   . DA  A 1 83  ? -53.992  -30.474 14.827 1.00 63.97  ? 82   DA  I OP2   1 
ATOM   1657  O "O5'" . DA  A 1 83  ? -53.131  -30.647 12.502 1.00 61.94  ? 82   DA  I "O5'" 1 
ATOM   1658  C "C5'" . DA  A 1 83  ? -53.283  -30.835 11.101 1.00 62.01  ? 82   DA  I "C5'" 1 
ATOM   1659  C "C4'" . DA  A 1 83  ? -52.123  -30.226 10.344 1.00 63.05  ? 82   DA  I "C4'" 1 
ATOM   1660  O "O4'" . DA  A 1 83  ? -52.263  -28.791 10.194 1.00 62.77  ? 82   DA  I "O4'" 1 
ATOM   1661  C "C3'" . DA  A 1 83  ? -50.729  -30.465 10.917 1.00 62.50  ? 82   DA  I "C3'" 1 
ATOM   1662  O "O3'" . DA  A 1 83  ? -49.876  -30.886 9.874  1.00 67.13  ? 82   DA  I "O3'" 1 
ATOM   1663  C "C2'" . DA  A 1 83  ? -50.285  -29.095 11.399 1.00 61.32  ? 82   DA  I "C2'" 1 
ATOM   1664  C "C1'" . DA  A 1 83  ? -51.033  -28.151 10.480 1.00 59.86  ? 82   DA  I "C1'" 1 
ATOM   1665  N N9    . DA  A 1 83  ? -51.362  -26.866 11.079 1.00 61.63  ? 82   DA  I N9    1 
ATOM   1666  C C8    . DA  A 1 83  ? -51.885  -26.626 12.326 1.00 62.04  ? 82   DA  I C8    1 
ATOM   1667  N N7    . DA  A 1 83  ? -52.113  -25.357 12.566 1.00 60.91  ? 82   DA  I N7    1 
ATOM   1668  C C5    . DA  A 1 83  ? -51.712  -24.721 11.401 1.00 59.10  ? 82   DA  I C5    1 
ATOM   1669  C C6    . DA  A 1 83  ? -51.706  -23.371 11.015 1.00 59.61  ? 82   DA  I C6    1 
ATOM   1670  N N6    . DA  A 1 83  ? -52.128  -22.376 11.796 1.00 61.61  ? 82   DA  I N6    1 
ATOM   1671  N N1    . DA  A 1 83  ? -51.241  -23.072 9.783  1.00 60.29  ? 82   DA  I N1    1 
ATOM   1672  C C2    . DA  A 1 83  ? -50.809  -24.070 9.001  1.00 58.30  ? 82   DA  I C2    1 
ATOM   1673  N N3    . DA  A 1 83  ? -50.762  -25.377 9.250  1.00 61.02  ? 82   DA  I N3    1 
ATOM   1674  C C4    . DA  A 1 83  ? -51.235  -25.638 10.482 1.00 60.21  ? 82   DA  I C4    1 
ATOM   1675  P P     . DC  A 1 84  ? -48.360  -31.248 10.202 1.00 67.30  ? 83   DC  I P     1 
ATOM   1676  O OP1   . DC  A 1 84  ? -47.991  -32.264 9.184  1.00 64.83  ? 83   DC  I OP1   1 
ATOM   1677  O OP2   . DC  A 1 84  ? -48.227  -31.566 11.647 1.00 64.57  ? 83   DC  I OP2   1 
ATOM   1678  O "O5'" . DC  A 1 84  ? -47.594  -29.879 9.946  1.00 67.40  ? 83   DC  I "O5'" 1 
ATOM   1679  C "C5'" . DC  A 1 84  ? -47.662  -29.236 8.684  1.00 69.97  ? 83   DC  I "C5'" 1 
ATOM   1680  C "C4'" . DC  A 1 84  ? -46.863  -27.956 8.715  1.00 74.98  ? 83   DC  I "C4'" 1 
ATOM   1681  O "O4'" . DC  A 1 84  ? -47.630  -26.857 9.264  1.00 75.56  ? 83   DC  I "O4'" 1 
ATOM   1682  C "C3'" . DC  A 1 84  ? -45.590  -28.042 9.555  1.00 79.67  ? 83   DC  I "C3'" 1 
ATOM   1683  O "O3'" . DC  A 1 84  ? -44.543  -27.347 8.890  1.00 87.25  ? 83   DC  I "O3'" 1 
ATOM   1684  C "C2'" . DC  A 1 84  ? -45.951  -27.262 10.804 1.00 78.21  ? 83   DC  I "C2'" 1 
ATOM   1685  C "C1'" . DC  A 1 84  ? -46.815  -26.180 10.202 1.00 74.22  ? 83   DC  I "C1'" 1 
ATOM   1686  N N1    . DC  A 1 84  ? -47.678  -25.462 11.144 1.00 68.43  ? 83   DC  I N1    1 
ATOM   1687  C C2    . DC  A 1 84  ? -47.940  -24.112 10.911 1.00 66.92  ? 83   DC  I C2    1 
ATOM   1688  O O2    . DC  A 1 84  ? -47.470  -23.586 9.908  1.00 68.52  ? 83   DC  I O2    1 
ATOM   1689  N N3    . DC  A 1 84  ? -48.701  -23.420 11.783 1.00 65.31  ? 83   DC  I N3    1 
ATOM   1690  C C4    . DC  A 1 84  ? -49.205  -24.033 12.851 1.00 65.17  ? 83   DC  I C4    1 
ATOM   1691  N N4    . DC  A 1 84  ? -49.957  -23.318 13.681 1.00 64.07  ? 83   DC  I N4    1 
ATOM   1692  C C5    . DC  A 1 84  ? -48.965  -25.415 13.112 1.00 64.97  ? 83   DC  I C5    1 
ATOM   1693  C C6    . DC  A 1 84  ? -48.206  -26.086 12.238 1.00 65.18  ? 83   DC  I C6    1 
ATOM   1694  P P     . DA  A 1 85  ? -43.118  -28.049 8.699  1.00 99.51  ? 84   DA  I P     1 
ATOM   1695  O OP1   . DA  A 1 85  ? -43.261  -28.988 7.556  1.00 93.31  ? 84   DA  I OP1   1 
ATOM   1696  O OP2   . DA  A 1 85  ? -42.623  -28.554 10.005 1.00 94.36  ? 84   DA  I OP2   1 
ATOM   1697  O "O5'" . DA  A 1 85  ? -42.203  -26.829 8.260  1.00 102.00 ? 84   DA  I "O5'" 1 
ATOM   1698  C "C5'" . DA  A 1 85  ? -42.589  -25.969 7.194  1.00 106.72 ? 84   DA  I "C5'" 1 
ATOM   1699  C "C4'" . DA  A 1 85  ? -42.051  -24.583 7.447  1.00 110.33 ? 84   DA  I "C4'" 1 
ATOM   1700  O "O4'" . DA  A 1 85  ? -42.963  -23.863 8.306  1.00 110.90 ? 84   DA  I "O4'" 1 
ATOM   1701  C "C3'" . DA  A 1 85  ? -40.706  -24.605 8.174  1.00 112.33 ? 84   DA  I "C3'" 1 
ATOM   1702  O "O3'" . DA  A 1 85  ? -39.823  -23.595 7.681  1.00 114.75 ? 84   DA  I "O3'" 1 
ATOM   1703  C "C2'" . DA  A 1 85  ? -41.080  -24.346 9.621  1.00 111.61 ? 84   DA  I "C2'" 1 
ATOM   1704  C "C1'" . DA  A 1 85  ? -42.304  -23.461 9.497  1.00 111.53 ? 84   DA  I "C1'" 1 
ATOM   1705  N N9    . DA  A 1 85  ? -43.243  -23.637 10.600 1.00 106.42 ? 84   DA  I N9    1 
ATOM   1706  C C8    . DA  A 1 85  ? -43.656  -24.820 11.152 1.00 106.39 ? 84   DA  I C8    1 
ATOM   1707  N N7    . DA  A 1 85  ? -44.506  -24.674 12.136 1.00 105.66 ? 84   DA  I N7    1 
ATOM   1708  C C5    . DA  A 1 85  ? -44.662  -23.302 12.238 1.00 105.97 ? 84   DA  I C5    1 
ATOM   1709  C C6    . DA  A 1 85  ? -45.431  -22.510 13.090 1.00 106.43 ? 84   DA  I C6    1 
ATOM   1710  N N6    . DA  A 1 85  ? -46.214  -23.011 14.044 1.00 105.67 ? 84   DA  I N6    1 
ATOM   1711  N N1    . DA  A 1 85  ? -45.370  -21.170 12.932 1.00 106.88 ? 84   DA  I N1    1 
ATOM   1712  C C2    . DA  A 1 85  ? -44.580  -20.676 11.972 1.00 106.45 ? 84   DA  I C2    1 
ATOM   1713  N N3    . DA  A 1 85  ? -43.804  -21.323 11.107 1.00 106.49 ? 84   DA  I N3    1 
ATOM   1714  C C4    . DA  A 1 85  ? -43.892  -22.650 11.296 1.00 106.22 ? 84   DA  I C4    1 
ATOM   1715  P P     . DT  A 1 86  ? -38.458  -23.285 8.470  1.00 117.68 ? 85   DT  I P     1 
ATOM   1716  O OP1   . DT  A 1 86  ? -37.417  -22.975 7.451  1.00 104.79 ? 85   DT  I OP1   1 
ATOM   1717  O OP2   . DT  A 1 86  ? -38.218  -24.375 9.455  1.00 103.48 ? 85   DT  I OP2   1 
ATOM   1718  O "O5'" . DT  A 1 86  ? -38.824  -21.950 9.257  1.00 117.69 ? 85   DT  I "O5'" 1 
ATOM   1719  C "C5'" . DT  A 1 86  ? -39.604  -20.935 8.624  1.00 119.28 ? 85   DT  I "C5'" 1 
ATOM   1720  C "C4'" . DT  A 1 86  ? -39.658  -19.696 9.487  1.00 120.82 ? 85   DT  I "C4'" 1 
ATOM   1721  O "O4'" . DT  A 1 86  ? -40.667  -19.818 10.518 1.00 121.22 ? 85   DT  I "O4'" 1 
ATOM   1722  C "C3'" . DT  A 1 86  ? -38.349  -19.379 10.203 1.00 122.38 ? 85   DT  I "C3'" 1 
ATOM   1723  O "O3'" . DT  A 1 86  ? -38.120  -17.974 10.167 1.00 124.30 ? 85   DT  I "O3'" 1 
ATOM   1724  C "C2'" . DT  A 1 86  ? -38.598  -19.859 11.623 1.00 121.99 ? 85   DT  I "C2'" 1 
ATOM   1725  C "C1'" . DT  A 1 86  ? -40.087  -19.596 11.799 1.00 122.02 ? 85   DT  I "C1'" 1 
ATOM   1726  N N1    . DT  A 1 86  ? -40.784  -20.475 12.778 1.00 109.20 ? 85   DT  I N1    1 
ATOM   1727  C C2    . DT  A 1 86  ? -41.694  -19.906 13.655 1.00 109.24 ? 85   DT  I C2    1 
ATOM   1728  O O2    . DT  A 1 86  ? -41.939  -18.711 13.690 1.00 108.98 ? 85   DT  I O2    1 
ATOM   1729  N N3    . DT  A 1 86  ? -42.309  -20.796 14.497 1.00 108.77 ? 85   DT  I N3    1 
ATOM   1730  C C4    . DT  A 1 86  ? -42.111  -22.159 14.561 1.00 108.78 ? 85   DT  I C4    1 
ATOM   1731  O O4    . DT  A 1 86  ? -42.750  -22.832 15.361 1.00 108.40 ? 85   DT  I O4    1 
ATOM   1732  C C5    . DT  A 1 86  ? -41.134  -22.685 13.636 1.00 109.10 ? 85   DT  I C5    1 
ATOM   1733  C C7    . DT  A 1 86  ? -40.838  -24.152 13.648 1.00 108.93 ? 85   DT  I C7    1 
ATOM   1734  C C6    . DT  A 1 86  ? -40.529  -21.830 12.802 1.00 109.09 ? 85   DT  I C6    1 
ATOM   1735  P P     . DG  A 1 87  ? -36.660  -17.402 10.493 1.00 108.72 ? 86   DG  I P     1 
ATOM   1736  O OP1   . DG  A 1 87  ? -36.324  -16.411 9.447  1.00 101.33 ? 86   DG  I OP1   1 
ATOM   1737  O OP2   . DG  A 1 87  ? -35.756  -18.551 10.739 1.00 101.18 ? 86   DG  I OP2   1 
ATOM   1738  O "O5'" . DG  A 1 87  ? -36.884  -16.593 11.842 1.00 108.67 ? 86   DG  I "O5'" 1 
ATOM   1739  C "C5'" . DG  A 1 87  ? -37.909  -15.606 11.913 1.00 107.36 ? 86   DG  I "C5'" 1 
ATOM   1740  C "C4'" . DG  A 1 87  ? -38.192  -15.250 13.351 1.00 106.78 ? 86   DG  I "C4'" 1 
ATOM   1741  O "O4'" . DG  A 1 87  ? -38.923  -16.326 13.997 1.00 107.44 ? 86   DG  I "O4'" 1 
ATOM   1742  C "C3'" . DG  A 1 87  ? -36.923  -15.031 14.172 1.00 106.26 ? 86   DG  I "C3'" 1 
ATOM   1743  O "O3'" . DG  A 1 87  ? -37.063  -13.879 15.005 1.00 102.95 ? 86   DG  I "O3'" 1 
ATOM   1744  C "C2'" . DG  A 1 87  ? -36.817  -16.299 15.000 1.00 107.75 ? 86   DG  I "C2'" 1 
ATOM   1745  C "C1'" . DG  A 1 87  ? -38.274  -16.682 15.203 1.00 108.67 ? 86   DG  I "C1'" 1 
ATOM   1746  N N9    . DG  A 1 87  ? -38.481  -18.109 15.434 1.00 104.91 ? 86   DG  I N9    1 
ATOM   1747  C C8    . DG  A 1 87  ? -37.856  -19.147 14.785 1.00 105.50 ? 86   DG  I C8    1 
ATOM   1748  N N7    . DG  A 1 87  ? -38.196  -20.322 15.245 1.00 105.21 ? 86   DG  I N7    1 
ATOM   1749  C C5    . DG  A 1 87  ? -39.114  -20.045 16.247 1.00 105.95 ? 86   DG  I C5    1 
ATOM   1750  C C6    . DG  A 1 87  ? -39.814  -20.920 17.111 1.00 106.31 ? 86   DG  I C6    1 
ATOM   1751  O O6    . DG  A 1 87  ? -39.766  -22.153 17.161 1.00 106.61 ? 86   DG  I O6    1 
ATOM   1752  N N1    . DG  A 1 87  ? -40.636  -20.223 17.986 1.00 106.42 ? 86   DG  I N1    1 
ATOM   1753  C C2    . DG  A 1 87  ? -40.769  -18.861 18.026 1.00 106.34 ? 86   DG  I C2    1 
ATOM   1754  N N2    . DG  A 1 87  ? -41.615  -18.385 18.944 1.00 105.95 ? 86   DG  I N2    1 
ATOM   1755  N N3    . DG  A 1 87  ? -40.121  -18.030 17.226 1.00 106.21 ? 86   DG  I N3    1 
ATOM   1756  C C4    . DG  A 1 87  ? -39.313  -18.685 16.369 1.00 105.90 ? 86   DG  I C4    1 
ATOM   1757  P P     . DC  A 1 88  ? -35.753  -13.155 15.585 1.00 103.29 ? 87   DC  I P     1 
ATOM   1758  O OP1   . DC  A 1 88  ? -35.887  -11.703 15.274 1.00 113.86 ? 87   DC  I OP1   1 
ATOM   1759  O OP2   . DC  A 1 88  ? -34.551  -13.899 15.141 1.00 110.87 ? 87   DC  I OP2   1 
ATOM   1760  O "O5'" . DC  A 1 88  ? -35.871  -13.363 17.157 1.00 102.69 ? 87   DC  I "O5'" 1 
ATOM   1761  C "C5'" . DC  A 1 88  ? -37.032  -12.927 17.852 1.00 98.08  ? 87   DC  I "C5'" 1 
ATOM   1762  C "C4'" . DC  A 1 88  ? -37.118  -13.598 19.200 1.00 94.11  ? 87   DC  I "C4'" 1 
ATOM   1763  O "O4'" . DC  A 1 88  ? -37.520  -14.979 19.058 1.00 94.77  ? 87   DC  I "O4'" 1 
ATOM   1764  C "C3'" . DC  A 1 88  ? -35.817  -13.613 20.002 1.00 91.50  ? 87   DC  I "C3'" 1 
ATOM   1765  O "O3'" . DC  A 1 88  ? -36.127  -13.435 21.381 1.00 86.25  ? 87   DC  I "O3'" 1 
ATOM   1766  C "C2'" . DC  A 1 88  ? -35.335  -15.045 19.834 1.00 93.50  ? 87   DC  I "C2'" 1 
ATOM   1767  C "C1'" . DC  A 1 88  ? -36.654  -15.794 19.830 1.00 96.81  ? 87   DC  I "C1'" 1 
ATOM   1768  N N1    . DC  A 1 88  ? -36.635  -17.138 19.230 1.00 111.33 ? 87   DC  I N1    1 
ATOM   1769  C C2    . DC  A 1 88  ? -37.304  -18.184 19.885 1.00 112.62 ? 87   DC  I C2    1 
ATOM   1770  O O2    . DC  A 1 88  ? -37.887  -17.949 20.953 1.00 110.90 ? 87   DC  I O2    1 
ATOM   1771  N N3    . DC  A 1 88  ? -37.293  -19.422 19.335 1.00 114.13 ? 87   DC  I N3    1 
ATOM   1772  C C4    . DC  A 1 88  ? -36.646  -19.635 18.186 1.00 114.86 ? 87   DC  I C4    1 
ATOM   1773  N N4    . DC  A 1 88  ? -36.655  -20.872 17.680 1.00 116.58 ? 87   DC  I N4    1 
ATOM   1774  C C5    . DC  A 1 88  ? -35.960  -18.588 17.501 1.00 113.78 ? 87   DC  I C5    1 
ATOM   1775  C C6    . DC  A 1 88  ? -35.982  -17.368 18.053 1.00 112.55 ? 87   DC  I C6    1 
ATOM   1776  P P     . DC  A 1 89  ? -35.978  -11.995 22.070 1.00 82.91  ? 88   DC  I P     1 
ATOM   1777  O OP1   . DC  A 1 89  ? -36.213  -10.947 21.052 1.00 97.47  ? 88   DC  I OP1   1 
ATOM   1778  O OP2   . DC  A 1 89  ? -34.718  -12.002 22.843 1.00 97.24  ? 88   DC  I OP2   1 
ATOM   1779  O "O5'" . DC  A 1 89  ? -37.191  -11.989 23.100 1.00 83.15  ? 88   DC  I "O5'" 1 
ATOM   1780  C "C5'" . DC  A 1 89  ? -38.540  -12.092 22.631 1.00 83.26  ? 88   DC  I "C5'" 1 
ATOM   1781  C "C4'" . DC  A 1 89  ? -39.342  -13.062 23.468 1.00 81.54  ? 88   DC  I "C4'" 1 
ATOM   1782  O "O4'" . DC  A 1 89  ? -38.945  -14.430 23.220 1.00 81.31  ? 88   DC  I "O4'" 1 
ATOM   1783  C "C3'" . DC  A 1 89  ? -39.264  -12.868 24.980 1.00 81.27  ? 88   DC  I "C3'" 1 
ATOM   1784  O "O3'" . DC  A 1 89  ? -40.553  -13.136 25.532 1.00 80.95  ? 88   DC  I "O3'" 1 
ATOM   1785  C "C2'" . DC  A 1 89  ? -38.268  -13.927 25.414 1.00 81.07  ? 88   DC  I "C2'" 1 
ATOM   1786  C "C1'" . DC  A 1 89  ? -38.551  -15.054 24.436 1.00 82.25  ? 88   DC  I "C1'" 1 
ATOM   1787  N N1    . DC  A 1 89  ? -37.401  -15.911 24.126 1.00 97.19  ? 88   DC  I N1    1 
ATOM   1788  C C2    . DC  A 1 89  ? -37.514  -17.294 24.316 1.00 97.60  ? 88   DC  I C2    1 
ATOM   1789  O O2    . DC  A 1 89  ? -38.551  -17.752 24.826 1.00 96.94  ? 88   DC  I O2    1 
ATOM   1790  N N3    . DC  A 1 89  ? -36.493  -18.093 23.941 1.00 97.59  ? 88   DC  I N3    1 
ATOM   1791  C C4    . DC  A 1 89  ? -35.390  -17.561 23.412 1.00 97.39  ? 88   DC  I C4    1 
ATOM   1792  N N4    . DC  A 1 89  ? -34.428  -18.392 23.014 1.00 97.41  ? 88   DC  I N4    1 
ATOM   1793  C C5    . DC  A 1 89  ? -35.231  -16.155 23.256 1.00 96.79  ? 88   DC  I C5    1 
ATOM   1794  C C6    . DC  A 1 89  ? -36.249  -15.375 23.626 1.00 96.82  ? 88   DC  I C6    1 
ATOM   1795  P P     . DT  A 1 90  ? -40.949  -12.545 26.971 1.00 82.05  ? 89   DT  I P     1 
ATOM   1796  O OP1   . DT  A 1 90  ? -42.340  -12.027 26.829 1.00 91.99  ? 89   DT  I OP1   1 
ATOM   1797  O OP2   . DT  A 1 90  ? -39.871  -11.660 27.502 1.00 92.57  ? 89   DT  I OP2   1 
ATOM   1798  O "O5'" . DT  A 1 90  ? -40.996  -13.843 27.883 1.00 80.50  ? 89   DT  I "O5'" 1 
ATOM   1799  C "C5'" . DT  A 1 90  ? -41.911  -14.880 27.590 1.00 76.95  ? 89   DT  I "C5'" 1 
ATOM   1800  C "C4'" . DT  A 1 90  ? -41.563  -16.116 28.380 1.00 74.10  ? 89   DT  I "C4'" 1 
ATOM   1801  O "O4'" . DT  A 1 90  ? -40.321  -16.677 27.904 1.00 76.18  ? 89   DT  I "O4'" 1 
ATOM   1802  C "C3'" . DT  A 1 90  ? -41.383  -15.916 29.883 1.00 72.77  ? 89   DT  I "C3'" 1 
ATOM   1803  O "O3'" . DT  A 1 90  ? -41.881  -17.086 30.515 1.00 67.99  ? 89   DT  I "O3'" 1 
ATOM   1804  C "C2'" . DT  A 1 90  ? -39.873  -15.894 30.040 1.00 74.28  ? 89   DT  I "C2'" 1 
ATOM   1805  C "C1'" . DT  A 1 90  ? -39.491  -16.941 29.020 1.00 78.84  ? 89   DT  I "C1'" 1 
ATOM   1806  N N1    . DT  A 1 90  ? -38.092  -16.970 28.555 1.00 94.13  ? 89   DT  I N1    1 
ATOM   1807  C C2    . DT  A 1 90  ? -37.438  -18.184 28.567 1.00 96.29  ? 89   DT  I C2    1 
ATOM   1808  O O2    . DT  A 1 90  ? -37.947  -19.214 28.958 1.00 94.48  ? 89   DT  I O2    1 
ATOM   1809  N N3    . DT  A 1 90  ? -36.155  -18.149 28.095 1.00 100.18 ? 89   DT  I N3    1 
ATOM   1810  C C4    . DT  A 1 90  ? -35.473  -17.055 27.615 1.00 101.15 ? 89   DT  I C4    1 
ATOM   1811  O O4    . DT  A 1 90  ? -34.323  -17.183 27.212 1.00 103.52 ? 89   DT  I O4    1 
ATOM   1812  C C5    . DT  A 1 90  ? -36.212  -15.814 27.633 1.00 100.35 ? 89   DT  I C5    1 
ATOM   1813  C C7    . DT  A 1 90  ? -35.552  -14.576 27.119 1.00 102.05 ? 89   DT  I C7    1 
ATOM   1814  C C6    . DT  A 1 90  ? -37.467  -15.830 28.105 1.00 97.87  ? 89   DT  I C6    1 
ATOM   1815  P P     . DT  A 1 91  ? -42.920  -16.978 31.733 1.00 61.23  ? 90   DT  I P     1 
ATOM   1816  O OP1   . DT  A 1 91  ? -44.245  -16.559 31.214 1.00 67.26  ? 90   DT  I OP1   1 
ATOM   1817  O OP2   . DT  A 1 91  ? -42.286  -16.219 32.849 1.00 65.48  ? 90   DT  I OP2   1 
ATOM   1818  O "O5'" . DT  A 1 91  ? -43.043  -18.511 32.134 1.00 61.28  ? 90   DT  I "O5'" 1 
ATOM   1819  C "C5'" . DT  A 1 91  ? -43.291  -19.483 31.123 1.00 60.34  ? 90   DT  I "C5'" 1 
ATOM   1820  C "C4'" . DT  A 1 91  ? -42.350  -20.659 31.245 1.00 58.93  ? 90   DT  I "C4'" 1 
ATOM   1821  O "O4'" . DT  A 1 91  ? -41.011  -20.264 30.889 1.00 58.25  ? 90   DT  I "O4'" 1 
ATOM   1822  C "C3'" . DT  A 1 91  ? -42.255  -21.344 32.610 1.00 59.78  ? 90   DT  I "C3'" 1 
ATOM   1823  O "O3'" . DT  A 1 91  ? -42.411  -22.754 32.462 1.00 59.80  ? 90   DT  I "O3'" 1 
ATOM   1824  C "C2'" . DT  A 1 91  ? -40.848  -21.027 33.087 1.00 60.57  ? 90   DT  I "C2'" 1 
ATOM   1825  C "C1'" . DT  A 1 91  ? -40.084  -20.838 31.790 1.00 61.06  ? 90   DT  I "C1'" 1 
ATOM   1826  N N1    . DT  A 1 91  ? -38.935  -19.915 31.877 1.00 72.05  ? 90   DT  I N1    1 
ATOM   1827  C C2    . DT  A 1 91  ? -37.675  -20.379 31.559 1.00 72.00  ? 90   DT  I C2    1 
ATOM   1828  O O2    . DT  A 1 91  ? -37.449  -21.528 31.233 1.00 70.23  ? 90   DT  I O2    1 
ATOM   1829  N N3    . DT  A 1 91  ? -36.681  -19.438 31.644 1.00 73.24  ? 90   DT  I N3    1 
ATOM   1830  C C4    . DT  A 1 91  ? -36.812  -18.116 32.016 1.00 76.32  ? 90   DT  I C4    1 
ATOM   1831  O O4    . DT  A 1 91  ? -35.830  -17.390 32.037 1.00 79.63  ? 90   DT  I O4    1 
ATOM   1832  C C5    . DT  A 1 91  ? -38.152  -17.700 32.356 1.00 76.11  ? 90   DT  I C5    1 
ATOM   1833  C C7    . DT  A 1 91  ? -38.385  -16.288 32.796 1.00 76.13  ? 90   DT  I C7    1 
ATOM   1834  C C6    . DT  A 1 91  ? -39.136  -18.608 32.265 1.00 75.12  ? 90   DT  I C6    1 
ATOM   1835  P P     . DT  A 1 92  ? -42.514  -23.672 33.768 1.00 62.28  ? 91   DT  I P     1 
ATOM   1836  O OP1   . DT  A 1 92  ? -43.598  -24.662 33.570 1.00 69.51  ? 91   DT  I OP1   1 
ATOM   1837  O OP2   . DT  A 1 92  ? -42.533  -22.769 34.946 1.00 68.50  ? 91   DT  I OP2   1 
ATOM   1838  O "O5'" . DT  A 1 92  ? -41.120  -24.431 33.766 1.00 64.07  ? 91   DT  I "O5'" 1 
ATOM   1839  C "C5'" . DT  A 1 92  ? -40.452  -24.704 32.536 1.00 66.40  ? 91   DT  I "C5'" 1 
ATOM   1840  C "C4'" . DT  A 1 92  ? -39.037  -25.162 32.798 1.00 70.47  ? 91   DT  I "C4'" 1 
ATOM   1841  O "O4'" . DT  A 1 92  ? -38.083  -24.080 32.648 1.00 70.87  ? 91   DT  I "O4'" 1 
ATOM   1842  C "C3'" . DT  A 1 92  ? -38.811  -25.772 34.180 1.00 72.28  ? 91   DT  I "C3'" 1 
ATOM   1843  O "O3'" . DT  A 1 92  ? -38.179  -27.040 34.036 1.00 79.26  ? 91   DT  I "O3'" 1 
ATOM   1844  C "C2'" . DT  A 1 92  ? -37.911  -24.765 34.883 1.00 70.10  ? 91   DT  I "C2'" 1 
ATOM   1845  C "C1'" . DT  A 1 92  ? -37.175  -24.082 33.735 1.00 68.14  ? 91   DT  I "C1'" 1 
ATOM   1846  N N1    . DT  A 1 92  ? -36.780  -22.676 33.996 1.00 75.24  ? 91   DT  I N1    1 
ATOM   1847  C C2    . DT  A 1 92  ? -35.545  -22.242 33.562 1.00 75.44  ? 91   DT  I C2    1 
ATOM   1848  O O2    . DT  A 1 92  ? -34.764  -22.950 32.962 1.00 71.97  ? 91   DT  I O2    1 
ATOM   1849  N N3    . DT  A 1 92  ? -35.257  -20.935 33.864 1.00 73.31  ? 91   DT  I N3    1 
ATOM   1850  C C4    . DT  A 1 92  ? -36.059  -20.040 34.545 1.00 72.96  ? 91   DT  I C4    1 
ATOM   1851  O O4    . DT  A 1 92  ? -35.662  -18.893 34.757 1.00 71.10  ? 91   DT  I O4    1 
ATOM   1852  C C5    . DT  A 1 92  ? -37.338  -20.556 34.960 1.00 73.75  ? 91   DT  I C5    1 
ATOM   1853  C C7    . DT  A 1 92  ? -38.276  -19.657 35.698 1.00 75.63  ? 91   DT  I C7    1 
ATOM   1854  C C6    . DT  A 1 92  ? -37.633  -21.828 34.666 1.00 74.49  ? 91   DT  I C6    1 
ATOM   1855  P P     . DT  A 1 93  ? -37.970  -27.980 35.318 1.00 92.86  ? 92   DT  I P     1 
ATOM   1856  O OP1   . DT  A 1 93  ? -38.173  -29.379 34.867 1.00 94.84  ? 92   DT  I OP1   1 
ATOM   1857  O OP2   . DT  A 1 93  ? -38.760  -27.456 36.464 1.00 93.88  ? 92   DT  I OP2   1 
ATOM   1858  O "O5'" . DT  A 1 93  ? -36.423  -27.761 35.611 1.00 95.59  ? 92   DT  I "O5'" 1 
ATOM   1859  C "C5'" . DT  A 1 93  ? -35.498  -27.699 34.527 1.00 99.99  ? 92   DT  I "C5'" 1 
ATOM   1860  C "C4'" . DT  A 1 93  ? -34.116  -27.388 35.042 1.00 103.89 ? 92   DT  I "C4'" 1 
ATOM   1861  O "O4'" . DT  A 1 93  ? -33.898  -25.962 35.131 1.00 103.64 ? 92   DT  I "O4'" 1 
ATOM   1862  C "C3'" . DT  A 1 93  ? -33.863  -27.949 36.435 1.00 108.69 ? 92   DT  I "C3'" 1 
ATOM   1863  O "O3'" . DT  A 1 93  ? -32.573  -28.540 36.484 1.00 116.40 ? 92   DT  I "O3'" 1 
ATOM   1864  C "C2'" . DT  A 1 93  ? -33.941  -26.728 37.337 1.00 105.99 ? 92   DT  I "C2'" 1 
ATOM   1865  C "C1'" . DT  A 1 93  ? -33.408  -25.641 36.424 1.00 104.24 ? 92   DT  I "C1'" 1 
ATOM   1866  N N1    . DT  A 1 93  ? -33.838  -24.265 36.740 1.00 108.50 ? 92   DT  I N1    1 
ATOM   1867  C C2    . DT  A 1 93  ? -32.927  -23.251 36.550 1.00 108.30 ? 92   DT  I C2    1 
ATOM   1868  O O2    . DT  A 1 93  ? -31.782  -23.446 36.177 1.00 109.13 ? 92   DT  I O2    1 
ATOM   1869  N N3    . DT  A 1 93  ? -33.408  -21.992 36.814 1.00 107.25 ? 92   DT  I N3    1 
ATOM   1870  C C4    . DT  A 1 93  ? -34.673  -21.656 37.246 1.00 106.59 ? 92   DT  I C4    1 
ATOM   1871  O O4    . DT  A 1 93  ? -34.971  -20.478 37.414 1.00 106.45 ? 92   DT  I O4    1 
ATOM   1872  C C5    . DT  A 1 93  ? -35.563  -22.769 37.458 1.00 106.51 ? 92   DT  I C5    1 
ATOM   1873  C C7    . DT  A 1 93  ? -36.943  -22.502 37.964 1.00 106.42 ? 92   DT  I C7    1 
ATOM   1874  C C6    . DT  A 1 93  ? -35.110  -24.002 37.195 1.00 107.51 ? 92   DT  I C6    1 
ATOM   1875  P P     . DG  A 1 94  ? -32.252  -29.632 37.610 1.00 121.11 ? 93   DG  I P     1 
ATOM   1876  O OP1   . DG  A 1 94  ? -31.653  -30.798 36.915 1.00 124.09 ? 93   DG  I OP1   1 
ATOM   1877  O OP2   . DG  A 1 94  ? -33.455  -29.825 38.468 1.00 123.96 ? 93   DG  I OP2   1 
ATOM   1878  O "O5'" . DG  A 1 94  ? -31.141  -28.903 38.480 1.00 123.70 ? 93   DG  I "O5'" 1 
ATOM   1879  C "C5'" . DG  A 1 94  ? -30.073  -28.199 37.852 1.00 126.95 ? 93   DG  I "C5'" 1 
ATOM   1880  C "C4'" . DG  A 1 94  ? -29.450  -27.238 38.833 1.00 129.91 ? 93   DG  I "C4'" 1 
ATOM   1881  O "O4'" . DG  A 1 94  ? -30.109  -25.946 38.791 1.00 130.45 ? 93   DG  I "O4'" 1 
ATOM   1882  C "C3'" . DG  A 1 94  ? -29.564  -27.725 40.279 1.00 132.52 ? 93   DG  I "C3'" 1 
ATOM   1883  O "O3'" . DG  A 1 94  ? -28.364  -27.445 40.992 1.00 136.99 ? 93   DG  I "O3'" 1 
ATOM   1884  C "C2'" . DG  A 1 94  ? -30.691  -26.877 40.839 1.00 131.44 ? 93   DG  I "C2'" 1 
ATOM   1885  C "C1'" . DG  A 1 94  ? -30.426  -25.572 40.121 1.00 130.13 ? 93   DG  I "C1'" 1 
ATOM   1886  N N9    . DG  A 1 94  ? -31.529  -24.612 40.103 1.00 131.12 ? 93   DG  I N9    1 
ATOM   1887  C C8    . DG  A 1 94  ? -32.876  -24.878 40.196 1.00 129.92 ? 93   DG  I C8    1 
ATOM   1888  N N7    . DG  A 1 94  ? -33.611  -23.798 40.209 1.00 128.97 ? 93   DG  I N7    1 
ATOM   1889  C C5    . DG  A 1 94  ? -32.697  -22.756 40.109 1.00 129.68 ? 93   DG  I C5    1 
ATOM   1890  C C6    . DG  A 1 94  ? -32.900  -21.348 40.081 1.00 129.81 ? 93   DG  I C6    1 
ATOM   1891  O O6    . DG  A 1 94  ? -33.961  -20.722 40.158 1.00 129.66 ? 93   DG  I O6    1 
ATOM   1892  N N1    . DG  A 1 94  ? -31.698  -20.660 39.954 1.00 129.74 ? 93   DG  I N1    1 
ATOM   1893  C C2    . DG  A 1 94  ? -30.458  -21.244 39.871 1.00 129.35 ? 93   DG  I C2    1 
ATOM   1894  N N2    . DG  A 1 94  ? -29.422  -20.407 39.738 1.00 128.45 ? 93   DG  I N2    1 
ATOM   1895  N N3    . DG  A 1 94  ? -30.252  -22.551 39.911 1.00 129.19 ? 93   DG  I N3    1 
ATOM   1896  C C4    . DG  A 1 94  ? -31.408  -23.243 40.028 1.00 129.93 ? 93   DG  I C4    1 
ATOM   1897  P P     . DA  A 1 95  ? -28.196  -27.974 42.497 1.00 177.20 ? 94   DA  I P     1 
ATOM   1898  O OP1   . DA  A 1 95  ? -27.878  -29.422 42.425 1.00 124.85 ? 94   DA  I OP1   1 
ATOM   1899  O OP2   . DA  A 1 95  ? -29.344  -27.518 43.322 1.00 124.22 ? 94   DA  I OP2   1 
ATOM   1900  O "O5'" . DA  A 1 95  ? -26.911  -27.188 43.000 1.00 178.83 ? 94   DA  I "O5'" 1 
ATOM   1901  C "C5'" . DA  A 1 95  ? -26.175  -26.348 42.115 1.00 180.47 ? 94   DA  I "C5'" 1 
ATOM   1902  C "C4'" . DA  A 1 95  ? -25.941  -25.002 42.759 1.00 181.99 ? 94   DA  I "C4'" 1 
ATOM   1903  O "O4'" . DA  A 1 95  ? -27.080  -24.129 42.554 1.00 182.61 ? 94   DA  I "O4'" 1 
ATOM   1904  C "C3'" . DA  A 1 95  ? -25.723  -25.073 44.271 1.00 182.61 ? 94   DA  I "C3'" 1 
ATOM   1905  O "O3'" . DA  A 1 95  ? -24.640  -24.224 44.660 1.00 182.61 ? 94   DA  I "O3'" 1 
ATOM   1906  C "C2'" . DA  A 1 95  ? -27.047  -24.591 44.845 1.00 182.61 ? 94   DA  I "C2'" 1 
ATOM   1907  C "C1'" . DA  A 1 95  ? -27.514  -23.595 43.800 1.00 182.61 ? 94   DA  I "C1'" 1 
ATOM   1908  N N9    . DA  A 1 95  ? -28.967  -23.408 43.732 1.00 130.49 ? 94   DA  I N9    1 
ATOM   1909  C C8    . DA  A 1 95  ? -29.932  -24.382 43.769 1.00 130.05 ? 94   DA  I C8    1 
ATOM   1910  N N7    . DA  A 1 95  ? -31.155  -23.921 43.655 1.00 129.49 ? 94   DA  I N7    1 
ATOM   1911  C C5    . DA  A 1 95  ? -30.987  -22.549 43.542 1.00 128.54 ? 94   DA  I C5    1 
ATOM   1912  C C6    . DA  A 1 95  ? -31.906  -21.494 43.389 1.00 127.25 ? 94   DA  I C6    1 
ATOM   1913  N N6    . DA  A 1 95  ? -33.227  -21.666 43.312 1.00 126.38 ? 94   DA  I N6    1 
ATOM   1914  N N1    . DA  A 1 95  ? -31.414  -20.239 43.317 1.00 126.92 ? 94   DA  I N1    1 
ATOM   1915  C C2    . DA  A 1 95  ? -30.088  -20.067 43.391 1.00 127.64 ? 94   DA  I C2    1 
ATOM   1916  N N3    . DA  A 1 95  ? -29.124  -20.977 43.531 1.00 128.61 ? 94   DA  I N3    1 
ATOM   1917  C C4    . DA  A 1 95  ? -29.645  -22.215 43.599 1.00 129.31 ? 94   DA  I C4    1 
ATOM   1918  P P     . DT  A 1 96  ? -24.556  -23.685 46.168 1.00 152.40 ? 95   DT  I P     1 
ATOM   1919  O OP1   . DT  A 1 96  ? -23.152  -23.274 46.412 1.00 149.50 ? 95   DT  I OP1   1 
ATOM   1920  O OP2   . DT  A 1 96  ? -25.207  -24.655 47.088 1.00 149.57 ? 95   DT  I OP2   1 
ATOM   1921  O "O5'" . DT  A 1 96  ? -25.446  -22.369 46.115 1.00 152.55 ? 95   DT  I "O5'" 1 
ATOM   1922  C "C5'" . DT  A 1 96  ? -24.886  -21.136 45.682 1.00 152.11 ? 95   DT  I "C5'" 1 
ATOM   1923  C "C4'" . DT  A 1 96  ? -25.278  -20.046 46.646 1.00 151.88 ? 95   DT  I "C4'" 1 
ATOM   1924  O "O4'" . DT  A 1 96  ? -26.616  -19.583 46.346 1.00 152.03 ? 95   DT  I "O4'" 1 
ATOM   1925  C "C3'" . DT  A 1 96  ? -25.315  -20.548 48.090 1.00 151.66 ? 95   DT  I "C3'" 1 
ATOM   1926  O "O3'" . DT  A 1 96  ? -24.854  -19.529 48.973 1.00 150.61 ? 95   DT  I "O3'" 1 
ATOM   1927  C "C2'" . DT  A 1 96  ? -26.788  -20.819 48.321 1.00 151.63 ? 95   DT  I "C2'" 1 
ATOM   1928  C "C1'" . DT  A 1 96  ? -27.423  -19.713 47.503 1.00 152.12 ? 95   DT  I "C1'" 1 
ATOM   1929  N N1    . DT  A 1 96  ? -28.812  -19.964 47.078 1.00 150.01 ? 95   DT  I N1    1 
ATOM   1930  C C2    . DT  A 1 96  ? -29.562  -18.885 46.677 1.00 149.81 ? 95   DT  I C2    1 
ATOM   1931  O O2    . DT  A 1 96  ? -29.115  -17.753 46.607 1.00 149.80 ? 95   DT  I O2    1 
ATOM   1932  N N3    . DT  A 1 96  ? -30.860  -19.180 46.355 1.00 149.50 ? 95   DT  I N3    1 
ATOM   1933  C C4    . DT  A 1 96  ? -31.465  -20.417 46.386 1.00 149.64 ? 95   DT  I C4    1 
ATOM   1934  O O4    . DT  A 1 96  ? -32.647  -20.522 46.085 1.00 149.78 ? 95   DT  I O4    1 
ATOM   1935  C C5    . DT  A 1 96  ? -30.612  -21.512 46.787 1.00 149.43 ? 95   DT  I C5    1 
ATOM   1936  C C7    . DT  A 1 96  ? -31.174  -22.898 46.827 1.00 149.68 ? 95   DT  I C7    1 
ATOM   1937  C C6    . DT  A 1 96  ? -29.345  -21.234 47.107 1.00 149.64 ? 95   DT  I C6    1 
ATOM   1938  P P     . DG  A 1 97  ? -24.839  -19.789 50.559 1.00 145.60 ? 96   DG  I P     1 
ATOM   1939  O OP1   . DG  A 1 97  ? -23.420  -19.953 50.975 1.00 159.08 ? 96   DG  I OP1   1 
ATOM   1940  O OP2   . DG  A 1 97  ? -25.833  -20.842 50.906 1.00 157.85 ? 96   DG  I OP2   1 
ATOM   1941  O "O5'" . DG  A 1 97  ? -25.359  -18.399 51.127 1.00 144.69 ? 96   DG  I "O5'" 1 
ATOM   1942  C "C5'" . DG  A 1 97  ? -25.138  -17.206 50.386 1.00 142.77 ? 96   DG  I "C5'" 1 
ATOM   1943  C "C4'" . DG  A 1 97  ? -26.141  -16.152 50.786 1.00 141.65 ? 96   DG  I "C4'" 1 
ATOM   1944  O "O4'" . DG  A 1 97  ? -27.460  -16.470 50.279 1.00 142.18 ? 96   DG  I "O4'" 1 
ATOM   1945  C "C3'" . DG  A 1 97  ? -26.301  -15.990 52.294 1.00 140.95 ? 96   DG  I "C3'" 1 
ATOM   1946  O "O3'" . DG  A 1 97  ? -26.447  -14.607 52.585 1.00 139.07 ? 96   DG  I "O3'" 1 
ATOM   1947  C "C2'" . DG  A 1 97  ? -27.599  -16.717 52.588 1.00 141.46 ? 96   DG  I "C2'" 1 
ATOM   1948  C "C1'" . DG  A 1 97  ? -28.393  -16.387 51.345 1.00 142.30 ? 96   DG  I "C1'" 1 
ATOM   1949  N N9    . DG  A 1 97  ? -29.505  -17.285 51.053 1.00 155.65 ? 96   DG  I N9    1 
ATOM   1950  C C8    . DG  A 1 97  ? -29.506  -18.659 51.089 1.00 155.24 ? 96   DG  I C8    1 
ATOM   1951  N N7    . DG  A 1 97  ? -30.661  -19.179 50.771 1.00 155.21 ? 96   DG  I N7    1 
ATOM   1952  C C5    . DG  A 1 97  ? -31.472  -18.081 50.511 1.00 155.89 ? 96   DG  I C5    1 
ATOM   1953  C C6    . DG  A 1 97  ? -32.836  -18.014 50.116 1.00 155.88 ? 96   DG  I C6    1 
ATOM   1954  O O6    . DG  A 1 97  ? -33.626  -18.944 49.906 1.00 156.11 ? 96   DG  I O6    1 
ATOM   1955  N N1    . DG  A 1 97  ? -33.261  -16.697 49.965 1.00 155.46 ? 96   DG  I N1    1 
ATOM   1956  C C2    . DG  A 1 97  ? -32.479  -15.587 50.165 1.00 155.09 ? 96   DG  I C2    1 
ATOM   1957  N N2    . DG  A 1 97  ? -33.072  -14.401 49.970 1.00 154.39 ? 96   DG  I N2    1 
ATOM   1958  N N3    . DG  A 1 97  ? -31.208  -15.635 50.529 1.00 155.29 ? 96   DG  I N3    1 
ATOM   1959  C C4    . DG  A 1 97  ? -30.773  -16.905 50.683 1.00 155.77 ? 96   DG  I C4    1 
ATOM   1960  P P     . DG  A 1 98  ? -26.880  -14.152 54.054 1.00 157.44 ? 97   DG  I P     1 
ATOM   1961  O OP1   . DG  A 1 98  ? -26.110  -12.917 54.346 1.00 129.28 ? 97   DG  I OP1   1 
ATOM   1962  O OP2   . DG  A 1 98  ? -26.779  -15.325 54.969 1.00 127.75 ? 97   DG  I OP2   1 
ATOM   1963  O "O5'" . DG  A 1 98  ? -28.419  -13.775 53.890 1.00 156.85 ? 97   DG  I "O5'" 1 
ATOM   1964  C "C5'" . DG  A 1 98  ? -28.834  -12.721 53.017 1.00 153.31 ? 97   DG  I "C5'" 1 
ATOM   1965  C "C4'" . DG  A 1 98  ? -30.233  -12.275 53.373 1.00 149.82 ? 97   DG  I "C4'" 1 
ATOM   1966  O "O4'" . DG  A 1 98  ? -31.161  -13.352 53.103 1.00 148.81 ? 97   DG  I "O4'" 1 
ATOM   1967  C "C3'" . DG  A 1 98  ? -30.411  -11.930 54.850 1.00 147.12 ? 97   DG  I "C3'" 1 
ATOM   1968  O "O3'" . DG  A 1 98  ? -31.307  -10.829 55.004 1.00 143.93 ? 97   DG  I "O3'" 1 
ATOM   1969  C "C2'" . DG  A 1 98  ? -30.991  -13.199 55.448 1.00 146.85 ? 97   DG  I "C2'" 1 
ATOM   1970  C "C1'" . DG  A 1 98  ? -31.801  -13.778 54.300 1.00 147.61 ? 97   DG  I "C1'" 1 
ATOM   1971  N N9    . DG  A 1 98  ? -31.850  -15.240 54.283 1.00 118.91 ? 97   DG  I N9    1 
ATOM   1972  C C8    . DG  A 1 98  ? -30.905  -16.107 54.780 1.00 119.38 ? 97   DG  I C8    1 
ATOM   1973  N N7    . DG  A 1 98  ? -31.221  -17.364 54.611 1.00 119.30 ? 97   DG  I N7    1 
ATOM   1974  C C5    . DG  A 1 98  ? -32.451  -17.327 53.964 1.00 119.23 ? 97   DG  I C5    1 
ATOM   1975  C C6    . DG  A 1 98  ? -33.297  -18.388 53.513 1.00 118.95 ? 97   DG  I C6    1 
ATOM   1976  O O6    . DG  A 1 98  ? -33.120  -19.613 53.596 1.00 120.15 ? 97   DG  I O6    1 
ATOM   1977  N N1    . DG  A 1 98  ? -34.449  -17.898 52.908 1.00 116.53 ? 97   DG  I N1    1 
ATOM   1978  C C2    . DG  A 1 98  ? -34.757  -16.568 52.750 1.00 115.39 ? 97   DG  I C2    1 
ATOM   1979  N N2    . DG  A 1 98  ? -35.919  -16.302 52.131 1.00 115.37 ? 97   DG  I N2    1 
ATOM   1980  N N3    . DG  A 1 98  ? -33.986  -15.574 53.164 1.00 116.58 ? 97   DG  I N3    1 
ATOM   1981  C C4    . DG  A 1 98  ? -32.856  -16.022 53.757 1.00 118.51 ? 97   DG  I C4    1 
ATOM   1982  P P     . DA  A 1 99  ? -31.707  -10.334 56.478 1.00 125.55 ? 98   DA  I P     1 
ATOM   1983  O OP1   . DA  A 1 99  ? -31.940  -8.867  56.416 1.00 127.54 ? 98   DA  I OP1   1 
ATOM   1984  O OP2   . DA  A 1 99  ? -30.728  -10.886 57.451 1.00 126.46 ? 98   DA  I OP2   1 
ATOM   1985  O "O5'" . DA  A 1 99  ? -33.100  -11.058 56.737 1.00 122.98 ? 98   DA  I "O5'" 1 
ATOM   1986  C "C5'" . DA  A 1 99  ? -34.166  -10.956 55.791 1.00 117.65 ? 98   DA  I "C5'" 1 
ATOM   1987  C "C4'" . DA  A 1 99  ? -35.389  -11.680 56.304 1.00 113.86 ? 98   DA  I "C4'" 1 
ATOM   1988  O "O4'" . DA  A 1 99  ? -35.240  -13.115 56.177 1.00 112.45 ? 98   DA  I "O4'" 1 
ATOM   1989  C "C3'" . DA  A 1 99  ? -35.694  -11.421 57.780 1.00 112.09 ? 98   DA  I "C3'" 1 
ATOM   1990  O "O3'" . DA  A 1 99  ? -37.100  -11.381 57.961 1.00 111.82 ? 98   DA  I "O3'" 1 
ATOM   1991  C "C2'" . DA  A 1 99  ? -35.167  -12.668 58.460 1.00 110.63 ? 98   DA  I "C2'" 1 
ATOM   1992  C "C1'" . DA  A 1 99  ? -35.538  -13.707 57.427 1.00 111.95 ? 98   DA  I "C1'" 1 
ATOM   1993  N N9    . DA  A 1 99  ? -34.807  -14.961 57.523 1.00 114.47 ? 98   DA  I N9    1 
ATOM   1994  C C8    . DA  A 1 99  ? -33.647  -15.230 58.197 1.00 115.38 ? 98   DA  I C8    1 
ATOM   1995  N N7    . DA  A 1 99  ? -33.258  -16.477 58.100 1.00 116.35 ? 98   DA  I N7    1 
ATOM   1996  C C5    . DA  A 1 99  ? -34.227  -17.067 57.301 1.00 116.29 ? 98   DA  I C5    1 
ATOM   1997  C C6    . DA  A 1 99  ? -34.390  -18.378 56.820 1.00 117.48 ? 98   DA  I C6    1 
ATOM   1998  N N6    . DA  A 1 99  ? -33.539  -19.377 57.080 1.00 117.36 ? 98   DA  I N6    1 
ATOM   1999  N N1    . DA  A 1 99  ? -35.471  -18.633 56.050 1.00 117.97 ? 98   DA  I N1    1 
ATOM   2000  C C2    . DA  A 1 99  ? -36.319  -17.630 55.782 1.00 118.07 ? 98   DA  I C2    1 
ATOM   2001  N N3    . DA  A 1 99  ? -36.269  -16.358 56.171 1.00 116.97 ? 98   DA  I N3    1 
ATOM   2002  C C4    . DA  A 1 99  ? -35.186  -16.142 56.937 1.00 115.73 ? 98   DA  I C4    1 
ATOM   2003  P P     . DG  A 1 100 ? -37.781  -10.063 58.542 1.00 116.66 ? 99   DG  I P     1 
ATOM   2004  O OP1   . DG  A 1 100 ? -37.325  -8.955  57.671 1.00 117.02 ? 99   DG  I OP1   1 
ATOM   2005  O OP2   . DG  A 1 100 ? -37.526  -10.003 60.002 1.00 118.61 ? 99   DG  I OP2   1 
ATOM   2006  O "O5'" . DG  A 1 100 ? -39.331  -10.322 58.290 1.00 115.60 ? 99   DG  I "O5'" 1 
ATOM   2007  C "C5'" . DG  A 1 100 ? -39.819  -10.560 56.976 1.00 113.25 ? 99   DG  I "C5'" 1 
ATOM   2008  C "C4'" . DG  A 1 100 ? -40.556  -11.875 56.922 1.00 109.49 ? 99   DG  I "C4'" 1 
ATOM   2009  O "O4'" . DG  A 1 100 ? -39.653  -12.981 57.164 1.00 109.49 ? 99   DG  I "O4'" 1 
ATOM   2010  C "C3'" . DG  A 1 100 ? -41.668  -12.020 57.953 1.00 107.51 ? 99   DG  I "C3'" 1 
ATOM   2011  O "O3'" . DG  A 1 100 ? -42.715  -12.786 57.371 1.00 103.12 ? 99   DG  I "O3'" 1 
ATOM   2012  C "C2'" . DG  A 1 100 ? -41.012  -12.830 59.053 1.00 108.64 ? 99   DG  I "C2'" 1 
ATOM   2013  C "C1'" . DG  A 1 100 ? -40.146  -13.766 58.239 1.00 110.35 ? 99   DG  I "C1'" 1 
ATOM   2014  N N9    . DG  A 1 100 ? -39.004  -14.314 58.963 1.00 113.26 ? 99   DG  I N9    1 
ATOM   2015  C C8    . DG  A 1 100 ? -38.142  -13.637 59.792 1.00 115.41 ? 99   DG  I C8    1 
ATOM   2016  N N7    . DG  A 1 100 ? -37.211  -14.401 60.296 1.00 116.80 ? 99   DG  I N7    1 
ATOM   2017  C C5    . DG  A 1 100 ? -37.475  -15.658 59.768 1.00 116.67 ? 99   DG  I C5    1 
ATOM   2018  C C6    . DG  A 1 100 ? -36.799  -16.895 59.951 1.00 117.55 ? 99   DG  I C6    1 
ATOM   2019  O O6    . DG  A 1 100 ? -35.796  -17.133 60.637 1.00 118.69 ? 99   DG  I O6    1 
ATOM   2020  N N1    . DG  A 1 100 ? -37.406  -17.917 59.230 1.00 117.38 ? 99   DG  I N1    1 
ATOM   2021  C C2    . DG  A 1 100 ? -38.515  -17.771 58.433 1.00 116.34 ? 99   DG  I C2    1 
ATOM   2022  N N2    . DG  A 1 100 ? -38.945  -18.873 57.814 1.00 115.52 ? 99   DG  I N2    1 
ATOM   2023  N N3    . DG  A 1 100 ? -39.152  -16.627 58.255 1.00 115.61 ? 99   DG  I N3    1 
ATOM   2024  C C4    . DG  A 1 100 ? -38.581  -15.620 58.946 1.00 114.96 ? 99   DG  I C4    1 
ATOM   2025  P P     . DC  A 1 101 ? -44.202  -12.659 57.943 1.00 88.40  ? 100  DC  I P     1 
ATOM   2026  O OP1   . DC  A 1 101 ? -45.042  -12.363 56.754 1.00 89.44  ? 100  DC  I OP1   1 
ATOM   2027  O OP2   . DC  A 1 101 ? -44.214  -11.741 59.114 1.00 89.82  ? 100  DC  I OP2   1 
ATOM   2028  O "O5'" . DC  A 1 101 ? -44.514  -14.124 58.474 1.00 88.73  ? 100  DC  I "O5'" 1 
ATOM   2029  C "C5'" . DC  A 1 101 ? -44.187  -15.260 57.689 1.00 88.88  ? 100  DC  I "C5'" 1 
ATOM   2030  C "C4'" . DC  A 1 101 ? -44.097  -16.483 58.567 1.00 87.96  ? 100  DC  I "C4'" 1 
ATOM   2031  O "O4'" . DC  A 1 101 ? -42.800  -16.604 59.201 1.00 89.27  ? 100  DC  I "O4'" 1 
ATOM   2032  C "C3'" . DC  A 1 101 ? -45.121  -16.489 59.693 1.00 87.46  ? 100  DC  I "C3'" 1 
ATOM   2033  O "O3'" . DC  A 1 101 ? -45.608  -17.806 59.852 1.00 88.04  ? 100  DC  I "O3'" 1 
ATOM   2034  C "C2'" . DC  A 1 101 ? -44.294  -16.123 60.911 1.00 88.82  ? 100  DC  I "C2'" 1 
ATOM   2035  C "C1'" . DC  A 1 101 ? -42.977  -16.799 60.594 1.00 90.23  ? 100  DC  I "C1'" 1 
ATOM   2036  N N1    . DC  A 1 101 ? -41.802  -16.243 61.291 1.00 93.13  ? 100  DC  I N1    1 
ATOM   2037  C C2    . DC  A 1 101 ? -40.757  -17.109 61.654 1.00 92.82  ? 100  DC  I C2    1 
ATOM   2038  O O2    . DC  A 1 101 ? -40.850  -18.317 61.379 1.00 91.43  ? 100  DC  I O2    1 
ATOM   2039  N N3    . DC  A 1 101 ? -39.673  -16.603 62.293 1.00 94.32  ? 100  DC  I N3    1 
ATOM   2040  C C4    . DC  A 1 101 ? -39.612  -15.295 62.572 1.00 95.60  ? 100  DC  I C4    1 
ATOM   2041  N N4    . DC  A 1 101 ? -38.530  -14.837 63.206 1.00 95.59  ? 100  DC  I N4    1 
ATOM   2042  C C5    . DC  A 1 101 ? -40.659  -14.397 62.214 1.00 94.76  ? 100  DC  I C5    1 
ATOM   2043  C C6    . DC  A 1 101 ? -41.725  -14.909 61.582 1.00 94.09  ? 100  DC  I C6    1 
ATOM   2044  P P     . DA  A 1 102 ? -47.118  -18.144 59.468 1.00 74.63  ? 101  DA  I P     1 
ATOM   2045  O OP1   . DA  A 1 102 ? -47.323  -17.776 58.050 1.00 70.53  ? 101  DA  I OP1   1 
ATOM   2046  O OP2   . DA  A 1 102 ? -48.040  -17.624 60.504 1.00 70.94  ? 101  DA  I OP2   1 
ATOM   2047  O "O5'" . DA  A 1 102 ? -47.108  -19.721 59.552 1.00 77.96  ? 101  DA  I "O5'" 1 
ATOM   2048  C "C5'" . DA  A 1 102 ? -46.157  -20.465 58.803 1.00 85.46  ? 101  DA  I "C5'" 1 
ATOM   2049  C "C4'" . DA  A 1 102 ? -45.551  -21.546 59.664 1.00 89.61  ? 101  DA  I "C4'" 1 
ATOM   2050  O "O4'" . DA  A 1 102 ? -44.506  -21.013 60.514 1.00 89.97  ? 101  DA  I "O4'" 1 
ATOM   2051  C "C3'" . DA  A 1 102 ? -46.555  -22.227 60.587 1.00 93.53  ? 101  DA  I "C3'" 1 
ATOM   2052  O "O3'" . DA  A 1 102 ? -46.332  -23.632 60.577 1.00 99.25  ? 101  DA  I "O3'" 1 
ATOM   2053  C "C2'" . DA  A 1 102 ? -46.273  -21.614 61.949 1.00 93.13  ? 101  DA  I "C2'" 1 
ATOM   2054  C "C1'" . DA  A 1 102 ? -44.788  -21.281 61.880 1.00 92.54  ? 101  DA  I "C1'" 1 
ATOM   2055  N N9    . DA  A 1 102 ? -44.402  -20.092 62.639 1.00 89.37  ? 101  DA  I N9    1 
ATOM   2056  C C8    . DA  A 1 102 ? -45.128  -18.938 62.808 1.00 90.00  ? 101  DA  I C8    1 
ATOM   2057  N N7    . DA  A 1 102 ? -44.503  -18.015 63.497 1.00 90.23  ? 101  DA  I N7    1 
ATOM   2058  C C5    . DA  A 1 102 ? -43.287  -18.602 63.813 1.00 91.23  ? 101  DA  I C5    1 
ATOM   2059  C C6    . DA  A 1 102 ? -42.170  -18.130 64.522 1.00 93.17  ? 101  DA  I C6    1 
ATOM   2060  N N6    . DA  A 1 102 ? -42.092  -16.903 65.041 1.00 94.68  ? 101  DA  I N6    1 
ATOM   2061  N N1    . DA  A 1 102 ? -41.120  -18.970 64.674 1.00 93.75  ? 101  DA  I N1    1 
ATOM   2062  C C2    . DA  A 1 102 ? -41.198  -20.199 64.135 1.00 92.49  ? 101  DA  I C2    1 
ATOM   2063  N N3    . DA  A 1 102 ? -42.191  -20.752 63.435 1.00 91.59  ? 101  DA  I N3    1 
ATOM   2064  C C4    . DA  A 1 102 ? -43.217  -19.890 63.307 1.00 90.70  ? 101  DA  I C4    1 
ATOM   2065  P P     . DG  A 1 103 ? -47.275  -24.585 61.442 1.00 115.94 ? 102  DG  I P     1 
ATOM   2066  O OP1   . DG  A 1 103 ? -47.494  -25.811 60.629 1.00 111.04 ? 102  DG  I OP1   1 
ATOM   2067  O OP2   . DG  A 1 103 ? -48.440  -23.796 61.921 1.00 110.72 ? 102  DG  I OP2   1 
ATOM   2068  O "O5'" . DG  A 1 103 ? -46.360  -24.921 62.697 1.00 118.11 ? 102  DG  I "O5'" 1 
ATOM   2069  C "C5'" . DG  A 1 103 ? -45.040  -25.416 62.508 1.00 122.83 ? 102  DG  I "C5'" 1 
ATOM   2070  C "C4'" . DG  A 1 103 ? -44.362  -25.606 63.843 1.00 125.89 ? 102  DG  I "C4'" 1 
ATOM   2071  O "O4'" . DG  A 1 103 ? -43.848  -24.351 64.346 1.00 126.60 ? 102  DG  I "O4'" 1 
ATOM   2072  C "C3'" . DG  A 1 103 ? -45.278  -26.155 64.935 1.00 128.34 ? 102  DG  I "C3'" 1 
ATOM   2073  O "O3'" . DG  A 1 103 ? -44.546  -27.082 65.732 1.00 132.33 ? 102  DG  I "O3'" 1 
ATOM   2074  C "C2'" . DG  A 1 103 ? -45.607  -24.924 65.759 1.00 127.07 ? 102  DG  I "C2'" 1 
ATOM   2075  C "C1'" . DG  A 1 103 ? -44.297  -24.173 65.677 1.00 126.98 ? 102  DG  I "C1'" 1 
ATOM   2076  N N9    . DG  A 1 103 ? -44.367  -22.740 65.944 1.00 122.64 ? 102  DG  I N9    1 
ATOM   2077  C C8    . DG  A 1 103 ? -45.353  -21.862 65.568 1.00 122.95 ? 102  DG  I C8    1 
ATOM   2078  N N7    . DG  A 1 103 ? -45.120  -20.637 65.957 1.00 123.03 ? 102  DG  I N7    1 
ATOM   2079  C C5    . DG  A 1 103 ? -43.909  -20.714 66.629 1.00 122.39 ? 102  DG  I C5    1 
ATOM   2080  C C6    . DG  A 1 103 ? -43.152  -19.708 67.273 1.00 121.69 ? 102  DG  I C6    1 
ATOM   2081  O O6    . DG  A 1 103 ? -43.401  -18.503 67.376 1.00 120.91 ? 102  DG  I O6    1 
ATOM   2082  N N1    . DG  A 1 103 ? -41.992  -20.225 67.836 1.00 122.65 ? 102  DG  I N1    1 
ATOM   2083  C C2    . DG  A 1 103 ? -41.607  -21.544 67.786 1.00 123.20 ? 102  DG  I C2    1 
ATOM   2084  N N2    . DG  A 1 103 ? -40.454  -21.855 68.404 1.00 124.09 ? 102  DG  I N2    1 
ATOM   2085  N N3    . DG  A 1 103 ? -42.301  -22.489 67.180 1.00 122.42 ? 102  DG  I N3    1 
ATOM   2086  C C4    . DG  A 1 103 ? -43.434  -22.007 66.630 1.00 122.66 ? 102  DG  I C4    1 
ATOM   2087  P P     . DT  A 1 104 ? -45.328  -28.080 66.711 1.00 141.59 ? 103  DT  I P     1 
ATOM   2088  O OP1   . DT  A 1 104 ? -45.265  -29.438 66.107 1.00 104.63 ? 103  DT  I OP1   1 
ATOM   2089  O OP2   . DT  A 1 104 ? -46.649  -27.488 67.056 1.00 104.70 ? 103  DT  I OP2   1 
ATOM   2090  O "O5'" . DT  A 1 104 ? -44.418  -28.063 68.014 1.00 143.88 ? 103  DT  I "O5'" 1 
ATOM   2091  C "C5'" . DT  A 1 104 ? -43.007  -28.212 67.910 1.00 146.81 ? 103  DT  I "C5'" 1 
ATOM   2092  C "C4'" . DT  A 1 104 ? -42.340  -27.701 69.164 1.00 148.65 ? 103  DT  I "C4'" 1 
ATOM   2093  O "O4'" . DT  A 1 104 ? -42.287  -26.252 69.157 1.00 148.28 ? 103  DT  I "O4'" 1 
ATOM   2094  C "C3'" . DT  A 1 104 ? -43.062  -28.097 70.454 1.00 150.78 ? 103  DT  I "C3'" 1 
ATOM   2095  O "O3'" . DT  A 1 104 ? -42.122  -28.534 71.438 1.00 155.46 ? 103  DT  I "O3'" 1 
ATOM   2096  C "C2'" . DT  A 1 104 ? -43.737  -26.809 70.894 1.00 149.05 ? 103  DT  I "C2'" 1 
ATOM   2097  C "C1'" . DT  A 1 104 ? -42.757  -25.764 70.401 1.00 147.41 ? 103  DT  I "C1'" 1 
ATOM   2098  N N1    . DT  A 1 104 ? -43.336  -24.423 70.190 1.00 110.34 ? 103  DT  I N1    1 
ATOM   2099  C C2    . DT  A 1 104 ? -42.627  -23.330 70.644 1.00 109.89 ? 103  DT  I C2    1 
ATOM   2100  O O2    . DT  A 1 104 ? -41.526  -23.414 71.165 1.00 110.27 ? 103  DT  I O2    1 
ATOM   2101  N N3    . DT  A 1 104 ? -43.254  -22.124 70.460 1.00 109.28 ? 103  DT  I N3    1 
ATOM   2102  C C4    . DT  A 1 104 ? -44.482  -21.905 69.870 1.00 108.70 ? 103  DT  I C4    1 
ATOM   2103  O O4    . DT  A 1 104 ? -44.926  -20.764 69.789 1.00 106.88 ? 103  DT  I O4    1 
ATOM   2104  C C5    . DT  A 1 104 ? -45.155  -23.089 69.389 1.00 108.86 ? 103  DT  I C5    1 
ATOM   2105  C C7    . DT  A 1 104 ? -46.479  -22.943 68.710 1.00 107.97 ? 103  DT  I C7    1 
ATOM   2106  C C6    . DT  A 1 104 ? -44.557  -24.274 69.572 1.00 109.48 ? 103  DT  I C6    1 
ATOM   2107  P P     . DT  A 1 105 ? -42.646  -29.013 72.881 1.00 171.18 ? 104  DT  I P     1 
ATOM   2108  O OP1   . DT  A 1 105 ? -41.676  -30.019 73.388 1.00 150.66 ? 104  DT  I OP1   1 
ATOM   2109  O OP2   . DT  A 1 105 ? -44.089  -29.366 72.781 1.00 150.10 ? 104  DT  I OP2   1 
ATOM   2110  O "O5'" . DT  A 1 105 ? -42.508  -27.700 73.769 1.00 171.70 ? 104  DT  I "O5'" 1 
ATOM   2111  C "C5'" . DT  A 1 105 ? -41.231  -27.108 73.990 1.00 172.87 ? 104  DT  I "C5'" 1 
ATOM   2112  C "C4'" . DT  A 1 105 ? -41.323  -26.073 75.083 1.00 174.14 ? 104  DT  I "C4'" 1 
ATOM   2113  O "O4'" . DT  A 1 105 ? -41.920  -24.856 74.577 1.00 174.89 ? 104  DT  I "O4'" 1 
ATOM   2114  C "C3'" . DT  A 1 105 ? -42.190  -26.511 76.263 1.00 175.21 ? 104  DT  I "C3'" 1 
ATOM   2115  O "O3'" . DT  A 1 105 ? -41.624  -26.030 77.479 1.00 177.19 ? 104  DT  I "O3'" 1 
ATOM   2116  C "C2'" . DT  A 1 105 ? -43.507  -25.808 75.998 1.00 175.21 ? 104  DT  I "C2'" 1 
ATOM   2117  C "C1'" . DT  A 1 105 ? -43.030  -24.507 75.384 1.00 175.26 ? 104  DT  I "C1'" 1 
ATOM   2118  N N1    . DT  A 1 105 ? -44.012  -23.814 74.534 1.00 155.89 ? 104  DT  I N1    1 
ATOM   2119  C C2    . DT  A 1 105 ? -44.024  -22.440 74.570 1.00 156.23 ? 104  DT  I C2    1 
ATOM   2120  O O2    . DT  A 1 105 ? -43.263  -21.788 75.261 1.00 156.80 ? 104  DT  I O2    1 
ATOM   2121  N N3    . DT  A 1 105 ? -44.963  -21.854 73.762 1.00 156.66 ? 104  DT  I N3    1 
ATOM   2122  C C4    . DT  A 1 105 ? -45.867  -22.490 72.938 1.00 156.87 ? 104  DT  I C4    1 
ATOM   2123  O O4    . DT  A 1 105 ? -46.651  -21.828 72.266 1.00 157.57 ? 104  DT  I O4    1 
ATOM   2124  C C5    . DT  A 1 105 ? -45.798  -23.934 72.946 1.00 156.20 ? 104  DT  I C5    1 
ATOM   2125  C C7    . DT  A 1 105 ? -46.742  -24.709 72.081 1.00 156.19 ? 104  DT  I C7    1 
ATOM   2126  C C6    . DT  A 1 105 ? -44.885  -24.516 73.733 1.00 155.72 ? 104  DT  I C6    1 
ATOM   2127  P P     . DT  A 1 106 ? -41.947  -26.783 78.858 1.00 173.13 ? 105  DT  I P     1 
ATOM   2128  O OP1   . DT  A 1 106 ? -40.675  -27.394 79.326 1.00 155.97 ? 105  DT  I OP1   1 
ATOM   2129  O OP2   . DT  A 1 106 ? -43.147  -27.636 78.662 1.00 155.63 ? 105  DT  I OP2   1 
ATOM   2130  O "O5'" . DT  A 1 106 ? -42.324  -25.592 79.842 1.00 172.38 ? 105  DT  I "O5'" 1 
ATOM   2131  C "C5'" . DT  A 1 106 ? -41.520  -24.420 79.890 1.00 172.25 ? 105  DT  I "C5'" 1 
ATOM   2132  C "C4'" . DT  A 1 106 ? -42.377  -23.214 80.183 1.00 172.38 ? 105  DT  I "C4'" 1 
ATOM   2133  O "O4'" . DT  A 1 106 ? -43.216  -22.886 79.047 1.00 172.24 ? 105  DT  I "O4'" 1 
ATOM   2134  C "C3'" . DT  A 1 106 ? -43.327  -23.402 81.365 1.00 173.26 ? 105  DT  I "C3'" 1 
ATOM   2135  O "O3'" . DT  A 1 106 ? -43.391  -22.187 82.107 1.00 174.27 ? 105  DT  I "O3'" 1 
ATOM   2136  C "C2'" . DT  A 1 106 ? -44.666  -23.651 80.696 1.00 172.41 ? 105  DT  I "C2'" 1 
ATOM   2137  C "C1'" . DT  A 1 106 ? -44.551  -22.729 79.500 1.00 171.75 ? 105  DT  I "C1'" 1 
ATOM   2138  N N1    . DT  A 1 106 ? -45.468  -23.003 78.375 1.00 154.17 ? 105  DT  I N1    1 
ATOM   2139  C C2    . DT  A 1 106 ? -46.094  -21.924 77.785 1.00 153.90 ? 105  DT  I C2    1 
ATOM   2140  O O2    . DT  A 1 106 ? -45.927  -20.774 78.152 1.00 153.80 ? 105  DT  I O2    1 
ATOM   2141  N N3    . DT  A 1 106 ? -46.931  -22.245 76.747 1.00 153.95 ? 105  DT  I N3    1 
ATOM   2142  C C4    . DT  A 1 106 ? -47.202  -23.507 76.252 1.00 153.73 ? 105  DT  I C4    1 
ATOM   2143  O O4    . DT  A 1 106 ? -47.977  -23.641 75.309 1.00 152.90 ? 105  DT  I O4    1 
ATOM   2144  C C5    . DT  A 1 106 ? -46.517  -24.593 76.920 1.00 153.69 ? 105  DT  I C5    1 
ATOM   2145  C C7    . DT  A 1 106 ? -46.758  -25.995 76.455 1.00 153.87 ? 105  DT  I C7    1 
ATOM   2146  C C6    . DT  A 1 106 ? -45.693  -24.290 77.933 1.00 153.71 ? 105  DT  I C6    1 
ATOM   2147  P P     . DC  A 1 107 ? -43.278  -22.230 83.703 1.00 170.89 ? 106  DC  I P     1 
ATOM   2148  O OP1   . DC  A 1 107 ? -41.846  -22.020 84.045 1.00 137.79 ? 106  DC  I OP1   1 
ATOM   2149  O OP2   . DC  A 1 107 ? -43.987  -23.448 84.182 1.00 137.27 ? 106  DC  I OP2   1 
ATOM   2150  O "O5'" . DC  A 1 107 ? -44.089  -20.948 84.174 1.00 171.19 ? 106  DC  I "O5'" 1 
ATOM   2151  C "C5'" . DC  A 1 107 ? -43.620  -19.643 83.865 1.00 170.89 ? 106  DC  I "C5'" 1 
ATOM   2152  C "C4'" . DC  A 1 107 ? -44.783  -18.685 83.785 1.00 171.12 ? 106  DC  I "C4'" 1 
ATOM   2153  O "O4'" . DC  A 1 107 ? -45.572  -18.972 82.603 1.00 171.72 ? 106  DC  I "O4'" 1 
ATOM   2154  C "C3'" . DC  A 1 107 ? -45.743  -18.777 84.970 1.00 171.15 ? 106  DC  I "C3'" 1 
ATOM   2155  O "O3'" . DC  A 1 107 ? -46.163  -17.470 85.360 1.00 171.06 ? 106  DC  I "O3'" 1 
ATOM   2156  C "C2'" . DC  A 1 107 ? -46.909  -19.581 84.422 1.00 170.82 ? 106  DC  I "C2'" 1 
ATOM   2157  C "C1'" . DC  A 1 107 ? -46.932  -19.167 82.962 1.00 171.49 ? 106  DC  I "C1'" 1 
ATOM   2158  N N1    . DC  A 1 107 ? -47.514  -20.167 82.043 1.00 139.06 ? 106  DC  I N1    1 
ATOM   2159  C C2    . DC  A 1 107 ? -48.239  -19.721 80.925 1.00 139.59 ? 106  DC  I C2    1 
ATOM   2160  O O2    . DC  A 1 107 ? -48.364  -18.502 80.736 1.00 139.51 ? 106  DC  I O2    1 
ATOM   2161  N N3    . DC  A 1 107 ? -48.785  -20.633 80.085 1.00 139.50 ? 106  DC  I N3    1 
ATOM   2162  C C4    . DC  A 1 107 ? -48.636  -21.938 80.327 1.00 139.02 ? 106  DC  I C4    1 
ATOM   2163  N N4    . DC  A 1 107 ? -49.205  -22.802 79.482 1.00 138.99 ? 106  DC  I N4    1 
ATOM   2164  C C5    . DC  A 1 107 ? -47.900  -22.418 81.451 1.00 138.51 ? 106  DC  I C5    1 
ATOM   2165  C C6    . DC  A 1 107 ? -47.359  -21.507 82.273 1.00 138.42 ? 106  DC  I C6    1 
ATOM   2166  P P     . DC  A 1 108 ? -47.370  -17.303 86.405 1.00 183.22 ? 107  DC  I P     1 
ATOM   2167  O OP1   . DC  A 1 108 ? -47.191  -15.990 87.075 1.00 157.85 ? 107  DC  I OP1   1 
ATOM   2168  O OP2   . DC  A 1 108 ? -47.478  -18.538 87.224 1.00 157.97 ? 107  DC  I OP2   1 
ATOM   2169  O "O5'" . DC  A 1 108 ? -48.653  -17.208 85.469 1.00 182.37 ? 107  DC  I "O5'" 1 
ATOM   2170  C "C5'" . DC  A 1 108 ? -48.798  -16.130 84.549 1.00 180.26 ? 107  DC  I "C5'" 1 
ATOM   2171  C "C4'" . DC  A 1 108 ? -50.252  -15.946 84.191 1.00 178.87 ? 107  DC  I "C4'" 1 
ATOM   2172  O "O4'" . DC  A 1 108 ? -50.680  -17.018 83.319 1.00 179.42 ? 107  DC  I "O4'" 1 
ATOM   2173  C "C3'" . DC  A 1 108 ? -51.188  -15.979 85.396 1.00 177.65 ? 107  DC  I "C3'" 1 
ATOM   2174  O "O3'" . DC  A 1 108 ? -52.254  -15.053 85.207 1.00 175.98 ? 107  DC  I "O3'" 1 
ATOM   2175  C "C2'" . DC  A 1 108 ? -51.716  -17.401 85.387 1.00 177.19 ? 107  DC  I "C2'" 1 
ATOM   2176  C "C1'" . DC  A 1 108 ? -51.777  -17.702 83.900 1.00 178.08 ? 107  DC  I "C1'" 1 
ATOM   2177  N N1    . DC  A 1 108 ? -51.649  -19.122 83.548 1.00 152.64 ? 107  DC  I N1    1 
ATOM   2178  C C2    . DC  A 1 108 ? -52.437  -19.625 82.518 1.00 152.08 ? 107  DC  I C2    1 
ATOM   2179  O O2    . DC  A 1 108 ? -53.224  -18.862 81.942 1.00 151.61 ? 107  DC  I O2    1 
ATOM   2180  N N3    . DC  A 1 108 ? -52.324  -20.928 82.173 1.00 151.69 ? 107  DC  I N3    1 
ATOM   2181  C C4    . DC  A 1 108 ? -51.464  -21.717 82.820 1.00 151.81 ? 107  DC  I C4    1 
ATOM   2182  N N4    . DC  A 1 108 ? -51.382  -22.997 82.443 1.00 152.18 ? 107  DC  I N4    1 
ATOM   2183  C C5    . DC  A 1 108 ? -50.650  -21.229 83.882 1.00 152.20 ? 107  DC  I C5    1 
ATOM   2184  C C6    . DC  A 1 108 ? -50.774  -19.937 84.210 1.00 152.49 ? 107  DC  I C6    1 
ATOM   2185  P P     . DA  A 1 109 ? -52.591  -13.996 86.362 1.00 153.56 ? 108  DA  I P     1 
ATOM   2186  O OP1   . DA  A 1 109 ? -51.614  -12.879 86.233 1.00 130.42 ? 108  DA  I OP1   1 
ATOM   2187  O OP2   . DA  A 1 109 ? -52.678  -14.759 87.633 1.00 129.74 ? 108  DA  I OP2   1 
ATOM   2188  O "O5'" . DA  A 1 109 ? -54.048  -13.461 85.995 1.00 150.72 ? 108  DA  I "O5'" 1 
ATOM   2189  C "C5'" . DA  A 1 109 ? -54.284  -12.699 84.808 1.00 144.89 ? 108  DA  I "C5'" 1 
ATOM   2190  C "C4'" . DA  A 1 109 ? -55.634  -13.051 84.226 1.00 140.83 ? 108  DA  I "C4'" 1 
ATOM   2191  O "O4'" . DA  A 1 109 ? -55.612  -14.423 83.767 1.00 140.95 ? 108  DA  I "O4'" 1 
ATOM   2192  C "C3'" . DA  A 1 109 ? -56.785  -12.964 85.228 1.00 138.56 ? 108  DA  I "C3'" 1 
ATOM   2193  O "O3'" . DA  A 1 109 ? -57.998  -12.650 84.550 1.00 133.74 ? 108  DA  I "O3'" 1 
ATOM   2194  C "C2'" . DA  A 1 109 ? -56.898  -14.390 85.728 1.00 138.64 ? 108  DA  I "C2'" 1 
ATOM   2195  C "C1'" . DA  A 1 109 ? -56.585  -15.181 84.468 1.00 139.50 ? 108  DA  I "C1'" 1 
ATOM   2196  N N9    . DA  A 1 109 ? -56.031  -16.512 84.715 1.00 116.28 ? 108  DA  I N9    1 
ATOM   2197  C C8    . DA  A 1 109 ? -55.264  -16.922 85.779 1.00 116.96 ? 108  DA  I C8    1 
ATOM   2198  N N7    . DA  A 1 109 ? -54.948  -18.193 85.743 1.00 117.00 ? 108  DA  I N7    1 
ATOM   2199  C C5    . DA  A 1 109 ? -55.537  -18.650 84.573 1.00 116.59 ? 108  DA  I C5    1 
ATOM   2200  C C6    . DA  A 1 109 ? -55.577  -19.914 83.971 1.00 116.54 ? 108  DA  I C6    1 
ATOM   2201  N N6    . DA  A 1 109 ? -54.991  -20.998 84.486 1.00 116.20 ? 108  DA  I N6    1 
ATOM   2202  N N1    . DA  A 1 109 ? -56.249  -20.032 82.806 1.00 116.71 ? 108  DA  I N1    1 
ATOM   2203  C C2    . DA  A 1 109 ? -56.834  -18.945 82.291 1.00 116.37 ? 108  DA  I C2    1 
ATOM   2204  N N3    . DA  A 1 109 ? -56.869  -17.704 82.764 1.00 115.81 ? 108  DA  I N3    1 
ATOM   2205  C C4    . DA  A 1 109 ? -56.196  -17.623 83.923 1.00 116.25 ? 108  DA  I C4    1 
ATOM   2206  P P     . DA  A 1 110 ? -58.208  -11.199 83.902 1.00 124.86 ? 109  DA  I P     1 
ATOM   2207  O OP1   . DA  A 1 110 ? -56.880  -10.699 83.457 1.00 122.81 ? 109  DA  I OP1   1 
ATOM   2208  O OP2   . DA  A 1 110 ? -59.040  -10.371 84.812 1.00 123.43 ? 109  DA  I OP2   1 
ATOM   2209  O "O5'" . DA  A 1 110 ? -59.086  -11.531 82.616 1.00 124.19 ? 109  DA  I "O5'" 1 
ATOM   2210  C "C5'" . DA  A 1 110 ? -58.516  -12.215 81.494 1.00 119.95 ? 109  DA  I "C5'" 1 
ATOM   2211  C "C4'" . DA  A 1 110 ? -59.451  -13.286 80.967 1.00 116.92 ? 109  DA  I "C4'" 1 
ATOM   2212  O "O4'" . DA  A 1 110 ? -59.205  -14.584 81.563 1.00 115.15 ? 109  DA  I "O4'" 1 
ATOM   2213  C "C3'" . DA  A 1 110 ? -60.957  -13.038 81.080 1.00 116.52 ? 109  DA  I "C3'" 1 
ATOM   2214  O "O3'" . DA  A 1 110 ? -61.571  -13.314 79.816 1.00 118.91 ? 109  DA  I "O3'" 1 
ATOM   2215  C "C2'" . DA  A 1 110 ? -61.402  -14.036 82.139 1.00 114.11 ? 109  DA  I "C2'" 1 
ATOM   2216  C "C1'" . DA  A 1 110 ? -60.442  -15.188 81.909 1.00 112.47 ? 109  DA  I "C1'" 1 
ATOM   2217  N N9    . DA  A 1 110 ? -60.203  -16.059 83.061 1.00 109.41 ? 109  DA  I N9    1 
ATOM   2218  C C8    . DA  A 1 110 ? -60.042  -15.701 84.377 1.00 108.40 ? 109  DA  I C8    1 
ATOM   2219  N N7    . DA  A 1 110 ? -59.786  -16.713 85.174 1.00 106.55 ? 109  DA  I N7    1 
ATOM   2220  C C5    . DA  A 1 110 ? -59.789  -17.814 84.328 1.00 105.72 ? 109  DA  I C5    1 
ATOM   2221  C C6    . DA  A 1 110 ? -59.570  -19.184 84.557 1.00 104.51 ? 109  DA  I C6    1 
ATOM   2222  N N6    . DA  A 1 110 ? -59.288  -19.697 85.750 1.00 104.31 ? 109  DA  I N6    1 
ATOM   2223  N N1    . DA  A 1 110 ? -59.650  -20.019 83.502 1.00 103.76 ? 109  DA  I N1    1 
ATOM   2224  C C2    . DA  A 1 110 ? -59.931  -19.505 82.302 1.00 104.60 ? 109  DA  I C2    1 
ATOM   2225  N N3    . DA  A 1 110 ? -60.152  -18.237 81.956 1.00 106.40 ? 109  DA  I N3    1 
ATOM   2226  C C4    . DA  A 1 110 ? -60.062  -17.430 83.028 1.00 107.16 ? 109  DA  I C4    1 
ATOM   2227  P P     . DA  A 1 111 ? -63.149  -13.587 79.735 1.00 129.39 ? 110  DA  I P     1 
ATOM   2228  O OP1   . DA  A 1 111 ? -63.589  -13.205 78.369 1.00 109.74 ? 110  DA  I OP1   1 
ATOM   2229  O OP2   . DA  A 1 111 ? -63.821  -12.997 80.922 1.00 109.72 ? 110  DA  I OP2   1 
ATOM   2230  O "O5'" . DA  A 1 111 ? -63.237  -15.169 79.856 1.00 127.86 ? 110  DA  I "O5'" 1 
ATOM   2231  C "C5'" . DA  A 1 111 ? -62.520  -16.003 78.951 1.00 125.46 ? 110  DA  I "C5'" 1 
ATOM   2232  C "C4'" . DA  A 1 111 ? -63.109  -17.392 78.961 1.00 124.26 ? 110  DA  I "C4'" 1 
ATOM   2233  O "O4'" . DA  A 1 111 ? -62.676  -18.115 80.138 1.00 123.88 ? 110  DA  I "O4'" 1 
ATOM   2234  C "C3'" . DA  A 1 111 ? -64.637  -17.394 78.999 1.00 123.02 ? 110  DA  I "C3'" 1 
ATOM   2235  O "O3'" . DA  A 1 111 ? -65.139  -18.471 78.219 1.00 120.50 ? 110  DA  I "O3'" 1 
ATOM   2236  C "C2'" . DA  A 1 111 ? -64.941  -17.655 80.459 1.00 124.63 ? 110  DA  I "C2'" 1 
ATOM   2237  C "C1'" . DA  A 1 111 ? -63.812  -18.589 80.836 1.00 124.16 ? 110  DA  I "C1'" 1 
ATOM   2238  N N9    . DA  A 1 111 ? -63.499  -18.597 82.260 1.00 105.47 ? 110  DA  I N9    1 
ATOM   2239  C C8    . DA  A 1 111 ? -63.646  -17.585 83.171 1.00 105.64 ? 110  DA  I C8    1 
ATOM   2240  N N7    . DA  A 1 111 ? -63.308  -17.921 84.390 1.00 106.00 ? 110  DA  I N7    1 
ATOM   2241  C C5    . DA  A 1 111 ? -62.902  -19.242 84.268 1.00 106.34 ? 110  DA  I C5    1 
ATOM   2242  C C6    . DA  A 1 111 ? -62.429  -20.178 85.201 1.00 106.94 ? 110  DA  I C6    1 
ATOM   2243  N N6    . DA  A 1 111 ? -62.276  -19.917 86.500 1.00 107.39 ? 110  DA  I N6    1 
ATOM   2244  N N1    . DA  A 1 111 ? -62.111  -21.411 84.750 1.00 106.87 ? 110  DA  I N1    1 
ATOM   2245  C C2    . DA  A 1 111 ? -62.260  -21.672 83.451 1.00 106.45 ? 110  DA  I C2    1 
ATOM   2246  N N3    . DA  A 1 111 ? -62.695  -20.879 82.480 1.00 107.12 ? 110  DA  I N3    1 
ATOM   2247  C C4    . DA  A 1 111 ? -63.005  -19.665 82.961 1.00 106.19 ? 110  DA  I C4    1 
ATOM   2248  P P     . DT  A 1 112 ? -66.713  -18.583 77.936 1.00 93.89  ? 111  DT  I P     1 
ATOM   2249  O OP1   . DT  A 1 112 ? -66.937  -18.026 76.576 1.00 108.41 ? 111  DT  I OP1   1 
ATOM   2250  O OP2   . DT  A 1 112 ? -67.486  -18.052 79.088 1.00 107.61 ? 111  DT  I OP2   1 
ATOM   2251  O "O5'" . DT  A 1 112 ? -66.944  -20.153 77.877 1.00 93.22  ? 111  DT  I "O5'" 1 
ATOM   2252  C "C5'" . DT  A 1 112 ? -65.950  -21.005 77.330 1.00 93.11  ? 111  DT  I "C5'" 1 
ATOM   2253  C "C4'" . DT  A 1 112 ? -65.967  -22.328 78.052 1.00 92.80  ? 111  DT  I "C4'" 1 
ATOM   2254  O "O4'" . DT  A 1 112 ? -65.371  -22.193 79.369 1.00 92.96  ? 111  DT  I "O4'" 1 
ATOM   2255  C "C3'" . DT  A 1 112 ? -67.386  -22.841 78.281 1.00 91.91  ? 111  DT  I "C3'" 1 
ATOM   2256  O "O3'" . DT  A 1 112 ? -67.445  -24.248 78.101 1.00 90.64  ? 111  DT  I "O3'" 1 
ATOM   2257  C "C2'" . DT  A 1 112 ? -67.643  -22.519 79.737 1.00 92.25  ? 111  DT  I "C2'" 1 
ATOM   2258  C "C1'" . DT  A 1 112 ? -66.266  -22.727 80.329 1.00 93.37  ? 111  DT  I "C1'" 1 
ATOM   2259  N N1    . DT  A 1 112 ? -66.062  -22.034 81.617 1.00 108.92 ? 111  DT  I N1    1 
ATOM   2260  C C2    . DT  A 1 112 ? -65.553  -22.768 82.672 1.00 109.41 ? 111  DT  I C2    1 
ATOM   2261  O O2    . DT  A 1 112 ? -65.211  -23.936 82.571 1.00 108.62 ? 111  DT  I O2    1 
ATOM   2262  N N3    . DT  A 1 112 ? -65.461  -22.080 83.855 1.00 109.62 ? 111  DT  I N3    1 
ATOM   2263  C C4    . DT  A 1 112 ? -65.814  -20.761 84.085 1.00 109.39 ? 111  DT  I C4    1 
ATOM   2264  O O4    . DT  A 1 112 ? -65.693  -20.283 85.212 1.00 109.76 ? 111  DT  I O4    1 
ATOM   2265  C C5    . DT  A 1 112 ? -66.314  -20.043 82.930 1.00 109.17 ? 111  DT  I C5    1 
ATOM   2266  C C7    . DT  A 1 112 ? -66.712  -18.607 83.087 1.00 108.88 ? 111  DT  I C7    1 
ATOM   2267  C C6    . DT  A 1 112 ? -66.405  -20.705 81.767 1.00 109.14 ? 111  DT  I C6    1 
ATOM   2268  P P     . DA  A 1 113 ? -68.790  -25.035 78.480 1.00 87.17  ? 112  DA  I P     1 
ATOM   2269  O OP1   . DA  A 1 113 ? -69.132  -25.942 77.354 1.00 101.04 ? 112  DA  I OP1   1 
ATOM   2270  O OP2   . DA  A 1 113 ? -69.804  -24.071 78.973 1.00 100.82 ? 112  DA  I OP2   1 
ATOM   2271  O "O5'" . DA  A 1 113 ? -68.310  -25.935 79.692 1.00 90.74  ? 112  DA  I "O5'" 1 
ATOM   2272  C "C5'" . DA  A 1 113 ? -67.093  -26.667 79.604 1.00 95.53  ? 112  DA  I "C5'" 1 
ATOM   2273  C "C4'" . DA  A 1 113 ? -66.947  -27.547 80.819 1.00 97.99  ? 112  DA  I "C4'" 1 
ATOM   2274  O "O4'" . DA  A 1 113 ? -66.722  -26.705 81.972 1.00 97.73  ? 112  DA  I "O4'" 1 
ATOM   2275  C "C3'" . DA  A 1 113 ? -68.214  -28.340 81.118 1.00 100.02 ? 112  DA  I "C3'" 1 
ATOM   2276  O "O3'" . DA  A 1 113 ? -67.883  -29.614 81.669 1.00 105.08 ? 112  DA  I "O3'" 1 
ATOM   2277  C "C2'" . DA  A 1 113 ? -68.938  -27.472 82.127 1.00 99.17  ? 112  DA  I "C2'" 1 
ATOM   2278  C "C1'" . DA  A 1 113 ? -67.795  -26.828 82.888 1.00 98.61  ? 112  DA  I "C1'" 1 
ATOM   2279  N N9    . DA  A 1 113 ? -68.099  -25.490 83.384 1.00 112.64 ? 112  DA  I N9    1 
ATOM   2280  C C8    . DA  A 1 113 ? -68.517  -24.400 82.663 1.00 112.64 ? 112  DA  I C8    1 
ATOM   2281  N N7    . DA  A 1 113 ? -68.707  -23.328 83.389 1.00 112.87 ? 112  DA  I N7    1 
ATOM   2282  C C5    . DA  A 1 113 ? -68.394  -23.739 84.677 1.00 112.88 ? 112  DA  I C5    1 
ATOM   2283  C C6    . DA  A 1 113 ? -68.396  -23.070 85.909 1.00 112.72 ? 112  DA  I C6    1 
ATOM   2284  N N6    . DA  A 1 113 ? -68.738  -21.788 86.051 1.00 112.81 ? 112  DA  I N6    1 
ATOM   2285  N N1    . DA  A 1 113 ? -68.030  -23.770 87.006 1.00 112.71 ? 112  DA  I N1    1 
ATOM   2286  C C2    . DA  A 1 113 ? -67.685  -25.054 86.860 1.00 112.17 ? 112  DA  I C2    1 
ATOM   2287  N N3    . DA  A 1 113 ? -67.646  -25.794 85.757 1.00 112.14 ? 112  DA  I N3    1 
ATOM   2288  C C4    . DA  A 1 113 ? -68.017  -25.069 84.687 1.00 112.78 ? 112  DA  I C4    1 
ATOM   2289  P P     . DC  A 1 114 ? -69.047  -30.674 81.953 1.00 109.12 ? 113  DC  I P     1 
ATOM   2290  O OP1   . DC  A 1 114 ? -68.450  -31.739 82.792 1.00 120.60 ? 113  DC  I OP1   1 
ATOM   2291  O OP2   . DC  A 1 114 ? -69.728  -31.031 80.684 1.00 119.89 ? 113  DC  I OP2   1 
ATOM   2292  O "O5'" . DC  A 1 114 ? -70.069  -29.836 82.829 1.00 111.39 ? 113  DC  I "O5'" 1 
ATOM   2293  C "C5'" . DC  A 1 114 ? -70.918  -30.476 83.762 1.00 115.72 ? 113  DC  I "C5'" 1 
ATOM   2294  C "C4'" . DC  A 1 114 ? -70.244  -30.542 85.112 1.00 118.03 ? 113  DC  I "C4'" 1 
ATOM   2295  O "O4'" . DC  A 1 114 ? -69.777  -29.228 85.505 1.00 118.38 ? 113  DC  I "O4'" 1 
ATOM   2296  C "C3'" . DC  A 1 114 ? -71.182  -31.008 86.219 1.00 120.14 ? 113  DC  I "C3'" 1 
ATOM   2297  O "O3'" . DC  A 1 114 ? -70.486  -31.846 87.137 1.00 124.32 ? 113  DC  I "O3'" 1 
ATOM   2298  C "C2'" . DC  A 1 114 ? -71.629  -29.715 86.872 1.00 119.06 ? 113  DC  I "C2'" 1 
ATOM   2299  C "C1'" . DC  A 1 114 ? -70.423  -28.809 86.699 1.00 118.56 ? 113  DC  I "C1'" 1 
ATOM   2300  N N1    . DC  A 1 114 ? -70.777  -27.387 86.547 1.00 129.48 ? 113  DC  I N1    1 
ATOM   2301  C C2    . DC  A 1 114 ? -70.437  -26.494 87.568 1.00 128.95 ? 113  DC  I C2    1 
ATOM   2302  O O2    . DC  A 1 114 ? -69.838  -26.922 88.569 1.00 128.61 ? 113  DC  I O2    1 
ATOM   2303  N N3    . DC  A 1 114 ? -70.768  -25.188 87.439 1.00 129.15 ? 113  DC  I N3    1 
ATOM   2304  C C4    . DC  A 1 114 ? -71.409  -24.767 86.349 1.00 129.33 ? 113  DC  I C4    1 
ATOM   2305  N N4    . DC  A 1 114 ? -71.715  -23.474 86.269 1.00 129.02 ? 113  DC  I N4    1 
ATOM   2306  C C5    . DC  A 1 114 ? -71.764  -25.654 85.294 1.00 129.53 ? 113  DC  I C5    1 
ATOM   2307  C C6    . DC  A 1 114 ? -71.431  -26.943 85.432 1.00 129.48 ? 113  DC  I C6    1 
ATOM   2308  P P     . DA  A 1 115 ? -71.306  -32.918 87.999 1.00 157.13 ? 114  DA  I P     1 
ATOM   2309  O OP1   . DA  A 1 115 ? -70.296  -33.785 88.665 1.00 120.22 ? 114  DA  I OP1   1 
ATOM   2310  O OP2   . DA  A 1 115 ? -72.353  -33.528 87.133 1.00 118.71 ? 114  DA  I OP2   1 
ATOM   2311  O "O5'" . DA  A 1 115 ? -72.040  -32.024 89.094 1.00 160.02 ? 114  DA  I "O5'" 1 
ATOM   2312  C "C5'" . DA  A 1 115 ? -71.397  -31.700 90.323 1.00 164.93 ? 114  DA  I "C5'" 1 
ATOM   2313  C "C4'" . DA  A 1 115 ? -72.380  -31.042 91.261 1.00 168.48 ? 114  DA  I "C4'" 1 
ATOM   2314  O "O4'" . DA  A 1 115 ? -72.583  -29.661 90.874 1.00 169.41 ? 114  DA  I "O4'" 1 
ATOM   2315  C "C3'" . DA  A 1 115 ? -73.765  -31.693 91.264 1.00 170.53 ? 114  DA  I "C3'" 1 
ATOM   2316  O "O3'" . DA  A 1 115 ? -74.286  -31.755 92.595 1.00 173.33 ? 114  DA  I "O3'" 1 
ATOM   2317  C "C2'" . DA  A 1 115 ? -74.594  -30.752 90.409 1.00 170.35 ? 114  DA  I "C2'" 1 
ATOM   2318  C "C1'" . DA  A 1 115 ? -73.972  -29.410 90.738 1.00 170.24 ? 114  DA  I "C1'" 1 
ATOM   2319  N N9    . DA  A 1 115 ? -74.157  -28.381 89.713 1.00 133.80 ? 114  DA  I N9    1 
ATOM   2320  C C8    . DA  A 1 115 ? -74.109  -28.524 88.348 1.00 134.11 ? 114  DA  I C8    1 
ATOM   2321  N N7    . DA  A 1 115 ? -74.338  -27.412 87.691 1.00 134.18 ? 114  DA  I N7    1 
ATOM   2322  C C5    . DA  A 1 115 ? -74.549  -26.472 88.690 1.00 133.94 ? 114  DA  I C5    1 
ATOM   2323  C C6    . DA  A 1 115 ? -74.848  -25.100 88.650 1.00 133.91 ? 114  DA  I C6    1 
ATOM   2324  N N6    . DA  A 1 115 ? -74.988  -24.408 87.518 1.00 133.60 ? 114  DA  I N6    1 
ATOM   2325  N N1    . DA  A 1 115 ? -75.002  -24.454 89.827 1.00 133.99 ? 114  DA  I N1    1 
ATOM   2326  C C2    . DA  A 1 115 ? -74.861  -25.151 90.961 1.00 134.10 ? 114  DA  I C2    1 
ATOM   2327  N N3    . DA  A 1 115 ? -74.580  -26.441 91.130 1.00 133.71 ? 114  DA  I N3    1 
ATOM   2328  C C4    . DA  A 1 115 ? -74.436  -27.054 89.941 1.00 133.74 ? 114  DA  I C4    1 
ATOM   2329  P P     . DC  A 1 116 ? -75.856  -32.009 92.826 1.00 149.30 ? 115  DC  I P     1 
ATOM   2330  O OP1   . DC  A 1 116 ? -76.003  -32.592 94.180 1.00 133.92 ? 115  DC  I OP1   1 
ATOM   2331  O OP2   . DC  A 1 116 ? -76.434  -32.719 91.656 1.00 133.60 ? 115  DC  I OP2   1 
ATOM   2332  O "O5'" . DC  A 1 116 ? -76.459  -30.540 92.867 1.00 150.62 ? 115  DC  I "O5'" 1 
ATOM   2333  C "C5'" . DC  A 1 116 ? -76.029  -29.614 93.858 1.00 153.87 ? 115  DC  I "C5'" 1 
ATOM   2334  C "C4'" . DC  A 1 116 ? -77.063  -28.529 94.029 1.00 156.13 ? 115  DC  I "C4'" 1 
ATOM   2335  O "O4'" . DC  A 1 116 ? -77.001  -27.612 92.909 1.00 157.84 ? 115  DC  I "O4'" 1 
ATOM   2336  C "C3'" . DC  A 1 116 ? -78.497  -29.059 94.068 1.00 156.73 ? 115  DC  I "C3'" 1 
ATOM   2337  O "O3'" . DC  A 1 116 ? -79.267  -28.315 95.010 1.00 156.66 ? 115  DC  I "O3'" 1 
ATOM   2338  C "C2'" . DC  A 1 116 ? -79.001  -28.802 92.660 1.00 157.95 ? 115  DC  I "C2'" 1 
ATOM   2339  C "C1'" . DC  A 1 116 ? -78.280  -27.516 92.298 1.00 158.96 ? 115  DC  I "C1'" 1 
ATOM   2340  N N1    . DC  A 1 116 ? -78.083  -27.323 90.852 1.00 144.80 ? 115  DC  I N1    1 
ATOM   2341  C C2    . DC  A 1 116 ? -78.184  -26.032 90.322 1.00 145.47 ? 115  DC  I C2    1 
ATOM   2342  O O2    . DC  A 1 116 ? -78.424  -25.086 91.085 1.00 145.45 ? 115  DC  I O2    1 
ATOM   2343  N N3    . DC  A 1 116 ? -78.018  -25.850 88.992 1.00 146.05 ? 115  DC  I N3    1 
ATOM   2344  C C4    . DC  A 1 116 ? -77.760  -26.895 88.203 1.00 146.11 ? 115  DC  I C4    1 
ATOM   2345  N N4    . DC  A 1 116 ? -77.604  -26.670 86.896 1.00 146.20 ? 115  DC  I N4    1 
ATOM   2346  C C5    . DC  A 1 116 ? -77.648  -28.219 88.717 1.00 145.72 ? 115  DC  I C5    1 
ATOM   2347  C C6    . DC  A 1 116 ? -77.814  -28.386 90.034 1.00 145.26 ? 115  DC  I C6    1 
ATOM   2348  P P     . DT  A 1 117 ? -80.829  -28.633 95.193 1.00 164.17 ? 116  DT  I P     1 
ATOM   2349  O OP1   . DT  A 1 117 ? -81.026  -29.107 96.584 1.00 142.76 ? 116  DT  I OP1   1 
ATOM   2350  O OP2   . DT  A 1 117 ? -81.301  -29.468 94.057 1.00 142.50 ? 116  DT  I OP2   1 
ATOM   2351  O "O5'" . DT  A 1 117 ? -81.497  -27.197 95.068 1.00 163.63 ? 116  DT  I "O5'" 1 
ATOM   2352  C "C5'" . DT  A 1 117 ? -80.886  -26.063 95.674 1.00 163.09 ? 116  DT  I "C5'" 1 
ATOM   2353  C "C4'" . DT  A 1 117 ? -81.575  -24.802 95.214 1.00 162.85 ? 116  DT  I "C4'" 1 
ATOM   2354  O "O4'" . DT  A 1 117 ? -81.238  -24.542 93.828 1.00 163.31 ? 116  DT  I "O4'" 1 
ATOM   2355  C "C3'" . DT  A 1 117 ? -83.099  -24.894 95.273 1.00 162.04 ? 116  DT  I "C3'" 1 
ATOM   2356  O "O3'" . DT  A 1 117 ? -83.658  -23.655 95.700 1.00 160.09 ? 116  DT  I "O3'" 1 
ATOM   2357  C "C2'" . DT  A 1 117 ? -83.490  -25.178 93.835 1.00 162.79 ? 116  DT  I "C2'" 1 
ATOM   2358  C "C1'" . DT  A 1 117 ? -82.427  -24.422 93.062 1.00 163.10 ? 116  DT  I "C1'" 1 
ATOM   2359  N N1    . DT  A 1 117 ? -82.162  -24.951 91.708 1.00 141.51 ? 116  DT  I N1    1 
ATOM   2360  C C2    . DT  A 1 117 ? -82.154  -24.058 90.662 1.00 140.95 ? 116  DT  I C2    1 
ATOM   2361  O O2    . DT  A 1 117 ? -82.341  -22.862 90.807 1.00 140.46 ? 116  DT  I O2    1 
ATOM   2362  N N3    . DT  A 1 117 ? -81.916  -24.620 89.431 1.00 140.83 ? 116  DT  I N3    1 
ATOM   2363  C C4    . DT  A 1 117 ? -81.691  -25.954 89.150 1.00 141.06 ? 116  DT  I C4    1 
ATOM   2364  O O4    . DT  A 1 117 ? -81.490  -26.308 87.992 1.00 139.85 ? 116  DT  I O4    1 
ATOM   2365  C C5    . DT  A 1 117 ? -81.713  -26.836 90.296 1.00 141.20 ? 116  DT  I C5    1 
ATOM   2366  C C7    . DT  A 1 117 ? -81.485  -28.301 90.091 1.00 141.07 ? 116  DT  I C7    1 
ATOM   2367  C C6    . DT  A 1 117 ? -81.941  -26.297 91.502 1.00 141.68 ? 116  DT  I C6    1 
ATOM   2368  P P     . DT  A 1 118 ? -85.243  -23.533 95.908 1.00 139.93 ? 117  DT  I P     1 
ATOM   2369  O OP1   . DT  A 1 118 ? -85.470  -23.042 97.289 1.00 154.69 ? 117  DT  I OP1   1 
ATOM   2370  O OP2   . DT  A 1 118 ? -85.884  -24.796 95.459 1.00 153.96 ? 117  DT  I OP2   1 
ATOM   2371  O "O5'" . DT  A 1 118 ? -85.646  -22.372 94.901 1.00 138.45 ? 117  DT  I "O5'" 1 
ATOM   2372  C "C5'" . DT  A 1 118 ? -84.912  -21.152 94.878 1.00 135.83 ? 117  DT  I "C5'" 1 
ATOM   2373  C "C4'" . DT  A 1 118 ? -85.319  -20.321 93.685 1.00 134.55 ? 117  DT  I "C4'" 1 
ATOM   2374  O "O4'" . DT  A 1 118 ? -84.880  -20.963 92.462 1.00 135.82 ? 117  DT  I "O4'" 1 
ATOM   2375  C "C3'" . DT  A 1 118 ? -86.827  -20.112 93.537 1.00 133.09 ? 117  DT  I "C3'" 1 
ATOM   2376  O "O3'" . DT  A 1 118 ? -87.076  -18.766 93.128 1.00 129.44 ? 117  DT  I "O3'" 1 
ATOM   2377  C "C2'" . DT  A 1 118 ? -87.215  -21.095 92.444 1.00 134.51 ? 117  DT  I "C2'" 1 
ATOM   2378  C "C1'" . DT  A 1 118 ? -85.976  -21.100 91.568 1.00 136.51 ? 117  DT  I "C1'" 1 
ATOM   2379  N N1    . DT  A 1 118 ? -85.765  -22.327 90.759 1.00 152.22 ? 117  DT  I N1    1 
ATOM   2380  C C2    . DT  A 1 118 ? -85.620  -22.186 89.392 1.00 152.69 ? 117  DT  I C2    1 
ATOM   2381  O O2    . DT  A 1 118 ? -85.695  -21.111 88.820 1.00 152.44 ? 117  DT  I O2    1 
ATOM   2382  N N3    . DT  A 1 118 ? -85.388  -23.360 88.716 1.00 152.70 ? 117  DT  I N3    1 
ATOM   2383  C C4    . DT  A 1 118 ? -85.297  -24.630 89.251 1.00 152.70 ? 117  DT  I C4    1 
ATOM   2384  O O4    . DT  A 1 118 ? -85.061  -25.588 88.522 1.00 151.67 ? 117  DT  I O4    1 
ATOM   2385  C C5    . DT  A 1 118 ? -85.489  -24.709 90.679 1.00 153.15 ? 117  DT  I C5    1 
ATOM   2386  C C7    . DT  A 1 118 ? -85.444  -26.051 91.337 1.00 153.79 ? 117  DT  I C7    1 
ATOM   2387  C C6    . DT  A 1 118 ? -85.704  -23.570 91.355 1.00 153.15 ? 117  DT  I C6    1 
ATOM   2388  P P     . DT  A 1 119 ? -88.581  -18.270 92.869 1.00 160.66 ? 118  DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 119 ? -88.752  -16.997 93.612 1.00 155.93 ? 118  DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 119 ? -89.516  -19.396 93.119 1.00 155.84 ? 118  DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 119 ? -88.586  -17.938 91.309 1.00 159.62 ? 118  DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 119 ? -87.491  -17.237 90.709 1.00 154.70 ? 118  DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 119 ? -87.599  -17.268 89.201 1.00 150.22 ? 118  DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 119 ? -87.426  -18.623 88.719 1.00 149.74 ? 118  DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 119 ? -88.938  -16.789 88.643 1.00 147.16 ? 118  DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 119 ? -88.729  -16.017 87.462 1.00 142.87 ? 118  DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 119 ? -89.667  -18.078 88.309 1.00 147.05 ? 118  DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 119 ? -88.526  -18.989 87.899 1.00 148.55 ? 118  DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 119 ? -88.784  -20.428 88.100 1.00 144.34 ? 118  DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 119 ? -88.682  -21.265 87.012 1.00 144.60 ? 118  DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 119 ? -88.395  -20.873 85.892 1.00 145.69 ? 118  DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 119 ? -88.932  -22.586 87.282 1.00 144.01 ? 118  DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 119 ? -89.270  -23.140 88.500 1.00 143.44 ? 118  DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 119 ? -89.467  -24.347 88.589 1.00 143.59 ? 118  DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 119 ? -89.363  -22.206 89.595 1.00 143.17 ? 118  DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 119 ? -89.729  -22.716 90.953 1.00 143.23 ? 118  DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 119 ? -89.118  -20.914 89.345 1.00 143.67 ? 118  DT  I C6    1 
ATOM   2408  P P     . DT  A 1 120 ? -89.854  -14.975 86.993 1.00 137.20 ? 119  DT  I P     1 
ATOM   2409  O OP1   . DT  A 1 120 ? -89.399  -14.382 85.712 1.00 132.11 ? 119  DT  I OP1   1 
ATOM   2410  O OP2   . DT  A 1 120 ? -90.179  -14.085 88.133 1.00 132.62 ? 119  DT  I OP2   1 
ATOM   2411  O "O5'" . DT  A 1 120 ? -91.117  -15.902 86.706 1.00 135.25 ? 119  DT  I "O5'" 1 
ATOM   2412  C "C5'" . DT  A 1 120 ? -91.686  -15.967 85.403 1.00 131.61 ? 119  DT  I "C5'" 1 
ATOM   2413  C "C4'" . DT  A 1 120 ? -90.686  -16.553 84.432 1.00 128.84 ? 119  DT  I "C4'" 1 
ATOM   2414  O "O4'" . DT  A 1 120 ? -90.302  -17.884 84.848 1.00 128.35 ? 119  DT  I "O4'" 1 
ATOM   2415  C "C3'" . DT  A 1 120 ? -91.193  -16.690 83.001 1.00 128.15 ? 119  DT  I "C3'" 1 
ATOM   2416  O "O3'" . DT  A 1 120 ? -90.116  -16.426 82.105 1.00 125.52 ? 119  DT  I "O3'" 1 
ATOM   2417  C "C2'" . DT  A 1 120 ? -91.627  -18.141 82.924 1.00 128.72 ? 119  DT  I "C2'" 1 
ATOM   2418  C "C1'" . DT  A 1 120 ? -90.640  -18.832 83.847 1.00 129.27 ? 119  DT  I "C1'" 1 
ATOM   2419  N N1    . DT  A 1 120 ? -91.188  -20.017 84.525 1.00 126.67 ? 119  DT  I N1    1 
ATOM   2420  C C2    . DT  A 1 120 ? -91.288  -21.190 83.813 1.00 127.27 ? 119  DT  I C2    1 
ATOM   2421  O O2    . DT  A 1 120 ? -90.948  -21.292 82.646 1.00 127.41 ? 119  DT  I O2    1 
ATOM   2422  N N3    . DT  A 1 120 ? -91.804  -22.246 84.522 1.00 127.91 ? 119  DT  I N3    1 
ATOM   2423  C C4    . DT  A 1 120 ? -92.219  -22.244 85.842 1.00 128.21 ? 119  DT  I C4    1 
ATOM   2424  O O4    . DT  A 1 120 ? -92.660  -23.270 86.348 1.00 127.81 ? 119  DT  I O4    1 
ATOM   2425  C C5    . DT  A 1 120 ? -92.087  -20.982 86.528 1.00 128.31 ? 119  DT  I C5    1 
ATOM   2426  C C7    . DT  A 1 120 ? -92.510  -20.889 87.959 1.00 128.51 ? 119  DT  I C7    1 
ATOM   2427  C C6    . DT  A 1 120 ? -91.587  -19.944 85.844 1.00 127.86 ? 119  DT  I C6    1 
ATOM   2428  P P     . DG  A 1 121 ? -90.367  -15.529 80.803 1.00 130.43 ? 120  DG  I P     1 
ATOM   2429  O OP1   . DG  A 1 121 ? -89.329  -14.465 80.787 1.00 137.11 ? 120  DG  I OP1   1 
ATOM   2430  O OP2   . DG  A 1 121 ? -91.803  -15.155 80.754 1.00 136.89 ? 120  DG  I OP2   1 
ATOM   2431  O "O5'" . DG  A 1 121 ? -90.074  -16.543 79.613 1.00 129.73 ? 120  DG  I "O5'" 1 
ATOM   2432  C "C5'" . DG  A 1 121 ? -88.820  -17.221 79.523 1.00 125.25 ? 120  DG  I "C5'" 1 
ATOM   2433  C "C4'" . DG  A 1 121 ? -88.921  -18.382 78.561 1.00 122.04 ? 120  DG  I "C4'" 1 
ATOM   2434  O "O4'" . DG  A 1 121 ? -89.834  -19.359 79.112 1.00 119.44 ? 120  DG  I "O4'" 1 
ATOM   2435  C "C3'" . DG  A 1 121 ? -89.461  -18.032 77.171 1.00 120.15 ? 120  DG  I "C3'" 1 
ATOM   2436  O "O3'" . DG  A 1 121 ? -88.803  -18.831 76.176 1.00 116.15 ? 120  DG  I "O3'" 1 
ATOM   2437  C "C2'" . DG  A 1 121 ? -90.938  -18.363 77.275 1.00 120.14 ? 120  DG  I "C2'" 1 
ATOM   2438  C "C1'" . DG  A 1 121 ? -90.964  -19.517 78.264 1.00 119.93 ? 120  DG  I "C1'" 1 
ATOM   2439  N N9    . DG  A 1 121 ? -92.141  -19.539 79.121 1.00 126.30 ? 120  DG  I N9    1 
ATOM   2440  C C8    . DG  A 1 121 ? -92.970  -18.489 79.445 1.00 125.66 ? 120  DG  I C8    1 
ATOM   2441  N N7    . DG  A 1 121 ? -93.916  -18.824 80.281 1.00 125.63 ? 120  DG  I N7    1 
ATOM   2442  C C5    . DG  A 1 121 ? -93.698  -20.176 80.514 1.00 126.28 ? 120  DG  I C5    1 
ATOM   2443  C C6    . DG  A 1 121 ? -94.390  -21.090 81.345 1.00 126.62 ? 120  DG  I C6    1 
ATOM   2444  O O6    . DG  A 1 121 ? -95.356  -20.878 82.088 1.00 128.81 ? 120  DG  I O6    1 
ATOM   2445  N N1    . DG  A 1 121 ? -93.843  -22.366 81.264 1.00 126.09 ? 120  DG  I N1    1 
ATOM   2446  C C2    . DG  A 1 121 ? -92.762  -22.713 80.493 1.00 125.42 ? 120  DG  I C2    1 
ATOM   2447  N N2    . DG  A 1 121 ? -92.388  -23.990 80.531 1.00 124.45 ? 120  DG  I N2    1 
ATOM   2448  N N3    . DG  A 1 121 ? -92.098  -21.870 79.735 1.00 125.99 ? 120  DG  I N3    1 
ATOM   2449  C C4    . DG  A 1 121 ? -92.616  -20.630 79.790 1.00 126.24 ? 120  DG  I C4    1 
ATOM   2450  P P     . DG  A 1 122 ? -89.423  -18.955 74.695 1.00 112.04 ? 121  DG  I P     1 
ATOM   2451  O OP1   . DG  A 1 122 ? -88.266  -19.138 73.790 1.00 102.24 ? 121  DG  I OP1   1 
ATOM   2452  O OP2   . DG  A 1 122 ? -90.393  -17.861 74.434 1.00 103.19 ? 121  DG  I OP2   1 
ATOM   2453  O "O5'" . DG  A 1 122 ? -90.219  -20.332 74.746 1.00 109.81 ? 121  DG  I "O5'" 1 
ATOM   2454  C "C5'" . DG  A 1 122 ? -89.541  -21.546 75.060 1.00 107.84 ? 121  DG  I "C5'" 1 
ATOM   2455  C "C4'" . DG  A 1 122 ? -90.443  -22.733 74.816 1.00 106.55 ? 121  DG  I "C4'" 1 
ATOM   2456  O "O4'" . DG  A 1 122 ? -91.480  -22.783 75.825 1.00 107.32 ? 121  DG  I "O4'" 1 
ATOM   2457  C "C3'" . DG  A 1 122 ? -91.162  -22.745 73.465 1.00 105.48 ? 121  DG  I "C3'" 1 
ATOM   2458  O "O3'" . DG  A 1 122 ? -91.148  -24.072 72.926 1.00 101.70 ? 121  DG  I "O3'" 1 
ATOM   2459  C "C2'" . DG  A 1 122 ? -92.576  -22.314 73.813 1.00 106.74 ? 121  DG  I "C2'" 1 
ATOM   2460  C "C1'" . DG  A 1 122 ? -92.753  -22.891 75.204 1.00 109.69 ? 121  DG  I "C1'" 1 
ATOM   2461  N N9    . DG  A 1 122 ? -93.723  -22.177 76.030 1.00 103.33 ? 121  DG  I N9    1 
ATOM   2462  C C8    . DG  A 1 122 ? -94.033  -20.836 75.975 1.00 104.31 ? 121  DG  I C8    1 
ATOM   2463  N N7    . DG  A 1 122 ? -94.964  -20.488 76.822 1.00 105.59 ? 121  DG  I N7    1 
ATOM   2464  C C5    . DG  A 1 122 ? -95.287  -21.666 77.482 1.00 106.77 ? 121  DG  I C5    1 
ATOM   2465  C C6    . DG  A 1 122 ? -96.242  -21.915 78.500 1.00 107.49 ? 121  DG  I C6    1 
ATOM   2466  O O6    . DG  A 1 122 ? -97.027  -21.119 79.031 1.00 108.42 ? 121  DG  I O6    1 
ATOM   2467  N N1    . DG  A 1 122 ? -96.236  -23.251 78.890 1.00 106.62 ? 121  DG  I N1    1 
ATOM   2468  C C2    . DG  A 1 122 ? -95.424  -24.223 78.364 1.00 106.41 ? 121  DG  I C2    1 
ATOM   2469  N N2    . DG  A 1 122 ? -95.565  -25.447 78.880 1.00 105.96 ? 121  DG  I N2    1 
ATOM   2470  N N3    . DG  A 1 122 ? -94.539  -24.010 77.405 1.00 106.22 ? 121  DG  I N3    1 
ATOM   2471  C C4    . DG  A 1 122 ? -94.523  -22.718 77.013 1.00 105.59 ? 121  DG  I C4    1 
ATOM   2472  P P     . DT  A 1 123 ? -92.059  -24.436 71.651 1.00 89.00  ? 122  DT  I P     1 
ATOM   2473  O OP1   . DT  A 1 123 ? -91.214  -25.303 70.789 1.00 99.95  ? 122  DT  I OP1   1 
ATOM   2474  O OP2   . DT  A 1 123 ? -92.695  -23.218 71.077 1.00 98.59  ? 122  DT  I OP2   1 
ATOM   2475  O "O5'" . DT  A 1 123 ? -93.203  -25.338 72.289 1.00 90.43  ? 122  DT  I "O5'" 1 
ATOM   2476  C "C5'" . DT  A 1 123 ? -92.865  -26.405 73.177 1.00 90.96  ? 122  DT  I "C5'" 1 
ATOM   2477  C "C4'" . DT  A 1 123 ? -94.106  -27.149 73.610 1.00 90.46  ? 122  DT  I "C4'" 1 
ATOM   2478  O "O4'" . DT  A 1 123 ? -94.849  -26.355 74.563 1.00 90.11  ? 122  DT  I "O4'" 1 
ATOM   2479  C "C3'" . DT  A 1 123 ? -95.068  -27.469 72.469 1.00 90.07  ? 122  DT  I "C3'" 1 
ATOM   2480  O "O3'" . DT  A 1 123 ? -95.575  -28.794 72.589 1.00 89.11  ? 122  DT  I "O3'" 1 
ATOM   2481  C "C2'" . DT  A 1 123 ? -96.179  -26.448 72.628 1.00 89.96  ? 122  DT  I "C2'" 1 
ATOM   2482  C "C1'" . DT  A 1 123 ? -96.185  -26.166 74.122 1.00 91.14  ? 122  DT  I "C1'" 1 
ATOM   2483  N N1    . DT  A 1 123 ? -96.569  -24.783 74.455 1.00 102.14 ? 122  DT  I N1    1 
ATOM   2484  C C2    . DT  A 1 123 ? -97.377  -24.554 75.552 1.00 102.72 ? 122  DT  I C2    1 
ATOM   2485  O O2    . DT  A 1 123 ? -97.800  -25.442 76.271 1.00 103.43 ? 122  DT  I O2    1 
ATOM   2486  N N3    . DT  A 1 123 ? -97.673  -23.235 75.774 1.00 101.44 ? 122  DT  I N3    1 
ATOM   2487  C C4    . DT  A 1 123 ? -97.254  -22.146 75.031 1.00 102.73 ? 122  DT  I C4    1 
ATOM   2488  O O4    . DT  A 1 123 ? -97.596  -21.013 75.360 1.00 104.17 ? 122  DT  I O4    1 
ATOM   2489  C C5    . DT  A 1 123 ? -96.415  -22.461 73.893 1.00 103.77 ? 122  DT  I C5    1 
ATOM   2490  C C7    . DT  A 1 123 ? -95.921  -21.352 73.018 1.00 103.49 ? 122  DT  I C7    1 
ATOM   2491  C C6    . DT  A 1 123 ? -96.117  -23.745 73.670 1.00 103.32 ? 122  DT  I C6    1 
ATOM   2492  P P     . DA  A 1 124 ? -96.366  -29.443 71.357 1.00 93.72  ? 123  DA  I P     1 
ATOM   2493  O OP1   . DA  A 1 124 ? -95.565  -30.559 70.809 1.00 106.46 ? 123  DA  I OP1   1 
ATOM   2494  O OP2   . DA  A 1 124 ? -96.817  -28.348 70.459 1.00 107.88 ? 123  DA  I OP2   1 
ATOM   2495  O "O5'" . DA  A 1 124 ? -97.652  -30.059 72.050 1.00 98.66  ? 123  DA  I "O5'" 1 
ATOM   2496  C "C5'" . DA  A 1 124 ? -97.551  -30.720 73.304 1.00 102.75 ? 123  DA  I "C5'" 1 
ATOM   2497  C "C4'" . DA  A 1 124 ? -98.899  -30.730 73.980 1.00 104.70 ? 123  DA  I "C4'" 1 
ATOM   2498  O "O4'" . DA  A 1 124 ? -99.194  -29.404 74.481 1.00 104.54 ? 123  DA  I "O4'" 1 
ATOM   2499  C "C3'" . DA  A 1 124 ? -100.033 -31.096 73.026 1.00 107.73 ? 123  DA  I "C3'" 1 
ATOM   2500  O "O3'" . DA  A 1 124 ? -100.969 -31.964 73.663 1.00 115.88 ? 123  DA  I "O3'" 1 
ATOM   2501  C "C2'" . DA  A 1 124 ? -100.654 -29.758 72.669 1.00 104.81 ? 123  DA  I "C2'" 1 
ATOM   2502  C "C1'" . DA  A 1 124 ? -100.384 -28.904 73.898 1.00 103.42 ? 123  DA  I "C1'" 1 
ATOM   2503  N N9    . DA  A 1 124 ? -100.166 -27.491 73.592 1.00 116.84 ? 123  DA  I N9    1 
ATOM   2504  C C8    . DA  A 1 124 ? -99.622  -26.948 72.452 1.00 116.23 ? 123  DA  I C8    1 
ATOM   2505  N N7    . DA  A 1 124 ? -99.575  -25.638 72.461 1.00 116.36 ? 123  DA  I N7    1 
ATOM   2506  C C5    . DA  A 1 124 ? -100.121 -25.293 73.689 1.00 116.47 ? 123  DA  I C5    1 
ATOM   2507  C C6    . DA  A 1 124 ? -100.361 -24.051 74.305 1.00 116.55 ? 123  DA  I C6    1 
ATOM   2508  N N6    . DA  A 1 124 ? -100.079 -22.871 73.745 1.00 113.87 ? 123  DA  I N6    1 
ATOM   2509  N N1    . DA  A 1 124 ? -100.915 -24.060 75.536 1.00 117.12 ? 123  DA  I N1    1 
ATOM   2510  C C2    . DA  A 1 124 ? -101.206 -25.239 76.099 1.00 116.76 ? 123  DA  I C2    1 
ATOM   2511  N N3    . DA  A 1 124 ? -101.033 -26.468 75.620 1.00 117.15 ? 123  DA  I N3    1 
ATOM   2512  C C4    . DA  A 1 124 ? -100.482 -26.425 74.398 1.00 116.60 ? 123  DA  I C4    1 
ATOM   2513  P P     . DG  A 1 125 ? -101.986 -32.823 72.770 1.00 117.01 ? 124  DG  I P     1 
ATOM   2514  O OP1   . DG  A 1 125 ? -102.085 -34.170 73.382 1.00 138.20 ? 124  DG  I OP1   1 
ATOM   2515  O OP2   . DG  A 1 125 ? -101.606 -32.689 71.343 1.00 139.27 ? 124  DG  I OP2   1 
ATOM   2516  O "O5'" . DG  A 1 125 ? -103.359 -32.062 72.997 1.00 120.12 ? 124  DG  I "O5'" 1 
ATOM   2517  C "C5'" . DG  A 1 125 ? -103.784 -31.746 74.315 1.00 125.47 ? 124  DG  I "C5'" 1 
ATOM   2518  C "C4'" . DG  A 1 125 ? -104.817 -30.649 74.275 1.00 129.94 ? 124  DG  I "C4'" 1 
ATOM   2519  O "O4'" . DG  A 1 125 ? -104.196 -29.373 73.994 1.00 129.54 ? 124  DG  I "O4'" 1 
ATOM   2520  C "C3'" . DG  A 1 125 ? -105.894 -30.840 73.204 1.00 133.50 ? 124  DG  I "C3'" 1 
ATOM   2521  O "O3'" . DG  A 1 125 ? -107.141 -30.370 73.722 1.00 139.11 ? 124  DG  I "O3'" 1 
ATOM   2522  C "C2'" . DG  A 1 125 ? -105.434 -29.903 72.101 1.00 132.23 ? 124  DG  I "C2'" 1 
ATOM   2523  C "C1'" . DG  A 1 125 ? -104.918 -28.759 72.944 1.00 130.44 ? 124  DG  I "C1'" 1 
ATOM   2524  N N9    . DG  A 1 125 ? -104.049 -27.794 72.285 1.00 152.38 ? 124  DG  I N9    1 
ATOM   2525  C C8    . DG  A 1 125 ? -103.220 -27.996 71.209 1.00 152.45 ? 124  DG  I C8    1 
ATOM   2526  N N7    . DG  A 1 125 ? -102.574 -26.917 70.853 1.00 152.22 ? 124  DG  I N7    1 
ATOM   2527  C C5    . DG  A 1 125 ? -103.003 -25.946 71.752 1.00 151.43 ? 124  DG  I C5    1 
ATOM   2528  C C6    . DG  A 1 125 ? -102.652 -24.564 71.872 1.00 150.49 ? 124  DG  I C6    1 
ATOM   2529  O O6    . DG  A 1 125 ? -101.859 -23.900 71.189 1.00 148.94 ? 124  DG  I O6    1 
ATOM   2530  N N1    . DG  A 1 125 ? -103.332 -23.955 72.921 1.00 150.16 ? 124  DG  I N1    1 
ATOM   2531  C C2    . DG  A 1 125 ? -104.228 -24.580 73.750 1.00 150.05 ? 124  DG  I C2    1 
ATOM   2532  N N2    . DG  A 1 125 ? -104.783 -23.816 74.703 1.00 148.51 ? 124  DG  I N2    1 
ATOM   2533  N N3    . DG  A 1 125 ? -104.559 -25.857 73.654 1.00 150.26 ? 124  DG  I N3    1 
ATOM   2534  C C4    . DG  A 1 125 ? -103.913 -26.473 72.640 1.00 151.56 ? 124  DG  I C4    1 
ATOM   2535  P P     . DA  A 1 126 ? -108.477 -31.242 73.530 1.00 151.35 ? 125  DA  I P     1 
ATOM   2536  O OP1   . DA  A 1 126 ? -108.389 -32.439 74.409 1.00 139.01 ? 125  DA  I OP1   1 
ATOM   2537  O OP2   . DA  A 1 126 ? -108.747 -31.415 72.081 1.00 138.39 ? 125  DA  I OP2   1 
ATOM   2538  O "O5'" . DA  A 1 126 ? -109.584 -30.276 74.132 1.00 152.30 ? 125  DA  I "O5'" 1 
ATOM   2539  C "C5'" . DA  A 1 126 ? -109.353 -29.617 75.370 1.00 155.61 ? 125  DA  I "C5'" 1 
ATOM   2540  C "C4'" . DA  A 1 126 ? -109.602 -28.135 75.228 1.00 158.82 ? 125  DA  I "C4'" 1 
ATOM   2541  O "O4'" . DA  A 1 126 ? -108.518 -27.488 74.516 1.00 159.37 ? 125  DA  I "O4'" 1 
ATOM   2542  C "C3'" . DA  A 1 126 ? -110.880 -27.773 74.470 1.00 161.57 ? 125  DA  I "C3'" 1 
ATOM   2543  O "O3'" . DA  A 1 126 ? -111.527 -26.682 75.124 1.00 165.64 ? 125  DA  I "O3'" 1 
ATOM   2544  C "C2'" . DA  A 1 126 ? -110.364 -27.305 73.122 1.00 161.45 ? 125  DA  I "C2'" 1 
ATOM   2545  C "C1'" . DA  A 1 126 ? -109.082 -26.624 73.546 1.00 160.62 ? 125  DA  I "C1'" 1 
ATOM   2546  N N9    . DA  A 1 126 ? -108.099 -26.394 72.488 1.00 149.21 ? 125  DA  I N9    1 
ATOM   2547  C C8    . DA  A 1 126 ? -107.607 -27.276 71.557 1.00 148.77 ? 125  DA  I C8    1 
ATOM   2548  N N7    . DA  A 1 126 ? -106.744 -26.741 70.726 1.00 149.24 ? 125  DA  I N7    1 
ATOM   2549  C C5    . DA  A 1 126 ? -106.659 -25.417 71.140 1.00 150.15 ? 125  DA  I C5    1 
ATOM   2550  C C6    . DA  A 1 126 ? -105.917 -24.317 70.664 1.00 150.82 ? 125  DA  I C6    1 
ATOM   2551  N N6    . DA  A 1 126 ? -105.087 -24.380 69.621 1.00 151.34 ? 125  DA  I N6    1 
ATOM   2552  N N1    . DA  A 1 126 ? -106.062 -23.136 71.304 1.00 151.05 ? 125  DA  I N1    1 
ATOM   2553  C C2    . DA  A 1 126 ? -106.898 -23.072 72.347 1.00 150.66 ? 125  DA  I C2    1 
ATOM   2554  N N3    . DA  A 1 126 ? -107.649 -24.031 72.886 1.00 150.25 ? 125  DA  I N3    1 
ATOM   2555  C C4    . DA  A 1 126 ? -107.483 -25.192 72.228 1.00 149.87 ? 125  DA  I C4    1 
ATOM   2556  P P     . DA  A 1 127 ? -113.083 -26.412 74.860 1.00 195.86 ? 126  DA  I P     1 
ATOM   2557  O OP1   . DA  A 1 127 ? -113.799 -26.642 76.143 1.00 154.31 ? 126  DA  I OP1   1 
ATOM   2558  O OP2   . DA  A 1 127 ? -113.474 -27.179 73.651 1.00 153.72 ? 126  DA  I OP2   1 
ATOM   2559  O "O5'" . DA  A 1 127 ? -113.139 -24.859 74.514 1.00 196.58 ? 126  DA  I "O5'" 1 
ATOM   2560  C "C5'" . DA  A 1 127 ? -112.725 -23.884 75.468 1.00 197.55 ? 126  DA  I "C5'" 1 
ATOM   2561  C "C4'" . DA  A 1 127 ? -112.551 -22.540 74.800 1.00 198.12 ? 126  DA  I "C4'" 1 
ATOM   2562  O "O4'" . DA  A 1 127 ? -111.409 -22.580 73.909 1.00 198.12 ? 126  DA  I "O4'" 1 
ATOM   2563  C "C3'" . DA  A 1 127 ? -113.738 -22.103 73.938 1.00 198.12 ? 126  DA  I "C3'" 1 
ATOM   2564  O "O3'" . DA  A 1 127 ? -113.929 -20.691 74.036 1.00 196.87 ? 126  DA  I "O3'" 1 
ATOM   2565  C "C2'" . DA  A 1 127 ? -113.287 -22.447 72.533 1.00 198.12 ? 126  DA  I "C2'" 1 
ATOM   2566  C "C1'" . DA  A 1 127 ? -111.809 -22.140 72.622 1.00 198.12 ? 126  DA  I "C1'" 1 
ATOM   2567  N N9    . DA  A 1 127 ? -110.993 -22.826 71.624 1.00 159.67 ? 126  DA  I N9    1 
ATOM   2568  C C8    . DA  A 1 127 ? -110.920 -24.170 71.351 1.00 160.10 ? 126  DA  I C8    1 
ATOM   2569  N N7    . DA  A 1 127 ? -110.104 -24.465 70.367 1.00 160.01 ? 126  DA  I N7    1 
ATOM   2570  C C5    . DA  A 1 127 ? -109.603 -23.231 69.970 1.00 159.87 ? 126  DA  I C5    1 
ATOM   2571  C C6    . DA  A 1 127 ? -108.691 -22.857 68.969 1.00 159.50 ? 126  DA  I C6    1 
ATOM   2572  N N6    . DA  A 1 127 ? -108.098 -23.723 68.144 1.00 158.93 ? 126  DA  I N6    1 
ATOM   2573  N N1    . DA  A 1 127 ? -108.407 -21.543 68.841 1.00 159.46 ? 126  DA  I N1    1 
ATOM   2574  C C2    . DA  A 1 127 ? -109.003 -20.674 69.666 1.00 159.51 ? 126  DA  I C2    1 
ATOM   2575  N N3    . DA  A 1 127 ? -109.876 -20.902 70.639 1.00 159.65 ? 126  DA  I N3    1 
ATOM   2576  C C4    . DA  A 1 127 ? -110.137 -22.216 70.741 1.00 159.95 ? 126  DA  I C4    1 
ATOM   2577  P P     . DT  A 1 128 ? -114.964 -19.964 73.048 1.00 188.53 ? 127  DT  I P     1 
ATOM   2578  O OP1   . DT  A 1 128 ? -115.605 -18.860 73.805 1.00 128.94 ? 127  DT  I OP1   1 
ATOM   2579  O OP2   . DT  A 1 128 ? -115.807 -21.016 72.428 1.00 129.09 ? 127  DT  I OP2   1 
ATOM   2580  O "O5'" . DT  A 1 128 ? -114.039 -19.326 71.918 1.00 187.08 ? 127  DT  I "O5'" 1 
ATOM   2581  C "C5'" . DT  A 1 128 ? -113.096 -18.309 72.247 1.00 183.88 ? 127  DT  I "C5'" 1 
ATOM   2582  C "C4'" . DT  A 1 128 ? -112.676 -17.545 71.011 1.00 181.34 ? 127  DT  I "C4'" 1 
ATOM   2583  O "O4'" . DT  A 1 128 ? -111.836 -18.371 70.168 1.00 180.64 ? 127  DT  I "O4'" 1 
ATOM   2584  C "C3'" . DT  A 1 128 ? -113.803 -17.025 70.114 1.00 179.27 ? 127  DT  I "C3'" 1 
ATOM   2585  O "O3'" . DT  A 1 128 ? -113.496 -15.684 69.698 1.00 176.44 ? 127  DT  I "O3'" 1 
ATOM   2586  C "C2'" . DT  A 1 128 ? -113.779 -17.981 68.933 1.00 178.93 ? 127  DT  I "C2'" 1 
ATOM   2587  C "C1'" . DT  A 1 128 ? -112.300 -18.304 68.829 1.00 178.79 ? 127  DT  I "C1'" 1 
ATOM   2588  N N1    . DT  A 1 128 ? -111.968 -19.580 68.163 1.00 118.85 ? 127  DT  I N1    1 
ATOM   2589  C C2    . DT  A 1 128 ? -110.920 -19.585 67.262 1.00 118.33 ? 127  DT  I C2    1 
ATOM   2590  O O2    . DT  A 1 128 ? -110.276 -18.586 66.977 1.00 118.29 ? 127  DT  I O2    1 
ATOM   2591  N N3    . DT  A 1 128 ? -110.655 -20.810 66.701 1.00 117.58 ? 127  DT  I N3    1 
ATOM   2592  C C4    . DT  A 1 128 ? -111.319 -21.999 66.938 1.00 117.62 ? 127  DT  I C4    1 
ATOM   2593  O O4    . DT  A 1 128 ? -110.961 -23.023 66.366 1.00 117.30 ? 127  DT  I O4    1 
ATOM   2594  C C5    . DT  A 1 128 ? -112.415 -21.919 67.878 1.00 117.58 ? 127  DT  I C5    1 
ATOM   2595  C C7    . DT  A 1 128 ? -113.202 -23.155 68.181 1.00 117.36 ? 127  DT  I C7    1 
ATOM   2596  C C6    . DT  A 1 128 ? -112.679 -20.730 68.438 1.00 118.07 ? 127  DT  I C6    1 
ATOM   2597  P P     . DC  A 1 129 ? -114.296 -15.011 68.473 1.00 152.89 ? 128  DC  I P     1 
ATOM   2598  O OP1   . DC  A 1 129 ? -114.334 -13.545 68.716 1.00 140.27 ? 128  DC  I OP1   1 
ATOM   2599  O OP2   . DC  A 1 129 ? -115.564 -15.750 68.255 1.00 141.44 ? 128  DC  I OP2   1 
ATOM   2600  O "O5'" . DC  A 1 129 ? -113.342 -15.275 67.224 1.00 151.34 ? 128  DC  I "O5'" 1 
ATOM   2601  C "C5'" . DC  A 1 129 ? -111.949 -14.959 67.295 1.00 147.50 ? 128  DC  I "C5'" 1 
ATOM   2602  C "C4'" . DC  A 1 129 ? -111.295 -15.127 65.943 1.00 144.46 ? 128  DC  I "C4'" 1 
ATOM   2603  O "O4'" . DC  A 1 129 ? -111.163 -16.534 65.623 1.00 144.22 ? 128  DC  I "O4'" 1 
ATOM   2604  C "C3'" . DC  A 1 129 ? -112.059 -14.490 64.781 1.00 143.14 ? 128  DC  I "C3'" 1 
ATOM   2605  O "O3'" . DC  A 1 129 ? -111.147 -13.848 63.884 1.00 141.03 ? 128  DC  I "O3'" 1 
ATOM   2606  C "C2'" . DC  A 1 129 ? -112.726 -15.677 64.108 1.00 143.74 ? 128  DC  I "C2'" 1 
ATOM   2607  C "C1'" . DC  A 1 129 ? -111.719 -16.790 64.342 1.00 145.34 ? 128  DC  I "C1'" 1 
ATOM   2608  N N1    . DC  A 1 129 ? -112.279 -18.156 64.351 1.00 134.78 ? 128  DC  I N1    1 
ATOM   2609  C C2    . DC  A 1 129 ? -111.797 -19.094 63.423 1.00 135.72 ? 128  DC  I C2    1 
ATOM   2610  O O2    . DC  A 1 129 ? -110.928 -18.746 62.615 1.00 136.13 ? 128  DC  I O2    1 
ATOM   2611  N N3    . DC  A 1 129 ? -112.294 -20.353 63.434 1.00 136.52 ? 128  DC  I N3    1 
ATOM   2612  C C4    . DC  A 1 129 ? -113.235 -20.690 64.319 1.00 136.65 ? 128  DC  I C4    1 
ATOM   2613  N N4    . DC  A 1 129 ? -113.695 -21.945 64.298 1.00 137.55 ? 128  DC  I N4    1 
ATOM   2614  C C5    . DC  A 1 129 ? -113.748 -19.756 65.269 1.00 136.60 ? 128  DC  I C5    1 
ATOM   2615  C C6    . DC  A 1 129 ? -113.247 -18.511 65.248 1.00 135.99 ? 128  DC  I C6    1 
ATOM   2616  P P     . DT  A 1 130 ? -111.664 -12.658 62.935 1.00 144.12 ? 129  DT  I P     1 
ATOM   2617  O OP1   . DT  A 1 130 ? -110.848 -11.456 63.248 1.00 153.42 ? 129  DT  I OP1   1 
ATOM   2618  O OP2   . DT  A 1 130 ? -113.144 -12.584 63.020 1.00 154.34 ? 129  DT  I OP2   1 
ATOM   2619  O "O5'" . DT  A 1 130 ? -111.268 -13.155 61.474 1.00 143.02 ? 129  DT  I "O5'" 1 
ATOM   2620  C "C5'" . DT  A 1 130 ? -109.899 -13.354 61.125 1.00 139.57 ? 129  DT  I "C5'" 1 
ATOM   2621  C "C4'" . DT  A 1 130 ? -109.776 -14.079 59.802 1.00 136.81 ? 129  DT  I "C4'" 1 
ATOM   2622  O "O4'" . DT  A 1 130 ? -110.173 -15.465 59.921 1.00 137.18 ? 129  DT  I "O4'" 1 
ATOM   2623  C "C3'" . DT  A 1 130 ? -110.576 -13.505 58.630 1.00 134.51 ? 129  DT  I "C3'" 1 
ATOM   2624  O "O3'" . DT  A 1 130 ? -109.776 -13.590 57.452 1.00 130.69 ? 129  DT  I "O3'" 1 
ATOM   2625  C "C2'" . DT  A 1 130 ? -111.738 -14.475 58.501 1.00 135.84 ? 129  DT  I "C2'" 1 
ATOM   2626  C "C1'" . DT  A 1 130 ? -111.072 -15.787 58.873 1.00 137.18 ? 129  DT  I "C1'" 1 
ATOM   2627  N N1    . DT  A 1 130 ? -111.964 -16.846 59.365 1.00 148.38 ? 129  DT  I N1    1 
ATOM   2628  C C2    . DT  A 1 130 ? -111.873 -18.087 58.778 1.00 149.02 ? 129  DT  I C2    1 
ATOM   2629  O O2    . DT  A 1 130 ? -111.129 -18.326 57.841 1.00 148.88 ? 129  DT  I O2    1 
ATOM   2630  N N3    . DT  A 1 130 ? -112.691 -19.041 59.328 1.00 149.38 ? 129  DT  I N3    1 
ATOM   2631  C C4    . DT  A 1 130 ? -113.581 -18.876 60.375 1.00 149.38 ? 129  DT  I C4    1 
ATOM   2632  O O4    . DT  A 1 130 ? -114.236 -19.836 60.777 1.00 149.43 ? 129  DT  I O4    1 
ATOM   2633  C C5    . DT  A 1 130 ? -113.649 -17.535 60.921 1.00 149.23 ? 129  DT  I C5    1 
ATOM   2634  C C7    . DT  A 1 130 ? -114.604 -17.250 62.036 1.00 149.05 ? 129  DT  I C7    1 
ATOM   2635  C C6    . DT  A 1 130 ? -112.846 -16.602 60.395 1.00 148.95 ? 129  DT  I C6    1 
ATOM   2636  P P     . DG  A 1 131 ? -108.649 -12.484 57.172 1.00 106.76 ? 130  DG  I P     1 
ATOM   2637  O OP1   . DG  A 1 131 ? -107.857 -12.276 58.415 1.00 108.83 ? 130  DG  I OP1   1 
ATOM   2638  O OP2   . DG  A 1 131 ? -109.302 -11.320 56.515 1.00 109.37 ? 130  DG  I OP2   1 
ATOM   2639  O "O5'" . DG  A 1 131 ? -107.693 -13.207 56.126 1.00 106.54 ? 130  DG  I "O5'" 1 
ATOM   2640  C "C5'" . DG  A 1 131 ? -106.699 -14.133 56.563 1.00 104.75 ? 130  DG  I "C5'" 1 
ATOM   2641  C "C4'" . DG  A 1 131 ? -106.585 -15.271 55.576 1.00 103.26 ? 130  DG  I "C4'" 1 
ATOM   2642  O "O4'" . DG  A 1 131 ? -107.803 -16.047 55.643 1.00 102.08 ? 130  DG  I "O4'" 1 
ATOM   2643  C "C3'" . DG  A 1 131 ? -106.447 -14.832 54.116 1.00 102.93 ? 130  DG  I "C3'" 1 
ATOM   2644  O "O3'" . DG  A 1 131 ? -105.643 -15.767 53.379 1.00 102.09 ? 130  DG  I "O3'" 1 
ATOM   2645  C "C2'" . DG  A 1 131 ? -107.879 -14.838 53.618 1.00 102.65 ? 130  DG  I "C2'" 1 
ATOM   2646  C "C1'" . DG  A 1 131 ? -108.487 -15.992 54.395 1.00 103.14 ? 130  DG  I "C1'" 1 
ATOM   2647  N N9    . DG  A 1 131 ? -109.906 -15.832 54.681 1.00 107.37 ? 130  DG  I N9    1 
ATOM   2648  C C8    . DG  A 1 131 ? -110.594 -14.658 54.870 1.00 107.57 ? 130  DG  I C8    1 
ATOM   2649  N N7    . DG  A 1 131 ? -111.856 -14.844 55.138 1.00 107.62 ? 130  DG  I N7    1 
ATOM   2650  C C5    . DG  A 1 131 ? -112.008 -16.224 55.118 1.00 108.38 ? 130  DG  I C5    1 
ATOM   2651  C C6    . DG  A 1 131 ? -113.155 -17.027 55.338 1.00 109.56 ? 130  DG  I C6    1 
ATOM   2652  O O6    . DG  A 1 131 ? -114.303 -16.669 55.617 1.00 110.10 ? 130  DG  I O6    1 
ATOM   2653  N N1    . DG  A 1 131 ? -112.863 -18.381 55.209 1.00 110.18 ? 130  DG  I N1    1 
ATOM   2654  C C2    . DG  A 1 131 ? -111.629 -18.896 54.911 1.00 109.53 ? 130  DG  I C2    1 
ATOM   2655  N N2    . DG  A 1 131 ? -111.552 -20.227 54.825 1.00 109.63 ? 130  DG  I N2    1 
ATOM   2656  N N3    . DG  A 1 131 ? -110.553 -18.161 54.713 1.00 108.83 ? 130  DG  I N3    1 
ATOM   2657  C C4    . DG  A 1 131 ? -110.814 -16.844 54.829 1.00 108.17 ? 130  DG  I C4    1 
ATOM   2658  P P     . DC  A 1 132 ? -105.605 -15.701 51.772 1.00 108.91 ? 131  DC  I P     1 
ATOM   2659  O OP1   . DC  A 1 132 ? -104.359 -16.378 51.331 1.00 120.70 ? 131  DC  I OP1   1 
ATOM   2660  O OP2   . DC  A 1 132 ? -105.866 -14.303 51.349 1.00 121.22 ? 131  DC  I OP2   1 
ATOM   2661  O "O5'" . DC  A 1 132 ? -106.847 -16.593 51.323 1.00 109.64 ? 131  DC  I "O5'" 1 
ATOM   2662  C "C5'" . DC  A 1 132 ? -106.854 -17.998 51.557 1.00 112.84 ? 131  DC  I "C5'" 1 
ATOM   2663  C "C4'" . DC  A 1 132 ? -107.863 -18.674 50.658 1.00 115.71 ? 131  DC  I "C4'" 1 
ATOM   2664  O "O4'" . DC  A 1 132 ? -109.209 -18.389 51.106 1.00 117.27 ? 131  DC  I "O4'" 1 
ATOM   2665  C "C3'" . DC  A 1 132 ? -107.809 -18.241 49.193 1.00 117.31 ? 131  DC  I "C3'" 1 
ATOM   2666  O "O3'" . DC  A 1 132 ? -108.116 -19.365 48.370 1.00 119.16 ? 131  DC  I "O3'" 1 
ATOM   2667  C "C2'" . DC  A 1 132 ? -108.941 -17.234 49.096 1.00 117.76 ? 131  DC  I "C2'" 1 
ATOM   2668  C "C1'" . DC  A 1 132 ? -109.964 -17.854 50.030 1.00 119.04 ? 131  DC  I "C1'" 1 
ATOM   2669  N N1    . DC  A 1 132 ? -110.954 -16.925 50.596 1.00 132.06 ? 131  DC  I N1    1 
ATOM   2670  C C2    . DC  A 1 132 ? -111.798 -17.387 51.613 1.00 133.14 ? 131  DC  I C2    1 
ATOM   2671  O O2    . DC  A 1 132 ? -111.705 -18.568 51.981 1.00 132.91 ? 131  DC  I O2    1 
ATOM   2672  N N3    . DC  A 1 132 ? -112.692 -16.538 52.167 1.00 134.06 ? 131  DC  I N3    1 
ATOM   2673  C C4    . DC  A 1 132 ? -112.769 -15.277 51.737 1.00 134.20 ? 131  DC  I C4    1 
ATOM   2674  N N4    . DC  A 1 132 ? -113.657 -14.470 52.324 1.00 134.58 ? 131  DC  I N4    1 
ATOM   2675  C C5    . DC  A 1 132 ? -111.935 -14.786 50.688 1.00 133.85 ? 131  DC  I C5    1 
ATOM   2676  C C6    . DC  A 1 132 ? -111.050 -15.636 50.151 1.00 133.15 ? 131  DC  I C6    1 
ATOM   2677  P P     . DA  A 1 133 ? -106.953 -20.084 47.538 1.00 135.86 ? 132  DA  I P     1 
ATOM   2678  O OP1   . DA  A 1 133 ? -105.741 -20.046 48.389 1.00 127.30 ? 132  DA  I OP1   1 
ATOM   2679  O OP2   . DA  A 1 133 ? -106.918 -19.490 46.175 1.00 125.62 ? 132  DA  I OP2   1 
ATOM   2680  O "O5'" . DA  A 1 133 ? -107.445 -21.597 47.449 1.00 138.08 ? 132  DA  I "O5'" 1 
ATOM   2681  C "C5'" . DA  A 1 133 ? -107.563 -22.400 48.626 1.00 140.87 ? 132  DA  I "C5'" 1 
ATOM   2682  C "C4'" . DA  A 1 133 ? -108.951 -22.995 48.721 1.00 142.85 ? 132  DA  I "C4'" 1 
ATOM   2683  O "O4'" . DA  A 1 133 ? -109.915 -21.927 48.899 1.00 143.05 ? 132  DA  I "O4'" 1 
ATOM   2684  C "C3'" . DA  A 1 133 ? -109.414 -23.772 47.484 1.00 145.09 ? 132  DA  I "C3'" 1 
ATOM   2685  O "O3'" . DA  A 1 133 ? -110.239 -24.889 47.873 1.00 148.60 ? 132  DA  I "O3'" 1 
ATOM   2686  C "C2'" . DA  A 1 133 ? -110.220 -22.738 46.719 1.00 144.05 ? 132  DA  I "C2'" 1 
ATOM   2687  C "C1'" . DA  A 1 133 ? -110.872 -21.956 47.846 1.00 143.13 ? 132  DA  I "C1'" 1 
ATOM   2688  N N9    . DA  A 1 133 ? -111.220 -20.575 47.508 1.00 133.02 ? 132  DA  I N9    1 
ATOM   2689  C C8    . DA  A 1 133 ? -110.627 -19.752 46.580 1.00 133.56 ? 132  DA  I C8    1 
ATOM   2690  N N7    . DA  A 1 133 ? -111.165 -18.558 46.512 1.00 133.86 ? 132  DA  I N7    1 
ATOM   2691  C C5    . DA  A 1 133 ? -112.183 -18.595 47.457 1.00 132.98 ? 132  DA  I C5    1 
ATOM   2692  C C6    . DA  A 1 133 ? -113.128 -17.636 47.876 1.00 132.44 ? 132  DA  I C6    1 
ATOM   2693  N N6    . DA  A 1 133 ? -113.205 -16.401 47.377 1.00 132.08 ? 132  DA  I N6    1 
ATOM   2694  N N1    . DA  A 1 133 ? -114.002 -17.995 48.839 1.00 132.34 ? 132  DA  I N1    1 
ATOM   2695  C C2    . DA  A 1 133 ? -113.928 -19.232 49.343 1.00 132.74 ? 132  DA  I C2    1 
ATOM   2696  N N3    . DA  A 1 133 ? -113.089 -20.220 49.035 1.00 133.15 ? 132  DA  I N3    1 
ATOM   2697  C C4    . DA  A 1 133 ? -112.231 -19.833 48.075 1.00 132.92 ? 132  DA  I C4    1 
ATOM   2698  P P     . DG  A 1 134 ? -110.729 -25.958 46.765 1.00 167.61 ? 133  DG  I P     1 
ATOM   2699  O OP1   . DG  A 1 134 ? -110.550 -27.328 47.318 1.00 129.80 ? 133  DG  I OP1   1 
ATOM   2700  O OP2   . DG  A 1 134 ? -110.114 -25.610 45.456 1.00 130.29 ? 133  DG  I OP2   1 
ATOM   2701  O "O5'" . DG  A 1 134 ? -112.293 -25.680 46.654 1.00 169.06 ? 133  DG  I "O5'" 1 
ATOM   2702  C "C5'" . DG  A 1 134 ? -112.769 -24.349 46.495 1.00 171.56 ? 133  DG  I "C5'" 1 
ATOM   2703  C "C4'" . DG  A 1 134 ? -114.219 -24.341 46.078 1.00 172.96 ? 133  DG  I "C4'" 1 
ATOM   2704  O "O4'" . DG  A 1 134 ? -114.570 -22.960 45.824 1.00 174.53 ? 133  DG  I "O4'" 1 
ATOM   2705  C "C3'" . DG  A 1 134 ? -114.499 -25.089 44.777 1.00 174.20 ? 133  DG  I "C3'" 1 
ATOM   2706  O "O3'" . DG  A 1 134 ? -115.807 -25.670 44.809 1.00 174.28 ? 133  DG  I "O3'" 1 
ATOM   2707  C "C2'" . DG  A 1 134 ? -114.379 -24.015 43.715 1.00 175.14 ? 133  DG  I "C2'" 1 
ATOM   2708  C "C1'" . DG  A 1 134 ? -114.773 -22.735 44.436 1.00 175.47 ? 133  DG  I "C1'" 1 
ATOM   2709  N N9    . DG  A 1 134 ? -113.943 -21.599 44.046 1.00 138.95 ? 133  DG  I N9    1 
ATOM   2710  C C8    . DG  A 1 134 ? -112.828 -21.632 43.241 1.00 138.91 ? 133  DG  I C8    1 
ATOM   2711  N N7    . DG  A 1 134 ? -112.298 -20.457 43.046 1.00 138.88 ? 133  DG  I N7    1 
ATOM   2712  C C5    . DG  A 1 134 ? -113.109 -19.595 43.769 1.00 139.04 ? 133  DG  I C5    1 
ATOM   2713  C C6    . DG  A 1 134 ? -113.032 -18.194 43.932 1.00 138.92 ? 133  DG  I C6    1 
ATOM   2714  O O6    . DG  A 1 134 ? -112.203 -17.407 43.450 1.00 139.42 ? 133  DG  I O6    1 
ATOM   2715  N N1    . DG  A 1 134 ? -114.053 -17.719 44.751 1.00 138.46 ? 133  DG  I N1    1 
ATOM   2716  C C2    . DG  A 1 134 ? -115.021 -18.495 45.337 1.00 138.19 ? 133  DG  I C2    1 
ATOM   2717  N N2    . DG  A 1 134 ? -115.915 -17.848 46.092 1.00 137.83 ? 133  DG  I N2    1 
ATOM   2718  N N3    . DG  A 1 134 ? -115.106 -19.805 45.191 1.00 137.96 ? 133  DG  I N3    1 
ATOM   2719  C C4    . DG  A 1 134 ? -114.125 -20.285 44.399 1.00 138.76 ? 133  DG  I C4    1 
ATOM   2720  P P     . DG  A 1 135 ? -116.507 -26.147 43.442 1.00 195.14 ? 134  DG  I P     1 
ATOM   2721  O OP1   . DG  A 1 135 ? -117.350 -27.323 43.780 1.00 165.43 ? 134  DG  I OP1   1 
ATOM   2722  O OP2   . DG  A 1 135 ? -115.492 -26.257 42.363 1.00 165.87 ? 134  DG  I OP2   1 
ATOM   2723  O "O5'" . DG  A 1 135 ? -117.481 -24.940 43.093 1.00 194.80 ? 134  DG  I "O5'" 1 
ATOM   2724  C "C5'" . DG  A 1 135 ? -118.614 -24.679 43.912 1.00 195.26 ? 134  DG  I "C5'" 1 
ATOM   2725  C "C4'" . DG  A 1 135 ? -119.490 -23.624 43.281 1.00 196.32 ? 134  DG  I "C4'" 1 
ATOM   2726  O "O4'" . DG  A 1 135 ? -118.945 -22.300 43.506 1.00 195.84 ? 134  DG  I "O4'" 1 
ATOM   2727  C "C3'" . DG  A 1 135 ? -119.684 -23.760 41.769 1.00 198.80 ? 134  DG  I "C3'" 1 
ATOM   2728  O "O3'" . DG  A 1 135 ? -121.065 -23.563 41.451 1.00 200.16 ? 134  DG  I "O3'" 1 
ATOM   2729  C "C2'" . DG  A 1 135 ? -118.829 -22.638 41.205 1.00 196.79 ? 134  DG  I "C2'" 1 
ATOM   2730  C "C1'" . DG  A 1 135 ? -118.958 -21.583 42.285 1.00 194.77 ? 134  DG  I "C1'" 1 
ATOM   2731  N N9    . DG  A 1 135 ? -117.891 -20.586 42.320 1.00 163.29 ? 134  DG  I N9    1 
ATOM   2732  C C8    . DG  A 1 135 ? -116.560 -20.773 42.035 1.00 161.72 ? 134  DG  I C8    1 
ATOM   2733  N N7    . DG  A 1 135 ? -115.859 -19.673 42.113 1.00 160.85 ? 134  DG  I N7    1 
ATOM   2734  C C5    . DG  A 1 135 ? -116.781 -18.704 42.484 1.00 160.01 ? 134  DG  I C5    1 
ATOM   2735  C C6    . DG  A 1 135 ? -116.611 -17.309 42.717 1.00 158.63 ? 134  DG  I C6    1 
ATOM   2736  O O6    . DG  A 1 135 ? -115.579 -16.631 42.635 1.00 156.26 ? 134  DG  I O6    1 
ATOM   2737  N N1    . DG  A 1 135 ? -117.811 -16.702 43.075 1.00 158.68 ? 134  DG  I N1    1 
ATOM   2738  C C2    . DG  A 1 135 ? -119.018 -17.346 43.195 1.00 159.51 ? 134  DG  I C2    1 
ATOM   2739  N N2    . DG  A 1 135 ? -120.063 -16.586 43.553 1.00 159.20 ? 134  DG  I N2    1 
ATOM   2740  N N3    . DG  A 1 135 ? -119.189 -18.641 42.979 1.00 160.43 ? 134  DG  I N3    1 
ATOM   2741  C C4    . DG  A 1 135 ? -118.037 -19.252 42.628 1.00 161.43 ? 134  DG  I C4    1 
ATOM   2742  P P     . DT  A 1 136 ? -121.504 -23.237 39.941 1.00 191.79 ? 135  DT  I P     1 
ATOM   2743  O OP1   . DT  A 1 136 ? -122.874 -23.785 39.775 1.00 146.60 ? 135  DT  I OP1   1 
ATOM   2744  O OP2   . DT  A 1 136 ? -120.431 -23.644 38.995 1.00 146.00 ? 135  DT  I OP2   1 
ATOM   2745  O "O5'" . DT  A 1 136 ? -121.609 -21.650 39.937 1.00 192.80 ? 135  DT  I "O5'" 1 
ATOM   2746  C "C5'" . DT  A 1 136 ? -122.473 -20.987 40.855 1.00 194.93 ? 135  DT  I "C5'" 1 
ATOM   2747  C "C4'" . DT  A 1 136 ? -122.840 -19.623 40.326 1.00 194.93 ? 135  DT  I "C4'" 1 
ATOM   2748  O "O4'" . DT  A 1 136 ? -121.723 -18.717 40.484 1.00 194.93 ? 135  DT  I "O4'" 1 
ATOM   2749  C "C3'" . DT  A 1 136 ? -123.186 -19.615 38.838 1.00 194.93 ? 135  DT  I "C3'" 1 
ATOM   2750  O "O3'" . DT  A 1 136 ? -124.269 -18.715 38.596 1.00 194.93 ? 135  DT  I "O3'" 1 
ATOM   2751  C "C2'" . DT  A 1 136 ? -121.909 -19.117 38.185 1.00 194.93 ? 135  DT  I "C2'" 1 
ATOM   2752  C "C1'" . DT  A 1 136 ? -121.377 -18.151 39.229 1.00 194.93 ? 135  DT  I "C1'" 1 
ATOM   2753  N N1    . DT  A 1 136 ? -119.915 -17.954 39.209 1.00 152.70 ? 135  DT  I N1    1 
ATOM   2754  C C2    . DT  A 1 136 ? -119.427 -16.675 39.381 1.00 152.47 ? 135  DT  I C2    1 
ATOM   2755  O O2    . DT  A 1 136 ? -120.143 -15.697 39.529 1.00 153.17 ? 135  DT  I O2    1 
ATOM   2756  N N3    . DT  A 1 136 ? -118.058 -16.581 39.374 1.00 151.68 ? 135  DT  I N3    1 
ATOM   2757  C C4    . DT  A 1 136 ? -117.152 -17.610 39.214 1.00 151.00 ? 135  DT  I C4    1 
ATOM   2758  O O4    . DT  A 1 136 ? -115.949 -17.373 39.247 1.00 150.04 ? 135  DT  I O4    1 
ATOM   2759  C C5    . DT  A 1 136 ? -117.732 -18.919 39.022 1.00 151.16 ? 135  DT  I C5    1 
ATOM   2760  C C7    . DT  A 1 136 ? -116.826 -20.092 38.824 1.00 151.56 ? 135  DT  I C7    1 
ATOM   2761  C C6    . DT  A 1 136 ? -119.066 -19.025 39.029 1.00 151.71 ? 135  DT  I C6    1 
ATOM   2762  P P     . DG  A 1 137 ? -124.688 -18.366 37.087 1.00 187.59 ? 136  DG  I P     1 
ATOM   2763  O OP1   . DG  A 1 137 ? -126.072 -17.828 37.133 1.00 151.49 ? 136  DG  I OP1   1 
ATOM   2764  O OP2   . DG  A 1 137 ? -124.383 -19.539 36.226 1.00 150.74 ? 136  DG  I OP2   1 
ATOM   2765  O "O5'" . DG  A 1 137 ? -123.698 -17.182 36.695 1.00 187.59 ? 136  DG  I "O5'" 1 
ATOM   2766  C "C5'" . DG  A 1 137 ? -123.770 -15.919 37.357 1.00 187.59 ? 136  DG  I "C5'" 1 
ATOM   2767  C "C4'" . DG  A 1 137 ? -123.108 -14.853 36.516 1.00 187.59 ? 136  DG  I "C4'" 1 
ATOM   2768  O "O4'" . DG  A 1 137 ? -121.667 -14.871 36.677 1.00 187.59 ? 136  DG  I "O4'" 1 
ATOM   2769  C "C3'" . DG  A 1 137 ? -123.367 -15.011 35.018 1.00 187.59 ? 136  DG  I "C3'" 1 
ATOM   2770  O "O3'" . DG  A 1 137 ? -123.565 -13.736 34.417 1.00 187.59 ? 136  DG  I "O3'" 1 
ATOM   2771  C "C2'" . DG  A 1 137 ? -122.070 -15.604 34.502 1.00 187.59 ? 136  DG  I "C2'" 1 
ATOM   2772  C "C1'" . DG  A 1 137 ? -121.063 -14.910 35.394 1.00 187.59 ? 136  DG  I "C1'" 1 
ATOM   2773  N N9    . DG  A 1 137 ? -119.772 -15.580 35.509 1.00 156.22 ? 136  DG  I N9    1 
ATOM   2774  C C8    . DG  A 1 137 ? -119.512 -16.927 35.411 1.00 156.21 ? 136  DG  I C8    1 
ATOM   2775  N N7    . DG  A 1 137 ? -118.246 -17.215 35.538 1.00 155.87 ? 136  DG  I N7    1 
ATOM   2776  C C5    . DG  A 1 137 ? -117.633 -15.986 35.735 1.00 155.40 ? 136  DG  I C5    1 
ATOM   2777  C C6    . DG  A 1 137 ? -116.271 -15.662 35.928 1.00 154.99 ? 136  DG  I C6    1 
ATOM   2778  O O6    . DG  A 1 137 ? -115.297 -16.421 35.962 1.00 154.26 ? 136  DG  I O6    1 
ATOM   2779  N N1    . DG  A 1 137 ? -116.089 -14.292 36.090 1.00 154.94 ? 136  DG  I N1    1 
ATOM   2780  C C2    . DG  A 1 137 ? -117.090 -13.355 36.065 1.00 154.66 ? 136  DG  I C2    1 
ATOM   2781  N N2    . DG  A 1 137 ? -116.711 -12.081 36.241 1.00 154.11 ? 136  DG  I N2    1 
ATOM   2782  N N3    . DG  A 1 137 ? -118.365 -13.643 35.882 1.00 154.59 ? 136  DG  I N3    1 
ATOM   2783  C C4    . DG  A 1 137 ? -118.563 -14.968 35.725 1.00 155.59 ? 136  DG  I C4    1 
ATOM   2784  P P     . DG  A 1 138 ? -124.278 -13.645 32.986 1.00 196.84 ? 137  DG  I P     1 
ATOM   2785  O OP1   . DG  A 1 138 ? -125.724 -13.423 33.238 1.00 147.94 ? 137  DG  I OP1   1 
ATOM   2786  O OP2   . DG  A 1 138 ? -123.839 -14.811 32.172 1.00 148.21 ? 137  DG  I OP2   1 
ATOM   2787  O "O5'" . DG  A 1 138 ? -123.668 -12.322 32.352 1.00 195.04 ? 137  DG  I "O5'" 1 
ATOM   2788  C "C5'" . DG  A 1 138 ? -123.430 -11.180 33.163 1.00 191.46 ? 137  DG  I "C5'" 1 
ATOM   2789  C "C4'" . DG  A 1 138 ? -122.119 -10.538 32.781 1.00 188.62 ? 137  DG  I "C4'" 1 
ATOM   2790  O "O4'" . DG  A 1 138 ? -121.025 -11.438 33.095 1.00 188.55 ? 137  DG  I "O4'" 1 
ATOM   2791  C "C3'" . DG  A 1 138 ? -121.981 -10.203 31.296 1.00 187.10 ? 137  DG  I "C3'" 1 
ATOM   2792  O "O3'" . DG  A 1 138 ? -121.352 -8.927  31.160 1.00 185.30 ? 137  DG  I "O3'" 1 
ATOM   2793  C "C2'" . DG  A 1 138 ? -121.094 -11.315 30.761 1.00 186.43 ? 137  DG  I "C2'" 1 
ATOM   2794  C "C1'" . DG  A 1 138 ? -120.206 -11.627 31.950 1.00 186.92 ? 137  DG  I "C1'" 1 
ATOM   2795  N N9    . DG  A 1 138 ? -119.700 -12.998 31.978 1.00 137.18 ? 137  DG  I N9    1 
ATOM   2796  C C8    . DG  A 1 138 ? -120.422 -14.147 31.761 1.00 136.67 ? 137  DG  I C8    1 
ATOM   2797  N N7    . DG  A 1 138 ? -119.699 -15.232 31.844 1.00 136.49 ? 137  DG  I N7    1 
ATOM   2798  C C5    . DG  A 1 138 ? -118.421 -14.773 32.134 1.00 136.24 ? 137  DG  I C5    1 
ATOM   2799  C C6    . DG  A 1 138 ? -117.216 -15.490 32.339 1.00 135.62 ? 137  DG  I C6    1 
ATOM   2800  O O6    . DG  A 1 138 ? -117.030 -16.712 32.303 1.00 134.85 ? 137  DG  I O6    1 
ATOM   2801  N N1    . DG  A 1 138 ? -116.154 -14.635 32.612 1.00 135.00 ? 137  DG  I N1    1 
ATOM   2802  C C2    . DG  A 1 138 ? -116.239 -13.265 32.677 1.00 134.71 ? 137  DG  I C2    1 
ATOM   2803  N N2    . DG  A 1 138 ? -115.097 -12.614 32.953 1.00 133.72 ? 137  DG  I N2    1 
ATOM   2804  N N3    . DG  A 1 138 ? -117.359 -12.584 32.486 1.00 135.20 ? 137  DG  I N3    1 
ATOM   2805  C C4    . DG  A 1 138 ? -118.404 -13.396 32.221 1.00 136.46 ? 137  DG  I C4    1 
ATOM   2806  P P     . DA  A 1 139 ? -120.885 -8.412  29.713 1.00 200.16 ? 138  DA  I P     1 
ATOM   2807  O OP1   . DA  A 1 139 ? -121.388 -7.024  29.546 1.00 142.39 ? 138  DA  I OP1   1 
ATOM   2808  O OP2   . DA  A 1 139 ? -121.207 -9.441  28.688 1.00 142.57 ? 138  DA  I OP2   1 
ATOM   2809  O "O5'" . DA  A 1 139 ? -119.304 -8.338  29.862 1.00 200.16 ? 138  DA  I "O5'" 1 
ATOM   2810  C "C5'" . DA  A 1 139 ? -118.713 -7.653  30.963 1.00 200.16 ? 138  DA  I "C5'" 1 
ATOM   2811  C "C4'" . DA  A 1 139 ? -117.249 -7.416  30.690 1.00 200.16 ? 138  DA  I "C4'" 1 
ATOM   2812  O "O4'" . DA  A 1 139 ? -116.543 -8.680  30.765 1.00 200.16 ? 138  DA  I "O4'" 1 
ATOM   2813  C "C3'" . DA  A 1 139 ? -116.996 -6.867  29.288 1.00 200.16 ? 138  DA  I "C3'" 1 
ATOM   2814  O "O3'" . DA  A 1 139 ? -115.952 -5.891  29.305 1.00 200.16 ? 138  DA  I "O3'" 1 
ATOM   2815  C "C2'" . DA  A 1 139 ? -116.615 -8.098  28.485 1.00 200.16 ? 138  DA  I "C2'" 1 
ATOM   2816  C "C1'" . DA  A 1 139 ? -115.953 -9.002  29.514 1.00 200.16 ? 138  DA  I "C1'" 1 
ATOM   2817  N N9    . DA  A 1 139 ? -116.181 -10.428 29.264 1.00 127.91 ? 138  DA  I N9    1 
ATOM   2818  C C8    . DA  A 1 139 ? -117.293 -10.996 28.690 1.00 127.48 ? 138  DA  I C8    1 
ATOM   2819  N N7    . DA  A 1 139 ? -117.224 -12.300 28.574 1.00 127.25 ? 138  DA  I N7    1 
ATOM   2820  C C5    . DA  A 1 139 ? -115.985 -12.618 29.111 1.00 126.62 ? 138  DA  I C5    1 
ATOM   2821  C C6    . DA  A 1 139 ? -115.313 -13.844 29.278 1.00 124.98 ? 138  DA  I C6    1 
ATOM   2822  N N6    . DA  A 1 139 ? -115.824 -15.025 28.915 1.00 122.51 ? 138  DA  I N6    1 
ATOM   2823  N N1    . DA  A 1 139 ? -114.086 -13.815 29.842 1.00 124.34 ? 138  DA  I N1    1 
ATOM   2824  C C2    . DA  A 1 139 ? -113.579 -12.629 30.213 1.00 125.06 ? 138  DA  I C2    1 
ATOM   2825  N N3    . DA  A 1 139 ? -114.112 -11.412 30.112 1.00 125.57 ? 138  DA  I N3    1 
ATOM   2826  C C4    . DA  A 1 139 ? -115.330 -11.474 29.543 1.00 127.06 ? 138  DA  I C4    1 
ATOM   2827  P P     . DT  A 1 140 ? -115.195 -5.518  27.941 1.00 200.16 ? 139  DT  I P     1 
ATOM   2828  O OP1   . DT  A 1 140 ? -114.452 -4.250  28.163 1.00 136.60 ? 139  DT  I OP1   1 
ATOM   2829  O OP2   . DT  A 1 140 ? -116.160 -5.614  26.819 1.00 136.22 ? 139  DT  I OP2   1 
ATOM   2830  O "O5'" . DT  A 1 140 ? -114.144 -6.704  27.801 1.00 200.16 ? 139  DT  I "O5'" 1 
ATOM   2831  C "C5'" . DT  A 1 140 ? -113.337 -7.080  28.914 1.00 200.16 ? 139  DT  I "C5'" 1 
ATOM   2832  C "C4'" . DT  A 1 140 ? -112.176 -7.929  28.457 1.00 200.16 ? 139  DT  I "C4'" 1 
ATOM   2833  O "O4'" . DT  A 1 140 ? -112.560 -9.319  28.328 1.00 200.16 ? 139  DT  I "O4'" 1 
ATOM   2834  C "C3'" . DT  A 1 140 ? -111.602 -7.515  27.104 1.00 200.16 ? 139  DT  I "C3'" 1 
ATOM   2835  O "O3'" . DT  A 1 140 ? -110.182 -7.566  27.159 1.00 200.16 ? 139  DT  I "O3'" 1 
ATOM   2836  C "C2'" . DT  A 1 140 ? -112.130 -8.580  26.160 1.00 200.16 ? 139  DT  I "C2'" 1 
ATOM   2837  C "C1'" . DT  A 1 140 ? -112.153 -9.799  27.060 1.00 200.16 ? 139  DT  I "C1'" 1 
ATOM   2838  N N1    . DT  A 1 140 ? -113.093 -10.855 26.645 1.00 123.62 ? 139  DT  I N1    1 
ATOM   2839  C C2    . DT  A 1 140 ? -112.721 -12.169 26.837 1.00 123.59 ? 139  DT  I C2    1 
ATOM   2840  O O2    . DT  A 1 140 ? -111.661 -12.494 27.341 1.00 125.34 ? 139  DT  I O2    1 
ATOM   2841  N N3    . DT  A 1 140 ? -113.641 -13.093 26.414 1.00 122.44 ? 139  DT  I N3    1 
ATOM   2842  C C4    . DT  A 1 140 ? -114.869 -12.843 25.833 1.00 122.24 ? 139  DT  I C4    1 
ATOM   2843  O O4    . DT  A 1 140 ? -115.590 -13.779 25.507 1.00 122.19 ? 139  DT  I O4    1 
ATOM   2844  C C5    . DT  A 1 140 ? -115.198 -11.444 25.663 1.00 122.15 ? 139  DT  I C5    1 
ATOM   2845  C C7    . DT  A 1 140 ? -116.505 -11.075 25.036 1.00 121.00 ? 139  DT  I C7    1 
ATOM   2846  C C6    . DT  A 1 140 ? -114.306 -10.533 26.074 1.00 121.99 ? 139  DT  I C6    1 
ATOM   2847  P P     . DA  A 1 141 ? -109.321 -7.173  25.866 1.00 171.91 ? 140  DA  I P     1 
ATOM   2848  O OP1   . DA  A 1 141 ? -108.658 -5.874  26.147 1.00 116.48 ? 140  DA  I OP1   1 
ATOM   2849  O OP2   . DA  A 1 141 ? -110.162 -7.321  24.647 1.00 116.72 ? 140  DA  I OP2   1 
ATOM   2850  O "O5'" . DA  A 1 141 ? -108.213 -8.310  25.856 1.00 168.94 ? 140  DA  I "O5'" 1 
ATOM   2851  C "C5'" . DA  A 1 141 ? -107.801 -8.917  27.076 1.00 163.47 ? 140  DA  I "C5'" 1 
ATOM   2852  C "C4'" . DA  A 1 141 ? -107.281 -10.307 26.809 1.00 159.62 ? 140  DA  I "C4'" 1 
ATOM   2853  O "O4'" . DA  A 1 141 ? -108.379 -11.218 26.562 1.00 157.51 ? 140  DA  I "O4'" 1 
ATOM   2854  C "C3'" . DA  A 1 141 ? -106.379 -10.380 25.581 1.00 159.05 ? 140  DA  I "C3'" 1 
ATOM   2855  O "O3'" . DA  A 1 141 ? -105.254 -11.211 25.855 1.00 160.25 ? 140  DA  I "O3'" 1 
ATOM   2856  C "C2'" . DA  A 1 141 ? -107.275 -10.980 24.511 1.00 157.06 ? 140  DA  I "C2'" 1 
ATOM   2857  C "C1'" . DA  A 1 141 ? -108.198 -11.875 25.317 1.00 156.17 ? 140  DA  I "C1'" 1 
ATOM   2858  N N9    . DA  A 1 141 ? -109.520 -12.083 24.723 1.00 100.41 ? 140  DA  I N9    1 
ATOM   2859  C C8    . DA  A 1 141 ? -110.500 -11.145 24.514 1.00 99.92  ? 140  DA  I C8    1 
ATOM   2860  N N7    . DA  A 1 141 ? -111.594 -11.630 23.974 1.00 99.78  ? 140  DA  I N7    1 
ATOM   2861  C C5    . DA  A 1 141 ? -111.314 -12.979 23.810 1.00 99.72  ? 140  DA  I C5    1 
ATOM   2862  C C6    . DA  A 1 141 ? -112.068 -14.047 23.276 1.00 99.28  ? 140  DA  I C6    1 
ATOM   2863  N N6    . DA  A 1 141 ? -113.312 -13.918 22.798 1.00 97.57  ? 140  DA  I N6    1 
ATOM   2864  N N1    . DA  A 1 141 ? -111.490 -15.269 23.251 1.00 99.43  ? 140  DA  I N1    1 
ATOM   2865  C C2    . DA  A 1 141 ? -110.244 -15.399 23.730 1.00 100.27 ? 140  DA  I C2    1 
ATOM   2866  N N3    . DA  A 1 141 ? -109.440 -14.476 24.254 1.00 100.67 ? 140  DA  I N3    1 
ATOM   2867  C C4    . DA  A 1 141 ? -110.040 -13.273 24.265 1.00 100.14 ? 140  DA  I C4    1 
ATOM   2868  P P     . DT  A 1 142 ? -104.104 -11.374 24.752 1.00 117.63 ? 141  DT  I P     1 
ATOM   2869  O OP1   . DT  A 1 142 ? -102.813 -11.497 25.482 1.00 116.01 ? 141  DT  I OP1   1 
ATOM   2870  O OP2   . DT  A 1 142 ? -104.281 -10.301 23.743 1.00 115.72 ? 141  DT  I OP2   1 
ATOM   2871  O "O5'" . DT  A 1 142 ? -104.458 -12.781 24.102 1.00 116.09 ? 141  DT  I "O5'" 1 
ATOM   2872  C "C5'" . DT  A 1 142 ? -104.635 -13.910 24.946 1.00 112.85 ? 141  DT  I "C5'" 1 
ATOM   2873  C "C4'" . DT  A 1 142 ? -104.808 -15.165 24.130 1.00 110.50 ? 141  DT  I "C4'" 1 
ATOM   2874  O "O4'" . DT  A 1 142 ? -106.167 -15.283 23.653 1.00 109.28 ? 141  DT  I "O4'" 1 
ATOM   2875  C "C3'" . DT  A 1 142 ? -103.903 -15.266 22.904 1.00 110.00 ? 141  DT  I "C3'" 1 
ATOM   2876  O "O3'" . DT  A 1 142 ? -103.346 -16.582 22.841 1.00 110.70 ? 141  DT  I "O3'" 1 
ATOM   2877  C "C2'" . DT  A 1 142 ? -104.848 -14.999 21.744 1.00 109.46 ? 141  DT  I "C2'" 1 
ATOM   2878  C "C1'" . DT  A 1 142 ? -106.160 -15.561 22.265 1.00 109.64 ? 141  DT  I "C1'" 1 
ATOM   2879  N N1    . DT  A 1 142 ? -107.377 -14.966 21.678 1.00 107.00 ? 141  DT  I N1    1 
ATOM   2880  C C2    . DT  A 1 142 ? -108.258 -15.797 21.016 1.00 107.02 ? 141  DT  I C2    1 
ATOM   2881  O O2    . DT  A 1 142 ? -108.081 -16.999 20.892 1.00 107.22 ? 141  DT  I O2    1 
ATOM   2882  N N3    . DT  A 1 142 ? -109.360 -15.168 20.500 1.00 105.96 ? 141  DT  I N3    1 
ATOM   2883  C C4    . DT  A 1 142 ? -109.667 -13.824 20.577 1.00 106.01 ? 141  DT  I C4    1 
ATOM   2884  O O4    . DT  A 1 142 ? -110.701 -13.406 20.055 1.00 106.92 ? 141  DT  I O4    1 
ATOM   2885  C C5    . DT  A 1 142 ? -108.703 -13.010 21.293 1.00 105.76 ? 141  DT  I C5    1 
ATOM   2886  C C7    . DT  A 1 142 ? -108.952 -11.543 21.442 1.00 106.38 ? 141  DT  I C7    1 
ATOM   2887  C C6    . DT  A 1 142 ? -107.621 -13.615 21.796 1.00 106.24 ? 141  DT  I C6    1 
ATOM   2888  P P     . DT  A 1 143 ? -102.357 -16.976 21.643 1.00 99.31  ? 142  DT  I P     1 
ATOM   2889  O OP1   . DT  A 1 143 ? -101.342 -17.913 22.201 1.00 96.43  ? 142  DT  I OP1   1 
ATOM   2890  O OP2   . DT  A 1 143 ? -101.919 -15.730 20.960 1.00 96.89  ? 142  DT  I OP2   1 
ATOM   2891  O "O5'" . DT  A 1 143 ? -103.306 -17.815 20.682 1.00 99.19  ? 142  DT  I "O5'" 1 
ATOM   2892  C "C5'" . DT  A 1 143 ? -104.054 -18.898 21.223 1.00 99.17  ? 142  DT  I "C5'" 1 
ATOM   2893  C "C4'" . DT  A 1 143 ? -104.915 -19.542 20.164 1.00 100.08 ? 142  DT  I "C4'" 1 
ATOM   2894  O "O4'" . DT  A 1 143 ? -106.057 -18.709 19.866 1.00 100.69 ? 142  DT  I "O4'" 1 
ATOM   2895  C "C3'" . DT  A 1 143 ? -104.213 -19.809 18.836 1.00 99.99  ? 142  DT  I "C3'" 1 
ATOM   2896  O "O3'" . DT  A 1 143 ? -104.566 -21.102 18.356 1.00 100.10 ? 142  DT  I "O3'" 1 
ATOM   2897  C "C2'" . DT  A 1 143 ? -104.769 -18.738 17.916 1.00 99.35  ? 142  DT  I "C2'" 1 
ATOM   2898  C "C1'" . DT  A 1 143 ? -106.176 -18.560 18.462 1.00 100.84 ? 142  DT  I "C1'" 1 
ATOM   2899  N N1    . DT  A 1 143 ? -106.792 -17.243 18.195 1.00 98.91  ? 142  DT  I N1    1 
ATOM   2900  C C2    . DT  A 1 143 ? -108.062 -17.219 17.654 1.00 97.78  ? 142  DT  I C2    1 
ATOM   2901  O O2    . DT  A 1 143 ? -108.697 -18.231 17.391 1.00 97.55  ? 142  DT  I O2    1 
ATOM   2902  N N3    . DT  A 1 143 ? -108.561 -15.956 17.432 1.00 95.90  ? 142  DT  I N3    1 
ATOM   2903  C C4    . DT  A 1 143 ? -107.932 -14.747 17.691 1.00 95.65  ? 142  DT  I C4    1 
ATOM   2904  O O4    . DT  A 1 143 ? -108.503 -13.689 17.432 1.00 95.16  ? 142  DT  I O4    1 
ATOM   2905  C C5    . DT  A 1 143 ? -106.609 -14.851 18.264 1.00 97.16  ? 142  DT  I C5    1 
ATOM   2906  C C7    . DT  A 1 143 ? -105.860 -13.597 18.592 1.00 98.08  ? 142  DT  I C7    1 
ATOM   2907  C C6    . DT  A 1 143 ? -106.110 -16.075 18.480 1.00 98.60  ? 142  DT  I C6    1 
ATOM   2908  P P     . DG  A 1 144 ? -103.737 -21.739 17.145 1.00 97.64  ? 143  DG  I P     1 
ATOM   2909  O OP1   . DG  A 1 144 ? -103.410 -23.151 17.444 1.00 97.37  ? 143  DG  I OP1   1 
ATOM   2910  O OP2   . DG  A 1 144 ? -102.646 -20.798 16.816 1.00 98.20  ? 143  DG  I OP2   1 
ATOM   2911  O "O5'" . DG  A 1 144 ? -104.781 -21.710 15.947 1.00 100.67 ? 143  DG  I "O5'" 1 
ATOM   2912  C "C5'" . DG  A 1 144 ? -106.081 -22.291 16.079 1.00 101.38 ? 143  DG  I "C5'" 1 
ATOM   2913  C "C4'" . DG  A 1 144 ? -106.944 -21.881 14.910 1.00 101.93 ? 143  DG  I "C4'" 1 
ATOM   2914  O "O4'" . DG  A 1 144 ? -107.396 -20.511 15.060 1.00 101.78 ? 143  DG  I "O4'" 1 
ATOM   2915  C "C3'" . DG  A 1 144 ? -106.203 -21.933 13.572 1.00 102.68 ? 143  DG  I "C3'" 1 
ATOM   2916  O "O3'" . DG  A 1 144 ? -107.058 -22.425 12.546 1.00 105.10 ? 143  DG  I "O3'" 1 
ATOM   2917  C "C2'" . DG  A 1 144 ? -105.887 -20.478 13.290 1.00 101.99 ? 143  DG  I "C2'" 1 
ATOM   2918  C "C1'" . DG  A 1 144 ? -107.120 -19.819 13.857 1.00 101.98 ? 143  DG  I "C1'" 1 
ATOM   2919  N N9    . DG  A 1 144 ? -106.997 -18.399 14.152 1.00 103.74 ? 143  DG  I N9    1 
ATOM   2920  C C8    . DG  A 1 144 ? -105.877 -17.705 14.539 1.00 104.03 ? 143  DG  I C8    1 
ATOM   2921  N N7    . DG  A 1 144 ? -106.094 -16.426 14.687 1.00 103.78 ? 143  DG  I N7    1 
ATOM   2922  C C5    . DG  A 1 144 ? -107.440 -16.273 14.387 1.00 104.54 ? 143  DG  I C5    1 
ATOM   2923  C C6    . DG  A 1 144 ? -108.256 -15.111 14.372 1.00 104.95 ? 143  DG  I C6    1 
ATOM   2924  O O6    . DG  A 1 144 ? -107.938 -13.940 14.624 1.00 103.73 ? 143  DG  I O6    1 
ATOM   2925  N N1    . DG  A 1 144 ? -109.569 -15.416 14.015 1.00 105.01 ? 143  DG  I N1    1 
ATOM   2926  C C2    . DG  A 1 144 ? -110.034 -16.675 13.706 1.00 105.13 ? 143  DG  I C2    1 
ATOM   2927  N N2    . DG  A 1 144 ? -111.331 -16.774 13.370 1.00 105.47 ? 143  DG  I N2    1 
ATOM   2928  N N3    . DG  A 1 144 ? -109.284 -17.759 13.720 1.00 104.72 ? 143  DG  I N3    1 
ATOM   2929  C C4    . DG  A 1 144 ? -108.009 -17.486 14.065 1.00 104.52 ? 143  DG  I C4    1 
ATOM   2930  P P     . DA  A 1 145 ? -106.423 -23.165 11.277 1.00 136.68 ? 144  DA  I P     1 
ATOM   2931  O OP1   . DA  A 1 145 ? -106.073 -24.545 11.691 1.00 99.98  ? 144  DA  I OP1   1 
ATOM   2932  O OP2   . DA  A 1 145 ? -105.378 -22.282 10.706 1.00 99.83  ? 144  DA  I OP2   1 
ATOM   2933  O "O5'" . DA  A 1 145 ? -107.642 -23.233 10.259 1.00 139.00 ? 144  DA  I "O5'" 1 
ATOM   2934  C "C5'" . DA  A 1 145 ? -108.945 -23.593 10.709 1.00 140.93 ? 144  DA  I "C5'" 1 
ATOM   2935  C "C4'" . DA  A 1 145 ? -109.982 -22.727 10.035 1.00 142.62 ? 144  DA  I "C4'" 1 
ATOM   2936  O "O4'" . DA  A 1 145 ? -109.905 -21.375 10.557 1.00 140.87 ? 144  DA  I "O4'" 1 
ATOM   2937  C "C3'" . DA  A 1 145 ? -109.811 -22.610 8.519  1.00 145.85 ? 144  DA  I "C3'" 1 
ATOM   2938  O "O3'" . DA  A 1 145 ? -111.083 -22.660 7.865  1.00 152.19 ? 144  DA  I "O3'" 1 
ATOM   2939  C "C2'" . DA  A 1 145 ? -109.171 -21.245 8.338  1.00 142.98 ? 144  DA  I "C2'" 1 
ATOM   2940  C "C1'" . DA  A 1 145 ? -109.775 -20.453 9.484  1.00 139.71 ? 144  DA  I "C1'" 1 
ATOM   2941  N N9    . DA  A 1 145 ? -108.937 -19.341 9.932  1.00 102.24 ? 144  DA  I N9    1 
ATOM   2942  C C8    . DA  A 1 145 ? -107.611 -19.384 10.294 1.00 101.81 ? 144  DA  I C8    1 
ATOM   2943  N N7    . DA  A 1 145 ? -107.114 -18.216 10.627 1.00 101.23 ? 144  DA  I N7    1 
ATOM   2944  C C5    . DA  A 1 145 ? -108.182 -17.345 10.480 1.00 100.53 ? 144  DA  I C5    1 
ATOM   2945  C C6    . DA  A 1 145 ? -108.299 -15.960 10.668 1.00 99.81  ? 144  DA  I C6    1 
ATOM   2946  N N6    . DA  A 1 145 ? -107.290 -15.180 11.062 1.00 98.76  ? 144  DA  I N6    1 
ATOM   2947  N N1    . DA  A 1 145 ? -109.503 -15.394 10.432 1.00 99.88  ? 144  DA  I N1    1 
ATOM   2948  C C2    . DA  A 1 145 ? -110.514 -16.181 10.034 1.00 100.60 ? 144  DA  I C2    1 
ATOM   2949  N N3    . DA  A 1 145 ? -110.527 -17.497 9.819  1.00 100.79 ? 144  DA  I N3    1 
ATOM   2950  C C4    . DA  A 1 145 ? -109.316 -18.025 10.060 1.00 101.39 ? 144  DA  I C4    1 
ATOM   2951  P P     . DT  A 1 146 ? -111.180 -22.386 6.284  1.00 132.06 ? 145  DT  I P     1 
ATOM   2952  O OP1   . DT  A 1 146 ? -112.454 -22.996 5.832  1.00 114.47 ? 145  DT  I OP1   1 
ATOM   2953  O OP2   . DT  A 1 146 ? -109.902 -22.777 5.632  1.00 115.82 ? 145  DT  I OP2   1 
ATOM   2954  O "O5'" . DT  A 1 146 ? -111.341 -20.807 6.196  1.00 133.56 ? 145  DT  I "O5'" 1 
ATOM   2955  C "C5'" . DT  A 1 146 ? -112.466 -20.171 6.786  1.00 135.93 ? 145  DT  I "C5'" 1 
ATOM   2956  C "C4'" . DT  A 1 146 ? -112.604 -18.769 6.249  1.00 137.72 ? 145  DT  I "C4'" 1 
ATOM   2957  O "O4'" . DT  A 1 146 ? -111.627 -17.898 6.869  1.00 137.87 ? 145  DT  I "O4'" 1 
ATOM   2958  C "C3'" . DT  A 1 146 ? -112.370 -18.654 4.742  1.00 138.40 ? 145  DT  I "C3'" 1 
ATOM   2959  O "O3'" . DT  A 1 146 ? -113.132 -17.560 4.229  1.00 139.94 ? 145  DT  I "O3'" 1 
ATOM   2960  C "C2'" . DT  A 1 146 ? -110.932 -18.177 4.664  1.00 138.56 ? 145  DT  I "C2'" 1 
ATOM   2961  C "C1'" . DT  A 1 146 ? -110.897 -17.236 5.851  1.00 138.61 ? 145  DT  I "C1'" 1 
ATOM   2962  N N1    . DT  A 1 146 ? -109.559 -16.908 6.371  1.00 123.14 ? 145  DT  I N1    1 
ATOM   2963  C C2    . DT  A 1 146 ? -109.361 -15.644 6.892  1.00 123.20 ? 145  DT  I C2    1 
ATOM   2964  O O2    . DT  A 1 146 ? -110.244 -14.806 6.965  1.00 124.79 ? 145  DT  I O2    1 
ATOM   2965  N N3    . DT  A 1 146 ? -108.084 -15.400 7.332  1.00 122.68 ? 145  DT  I N3    1 
ATOM   2966  C C4    . DT  A 1 146 ? -107.013 -16.273 7.311  1.00 123.59 ? 145  DT  I C4    1 
ATOM   2967  O O4    . DT  A 1 146 ? -105.924 -15.911 7.744  1.00 124.32 ? 145  DT  I O4    1 
ATOM   2968  C C5    . DT  A 1 146 ? -107.294 -17.584 6.759  1.00 123.72 ? 145  DT  I C5    1 
ATOM   2969  C C7    . DT  A 1 146 ? -106.194 -18.596 6.689  1.00 123.57 ? 145  DT  I C7    1 
ATOM   2970  C C6    . DT  A 1 146 ? -108.538 -17.832 6.326  1.00 123.42 ? 145  DT  I C6    1 
ATOM   2971  O "O5'" . DA  B 1 1   ? -106.787 -4.247  11.083 1.00 165.94 ? 146  DA  J "O5'" 1 
ATOM   2972  C "C5'" . DA  B 1 1   ? -106.501 -5.253  10.103 1.00 165.77 ? 146  DA  J "C5'" 1 
ATOM   2973  C "C4'" . DA  B 1 1   ? -107.677 -5.559  9.203  1.00 165.47 ? 146  DA  J "C4'" 1 
ATOM   2974  O "O4'" . DA  B 1 1   ? -107.341 -6.688  8.356  1.00 164.98 ? 146  DA  J "O4'" 1 
ATOM   2975  C "C3'" . DA  B 1 1   ? -108.949 -5.956  9.954  1.00 166.01 ? 146  DA  J "C3'" 1 
ATOM   2976  O "O3'" . DA  B 1 1   ? -110.117 -5.437  9.310  1.00 167.25 ? 146  DA  J "O3'" 1 
ATOM   2977  C "C2'" . DA  B 1 1   ? -108.939 -7.471  9.895  1.00 164.69 ? 146  DA  J "C2'" 1 
ATOM   2978  C "C1'" . DA  B 1 1   ? -108.246 -7.765  8.574  1.00 163.45 ? 146  DA  J "C1'" 1 
ATOM   2979  N N9    . DA  B 1 1   ? -107.476 -9.012  8.605  1.00 154.42 ? 146  DA  J N9    1 
ATOM   2980  C C8    . DA  B 1 1   ? -106.322 -9.267  9.310  1.00 154.32 ? 146  DA  J C8    1 
ATOM   2981  N N7    . DA  B 1 1   ? -105.881 -10.496 9.178  1.00 153.83 ? 146  DA  J N7    1 
ATOM   2982  C C5    . DA  B 1 1   ? -106.800 -11.091 8.323  1.00 153.56 ? 146  DA  J C5    1 
ATOM   2983  C C6    . DA  B 1 1   ? -106.901 -12.393 7.799  1.00 153.34 ? 146  DA  J C6    1 
ATOM   2984  N N6    . DA  B 1 1   ? -106.039 -13.371 8.078  1.00 153.33 ? 146  DA  J N6    1 
ATOM   2985  N N1    . DA  B 1 1   ? -107.936 -12.660 6.974  1.00 153.48 ? 146  DA  J N1    1 
ATOM   2986  C C2    . DA  B 1 1   ? -108.807 -11.680 6.702  1.00 153.91 ? 146  DA  J C2    1 
ATOM   2987  N N3    . DA  B 1 1   ? -108.823 -10.420 7.134  1.00 153.94 ? 146  DA  J N3    1 
ATOM   2988  C C4    . DA  B 1 1   ? -107.782 -10.185 7.952  1.00 153.83 ? 146  DA  J C4    1 
ATOM   2989  P P     . DT  B 1 2   ? -111.539 -5.516  10.060 1.00 174.60 ? 147  DT  J P     1 
ATOM   2990  O OP1   . DT  B 1 2   ? -112.414 -4.475  9.467  1.00 174.74 ? 147  DT  J OP1   1 
ATOM   2991  O OP2   . DT  B 1 2   ? -111.306 -5.530  11.527 1.00 174.27 ? 147  DT  J OP2   1 
ATOM   2992  O "O5'" . DT  B 1 2   ? -112.122 -6.934  9.634  1.00 173.29 ? 147  DT  J "O5'" 1 
ATOM   2993  C "C5'" . DT  B 1 2   ? -112.805 -7.100  8.394  1.00 171.64 ? 147  DT  J "C5'" 1 
ATOM   2994  C "C4'" . DT  B 1 2   ? -113.626 -8.365  8.426  1.00 170.75 ? 147  DT  J "C4'" 1 
ATOM   2995  O "O4'" . DT  B 1 2   ? -112.746 -9.517  8.405  1.00 171.28 ? 147  DT  J "O4'" 1 
ATOM   2996  C "C3'" . DT  B 1 2   ? -114.473 -8.506  9.690  1.00 170.84 ? 147  DT  J "C3'" 1 
ATOM   2997  O "O3'" . DT  B 1 2   ? -115.721 -9.127  9.379  1.00 170.75 ? 147  DT  J "O3'" 1 
ATOM   2998  C "C2'" . DT  B 1 2   ? -113.637 -9.419  10.568 1.00 170.08 ? 147  DT  J "C2'" 1 
ATOM   2999  C "C1'" . DT  B 1 2   ? -112.991 -10.332 9.542  1.00 169.62 ? 147  DT  J "C1'" 1 
ATOM   3000  N N1    . DT  B 1 2   ? -111.708 -10.939 9.962  1.00 168.84 ? 147  DT  J N1    1 
ATOM   3001  C C2    . DT  B 1 2   ? -111.464 -12.245 9.595  1.00 168.15 ? 147  DT  J C2    1 
ATOM   3002  O O2    . DT  B 1 2   ? -112.258 -12.918 8.956  1.00 167.51 ? 147  DT  J O2    1 
ATOM   3003  N N3    . DT  B 1 2   ? -110.250 -12.738 10.009 1.00 167.73 ? 147  DT  J N3    1 
ATOM   3004  C C4    . DT  B 1 2   ? -109.282 -12.075 10.741 1.00 167.18 ? 147  DT  J C4    1 
ATOM   3005  O O4    . DT  B 1 2   ? -108.236 -12.649 11.035 1.00 166.70 ? 147  DT  J O4    1 
ATOM   3006  C C5    . DT  B 1 2   ? -109.609 -10.715 11.103 1.00 167.17 ? 147  DT  J C5    1 
ATOM   3007  C C7    . DT  B 1 2   ? -108.629 -9.925  11.913 1.00 166.58 ? 147  DT  J C7    1 
ATOM   3008  C C6    . DT  B 1 2   ? -110.788 -10.220 10.698 1.00 167.57 ? 147  DT  J C6    1 
ATOM   3009  P P     . DC  B 1 3   ? -116.883 -9.173  10.487 1.00 199.49 ? 148  DC  J P     1 
ATOM   3010  O OP1   . DC  B 1 3   ? -117.966 -10.032 9.944  1.00 143.64 ? 148  DC  J OP1   1 
ATOM   3011  O OP2   . DC  B 1 3   ? -117.188 -7.778  10.899 1.00 143.51 ? 148  DC  J OP2   1 
ATOM   3012  O "O5'" . DC  B 1 3   ? -116.208 -9.935  11.714 1.00 199.49 ? 148  DC  J "O5'" 1 
ATOM   3013  C "C5'" . DC  B 1 3   ? -116.997 -10.551 12.734 1.00 199.49 ? 148  DC  J "C5'" 1 
ATOM   3014  C "C4'" . DC  B 1 3   ? -117.482 -11.902 12.262 1.00 199.49 ? 148  DC  J "C4'" 1 
ATOM   3015  O "O4'" . DC  B 1 3   ? -116.412 -12.534 11.523 1.00 199.49 ? 148  DC  J "O4'" 1 
ATOM   3016  C "C3'" . DC  B 1 3   ? -117.881 -12.880 13.367 1.00 199.47 ? 148  DC  J "C3'" 1 
ATOM   3017  O "O3'" . DC  B 1 3   ? -119.128 -13.547 13.072 1.00 197.08 ? 148  DC  J "O3'" 1 
ATOM   3018  C "C2'" . DC  B 1 3   ? -116.664 -13.771 13.532 1.00 199.49 ? 148  DC  J "C2'" 1 
ATOM   3019  C "C1'" . DC  B 1 3   ? -115.927 -13.688 12.198 1.00 199.49 ? 148  DC  J "C1'" 1 
ATOM   3020  N N1    . DC  B 1 3   ? -114.471 -13.518 12.367 1.00 138.50 ? 148  DC  J N1    1 
ATOM   3021  C C2    . DC  B 1 3   ? -113.624 -14.610 12.146 1.00 137.68 ? 148  DC  J C2    1 
ATOM   3022  O O2    . DC  B 1 3   ? -114.116 -15.690 11.778 1.00 137.92 ? 148  DC  J O2    1 
ATOM   3023  N N3    . DC  B 1 3   ? -112.292 -14.460 12.340 1.00 136.91 ? 148  DC  J N3    1 
ATOM   3024  C C4    . DC  B 1 3   ? -111.803 -13.282 12.738 1.00 136.65 ? 148  DC  J C4    1 
ATOM   3025  N N4    . DC  B 1 3   ? -110.491 -13.185 12.946 1.00 135.62 ? 148  DC  J N4    1 
ATOM   3026  C C5    . DC  B 1 3   ? -112.640 -12.151 12.948 1.00 136.63 ? 148  DC  J C5    1 
ATOM   3027  C C6    . DC  B 1 3   ? -113.954 -12.311 12.751 1.00 137.35 ? 148  DC  J C6    1 
ATOM   3028  P P     . DA  B 1 4   ? -119.153 -14.984 12.336 1.00 164.17 ? 149  DA  J P     1 
ATOM   3029  O OP1   . DA  B 1 4   ? -118.643 -14.787 10.952 1.00 148.02 ? 149  DA  J OP1   1 
ATOM   3030  O OP2   . DA  B 1 4   ? -120.500 -15.580 12.541 1.00 147.94 ? 149  DA  J OP2   1 
ATOM   3031  O "O5'" . DA  B 1 4   ? -118.109 -15.899 13.114 1.00 162.99 ? 149  DA  J "O5'" 1 
ATOM   3032  C "C5'" . DA  B 1 4   ? -117.590 -17.073 12.493 1.00 161.08 ? 149  DA  J "C5'" 1 
ATOM   3033  C "C4'" . DA  B 1 4   ? -117.064 -18.030 13.535 1.00 159.21 ? 149  DA  J "C4'" 1 
ATOM   3034  O "O4'" . DA  B 1 4   ? -115.905 -17.451 14.174 1.00 160.19 ? 149  DA  J "O4'" 1 
ATOM   3035  C "C3'" . DA  B 1 4   ? -118.045 -18.353 14.659 1.00 157.22 ? 149  DA  J "C3'" 1 
ATOM   3036  O "O3'" . DA  B 1 4   ? -117.839 -19.707 15.063 1.00 153.03 ? 149  DA  J "O3'" 1 
ATOM   3037  C "C2'" . DA  B 1 4   ? -117.625 -17.400 15.763 1.00 158.49 ? 149  DA  J "C2'" 1 
ATOM   3038  C "C1'" . DA  B 1 4   ? -116.121 -17.357 15.573 1.00 160.62 ? 149  DA  J "C1'" 1 
ATOM   3039  N N9    . DA  B 1 4   ? -115.466 -16.138 16.040 1.00 146.34 ? 149  DA  J N9    1 
ATOM   3040  C C8    . DA  B 1 4   ? -116.032 -14.935 16.384 1.00 147.14 ? 149  DA  J C8    1 
ATOM   3041  N N7    . DA  B 1 4   ? -115.159 -14.025 16.749 1.00 147.59 ? 149  DA  J N7    1 
ATOM   3042  C C5    . DA  B 1 4   ? -113.936 -14.675 16.645 1.00 147.47 ? 149  DA  J C5    1 
ATOM   3043  C C6    . DA  B 1 4   ? -112.613 -14.257 16.893 1.00 147.43 ? 149  DA  J C6    1 
ATOM   3044  N N6    . DA  B 1 4   ? -112.286 -13.030 17.308 1.00 148.11 ? 149  DA  J N6    1 
ATOM   3045  N N1    . DA  B 1 4   ? -111.625 -15.157 16.695 1.00 147.00 ? 149  DA  J N1    1 
ATOM   3046  C C2    . DA  B 1 4   ? -111.952 -16.389 16.279 1.00 146.04 ? 149  DA  J C2    1 
ATOM   3047  N N3    . DA  B 1 4   ? -113.151 -16.898 16.010 1.00 145.88 ? 149  DA  J N3    1 
ATOM   3048  C C4    . DA  B 1 4   ? -114.112 -15.979 16.215 1.00 146.93 ? 149  DA  J C4    1 
ATOM   3049  P P     . DA  B 1 5   ? -118.867 -20.409 16.077 1.00 134.10 ? 150  DA  J P     1 
ATOM   3050  O OP1   . DA  B 1 5   ? -119.864 -21.169 15.281 1.00 133.04 ? 150  DA  J OP1   1 
ATOM   3051  O OP2   . DA  B 1 5   ? -119.325 -19.401 17.069 1.00 134.38 ? 150  DA  J OP2   1 
ATOM   3052  O "O5'" . DA  B 1 5   ? -117.956 -21.467 16.839 1.00 132.64 ? 150  DA  J "O5'" 1 
ATOM   3053  C "C5'" . DA  B 1 5   ? -116.991 -22.246 16.131 1.00 127.54 ? 150  DA  J "C5'" 1 
ATOM   3054  C "C4'" . DA  B 1 5   ? -115.801 -22.531 17.017 1.00 123.71 ? 150  DA  J "C4'" 1 
ATOM   3055  O "O4'" . DA  B 1 5   ? -115.038 -21.315 17.217 1.00 122.20 ? 150  DA  J "O4'" 1 
ATOM   3056  C "C3'" . DA  B 1 5   ? -116.169 -23.041 18.412 1.00 122.02 ? 150  DA  J "C3'" 1 
ATOM   3057  O "O3'" . DA  B 1 5   ? -115.265 -24.082 18.809 1.00 121.43 ? 150  DA  J "O3'" 1 
ATOM   3058  C "C2'" . DA  B 1 5   ? -116.045 -21.801 19.281 1.00 119.55 ? 150  DA  J "C2'" 1 
ATOM   3059  C "C1'" . DA  B 1 5   ? -114.924 -21.032 18.602 1.00 119.54 ? 150  DA  J "C1'" 1 
ATOM   3060  N N9    . DA  B 1 5   ? -114.992 -19.580 18.776 1.00 116.84 ? 150  DA  J N9    1 
ATOM   3061  C C8    . DA  B 1 5   ? -116.088 -18.761 18.647 1.00 115.73 ? 150  DA  J C8    1 
ATOM   3062  N N7    . DA  B 1 5   ? -115.837 -17.496 18.897 1.00 114.11 ? 150  DA  J N7    1 
ATOM   3063  C C5    . DA  B 1 5   ? -114.482 -17.478 19.206 1.00 113.77 ? 150  DA  J C5    1 
ATOM   3064  C C6    . DA  B 1 5   ? -113.598 -16.432 19.572 1.00 112.24 ? 150  DA  J C6    1 
ATOM   3065  N N6    . DA  B 1 5   ? -113.963 -15.152 19.692 1.00 109.04 ? 150  DA  J N6    1 
ATOM   3066  N N1    . DA  B 1 5   ? -112.308 -16.757 19.813 1.00 112.81 ? 150  DA  J N1    1 
ATOM   3067  C C2    . DA  B 1 5   ? -111.936 -18.042 19.691 1.00 113.60 ? 150  DA  J C2    1 
ATOM   3068  N N3    . DA  B 1 5   ? -112.669 -19.109 19.356 1.00 114.39 ? 150  DA  J N3    1 
ATOM   3069  C C4    . DA  B 1 5   ? -113.947 -18.755 19.126 1.00 115.36 ? 150  DA  J C4    1 
ATOM   3070  P P     . DT  B 1 6   ? -115.435 -24.797 20.241 1.00 123.70 ? 151  DT  J P     1 
ATOM   3071  O OP1   . DT  B 1 6   ? -115.334 -26.270 20.057 1.00 114.97 ? 151  DT  J OP1   1 
ATOM   3072  O OP2   . DT  B 1 6   ? -116.615 -24.216 20.935 1.00 115.83 ? 151  DT  J OP2   1 
ATOM   3073  O "O5'" . DT  B 1 6   ? -114.143 -24.308 21.024 1.00 122.27 ? 151  DT  J "O5'" 1 
ATOM   3074  C "C5'" . DT  B 1 6   ? -113.779 -22.939 20.984 1.00 118.13 ? 151  DT  J "C5'" 1 
ATOM   3075  C "C4'" . DT  B 1 6   ? -112.672 -22.661 21.965 1.00 114.42 ? 151  DT  J "C4'" 1 
ATOM   3076  O "O4'" . DT  B 1 6   ? -112.486 -21.229 22.007 1.00 113.69 ? 151  DT  J "O4'" 1 
ATOM   3077  C "C3'" . DT  B 1 6   ? -113.007 -23.074 23.392 1.00 114.25 ? 151  DT  J "C3'" 1 
ATOM   3078  O "O3'" . DT  B 1 6   ? -111.785 -23.393 24.054 1.00 115.78 ? 151  DT  J "O3'" 1 
ATOM   3079  C "C2'" . DT  B 1 6   ? -113.657 -21.826 23.960 1.00 112.73 ? 151  DT  J "C2'" 1 
ATOM   3080  C "C1'" . DT  B 1 6   ? -112.898 -20.709 23.260 1.00 112.33 ? 151  DT  J "C1'" 1 
ATOM   3081  N N1    . DT  B 1 6   ? -113.681 -19.488 22.995 1.00 104.60 ? 151  DT  J N1    1 
ATOM   3082  C C2    . DT  B 1 6   ? -113.053 -18.277 23.166 1.00 104.21 ? 151  DT  J C2    1 
ATOM   3083  O O2    . DT  B 1 6   ? -111.897 -18.177 23.536 1.00 103.00 ? 151  DT  J O2    1 
ATOM   3084  N N3    . DT  B 1 6   ? -113.828 -17.180 22.884 1.00 104.94 ? 151  DT  J N3    1 
ATOM   3085  C C4    . DT  B 1 6   ? -115.138 -17.175 22.458 1.00 105.25 ? 151  DT  J C4    1 
ATOM   3086  O O4    . DT  B 1 6   ? -115.700 -16.110 22.231 1.00 105.08 ? 151  DT  J O4    1 
ATOM   3087  C C5    . DT  B 1 6   ? -115.744 -18.482 22.307 1.00 104.80 ? 151  DT  J C5    1 
ATOM   3088  C C7    . DT  B 1 6   ? -117.169 -18.572 21.856 1.00 105.41 ? 151  DT  J C7    1 
ATOM   3089  C C6    . DT  B 1 6   ? -114.994 -19.560 22.581 1.00 104.61 ? 151  DT  J C6    1 
ATOM   3090  P P     . DA  B 1 7   ? -111.800 -24.205 25.436 1.00 131.62 ? 152  DA  J P     1 
ATOM   3091  O OP1   . DA  B 1 7   ? -111.645 -25.647 25.118 1.00 132.37 ? 152  DA  J OP1   1 
ATOM   3092  O OP2   . DA  B 1 7   ? -112.943 -23.752 26.265 1.00 136.55 ? 152  DA  J OP2   1 
ATOM   3093  O "O5'" . DA  B 1 7   ? -110.461 -23.693 26.115 1.00 131.56 ? 152  DA  J "O5'" 1 
ATOM   3094  C "C5'" . DA  B 1 7   ? -109.345 -23.345 25.300 1.00 131.12 ? 152  DA  J "C5'" 1 
ATOM   3095  C "C4'" . DA  B 1 7   ? -108.744 -22.035 25.752 1.00 130.10 ? 152  DA  J "C4'" 1 
ATOM   3096  O "O4'" . DA  B 1 7   ? -109.627 -20.928 25.438 1.00 129.57 ? 152  DA  J "O4'" 1 
ATOM   3097  C "C3'" . DA  B 1 7   ? -108.471 -21.952 27.253 1.00 131.41 ? 152  DA  J "C3'" 1 
ATOM   3098  O "O3'" . DA  B 1 7   ? -107.196 -21.351 27.489 1.00 132.81 ? 152  DA  J "O3'" 1 
ATOM   3099  C "C2'" . DA  B 1 7   ? -109.590 -21.066 27.771 1.00 130.28 ? 152  DA  J "C2'" 1 
ATOM   3100  C "C1'" . DA  B 1 7   ? -109.836 -20.138 26.599 1.00 129.31 ? 152  DA  J "C1'" 1 
ATOM   3101  N N9    . DA  B 1 7   ? -111.196 -19.606 26.540 1.00 132.18 ? 152  DA  J N9    1 
ATOM   3102  C C8    . DA  B 1 7   ? -112.367 -20.315 26.449 1.00 131.87 ? 152  DA  J C8    1 
ATOM   3103  N N7    . DA  B 1 7   ? -113.439 -19.562 26.395 1.00 130.19 ? 152  DA  J N7    1 
ATOM   3104  C C5    . DA  B 1 7   ? -112.942 -18.268 26.462 1.00 130.32 ? 152  DA  J C5    1 
ATOM   3105  C C6    . DA  B 1 7   ? -113.572 -17.007 26.449 1.00 131.08 ? 152  DA  J C6    1 
ATOM   3106  N N6    . DA  B 1 7   ? -114.894 -16.838 26.354 1.00 131.13 ? 152  DA  J N6    1 
ATOM   3107  N N1    . DA  B 1 7   ? -112.785 -15.912 26.536 1.00 132.17 ? 152  DA  J N1    1 
ATOM   3108  C C2    . DA  B 1 7   ? -111.460 -16.081 26.626 1.00 130.79 ? 152  DA  J C2    1 
ATOM   3109  N N3    . DA  B 1 7   ? -110.751 -17.211 26.644 1.00 130.80 ? 152  DA  J N3    1 
ATOM   3110  C C4    . DA  B 1 7   ? -111.561 -18.280 26.557 1.00 131.01 ? 152  DA  J C4    1 
ATOM   3111  P P     . DT  B 1 8   ? -106.714 -21.089 28.994 1.00 119.88 ? 153  DT  J P     1 
ATOM   3112  O OP1   . DT  B 1 8   ? -105.235 -21.089 28.976 1.00 102.13 ? 153  DT  J OP1   1 
ATOM   3113  O OP2   . DT  B 1 8   ? -107.441 -22.009 29.913 1.00 100.26 ? 153  DT  J OP2   1 
ATOM   3114  O "O5'" . DT  B 1 8   ? -107.194 -19.601 29.268 1.00 120.31 ? 153  DT  J "O5'" 1 
ATOM   3115  C "C5'" . DT  B 1 8   ? -106.647 -18.526 28.516 1.00 120.49 ? 153  DT  J "C5'" 1 
ATOM   3116  C "C4'" . DT  B 1 8   ? -106.876 -17.224 29.241 1.00 121.80 ? 153  DT  J "C4'" 1 
ATOM   3117  O "O4'" . DT  B 1 8   ? -108.246 -16.795 29.078 1.00 119.57 ? 153  DT  J "O4'" 1 
ATOM   3118  C "C3'" . DT  B 1 8   ? -106.644 -17.326 30.746 1.00 124.70 ? 153  DT  J "C3'" 1 
ATOM   3119  O "O3'" . DT  B 1 8   ? -106.125 -16.089 31.215 1.00 131.22 ? 153  DT  J "O3'" 1 
ATOM   3120  C "C2'" . DT  B 1 8   ? -108.043 -17.537 31.291 1.00 121.38 ? 153  DT  J "C2'" 1 
ATOM   3121  C "C1'" . DT  B 1 8   ? -108.861 -16.670 30.350 1.00 118.39 ? 153  DT  J "C1'" 1 
ATOM   3122  N N1    . DT  B 1 8   ? -110.276 -17.055 30.209 1.00 97.97  ? 153  DT  J N1    1 
ATOM   3123  C C2    . DT  B 1 8   ? -111.178 -16.058 29.926 1.00 96.52  ? 153  DT  J C2    1 
ATOM   3124  O O2    . DT  B 1 8   ? -110.854 -14.892 29.774 1.00 96.20  ? 153  DT  J O2    1 
ATOM   3125  N N3    . DT  B 1 8   ? -112.476 -16.477 29.823 1.00 95.69  ? 153  DT  J N3    1 
ATOM   3126  C C4    . DT  B 1 8   ? -112.950 -17.764 29.961 1.00 94.76  ? 153  DT  J C4    1 
ATOM   3127  O O4    . DT  B 1 8   ? -114.146 -17.988 29.839 1.00 92.35  ? 153  DT  J O4    1 
ATOM   3128  C C5    . DT  B 1 8   ? -111.950 -18.761 30.246 1.00 95.58  ? 153  DT  J C5    1 
ATOM   3129  C C7    . DT  B 1 8   ? -112.373 -20.186 30.401 1.00 95.87  ? 153  DT  J C7    1 
ATOM   3130  C C6    . DT  B 1 8   ? -110.679 -18.363 30.357 1.00 96.75  ? 153  DT  J C6    1 
ATOM   3131  P P     . DC  B 1 9   ? -105.287 -16.037 32.579 1.00 146.53 ? 154  DC  J P     1 
ATOM   3132  O OP1   . DC  B 1 9   ? -103.846 -16.048 32.203 1.00 106.17 ? 154  DC  J OP1   1 
ATOM   3133  O OP2   . DC  B 1 9   ? -105.811 -17.045 33.539 1.00 105.44 ? 154  DC  J OP2   1 
ATOM   3134  O "O5'" . DC  B 1 9   ? -105.644 -14.592 33.123 1.00 147.72 ? 154  DC  J "O5'" 1 
ATOM   3135  C "C5'" . DC  B 1 9   ? -105.825 -13.517 32.209 1.00 151.26 ? 154  DC  J "C5'" 1 
ATOM   3136  C "C4'" . DC  B 1 9   ? -106.959 -12.632 32.664 1.00 153.74 ? 154  DC  J "C4'" 1 
ATOM   3137  O "O4'" . DC  B 1 9   ? -108.249 -13.217 32.351 1.00 155.01 ? 154  DC  J "O4'" 1 
ATOM   3138  C "C3'" . DC  B 1 9   ? -106.957 -12.373 34.169 1.00 155.79 ? 154  DC  J "C3'" 1 
ATOM   3139  O "O3'" . DC  B 1 9   ? -107.197 -10.994 34.414 1.00 157.37 ? 154  DC  J "O3'" 1 
ATOM   3140  C "C2'" . DC  B 1 9   ? -108.119 -13.208 34.676 1.00 156.00 ? 154  DC  J "C2'" 1 
ATOM   3141  C "C1'" . DC  B 1 9   ? -109.076 -13.147 33.501 1.00 155.84 ? 154  DC  J "C1'" 1 
ATOM   3142  N N1    . DC  B 1 9   ? -110.055 -14.247 33.439 1.00 115.84 ? 154  DC  J N1    1 
ATOM   3143  C C2    . DC  B 1 9   ? -111.403 -13.945 33.172 1.00 115.95 ? 154  DC  J C2    1 
ATOM   3144  O O2    . DC  B 1 9   ? -111.732 -12.764 32.988 1.00 116.10 ? 154  DC  J O2    1 
ATOM   3145  N N3    . DC  B 1 9   ? -112.309 -14.948 33.124 1.00 115.81 ? 154  DC  J N3    1 
ATOM   3146  C C4    . DC  B 1 9   ? -111.919 -16.208 33.325 1.00 115.73 ? 154  DC  J C4    1 
ATOM   3147  N N4    . DC  B 1 9   ? -112.846 -17.167 33.263 1.00 115.83 ? 154  DC  J N4    1 
ATOM   3148  C C5    . DC  B 1 9   ? -110.559 -16.544 33.598 1.00 115.64 ? 154  DC  J C5    1 
ATOM   3149  C C6    . DC  B 1 9   ? -109.669 -15.542 33.644 1.00 115.58 ? 154  DC  J C6    1 
ATOM   3150  P P     . DC  B 1 10  ? -106.602 -10.309 35.735 1.00 163.38 ? 155  DC  J P     1 
ATOM   3151  O OP1   . DC  B 1 10  ? -105.587 -9.312  35.298 1.00 123.41 ? 155  DC  J OP1   1 
ATOM   3152  O OP2   . DC  B 1 10  ? -106.218 -11.373 36.702 1.00 122.77 ? 155  DC  J OP2   1 
ATOM   3153  O "O5'" . DC  B 1 10  ? -107.865 -9.532  36.306 1.00 163.78 ? 155  DC  J "O5'" 1 
ATOM   3154  C "C5'" . DC  B 1 10  ? -108.737 -8.832  35.425 1.00 165.37 ? 155  DC  J "C5'" 1 
ATOM   3155  C "C4'" . DC  B 1 10  ? -110.150 -8.867  35.956 1.00 166.49 ? 155  DC  J "C4'" 1 
ATOM   3156  O "O4'" . DC  B 1 10  ? -110.820 -10.110 35.626 1.00 167.68 ? 155  DC  J "O4'" 1 
ATOM   3157  C "C3'" . DC  B 1 10  ? -110.250 -8.721  37.474 1.00 166.36 ? 155  DC  J "C3'" 1 
ATOM   3158  O "O3'" . DC  B 1 10  ? -111.317 -7.838  37.795 1.00 166.07 ? 155  DC  J "O3'" 1 
ATOM   3159  C "C2'" . DC  B 1 10  ? -110.614 -10.119 37.940 1.00 166.96 ? 155  DC  J "C2'" 1 
ATOM   3160  C "C1'" . DC  B 1 10  ? -111.481 -10.583 36.789 1.00 167.02 ? 155  DC  J "C1'" 1 
ATOM   3161  N N1    . DC  B 1 10  ? -111.665 -12.041 36.670 1.00 126.93 ? 155  DC  J N1    1 
ATOM   3162  C C2    . DC  B 1 10  ? -112.854 -12.525 36.104 1.00 125.78 ? 155  DC  J C2    1 
ATOM   3163  O O2    . DC  B 1 10  ? -113.704 -11.713 35.705 1.00 124.60 ? 155  DC  J O2    1 
ATOM   3164  N N3    . DC  B 1 10  ? -113.046 -13.861 36.009 1.00 125.35 ? 155  DC  J N3    1 
ATOM   3165  C C4    . DC  B 1 10  ? -112.110 -14.703 36.457 1.00 125.50 ? 155  DC  J C4    1 
ATOM   3166  N N4    . DC  B 1 10  ? -112.345 -16.013 36.356 1.00 124.64 ? 155  DC  J N4    1 
ATOM   3167  C C5    . DC  B 1 10  ? -110.891 -14.239 37.031 1.00 125.92 ? 155  DC  J C5    1 
ATOM   3168  C C6    . DC  B 1 10  ? -110.709 -12.914 37.115 1.00 126.58 ? 155  DC  J C6    1 
ATOM   3169  P P     . DA  B 1 11  ? -111.350 -7.129  39.228 1.00 149.11 ? 156  DA  J P     1 
ATOM   3170  O OP1   . DA  B 1 11  ? -110.759 -5.773  39.075 1.00 164.63 ? 156  DA  J OP1   1 
ATOM   3171  O OP2   . DA  B 1 11  ? -110.783 -8.071  40.227 1.00 164.08 ? 156  DA  J OP2   1 
ATOM   3172  O "O5'" . DA  B 1 11  ? -112.907 -6.977  39.508 1.00 148.48 ? 156  DA  J "O5'" 1 
ATOM   3173  C "C5'" . DA  B 1 11  ? -113.778 -6.442  38.518 1.00 147.04 ? 156  DA  J "C5'" 1 
ATOM   3174  C "C4'" . DA  B 1 11  ? -115.205 -6.805  38.848 1.00 146.38 ? 156  DA  J "C4'" 1 
ATOM   3175  O "O4'" . DA  B 1 11  ? -115.458 -8.185  38.488 1.00 145.16 ? 156  DA  J "O4'" 1 
ATOM   3176  C "C3'" . DA  B 1 11  ? -115.512 -6.694  40.340 1.00 147.16 ? 156  DA  J "C3'" 1 
ATOM   3177  O "O3'" . DA  B 1 11  ? -116.821 -6.172  40.553 1.00 150.25 ? 156  DA  J "O3'" 1 
ATOM   3178  C "C2'" . DA  B 1 11  ? -115.425 -8.128  40.828 1.00 145.16 ? 156  DA  J "C2'" 1 
ATOM   3179  C "C1'" . DA  B 1 11  ? -115.916 -8.905  39.623 1.00 143.87 ? 156  DA  J "C1'" 1 
ATOM   3180  N N9    . DA  B 1 11  ? -115.383 -10.263 39.539 1.00 158.22 ? 156  DA  J N9    1 
ATOM   3181  C C8    . DA  B 1 11  ? -114.071 -10.659 39.598 1.00 158.09 ? 156  DA  J C8    1 
ATOM   3182  N N7    . DA  B 1 11  ? -113.905 -11.956 39.503 1.00 157.66 ? 156  DA  J N7    1 
ATOM   3183  C C5    . DA  B 1 11  ? -115.197 -12.447 39.370 1.00 157.75 ? 156  DA  J C5    1 
ATOM   3184  C C6    . DA  B 1 11  ? -115.704 -13.752 39.229 1.00 157.59 ? 156  DA  J C6    1 
ATOM   3185  N N6    . DA  B 1 11  ? -114.938 -14.844 39.199 1.00 157.40 ? 156  DA  J N6    1 
ATOM   3186  N N1    . DA  B 1 11  ? -117.043 -13.897 39.119 1.00 157.51 ? 156  DA  J N1    1 
ATOM   3187  C C2    . DA  B 1 11  ? -117.810 -12.800 39.153 1.00 156.89 ? 156  DA  J C2    1 
ATOM   3188  N N3    . DA  B 1 11  ? -117.451 -11.523 39.283 1.00 157.30 ? 156  DA  J N3    1 
ATOM   3189  C C4    . DA  B 1 11  ? -116.116 -11.414 39.388 1.00 157.90 ? 156  DA  J C4    1 
ATOM   3190  P P     . DC  B 1 12  ? -117.404 -6.095  42.044 1.00 200.16 ? 157  DC  J P     1 
ATOM   3191  O OP1   . DC  B 1 12  ? -118.632 -5.262  41.990 1.00 126.87 ? 157  DC  J OP1   1 
ATOM   3192  O OP2   . DC  B 1 12  ? -116.299 -5.723  42.970 1.00 126.40 ? 157  DC  J OP2   1 
ATOM   3193  O "O5'" . DC  B 1 12  ? -117.827 -7.599  42.348 1.00 200.16 ? 157  DC  J "O5'" 1 
ATOM   3194  C "C5'" . DC  B 1 12  ? -118.971 -8.172  41.720 1.00 200.16 ? 157  DC  J "C5'" 1 
ATOM   3195  C "C4'" . DC  B 1 12  ? -119.479 -9.337  42.535 1.00 200.16 ? 157  DC  J "C4'" 1 
ATOM   3196  O "O4'" . DC  B 1 12  ? -118.726 -10.538 42.233 1.00 200.16 ? 157  DC  J "O4'" 1 
ATOM   3197  C "C3'" . DC  B 1 12  ? -119.365 -9.123  44.045 1.00 200.16 ? 157  DC  J "C3'" 1 
ATOM   3198  O "O3'" . DC  B 1 12  ? -120.544 -9.584  44.704 1.00 200.16 ? 157  DC  J "O3'" 1 
ATOM   3199  C "C2'" . DC  B 1 12  ? -118.170 -9.978  44.432 1.00 200.16 ? 157  DC  J "C2'" 1 
ATOM   3200  C "C1'" . DC  B 1 12  ? -118.267 -11.126 43.441 1.00 200.16 ? 157  DC  J "C1'" 1 
ATOM   3201  N N1    . DC  B 1 12  ? -117.000 -11.832 43.161 1.00 131.09 ? 157  DC  J N1    1 
ATOM   3202  C C2    . DC  B 1 12  ? -117.040 -13.204 42.852 1.00 130.51 ? 157  DC  J C2    1 
ATOM   3203  O O2    . DC  B 1 12  ? -118.136 -13.782 42.810 1.00 131.03 ? 157  DC  J O2    1 
ATOM   3204  N N3    . DC  B 1 12  ? -115.884 -13.860 42.606 1.00 129.30 ? 157  DC  J N3    1 
ATOM   3205  C C4    . DC  B 1 12  ? -114.722 -13.206 42.654 1.00 128.47 ? 157  DC  J C4    1 
ATOM   3206  N N4    . DC  B 1 12  ? -113.610 -13.895 42.405 1.00 127.76 ? 157  DC  J N4    1 
ATOM   3207  C C5    . DC  B 1 12  ? -114.651 -11.814 42.960 1.00 128.81 ? 157  DC  J C5    1 
ATOM   3208  C C6    . DC  B 1 12  ? -115.802 -11.172 43.204 1.00 130.27 ? 157  DC  J C6    1 
ATOM   3209  P P     . DC  B 1 13  ? -120.908 -9.031  46.168 1.00 155.93 ? 158  DC  J P     1 
ATOM   3210  O OP1   . DC  B 1 13  ? -122.158 -8.242  46.044 1.00 146.13 ? 158  DC  J OP1   1 
ATOM   3211  O OP2   . DC  B 1 13  ? -119.700 -8.407  46.772 1.00 145.37 ? 158  DC  J OP2   1 
ATOM   3212  O "O5'" . DC  B 1 13  ? -121.253 -10.358 46.971 1.00 156.67 ? 158  DC  J "O5'" 1 
ATOM   3213  C "C5'" . DC  B 1 13  ? -122.208 -11.279 46.459 1.00 158.19 ? 158  DC  J "C5'" 1 
ATOM   3214  C "C4'" . DC  B 1 13  ? -121.976 -12.649 47.046 1.00 159.97 ? 158  DC  J "C4'" 1 
ATOM   3215  O "O4'" . DC  B 1 13  ? -120.824 -13.281 46.434 1.00 160.11 ? 158  DC  J "O4'" 1 
ATOM   3216  C "C3'" . DC  B 1 13  ? -121.708 -12.636 48.551 1.00 162.09 ? 158  DC  J "C3'" 1 
ATOM   3217  O "O3'" . DC  B 1 13  ? -122.382 -13.727 49.177 1.00 165.72 ? 158  DC  J "O3'" 1 
ATOM   3218  C "C2'" . DC  B 1 13  ? -120.208 -12.850 48.639 1.00 161.59 ? 158  DC  J "C2'" 1 
ATOM   3219  C "C1'" . DC  B 1 13  ? -119.970 -13.767 47.456 1.00 161.41 ? 158  DC  J "C1'" 1 
ATOM   3220  N N1    . DC  B 1 13  ? -118.590 -13.787 46.942 1.00 152.16 ? 158  DC  J N1    1 
ATOM   3221  C C2    . DC  B 1 13  ? -118.002 -15.025 46.644 1.00 152.66 ? 158  DC  J C2    1 
ATOM   3222  O O2    . DC  B 1 13  ? -118.666 -16.063 46.809 1.00 153.17 ? 158  DC  J O2    1 
ATOM   3223  N N3    . DC  B 1 13  ? -116.728 -15.059 46.186 1.00 152.76 ? 158  DC  J N3    1 
ATOM   3224  C C4    . DC  B 1 13  ? -116.051 -13.922 46.016 1.00 152.70 ? 158  DC  J C4    1 
ATOM   3225  N N4    . DC  B 1 13  ? -114.800 -14.003 45.562 1.00 153.18 ? 158  DC  J N4    1 
ATOM   3226  C C5    . DC  B 1 13  ? -116.627 -12.650 46.305 1.00 152.80 ? 158  DC  J C5    1 
ATOM   3227  C C6    . DC  B 1 13  ? -117.887 -12.629 46.761 1.00 152.42 ? 158  DC  J C6    1 
ATOM   3228  P P     . DT  B 1 14  ? -123.014 -13.533 50.637 1.00 166.42 ? 159  DT  J P     1 
ATOM   3229  O OP1   . DT  B 1 14  ? -124.487 -13.450 50.471 1.00 174.11 ? 159  DT  J OP1   1 
ATOM   3230  O OP2   . DT  B 1 14  ? -122.282 -12.430 51.317 1.00 171.99 ? 159  DT  J OP2   1 
ATOM   3231  O "O5'" . DT  B 1 14  ? -122.676 -14.900 51.377 1.00 166.85 ? 159  DT  J "O5'" 1 
ATOM   3232  C "C5'" . DT  B 1 14  ? -123.036 -16.152 50.803 1.00 166.87 ? 159  DT  J "C5'" 1 
ATOM   3233  C "C4'" . DT  B 1 14  ? -122.091 -17.223 51.290 1.00 166.74 ? 159  DT  J "C4'" 1 
ATOM   3234  O "O4'" . DT  B 1 14  ? -120.788 -17.029 50.683 1.00 167.79 ? 159  DT  J "O4'" 1 
ATOM   3235  C "C3'" . DT  B 1 14  ? -121.865 -17.177 52.802 1.00 165.63 ? 159  DT  J "C3'" 1 
ATOM   3236  O "O3'" . DT  B 1 14  ? -121.726 -18.501 53.314 1.00 163.83 ? 159  DT  J "O3'" 1 
ATOM   3237  C "C2'" . DT  B 1 14  ? -120.552 -16.428 52.935 1.00 166.58 ? 159  DT  J "C2'" 1 
ATOM   3238  C "C1'" . DT  B 1 14  ? -119.801 -16.889 51.696 1.00 167.17 ? 159  DT  J "C1'" 1 
ATOM   3239  N N1    . DT  B 1 14  ? -118.761 -15.954 51.207 1.00 174.00 ? 159  DT  J N1    1 
ATOM   3240  C C2    . DT  B 1 14  ? -117.649 -16.484 50.584 1.00 173.97 ? 159  DT  J C2    1 
ATOM   3241  O O2    . DT  B 1 14  ? -117.484 -17.680 50.415 1.00 174.43 ? 159  DT  J O2    1 
ATOM   3242  N N3    . DT  B 1 14  ? -116.731 -15.554 50.163 1.00 173.89 ? 159  DT  J N3    1 
ATOM   3243  C C4    . DT  B 1 14  ? -116.808 -14.181 50.300 1.00 173.70 ? 159  DT  J C4    1 
ATOM   3244  O O4    . DT  B 1 14  ? -115.905 -13.473 49.867 1.00 173.24 ? 159  DT  J O4    1 
ATOM   3245  C C5    . DT  B 1 14  ? -117.996 -13.693 50.966 1.00 173.56 ? 159  DT  J C5    1 
ATOM   3246  C C7    . DT  B 1 14  ? -118.163 -12.219 51.167 1.00 173.71 ? 159  DT  J C7    1 
ATOM   3247  C C6    . DT  B 1 14  ? -118.901 -14.592 51.378 1.00 173.82 ? 159  DT  J C6    1 
ATOM   3248  P P     . DG  B 1 15  ? -122.481 -18.917 54.669 1.00 138.56 ? 160  DG  J P     1 
ATOM   3249  O OP1   . DG  B 1 15  ? -123.936 -18.831 54.395 1.00 156.69 ? 160  DG  J OP1   1 
ATOM   3250  O OP2   . DG  B 1 15  ? -121.901 -18.158 55.809 1.00 156.10 ? 160  DG  J OP2   1 
ATOM   3251  O "O5'" . DG  B 1 15  ? -122.102 -20.454 54.836 1.00 137.64 ? 160  DG  J "O5'" 1 
ATOM   3252  C "C5'" . DG  B 1 15  ? -122.079 -21.321 53.703 1.00 136.15 ? 160  DG  J "C5'" 1 
ATOM   3253  C "C4'" . DG  B 1 15  ? -120.961 -22.327 53.840 1.00 135.68 ? 160  DG  J "C4'" 1 
ATOM   3254  O "O4'" . DG  B 1 15  ? -119.684 -21.651 53.792 1.00 136.74 ? 160  DG  J "O4'" 1 
ATOM   3255  C "C3'" . DG  B 1 15  ? -120.977 -23.091 55.157 1.00 134.79 ? 160  DG  J "C3'" 1 
ATOM   3256  O "O3'" . DG  B 1 15  ? -120.531 -24.428 54.938 1.00 132.50 ? 160  DG  J "O3'" 1 
ATOM   3257  C "C2'" . DG  B 1 15  ? -120.026 -22.303 56.042 1.00 135.13 ? 160  DG  J "C2'" 1 
ATOM   3258  C "C1'" . DG  B 1 15  ? -119.033 -21.693 55.058 1.00 136.58 ? 160  DG  J "C1'" 1 
ATOM   3259  N N9    . DG  B 1 15  ? -118.664 -20.319 55.392 1.00 155.05 ? 160  DG  J N9    1 
ATOM   3260  C C8    . DG  B 1 15  ? -119.234 -19.527 56.361 1.00 155.55 ? 160  DG  J C8    1 
ATOM   3261  N N7    . DG  B 1 15  ? -118.745 -18.317 56.388 1.00 155.51 ? 160  DG  J N7    1 
ATOM   3262  C C5    . DG  B 1 15  ? -117.785 -18.312 55.386 1.00 155.40 ? 160  DG  J C5    1 
ATOM   3263  C C6    . DG  B 1 15  ? -116.937 -17.270 54.937 1.00 155.09 ? 160  DG  J C6    1 
ATOM   3264  O O6    . DG  B 1 15  ? -116.876 -16.101 55.338 1.00 154.70 ? 160  DG  J O6    1 
ATOM   3265  N N1    . DG  B 1 15  ? -116.104 -17.696 53.906 1.00 154.89 ? 160  DG  J N1    1 
ATOM   3266  C C2    . DG  B 1 15  ? -116.093 -18.961 53.371 1.00 155.04 ? 160  DG  J C2    1 
ATOM   3267  N N2    . DG  B 1 15  ? -115.208 -19.179 52.389 1.00 154.67 ? 160  DG  J N2    1 
ATOM   3268  N N3    . DG  B 1 15  ? -116.891 -19.940 53.771 1.00 155.21 ? 160  DG  J N3    1 
ATOM   3269  C C4    . DG  B 1 15  ? -117.706 -19.547 54.775 1.00 155.34 ? 160  DG  J C4    1 
ATOM   3270  P P     . DC  B 1 16  ? -120.089 -25.328 56.185 1.00 167.93 ? 161  DC  J P     1 
ATOM   3271  O OP1   . DC  B 1 16  ? -120.220 -26.752 55.777 1.00 149.96 ? 161  DC  J OP1   1 
ATOM   3272  O OP2   . DC  B 1 16  ? -120.805 -24.834 57.392 1.00 150.60 ? 161  DC  J OP2   1 
ATOM   3273  O "O5'" . DC  B 1 16  ? -118.542 -24.986 56.342 1.00 166.13 ? 161  DC  J "O5'" 1 
ATOM   3274  C "C5'" . DC  B 1 16  ? -117.616 -25.323 55.310 1.00 161.10 ? 161  DC  J "C5'" 1 
ATOM   3275  C "C4'" . DC  B 1 16  ? -116.201 -25.222 55.827 1.00 156.65 ? 161  DC  J "C4'" 1 
ATOM   3276  O "O4'" . DC  B 1 16  ? -115.790 -23.838 55.904 1.00 155.51 ? 161  DC  J "O4'" 1 
ATOM   3277  C "C3'" . DC  B 1 16  ? -116.011 -25.806 57.226 1.00 153.73 ? 161  DC  J "C3'" 1 
ATOM   3278  O "O3'" . DC  B 1 16  ? -114.790 -26.529 57.276 1.00 150.39 ? 161  DC  J "O3'" 1 
ATOM   3279  C "C2'" . DC  B 1 16  ? -115.945 -24.581 58.118 1.00 152.91 ? 161  DC  J "C2'" 1 
ATOM   3280  C "C1'" . DC  B 1 16  ? -115.297 -23.559 57.202 1.00 152.38 ? 161  DC  J "C1'" 1 
ATOM   3281  N N1    . DC  B 1 16  ? -115.612 -22.157 57.513 1.00 132.96 ? 161  DC  J N1    1 
ATOM   3282  C C2    . DC  B 1 16  ? -115.159 -21.160 56.644 1.00 132.35 ? 161  DC  J C2    1 
ATOM   3283  O O2    . DC  B 1 16  ? -114.524 -21.491 55.634 1.00 132.60 ? 161  DC  J O2    1 
ATOM   3284  N N3    . DC  B 1 16  ? -115.424 -19.865 56.925 1.00 131.73 ? 161  DC  J N3    1 
ATOM   3285  C C4    . DC  B 1 16  ? -116.118 -19.550 58.022 1.00 131.06 ? 161  DC  J C4    1 
ATOM   3286  N N4    . DC  B 1 16  ? -116.354 -18.255 58.265 1.00 130.72 ? 161  DC  J N4    1 
ATOM   3287  C C5    . DC  B 1 16  ? -116.600 -20.546 58.921 1.00 130.96 ? 161  DC  J C5    1 
ATOM   3288  C C6    . DC  B 1 16  ? -116.327 -21.825 58.630 1.00 131.95 ? 161  DC  J C6    1 
ATOM   3289  P P     . DA  B 1 17  ? -114.818 -28.119 57.102 1.00 151.83 ? 162  DA  J P     1 
ATOM   3290  O OP1   . DA  B 1 17  ? -115.814 -28.401 56.036 1.00 122.50 ? 162  DA  J OP1   1 
ATOM   3291  O OP2   . DA  B 1 17  ? -114.970 -28.742 58.442 1.00 123.02 ? 162  DA  J OP2   1 
ATOM   3292  O "O5'" . DA  B 1 17  ? -113.374 -28.462 56.529 1.00 149.93 ? 162  DA  J "O5'" 1 
ATOM   3293  C "C5'" . DA  B 1 17  ? -113.050 -28.188 55.168 1.00 145.07 ? 162  DA  J "C5'" 1 
ATOM   3294  C "C4'" . DA  B 1 17  ? -111.716 -27.486 55.084 1.00 141.93 ? 162  DA  J "C4'" 1 
ATOM   3295  O "O4'" . DA  B 1 17  ? -111.809 -26.209 55.753 1.00 140.21 ? 162  DA  J "O4'" 1 
ATOM   3296  C "C3'" . DA  B 1 17  ? -110.565 -28.222 55.759 1.00 140.86 ? 162  DA  J "C3'" 1 
ATOM   3297  O "O3'" . DA  B 1 17  ? -109.363 -27.969 55.031 1.00 139.80 ? 162  DA  J "O3'" 1 
ATOM   3298  C "C2'" . DA  B 1 17  ? -110.521 -27.607 57.146 1.00 140.00 ? 162  DA  J "C2'" 1 
ATOM   3299  C "C1'" . DA  B 1 17  ? -110.966 -26.176 56.897 1.00 140.08 ? 162  DA  J "C1'" 1 
ATOM   3300  N N9    . DA  B 1 17  ? -111.751 -25.600 57.985 1.00 111.03 ? 162  DA  J N9    1 
ATOM   3301  C C8    . DA  B 1 17  ? -112.499 -26.260 58.929 1.00 111.31 ? 162  DA  J C8    1 
ATOM   3302  N N7    . DA  B 1 17  ? -113.153 -25.462 59.737 1.00 111.37 ? 162  DA  J N7    1 
ATOM   3303  C C5    . DA  B 1 17  ? -112.798 -24.190 59.306 1.00 110.84 ? 162  DA  J C5    1 
ATOM   3304  C C6    . DA  B 1 17  ? -113.168 -22.904 59.742 1.00 110.85 ? 162  DA  J C6    1 
ATOM   3305  N N6    . DA  B 1 17  ? -114.022 -22.679 60.745 1.00 109.51 ? 162  DA  J N6    1 
ATOM   3306  N N1    . DA  B 1 17  ? -112.628 -21.842 59.100 1.00 111.17 ? 162  DA  J N1    1 
ATOM   3307  C C2    . DA  B 1 17  ? -111.784 -22.070 58.087 1.00 111.45 ? 162  DA  J C2    1 
ATOM   3308  N N3    . DA  B 1 17  ? -111.368 -23.229 57.582 1.00 111.01 ? 162  DA  J N3    1 
ATOM   3309  C C4    . DA  B 1 17  ? -111.920 -24.261 58.242 1.00 110.94 ? 162  DA  J C4    1 
ATOM   3310  P P     . DG  B 1 18  ? -107.968 -28.541 55.571 1.00 141.54 ? 163  DG  J P     1 
ATOM   3311  O OP1   . DG  B 1 18  ? -107.168 -28.888 54.369 1.00 106.74 ? 163  DG  J OP1   1 
ATOM   3312  O OP2   . DG  B 1 18  ? -108.248 -29.579 56.597 1.00 106.67 ? 163  DG  J OP2   1 
ATOM   3313  O "O5'" . DG  B 1 18  ? -107.312 -27.285 56.300 1.00 138.09 ? 163  DG  J "O5'" 1 
ATOM   3314  C "C5'" . DG  B 1 18  ? -107.161 -26.048 55.609 1.00 134.55 ? 163  DG  J "C5'" 1 
ATOM   3315  C "C4'" . DG  B 1 18  ? -106.720 -24.953 56.553 1.00 132.97 ? 163  DG  J "C4'" 1 
ATOM   3316  O "O4'" . DG  B 1 18  ? -107.788 -24.573 57.456 1.00 132.62 ? 163  DG  J "O4'" 1 
ATOM   3317  C "C3'" . DG  B 1 18  ? -105.506 -25.250 57.439 1.00 132.02 ? 163  DG  J "C3'" 1 
ATOM   3318  O "O3'" . DG  B 1 18  ? -104.676 -24.085 57.479 1.00 130.80 ? 163  DG  J "O3'" 1 
ATOM   3319  C "C2'" . DG  B 1 18  ? -106.126 -25.463 58.810 1.00 132.00 ? 163  DG  J "C2'" 1 
ATOM   3320  C "C1'" . DG  B 1 18  ? -107.245 -24.446 58.758 1.00 132.21 ? 163  DG  J "C1'" 1 
ATOM   3321  N N9    . DG  B 1 18  ? -108.321 -24.611 59.730 1.00 97.69  ? 163  DG  J N9    1 
ATOM   3322  C C8    . DG  B 1 18  ? -108.811 -25.784 60.256 1.00 98.28  ? 163  DG  J C8    1 
ATOM   3323  N N7    . DG  B 1 18  ? -109.772 -25.595 61.122 1.00 98.47  ? 163  DG  J N7    1 
ATOM   3324  C C5    . DG  B 1 18  ? -109.926 -24.213 61.169 1.00 97.72  ? 163  DG  J C5    1 
ATOM   3325  C C6    . DG  B 1 18  ? -110.812 -23.408 61.935 1.00 97.38  ? 163  DG  J C6    1 
ATOM   3326  O O6    . DG  B 1 18  ? -111.664 -23.767 62.756 1.00 96.47  ? 163  DG  J O6    1 
ATOM   3327  N N1    . DG  B 1 18  ? -110.633 -22.053 61.670 1.00 96.87  ? 163  DG  J N1    1 
ATOM   3328  C C2    . DG  B 1 18  ? -109.723 -21.537 60.784 1.00 96.22  ? 163  DG  J C2    1 
ATOM   3329  N N2    . DG  B 1 18  ? -109.710 -20.207 60.662 1.00 94.59  ? 163  DG  J N2    1 
ATOM   3330  N N3    . DG  B 1 18  ? -108.890 -22.272 60.070 1.00 97.34  ? 163  DG  J N3    1 
ATOM   3331  C C4    . DG  B 1 18  ? -109.044 -23.592 60.310 1.00 97.56  ? 163  DG  J C4    1 
ATOM   3332  P P     . DA  B 1 19  ? -103.236 -24.146 58.188 1.00 112.28 ? 164  DA  J P     1 
ATOM   3333  O OP1   . DA  B 1 19  ? -102.216 -24.303 57.121 1.00 99.18  ? 164  DA  J OP1   1 
ATOM   3334  O OP2   . DA  B 1 19  ? -103.269 -25.104 59.321 1.00 98.32  ? 164  DA  J OP2   1 
ATOM   3335  O "O5'" . DA  B 1 19  ? -103.085 -22.686 58.782 1.00 111.94 ? 164  DA  J "O5'" 1 
ATOM   3336  C "C5'" . DA  B 1 19  ? -103.403 -21.565 57.981 1.00 111.61 ? 164  DA  J "C5'" 1 
ATOM   3337  C "C4'" . DA  B 1 19  ? -103.746 -20.390 58.860 1.00 111.41 ? 164  DA  J "C4'" 1 
ATOM   3338  O "O4'" . DA  B 1 19  ? -104.975 -20.673 59.568 1.00 110.56 ? 164  DA  J "O4'" 1 
ATOM   3339  C "C3'" . DA  B 1 19  ? -102.699 -20.083 59.929 1.00 111.81 ? 164  DA  J "C3'" 1 
ATOM   3340  O "O3'" . DA  B 1 19  ? -102.522 -18.672 60.039 1.00 112.66 ? 164  DA  J "O3'" 1 
ATOM   3341  C "C2'" . DA  B 1 19  ? -103.301 -20.662 61.196 1.00 111.33 ? 164  DA  J "C2'" 1 
ATOM   3342  C "C1'" . DA  B 1 19  ? -104.784 -20.477 60.957 1.00 110.86 ? 164  DA  J "C1'" 1 
ATOM   3343  N N9    . DA  B 1 19  ? -105.634 -21.433 61.666 1.00 97.74  ? 164  DA  J N9    1 
ATOM   3344  C C8    . DA  B 1 19  ? -105.490 -22.798 61.759 1.00 97.46  ? 164  DA  J C8    1 
ATOM   3345  N N7    . DA  B 1 19  ? -106.410 -23.377 62.495 1.00 96.83  ? 164  DA  J N7    1 
ATOM   3346  C C5    . DA  B 1 19  ? -107.216 -22.324 62.909 1.00 96.15  ? 164  DA  J C5    1 
ATOM   3347  C C6    . DA  B 1 19  ? -108.364 -22.273 63.716 1.00 95.15  ? 164  DA  J C6    1 
ATOM   3348  N N6    . DA  B 1 19  ? -108.915 -23.346 64.282 1.00 94.31  ? 164  DA  J N6    1 
ATOM   3349  N N1    . DA  B 1 19  ? -108.933 -21.066 63.923 1.00 95.55  ? 164  DA  J N1    1 
ATOM   3350  C C2    . DA  B 1 19  ? -108.374 -19.987 63.357 1.00 95.51  ? 164  DA  J C2    1 
ATOM   3351  N N3    . DA  B 1 19  ? -107.296 -19.905 62.586 1.00 96.25  ? 164  DA  J N3    1 
ATOM   3352  C C4    . DA  B 1 19  ? -106.756 -21.122 62.397 1.00 97.00  ? 164  DA  J C4    1 
ATOM   3353  P P     . DT  B 1 20  ? -101.713 -18.071 61.281 1.00 125.47 ? 165  DT  J P     1 
ATOM   3354  O OP1   . DT  B 1 20  ? -101.128 -16.774 60.863 1.00 111.41 ? 165  DT  J OP1   1 
ATOM   3355  O OP2   . DT  B 1 20  ? -100.834 -19.121 61.853 1.00 111.31 ? 165  DT  J OP2   1 
ATOM   3356  O "O5'" . DT  B 1 20  ? -102.878 -17.774 62.312 1.00 128.18 ? 165  DT  J "O5'" 1 
ATOM   3357  C "C5'" . DT  B 1 20  ? -103.922 -16.876 61.967 1.00 130.01 ? 165  DT  J "C5'" 1 
ATOM   3358  C "C4'" . DT  B 1 20  ? -104.580 -16.364 63.222 1.00 132.13 ? 165  DT  J "C4'" 1 
ATOM   3359  O "O4'" . DT  B 1 20  ? -105.408 -17.408 63.787 1.00 133.06 ? 165  DT  J "O4'" 1 
ATOM   3360  C "C3'" . DT  B 1 20  ? -103.575 -15.983 64.309 1.00 133.58 ? 165  DT  J "C3'" 1 
ATOM   3361  O "O3'" . DT  B 1 20  ? -104.023 -14.815 64.996 1.00 135.84 ? 165  DT  J "O3'" 1 
ATOM   3362  C "C2'" . DT  B 1 20  ? -103.564 -17.196 65.223 1.00 133.42 ? 165  DT  J "C2'" 1 
ATOM   3363  C "C1'" . DT  B 1 20  ? -104.995 -17.690 65.113 1.00 133.28 ? 165  DT  J "C1'" 1 
ATOM   3364  N N1    . DT  B 1 20  ? -105.188 -19.132 65.346 1.00 119.99 ? 165  DT  J N1    1 
ATOM   3365  C C2    . DT  B 1 20  ? -106.286 -19.507 66.079 1.00 119.75 ? 165  DT  J C2    1 
ATOM   3366  O O2    . DT  B 1 20  ? -107.078 -18.702 66.543 1.00 120.09 ? 165  DT  J O2    1 
ATOM   3367  N N3    . DT  B 1 20  ? -106.427 -20.861 66.251 1.00 119.30 ? 165  DT  J N3    1 
ATOM   3368  C C4    . DT  B 1 20  ? -105.596 -21.853 65.777 1.00 118.53 ? 165  DT  J C4    1 
ATOM   3369  O O4    . DT  B 1 20  ? -105.860 -23.030 66.004 1.00 117.31 ? 165  DT  J O4    1 
ATOM   3370  C C5    . DT  B 1 20  ? -104.453 -21.388 65.025 1.00 118.88 ? 165  DT  J C5    1 
ATOM   3371  C C7    . DT  B 1 20  ? -103.486 -22.392 64.482 1.00 118.74 ? 165  DT  J C7    1 
ATOM   3372  C C6    . DT  B 1 20  ? -104.309 -20.068 64.846 1.00 119.29 ? 165  DT  J C6    1 
ATOM   3373  P P     . DT  B 1 21  ? -103.210 -14.281 66.268 1.00 127.07 ? 166  DT  J P     1 
ATOM   3374  O OP1   . DT  B 1 21  ? -103.316 -12.799 66.261 1.00 136.40 ? 166  DT  J OP1   1 
ATOM   3375  O OP2   . DT  B 1 21  ? -101.870 -14.923 66.295 1.00 136.02 ? 166  DT  J OP2   1 
ATOM   3376  O "O5'" . DT  B 1 21  ? -104.054 -14.846 67.493 1.00 127.99 ? 166  DT  J "O5'" 1 
ATOM   3377  C "C5'" . DT  B 1 21  ? -105.446 -14.568 67.605 1.00 128.83 ? 166  DT  J "C5'" 1 
ATOM   3378  C "C4'" . DT  B 1 21  ? -105.988 -15.139 68.893 1.00 129.82 ? 166  DT  J "C4'" 1 
ATOM   3379  O "O4'" . DT  B 1 21  ? -106.091 -16.581 68.794 1.00 128.11 ? 166  DT  J "O4'" 1 
ATOM   3380  C "C3'" . DT  B 1 21  ? -105.129 -14.853 70.127 1.00 131.37 ? 166  DT  J "C3'" 1 
ATOM   3381  O "O3'" . DT  B 1 21  ? -105.965 -14.525 71.238 1.00 135.03 ? 166  DT  J "O3'" 1 
ATOM   3382  C "C2'" . DT  B 1 21  ? -104.424 -16.173 70.381 1.00 129.11 ? 166  DT  J "C2'" 1 
ATOM   3383  C "C1'" . DT  B 1 21  ? -105.454 -17.183 69.911 1.00 127.12 ? 166  DT  J "C1'" 1 
ATOM   3384  N N1    . DT  B 1 21  ? -104.885 -18.478 69.477 1.00 136.37 ? 166  DT  J N1    1 
ATOM   3385  C C2    . DT  B 1 21  ? -105.453 -19.636 69.960 1.00 136.41 ? 166  DT  J C2    1 
ATOM   3386  O O2    . DT  B 1 21  ? -106.412 -19.646 70.720 1.00 137.37 ? 166  DT  J O2    1 
ATOM   3387  N N3    . DT  B 1 21  ? -104.853 -20.793 69.519 1.00 136.07 ? 166  DT  J N3    1 
ATOM   3388  C C4    . DT  B 1 21  ? -103.771 -20.900 68.667 1.00 136.32 ? 166  DT  J C4    1 
ATOM   3389  O O4    . DT  B 1 21  ? -103.339 -22.003 68.363 1.00 136.30 ? 166  DT  J O4    1 
ATOM   3390  C C5    . DT  B 1 21  ? -103.231 -19.652 68.199 1.00 136.62 ? 166  DT  J C5    1 
ATOM   3391  C C7    . DT  B 1 21  ? -102.055 -19.674 67.276 1.00 135.81 ? 166  DT  J C7    1 
ATOM   3392  C C6    . DT  B 1 21  ? -103.808 -18.518 68.617 1.00 136.83 ? 166  DT  J C6    1 
ATOM   3393  P P     . DC  B 1 22  ? -105.308 -14.022 72.615 1.00 145.75 ? 167  DC  J P     1 
ATOM   3394  O OP1   . DC  B 1 22  ? -105.707 -12.605 72.811 1.00 175.69 ? 167  DC  J OP1   1 
ATOM   3395  O OP2   . DC  B 1 22  ? -103.870 -14.388 72.643 1.00 176.06 ? 167  DC  J OP2   1 
ATOM   3396  O "O5'" . DC  B 1 22  ? -106.065 -14.909 73.694 1.00 146.85 ? 167  DC  J "O5'" 1 
ATOM   3397  C "C5'" . DC  B 1 22  ? -107.421 -15.291 73.486 1.00 149.26 ? 167  DC  J "C5'" 1 
ATOM   3398  C "C4'" . DC  B 1 22  ? -107.725 -16.560 74.245 1.00 151.39 ? 167  DC  J "C4'" 1 
ATOM   3399  O "O4'" . DC  B 1 22  ? -107.090 -17.696 73.609 1.00 151.69 ? 167  DC  J "O4'" 1 
ATOM   3400  C "C3'" . DC  B 1 22  ? -107.224 -16.547 75.689 1.00 152.77 ? 167  DC  J "C3'" 1 
ATOM   3401  O "O3'" . DC  B 1 22  ? -108.183 -17.174 76.537 1.00 153.66 ? 167  DC  J "O3'" 1 
ATOM   3402  C "C2'" . DC  B 1 22  ? -105.959 -17.382 75.628 1.00 153.42 ? 167  DC  J "C2'" 1 
ATOM   3403  C "C1'" . DC  B 1 22  ? -106.322 -18.404 74.569 1.00 153.74 ? 167  DC  J "C1'" 1 
ATOM   3404  N N1    . DC  B 1 22  ? -105.172 -19.019 73.884 1.00 185.65 ? 167  DC  J N1    1 
ATOM   3405  C C2    . DC  B 1 22  ? -105.108 -20.415 73.808 1.00 186.24 ? 167  DC  J C2    1 
ATOM   3406  O O2    . DC  B 1 22  ? -106.022 -21.085 74.312 1.00 186.12 ? 167  DC  J O2    1 
ATOM   3407  N N3    . DC  B 1 22  ? -104.052 -20.997 73.192 1.00 186.66 ? 167  DC  J N3    1 
ATOM   3408  C C4    . DC  B 1 22  ? -103.088 -20.240 72.661 1.00 186.88 ? 167  DC  J C4    1 
ATOM   3409  N N4    . DC  B 1 22  ? -102.065 -20.859 72.063 1.00 186.85 ? 167  DC  J N4    1 
ATOM   3410  C C5    . DC  B 1 22  ? -103.130 -18.815 72.721 1.00 186.55 ? 167  DC  J C5    1 
ATOM   3411  C C6    . DC  B 1 22  ? -104.182 -18.251 73.335 1.00 185.96 ? 167  DC  J C6    1 
ATOM   3412  P P     . DT  B 1 23  ? -107.974 -17.145 78.125 1.00 145.24 ? 168  DT  J P     1 
ATOM   3413  O OP1   . DT  B 1 23  ? -109.330 -17.267 78.729 1.00 117.06 ? 168  DT  J OP1   1 
ATOM   3414  O OP2   . DT  B 1 23  ? -107.112 -15.977 78.464 1.00 116.45 ? 168  DT  J OP2   1 
ATOM   3415  O "O5'" . DT  B 1 23  ? -107.162 -18.484 78.422 1.00 145.01 ? 168  DT  J "O5'" 1 
ATOM   3416  C "C5'" . DT  B 1 23  ? -107.823 -19.748 78.443 1.00 146.93 ? 168  DT  J "C5'" 1 
ATOM   3417  C "C4'" . DT  B 1 23  ? -106.929 -20.796 79.064 1.00 149.71 ? 168  DT  J "C4'" 1 
ATOM   3418  O "O4'" . DT  B 1 23  ? -105.914 -21.230 78.123 1.00 148.74 ? 168  DT  J "O4'" 1 
ATOM   3419  C "C3'" . DT  B 1 23  ? -106.179 -20.328 80.313 1.00 152.72 ? 168  DT  J "C3'" 1 
ATOM   3420  O "O3'" . DT  B 1 23  ? -106.140 -21.379 81.284 1.00 157.51 ? 168  DT  J "O3'" 1 
ATOM   3421  C "C2'" . DT  B 1 23  ? -104.775 -20.071 79.794 1.00 151.88 ? 168  DT  J "C2'" 1 
ATOM   3422  C "C1'" . DT  B 1 23  ? -104.642 -21.162 78.748 1.00 150.14 ? 168  DT  J "C1'" 1 
ATOM   3423  N N1    . DT  B 1 23  ? -103.616 -20.941 77.700 1.00 121.50 ? 168  DT  J N1    1 
ATOM   3424  C C2    . DT  B 1 23  ? -103.056 -22.055 77.106 1.00 120.93 ? 168  DT  J C2    1 
ATOM   3425  O O2    . DT  B 1 23  ? -103.362 -23.199 77.409 1.00 119.48 ? 168  DT  J O2    1 
ATOM   3426  N N3    . DT  B 1 23  ? -102.116 -21.778 76.137 1.00 120.70 ? 168  DT  J N3    1 
ATOM   3427  C C4    . DT  B 1 23  ? -101.685 -20.531 75.716 1.00 120.83 ? 168  DT  J C4    1 
ATOM   3428  O O4    . DT  B 1 23  ? -100.836 -20.442 74.827 1.00 119.74 ? 168  DT  J O4    1 
ATOM   3429  C C5    . DT  B 1 23  ? -102.307 -19.407 76.389 1.00 121.05 ? 168  DT  J C5    1 
ATOM   3430  C C7    . DT  B 1 23  ? -101.897 -18.017 76.011 1.00 120.25 ? 168  DT  J C7    1 
ATOM   3431  C C6    . DT  B 1 23  ? -103.229 -19.666 77.332 1.00 121.44 ? 168  DT  J C6    1 
ATOM   3432  P P     . DA  B 1 24  ? -106.387 -21.044 82.837 1.00 151.97 ? 169  DA  J P     1 
ATOM   3433  O OP1   . DA  B 1 24  ? -107.841 -21.214 83.100 1.00 142.27 ? 169  DA  J OP1   1 
ATOM   3434  O OP2   . DA  B 1 24  ? -105.728 -19.751 83.166 1.00 142.29 ? 169  DA  J OP2   1 
ATOM   3435  O "O5'" . DA  B 1 24  ? -105.606 -22.208 83.591 1.00 153.79 ? 169  DA  J "O5'" 1 
ATOM   3436  C "C5'" . DA  B 1 24  ? -105.800 -23.569 83.226 1.00 156.88 ? 169  DA  J "C5'" 1 
ATOM   3437  C "C4'" . DA  B 1 24  ? -104.467 -24.272 83.124 1.00 159.06 ? 169  DA  J "C4'" 1 
ATOM   3438  O "O4'" . DA  B 1 24  ? -103.748 -23.806 81.954 1.00 159.27 ? 169  DA  J "O4'" 1 
ATOM   3439  C "C3'" . DA  B 1 24  ? -103.537 -24.032 84.315 1.00 159.90 ? 169  DA  J "C3'" 1 
ATOM   3440  O "O3'" . DA  B 1 24  ? -102.832 -25.233 84.638 1.00 160.75 ? 169  DA  J "O3'" 1 
ATOM   3441  C "C2'" . DA  B 1 24  ? -102.560 -22.998 83.790 1.00 160.55 ? 169  DA  J "C2'" 1 
ATOM   3442  C "C1'" . DA  B 1 24  ? -102.438 -23.420 82.339 1.00 160.37 ? 169  DA  J "C1'" 1 
ATOM   3443  N N9    . DA  B 1 24  ? -101.972 -22.372 81.428 1.00 150.77 ? 169  DA  J N9    1 
ATOM   3444  C C8    . DA  B 1 24  ? -102.196 -21.019 81.510 1.00 150.81 ? 169  DA  J C8    1 
ATOM   3445  N N7    . DA  B 1 24  ? -101.620 -20.328 80.556 1.00 150.56 ? 169  DA  J N7    1 
ATOM   3446  C C5    . DA  B 1 24  ? -100.976 -21.289 79.790 1.00 150.60 ? 169  DA  J C5    1 
ATOM   3447  C C6    . DA  B 1 24  ? -100.178 -21.198 78.638 1.00 150.55 ? 169  DA  J C6    1 
ATOM   3448  N N6    . DA  B 1 24  ? -99.877  -20.047 78.035 1.00 150.64 ? 169  DA  J N6    1 
ATOM   3449  N N1    . DA  B 1 24  ? -99.690  -22.346 78.122 1.00 150.85 ? 169  DA  J N1    1 
ATOM   3450  C C2    . DA  B 1 24  ? -99.986  -23.500 78.733 1.00 151.05 ? 169  DA  J C2    1 
ATOM   3451  N N3    . DA  B 1 24  ? -100.719 -23.713 79.823 1.00 151.09 ? 169  DA  J N3    1 
ATOM   3452  C C4    . DA  B 1 24  ? -101.191 -22.553 80.310 1.00 150.92 ? 169  DA  J C4    1 
ATOM   3453  P P     . DC  B 1 25  ? -102.321 -25.477 86.141 1.00 140.72 ? 170  DC  J P     1 
ATOM   3454  O OP1   . DC  B 1 25  ? -103.431 -25.100 87.049 1.00 145.61 ? 170  DC  J OP1   1 
ATOM   3455  O OP2   . DC  B 1 25  ? -100.990 -24.842 86.313 1.00 143.93 ? 170  DC  J OP2   1 
ATOM   3456  O "O5'" . DC  B 1 25  ? -102.137 -27.055 86.219 1.00 139.74 ? 170  DC  J "O5'" 1 
ATOM   3457  C "C5'" . DC  B 1 25  ? -100.877 -27.626 86.548 1.00 139.29 ? 170  DC  J "C5'" 1 
ATOM   3458  C "C4'" . DC  B 1 25  ? -100.346 -28.415 85.375 1.00 139.14 ? 170  DC  J "C4'" 1 
ATOM   3459  O "O4'" . DC  B 1 25  ? -100.305 -27.554 84.209 1.00 138.61 ? 170  DC  J "O4'" 1 
ATOM   3460  C "C3'" . DC  B 1 25  ? -98.922  -28.934 85.564 1.00 139.80 ? 170  DC  J "C3'" 1 
ATOM   3461  O "O3'" . DC  B 1 25  ? -98.769  -30.204 84.926 1.00 141.38 ? 170  DC  J "O3'" 1 
ATOM   3462  C "C2'" . DC  B 1 25  ? -98.074  -27.884 84.874 1.00 139.11 ? 170  DC  J "C2'" 1 
ATOM   3463  C "C1'" . DC  B 1 25  ? -98.969  -27.433 83.735 1.00 138.67 ? 170  DC  J "C1'" 1 
ATOM   3464  N N1    . DC  B 1 25  ? -98.749  -26.032 83.348 1.00 141.61 ? 170  DC  J N1    1 
ATOM   3465  C C2    . DC  B 1 25  ? -97.670  -25.731 82.525 1.00 141.54 ? 170  DC  J C2    1 
ATOM   3466  O O2    . DC  B 1 25  ? -96.948  -26.656 82.129 1.00 141.74 ? 170  DC  J O2    1 
ATOM   3467  N N3    . DC  B 1 25  ? -97.438  -24.445 82.180 1.00 140.87 ? 170  DC  J N3    1 
ATOM   3468  C C4    . DC  B 1 25  ? -98.245  -23.481 82.626 1.00 140.14 ? 170  DC  J C4    1 
ATOM   3469  N N4    . DC  B 1 25  ? -97.977  -22.226 82.269 1.00 139.47 ? 170  DC  J N4    1 
ATOM   3470  C C5    . DC  B 1 25  ? -99.361  -23.762 83.458 1.00 140.20 ? 170  DC  J C5    1 
ATOM   3471  C C6    . DC  B 1 25  ? -99.576  -25.039 83.791 1.00 141.03 ? 170  DC  J C6    1 
ATOM   3472  P P     . DC  B 1 26  ? -97.341  -30.937 84.952 1.00 137.46 ? 171  DC  J P     1 
ATOM   3473  O OP1   . DC  B 1 26  ? -97.464  -32.204 84.183 1.00 128.67 ? 171  DC  J OP1   1 
ATOM   3474  O OP2   . DC  B 1 26  ? -96.863  -30.977 86.357 1.00 129.72 ? 171  DC  J OP2   1 
ATOM   3475  O "O5'" . DC  B 1 26  ? -96.399  -29.949 84.133 1.00 135.77 ? 171  DC  J "O5'" 1 
ATOM   3476  C "C5'" . DC  B 1 26  ? -95.851  -30.336 82.879 1.00 132.43 ? 171  DC  J "C5'" 1 
ATOM   3477  C "C4'" . DC  B 1 26  ? -94.447  -29.800 82.747 1.00 130.04 ? 171  DC  J "C4'" 1 
ATOM   3478  O "O4'" . DC  B 1 26  ? -94.490  -28.365 82.586 1.00 130.89 ? 171  DC  J "O4'" 1 
ATOM   3479  C "C3'" . DC  B 1 26  ? -93.556  -30.066 83.960 1.00 127.91 ? 171  DC  J "C3'" 1 
ATOM   3480  O "O3'" . DC  B 1 26  ? -92.240  -30.377 83.514 1.00 123.65 ? 171  DC  J "O3'" 1 
ATOM   3481  C "C2'" . DC  B 1 26  ? -93.569  -28.741 84.705 1.00 128.93 ? 171  DC  J "C2'" 1 
ATOM   3482  C "C1'" . DC  B 1 26  ? -93.697  -27.735 83.577 1.00 130.62 ? 171  DC  J "C1'" 1 
ATOM   3483  N N1    . DC  B 1 26  ? -94.344  -26.452 83.917 1.00 122.87 ? 171  DC  J N1    1 
ATOM   3484  C C2    . DC  B 1 26  ? -94.076  -25.348 83.112 1.00 123.43 ? 171  DC  J C2    1 
ATOM   3485  O O2    . DC  B 1 26  ? -93.307  -25.485 82.160 1.00 123.79 ? 171  DC  J O2    1 
ATOM   3486  N N3    . DC  B 1 26  ? -94.661  -24.164 83.389 1.00 123.61 ? 171  DC  J N3    1 
ATOM   3487  C C4    . DC  B 1 26  ? -95.490  -24.058 84.424 1.00 123.26 ? 171  DC  J C4    1 
ATOM   3488  N N4    . DC  B 1 26  ? -96.048  -22.870 84.651 1.00 123.72 ? 171  DC  J N4    1 
ATOM   3489  C C5    . DC  B 1 26  ? -95.784  -25.166 85.269 1.00 123.57 ? 171  DC  J C5    1 
ATOM   3490  C C6    . DC  B 1 26  ? -95.192  -26.335 84.983 1.00 123.39 ? 171  DC  J C6    1 
ATOM   3491  P P     . DA  B 1 27  ? -91.875  -31.891 83.120 1.00 145.52 ? 172  DA  J P     1 
ATOM   3492  O OP1   . DA  B 1 27  ? -93.075  -32.495 82.489 1.00 115.93 ? 172  DA  J OP1   1 
ATOM   3493  O OP2   . DA  B 1 27  ? -91.261  -32.547 84.298 1.00 116.86 ? 172  DA  J OP2   1 
ATOM   3494  O "O5'" . DA  B 1 27  ? -90.751  -31.715 82.005 1.00 144.02 ? 172  DA  J "O5'" 1 
ATOM   3495  C "C5'" . DA  B 1 27  ? -91.110  -31.418 80.656 1.00 140.06 ? 172  DA  J "C5'" 1 
ATOM   3496  C "C4'" . DA  B 1 27  ? -90.145  -30.430 80.038 1.00 137.17 ? 172  DA  J "C4'" 1 
ATOM   3497  O "O4'" . DA  B 1 27  ? -90.269  -29.135 80.666 1.00 135.53 ? 172  DA  J "O4'" 1 
ATOM   3498  C "C3'" . DA  B 1 27  ? -88.662  -30.786 80.088 1.00 135.18 ? 172  DA  J "C3'" 1 
ATOM   3499  O "O3'" . DA  B 1 27  ? -88.068  -30.377 78.854 1.00 133.28 ? 172  DA  J "O3'" 1 
ATOM   3500  C "C2'" . DA  B 1 27  ? -88.146  -29.977 81.266 1.00 133.80 ? 172  DA  J "C2'" 1 
ATOM   3501  C "C1'" . DA  B 1 27  ? -89.043  -28.744 81.271 1.00 133.50 ? 172  DA  J "C1'" 1 
ATOM   3502  N N9    . DA  B 1 27  ? -89.378  -28.239 82.602 1.00 103.10 ? 172  DA  J N9    1 
ATOM   3503  C C8    . DA  B 1 27  ? -89.299  -28.890 83.809 1.00 102.34 ? 172  DA  J C8    1 
ATOM   3504  N N7    . DA  B 1 27  ? -89.754  -28.188 84.818 1.00 101.72 ? 172  DA  J N7    1 
ATOM   3505  C C5    . DA  B 1 27  ? -90.142  -26.989 84.240 1.00 101.18 ? 172  DA  J C5    1 
ATOM   3506  C C6    . DA  B 1 27  ? -90.708  -25.824 84.773 1.00 100.84 ? 172  DA  J C6    1 
ATOM   3507  N N6    . DA  B 1 27  ? -90.999  -25.668 86.063 1.00 100.99 ? 172  DA  J N6    1 
ATOM   3508  N N1    . DA  B 1 27  ? -90.968  -24.807 83.925 1.00 100.79 ? 172  DA  J N1    1 
ATOM   3509  C C2    . DA  B 1 27  ? -90.670  -24.961 82.633 1.00 101.96 ? 172  DA  J C2    1 
ATOM   3510  N N3    . DA  B 1 27  ? -90.138  -26.005 82.011 1.00 102.71 ? 172  DA  J N3    1 
ATOM   3511  C C4    . DA  B 1 27  ? -89.897  -26.999 82.881 1.00 102.10 ? 172  DA  J C4    1 
ATOM   3512  P P     . DA  B 1 28  ? -86.531  -30.708 78.551 1.00 104.81 ? 173  DA  J P     1 
ATOM   3513  O OP1   . DA  B 1 28  ? -86.477  -31.275 77.182 1.00 124.14 ? 173  DA  J OP1   1 
ATOM   3514  O OP2   . DA  B 1 28  ? -85.946  -31.459 79.687 1.00 125.79 ? 173  DA  J OP2   1 
ATOM   3515  O "O5'" . DA  B 1 28  ? -85.877  -29.264 78.505 1.00 102.57 ? 173  DA  J "O5'" 1 
ATOM   3516  C "C5'" . DA  B 1 28  ? -86.574  -28.202 77.866 1.00 99.15  ? 173  DA  J "C5'" 1 
ATOM   3517  C "C4'" . DA  B 1 28  ? -86.147  -26.875 78.440 1.00 97.05  ? 173  DA  J "C4'" 1 
ATOM   3518  O "O4'" . DA  B 1 28  ? -86.661  -26.686 79.781 1.00 95.17  ? 173  DA  J "O4'" 1 
ATOM   3519  C "C3'" . DA  B 1 28  ? -84.635  -26.709 78.543 1.00 95.95  ? 173  DA  J "C3'" 1 
ATOM   3520  O "O3'" . DA  B 1 28  ? -84.315  -25.364 78.229 1.00 95.57  ? 173  DA  J "O3'" 1 
ATOM   3521  C "C2'" . DA  B 1 28  ? -84.363  -26.945 80.014 1.00 95.61  ? 173  DA  J "C2'" 1 
ATOM   3522  C "C1'" . DA  B 1 28  ? -85.590  -26.307 80.628 1.00 94.91  ? 173  DA  J "C1'" 1 
ATOM   3523  N N9    . DA  B 1 28  ? -85.900  -26.750 81.983 1.00 114.96 ? 173  DA  J N9    1 
ATOM   3524  C C8    . DA  B 1 28  ? -85.584  -27.943 82.583 1.00 114.51 ? 173  DA  J C8    1 
ATOM   3525  N N7    . DA  B 1 28  ? -85.985  -28.030 83.826 1.00 113.98 ? 173  DA  J N7    1 
ATOM   3526  C C5    . DA  B 1 28  ? -86.610  -26.812 84.059 1.00 114.15 ? 173  DA  J C5    1 
ATOM   3527  C C6    . DA  B 1 28  ? -87.243  -26.275 85.192 1.00 114.11 ? 173  DA  J C6    1 
ATOM   3528  N N6    . DA  B 1 28  ? -87.348  -26.922 86.357 1.00 114.90 ? 173  DA  J N6    1 
ATOM   3529  N N1    . DA  B 1 28  ? -87.770  -25.034 85.088 1.00 113.66 ? 173  DA  J N1    1 
ATOM   3530  C C2    . DA  B 1 28  ? -87.660  -24.387 83.922 1.00 112.91 ? 173  DA  J C2    1 
ATOM   3531  N N3    . DA  B 1 28  ? -87.083  -24.785 82.792 1.00 114.01 ? 173  DA  J N3    1 
ATOM   3532  C C4    . DA  B 1 28  ? -86.571  -26.019 82.929 1.00 114.51 ? 173  DA  J C4    1 
ATOM   3533  P P     . DA  B 1 29  ? -82.978  -25.042 77.425 1.00 100.72 ? 174  DA  J P     1 
ATOM   3534  O OP1   . DA  B 1 29  ? -83.294  -25.238 75.986 1.00 112.23 ? 174  DA  J OP1   1 
ATOM   3535  O OP2   . DA  B 1 29  ? -81.859  -25.801 78.044 1.00 112.14 ? 174  DA  J OP2   1 
ATOM   3536  O "O5'" . DA  B 1 29  ? -82.780  -23.490 77.708 1.00 98.70  ? 174  DA  J "O5'" 1 
ATOM   3537  C "C5'" . DA  B 1 29  ? -83.838  -22.573 77.458 1.00 96.46  ? 174  DA  J "C5'" 1 
ATOM   3538  C "C4'" . DA  B 1 29  ? -83.848  -21.492 78.510 1.00 96.38  ? 174  DA  J "C4'" 1 
ATOM   3539  O "O4'" . DA  B 1 29  ? -84.203  -22.065 79.792 1.00 95.70  ? 174  DA  J "O4'" 1 
ATOM   3540  C "C3'" . DA  B 1 29  ? -82.507  -20.790 78.720 1.00 97.32  ? 174  DA  J "C3'" 1 
ATOM   3541  O "O3'" . DA  B 1 29  ? -82.739  -19.407 78.975 1.00 98.32  ? 174  DA  J "O3'" 1 
ATOM   3542  C "C2'" . DA  B 1 29  ? -81.946  -21.464 79.958 1.00 96.06  ? 174  DA  J "C2'" 1 
ATOM   3543  C "C1'" . DA  B 1 29  ? -83.207  -21.749 80.751 1.00 95.29  ? 174  DA  J "C1'" 1 
ATOM   3544  N N9    . DA  B 1 29  ? -83.114  -22.870 81.686 1.00 106.64 ? 174  DA  J N9    1 
ATOM   3545  C C8    . DA  B 1 29  ? -82.331  -23.997 81.607 1.00 106.67 ? 174  DA  J C8    1 
ATOM   3546  N N7    . DA  B 1 29  ? -82.479  -24.817 82.619 1.00 107.81 ? 174  DA  J N7    1 
ATOM   3547  C C5    . DA  B 1 29  ? -83.425  -24.189 83.416 1.00 108.01 ? 174  DA  J C5    1 
ATOM   3548  C C6    . DA  B 1 29  ? -84.016  -24.544 84.639 1.00 107.53 ? 174  DA  J C6    1 
ATOM   3549  N N6    . DA  B 1 29  ? -83.728  -25.664 85.302 1.00 106.49 ? 174  DA  J N6    1 
ATOM   3550  N N1    . DA  B 1 29  ? -84.923  -23.694 85.166 1.00 107.54 ? 174  DA  J N1    1 
ATOM   3551  C C2    . DA  B 1 29  ? -85.204  -22.563 84.506 1.00 107.54 ? 174  DA  J C2    1 
ATOM   3552  N N3    . DA  B 1 29  ? -84.717  -22.119 83.353 1.00 107.54 ? 174  DA  J N3    1 
ATOM   3553  C C4    . DA  B 1 29  ? -83.823  -22.989 82.854 1.00 107.62 ? 174  DA  J C4    1 
ATOM   3554  P P     . DA  B 1 30  ? -81.496  -18.411 79.146 1.00 106.45 ? 175  DA  J P     1 
ATOM   3555  O OP1   . DA  B 1 30  ? -81.777  -17.222 78.301 1.00 105.17 ? 175  DA  J OP1   1 
ATOM   3556  O OP2   . DA  B 1 30  ? -80.227  -19.160 78.963 1.00 105.08 ? 175  DA  J OP2   1 
ATOM   3557  O "O5'" . DA  B 1 30  ? -81.596  -17.966 80.668 1.00 108.59 ? 175  DA  J "O5'" 1 
ATOM   3558  C "C5'" . DA  B 1 30  ? -82.705  -17.200 81.124 1.00 110.62 ? 175  DA  J "C5'" 1 
ATOM   3559  C "C4'" . DA  B 1 30  ? -82.572  -16.918 82.601 1.00 112.68 ? 175  DA  J "C4'" 1 
ATOM   3560  O "O4'" . DA  B 1 30  ? -82.644  -18.166 83.328 1.00 111.30 ? 175  DA  J "O4'" 1 
ATOM   3561  C "C3'" . DA  B 1 30  ? -81.254  -16.261 83.016 1.00 114.72 ? 175  DA  J "C3'" 1 
ATOM   3562  O "O3'" . DA  B 1 30  ? -81.504  -15.276 84.023 1.00 119.31 ? 175  DA  J "O3'" 1 
ATOM   3563  C "C2'" . DA  B 1 30  ? -80.433  -17.417 83.562 1.00 113.12 ? 175  DA  J "C2'" 1 
ATOM   3564  C "C1'" . DA  B 1 30  ? -81.497  -18.322 84.150 1.00 111.12 ? 175  DA  J "C1'" 1 
ATOM   3565  N N9    . DA  B 1 30  ? -81.154  -19.742 84.169 1.00 108.73 ? 175  DA  J N9    1 
ATOM   3566  C C8    . DA  B 1 30  ? -80.584  -20.496 83.176 1.00 108.00 ? 175  DA  J C8    1 
ATOM   3567  N N7    . DA  B 1 30  ? -80.426  -21.757 83.495 1.00 107.73 ? 175  DA  J N7    1 
ATOM   3568  C C5    . DA  B 1 30  ? -80.921  -21.837 84.787 1.00 107.45 ? 175  DA  J C5    1 
ATOM   3569  C C6    . DA  B 1 30  ? -81.043  -22.908 85.692 1.00 107.14 ? 175  DA  J C6    1 
ATOM   3570  N N6    . DA  B 1 30  ? -80.670  -24.160 85.416 1.00 106.73 ? 175  DA  J N6    1 
ATOM   3571  N N1    . DA  B 1 30  ? -81.571  -22.645 86.908 1.00 106.76 ? 175  DA  J N1    1 
ATOM   3572  C C2    . DA  B 1 30  ? -81.955  -21.392 87.182 1.00 106.51 ? 175  DA  J C2    1 
ATOM   3573  N N3    . DA  B 1 30  ? -81.898  -20.307 86.414 1.00 107.59 ? 175  DA  J N3    1 
ATOM   3574  C C4    . DA  B 1 30  ? -81.366  -20.602 85.216 1.00 107.86 ? 175  DA  J C4    1 
ATOM   3575  P P     . DG  B 1 31  ? -80.273  -14.556 84.760 1.00 123.28 ? 176  DG  J P     1 
ATOM   3576  O OP1   . DG  B 1 31  ? -80.743  -13.203 85.157 1.00 137.97 ? 176  DG  J OP1   1 
ATOM   3577  O OP2   . DG  B 1 31  ? -79.054  -14.694 83.928 1.00 138.80 ? 176  DG  J OP2   1 
ATOM   3578  O "O5'" . DG  B 1 31  ? -80.069  -15.435 86.070 1.00 125.48 ? 176  DG  J "O5'" 1 
ATOM   3579  C "C5'" . DG  B 1 31  ? -81.032  -15.408 87.121 1.00 129.13 ? 176  DG  J "C5'" 1 
ATOM   3580  C "C4'" . DG  B 1 31  ? -80.423  -15.941 88.395 1.00 131.68 ? 176  DG  J "C4'" 1 
ATOM   3581  O "O4'" . DG  B 1 31  ? -80.411  -17.389 88.388 1.00 132.21 ? 176  DG  J "O4'" 1 
ATOM   3582  C "C3'" . DG  B 1 31  ? -78.975  -15.503 88.611 1.00 133.92 ? 176  DG  J "C3'" 1 
ATOM   3583  O "O3'" . DG  B 1 31  ? -78.760  -15.145 89.973 1.00 137.68 ? 176  DG  J "O3'" 1 
ATOM   3584  C "C2'" . DG  B 1 31  ? -78.171  -16.742 88.262 1.00 133.39 ? 176  DG  J "C2'" 1 
ATOM   3585  C "C1'" . DG  B 1 31  ? -79.107  -17.856 88.688 1.00 132.72 ? 176  DG  J "C1'" 1 
ATOM   3586  N N9    . DG  B 1 31  ? -78.909  -19.113 87.979 1.00 148.36 ? 176  DG  J N9    1 
ATOM   3587  C C8    . DG  B 1 31  ? -78.835  -19.293 86.620 1.00 148.19 ? 176  DG  J C8    1 
ATOM   3588  N N7    . DG  B 1 31  ? -78.656  -20.539 86.278 1.00 149.04 ? 176  DG  J N7    1 
ATOM   3589  C C5    . DG  B 1 31  ? -78.609  -21.224 87.485 1.00 149.33 ? 176  DG  J C5    1 
ATOM   3590  C C6    . DG  B 1 31  ? -78.436  -22.608 87.752 1.00 149.45 ? 176  DG  J C6    1 
ATOM   3591  O O6    . DG  B 1 31  ? -78.287  -23.535 86.950 1.00 148.63 ? 176  DG  J O6    1 
ATOM   3592  N N1    . DG  B 1 31  ? -78.451  -22.872 89.116 1.00 150.25 ? 176  DG  J N1    1 
ATOM   3593  C C2    . DG  B 1 31  ? -78.610  -21.930 90.099 1.00 150.96 ? 176  DG  J C2    1 
ATOM   3594  N N2    . DG  B 1 31  ? -78.594  -22.388 91.361 1.00 151.38 ? 176  DG  J N2    1 
ATOM   3595  N N3    . DG  B 1 31  ? -78.772  -20.636 89.865 1.00 150.52 ? 176  DG  J N3    1 
ATOM   3596  C C4    . DG  B 1 31  ? -78.762  -20.358 88.544 1.00 149.33 ? 176  DG  J C4    1 
ATOM   3597  P P     . DT  B 1 32  ? -77.569  -14.138 90.344 1.00 149.90 ? 177  DT  J P     1 
ATOM   3598  O OP1   . DT  B 1 32  ? -78.185  -12.932 90.949 1.00 168.31 ? 177  DT  J OP1   1 
ATOM   3599  O OP2   . DT  B 1 32  ? -76.680  -13.995 89.164 1.00 168.26 ? 177  DT  J OP2   1 
ATOM   3600  O "O5'" . DT  B 1 32  ? -76.776  -14.928 91.469 1.00 152.68 ? 177  DT  J "O5'" 1 
ATOM   3601  C "C5'" . DT  B 1 32  ? -77.457  -15.426 92.610 1.00 157.51 ? 177  DT  J "C5'" 1 
ATOM   3602  C "C4'" . DT  B 1 32  ? -76.582  -16.412 93.342 1.00 160.87 ? 177  DT  J "C4'" 1 
ATOM   3603  O "O4'" . DT  B 1 32  ? -76.623  -17.712 92.702 1.00 161.24 ? 177  DT  J "O4'" 1 
ATOM   3604  C "C3'" . DT  B 1 32  ? -75.110  -16.005 93.392 1.00 162.66 ? 177  DT  J "C3'" 1 
ATOM   3605  O "O3'" . DT  B 1 32  ? -74.589  -16.247 94.698 1.00 165.15 ? 177  DT  J "O3'" 1 
ATOM   3606  C "C2'" . DT  B 1 32  ? -74.455  -16.919 92.369 1.00 162.45 ? 177  DT  J "C2'" 1 
ATOM   3607  C "C1'" . DT  B 1 32  ? -75.299  -18.173 92.492 1.00 161.38 ? 177  DT  J "C1'" 1 
ATOM   3608  N N1    . DT  B 1 32  ? -75.300  -19.059 91.309 1.00 179.18 ? 177  DT  J N1    1 
ATOM   3609  C C2    . DT  B 1 32  ? -75.143  -20.411 91.524 1.00 178.67 ? 177  DT  J C2    1 
ATOM   3610  O O2    . DT  B 1 32  ? -75.003  -20.896 92.634 1.00 179.30 ? 177  DT  J O2    1 
ATOM   3611  N N3    . DT  B 1 32  ? -75.154  -21.178 90.385 1.00 177.88 ? 177  DT  J N3    1 
ATOM   3612  C C4    . DT  B 1 32  ? -75.301  -20.739 89.085 1.00 177.67 ? 177  DT  J C4    1 
ATOM   3613  O O4    . DT  B 1 32  ? -75.292  -21.548 88.164 1.00 176.27 ? 177  DT  J O4    1 
ATOM   3614  C C5    . DT  B 1 32  ? -75.459  -19.311 88.931 1.00 177.89 ? 177  DT  J C5    1 
ATOM   3615  C C7    . DT  B 1 32  ? -75.619  -18.745 87.556 1.00 178.06 ? 177  DT  J C7    1 
ATOM   3616  C C6    . DT  B 1 32  ? -75.452  -18.552 90.036 1.00 178.63 ? 177  DT  J C6    1 
ATOM   3617  P P     . DG  B 1 33  ? -73.025  -16.042 94.978 1.00 135.02 ? 178  DG  J P     1 
ATOM   3618  O OP1   . DG  B 1 33  ? -72.886  -15.432 96.324 1.00 160.00 ? 178  DG  J OP1   1 
ATOM   3619  O OP2   . DG  B 1 33  ? -72.405  -15.375 93.802 1.00 159.79 ? 178  DG  J OP2   1 
ATOM   3620  O "O5'" . DG  B 1 33  ? -72.490  -17.536 95.057 1.00 136.09 ? 178  DG  J "O5'" 1 
ATOM   3621  C "C5'" . DG  B 1 33  ? -73.025  -18.448 96.009 1.00 138.43 ? 178  DG  J "C5'" 1 
ATOM   3622  C "C4'" . DG  B 1 33  ? -72.224  -19.724 95.988 1.00 140.07 ? 178  DG  J "C4'" 1 
ATOM   3623  O "O4'" . DG  B 1 33  ? -72.496  -20.421 94.747 1.00 140.83 ? 178  DG  J "O4'" 1 
ATOM   3624  C "C3'" . DG  B 1 33  ? -70.714  -19.481 96.016 1.00 140.86 ? 178  DG  J "C3'" 1 
ATOM   3625  O "O3'" . DG  B 1 33  ? -70.054  -20.490 96.788 1.00 141.32 ? 178  DG  J "O3'" 1 
ATOM   3626  C "C2'" . DG  B 1 33  ? -70.318  -19.586 94.555 1.00 141.88 ? 178  DG  J "C2'" 1 
ATOM   3627  C "C1'" . DG  B 1 33  ? -71.279  -20.645 94.050 1.00 142.42 ? 178  DG  J "C1'" 1 
ATOM   3628  N N9    . DG  B 1 33  ? -71.552  -20.583 92.617 1.00 168.80 ? 178  DG  J N9    1 
ATOM   3629  C C8    . DG  B 1 33  ? -71.898  -19.475 91.880 1.00 169.11 ? 178  DG  J C8    1 
ATOM   3630  N N7    . DG  B 1 33  ? -72.075  -19.736 90.613 1.00 169.55 ? 178  DG  J N7    1 
ATOM   3631  C C5    . DG  B 1 33  ? -71.832  -21.099 90.506 1.00 170.03 ? 178  DG  J C5    1 
ATOM   3632  C C6    . DG  B 1 33  ? -71.874  -21.954 89.375 1.00 170.52 ? 178  DG  J C6    1 
ATOM   3633  O O6    . DG  B 1 33  ? -72.150  -21.669 88.204 1.00 170.75 ? 178  DG  J O6    1 
ATOM   3634  N N1    . DG  B 1 33  ? -71.555  -23.265 89.713 1.00 170.90 ? 178  DG  J N1    1 
ATOM   3635  C C2    . DG  B 1 33  ? -71.240  -23.701 90.976 1.00 171.07 ? 178  DG  J C2    1 
ATOM   3636  N N2    . DG  B 1 33  ? -70.961  -25.006 91.098 1.00 171.56 ? 178  DG  J N2    1 
ATOM   3637  N N3    . DG  B 1 33  ? -71.202  -22.916 92.040 1.00 170.93 ? 178  DG  J N3    1 
ATOM   3638  C C4    . DG  B 1 33  ? -71.506  -21.636 91.733 1.00 169.79 ? 178  DG  J C4    1 
ATOM   3639  P P     . DT  B 1 34  ? -68.445  -20.508 96.875 1.00 159.95 ? 179  DT  J P     1 
ATOM   3640  O OP1   . DT  B 1 34  ? -68.082  -20.836 98.281 1.00 130.03 ? 179  DT  J OP1   1 
ATOM   3641  O OP2   . DT  B 1 34  ? -67.905  -19.271 96.245 1.00 129.66 ? 179  DT  J OP2   1 
ATOM   3642  O "O5'" . DT  B 1 34  ? -68.040  -21.750 95.963 1.00 159.75 ? 179  DT  J "O5'" 1 
ATOM   3643  C "C5'" . DT  B 1 34  ? -68.645  -23.023 96.167 1.00 158.73 ? 179  DT  J "C5'" 1 
ATOM   3644  C "C4'" . DT  B 1 34  ? -68.052  -24.045 95.227 1.00 158.07 ? 179  DT  J "C4'" 1 
ATOM   3645  O "O4'" . DT  B 1 34  ? -68.476  -23.788 93.866 1.00 157.94 ? 179  DT  J "O4'" 1 
ATOM   3646  C "C3'" . DT  B 1 34  ? -66.525  -24.082 95.194 1.00 157.30 ? 179  DT  J "C3'" 1 
ATOM   3647  O "O3'" . DT  B 1 34  ? -66.092  -25.440 95.115 1.00 156.21 ? 179  DT  J "O3'" 1 
ATOM   3648  C "C2'" . DT  B 1 34  ? -66.184  -23.349 93.910 1.00 157.89 ? 179  DT  J "C2'" 1 
ATOM   3649  C "C1'" . DT  B 1 34  ? -67.341  -23.752 93.015 1.00 158.03 ? 179  DT  J "C1'" 1 
ATOM   3650  N N1    . DT  B 1 34  ? -67.628  -22.820 91.908 1.00 127.61 ? 179  DT  J N1    1 
ATOM   3651  C C2    . DT  B 1 34  ? -67.731  -23.334 90.632 1.00 126.93 ? 179  DT  J C2    1 
ATOM   3652  O O2    . DT  B 1 34  ? -67.606  -24.521 90.376 1.00 125.73 ? 179  DT  J O2    1 
ATOM   3653  N N3    . DT  B 1 34  ? -67.993  -22.399 89.660 1.00 126.27 ? 179  DT  J N3    1 
ATOM   3654  C C4    . DT  B 1 34  ? -68.165  -21.036 89.835 1.00 126.22 ? 179  DT  J C4    1 
ATOM   3655  O O4    . DT  B 1 34  ? -68.395  -20.317 88.866 1.00 125.19 ? 179  DT  J O4    1 
ATOM   3656  C C5    . DT  B 1 34  ? -68.054  -20.570 91.197 1.00 126.30 ? 179  DT  J C5    1 
ATOM   3657  C C7    . DT  B 1 34  ? -68.241  -19.113 91.481 1.00 125.71 ? 179  DT  J C7    1 
ATOM   3658  C C6    . DT  B 1 34  ? -67.790  -21.472 92.152 1.00 127.36 ? 179  DT  J C6    1 
ATOM   3659  P P     . DA  B 1 35  ? -64.524  -25.778 95.134 1.00 139.24 ? 180  DA  J P     1 
ATOM   3660  O OP1   . DA  B 1 35  ? -64.292  -26.800 96.188 1.00 129.71 ? 180  DA  J OP1   1 
ATOM   3661  O OP2   . DA  B 1 35  ? -63.759  -24.501 95.157 1.00 129.76 ? 180  DA  J OP2   1 
ATOM   3662  O "O5'" . DA  B 1 35  ? -64.289  -26.480 93.728 1.00 137.12 ? 180  DA  J "O5'" 1 
ATOM   3663  C "C5'" . DA  B 1 35  ? -65.126  -27.554 93.313 1.00 133.67 ? 180  DA  J "C5'" 1 
ATOM   3664  C "C4'" . DA  B 1 35  ? -64.755  -27.992 91.917 1.00 130.66 ? 180  DA  J "C4'" 1 
ATOM   3665  O "O4'" . DA  B 1 35  ? -65.202  -27.014 90.947 1.00 130.94 ? 180  DA  J "O4'" 1 
ATOM   3666  C "C3'" . DA  B 1 35  ? -63.252  -28.140 91.714 1.00 128.38 ? 180  DA  J "C3'" 1 
ATOM   3667  O "O3'" . DA  B 1 35  ? -62.990  -29.284 90.911 1.00 123.92 ? 180  DA  J "O3'" 1 
ATOM   3668  C "C2'" . DA  B 1 35  ? -62.860  -26.856 91.005 1.00 129.06 ? 180  DA  J "C2'" 1 
ATOM   3669  C "C1'" . DA  B 1 35  ? -64.102  -26.523 90.195 1.00 131.04 ? 180  DA  J "C1'" 1 
ATOM   3670  N N9    . DA  B 1 35  ? -64.316  -25.090 89.976 1.00 122.03 ? 180  DA  J N9    1 
ATOM   3671  C C8    . DA  B 1 35  ? -64.419  -24.104 90.927 1.00 122.46 ? 180  DA  J C8    1 
ATOM   3672  N N7    . DA  B 1 35  ? -64.613  -22.906 90.432 1.00 122.45 ? 180  DA  J N7    1 
ATOM   3673  C C5    . DA  B 1 35  ? -64.641  -23.114 89.063 1.00 122.85 ? 180  DA  J C5    1 
ATOM   3674  C C6    . DA  B 1 35  ? -64.819  -22.239 87.985 1.00 123.20 ? 180  DA  J C6    1 
ATOM   3675  N N6    . DA  B 1 35  ? -65.012  -20.927 88.127 1.00 124.01 ? 180  DA  J N6    1 
ATOM   3676  N N1    . DA  B 1 35  ? -64.796  -22.763 86.738 1.00 123.08 ? 180  DA  J N1    1 
ATOM   3677  C C2    . DA  B 1 35  ? -64.609  -24.082 86.600 1.00 123.24 ? 180  DA  J C2    1 
ATOM   3678  N N3    . DA  B 1 35  ? -64.433  -25.011 87.539 1.00 123.16 ? 180  DA  J N3    1 
ATOM   3679  C C4    . DA  B 1 35  ? -64.459  -24.454 88.765 1.00 122.70 ? 180  DA  J C4    1 
ATOM   3680  P P     . DT  B 1 36  ? -61.476  -29.746 90.666 1.00 130.14 ? 181  DT  J P     1 
ATOM   3681  O OP1   . DT  B 1 36  ? -61.378  -31.181 91.030 1.00 119.37 ? 181  DT  J OP1   1 
ATOM   3682  O OP2   . DT  B 1 36  ? -60.557  -28.761 91.295 1.00 120.09 ? 181  DT  J OP2   1 
ATOM   3683  O "O5'" . DT  B 1 36  ? -61.330  -29.615 89.090 1.00 128.38 ? 181  DT  J "O5'" 1 
ATOM   3684  C "C5'" . DT  B 1 36  ? -62.430  -29.922 88.235 1.00 122.31 ? 181  DT  J "C5'" 1 
ATOM   3685  C "C4'" . DT  B 1 36  ? -62.149  -29.442 86.832 1.00 118.31 ? 181  DT  J "C4'" 1 
ATOM   3686  O "O4'" . DT  B 1 36  ? -62.451  -28.030 86.685 1.00 116.25 ? 181  DT  J "O4'" 1 
ATOM   3687  C "C3'" . DT  B 1 36  ? -60.690  -29.620 86.413 1.00 116.50 ? 181  DT  J "C3'" 1 
ATOM   3688  O "O3'" . DT  B 1 36  ? -60.633  -30.175 85.106 1.00 114.27 ? 181  DT  J "O3'" 1 
ATOM   3689  C "C2'" . DT  B 1 36  ? -60.135  -28.206 86.432 1.00 115.32 ? 181  DT  J "C2'" 1 
ATOM   3690  C "C1'" . DT  B 1 36  ? -61.353  -27.381 86.062 1.00 114.90 ? 181  DT  J "C1'" 1 
ATOM   3691  N N1    . DT  B 1 36  ? -61.319  -25.973 86.518 1.00 103.28 ? 181  DT  J N1    1 
ATOM   3692  C C2    . DT  B 1 36  ? -61.598  -24.984 85.596 1.00 103.85 ? 181  DT  J C2    1 
ATOM   3693  O O2    . DT  B 1 36  ? -61.861  -25.211 84.424 1.00 105.15 ? 181  DT  J O2    1 
ATOM   3694  N N3    . DT  B 1 36  ? -61.554  -23.708 86.095 1.00 102.49 ? 181  DT  J N3    1 
ATOM   3695  C C4    . DT  B 1 36  ? -61.260  -23.325 87.386 1.00 101.08 ? 181  DT  J C4    1 
ATOM   3696  O O4    . DT  B 1 36  ? -61.269  -22.134 87.689 1.00 99.57  ? 181  DT  J O4    1 
ATOM   3697  C C5    . DT  B 1 36  ? -60.961  -24.409 88.297 1.00 101.38 ? 181  DT  J C5    1 
ATOM   3698  C C7    . DT  B 1 36  ? -60.601  -24.087 89.714 1.00 101.37 ? 181  DT  J C7    1 
ATOM   3699  C C6    . DT  B 1 36  ? -61.014  -25.663 87.823 1.00 101.94 ? 181  DT  J C6    1 
ATOM   3700  P P     . DT  B 1 37  ? -59.214  -30.394 84.397 1.00 120.52 ? 182  DT  J P     1 
ATOM   3701  O OP1   . DT  B 1 37  ? -59.175  -31.801 83.917 1.00 133.61 ? 182  DT  J OP1   1 
ATOM   3702  O OP2   . DT  B 1 37  ? -58.133  -29.885 85.281 1.00 134.13 ? 182  DT  J OP2   1 
ATOM   3703  O "O5'" . DT  B 1 37  ? -59.334  -29.435 83.137 1.00 119.79 ? 182  DT  J "O5'" 1 
ATOM   3704  C "C5'" . DT  B 1 37  ? -60.584  -29.305 82.469 1.00 116.11 ? 182  DT  J "C5'" 1 
ATOM   3705  C "C4'" . DT  B 1 37  ? -60.499  -28.257 81.387 1.00 113.18 ? 182  DT  J "C4'" 1 
ATOM   3706  O "O4'" . DT  B 1 37  ? -60.558  -26.927 81.955 1.00 112.92 ? 182  DT  J "O4'" 1 
ATOM   3707  C "C3'" . DT  B 1 37  ? -59.230  -28.310 80.539 1.00 111.03 ? 182  DT  J "C3'" 1 
ATOM   3708  O "O3'" . DT  B 1 37  ? -59.586  -28.156 79.166 1.00 107.47 ? 182  DT  J "O3'" 1 
ATOM   3709  C "C2'" . DT  B 1 37  ? -58.408  -27.137 81.051 1.00 111.38 ? 182  DT  J "C2'" 1 
ATOM   3710  C "C1'" . DT  B 1 37  ? -59.486  -26.144 81.454 1.00 112.15 ? 182  DT  J "C1'" 1 
ATOM   3711  N N1    . DT  B 1 37  ? -59.113  -25.167 82.501 1.00 125.01 ? 182  DT  J N1    1 
ATOM   3712  C C2    . DT  B 1 37  ? -59.242  -23.825 82.211 1.00 125.14 ? 182  DT  J C2    1 
ATOM   3713  O O2    . DT  B 1 37  ? -59.652  -23.409 81.140 1.00 125.91 ? 182  DT  J O2    1 
ATOM   3714  N N3    . DT  B 1 37  ? -58.880  -22.983 83.230 1.00 125.27 ? 182  DT  J N3    1 
ATOM   3715  C C4    . DT  B 1 37  ? -58.424  -23.336 84.481 1.00 125.56 ? 182  DT  J C4    1 
ATOM   3716  O O4    . DT  B 1 37  ? -58.139  -22.464 85.295 1.00 125.96 ? 182  DT  J O4    1 
ATOM   3717  C C5    . DT  B 1 37  ? -58.323  -24.757 84.722 1.00 125.58 ? 182  DT  J C5    1 
ATOM   3718  C C7    . DT  B 1 37  ? -57.861  -25.234 86.062 1.00 125.69 ? 182  DT  J C7    1 
ATOM   3719  C C6    . DT  B 1 37  ? -58.658  -25.589 83.729 1.00 125.07 ? 182  DT  J C6    1 
ATOM   3720  P P     . DT  B 1 38  ? -58.441  -28.059 78.057 1.00 110.58 ? 183  DT  J P     1 
ATOM   3721  O OP1   . DT  B 1 38  ? -58.900  -28.798 76.857 1.00 130.25 ? 183  DT  J OP1   1 
ATOM   3722  O OP2   . DT  B 1 38  ? -57.139  -28.404 78.681 1.00 131.46 ? 183  DT  J OP2   1 
ATOM   3723  O "O5'" . DT  B 1 38  ? -58.446  -26.514 77.708 1.00 108.94 ? 183  DT  J "O5'" 1 
ATOM   3724  C "C5'" . DT  B 1 38  ? -59.678  -25.820 77.587 1.00 107.05 ? 183  DT  J "C5'" 1 
ATOM   3725  C "C4'" . DT  B 1 38  ? -59.416  -24.406 77.142 1.00 106.25 ? 183  DT  J "C4'" 1 
ATOM   3726  O "O4'" . DT  B 1 38  ? -58.852  -23.649 78.237 1.00 105.51 ? 183  DT  J "O4'" 1 
ATOM   3727  C "C3'" . DT  B 1 38  ? -58.387  -24.357 76.022 1.00 106.12 ? 183  DT  J "C3'" 1 
ATOM   3728  O "O3'" . DT  B 1 38  ? -58.698  -23.300 75.124 1.00 105.65 ? 183  DT  J "O3'" 1 
ATOM   3729  C "C2'" . DT  B 1 38  ? -57.087  -24.093 76.757 1.00 105.65 ? 183  DT  J "C2'" 1 
ATOM   3730  C "C1'" . DT  B 1 38  ? -57.538  -23.224 77.916 1.00 106.16 ? 183  DT  J "C1'" 1 
ATOM   3731  N N1    . DT  B 1 38  ? -56.719  -23.351 79.132 1.00 125.69 ? 183  DT  J N1    1 
ATOM   3732  C C2    . DT  B 1 38  ? -56.724  -22.300 80.016 1.00 125.28 ? 183  DT  J C2    1 
ATOM   3733  O O2    . DT  B 1 38  ? -57.355  -21.272 79.826 1.00 123.30 ? 183  DT  J O2    1 
ATOM   3734  N N3    . DT  B 1 38  ? -55.957  -22.493 81.136 1.00 125.22 ? 183  DT  J N3    1 
ATOM   3735  C C4    . DT  B 1 38  ? -55.193  -23.604 81.446 1.00 125.87 ? 183  DT  J C4    1 
ATOM   3736  O O4    . DT  B 1 38  ? -54.553  -23.633 82.495 1.00 126.08 ? 183  DT  J O4    1 
ATOM   3737  C C5    . DT  B 1 38  ? -55.222  -24.666 80.464 1.00 126.46 ? 183  DT  J C5    1 
ATOM   3738  C C7    . DT  B 1 38  ? -54.412  -25.903 80.706 1.00 126.80 ? 183  DT  J C7    1 
ATOM   3739  C C6    . DT  B 1 38  ? -55.979  -24.490 79.373 1.00 125.93 ? 183  DT  J C6    1 
ATOM   3740  P P     . DG  B 1 39  ? -58.804  -23.602 73.556 1.00 92.81  ? 184  DG  J P     1 
ATOM   3741  O OP1   . DG  B 1 39  ? -60.181  -24.089 73.277 1.00 122.59 ? 184  DG  J OP1   1 
ATOM   3742  O OP2   . DG  B 1 39  ? -57.636  -24.429 73.163 1.00 121.99 ? 184  DG  J OP2   1 
ATOM   3743  O "O5'" . DG  B 1 39  ? -58.641  -22.160 72.918 1.00 94.11  ? 184  DG  J "O5'" 1 
ATOM   3744  C "C5'" . DG  B 1 39  ? -59.054  -21.002 73.634 1.00 95.84  ? 184  DG  J "C5'" 1 
ATOM   3745  C "C4'" . DG  B 1 39  ? -57.880  -20.073 73.819 1.00 96.97  ? 184  DG  J "C4'" 1 
ATOM   3746  O "O4'" . DG  B 1 39  ? -56.974  -20.607 74.815 1.00 96.81  ? 184  DG  J "O4'" 1 
ATOM   3747  C "C3'" . DG  B 1 39  ? -57.047  -19.897 72.549 1.00 98.77  ? 184  DG  J "C3'" 1 
ATOM   3748  O "O3'" . DG  B 1 39  ? -56.580  -18.559 72.464 1.00 101.85 ? 184  DG  J "O3'" 1 
ATOM   3749  C "C2'" . DG  B 1 39  ? -55.866  -20.821 72.773 1.00 97.74  ? 184  DG  J "C2'" 1 
ATOM   3750  C "C1'" . DG  B 1 39  ? -55.670  -20.670 74.263 1.00 97.06  ? 184  DG  J "C1'" 1 
ATOM   3751  N N9    . DG  B 1 39  ? -54.956  -21.758 74.913 1.00 125.95 ? 184  DG  J N9    1 
ATOM   3752  C C8    . DG  B 1 39  ? -54.623  -22.986 74.387 1.00 125.63 ? 184  DG  J C8    1 
ATOM   3753  N N7    . DG  B 1 39  ? -53.961  -23.739 75.225 1.00 125.42 ? 184  DG  J N7    1 
ATOM   3754  C C5    . DG  B 1 39  ? -53.857  -22.961 76.370 1.00 124.76 ? 184  DG  J C5    1 
ATOM   3755  C C6    . DG  B 1 39  ? -53.246  -23.242 77.619 1.00 123.78 ? 184  DG  J C6    1 
ATOM   3756  O O6    . DG  B 1 39  ? -52.657  -24.273 77.975 1.00 123.86 ? 184  DG  J O6    1 
ATOM   3757  N N1    . DG  B 1 39  ? -53.373  -22.167 78.500 1.00 122.95 ? 184  DG  J N1    1 
ATOM   3758  C C2    . DG  B 1 39  ? -54.007  -20.975 78.215 1.00 123.65 ? 184  DG  J C2    1 
ATOM   3759  N N2    . DG  B 1 39  ? -54.018  -20.051 79.186 1.00 124.09 ? 184  DG  J N2    1 
ATOM   3760  N N3    . DG  B 1 39  ? -54.583  -20.709 77.058 1.00 124.26 ? 184  DG  J N3    1 
ATOM   3761  C C4    . DG  B 1 39  ? -54.469  -21.737 76.191 1.00 125.25 ? 184  DG  J C4    1 
ATOM   3762  P P     . DG  B 1 40  ? -56.314  -17.907 71.028 1.00 145.43 ? 185  DG  J P     1 
ATOM   3763  O OP1   . DG  B 1 40  ? -57.628  -17.814 70.342 1.00 162.84 ? 185  DG  J OP1   1 
ATOM   3764  O OP2   . DG  B 1 40  ? -55.197  -18.646 70.385 1.00 162.32 ? 185  DG  J OP2   1 
ATOM   3765  O "O5'" . DG  B 1 40  ? -55.824  -16.435 71.380 1.00 146.96 ? 185  DG  J "O5'" 1 
ATOM   3766  C "C5'" . DG  B 1 40  ? -56.530  -15.645 72.331 1.00 149.74 ? 185  DG  J "C5'" 1 
ATOM   3767  C "C4'" . DG  B 1 40  ? -55.560  -15.013 73.299 1.00 152.28 ? 185  DG  J "C4'" 1 
ATOM   3768  O "O4'" . DG  B 1 40  ? -54.994  -16.034 74.158 1.00 152.86 ? 185  DG  J "O4'" 1 
ATOM   3769  C "C3'" . DG  B 1 40  ? -54.381  -14.332 72.611 1.00 153.75 ? 185  DG  J "C3'" 1 
ATOM   3770  O "O3'" . DG  B 1 40  ? -54.052  -13.111 73.264 1.00 156.18 ? 185  DG  J "O3'" 1 
ATOM   3771  C "C2'" . DG  B 1 40  ? -53.253  -15.338 72.747 1.00 153.85 ? 185  DG  J "C2'" 1 
ATOM   3772  C "C1'" . DG  B 1 40  ? -53.577  -16.057 74.044 1.00 153.98 ? 185  DG  J "C1'" 1 
ATOM   3773  N N9    . DG  B 1 40  ? -53.151  -17.455 74.037 1.00 172.43 ? 185  DG  J N9    1 
ATOM   3774  C C8    . DG  B 1 40  ? -53.283  -18.345 72.999 1.00 172.59 ? 185  DG  J C8    1 
ATOM   3775  N N7    . DG  B 1 40  ? -52.795  -19.525 73.267 1.00 172.73 ? 185  DG  J N7    1 
ATOM   3776  C C5    . DG  B 1 40  ? -52.313  -19.411 74.563 1.00 172.56 ? 185  DG  J C5    1 
ATOM   3777  C C6    . DG  B 1 40  ? -51.672  -20.368 75.386 1.00 172.70 ? 185  DG  J C6    1 
ATOM   3778  O O6    . DG  B 1 40  ? -51.385  -21.540 75.124 1.00 172.14 ? 185  DG  J O6    1 
ATOM   3779  N N1    . DG  B 1 40  ? -51.357  -19.840 76.632 1.00 173.24 ? 185  DG  J N1    1 
ATOM   3780  C C2    . DG  B 1 40  ? -51.622  -18.556 77.035 1.00 173.39 ? 185  DG  J C2    1 
ATOM   3781  N N2    . DG  B 1 40  ? -51.247  -18.245 78.284 1.00 173.32 ? 185  DG  J N2    1 
ATOM   3782  N N3    . DG  B 1 40  ? -52.213  -17.648 76.273 1.00 173.38 ? 185  DG  J N3    1 
ATOM   3783  C C4    . DG  B 1 40  ? -52.530  -18.141 75.057 1.00 173.01 ? 185  DG  J C4    1 
ATOM   3784  P P     . DA  B 1 41  ? -52.703  -12.346 72.865 1.00 153.71 ? 186  DA  J P     1 
ATOM   3785  O OP1   . DA  B 1 41  ? -52.937  -10.900 73.077 1.00 120.80 ? 186  DA  J OP1   1 
ATOM   3786  O OP2   . DA  B 1 41  ? -52.250  -12.826 71.536 1.00 120.43 ? 186  DA  J OP2   1 
ATOM   3787  O "O5'" . DA  B 1 41  ? -51.667  -12.853 73.960 1.00 153.70 ? 186  DA  J "O5'" 1 
ATOM   3788  C "C5'" . DA  B 1 41  ? -51.875  -12.557 75.336 1.00 154.19 ? 186  DA  J "C5'" 1 
ATOM   3789  C "C4'" . DA  B 1 41  ? -50.564  -12.607 76.085 1.00 155.01 ? 186  DA  J "C4'" 1 
ATOM   3790  O "O4'" . DA  B 1 41  ? -50.182  -13.979 76.330 1.00 155.85 ? 186  DA  J "O4'" 1 
ATOM   3791  C "C3'" . DA  B 1 41  ? -49.389  -11.961 75.353 1.00 154.83 ? 186  DA  J "C3'" 1 
ATOM   3792  O "O3'" . DA  B 1 41  ? -48.571  -11.255 76.291 1.00 154.32 ? 186  DA  J "O3'" 1 
ATOM   3793  C "C2'" . DA  B 1 41  ? -48.651  -13.150 74.759 1.00 154.74 ? 186  DA  J "C2'" 1 
ATOM   3794  C "C1'" . DA  B 1 41  ? -48.892  -14.233 75.797 1.00 155.08 ? 186  DA  J "C1'" 1 
ATOM   3795  N N9    . DA  B 1 41  ? -48.894  -15.607 75.295 1.00 122.61 ? 186  DA  J N9    1 
ATOM   3796  C C8    . DA  B 1 41  ? -49.493  -16.107 74.166 1.00 122.38 ? 186  DA  J C8    1 
ATOM   3797  N N7    . DA  B 1 41  ? -49.364  -17.404 74.029 1.00 121.82 ? 186  DA  J N7    1 
ATOM   3798  C C5    . DA  B 1 41  ? -48.619  -17.781 75.137 1.00 122.13 ? 186  DA  J C5    1 
ATOM   3799  C C6    . DA  B 1 41  ? -48.152  -19.031 75.584 1.00 122.05 ? 186  DA  J C6    1 
ATOM   3800  N N6    . DA  B 1 41  ? -48.387  -20.181 74.948 1.00 122.31 ? 186  DA  J N6    1 
ATOM   3801  N N1    . DA  B 1 41  ? -47.429  -19.061 76.728 1.00 122.18 ? 186  DA  J N1    1 
ATOM   3802  C C2    . DA  B 1 41  ? -47.202  -17.908 77.370 1.00 122.31 ? 186  DA  J C2    1 
ATOM   3803  N N3    . DA  B 1 41  ? -47.593  -16.674 77.053 1.00 122.63 ? 186  DA  J N3    1 
ATOM   3804  C C4    . DA  B 1 41  ? -48.307  -16.682 75.914 1.00 122.45 ? 186  DA  J C4    1 
ATOM   3805  P P     . DA  B 1 42  ? -47.391  -10.305 75.761 1.00 141.91 ? 187  DA  J P     1 
ATOM   3806  O OP1   . DA  B 1 42  ? -47.227  -9.198  76.745 1.00 131.14 ? 187  DA  J OP1   1 
ATOM   3807  O OP2   . DA  B 1 42  ? -47.638  -9.989  74.331 1.00 130.56 ? 187  DA  J OP2   1 
ATOM   3808  O "O5'" . DA  B 1 42  ? -46.112  -11.245 75.844 1.00 141.21 ? 187  DA  J "O5'" 1 
ATOM   3809  C "C5'" . DA  B 1 42  ? -45.587  -11.640 77.105 1.00 140.32 ? 187  DA  J "C5'" 1 
ATOM   3810  C "C4'" . DA  B 1 42  ? -44.383  -12.527 76.907 1.00 140.52 ? 187  DA  J "C4'" 1 
ATOM   3811  O "O4'" . DA  B 1 42  ? -44.804  -13.861 76.534 1.00 139.34 ? 187  DA  J "O4'" 1 
ATOM   3812  C "C3'" . DA  B 1 42  ? -43.447  -12.050 75.797 1.00 142.16 ? 187  DA  J "C3'" 1 
ATOM   3813  O "O3'" . DA  B 1 42  ? -42.086  -12.253 76.174 1.00 147.27 ? 187  DA  J "O3'" 1 
ATOM   3814  C "C2'" . DA  B 1 42  ? -43.792  -12.963 74.637 1.00 140.34 ? 187  DA  J "C2'" 1 
ATOM   3815  C "C1'" . DA  B 1 42  ? -44.104  -14.252 75.369 1.00 138.25 ? 187  DA  J "C1'" 1 
ATOM   3816  N N9    . DA  B 1 42  ? -44.933  -15.202 74.630 1.00 125.33 ? 187  DA  J N9    1 
ATOM   3817  C C8    . DA  B 1 42  ? -45.978  -14.950 73.777 1.00 124.21 ? 187  DA  J C8    1 
ATOM   3818  N N7    . DA  B 1 42  ? -46.493  -16.029 73.240 1.00 123.02 ? 187  DA  J N7    1 
ATOM   3819  C C5    . DA  B 1 42  ? -45.738  -17.061 73.780 1.00 122.85 ? 187  DA  J C5    1 
ATOM   3820  C C6    . DA  B 1 42  ? -45.778  -18.454 73.604 1.00 122.53 ? 187  DA  J C6    1 
ATOM   3821  N N6    . DA  B 1 42  ? -46.640  -19.074 72.796 1.00 122.09 ? 187  DA  J N6    1 
ATOM   3822  N N1    . DA  B 1 42  ? -44.890  -19.200 74.297 1.00 122.63 ? 187  DA  J N1    1 
ATOM   3823  C C2    . DA  B 1 42  ? -44.026  -18.577 75.108 1.00 123.22 ? 187  DA  J C2    1 
ATOM   3824  N N3    . DA  B 1 42  ? -43.889  -17.278 75.354 1.00 123.16 ? 187  DA  J N3    1 
ATOM   3825  C C4    . DA  B 1 42  ? -44.784  -16.567 74.648 1.00 123.71 ? 187  DA  J C4    1 
ATOM   3826  P P     . DA  B 1 43  ? -40.959  -11.257 75.626 1.00 168.58 ? 188  DA  J P     1 
ATOM   3827  O OP1   . DA  B 1 43  ? -40.929  -10.073 76.523 1.00 126.17 ? 188  DA  J OP1   1 
ATOM   3828  O OP2   . DA  B 1 43  ? -41.184  -11.074 74.169 1.00 126.51 ? 188  DA  J OP2   1 
ATOM   3829  O "O5'" . DA  B 1 43  ? -39.610  -12.071 75.825 1.00 168.65 ? 188  DA  J "O5'" 1 
ATOM   3830  C "C5'" . DA  B 1 43  ? -39.428  -12.907 76.958 1.00 168.90 ? 188  DA  J "C5'" 1 
ATOM   3831  C "C4'" . DA  B 1 43  ? -38.837  -14.227 76.526 1.00 169.97 ? 188  DA  J "C4'" 1 
ATOM   3832  O "O4'" . DA  B 1 43  ? -39.845  -15.017 75.843 1.00 169.78 ? 188  DA  J "O4'" 1 
ATOM   3833  C "C3'" . DA  B 1 43  ? -37.675  -14.079 75.541 1.00 171.04 ? 188  DA  J "C3'" 1 
ATOM   3834  O "O3'" . DA  B 1 43  ? -36.640  -15.019 75.841 1.00 172.85 ? 188  DA  J "O3'" 1 
ATOM   3835  C "C2'" . DA  B 1 43  ? -38.307  -14.412 74.202 1.00 170.66 ? 188  DA  J "C2'" 1 
ATOM   3836  C "C1'" . DA  B 1 43  ? -39.318  -15.466 74.606 1.00 170.25 ? 188  DA  J "C1'" 1 
ATOM   3837  N N9    . DA  B 1 43  ? -40.421  -15.654 73.661 1.00 127.31 ? 188  DA  J N9    1 
ATOM   3838  C C8    . DA  B 1 43  ? -41.103  -14.697 72.949 1.00 127.28 ? 188  DA  J C8    1 
ATOM   3839  N N7    . DA  B 1 43  ? -42.010  -15.187 72.137 1.00 127.31 ? 188  DA  J N7    1 
ATOM   3840  C C5    . DA  B 1 43  ? -41.931  -16.559 72.335 1.00 126.58 ? 188  DA  J C5    1 
ATOM   3841  C C6    . DA  B 1 43  ? -42.630  -17.642 71.766 1.00 125.92 ? 188  DA  J C6    1 
ATOM   3842  N N6    . DA  B 1 43  ? -43.579  -17.506 70.838 1.00 124.38 ? 188  DA  J N6    1 
ATOM   3843  N N1    . DA  B 1 43  ? -42.313  -18.886 72.188 1.00 126.23 ? 188  DA  J N1    1 
ATOM   3844  C C2    . DA  B 1 43  ? -41.356  -19.024 73.113 1.00 126.28 ? 188  DA  J C2    1 
ATOM   3845  N N3    . DA  B 1 43  ? -40.625  -18.088 73.718 1.00 126.10 ? 188  DA  J N3    1 
ATOM   3846  C C4    . DA  B 1 43  ? -40.965  -16.862 73.280 1.00 126.79 ? 188  DA  J C4    1 
ATOM   3847  P P     . DC  B 1 44  ? -35.470  -15.279 74.772 1.00 176.38 ? 189  DC  J P     1 
ATOM   3848  O OP1   . DC  B 1 44  ? -34.361  -15.975 75.478 1.00 138.73 ? 189  DC  J OP1   1 
ATOM   3849  O OP2   . DC  B 1 44  ? -35.200  -14.005 74.053 1.00 138.38 ? 189  DC  J OP2   1 
ATOM   3850  O "O5'" . DC  B 1 44  ? -36.128  -16.307 73.748 1.00 176.32 ? 189  DC  J "O5'" 1 
ATOM   3851  C "C5'" . DC  B 1 44  ? -36.448  -17.634 74.160 1.00 175.85 ? 189  DC  J "C5'" 1 
ATOM   3852  C "C4'" . DC  B 1 44  ? -36.469  -18.562 72.970 1.00 175.68 ? 189  DC  J "C4'" 1 
ATOM   3853  O "O4'" . DC  B 1 44  ? -37.722  -18.457 72.251 1.00 176.59 ? 189  DC  J "O4'" 1 
ATOM   3854  C "C3'" . DC  B 1 44  ? -35.366  -18.305 71.941 1.00 175.48 ? 189  DC  J "C3'" 1 
ATOM   3855  O "O3'" . DC  B 1 44  ? -34.873  -19.550 71.451 1.00 174.33 ? 189  DC  J "O3'" 1 
ATOM   3856  C "C2'" . DC  B 1 44  ? -36.099  -17.581 70.826 1.00 175.78 ? 189  DC  J "C2'" 1 
ATOM   3857  C "C1'" . DC  B 1 44  ? -37.447  -18.273 70.873 1.00 176.59 ? 189  DC  J "C1'" 1 
ATOM   3858  N N1    . DC  B 1 44  ? -38.576  -17.545 70.271 1.00 139.82 ? 189  DC  J N1    1 
ATOM   3859  C C2    . DC  B 1 44  ? -39.554  -18.282 69.600 1.00 139.93 ? 189  DC  J C2    1 
ATOM   3860  O O2    . DC  B 1 44  ? -39.428  -19.514 69.532 1.00 139.74 ? 189  DC  J O2    1 
ATOM   3861  N N3    . DC  B 1 44  ? -40.608  -17.639 69.045 1.00 139.45 ? 189  DC  J N3    1 
ATOM   3862  C C4    . DC  B 1 44  ? -40.703  -16.313 69.140 1.00 139.24 ? 189  DC  J C4    1 
ATOM   3863  N N4    . DC  B 1 44  ? -41.761  -15.722 68.581 1.00 138.65 ? 189  DC  J N4    1 
ATOM   3864  C C5    . DC  B 1 44  ? -39.717  -15.533 69.814 1.00 139.45 ? 189  DC  J C5    1 
ATOM   3865  C C6    . DC  B 1 44  ? -38.679  -16.185 70.360 1.00 139.70 ? 189  DC  J C6    1 
ATOM   3866  P P     . DT  B 1 45  ? -33.342  -19.676 70.988 1.00 155.73 ? 190  DT  J P     1 
ATOM   3867  O OP1   . DT  B 1 45  ? -32.512  -19.812 72.211 1.00 159.84 ? 190  DT  J OP1   1 
ATOM   3868  O OP2   . DT  B 1 45  ? -33.045  -18.596 70.011 1.00 159.84 ? 190  DT  J OP2   1 
ATOM   3869  O "O5'" . DT  B 1 45  ? -33.312  -21.067 70.219 1.00 154.86 ? 190  DT  J "O5'" 1 
ATOM   3870  C "C5'" . DT  B 1 45  ? -34.065  -22.177 70.703 1.00 153.28 ? 190  DT  J "C5'" 1 
ATOM   3871  C "C4'" . DT  B 1 45  ? -34.784  -22.856 69.561 1.00 152.01 ? 190  DT  J "C4'" 1 
ATOM   3872  O "O4'" . DT  B 1 45  ? -35.849  -22.007 69.064 1.00 151.83 ? 190  DT  J "O4'" 1 
ATOM   3873  C "C3'" . DT  B 1 45  ? -33.893  -23.165 68.360 1.00 150.78 ? 190  DT  J "C3'" 1 
ATOM   3874  O "O3'" . DT  B 1 45  ? -34.234  -24.444 67.827 1.00 149.34 ? 190  DT  J "O3'" 1 
ATOM   3875  C "C2'" . DT  B 1 45  ? -34.233  -22.063 67.372 1.00 151.11 ? 190  DT  J "C2'" 1 
ATOM   3876  C "C1'" . DT  B 1 45  ? -35.704  -21.819 67.663 1.00 151.22 ? 190  DT  J "C1'" 1 
ATOM   3877  N N1    . DT  B 1 45  ? -36.195  -20.464 67.326 1.00 155.29 ? 190  DT  J N1    1 
ATOM   3878  C C2    . DT  B 1 45  ? -37.438  -20.348 66.734 1.00 154.79 ? 190  DT  J C2    1 
ATOM   3879  O O2    . DT  B 1 45  ? -38.142  -21.307 66.462 1.00 154.60 ? 190  DT  J O2    1 
ATOM   3880  N N3    . DT  B 1 45  ? -37.829  -19.057 66.465 1.00 153.92 ? 190  DT  J N3    1 
ATOM   3881  C C4    . DT  B 1 45  ? -37.116  -17.899 66.717 1.00 153.82 ? 190  DT  J C4    1 
ATOM   3882  O O4    . DT  B 1 45  ? -37.601  -16.806 66.424 1.00 152.59 ? 190  DT  J O4    1 
ATOM   3883  C C5    . DT  B 1 45  ? -35.816  -18.095 67.326 1.00 153.95 ? 190  DT  J C5    1 
ATOM   3884  C C7    . DT  B 1 45  ? -34.963  -16.901 67.619 1.00 153.92 ? 190  DT  J C7    1 
ATOM   3885  C C6    . DT  B 1 45  ? -35.429  -19.349 67.600 1.00 154.20 ? 190  DT  J C6    1 
ATOM   3886  P P     . DG  B 1 46  ? -33.176  -25.229 66.909 1.00 154.61 ? 191  DG  J P     1 
ATOM   3887  O OP1   . DG  B 1 46  ? -33.288  -26.674 67.240 1.00 153.15 ? 191  DG  J OP1   1 
ATOM   3888  O OP2   . DG  B 1 46  ? -31.863  -24.544 67.023 1.00 152.90 ? 191  DG  J OP2   1 
ATOM   3889  O "O5'" . DG  B 1 46  ? -33.721  -25.012 65.429 1.00 152.92 ? 191  DG  J "O5'" 1 
ATOM   3890  C "C5'" . DG  B 1 46  ? -34.876  -25.707 64.967 1.00 147.99 ? 191  DG  J "C5'" 1 
ATOM   3891  C "C4'" . DG  B 1 46  ? -35.250  -25.230 63.585 1.00 144.63 ? 191  DG  J "C4'" 1 
ATOM   3892  O "O4'" . DG  B 1 46  ? -35.846  -23.910 63.639 1.00 144.25 ? 191  DG  J "O4'" 1 
ATOM   3893  C "C3'" . DG  B 1 46  ? -34.068  -25.121 62.620 1.00 143.22 ? 191  DG  J "C3'" 1 
ATOM   3894  O "O3'" . DG  B 1 46  ? -34.492  -25.536 61.325 1.00 141.18 ? 191  DG  J "O3'" 1 
ATOM   3895  C "C2'" . DG  B 1 46  ? -33.795  -23.629 62.581 1.00 143.05 ? 191  DG  J "C2'" 1 
ATOM   3896  C "C1'" . DG  B 1 46  ? -35.208  -23.092 62.674 1.00 144.73 ? 191  DG  J "C1'" 1 
ATOM   3897  N N9    . DG  B 1 46  ? -35.357  -21.693 63.069 1.00 144.71 ? 191  DG  J N9    1 
ATOM   3898  C C8    . DG  B 1 46  ? -34.482  -20.928 63.803 1.00 145.54 ? 191  DG  J C8    1 
ATOM   3899  N N7    . DG  B 1 46  ? -34.895  -19.702 63.974 1.00 146.47 ? 191  DG  J N7    1 
ATOM   3900  C C5    . DG  B 1 46  ? -36.118  -19.654 63.317 1.00 147.15 ? 191  DG  J C5    1 
ATOM   3901  C C6    . DG  B 1 46  ? -37.045  -18.581 63.156 1.00 148.64 ? 191  DG  J C6    1 
ATOM   3902  O O6    . DG  B 1 46  ? -36.962  -17.415 63.570 1.00 149.47 ? 191  DG  J O6    1 
ATOM   3903  N N1    . DG  B 1 46  ? -38.160  -18.975 62.423 1.00 149.27 ? 191  DG  J N1    1 
ATOM   3904  C C2    . DG  B 1 46  ? -38.362  -20.230 61.907 1.00 148.76 ? 191  DG  J C2    1 
ATOM   3905  N N2    . DG  B 1 46  ? -39.502  -20.413 61.230 1.00 148.84 ? 191  DG  J N2    1 
ATOM   3906  N N3    . DG  B 1 46  ? -37.510  -21.232 62.044 1.00 147.65 ? 191  DG  J N3    1 
ATOM   3907  C C4    . DG  B 1 46  ? -36.418  -20.876 62.756 1.00 146.34 ? 191  DG  J C4    1 
ATOM   3908  P P     . DC  B 1 47  ? -34.494  -27.095 60.952 1.00 127.62 ? 192  DC  J P     1 
ATOM   3909  O OP1   . DC  B 1 47  ? -34.752  -27.843 62.214 1.00 130.81 ? 192  DC  J OP1   1 
ATOM   3910  O OP2   . DC  B 1 47  ? -33.282  -27.399 60.143 1.00 130.94 ? 192  DC  J OP2   1 
ATOM   3911  O "O5'" . DC  B 1 47  ? -35.770  -27.254 60.014 1.00 125.81 ? 192  DC  J "O5'" 1 
ATOM   3912  C "C5'" . DC  B 1 47  ? -37.075  -27.357 60.577 1.00 119.57 ? 192  DC  J "C5'" 1 
ATOM   3913  C "C4'" . DC  B 1 47  ? -38.082  -26.624 59.720 1.00 114.89 ? 192  DC  J "C4'" 1 
ATOM   3914  O "O4'" . DC  B 1 47  ? -37.947  -25.192 59.871 1.00 113.37 ? 192  DC  J "O4'" 1 
ATOM   3915  C "C3'" . DC  B 1 47  ? -38.001  -26.902 58.219 1.00 112.21 ? 192  DC  J "C3'" 1 
ATOM   3916  O "O3'" . DC  B 1 47  ? -39.324  -27.023 57.709 1.00 109.23 ? 192  DC  J "O3'" 1 
ATOM   3917  C "C2'" . DC  B 1 47  ? -37.338  -25.655 57.662 1.00 111.02 ? 192  DC  J "C2'" 1 
ATOM   3918  C "C1'" . DC  B 1 47  ? -37.880  -24.586 58.590 1.00 111.77 ? 192  DC  J "C1'" 1 
ATOM   3919  N N1    . DC  B 1 47  ? -37.063  -23.374 58.717 1.00 114.50 ? 192  DC  J N1    1 
ATOM   3920  C C2    . DC  B 1 47  ? -37.573  -22.168 58.235 1.00 114.86 ? 192  DC  J C2    1 
ATOM   3921  O O2    . DC  B 1 47  ? -38.671  -22.170 57.661 1.00 115.29 ? 192  DC  J O2    1 
ATOM   3922  N N3    . DC  B 1 47  ? -36.856  -21.033 58.405 1.00 113.78 ? 192  DC  J N3    1 
ATOM   3923  C C4    . DC  B 1 47  ? -35.670  -21.079 59.018 1.00 112.73 ? 192  DC  J C4    1 
ATOM   3924  N N4    . DC  B 1 47  ? -35.012  -19.935 59.197 1.00 110.88 ? 192  DC  J N4    1 
ATOM   3925  C C5    . DC  B 1 47  ? -35.111  -22.302 59.486 1.00 113.01 ? 192  DC  J C5    1 
ATOM   3926  C C6    . DC  B 1 47  ? -35.835  -23.416 59.316 1.00 113.92 ? 192  DC  J C6    1 
ATOM   3927  P P     . DT  B 1 48  ? -39.555  -27.590 56.231 1.00 118.63 ? 193  DT  J P     1 
ATOM   3928  O OP1   . DT  B 1 48  ? -40.729  -28.499 56.281 1.00 98.66  ? 193  DT  J OP1   1 
ATOM   3929  O OP2   . DT  B 1 48  ? -38.261  -28.085 55.715 1.00 100.53 ? 193  DT  J OP2   1 
ATOM   3930  O "O5'" . DT  B 1 48  ? -39.923  -26.288 55.399 1.00 116.62 ? 193  DT  J "O5'" 1 
ATOM   3931  C "C5'" . DT  B 1 48  ? -40.933  -25.393 55.855 1.00 111.92 ? 193  DT  J "C5'" 1 
ATOM   3932  C "C4'" . DT  B 1 48  ? -40.863  -24.102 55.076 1.00 109.62 ? 193  DT  J "C4'" 1 
ATOM   3933  O "O4'" . DT  B 1 48  ? -39.765  -23.278 55.534 1.00 111.02 ? 193  DT  J "O4'" 1 
ATOM   3934  C "C3'" . DT  B 1 48  ? -40.637  -24.304 53.578 1.00 107.51 ? 193  DT  J "C3'" 1 
ATOM   3935  O "O3'" . DT  B 1 48  ? -41.304  -23.263 52.879 1.00 102.46 ? 193  DT  J "O3'" 1 
ATOM   3936  C "C2'" . DT  B 1 48  ? -39.147  -24.069 53.436 1.00 109.19 ? 193  DT  J "C2'" 1 
ATOM   3937  C "C1'" . DT  B 1 48  ? -38.986  -22.918 54.407 1.00 112.62 ? 193  DT  J "C1'" 1 
ATOM   3938  N N1    . DT  B 1 48  ? -37.616  -22.634 54.855 1.00 96.58  ? 193  DT  J N1    1 
ATOM   3939  C C2    . DT  B 1 48  ? -37.289  -21.321 55.130 1.00 97.35  ? 193  DT  J C2    1 
ATOM   3940  O O2    . DT  B 1 48  ? -38.077  -20.395 55.020 1.00 96.73  ? 193  DT  J O2    1 
ATOM   3941  N N3    . DT  B 1 48  ? -35.996  -21.130 55.538 1.00 99.09  ? 193  DT  J N3    1 
ATOM   3942  C C4    . DT  B 1 48  ? -35.018  -22.096 55.694 1.00 100.06 ? 193  DT  J C4    1 
ATOM   3943  O O4    . DT  B 1 48  ? -33.890  -21.771 56.070 1.00 100.47 ? 193  DT  J O4    1 
ATOM   3944  C C5    . DT  B 1 48  ? -35.433  -23.450 55.388 1.00 99.85  ? 193  DT  J C5    1 
ATOM   3945  C C7    . DT  B 1 48  ? -34.443  -24.561 55.528 1.00 100.62 ? 193  DT  J C7    1 
ATOM   3946  C C6    . DT  B 1 48  ? -36.695  -23.647 54.991 1.00 98.29  ? 193  DT  J C6    1 
ATOM   3947  P P     . DC  B 1 49  ? -42.758  -23.514 52.262 1.00 76.95  ? 194  DC  J P     1 
ATOM   3948  O OP1   . DC  B 1 49  ? -43.619  -24.121 53.315 1.00 71.21  ? 194  DC  J OP1   1 
ATOM   3949  O OP2   . DC  B 1 49  ? -42.611  -24.178 50.936 1.00 72.76  ? 194  DC  J OP2   1 
ATOM   3950  O "O5'" . DC  B 1 49  ? -43.268  -22.036 51.997 1.00 75.44  ? 194  DC  J "O5'" 1 
ATOM   3951  C "C5'" . DC  B 1 49  ? -43.340  -21.089 53.058 1.00 73.73  ? 194  DC  J "C5'" 1 
ATOM   3952  C "C4'" . DC  B 1 49  ? -42.765  -19.771 52.602 1.00 71.84  ? 194  DC  J "C4'" 1 
ATOM   3953  O "O4'" . DC  B 1 49  ? -41.349  -19.719 52.901 1.00 74.18  ? 194  DC  J "O4'" 1 
ATOM   3954  C "C3'" . DC  B 1 49  ? -42.901  -19.545 51.096 1.00 70.08  ? 194  DC  J "C3'" 1 
ATOM   3955  O "O3'" . DC  B 1 49  ? -43.343  -18.221 50.807 1.00 64.97  ? 194  DC  J "O3'" 1 
ATOM   3956  C "C2'" . DC  B 1 49  ? -41.495  -19.778 50.571 1.00 71.76  ? 194  DC  J "C2'" 1 
ATOM   3957  C "C1'" . DC  B 1 49  ? -40.629  -19.350 51.740 1.00 73.74  ? 194  DC  J "C1'" 1 
ATOM   3958  N N1    . DC  B 1 49  ? -39.310  -19.996 51.807 1.00 71.64  ? 194  DC  J N1    1 
ATOM   3959  C C2    . DC  B 1 49  ? -38.217  -19.236 52.226 1.00 72.17  ? 194  DC  J C2    1 
ATOM   3960  O O2    . DC  B 1 49  ? -38.395  -18.046 52.518 1.00 72.41  ? 194  DC  J O2    1 
ATOM   3961  N N3    . DC  B 1 49  ? -36.996  -19.818 52.300 1.00 72.50  ? 194  DC  J N3    1 
ATOM   3962  C C4    . DC  B 1 49  ? -36.848  -21.106 51.970 1.00 71.92  ? 194  DC  J C4    1 
ATOM   3963  N N4    . DC  B 1 49  ? -35.626  -21.641 52.059 1.00 69.90  ? 194  DC  J N4    1 
ATOM   3964  C C5    . DC  B 1 49  ? -37.946  -21.902 51.536 1.00 71.64  ? 194  DC  J C5    1 
ATOM   3965  C C6    . DC  B 1 49  ? -39.149  -21.312 51.473 1.00 71.00  ? 194  DC  J C6    1 
ATOM   3966  P P     . DC  B 1 50  ? -43.562  -17.775 49.281 1.00 62.33  ? 195  DC  J P     1 
ATOM   3967  O OP1   . DC  B 1 50  ? -44.939  -17.230 49.178 1.00 74.75  ? 195  DC  J OP1   1 
ATOM   3968  O OP2   . DC  B 1 50  ? -43.126  -18.841 48.350 1.00 72.58  ? 195  DC  J OP2   1 
ATOM   3969  O "O5'" . DC  B 1 50  ? -42.510  -16.598 49.100 1.00 65.87  ? 195  DC  J "O5'" 1 
ATOM   3970  C "C5'" . DC  B 1 50  ? -42.369  -15.577 50.084 1.00 67.94  ? 195  DC  J "C5'" 1 
ATOM   3971  C "C4'" . DC  B 1 50  ? -41.193  -14.696 49.739 1.00 69.13  ? 195  DC  J "C4'" 1 
ATOM   3972  O "O4'" . DC  B 1 50  ? -39.949  -15.367 50.055 1.00 69.13  ? 195  DC  J "O4'" 1 
ATOM   3973  C "C3'" . DC  B 1 50  ? -41.109  -14.318 48.260 1.00 70.97  ? 195  DC  J "C3'" 1 
ATOM   3974  O "O3'" . DC  B 1 50  ? -40.711  -12.950 48.142 1.00 76.34  ? 195  DC  J "O3'" 1 
ATOM   3975  C "C2'" . DC  B 1 50  ? -40.039  -15.248 47.713 1.00 67.63  ? 195  DC  J "C2'" 1 
ATOM   3976  C "C1'" . DC  B 1 50  ? -39.112  -15.407 48.905 1.00 67.31  ? 195  DC  J "C1'" 1 
ATOM   3977  N N1    . DC  B 1 50  ? -38.338  -16.663 48.953 1.00 81.76  ? 195  DC  J N1    1 
ATOM   3978  C C2    . DC  B 1 50  ? -36.945  -16.600 49.178 1.00 81.28  ? 195  DC  J C2    1 
ATOM   3979  O O2    . DC  B 1 50  ? -36.394  -15.489 49.293 1.00 82.37  ? 195  DC  J O2    1 
ATOM   3980  N N3    . DC  B 1 50  ? -36.238  -17.744 49.261 1.00 80.37  ? 195  DC  J N3    1 
ATOM   3981  C C4    . DC  B 1 50  ? -36.852  -18.914 49.117 1.00 81.53  ? 195  DC  J C4    1 
ATOM   3982  N N4    . DC  B 1 50  ? -36.109  -20.016 49.214 1.00 80.39  ? 195  DC  J N4    1 
ATOM   3983  C C5    . DC  B 1 50  ? -38.256  -19.009 48.871 1.00 81.99  ? 195  DC  J C5    1 
ATOM   3984  C C6    . DC  B 1 50  ? -38.952  -17.871 48.798 1.00 82.32  ? 195  DC  J C6    1 
ATOM   3985  P P     . DA  B 1 51  ? -40.985  -12.149 46.776 1.00 75.02  ? 196  DA  J P     1 
ATOM   3986  O OP1   . DA  B 1 51  ? -41.647  -10.870 47.134 1.00 94.32  ? 196  DA  J OP1   1 
ATOM   3987  O OP2   . DA  B 1 51  ? -41.619  -13.047 45.778 1.00 93.17  ? 196  DA  J OP2   1 
ATOM   3988  O "O5'" . DA  B 1 51  ? -39.511  -11.837 46.296 1.00 78.18  ? 196  DA  J "O5'" 1 
ATOM   3989  C "C5'" . DA  B 1 51  ? -38.535  -11.424 47.236 1.00 83.23  ? 196  DA  J "C5'" 1 
ATOM   3990  C "C4'" . DA  B 1 51  ? -37.168  -11.522 46.611 1.00 86.89  ? 196  DA  J "C4'" 1 
ATOM   3991  O "O4'" . DA  B 1 51  ? -36.609  -12.844 46.812 1.00 86.96  ? 196  DA  J "O4'" 1 
ATOM   3992  C "C3'" . DA  B 1 51  ? -37.215  -11.293 45.102 1.00 90.27  ? 196  DA  J "C3'" 1 
ATOM   3993  O "O3'" . DA  B 1 51  ? -36.147  -10.440 44.695 1.00 97.07  ? 196  DA  J "O3'" 1 
ATOM   3994  C "C2'" . DA  B 1 51  ? -37.067  -12.690 44.523 1.00 88.42  ? 196  DA  J "C2'" 1 
ATOM   3995  C "C1'" . DA  B 1 51  ? -36.200  -13.379 45.564 1.00 88.05  ? 196  DA  J "C1'" 1 
ATOM   3996  N N9    . DA  B 1 51  ? -36.361  -14.829 45.628 1.00 107.72 ? 196  DA  J N9    1 
ATOM   3997  C C8    . DA  B 1 51  ? -37.454  -15.579 45.260 1.00 109.54 ? 196  DA  J C8    1 
ATOM   3998  N N7    . DA  B 1 51  ? -37.300  -16.867 45.450 1.00 109.33 ? 196  DA  J N7    1 
ATOM   3999  C C5    . DA  B 1 51  ? -36.019  -16.974 45.973 1.00 108.92 ? 196  DA  J C5    1 
ATOM   4000  C C6    . DA  B 1 51  ? -35.258  -18.081 46.385 1.00 109.70 ? 196  DA  J C6    1 
ATOM   4001  N N6    . DA  B 1 51  ? -35.700  -19.341 46.335 1.00 110.31 ? 196  DA  J N6    1 
ATOM   4002  N N1    . DA  B 1 51  ? -34.012  -17.844 46.857 1.00 110.53 ? 196  DA  J N1    1 
ATOM   4003  C C2    . DA  B 1 51  ? -33.574  -16.575 46.907 1.00 110.13 ? 196  DA  J C2    1 
ATOM   4004  N N3    . DA  B 1 51  ? -34.196  -15.454 46.549 1.00 108.68 ? 196  DA  J N3    1 
ATOM   4005  C C4    . DA  B 1 51  ? -35.428  -15.726 46.085 1.00 108.51 ? 196  DA  J C4    1 
ATOM   4006  P P     . DT  B 1 52  ? -36.100  -9.904  43.184 1.00 118.81 ? 197  DT  J P     1 
ATOM   4007  O OP1   . DT  B 1 52  ? -35.948  -8.422  43.215 1.00 115.89 ? 197  DT  J OP1   1 
ATOM   4008  O OP2   . DT  B 1 52  ? -37.240  -10.515 42.450 1.00 114.45 ? 197  DT  J OP2   1 
ATOM   4009  O "O5'" . DT  B 1 52  ? -34.762  -10.558 42.640 1.00 120.24 ? 197  DT  J "O5'" 1 
ATOM   4010  C "C5'" . DT  B 1 52  ? -34.280  -11.758 43.226 1.00 123.36 ? 197  DT  J "C5'" 1 
ATOM   4011  C "C4'" . DT  B 1 52  ? -32.774  -11.754 43.241 1.00 125.76 ? 197  DT  J "C4'" 1 
ATOM   4012  O "O4'" . DT  B 1 52  ? -32.318  -12.998 43.811 1.00 127.69 ? 197  DT  J "O4'" 1 
ATOM   4013  C "C3'" . DT  B 1 52  ? -32.201  -11.698 41.835 1.00 127.53 ? 197  DT  J "C3'" 1 
ATOM   4014  O "O3'" . DT  B 1 52  ? -30.998  -10.935 41.817 1.00 128.93 ? 197  DT  J "O3'" 1 
ATOM   4015  C "C2'" . DT  B 1 52  ? -32.004  -13.157 41.463 1.00 128.27 ? 197  DT  J "C2'" 1 
ATOM   4016  C "C1'" . DT  B 1 52  ? -31.877  -13.888 42.797 1.00 129.21 ? 197  DT  J "C1'" 1 
ATOM   4017  N N1    . DT  B 1 52  ? -32.731  -15.090 42.878 1.00 126.91 ? 197  DT  J N1    1 
ATOM   4018  C C2    . DT  B 1 52  ? -32.235  -16.213 43.498 1.00 127.53 ? 197  DT  J C2    1 
ATOM   4019  O O2    . DT  B 1 52  ? -31.119  -16.266 43.989 1.00 128.28 ? 197  DT  J O2    1 
ATOM   4020  N N3    . DT  B 1 52  ? -33.101  -17.280 43.525 1.00 127.76 ? 197  DT  J N3    1 
ATOM   4021  C C4    . DT  B 1 52  ? -34.381  -17.331 43.007 1.00 127.70 ? 197  DT  J C4    1 
ATOM   4022  O O4    . DT  B 1 52  ? -35.041  -18.361 43.107 1.00 128.62 ? 197  DT  J O4    1 
ATOM   4023  C C5    . DT  B 1 52  ? -34.835  -16.119 42.373 1.00 127.51 ? 197  DT  J C5    1 
ATOM   4024  C C7    . DT  B 1 52  ? -36.209  -16.081 41.783 1.00 127.53 ? 197  DT  J C7    1 
ATOM   4025  C C6    . DT  B 1 52  ? -34.000  -15.075 42.341 1.00 126.82 ? 197  DT  J C6    1 
ATOM   4026  P P     . DC  B 1 53  ? -30.428  -10.401 40.420 1.00 128.50 ? 198  DC  J P     1 
ATOM   4027  O OP1   . DC  B 1 53  ? -29.477  -9.307  40.728 1.00 108.23 ? 198  DC  J OP1   1 
ATOM   4028  O OP2   . DC  B 1 53  ? -31.568  -10.152 39.493 1.00 107.78 ? 198  DC  J OP2   1 
ATOM   4029  O "O5'" . DC  B 1 53  ? -29.602  -11.652 39.895 1.00 127.72 ? 198  DC  J "O5'" 1 
ATOM   4030  C "C5'" . DC  B 1 53  ? -28.592  -12.246 40.709 1.00 127.11 ? 198  DC  J "C5'" 1 
ATOM   4031  C "C4'" . DC  B 1 53  ? -28.043  -13.474 40.025 1.00 127.72 ? 198  DC  J "C4'" 1 
ATOM   4032  O "O4'" . DC  B 1 53  ? -28.820  -14.646 40.371 1.00 128.35 ? 198  DC  J "O4'" 1 
ATOM   4033  C "C3'" . DC  B 1 53  ? -28.090  -13.359 38.501 1.00 129.10 ? 198  DC  J "C3'" 1 
ATOM   4034  O "O3'" . DC  B 1 53  ? -26.894  -13.859 37.916 1.00 130.28 ? 198  DC  J "O3'" 1 
ATOM   4035  C "C2'" . DC  B 1 53  ? -29.263  -14.237 38.113 1.00 128.75 ? 198  DC  J "C2'" 1 
ATOM   4036  C "C1'" . DC  B 1 53  ? -29.214  -15.311 39.183 1.00 128.22 ? 198  DC  J "C1'" 1 
ATOM   4037  N N1    . DC  B 1 53  ? -30.502  -15.978 39.431 1.00 107.67 ? 198  DC  J N1    1 
ATOM   4038  C C2    . DC  B 1 53  ? -30.501  -17.273 39.964 1.00 107.26 ? 198  DC  J C2    1 
ATOM   4039  O O2    . DC  B 1 53  ? -29.418  -17.802 40.251 1.00 106.92 ? 198  DC  J O2    1 
ATOM   4040  N N3    . DC  B 1 53  ? -31.677  -17.911 40.154 1.00 107.04 ? 198  DC  J N3    1 
ATOM   4041  C C4    . DC  B 1 53  ? -32.823  -17.301 39.844 1.00 106.37 ? 198  DC  J C4    1 
ATOM   4042  N N4    . DC  B 1 53  ? -33.959  -17.969 40.039 1.00 106.50 ? 198  DC  J N4    1 
ATOM   4043  C C5    . DC  B 1 53  ? -32.855  -15.976 39.317 1.00 106.27 ? 198  DC  J C5    1 
ATOM   4044  C C6    . DC  B 1 53  ? -31.684  -15.358 39.130 1.00 106.83 ? 198  DC  J C6    1 
ATOM   4045  P P     . DA  B 1 54  ? -26.256  -13.098 36.658 1.00 139.24 ? 199  DA  J P     1 
ATOM   4046  O OP1   . DA  B 1 54  ? -25.465  -11.959 37.186 1.00 111.42 ? 199  DA  J OP1   1 
ATOM   4047  O OP2   . DA  B 1 54  ? -27.328  -12.850 35.659 1.00 110.39 ? 199  DA  J OP2   1 
ATOM   4048  O "O5'" . DA  B 1 54  ? -25.264  -14.177 36.049 1.00 140.60 ? 199  DA  J "O5'" 1 
ATOM   4049  C "C5'" . DA  B 1 54  ? -24.997  -15.398 36.735 1.00 142.97 ? 199  DA  J "C5'" 1 
ATOM   4050  C "C4'" . DA  B 1 54  ? -25.272  -16.568 35.822 1.00 144.74 ? 199  DA  J "C4'" 1 
ATOM   4051  O "O4'" . DA  B 1 54  ? -26.551  -17.182 36.124 1.00 145.42 ? 199  DA  J "O4'" 1 
ATOM   4052  C "C3'" . DA  B 1 54  ? -25.314  -16.193 34.338 1.00 145.50 ? 199  DA  J "C3'" 1 
ATOM   4053  O "O3'" . DA  B 1 54  ? -24.636  -17.182 33.565 1.00 146.44 ? 199  DA  J "O3'" 1 
ATOM   4054  C "C2'" . DA  B 1 54  ? -26.799  -16.201 34.018 1.00 145.49 ? 199  DA  J "C2'" 1 
ATOM   4055  C "C1'" . DA  B 1 54  ? -27.301  -17.311 34.924 1.00 146.16 ? 199  DA  J "C1'" 1 
ATOM   4056  N N9    . DA  B 1 54  ? -28.725  -17.245 35.261 1.00 118.52 ? 199  DA  J N9    1 
ATOM   4057  C C8    . DA  B 1 54  ? -29.572  -16.161 35.190 1.00 118.20 ? 199  DA  J C8    1 
ATOM   4058  N N7    . DA  B 1 54  ? -30.799  -16.422 35.577 1.00 117.81 ? 199  DA  J N7    1 
ATOM   4059  C C5    . DA  B 1 54  ? -30.760  -17.765 35.922 1.00 117.68 ? 199  DA  J C5    1 
ATOM   4060  C C6    . DA  B 1 54  ? -31.741  -18.642 36.407 1.00 117.45 ? 199  DA  J C6    1 
ATOM   4061  N N6    . DA  B 1 54  ? -33.005  -18.282 36.632 1.00 117.31 ? 199  DA  J N6    1 
ATOM   4062  N N1    . DA  B 1 54  ? -31.375  -19.919 36.650 1.00 117.12 ? 199  DA  J N1    1 
ATOM   4063  C C2    . DA  B 1 54  ? -30.106  -20.282 36.410 1.00 116.70 ? 199  DA  J C2    1 
ATOM   4064  N N3    . DA  B 1 54  ? -29.095  -19.552 35.951 1.00 116.99 ? 199  DA  J N3    1 
ATOM   4065  C C4    . DA  B 1 54  ? -29.491  -18.287 35.726 1.00 117.86 ? 199  DA  J C4    1 
ATOM   4066  P P     . DA  B 1 55  ? -24.388  -16.943 31.995 1.00 134.20 ? 200  DA  J P     1 
ATOM   4067  O OP1   . DA  B 1 55  ? -22.930  -16.738 31.795 1.00 120.72 ? 200  DA  J OP1   1 
ATOM   4068  O OP2   . DA  B 1 55  ? -25.350  -15.933 31.471 1.00 119.28 ? 200  DA  J OP2   1 
ATOM   4069  O "O5'" . DA  B 1 55  ? -24.765  -18.361 31.388 1.00 132.81 ? 200  DA  J "O5'" 1 
ATOM   4070  C "C5'" . DA  B 1 55  ? -24.430  -19.559 32.087 1.00 131.19 ? 200  DA  J "C5'" 1 
ATOM   4071  C "C4'" . DA  B 1 55  ? -25.292  -20.692 31.592 1.00 130.55 ? 200  DA  J "C4'" 1 
ATOM   4072  O "O4'" . DA  B 1 55  ? -26.611  -20.597 32.182 1.00 130.53 ? 200  DA  J "O4'" 1 
ATOM   4073  C "C3'" . DA  B 1 55  ? -25.496  -20.627 30.080 1.00 130.52 ? 200  DA  J "C3'" 1 
ATOM   4074  O "O3'" . DA  B 1 55  ? -25.465  -21.927 29.495 1.00 131.40 ? 200  DA  J "O3'" 1 
ATOM   4075  C "C2'" . DA  B 1 55  ? -26.866  -19.991 29.931 1.00 130.08 ? 200  DA  J "C2'" 1 
ATOM   4076  C "C1'" . DA  B 1 55  ? -27.595  -20.501 31.162 1.00 129.92 ? 200  DA  J "C1'" 1 
ATOM   4077  N N9    . DA  B 1 55  ? -28.662  -19.619 31.638 1.00 115.96 ? 200  DA  J N9    1 
ATOM   4078  C C8    . DA  B 1 55  ? -28.704  -18.248 31.596 1.00 115.26 ? 200  DA  J C8    1 
ATOM   4079  N N7    . DA  B 1 55  ? -29.804  -17.735 32.093 1.00 114.70 ? 200  DA  J N7    1 
ATOM   4080  C C5    . DA  B 1 55  ? -30.535  -18.843 32.489 1.00 114.56 ? 200  DA  J C5    1 
ATOM   4081  C C6    . DA  B 1 55  ? -31.796  -18.973 33.086 1.00 113.79 ? 200  DA  J C6    1 
ATOM   4082  N N6    . DA  B 1 55  ? -32.571  -17.937 33.408 1.00 112.76 ? 200  DA  J N6    1 
ATOM   4083  N N1    . DA  B 1 55  ? -32.240  -20.219 33.348 1.00 113.81 ? 200  DA  J N1    1 
ATOM   4084  C C2    . DA  B 1 55  ? -31.459  -21.255 33.033 1.00 113.90 ? 200  DA  J C2    1 
ATOM   4085  N N3    . DA  B 1 55  ? -30.255  -21.262 32.472 1.00 114.38 ? 200  DA  J N3    1 
ATOM   4086  C C4    . DA  B 1 55  ? -29.845  -20.009 32.220 1.00 115.20 ? 200  DA  J C4    1 
ATOM   4087  P P     . DA  B 1 56  ? -25.758  -22.087 27.928 1.00 151.42 ? 201  DA  J P     1 
ATOM   4088  O OP1   . DA  B 1 56  ? -25.056  -23.298 27.442 1.00 110.54 ? 201  DA  J OP1   1 
ATOM   4089  O OP2   . DA  B 1 56  ? -25.530  -20.779 27.257 1.00 109.64 ? 201  DA  J OP2   1 
ATOM   4090  O "O5'" . DA  B 1 56  ? -27.315  -22.378 27.892 1.00 151.14 ? 201  DA  J "O5'" 1 
ATOM   4091  C "C5'" . DA  B 1 56  ? -27.827  -23.645 28.270 1.00 149.66 ? 201  DA  J "C5'" 1 
ATOM   4092  C "C4'" . DA  B 1 56  ? -29.150  -23.863 27.584 1.00 148.79 ? 201  DA  J "C4'" 1 
ATOM   4093  O "O4'" . DA  B 1 56  ? -30.157  -23.027 28.204 1.00 150.26 ? 201  DA  J "O4'" 1 
ATOM   4094  C "C3'" . DA  B 1 56  ? -29.103  -23.449 26.113 1.00 146.84 ? 201  DA  J "C3'" 1 
ATOM   4095  O "O3'" . DA  B 1 56  ? -29.934  -24.309 25.350 1.00 142.30 ? 201  DA  J "O3'" 1 
ATOM   4096  C "C2'" . DA  B 1 56  ? -29.702  -22.057 26.124 1.00 147.84 ? 201  DA  J "C2'" 1 
ATOM   4097  C "C1'" . DA  B 1 56  ? -30.743  -22.188 27.220 1.00 150.19 ? 201  DA  J "C1'" 1 
ATOM   4098  N N9    . DA  B 1 56  ? -31.116  -20.930 27.861 1.00 109.95 ? 201  DA  J N9    1 
ATOM   4099  C C8    . DA  B 1 56  ? -30.568  -19.685 27.668 1.00 110.56 ? 201  DA  J C8    1 
ATOM   4100  N N7    . DA  B 1 56  ? -31.131  -18.743 28.384 1.00 110.87 ? 201  DA  J N7    1 
ATOM   4101  C C5    . DA  B 1 56  ? -32.118  -19.412 29.096 1.00 110.67 ? 201  DA  J C5    1 
ATOM   4102  C C6    . DA  B 1 56  ? -33.068  -18.974 30.030 1.00 110.50 ? 201  DA  J C6    1 
ATOM   4103  N N6    . DA  B 1 56  ? -33.198  -17.704 30.413 1.00 110.53 ? 201  DA  J N6    1 
ATOM   4104  N N1    . DA  B 1 56  ? -33.893  -19.895 30.562 1.00 111.05 ? 201  DA  J N1    1 
ATOM   4105  C C2    . DA  B 1 56  ? -33.770  -21.168 30.170 1.00 111.19 ? 201  DA  J C2    1 
ATOM   4106  N N3    . DA  B 1 56  ? -32.924  -21.703 29.295 1.00 110.79 ? 201  DA  J N3    1 
ATOM   4107  C C4    . DA  B 1 56  ? -32.115  -20.760 28.788 1.00 110.57 ? 201  DA  J C4    1 
ATOM   4108  P P     . DA  B 1 57  ? -29.314  -25.628 24.694 1.00 152.87 ? 202  DA  J P     1 
ATOM   4109  O OP1   . DA  B 1 57  ? -28.182  -26.072 25.553 1.00 129.28 ? 202  DA  J OP1   1 
ATOM   4110  O OP2   . DA  B 1 57  ? -29.089  -25.356 23.251 1.00 129.47 ? 202  DA  J OP2   1 
ATOM   4111  O "O5'" . DA  B 1 57  ? -30.495  -26.681 24.840 1.00 152.27 ? 202  DA  J "O5'" 1 
ATOM   4112  C "C5'" . DA  B 1 57  ? -31.045  -26.986 26.121 1.00 147.01 ? 202  DA  J "C5'" 1 
ATOM   4113  C "C4'" . DA  B 1 57  ? -32.545  -26.800 26.103 1.00 143.04 ? 202  DA  J "C4'" 1 
ATOM   4114  O "O4'" . DA  B 1 57  ? -32.923  -25.412 26.260 1.00 142.09 ? 202  DA  J "O4'" 1 
ATOM   4115  C "C3'" . DA  B 1 57  ? -33.221  -27.267 24.818 1.00 141.11 ? 202  DA  J "C3'" 1 
ATOM   4116  O "O3'" . DA  B 1 57  ? -34.485  -27.804 25.162 1.00 140.57 ? 202  DA  J "O3'" 1 
ATOM   4117  C "C2'" . DA  B 1 57  ? -33.443  -25.972 24.059 1.00 139.61 ? 202  DA  J "C2'" 1 
ATOM   4118  C "C1'" . DA  B 1 57  ? -33.798  -25.051 25.203 1.00 139.58 ? 202  DA  J "C1'" 1 
ATOM   4119  N N9    . DA  B 1 57  ? -33.626  -23.627 24.948 1.00 115.01 ? 202  DA  J N9    1 
ATOM   4120  C C8    . DA  B 1 57  ? -32.937  -22.999 23.942 1.00 113.50 ? 202  DA  J C8    1 
ATOM   4121  N N7    . DA  B 1 57  ? -32.952  -21.691 24.032 1.00 112.61 ? 202  DA  J N7    1 
ATOM   4122  C C5    . DA  B 1 57  ? -33.709  -21.444 25.173 1.00 112.57 ? 202  DA  J C5    1 
ATOM   4123  C C6    . DA  B 1 57  ? -34.088  -20.254 25.828 1.00 111.22 ? 202  DA  J C6    1 
ATOM   4124  N N6    . DA  B 1 57  ? -33.724  -19.034 25.426 1.00 109.07 ? 202  DA  J N6    1 
ATOM   4125  N N1    . DA  B 1 57  ? -34.858  -20.364 26.933 1.00 111.25 ? 202  DA  J N1    1 
ATOM   4126  C C2    . DA  B 1 57  ? -35.209  -21.584 27.350 1.00 110.82 ? 202  DA  J C2    1 
ATOM   4127  N N3    . DA  B 1 57  ? -34.904  -22.769 26.833 1.00 113.35 ? 202  DA  J N3    1 
ATOM   4128  C C4    . DA  B 1 57  ? -34.142  -22.626 25.734 1.00 113.99 ? 202  DA  J C4    1 
ATOM   4129  P P     . DG  B 1 58  ? -35.063  -29.047 24.349 1.00 93.35  ? 203  DG  J P     1 
ATOM   4130  O OP1   . DG  B 1 58  ? -34.264  -30.228 24.777 1.00 118.35 ? 203  DG  J OP1   1 
ATOM   4131  O OP2   . DG  B 1 58  ? -35.146  -28.692 22.906 1.00 116.40 ? 203  DG  J OP2   1 
ATOM   4132  O "O5'" . DG  B 1 58  ? -36.536  -29.172 24.934 1.00 90.98  ? 203  DG  J "O5'" 1 
ATOM   4133  C "C5'" . DG  B 1 58  ? -36.760  -29.046 26.335 1.00 84.05  ? 203  DG  J "C5'" 1 
ATOM   4134  C "C4'" . DG  B 1 58  ? -37.877  -28.065 26.601 1.00 79.25  ? 203  DG  J "C4'" 1 
ATOM   4135  O "O4'" . DG  B 1 58  ? -37.488  -26.728 26.196 1.00 76.97  ? 203  DG  J "O4'" 1 
ATOM   4136  C "C3'" . DG  B 1 58  ? -39.171  -28.368 25.852 1.00 75.54  ? 203  DG  J "C3'" 1 
ATOM   4137  O "O3'" . DG  B 1 58  ? -40.279  -28.107 26.709 1.00 73.88  ? 203  DG  J "O3'" 1 
ATOM   4138  C "C2'" . DG  B 1 58  ? -39.147  -27.382 24.700 1.00 74.17  ? 203  DG  J "C2'" 1 
ATOM   4139  C "C1'" . DG  B 1 58  ? -38.476  -26.184 25.337 1.00 75.57  ? 203  DG  J "C1'" 1 
ATOM   4140  N N9    . DG  B 1 58  ? -37.814  -25.298 24.389 1.00 99.58  ? 203  DG  J N9    1 
ATOM   4141  C C8    . DG  B 1 58  ? -37.062  -25.669 23.304 1.00 100.22 ? 203  DG  J C8    1 
ATOM   4142  N N7    . DG  B 1 58  ? -36.599  -24.655 22.628 1.00 100.08 ? 203  DG  J N7    1 
ATOM   4143  C C5    . DG  B 1 58  ? -37.071  -23.544 23.312 1.00 99.81  ? 203  DG  J C5    1 
ATOM   4144  C C6    . DG  B 1 58  ? -36.889  -22.159 23.054 1.00 99.25  ? 203  DG  J C6    1 
ATOM   4145  O O6    . DG  B 1 58  ? -36.244  -21.621 22.142 1.00 99.12  ? 203  DG  J O6    1 
ATOM   4146  N N1    . DG  B 1 58  ? -37.548  -21.373 23.992 1.00 98.19  ? 203  DG  J N1    1 
ATOM   4147  C C2    . DG  B 1 58  ? -38.282  -21.851 25.041 1.00 98.85  ? 203  DG  J C2    1 
ATOM   4148  N N2    . DG  B 1 58  ? -38.848  -20.925 25.820 1.00 101.02 ? 203  DG  J N2    1 
ATOM   4149  N N3    . DG  B 1 58  ? -38.452  -23.139 25.303 1.00 99.56  ? 203  DG  J N3    1 
ATOM   4150  C C4    . DG  B 1 58  ? -37.824  -23.923 24.401 1.00 99.61  ? 203  DG  J C4    1 
ATOM   4151  P P     . DG  B 1 59  ? -41.769  -28.385 26.185 1.00 88.52  ? 204  DG  J P     1 
ATOM   4152  O OP1   . DG  B 1 59  ? -42.536  -28.962 27.329 1.00 70.04  ? 204  DG  J OP1   1 
ATOM   4153  O OP2   . DG  B 1 59  ? -41.718  -29.084 24.873 1.00 72.02  ? 204  DG  J OP2   1 
ATOM   4154  O "O5'" . DG  B 1 59  ? -42.343  -26.939 25.906 1.00 87.19  ? 204  DG  J "O5'" 1 
ATOM   4155  C "C5'" . DG  B 1 59  ? -42.254  -25.936 26.897 1.00 83.91  ? 204  DG  J "C5'" 1 
ATOM   4156  C "C4'" . DG  B 1 59  ? -42.691  -24.622 26.311 1.00 80.76  ? 204  DG  J "C4'" 1 
ATOM   4157  O "O4'" . DG  B 1 59  ? -41.701  -24.159 25.357 1.00 81.09  ? 204  DG  J "O4'" 1 
ATOM   4158  C "C3'" . DG  B 1 59  ? -43.997  -24.756 25.533 1.00 79.72  ? 204  DG  J "C3'" 1 
ATOM   4159  O "O3'" . DG  B 1 59  ? -44.790  -23.610 25.785 1.00 76.75  ? 204  DG  J "O3'" 1 
ATOM   4160  C "C2'" . DG  B 1 59  ? -43.539  -24.765 24.085 1.00 80.50  ? 204  DG  J "C2'" 1 
ATOM   4161  C "C1'" . DG  B 1 59  ? -42.363  -23.818 24.158 1.00 83.23  ? 204  DG  J "C1'" 1 
ATOM   4162  N N9    . DG  B 1 59  ? -41.407  -23.888 23.057 1.00 70.08  ? 204  DG  J N9    1 
ATOM   4163  C C8    . DG  B 1 59  ? -40.987  -25.006 22.375 1.00 71.64  ? 204  DG  J C8    1 
ATOM   4164  N N7    . DG  B 1 59  ? -40.166  -24.732 21.396 1.00 72.33  ? 204  DG  J N7    1 
ATOM   4165  C C5    . DG  B 1 59  ? -40.031  -23.352 21.442 1.00 73.65  ? 204  DG  J C5    1 
ATOM   4166  C C6    . DG  B 1 59  ? -39.286  -22.481 20.618 1.00 75.38  ? 204  DG  J C6    1 
ATOM   4167  O O6    . DG  B 1 59  ? -38.573  -22.761 19.652 1.00 76.40  ? 204  DG  J O6    1 
ATOM   4168  N N1    . DG  B 1 59  ? -39.427  -21.156 21.013 1.00 77.86  ? 204  DG  J N1    1 
ATOM   4169  C C2    . DG  B 1 59  ? -40.180  -20.724 22.075 1.00 78.19  ? 204  DG  J C2    1 
ATOM   4170  N N2    . DG  B 1 59  ? -40.160  -19.402 22.311 1.00 79.21  ? 204  DG  J N2    1 
ATOM   4171  N N3    . DG  B 1 59  ? -40.891  -21.530 22.850 1.00 76.86  ? 204  DG  J N3    1 
ATOM   4172  C C4    . DG  B 1 59  ? -40.773  -22.820 22.474 1.00 73.71  ? 204  DG  J C4    1 
ATOM   4173  P P     . DC  B 1 60  ? -46.370  -23.682 25.601 1.00 63.99  ? 205  DC  J P     1 
ATOM   4174  O OP1   . DC  B 1 60  ? -46.954  -23.966 26.933 1.00 64.03  ? 205  DC  J OP1   1 
ATOM   4175  O OP2   . DC  B 1 60  ? -46.709  -24.534 24.445 1.00 64.90  ? 205  DC  J OP2   1 
ATOM   4176  O "O5'" . DC  B 1 60  ? -46.728  -22.191 25.203 1.00 63.80  ? 205  DC  J "O5'" 1 
ATOM   4177  C "C5'" . DC  B 1 60  ? -46.165  -21.117 25.939 1.00 60.39  ? 205  DC  J "C5'" 1 
ATOM   4178  C "C4'" . DC  B 1 60  ? -45.890  -19.942 25.033 1.00 60.21  ? 205  DC  J "C4'" 1 
ATOM   4179  O "O4'" . DC  B 1 60  ? -44.776  -20.219 24.144 1.00 59.09  ? 205  DC  J "O4'" 1 
ATOM   4180  C "C3'" . DC  B 1 60  ? -47.063  -19.511 24.152 1.00 61.50  ? 205  DC  J "C3'" 1 
ATOM   4181  O "O3'" . DC  B 1 60  ? -47.334  -18.136 24.379 1.00 65.03  ? 205  DC  J "O3'" 1 
ATOM   4182  C "C2'" . DC  B 1 60  ? -46.582  -19.751 22.728 1.00 60.40  ? 205  DC  J "C2'" 1 
ATOM   4183  C "C1'" . DC  B 1 60  ? -45.067  -19.702 22.853 1.00 58.97  ? 205  DC  J "C1'" 1 
ATOM   4184  N N1    . DC  B 1 60  ? -44.330  -20.517 21.860 1.00 60.83  ? 205  DC  J N1    1 
ATOM   4185  C C2    . DC  B 1 60  ? -43.467  -19.874 20.946 1.00 61.38  ? 205  DC  J C2    1 
ATOM   4186  O O2    . DC  B 1 60  ? -43.350  -18.647 20.992 1.00 64.65  ? 205  DC  J O2    1 
ATOM   4187  N N3    . DC  B 1 60  ? -42.790  -20.608 20.046 1.00 61.18  ? 205  DC  J N3    1 
ATOM   4188  C C4    . DC  B 1 60  ? -42.933  -21.933 20.031 1.00 61.23  ? 205  DC  J C4    1 
ATOM   4189  N N4    . DC  B 1 60  ? -42.220  -22.623 19.145 1.00 59.66  ? 205  DC  J N4    1 
ATOM   4190  C C5    . DC  B 1 60  ? -43.806  -22.614 20.932 1.00 60.13  ? 205  DC  J C5    1 
ATOM   4191  C C6    . DC  B 1 60  ? -44.477  -21.876 21.823 1.00 60.32  ? 205  DC  J C6    1 
ATOM   4192  P P     . DA  B 1 61  ? -48.608  -17.454 23.696 1.00 71.05  ? 206  DA  J P     1 
ATOM   4193  O OP1   . DA  B 1 61  ? -48.977  -16.344 24.619 1.00 79.61  ? 206  DA  J OP1   1 
ATOM   4194  O OP2   . DA  B 1 61  ? -49.629  -18.450 23.299 1.00 80.80  ? 206  DA  J OP2   1 
ATOM   4195  O "O5'" . DA  B 1 61  ? -47.955  -16.851 22.385 1.00 72.43  ? 206  DA  J "O5'" 1 
ATOM   4196  C "C5'" . DA  B 1 61  ? -46.800  -16.037 22.506 1.00 74.17  ? 206  DA  J "C5'" 1 
ATOM   4197  C "C4'" . DA  B 1 61  ? -46.566  -15.279 21.228 1.00 75.01  ? 206  DA  J "C4'" 1 
ATOM   4198  O "O4'" . DA  B 1 61  ? -45.768  -16.080 20.335 1.00 73.50  ? 206  DA  J "O4'" 1 
ATOM   4199  C "C3'" . DA  B 1 61  ? -47.842  -14.919 20.476 1.00 76.66  ? 206  DA  J "C3'" 1 
ATOM   4200  O "O3'" . DA  B 1 61  ? -47.714  -13.598 19.940 1.00 82.14  ? 206  DA  J "O3'" 1 
ATOM   4201  C "C2'" . DA  B 1 61  ? -47.935  -15.991 19.401 1.00 75.43  ? 206  DA  J "C2'" 1 
ATOM   4202  C "C1'" . DA  B 1 61  ? -46.485  -16.392 19.154 1.00 74.51  ? 206  DA  J "C1'" 1 
ATOM   4203  N N9    . DA  B 1 61  ? -46.290  -17.818 18.918 1.00 84.97  ? 206  DA  J N9    1 
ATOM   4204  C C8    . DA  B 1 61  ? -46.941  -18.863 19.516 1.00 85.86  ? 206  DA  J C8    1 
ATOM   4205  N N7    . DA  B 1 61  ? -46.520  -20.039 19.129 1.00 86.56  ? 206  DA  J N7    1 
ATOM   4206  C C5    . DA  B 1 61  ? -45.526  -19.747 18.208 1.00 87.54  ? 206  DA  J C5    1 
ATOM   4207  C C6    . DA  B 1 61  ? -44.685  -20.563 17.436 1.00 89.76  ? 206  DA  J C6    1 
ATOM   4208  N N6    . DA  B 1 61  ? -44.704  -21.895 17.478 1.00 90.80  ? 206  DA  J N6    1 
ATOM   4209  N N1    . DA  B 1 61  ? -43.808  -19.957 16.608 1.00 90.50  ? 206  DA  J N1    1 
ATOM   4210  C C2    . DA  B 1 61  ? -43.783  -18.619 16.575 1.00 89.80  ? 206  DA  J C2    1 
ATOM   4211  N N3    . DA  B 1 61  ? -44.520  -17.746 17.258 1.00 87.01  ? 206  DA  J N3    1 
ATOM   4212  C C4    . DA  B 1 61  ? -45.381  -18.384 18.063 1.00 85.73  ? 206  DA  J C4    1 
ATOM   4213  P P     . DT  B 1 62  ? -48.919  -12.946 19.107 1.00 84.38  ? 207  DT  J P     1 
ATOM   4214  O OP1   . DT  B 1 62  ? -48.854  -11.498 19.425 1.00 95.53  ? 207  DT  J OP1   1 
ATOM   4215  O OP2   . DT  B 1 62  ? -50.184  -13.694 19.334 1.00 96.41  ? 207  DT  J OP2   1 
ATOM   4216  O "O5'" . DT  B 1 62  ? -48.453  -13.180 17.606 1.00 84.36  ? 207  DT  J "O5'" 1 
ATOM   4217  C "C5'" . DT  B 1 62  ? -47.158  -12.756 17.200 1.00 85.57  ? 207  DT  J "C5'" 1 
ATOM   4218  C "C4'" . DT  B 1 62  ? -46.958  -13.011 15.727 1.00 86.15  ? 207  DT  J "C4'" 1 
ATOM   4219  O "O4'" . DT  B 1 62  ? -46.468  -14.354 15.499 1.00 86.17  ? 207  DT  J "O4'" 1 
ATOM   4220  C "C3'" . DT  B 1 62  ? -48.225  -12.851 14.891 1.00 85.93  ? 207  DT  J "C3'" 1 
ATOM   4221  O "O3'" . DT  B 1 62  ? -47.951  -12.071 13.719 1.00 88.24  ? 207  DT  J "O3'" 1 
ATOM   4222  C "C2'" . DT  B 1 62  ? -48.603  -14.282 14.549 1.00 86.01  ? 207  DT  J "C2'" 1 
ATOM   4223  C "C1'" . DT  B 1 62  ? -47.257  -14.990 14.513 1.00 85.13  ? 207  DT  J "C1'" 1 
ATOM   4224  N N1    . DT  B 1 62  ? -47.324  -16.433 14.838 1.00 98.65  ? 207  DT  J N1    1 
ATOM   4225  C C2    . DT  B 1 62  ? -46.470  -17.298 14.184 1.00 99.45  ? 207  DT  J C2    1 
ATOM   4226  O O2    . DT  B 1 62  ? -45.627  -16.926 13.384 1.00 101.88 ? 207  DT  J O2    1 
ATOM   4227  N N3    . DT  B 1 62  ? -46.638  -18.624 14.507 1.00 97.29  ? 207  DT  J N3    1 
ATOM   4228  C C4    . DT  B 1 62  ? -47.547  -19.156 15.401 1.00 95.50  ? 207  DT  J C4    1 
ATOM   4229  O O4    . DT  B 1 62  ? -47.599  -20.372 15.571 1.00 92.33  ? 207  DT  J O4    1 
ATOM   4230  C C5    . DT  B 1 62  ? -48.387  -18.190 16.073 1.00 96.12  ? 207  DT  J C5    1 
ATOM   4231  C C7    . DT  B 1 62  ? -49.383  -18.668 17.079 1.00 94.19  ? 207  DT  J C7    1 
ATOM   4232  C C6    . DT  B 1 62  ? -48.236  -16.896 15.762 1.00 97.36  ? 207  DT  J C6    1 
ATOM   4233  P P     . DG  B 1 63  ? -49.099  -11.853 12.614 1.00 102.95 ? 208  DG  J P     1 
ATOM   4234  O OP1   . DG  B 1 63  ? -48.934  -10.482 12.054 1.00 93.69  ? 208  DG  J OP1   1 
ATOM   4235  O OP2   . DG  B 1 63  ? -50.406  -12.256 13.200 1.00 95.71  ? 208  DG  J OP2   1 
ATOM   4236  O "O5'" . DG  B 1 63  ? -48.698  -12.903 11.486 1.00 102.95 ? 208  DG  J "O5'" 1 
ATOM   4237  C "C5'" . DG  B 1 63  ? -47.375  -12.921 10.955 1.00 104.54 ? 208  DG  J "C5'" 1 
ATOM   4238  C "C4'" . DG  B 1 63  ? -47.325  -13.789 9.723  1.00 104.78 ? 208  DG  J "C4'" 1 
ATOM   4239  O "O4'" . DG  B 1 63  ? -47.228  -15.181 10.105 1.00 105.32 ? 208  DG  J "O4'" 1 
ATOM   4240  C "C3'" . DG  B 1 63  ? -48.578  -13.662 8.860  1.00 106.17 ? 208  DG  J "C3'" 1 
ATOM   4241  O "O3'" . DG  B 1 63  ? -48.245  -13.703 7.469  1.00 108.72 ? 208  DG  J "O3'" 1 
ATOM   4242  C "C2'" . DG  B 1 63  ? -49.413  -14.858 9.277  1.00 106.20 ? 208  DG  J "C2'" 1 
ATOM   4243  C "C1'" . DG  B 1 63  ? -48.372  -15.901 9.659  1.00 104.87 ? 208  DG  J "C1'" 1 
ATOM   4244  N N9    . DG  B 1 63  ? -48.799  -16.768 10.753 1.00 96.61  ? 208  DG  J N9    1 
ATOM   4245  C C8    . DG  B 1 63  ? -49.301  -16.370 11.971 1.00 95.34  ? 208  DG  J C8    1 
ATOM   4246  N N7    . DG  B 1 63  ? -49.570  -17.368 12.767 1.00 94.18  ? 208  DG  J N7    1 
ATOM   4247  C C5    . DG  B 1 63  ? -49.230  -18.494 12.031 1.00 94.62  ? 208  DG  J C5    1 
ATOM   4248  C C6    . DG  B 1 63  ? -49.286  -19.864 12.378 1.00 93.77  ? 208  DG  J C6    1 
ATOM   4249  O O6    . DG  B 1 63  ? -49.645  -20.371 13.440 1.00 93.92  ? 208  DG  J O6    1 
ATOM   4250  N N1    . DG  B 1 63  ? -48.856  -20.672 11.334 1.00 94.57  ? 208  DG  J N1    1 
ATOM   4251  C C2    . DG  B 1 63  ? -48.420  -20.220 10.116 1.00 95.74  ? 208  DG  J C2    1 
ATOM   4252  N N2    . DG  B 1 63  ? -48.061  -21.157 9.241  1.00 96.76  ? 208  DG  J N2    1 
ATOM   4253  N N3    . DG  B 1 63  ? -48.348  -18.943 9.781  1.00 95.80  ? 208  DG  J N3    1 
ATOM   4254  C C4    . DG  B 1 63  ? -48.766  -18.142 10.780 1.00 95.81  ? 208  DG  J C4    1 
ATOM   4255  P P     . DT  B 1 64  ? -49.415  -13.809 6.369  1.00 144.43 ? 209  DT  J P     1 
ATOM   4256  O OP1   . DT  B 1 64  ? -48.976  -13.002 5.213  1.00 95.69  ? 209  DT  J OP1   1 
ATOM   4257  O OP2   . DT  B 1 64  ? -50.766  -13.574 6.959  1.00 94.36  ? 209  DT  J OP2   1 
ATOM   4258  O "O5'" . DT  B 1 64  ? -49.329  -15.332 5.937  1.00 144.29 ? 209  DT  J "O5'" 1 
ATOM   4259  C "C5'" . DT  B 1 64  ? -48.066  -15.935 5.690  1.00 144.60 ? 209  DT  J "C5'" 1 
ATOM   4260  C "C4'" . DT  B 1 64  ? -48.268  -17.337 5.174  1.00 144.74 ? 209  DT  J "C4'" 1 
ATOM   4261  O "O4'" . DT  B 1 64  ? -48.672  -18.204 6.261  1.00 144.99 ? 209  DT  J "O4'" 1 
ATOM   4262  C "C3'" . DT  B 1 64  ? -49.371  -17.419 4.122  1.00 144.79 ? 209  DT  J "C3'" 1 
ATOM   4263  O "O3'" . DT  B 1 64  ? -48.987  -18.340 3.104  1.00 145.05 ? 209  DT  J "O3'" 1 
ATOM   4264  C "C2'" . DT  B 1 64  ? -50.574  -17.914 4.909  1.00 144.37 ? 209  DT  J "C2'" 1 
ATOM   4265  C "C1'" . DT  B 1 64  ? -49.942  -18.778 5.990  1.00 144.52 ? 209  DT  J "C1'" 1 
ATOM   4266  N N1    . DT  B 1 64  ? -50.694  -18.842 7.265  1.00 94.62  ? 209  DT  J N1    1 
ATOM   4267  C C2    . DT  B 1 64  ? -50.936  -20.085 7.799  1.00 93.18  ? 209  DT  J C2    1 
ATOM   4268  O O2    . DT  B 1 64  ? -50.581  -21.119 7.258  1.00 93.58  ? 209  DT  J O2    1 
ATOM   4269  N N3    . DT  B 1 64  ? -51.617  -20.077 8.991  1.00 91.35  ? 209  DT  J N3    1 
ATOM   4270  C C4    . DT  B 1 64  ? -52.079  -18.974 9.680  1.00 91.63  ? 209  DT  J C4    1 
ATOM   4271  O O4    . DT  B 1 64  ? -52.677  -19.123 10.744 1.00 90.96  ? 209  DT  J O4    1 
ATOM   4272  C C5    . DT  B 1 64  ? -51.803  -17.699 9.055  1.00 91.30  ? 209  DT  J C5    1 
ATOM   4273  C C7    . DT  B 1 64  ? -52.279  -16.447 9.719  1.00 91.04  ? 209  DT  J C7    1 
ATOM   4274  C C6    . DT  B 1 64  ? -51.130  -17.698 7.896  1.00 92.96  ? 209  DT  J C6    1 
ATOM   4275  P P     . DT  B 1 65  ? -49.655  -18.254 1.645  1.00 119.45 ? 210  DT  J P     1 
ATOM   4276  O OP1   . DT  B 1 65  ? -48.546  -18.064 0.675  1.00 91.90  ? 210  DT  J OP1   1 
ATOM   4277  O OP2   . DT  B 1 65  ? -50.819  -17.324 1.635  1.00 90.75  ? 210  DT  J OP2   1 
ATOM   4278  O "O5'" . DT  B 1 65  ? -50.229  -19.721 1.461  1.00 119.44 ? 210  DT  J "O5'" 1 
ATOM   4279  C "C5'" . DT  B 1 65  ? -49.524  -20.842 1.987  1.00 117.68 ? 210  DT  J "C5'" 1 
ATOM   4280  C "C4'" . DT  B 1 65  ? -50.482  -21.985 2.209  1.00 117.39 ? 210  DT  J "C4'" 1 
ATOM   4281  O "O4'" . DT  B 1 65  ? -51.034  -21.971 3.549  1.00 118.72 ? 210  DT  J "O4'" 1 
ATOM   4282  C "C3'" . DT  B 1 65  ? -51.671  -21.921 1.255  1.00 116.84 ? 210  DT  J "C3'" 1 
ATOM   4283  O "O3'" . DT  B 1 65  ? -51.959  -23.214 0.759  1.00 116.40 ? 210  DT  J "O3'" 1 
ATOM   4284  C "C2'" . DT  B 1 65  ? -52.809  -21.435 2.133  1.00 117.04 ? 210  DT  J "C2'" 1 
ATOM   4285  C "C1'" . DT  B 1 65  ? -52.448  -22.072 3.461  1.00 118.06 ? 210  DT  J "C1'" 1 
ATOM   4286  N N1    . DT  B 1 65  ? -53.033  -21.427 4.651  1.00 90.93  ? 210  DT  J N1    1 
ATOM   4287  C C2    . DT  B 1 65  ? -53.135  -22.170 5.805  1.00 90.61  ? 210  DT  J C2    1 
ATOM   4288  O O2    . DT  B 1 65  ? -52.765  -23.331 5.887  1.00 90.22  ? 210  DT  J O2    1 
ATOM   4289  N N3    . DT  B 1 65  ? -53.686  -21.500 6.867  1.00 89.51  ? 210  DT  J N3    1 
ATOM   4290  C C4    . DT  B 1 65  ? -54.131  -20.192 6.886  1.00 89.25  ? 210  DT  J C4    1 
ATOM   4291  O O4    . DT  B 1 65  ? -54.586  -19.715 7.918  1.00 88.97  ? 210  DT  J O4    1 
ATOM   4292  C C5    . DT  B 1 65  ? -54.004  -19.479 5.643  1.00 89.71  ? 210  DT  J C5    1 
ATOM   4293  C C7    . DT  B 1 65  ? -54.480  -18.065 5.570  1.00 89.82  ? 210  DT  J C7    1 
ATOM   4294  C C6    . DT  B 1 65  ? -53.466  -20.120 4.602  1.00 90.26  ? 210  DT  J C6    1 
ATOM   4295  P P     . DC  B 1 66  ? -52.847  -23.364 -0.554 1.00 93.99  ? 211  DC  J P     1 
ATOM   4296  O OP1   . DC  B 1 66  ? -51.959  -23.923 -1.602 1.00 100.23 ? 211  DC  J OP1   1 
ATOM   4297  O OP2   . DC  B 1 66  ? -53.563  -22.087 -0.792 1.00 96.73  ? 211  DC  J OP2   1 
ATOM   4298  O "O5'" . DC  B 1 66  ? -53.919  -24.459 -0.138 1.00 94.08  ? 211  DC  J "O5'" 1 
ATOM   4299  C "C5'" . DC  B 1 66  ? -53.545  -25.574 0.670  1.00 91.31  ? 211  DC  J "C5'" 1 
ATOM   4300  C "C4'" . DC  B 1 66  ? -54.725  -26.041 1.488  1.00 89.45  ? 211  DC  J "C4'" 1 
ATOM   4301  O "O4'" . DC  B 1 66  ? -55.003  -25.139 2.590  1.00 89.50  ? 211  DC  J "O4'" 1 
ATOM   4302  C "C3'" . DC  B 1 66  ? -56.027  -26.141 0.696  1.00 87.87  ? 211  DC  J "C3'" 1 
ATOM   4303  O "O3'" . DC  B 1 66  ? -56.745  -27.275 1.161  1.00 87.60  ? 211  DC  J "O3'" 1 
ATOM   4304  C "C2'" . DC  B 1 66  ? -56.773  -24.887 1.110  1.00 87.16  ? 211  DC  J "C2'" 1 
ATOM   4305  C "C1'" . DC  B 1 66  ? -56.385  -24.821 2.570  1.00 88.88  ? 211  DC  J "C1'" 1 
ATOM   4306  N N1    . DC  B 1 66  ? -56.578  -23.533 3.256  1.00 95.65  ? 211  DC  J N1    1 
ATOM   4307  C C2    . DC  B 1 66  ? -56.526  -23.514 4.650  1.00 95.09  ? 211  DC  J C2    1 
ATOM   4308  O O2    . DC  B 1 66  ? -56.350  -24.581 5.251  1.00 93.07  ? 211  DC  J O2    1 
ATOM   4309  N N3    . DC  B 1 66  ? -56.671  -22.339 5.305  1.00 94.33  ? 211  DC  J N3    1 
ATOM   4310  C C4    . DC  B 1 66  ? -56.871  -21.214 4.615  1.00 94.06  ? 211  DC  J C4    1 
ATOM   4311  N N4    . DC  B 1 66  ? -56.975  -20.071 5.294  1.00 91.84  ? 211  DC  J N4    1 
ATOM   4312  C C5    . DC  B 1 66  ? -56.960  -21.210 3.193  1.00 94.15  ? 211  DC  J C5    1 
ATOM   4313  C C6    . DC  B 1 66  ? -56.804  -22.380 2.559  1.00 94.43  ? 211  DC  J C6    1 
ATOM   4314  P P     . DA  B 1 67  ? -56.839  -28.582 0.245  1.00 84.87  ? 212  DA  J P     1 
ATOM   4315  O OP1   . DA  B 1 67  ? -55.463  -28.913 -0.203 1.00 98.93  ? 212  DA  J OP1   1 
ATOM   4316  O OP2   . DA  B 1 67  ? -57.930  -28.392 -0.747 1.00 99.81  ? 212  DA  J OP2   1 
ATOM   4317  O "O5'" . DA  B 1 67  ? -57.289  -29.716 1.258  1.00 83.63  ? 212  DA  J "O5'" 1 
ATOM   4318  C "C5'" . DA  B 1 67  ? -56.425  -30.137 2.309  1.00 80.78  ? 212  DA  J "C5'" 1 
ATOM   4319  C "C4'" . DA  B 1 67  ? -57.222  -30.334 3.576  1.00 79.51  ? 212  DA  J "C4'" 1 
ATOM   4320  O "O4'" . DA  B 1 67  ? -57.641  -29.053 4.102  1.00 78.55  ? 212  DA  J "O4'" 1 
ATOM   4321  C "C3'" . DA  B 1 67  ? -58.496  -31.155 3.404  1.00 77.70  ? 212  DA  J "C3'" 1 
ATOM   4322  O "O3'" . DA  B 1 67  ? -58.624  -32.008 4.537  1.00 78.01  ? 212  DA  J "O3'" 1 
ATOM   4323  C "C2'" . DA  B 1 67  ? -59.593  -30.100 3.324  1.00 75.57  ? 212  DA  J "C2'" 1 
ATOM   4324  C "C1'" . DA  B 1 67  ? -59.054  -28.975 4.188  1.00 76.68  ? 212  DA  J "C1'" 1 
ATOM   4325  N N9    . DA  B 1 67  ? -59.416  -27.615 3.800  1.00 90.99  ? 212  DA  J N9    1 
ATOM   4326  C C8    . DA  B 1 67  ? -59.350  -27.040 2.557  1.00 90.53  ? 212  DA  J C8    1 
ATOM   4327  N N7    . DA  B 1 67  ? -59.625  -25.755 2.553  1.00 91.15  ? 212  DA  J N7    1 
ATOM   4328  C C5    . DA  B 1 67  ? -59.914  -25.472 3.882  1.00 89.61  ? 212  DA  J C5    1 
ATOM   4329  C C6    . DA  B 1 67  ? -60.255  -24.275 4.549  1.00 88.70  ? 212  DA  J C6    1 
ATOM   4330  N N6    . DA  B 1 67  ? -60.334  -23.088 3.950  1.00 87.94  ? 212  DA  J N6    1 
ATOM   4331  N N1    . DA  B 1 67  ? -60.498  -24.343 5.876  1.00 88.89  ? 212  DA  J N1    1 
ATOM   4332  C C2    . DA  B 1 67  ? -60.387  -25.528 6.486  1.00 90.42  ? 212  DA  J C2    1 
ATOM   4333  N N3    . DA  B 1 67  ? -60.055  -26.714 5.977  1.00 91.38  ? 212  DA  J N3    1 
ATOM   4334  C C4    . DA  B 1 67  ? -59.826  -26.617 4.654  1.00 90.78  ? 212  DA  J C4    1 
ATOM   4335  P P     . DG  B 1 68  ? -59.677  -33.208 4.521  1.00 85.50  ? 213  DG  J P     1 
ATOM   4336  O OP1   . DG  B 1 68  ? -59.076  -34.304 5.328  1.00 88.27  ? 213  DG  J OP1   1 
ATOM   4337  O OP2   . DG  B 1 68  ? -60.124  -33.471 3.132  1.00 91.36  ? 213  DG  J OP2   1 
ATOM   4338  O "O5'" . DG  B 1 68  ? -60.913  -32.592 5.313  1.00 86.32  ? 213  DG  J "O5'" 1 
ATOM   4339  C "C5'" . DG  B 1 68  ? -60.769  -32.136 6.660  1.00 85.20  ? 213  DG  J "C5'" 1 
ATOM   4340  C "C4'" . DG  B 1 68  ? -62.029  -31.435 7.113  1.00 83.67  ? 213  DG  J "C4'" 1 
ATOM   4341  O "O4'" . DG  B 1 68  ? -62.135  -30.124 6.514  1.00 84.57  ? 213  DG  J "O4'" 1 
ATOM   4342  C "C3'" . DG  B 1 68  ? -63.332  -32.152 6.761  1.00 81.23  ? 213  DG  J "C3'" 1 
ATOM   4343  O "O3'" . DG  B 1 68  ? -64.276  -31.904 7.792  1.00 77.17  ? 213  DG  J "O3'" 1 
ATOM   4344  C "C2'" . DG  B 1 68  ? -63.806  -31.395 5.536  1.00 81.86  ? 213  DG  J "C2'" 1 
ATOM   4345  C "C1'" . DG  B 1 68  ? -63.428  -29.996 5.953  1.00 83.67  ? 213  DG  J "C1'" 1 
ATOM   4346  N N9    . DG  B 1 68  ? -63.357  -29.004 4.894  1.00 91.12  ? 213  DG  J N9    1 
ATOM   4347  C C8    . DG  B 1 68  ? -63.128  -29.218 3.561  1.00 92.75  ? 213  DG  J C8    1 
ATOM   4348  N N7    . DG  B 1 68  ? -63.078  -28.114 2.870  1.00 94.04  ? 213  DG  J N7    1 
ATOM   4349  C C5    . DG  B 1 68  ? -63.295  -27.114 3.807  1.00 92.47  ? 213  DG  J C5    1 
ATOM   4350  C C6    . DG  B 1 68  ? -63.332  -25.707 3.656  1.00 93.26  ? 213  DG  J C6    1 
ATOM   4351  O O6    . DG  B 1 68  ? -63.164  -25.039 2.629  1.00 94.89  ? 213  DG  J O6    1 
ATOM   4352  N N1    . DG  B 1 68  ? -63.586  -25.067 4.867  1.00 93.16  ? 213  DG  J N1    1 
ATOM   4353  C C2    . DG  B 1 68  ? -63.771  -25.697 6.067  1.00 91.67  ? 213  DG  J C2    1 
ATOM   4354  N N2    . DG  B 1 68  ? -64.007  -24.902 7.122  1.00 90.37  ? 213  DG  J N2    1 
ATOM   4355  N N3    . DG  B 1 68  ? -63.728  -27.012 6.222  1.00 91.17  ? 213  DG  J N3    1 
ATOM   4356  C C4    . DG  B 1 68  ? -63.485  -27.651 5.056  1.00 91.42  ? 213  DG  J C4    1 
ATOM   4357  P P     . DC  B 1 69  ? -64.419  -32.929 9.005  1.00 80.55  ? 214  DC  J P     1 
ATOM   4358  O OP1   . DC  B 1 69  ? -63.050  -33.336 9.404  1.00 67.73  ? 214  DC  J OP1   1 
ATOM   4359  O OP2   . DC  B 1 69  ? -65.434  -33.959 8.676  1.00 70.15  ? 214  DC  J OP2   1 
ATOM   4360  O "O5'" . DC  B 1 69  ? -65.020  -32.001 10.135 1.00 81.03  ? 214  DC  J "O5'" 1 
ATOM   4361  C "C5'" . DC  B 1 69  ? -64.259  -30.921 10.639 1.00 78.57  ? 214  DC  J "C5'" 1 
ATOM   4362  C "C4'" . DC  B 1 69  ? -65.131  -29.701 10.797 1.00 76.20  ? 214  DC  J "C4'" 1 
ATOM   4363  O "O4'" . DC  B 1 69  ? -65.211  -28.961 9.555  1.00 76.32  ? 214  DC  J "O4'" 1 
ATOM   4364  C "C3'" . DC  B 1 69  ? -66.568  -29.977 11.245 1.00 73.68  ? 214  DC  J "C3'" 1 
ATOM   4365  O "O3'" . DC  B 1 69  ? -66.904  -29.098 12.327 1.00 72.54  ? 214  DC  J "O3'" 1 
ATOM   4366  C "C2'" . DC  B 1 69  ? -67.385  -29.659 10.002 1.00 76.35  ? 214  DC  J "C2'" 1 
ATOM   4367  C "C1'" . DC  B 1 69  ? -66.554  -28.571 9.342  1.00 77.39  ? 214  DC  J "C1'" 1 
ATOM   4368  N N1    . DC  B 1 69  ? -66.745  -28.382 7.890  1.00 68.73  ? 214  DC  J N1    1 
ATOM   4369  C C2    . DC  B 1 69  ? -66.994  -27.082 7.403  1.00 69.96  ? 214  DC  J C2    1 
ATOM   4370  O O2    . DC  B 1 69  ? -67.092  -26.137 8.212  1.00 71.92  ? 214  DC  J O2    1 
ATOM   4371  N N3    . DC  B 1 69  ? -67.117  -26.890 6.066  1.00 70.11  ? 214  DC  J N3    1 
ATOM   4372  C C4    . DC  B 1 69  ? -67.005  -27.929 5.229  1.00 70.94  ? 214  DC  J C4    1 
ATOM   4373  N N4    . DC  B 1 69  ? -67.095  -27.685 3.912  1.00 70.47  ? 214  DC  J N4    1 
ATOM   4374  C C5    . DC  B 1 69  ? -66.784  -29.261 5.702  1.00 69.41  ? 214  DC  J C5    1 
ATOM   4375  C C6    . DC  B 1 69  ? -66.665  -29.438 7.024  1.00 68.94  ? 214  DC  J C6    1 
ATOM   4376  P P     . DG  B 1 70  ? -68.273  -29.309 13.151 1.00 61.05  ? 215  DG  J P     1 
ATOM   4377  O OP1   . DG  B 1 70  ? -67.937  -29.269 14.601 1.00 74.39  ? 215  DG  J OP1   1 
ATOM   4378  O OP2   . DG  B 1 70  ? -69.026  -30.464 12.607 1.00 74.74  ? 215  DG  J OP2   1 
ATOM   4379  O "O5'" . DG  B 1 70  ? -69.065  -27.980 12.780 1.00 63.75  ? 215  DG  J "O5'" 1 
ATOM   4380  C "C5'" . DG  B 1 70  ? -68.409  -26.710 12.870 1.00 68.92  ? 215  DG  J "C5'" 1 
ATOM   4381  C "C4'" . DG  B 1 70  ? -69.341  -25.609 12.428 1.00 72.89  ? 215  DG  J "C4'" 1 
ATOM   4382  O "O4'" . DG  B 1 70  ? -69.430  -25.595 10.989 1.00 73.60  ? 215  DG  J "O4'" 1 
ATOM   4383  C "C3'" . DG  B 1 70  ? -70.764  -25.798 12.932 1.00 75.95  ? 215  DG  J "C3'" 1 
ATOM   4384  O "O3'" . DG  B 1 70  ? -71.365  -24.539 13.206 1.00 82.41  ? 215  DG  J "O3'" 1 
ATOM   4385  C "C2'" . DG  B 1 70  ? -71.452  -26.507 11.781 1.00 73.47  ? 215  DG  J "C2'" 1 
ATOM   4386  C "C1'" . DG  B 1 70  ? -70.737  -25.951 10.566 1.00 73.25  ? 215  DG  J "C1'" 1 
ATOM   4387  N N9    . DG  B 1 70  ? -70.587  -26.910 9.478  1.00 82.64  ? 215  DG  J N9    1 
ATOM   4388  C C8    . DG  B 1 70  ? -70.490  -28.279 9.574  1.00 82.49  ? 215  DG  J C8    1 
ATOM   4389  N N7    . DG  B 1 70  ? -70.331  -28.861 8.418  1.00 80.63  ? 215  DG  J N7    1 
ATOM   4390  C C5    . DG  B 1 70  ? -70.333  -27.817 7.504  1.00 80.86  ? 215  DG  J C5    1 
ATOM   4391  C C6    . DG  B 1 70  ? -70.203  -27.829 6.099  1.00 80.41  ? 215  DG  J C6    1 
ATOM   4392  O O6    . DG  B 1 70  ? -70.055  -28.801 5.349  1.00 80.64  ? 215  DG  J O6    1 
ATOM   4393  N N1    . DG  B 1 70  ? -70.262  -26.546 5.569  1.00 78.33  ? 215  DG  J N1    1 
ATOM   4394  C C2    . DG  B 1 70  ? -70.430  -25.396 6.297  1.00 79.43  ? 215  DG  J C2    1 
ATOM   4395  N N2    . DG  B 1 70  ? -70.472  -24.246 5.606  1.00 78.45  ? 215  DG  J N2    1 
ATOM   4396  N N3    . DG  B 1 70  ? -70.551  -25.370 7.608  1.00 81.39  ? 215  DG  J N3    1 
ATOM   4397  C C4    . DG  B 1 70  ? -70.495  -26.608 8.143  1.00 81.62  ? 215  DG  J C4    1 
ATOM   4398  P P     . DG  B 1 71  ? -72.866  -24.485 13.756 1.00 93.48  ? 216  DG  J P     1 
ATOM   4399  O OP1   . DG  B 1 71  ? -72.870  -23.699 15.018 1.00 94.17  ? 216  DG  J OP1   1 
ATOM   4400  O OP2   . DG  B 1 71  ? -73.438  -25.855 13.737 1.00 95.18  ? 216  DG  J OP2   1 
ATOM   4401  O "O5'" . DG  B 1 71  ? -73.604  -23.650 12.631 1.00 94.23  ? 216  DG  J "O5'" 1 
ATOM   4402  C "C5'" . DG  B 1 71  ? -72.875  -22.753 11.803 1.00 96.89  ? 216  DG  J "C5'" 1 
ATOM   4403  C "C4'" . DG  B 1 71  ? -73.593  -22.578 10.490 1.00 97.87  ? 216  DG  J "C4'" 1 
ATOM   4404  O "O4'" . DG  B 1 71  ? -73.262  -23.639 9.561  1.00 97.45  ? 216  DG  J "O4'" 1 
ATOM   4405  C "C3'" . DG  B 1 71  ? -75.111  -22.612 10.653 1.00 99.44  ? 216  DG  J "C3'" 1 
ATOM   4406  O "O3'" . DG  B 1 71  ? -75.689  -21.597 9.838  1.00 102.37 ? 216  DG  J "O3'" 1 
ATOM   4407  C "C2'" . DG  B 1 71  ? -75.488  -24.003 10.161 1.00 98.10  ? 216  DG  J "C2'" 1 
ATOM   4408  C "C1'" . DG  B 1 71  ? -74.458  -24.228 9.075  1.00 97.40  ? 216  DG  J "C1'" 1 
ATOM   4409  N N9    . DG  B 1 71  ? -74.167  -25.617 8.732  1.00 99.62  ? 216  DG  J N9    1 
ATOM   4410  C C8    . DG  B 1 71  ? -74.009  -26.684 9.586  1.00 99.52  ? 216  DG  J C8    1 
ATOM   4411  N N7    . DG  B 1 71  ? -73.709  -27.796 8.965  1.00 98.99  ? 216  DG  J N7    1 
ATOM   4412  C C5    . DG  B 1 71  ? -73.678  -27.441 7.622  1.00 98.98  ? 216  DG  J C5    1 
ATOM   4413  C C6    . DG  B 1 71  ? -73.394  -28.221 6.461  1.00 98.16  ? 216  DG  J C6    1 
ATOM   4414  O O6    . DG  B 1 71  ? -73.094  -29.423 6.385  1.00 96.94  ? 216  DG  J O6    1 
ATOM   4415  N N1    . DG  B 1 71  ? -73.476  -27.458 5.304  1.00 96.91  ? 216  DG  J N1    1 
ATOM   4416  C C2    . DG  B 1 71  ? -73.786  -26.123 5.259  1.00 97.74  ? 216  DG  J C2    1 
ATOM   4417  N N2    . DG  B 1 71  ? -73.820  -25.565 4.042  1.00 98.17  ? 216  DG  J N2    1 
ATOM   4418  N N3    . DG  B 1 71  ? -74.045  -25.387 6.324  1.00 98.07  ? 216  DG  J N3    1 
ATOM   4419  C C4    . DG  B 1 71  ? -73.972  -26.104 7.462  1.00 99.54  ? 216  DG  J C4    1 
ATOM   4420  P P     . DA  B 1 73  ? -77.105  -20.968 10.237 1.00 119.85 ? 217  DA  J P     1 
ATOM   4421  O OP1   . DA  B 1 73  ? -76.852  -19.709 10.991 1.00 98.88  ? 217  DA  J OP1   1 
ATOM   4422  O OP2   . DA  B 1 73  ? -77.952  -22.038 10.831 1.00 98.13  ? 217  DA  J OP2   1 
ATOM   4423  O "O5'" . DA  B 1 73  ? -77.707  -20.588 8.820  1.00 120.24 ? 217  DA  J "O5'" 1 
ATOM   4424  C "C5'" . DA  B 1 73  ? -76.860  -20.088 7.796  1.00 117.68 ? 217  DA  J "C5'" 1 
ATOM   4425  C "C4'" . DA  B 1 73  ? -77.261  -20.668 6.463  1.00 116.52 ? 217  DA  J "C4'" 1 
ATOM   4426  O "O4'" . DA  B 1 73  ? -76.765  -22.020 6.286  1.00 115.63 ? 217  DA  J "O4'" 1 
ATOM   4427  C "C3'" . DA  B 1 73  ? -78.771  -20.739 6.247  1.00 117.34 ? 217  DA  J "C3'" 1 
ATOM   4428  O "O3'" . DA  B 1 73  ? -79.062  -20.290 4.932  1.00 122.49 ? 217  DA  J "O3'" 1 
ATOM   4429  C "C2'" . DA  B 1 73  ? -79.079  -22.221 6.370  1.00 114.20 ? 217  DA  J "C2'" 1 
ATOM   4430  C "C1'" . DA  B 1 73  ? -77.816  -22.831 5.797  1.00 113.27 ? 217  DA  J "C1'" 1 
ATOM   4431  N N9    . DA  B 1 73  ? -77.557  -24.219 6.186  1.00 90.77  ? 217  DA  J N9    1 
ATOM   4432  C C8    . DA  B 1 73  ? -77.500  -24.770 7.446  1.00 90.29  ? 217  DA  J C8    1 
ATOM   4433  N N7    . DA  B 1 73  ? -77.292  -26.065 7.446  1.00 89.25  ? 217  DA  J N7    1 
ATOM   4434  C C5    . DA  B 1 73  ? -77.194  -26.388 6.098  1.00 87.82  ? 217  DA  J C5    1 
ATOM   4435  C C6    . DA  B 1 73  ? -76.985  -27.608 5.426  1.00 87.13  ? 217  DA  J C6    1 
ATOM   4436  N N6    . DA  B 1 73  ? -76.822  -28.780 6.044  1.00 85.30  ? 217  DA  J N6    1 
ATOM   4437  N N1    . DA  B 1 73  ? -76.947  -27.582 4.076  1.00 87.33  ? 217  DA  J N1    1 
ATOM   4438  C C2    . DA  B 1 73  ? -77.100  -26.406 3.452  1.00 88.76  ? 217  DA  J C2    1 
ATOM   4439  N N3    . DA  B 1 73  ? -77.301  -25.197 3.971  1.00 89.72  ? 217  DA  J N3    1 
ATOM   4440  C C4    . DA  B 1 73  ? -77.342  -25.258 5.313  1.00 89.23  ? 217  DA  J C4    1 
ATOM   4441  P P     . DT  B 1 74  ? -80.518  -19.727 4.594  1.00 121.20 ? 218  DT  J P     1 
ATOM   4442  O OP1   . DT  B 1 74  ? -80.298  -18.420 3.923  1.00 104.17 ? 218  DT  J OP1   1 
ATOM   4443  O OP2   . DT  B 1 74  ? -81.365  -19.802 5.815  1.00 104.73 ? 218  DT  J OP2   1 
ATOM   4444  O "O5'" . DT  B 1 74  ? -81.053  -20.786 3.538  1.00 119.93 ? 218  DT  J "O5'" 1 
ATOM   4445  C "C5'" . DT  B 1 74  ? -80.278  -21.116 2.394  1.00 120.51 ? 218  DT  J "C5'" 1 
ATOM   4446  C "C4'" . DT  B 1 74  ? -80.854  -22.334 1.716  1.00 122.50 ? 218  DT  J "C4'" 1 
ATOM   4447  O "O4'" . DT  B 1 74  ? -80.307  -23.565 2.253  1.00 122.37 ? 218  DT  J "O4'" 1 
ATOM   4448  C "C3'" . DT  B 1 74  ? -82.375  -22.452 1.835  1.00 124.79 ? 218  DT  J "C3'" 1 
ATOM   4449  O "O3'" . DT  B 1 74  ? -82.923  -22.784 0.558  1.00 128.60 ? 218  DT  J "O3'" 1 
ATOM   4450  C "C2'" . DT  B 1 74  ? -82.562  -23.607 2.806  1.00 122.68 ? 218  DT  J "C2'" 1 
ATOM   4451  C "C1'" . DT  B 1 74  ? -81.375  -24.476 2.451  1.00 120.34 ? 218  DT  J "C1'" 1 
ATOM   4452  N N1    . DT  B 1 74  ? -80.971  -25.480 3.460  1.00 103.02 ? 218  DT  J N1    1 
ATOM   4453  C C2    . DT  B 1 74  ? -80.506  -26.696 2.999  1.00 101.94 ? 218  DT  J C2    1 
ATOM   4454  O O2    . DT  B 1 74  ? -80.362  -26.949 1.815  1.00 101.71 ? 218  DT  J O2    1 
ATOM   4455  N N3    . DT  B 1 74  ? -80.210  -27.608 3.977  1.00 101.27 ? 218  DT  J N3    1 
ATOM   4456  C C4    . DT  B 1 74  ? -80.319  -27.432 5.337  1.00 102.68 ? 218  DT  J C4    1 
ATOM   4457  O O4    . DT  B 1 74  ? -80.049  -28.358 6.093  1.00 104.20 ? 218  DT  J O4    1 
ATOM   4458  C C5    . DT  B 1 74  ? -80.771  -26.122 5.757  1.00 103.03 ? 218  DT  J C5    1 
ATOM   4459  C C7    . DT  B 1 74  ? -80.877  -25.829 7.221  1.00 103.24 ? 218  DT  J C7    1 
ATOM   4460  C C6    . DT  B 1 74  ? -81.073  -25.223 4.809  1.00 102.95 ? 218  DT  J C6    1 
ATOM   4461  P P     . DT  B 1 75  ? -84.516  -22.809 0.349  1.00 125.53 ? 219  DT  J P     1 
ATOM   4462  O OP1   . DT  B 1 75  ? -84.833  -21.756 -0.654 1.00 131.23 ? 219  DT  J OP1   1 
ATOM   4463  O OP2   . DT  B 1 75  ? -85.209  -22.812 1.667  1.00 131.56 ? 219  DT  J OP2   1 
ATOM   4464  O "O5'" . DT  B 1 75  ? -84.731  -24.227 -0.325 1.00 124.44 ? 219  DT  J "O5'" 1 
ATOM   4465  C "C5'" . DT  B 1 75  ? -83.674  -24.820 -1.058 1.00 124.03 ? 219  DT  J "C5'" 1 
ATOM   4466  C "C4'" . DT  B 1 75  ? -83.812  -26.319 -1.022 1.00 124.68 ? 219  DT  J "C4'" 1 
ATOM   4467  O "O4'" . DT  B 1 75  ? -83.317  -26.856 0.228  1.00 123.35 ? 219  DT  J "O4'" 1 
ATOM   4468  C "C3'" . DT  B 1 75  ? -85.267  -26.765 -1.135 1.00 126.27 ? 219  DT  J "C3'" 1 
ATOM   4469  O "O3'" . DT  B 1 75  ? -85.366  -27.840 -2.059 1.00 128.31 ? 219  DT  J "O3'" 1 
ATOM   4470  C "C2'" . DT  B 1 75  ? -85.609  -27.225 0.272  1.00 124.16 ? 219  DT  J "C2'" 1 
ATOM   4471  C "C1'" . DT  B 1 75  ? -84.275  -27.762 0.745  1.00 121.70 ? 219  DT  J "C1'" 1 
ATOM   4472  N N1    . DT  B 1 75  ? -84.100  -27.851 2.213  1.00 127.93 ? 219  DT  J N1    1 
ATOM   4473  C C2    . DT  B 1 75  ? -83.775  -29.081 2.755  1.00 126.27 ? 219  DT  J C2    1 
ATOM   4474  O O2    . DT  B 1 75  ? -83.630  -30.092 2.087  1.00 126.13 ? 219  DT  J O2    1 
ATOM   4475  N N3    . DT  B 1 75  ? -83.629  -29.085 4.119  1.00 124.22 ? 219  DT  J N3    1 
ATOM   4476  C C4    . DT  B 1 75  ? -83.776  -28.016 4.976  1.00 122.94 ? 219  DT  J C4    1 
ATOM   4477  O O4    . DT  B 1 75  ? -83.616  -28.175 6.179  1.00 122.87 ? 219  DT  J O4    1 
ATOM   4478  C C5    . DT  B 1 75  ? -84.118  -26.762 4.346  1.00 123.39 ? 219  DT  J C5    1 
ATOM   4479  C C7    . DT  B 1 75  ? -84.301  -25.549 5.202  1.00 122.96 ? 219  DT  J C7    1 
ATOM   4480  C C6    . DT  B 1 75  ? -84.260  -26.741 3.014  1.00 125.55 ? 219  DT  J C6    1 
ATOM   4481  P P     . DC  B 1 76  ? -86.809  -28.354 -2.516 1.00 136.93 ? 220  DC  J P     1 
ATOM   4482  O OP1   . DC  B 1 76  ? -86.705  -28.663 -3.964 1.00 115.75 ? 220  DC  J OP1   1 
ATOM   4483  O OP2   . DC  B 1 76  ? -87.853  -27.414 -2.030 1.00 114.54 ? 220  DC  J OP2   1 
ATOM   4484  O "O5'" . DC  B 1 76  ? -86.964  -29.717 -1.720 1.00 134.19 ? 220  DC  J "O5'" 1 
ATOM   4485  C "C5'" . DC  B 1 76  ? -86.120  -30.820 -2.015 1.00 133.22 ? 220  DC  J "C5'" 1 
ATOM   4486  C "C4'" . DC  B 1 76  ? -86.625  -32.046 -1.300 1.00 133.21 ? 220  DC  J "C4'" 1 
ATOM   4487  O "O4'" . DC  B 1 76  ? -86.234  -32.004 0.094  1.00 132.88 ? 220  DC  J "O4'" 1 
ATOM   4488  C "C3'" . DC  B 1 76  ? -88.150  -32.146 -1.312 1.00 133.65 ? 220  DC  J "C3'" 1 
ATOM   4489  O "O3'" . DC  B 1 76  ? -88.550  -33.501 -1.503 1.00 134.26 ? 220  DC  J "O3'" 1 
ATOM   4490  C "C2'" . DC  B 1 76  ? -88.545  -31.653 0.068  1.00 133.39 ? 220  DC  J "C2'" 1 
ATOM   4491  C "C1'" . DC  B 1 76  ? -87.381  -32.136 0.915  1.00 131.42 ? 220  DC  J "C1'" 1 
ATOM   4492  N N1    . DC  B 1 76  ? -87.143  -31.382 2.159  1.00 106.85 ? 220  DC  J N1    1 
ATOM   4493  C C2    . DC  B 1 76  ? -86.842  -32.097 3.325  1.00 104.31 ? 220  DC  J C2    1 
ATOM   4494  O O2    . DC  B 1 76  ? -86.761  -33.340 3.260  1.00 101.18 ? 220  DC  J O2    1 
ATOM   4495  N N3    . DC  B 1 76  ? -86.643  -31.420 4.486  1.00 102.41 ? 220  DC  J N3    1 
ATOM   4496  C C4    . DC  B 1 76  ? -86.728  -30.085 4.503  1.00 102.20 ? 220  DC  J C4    1 
ATOM   4497  N N4    . DC  B 1 76  ? -86.525  -29.458 5.664  1.00 102.21 ? 220  DC  J N4    1 
ATOM   4498  C C5    . DC  B 1 76  ? -87.024  -29.333 3.327  1.00 102.33 ? 220  DC  J C5    1 
ATOM   4499  C C6    . DC  B 1 76  ? -87.221  -30.015 2.188  1.00 104.69 ? 220  DC  J C6    1 
ATOM   4500  P P     . DC  B 1 77  ? -90.074  -33.830 -1.875 1.00 140.06 ? 221  DC  J P     1 
ATOM   4501  O OP1   . DC  B 1 77  ? -90.070  -34.558 -3.170 1.00 127.54 ? 221  DC  J OP1   1 
ATOM   4502  O OP2   . DC  B 1 77  ? -90.864  -32.580 -1.737 1.00 125.31 ? 221  DC  J OP2   1 
ATOM   4503  O "O5'" . DC  B 1 77  ? -90.519  -34.830 -0.719 1.00 137.71 ? 221  DC  J "O5'" 1 
ATOM   4504  C "C5'" . DC  B 1 77  ? -89.724  -35.969 -0.401 1.00 135.39 ? 221  DC  J "C5'" 1 
ATOM   4505  C "C4'" . DC  B 1 77  ? -90.130  -36.536 0.939  1.00 134.70 ? 221  DC  J "C4'" 1 
ATOM   4506  O "O4'" . DC  B 1 77  ? -89.655  -35.704 2.024  1.00 134.19 ? 221  DC  J "O4'" 1 
ATOM   4507  C "C3'" . DC  B 1 77  ? -91.639  -36.675 1.141  1.00 135.10 ? 221  DC  J "C3'" 1 
ATOM   4508  O "O3'" . DC  B 1 77  ? -91.898  -37.883 1.843  1.00 137.87 ? 221  DC  J "O3'" 1 
ATOM   4509  C "C2'" . DC  B 1 77  ? -91.974  -35.506 2.048  1.00 133.03 ? 221  DC  J "C2'" 1 
ATOM   4510  C "C1'" . DC  B 1 77  ? -90.732  -35.460 2.913  1.00 131.46 ? 221  DC  J "C1'" 1 
ATOM   4511  N N1    . DC  B 1 77  ? -90.483  -34.187 3.609  1.00 115.33 ? 221  DC  J N1    1 
ATOM   4512  C C2    . DC  B 1 77  ? -89.956  -34.230 4.903  1.00 113.07 ? 221  DC  J C2    1 
ATOM   4513  O O2    . DC  B 1 77  ? -89.710  -35.333 5.412  1.00 110.89 ? 221  DC  J O2    1 
ATOM   4514  N N3    . DC  B 1 77  ? -89.728  -33.071 5.563  1.00 111.83 ? 221  DC  J N3    1 
ATOM   4515  C C4    . DC  B 1 77  ? -90.001  -31.903 4.975  1.00 111.41 ? 221  DC  J C4    1 
ATOM   4516  N N4    . DC  B 1 77  ? -89.756  -30.786 5.661  1.00 110.11 ? 221  DC  J N4    1 
ATOM   4517  C C5    . DC  B 1 77  ? -90.536  -31.830 3.656  1.00 111.76 ? 221  DC  J C5    1 
ATOM   4518  C C6    . DC  B 1 77  ? -90.758  -32.986 3.014  1.00 113.77 ? 221  DC  J C6    1 
ATOM   4519  P P     . DG  B 1 78  ? -92.338  -39.189 1.031  1.00 101.32 ? 222  DG  J P     1 
ATOM   4520  O OP1   . DG  B 1 78  ? -91.436  -39.300 -0.142 1.00 155.67 ? 222  DG  J OP1   1 
ATOM   4521  O OP2   . DG  B 1 78  ? -93.808  -39.142 0.831  1.00 154.52 ? 222  DG  J OP2   1 
ATOM   4522  O "O5'" . DG  B 1 78  ? -91.998  -40.378 2.035  1.00 101.75 ? 222  DG  J "O5'" 1 
ATOM   4523  C "C5'" . DG  B 1 78  ? -90.672  -40.553 2.538  1.00 102.89 ? 222  DG  J "C5'" 1 
ATOM   4524  C "C4'" . DG  B 1 78  ? -90.698  -40.691 4.043  1.00 103.72 ? 222  DG  J "C4'" 1 
ATOM   4525  O "O4'" . DG  B 1 78  ? -90.981  -39.412 4.660  1.00 103.82 ? 222  DG  J "O4'" 1 
ATOM   4526  C "C3'" . DG  B 1 78  ? -91.761  -41.655 4.561  1.00 104.28 ? 222  DG  J "C3'" 1 
ATOM   4527  O "O3'" . DG  B 1 78  ? -91.248  -42.428 5.642  1.00 106.48 ? 222  DG  J "O3'" 1 
ATOM   4528  C "C2'" . DG  B 1 78  ? -92.884  -40.744 5.025  1.00 102.99 ? 222  DG  J "C2'" 1 
ATOM   4529  C "C1'" . DG  B 1 78  ? -92.157  -39.482 5.452  1.00 104.04 ? 222  DG  J "C1'" 1 
ATOM   4530  N N9    . DG  B 1 78  ? -92.923  -38.267 5.200  1.00 158.75 ? 222  DG  J N9    1 
ATOM   4531  C C8    . DG  B 1 78  ? -93.886  -38.085 4.238  1.00 159.87 ? 222  DG  J C8    1 
ATOM   4532  N N7    . DG  B 1 78  ? -94.389  -36.882 4.238  1.00 160.30 ? 222  DG  J N7    1 
ATOM   4533  C C5    . DG  B 1 78  ? -93.720  -36.229 5.263  1.00 160.55 ? 222  DG  J C5    1 
ATOM   4534  C C6    . DG  B 1 78  ? -93.838  -34.898 5.733  1.00 161.17 ? 222  DG  J C6    1 
ATOM   4535  O O6    . DG  B 1 78  ? -94.576  -33.999 5.319  1.00 160.38 ? 222  DG  J O6    1 
ATOM   4536  N N1    . DG  B 1 78  ? -92.977  -34.653 6.796  1.00 162.07 ? 222  DG  J N1    1 
ATOM   4537  C C2    . DG  B 1 78  ? -92.112  -35.569 7.338  1.00 162.24 ? 222  DG  J C2    1 
ATOM   4538  N N2    . DG  B 1 78  ? -91.367  -35.141 8.370  1.00 162.44 ? 222  DG  J N2    1 
ATOM   4539  N N3    . DG  B 1 78  ? -91.986  -36.814 6.903  1.00 161.25 ? 222  DG  J N3    1 
ATOM   4540  C C4    . DG  B 1 78  ? -92.816  -37.073 5.871  1.00 160.19 ? 222  DG  J C4    1 
ATOM   4541  P P     . DC  B 1 79  ? -92.180  -43.533 6.333  1.00 120.00 ? 223  DC  J P     1 
ATOM   4542  O OP1   . DC  B 1 79  ? -91.350  -44.744 6.555  1.00 110.72 ? 223  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 1 79  ? -93.450  -43.642 5.577  1.00 110.15 ? 223  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 1 79  ? -92.522  -42.879 7.740  1.00 120.81 ? 223  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 1 79  ? -91.491  -42.358 8.568  1.00 118.64 ? 223  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 1 79  ? -92.102  -41.639 9.743  1.00 118.15 ? 223  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 1 79  ? -92.651  -40.369 9.311  1.00 117.05 ? 223  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 1 79  ? -93.265  -42.420 10.355 1.00 118.07 ? 223  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 1 79  ? -93.259  -42.271 11.773 1.00 119.17 ? 223  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 1 79  ? -94.482  -41.723 9.780  1.00 117.32 ? 223  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 1 79  ? -94.000  -40.287 9.727  1.00 117.07 ? 223  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 1 79  ? -94.732  -39.416 8.791  1.00 106.33 ? 223  DC  J N1    1 
ATOM   4553  C C2    . DC  B 1 79  ? -94.874  -38.056 9.106  1.00 105.80 ? 223  DC  J C2    1 
ATOM   4554  O O2    . DC  B 1 79  ? -94.347  -37.619 10.139 1.00 104.16 ? 223  DC  J O2    1 
ATOM   4555  N N3    . DC  B 1 79  ? -95.581  -37.255 8.273  1.00 105.85 ? 223  DC  J N3    1 
ATOM   4556  C C4    . DC  B 1 79  ? -96.126  -37.763 7.162  1.00 106.69 ? 223  DC  J C4    1 
ATOM   4557  N N4    . DC  B 1 79  ? -96.823  -36.941 6.372  1.00 106.66 ? 223  DC  J N4    1 
ATOM   4558  C C5    . DC  B 1 79  ? -95.981  -39.137 6.811  1.00 107.16 ? 223  DC  J C5    1 
ATOM   4559  C C6    . DC  B 1 79  ? -95.281  -39.919 7.644  1.00 106.55 ? 223  DC  J C6    1 
ATOM   4560  P P     . DT  B 1 80  ? -93.038  -43.555 12.709 1.00 113.72 ? 224  DT  J P     1 
ATOM   4561  O OP1   . DT  B 1 80  ? -92.077  -44.453 12.018 1.00 126.08 ? 224  DT  J OP1   1 
ATOM   4562  O OP2   . DT  B 1 80  ? -94.362  -44.074 13.134 1.00 124.52 ? 224  DT  J OP2   1 
ATOM   4563  O "O5'" . DT  B 1 80  ? -92.312  -42.931 13.973 1.00 110.56 ? 224  DT  J "O5'" 1 
ATOM   4564  C "C5'" . DT  B 1 80  ? -91.330  -41.919 13.803 1.00 105.16 ? 224  DT  J "C5'" 1 
ATOM   4565  C "C4'" . DT  B 1 80  ? -91.803  -40.624 14.422 1.00 101.51 ? 224  DT  J "C4'" 1 
ATOM   4566  O "O4'" . DT  B 1 80  ? -92.766  -39.938 13.584 1.00 100.57 ? 224  DT  J "O4'" 1 
ATOM   4567  C "C3'" . DT  B 1 80  ? -92.461  -40.755 15.796 1.00 100.14 ? 224  DT  J "C3'" 1 
ATOM   4568  O "O3'" . DT  B 1 80  ? -91.998  -39.675 16.609 1.00 97.86  ? 224  DT  J "O3'" 1 
ATOM   4569  C "C2'" . DT  B 1 80  ? -93.937  -40.568 15.489 1.00 100.25 ? 224  DT  J "C2'" 1 
ATOM   4570  C "C1'" . DT  B 1 80  ? -93.856  -39.527 14.394 1.00 101.06 ? 224  DT  J "C1'" 1 
ATOM   4571  N N1    . DT  B 1 80  ? -95.046  -39.376 13.532 1.00 115.12 ? 224  DT  J N1    1 
ATOM   4572  C C2    . DT  B 1 80  ? -95.564  -38.108 13.378 1.00 116.16 ? 224  DT  J C2    1 
ATOM   4573  O O2    . DT  B 1 80  ? -95.112  -37.131 13.947 1.00 116.68 ? 224  DT  J O2    1 
ATOM   4574  N N3    . DT  B 1 80  ? -96.639  -38.026 12.531 1.00 117.03 ? 224  DT  J N3    1 
ATOM   4575  C C4    . DT  B 1 80  ? -97.241  -39.060 11.842 1.00 117.52 ? 224  DT  J C4    1 
ATOM   4576  O O4    . DT  B 1 80  ? -98.188  -38.825 11.091 1.00 117.04 ? 224  DT  J O4    1 
ATOM   4577  C C5    . DT  B 1 80  ? -96.668  -40.370 12.075 1.00 116.93 ? 224  DT  J C5    1 
ATOM   4578  C C7    . DT  B 1 80  ? -97.274  -41.558 11.399 1.00 116.94 ? 224  DT  J C7    1 
ATOM   4579  C C6    . DT  B 1 80  ? -95.611  -40.460 12.895 1.00 116.00 ? 224  DT  J C6    1 
ATOM   4580  P P     . DG  B 1 81  ? -92.173  -39.732 18.203 1.00 98.99  ? 225  DG  J P     1 
ATOM   4581  O OP1   . DG  B 1 81  ? -90.830  -39.942 18.806 1.00 103.45 ? 225  DG  J OP1   1 
ATOM   4582  O OP2   . DG  B 1 81  ? -93.296  -40.645 18.561 1.00 102.46 ? 225  DG  J OP2   1 
ATOM   4583  O "O5'" . DG  B 1 81  ? -92.627  -38.255 18.548 1.00 98.71  ? 225  DG  J "O5'" 1 
ATOM   4584  C "C5'" . DG  B 1 81  ? -93.603  -38.039 19.537 1.00 99.14  ? 225  DG  J "C5'" 1 
ATOM   4585  C "C4'" . DG  B 1 81  ? -94.561  -36.959 19.104 1.00 97.65  ? 225  DG  J "C4'" 1 
ATOM   4586  O "O4'" . DG  B 1 81  ? -95.184  -37.310 17.841 1.00 99.60  ? 225  DG  J "O4'" 1 
ATOM   4587  C "C3'" . DG  B 1 81  ? -95.693  -36.830 20.113 1.00 96.12  ? 225  DG  J "C3'" 1 
ATOM   4588  O "O3'" . DG  B 1 81  ? -96.027  -35.474 20.324 1.00 89.08  ? 225  DG  J "O3'" 1 
ATOM   4589  C "C2'" . DG  B 1 81  ? -96.842  -37.582 19.475 1.00 99.04  ? 225  DG  J "C2'" 1 
ATOM   4590  C "C1'" . DG  B 1 81  ? -96.600  -37.345 17.998 1.00 103.09 ? 225  DG  J "C1'" 1 
ATOM   4591  N N9    . DG  B 1 81  ? -97.147  -38.402 17.148 1.00 112.30 ? 225  DG  J N9    1 
ATOM   4592  C C8    . DG  B 1 81  ? -96.863  -39.746 17.196 1.00 114.80 ? 225  DG  J C8    1 
ATOM   4593  N N7    . DG  B 1 81  ? -97.548  -40.446 16.333 1.00 116.09 ? 225  DG  J N7    1 
ATOM   4594  C C5    . DG  B 1 81  ? -98.325  -39.507 15.670 1.00 116.59 ? 225  DG  J C5    1 
ATOM   4595  C C6    . DG  B 1 81  ? -99.274  -39.670 14.624 1.00 118.66 ? 225  DG  J C6    1 
ATOM   4596  O O6    . DG  B 1 81  ? -99.635  -40.712 14.062 1.00 119.84 ? 225  DG  J O6    1 
ATOM   4597  N N1    . DG  B 1 81  ? -99.826  -38.450 14.243 1.00 119.38 ? 225  DG  J N1    1 
ATOM   4598  C C2    . DG  B 1 81  ? -99.509  -37.231 14.798 1.00 118.41 ? 225  DG  J C2    1 
ATOM   4599  N N2    . DG  B 1 81  ? -100.151 -36.167 14.300 1.00 119.48 ? 225  DG  J N2    1 
ATOM   4600  N N3    . DG  B 1 81  ? -98.629  -37.068 15.771 1.00 116.62 ? 225  DG  J N3    1 
ATOM   4601  C C4    . DG  B 1 81  ? -98.081  -38.239 16.155 1.00 114.96 ? 225  DG  J C4    1 
ATOM   4602  P P     . DA  B 1 82  ? -96.464  -35.009 21.786 1.00 75.12  ? 226  DA  J P     1 
ATOM   4603  O OP1   . DA  B 1 82  ? -95.241  -34.504 22.454 1.00 91.32  ? 226  DA  J OP1   1 
ATOM   4604  O OP2   . DA  B 1 82  ? -97.250  -36.106 22.421 1.00 87.67  ? 226  DA  J OP2   1 
ATOM   4605  O "O5'" . DA  B 1 82  ? -97.419  -33.772 21.502 1.00 76.09  ? 226  DA  J "O5'" 1 
ATOM   4606  C "C5'" . DA  B 1 82  ? -97.082  -32.796 20.517 1.00 74.21  ? 226  DA  J "C5'" 1 
ATOM   4607  C "C4'" . DA  B 1 82  ? -98.343  -32.221 19.914 1.00 74.36  ? 226  DA  J "C4'" 1 
ATOM   4608  O "O4'" . DA  B 1 82  ? -98.937  -33.186 19.012 1.00 74.42  ? 226  DA  J "O4'" 1 
ATOM   4609  C "C3'" . DA  B 1 82  ? -99.416  -31.894 20.953 1.00 73.02  ? 226  DA  J "C3'" 1 
ATOM   4610  O "O3'" . DA  B 1 82  ? -100.077 -30.676 20.623 1.00 72.05  ? 226  DA  J "O3'" 1 
ATOM   4611  C "C2'" . DA  B 1 82  ? -100.353 -33.090 20.895 1.00 71.90  ? 226  DA  J "C2'" 1 
ATOM   4612  C "C1'" . DA  B 1 82  ? -100.245 -33.540 19.443 1.00 73.70  ? 226  DA  J "C1'" 1 
ATOM   4613  N N9    . DA  B 1 82  ? -100.395 -34.979 19.229 1.00 89.17  ? 226  DA  J N9    1 
ATOM   4614  C C8    . DA  B 1 82  ? -99.818  -35.987 19.957 1.00 88.07  ? 226  DA  J C8    1 
ATOM   4615  N N7    . DA  B 1 82  ? -100.087 -37.189 19.507 1.00 88.92  ? 226  DA  J N7    1 
ATOM   4616  C C5    . DA  B 1 82  ? -100.908 -36.959 18.413 1.00 90.10  ? 226  DA  J C5    1 
ATOM   4617  C C6    . DA  B 1 82  ? -101.525 -37.828 17.496 1.00 89.11  ? 226  DA  J C6    1 
ATOM   4618  N N6    . DA  B 1 82  ? -101.394 -39.157 17.536 1.00 89.35  ? 226  DA  J N6    1 
ATOM   4619  N N1    . DA  B 1 82  ? -102.283 -37.280 16.524 1.00 89.61  ? 226  DA  J N1    1 
ATOM   4620  C C2    . DA  B 1 82  ? -102.401 -35.947 16.479 1.00 88.40  ? 226  DA  J C2    1 
ATOM   4621  N N3    . DA  B 1 82  ? -101.866 -35.022 17.279 1.00 89.26  ? 226  DA  J N3    1 
ATOM   4622  C C4    . DA  B 1 82  ? -101.119 -35.601 18.237 1.00 90.46  ? 226  DA  J C4    1 
ATOM   4623  P P     . DA  B 1 83  ? -101.106 -30.036 21.666 1.00 87.35  ? 227  DA  J P     1 
ATOM   4624  O OP1   . DA  B 1 83  ? -100.844 -28.578 21.763 1.00 83.83  ? 227  DA  J OP1   1 
ATOM   4625  O OP2   . DA  B 1 83  ? -101.080 -30.874 22.889 1.00 84.58  ? 227  DA  J OP2   1 
ATOM   4626  O "O5'" . DA  B 1 83  ? -102.521 -30.252 20.967 1.00 92.64  ? 227  DA  J "O5'" 1 
ATOM   4627  C "C5'" . DA  B 1 83  ? -102.767 -29.766 19.643 1.00 93.41  ? 227  DA  J "C5'" 1 
ATOM   4628  C "C4'" . DA  B 1 83  ? -104.114 -30.241 19.144 1.00 92.51  ? 227  DA  J "C4'" 1 
ATOM   4629  O "O4'" . DA  B 1 83  ? -104.062 -31.648 18.799 1.00 90.56  ? 227  DA  J "O4'" 1 
ATOM   4630  C "C3'" . DA  B 1 83  ? -105.262 -30.086 20.146 1.00 92.25  ? 227  DA  J "C3'" 1 
ATOM   4631  O "O3'" . DA  B 1 83  ? -106.422 -29.538 19.514 1.00 95.71  ? 227  DA  J "O3'" 1 
ATOM   4632  C "C2'" . DA  B 1 83  ? -105.532 -31.509 20.606 1.00 89.89  ? 227  DA  J "C2'" 1 
ATOM   4633  C "C1'" . DA  B 1 83  ? -105.169 -32.315 19.377 1.00 88.84  ? 227  DA  J "C1'" 1 
ATOM   4634  N N9    . DA  B 1 83  ? -104.778 -33.695 19.651 1.00 84.70  ? 227  DA  J N9    1 
ATOM   4635  C C8    . DA  B 1 83  ? -104.152 -34.189 20.763 1.00 85.25  ? 227  DA  J C8    1 
ATOM   4636  N N7    . DA  B 1 83  ? -103.945 -35.485 20.724 1.00 84.77  ? 227  DA  J N7    1 
ATOM   4637  C C5    . DA  B 1 83  ? -104.466 -35.870 19.499 1.00 85.79  ? 227  DA  J C5    1 
ATOM   4638  C C6    . DA  B 1 83  ? -104.555 -37.123 18.854 1.00 85.73  ? 227  DA  J C6    1 
ATOM   4639  N N6    . DA  B 1 83  ? -104.095 -38.264 19.366 1.00 87.50  ? 227  DA  J N6    1 
ATOM   4640  N N1    . DA  B 1 83  ? -105.143 -37.160 17.640 1.00 85.88  ? 227  DA  J N1    1 
ATOM   4641  C C2    . DA  B 1 83  ? -105.600 -36.014 17.113 1.00 86.68  ? 227  DA  J C2    1 
ATOM   4642  N N3    . DA  B 1 83  ? -105.569 -34.780 17.617 1.00 87.18  ? 227  DA  J N3    1 
ATOM   4643  C C4    . DA  B 1 83  ? -104.983 -34.776 18.826 1.00 86.54  ? 227  DA  J C4    1 
ATOM   4644  P P     . DC  B 1 84  ? -107.746 -29.269 20.384 1.00 98.07  ? 228  DC  J P     1 
ATOM   4645  O OP1   . DC  B 1 84  ? -108.482 -28.151 19.735 1.00 114.97 ? 228  DC  J OP1   1 
ATOM   4646  O OP2   . DC  B 1 84  ? -107.384 -29.168 21.817 1.00 117.02 ? 228  DC  J OP2   1 
ATOM   4647  O "O5'" . DC  B 1 84  ? -108.572 -30.614 20.195 1.00 98.63  ? 228  DC  J "O5'" 1 
ATOM   4648  C "C5'" . DC  B 1 84  ? -109.038 -30.991 18.909 1.00 100.47 ? 228  DC  J "C5'" 1 
ATOM   4649  C "C4'" . DC  B 1 84  ? -109.948 -32.189 19.015 1.00 102.07 ? 228  DC  J "C4'" 1 
ATOM   4650  O "O4'" . DC  B 1 84  ? -109.173 -33.410 19.117 1.00 100.12 ? 228  DC  J "O4'" 1 
ATOM   4651  C "C3'" . DC  B 1 84  ? -110.885 -32.168 20.228 1.00 105.38 ? 228  DC  J "C3'" 1 
ATOM   4652  O "O3'" . DC  B 1 84  ? -112.181 -32.646 19.852 1.00 112.98 ? 228  DC  J "O3'" 1 
ATOM   4653  C "C2'" . DC  B 1 84  ? -110.236 -33.160 21.175 1.00 102.44 ? 228  DC  J "C2'" 1 
ATOM   4654  C "C1'" . DC  B 1 84  ? -109.693 -34.174 20.190 1.00 98.32  ? 228  DC  J "C1'" 1 
ATOM   4655  N N1    . DC  B 1 84  ? -108.640 -35.077 20.688 1.00 114.70 ? 228  DC  J N1    1 
ATOM   4656  C C2    . DC  B 1 84  ? -108.257 -36.162 19.889 1.00 114.48 ? 228  DC  J C2    1 
ATOM   4657  O O2    . DC  B 1 84  ? -108.754 -36.280 18.758 1.00 116.78 ? 228  DC  J O2    1 
ATOM   4658  N N3    . DC  B 1 84  ? -107.353 -37.047 20.363 1.00 113.16 ? 228  DC  J N3    1 
ATOM   4659  C C4    . DC  B 1 84  ? -106.820 -36.869 21.570 1.00 112.57 ? 228  DC  J C4    1 
ATOM   4660  N N4    . DC  B 1 84  ? -105.949 -37.779 22.001 1.00 113.43 ? 228  DC  J N4    1 
ATOM   4661  C C5    . DC  B 1 84  ? -107.159 -35.752 22.389 1.00 112.66 ? 228  DC  J C5    1 
ATOM   4662  C C6    . DC  B 1 84  ? -108.064 -34.887 21.913 1.00 113.09 ? 228  DC  J C6    1 
ATOM   4663  P P     . DA  B 1 85  ? -113.478 -32.222 20.710 1.00 134.12 ? 229  DA  J P     1 
ATOM   4664  O OP1   . DA  B 1 85  ? -114.097 -31.045 20.044 1.00 124.20 ? 229  DA  J OP1   1 
ATOM   4665  O OP2   . DA  B 1 85  ? -113.127 -32.142 22.151 1.00 124.22 ? 229  DA  J OP2   1 
ATOM   4666  O "O5'" . DA  B 1 85  ? -114.439 -33.470 20.491 1.00 139.11 ? 229  DA  J "O5'" 1 
ATOM   4667  C "C5'" . DA  B 1 85  ? -114.610 -34.009 19.186 1.00 148.73 ? 229  DA  J "C5'" 1 
ATOM   4668  C "C4'" . DA  B 1 85  ? -114.629 -35.518 19.232 1.00 154.98 ? 229  DA  J "C4'" 1 
ATOM   4669  O "O4'" . DA  B 1 85  ? -113.329 -36.044 19.598 1.00 155.84 ? 229  DA  J "O4'" 1 
ATOM   4670  C "C3'" . DA  B 1 85  ? -115.622 -36.119 20.225 1.00 159.05 ? 229  DA  J "C3'" 1 
ATOM   4671  O "O3'" . DA  B 1 85  ? -116.261 -37.242 19.620 1.00 163.44 ? 229  DA  J "O3'" 1 
ATOM   4672  C "C2'" . DA  B 1 85  ? -114.739 -36.578 21.371 1.00 159.36 ? 229  DA  J "C2'" 1 
ATOM   4673  C "C1'" . DA  B 1 85  ? -113.489 -37.005 20.630 1.00 158.47 ? 229  DA  J "C1'" 1 
ATOM   4674  N N9    . DA  B 1 85  ? -112.269 -37.022 21.436 1.00 151.24 ? 229  DA  J N9    1 
ATOM   4675  C C8    . DA  B 1 85  ? -111.637 -35.957 22.025 1.00 151.56 ? 229  DA  J C8    1 
ATOM   4676  N N7    . DA  B 1 85  ? -110.550 -36.283 22.681 1.00 152.25 ? 229  DA  J N7    1 
ATOM   4677  C C5    . DA  B 1 85  ? -110.460 -37.658 22.518 1.00 152.58 ? 229  DA  J C5    1 
ATOM   4678  C C6    . DA  B 1 85  ? -109.528 -38.607 22.976 1.00 152.99 ? 229  DA  J C6    1 
ATOM   4679  N N6    . DA  B 1 85  ? -108.465 -38.301 23.719 1.00 152.91 ? 229  DA  J N6    1 
ATOM   4680  N N1    . DA  B 1 85  ? -109.730 -39.899 22.640 1.00 153.10 ? 229  DA  J N1    1 
ATOM   4681  C C2    . DA  B 1 85  ? -110.799 -40.205 21.896 1.00 152.63 ? 229  DA  J C2    1 
ATOM   4682  N N3    . DA  B 1 85  ? -111.745 -39.405 21.407 1.00 152.34 ? 229  DA  J N3    1 
ATOM   4683  C C4    . DA  B 1 85  ? -111.515 -38.128 21.757 1.00 152.12 ? 229  DA  J C4    1 
ATOM   4684  P P     . DT  B 1 86  ? -117.314 -38.104 20.465 1.00 145.32 ? 230  DT  J P     1 
ATOM   4685  O OP1   . DT  B 1 86  ? -118.263 -38.704 19.495 1.00 136.00 ? 230  DT  J OP1   1 
ATOM   4686  O OP2   . DT  B 1 86  ? -117.827 -37.263 21.582 1.00 135.46 ? 230  DT  J OP2   1 
ATOM   4687  O "O5'" . DT  B 1 86  ? -116.431 -39.275 21.078 1.00 147.64 ? 230  DT  J "O5'" 1 
ATOM   4688  C "C5'" . DT  B 1 86  ? -115.988 -40.351 20.262 1.00 151.48 ? 230  DT  J "C5'" 1 
ATOM   4689  C "C4'" . DT  B 1 86  ? -115.812 -41.588 21.108 1.00 154.85 ? 230  DT  J "C4'" 1 
ATOM   4690  O "O4'" . DT  B 1 86  ? -114.641 -41.436 21.949 1.00 157.02 ? 230  DT  J "O4'" 1 
ATOM   4691  C "C3'" . DT  B 1 86  ? -116.988 -41.832 22.054 1.00 156.08 ? 230  DT  J "C3'" 1 
ATOM   4692  O "O3'" . DT  B 1 86  ? -117.251 -43.232 22.163 1.00 157.10 ? 230  DT  J "O3'" 1 
ATOM   4693  C "C2'" . DT  B 1 86  ? -116.486 -41.285 23.378 1.00 156.57 ? 230  DT  J "C2'" 1 
ATOM   4694  C "C1'" . DT  B 1 86  ? -115.005 -41.618 23.309 1.00 157.53 ? 230  DT  J "C1'" 1 
ATOM   4695  N N1    . DT  B 1 86  ? -114.130 -40.765 24.144 1.00 149.72 ? 230  DT  J N1    1 
ATOM   4696  C C2    . DT  B 1 86  ? -113.241 -41.389 24.994 1.00 149.74 ? 230  DT  J C2    1 
ATOM   4697  O O2    . DT  B 1 86  ? -113.129 -42.601 25.071 1.00 149.90 ? 230  DT  J O2    1 
ATOM   4698  N N3    . DT  B 1 86  ? -112.485 -40.534 25.759 1.00 149.37 ? 230  DT  J N3    1 
ATOM   4699  C C4    . DT  B 1 86  ? -112.529 -39.152 25.758 1.00 149.14 ? 230  DT  J C4    1 
ATOM   4700  O O4    . DT  B 1 86  ? -111.800 -38.515 26.513 1.00 148.09 ? 230  DT  J O4    1 
ATOM   4701  C C5    . DT  B 1 86  ? -113.469 -38.565 24.834 1.00 149.37 ? 230  DT  J C5    1 
ATOM   4702  C C7    . DT  B 1 86  ? -113.573 -37.075 24.757 1.00 149.48 ? 230  DT  J C7    1 
ATOM   4703  C C6    . DT  B 1 86  ? -114.213 -39.389 24.082 1.00 149.72 ? 230  DT  J C6    1 
ATOM   4704  P P     . DG  B 1 87  ? -118.737 -43.741 22.505 1.00 179.47 ? 231  DG  J P     1 
ATOM   4705  O OP1   . DG  B 1 87  ? -119.347 -44.203 21.232 1.00 154.15 ? 231  DG  J OP1   1 
ATOM   4706  O OP2   . DG  B 1 87  ? -119.424 -42.701 23.318 1.00 153.57 ? 231  DG  J OP2   1 
ATOM   4707  O "O5'" . DG  B 1 87  ? -118.486 -45.013 23.430 1.00 179.54 ? 231  DG  J "O5'" 1 
ATOM   4708  C "C5'" . DG  B 1 87  ? -117.510 -45.990 23.075 1.00 178.29 ? 231  DG  J "C5'" 1 
ATOM   4709  C "C4'" . DG  B 1 87  ? -116.818 -46.511 24.313 1.00 176.98 ? 231  DG  J "C4'" 1 
ATOM   4710  O "O4'" . DG  B 1 87  ? -115.940 -45.493 24.863 1.00 177.67 ? 231  DG  J "O4'" 1 
ATOM   4711  C "C3'" . DG  B 1 87  ? -117.767 -46.911 25.445 1.00 176.22 ? 231  DG  J "C3'" 1 
ATOM   4712  O "O3'" . DG  B 1 87  ? -117.320 -48.120 26.063 1.00 174.20 ? 231  DG  J "O3'" 1 
ATOM   4713  C "C2'" . DG  B 1 87  ? -117.663 -45.753 26.420 1.00 176.47 ? 231  DG  J "C2'" 1 
ATOM   4714  C "C1'" . DG  B 1 87  ? -116.218 -45.326 26.246 1.00 178.12 ? 231  DG  J "C1'" 1 
ATOM   4715  N N9    . DG  B 1 87  ? -115.966 -43.933 26.609 1.00 154.78 ? 231  DG  J N9    1 
ATOM   4716  C C8    . DG  B 1 87  ? -116.712 -42.836 26.251 1.00 155.63 ? 231  DG  J C8    1 
ATOM   4717  N N7    . DG  B 1 87  ? -116.257 -41.719 26.753 1.00 155.44 ? 231  DG  J N7    1 
ATOM   4718  C C5    . DG  B 1 87  ? -115.140 -42.100 27.483 1.00 155.28 ? 231  DG  J C5    1 
ATOM   4719  C C6    . DG  B 1 87  ? -114.238 -41.323 28.251 1.00 154.92 ? 231  DG  J C6    1 
ATOM   4720  O O6    . DG  B 1 87  ? -114.244 -40.103 28.446 1.00 154.10 ? 231  DG  J O6    1 
ATOM   4721  N N1    . DG  B 1 87  ? -113.248 -42.110 28.827 1.00 154.86 ? 231  DG  J N1    1 
ATOM   4722  C C2    . DG  B 1 87  ? -113.139 -43.470 28.685 1.00 155.02 ? 231  DG  J C2    1 
ATOM   4723  N N2    . DG  B 1 87  ? -112.117 -44.049 29.330 1.00 154.74 ? 231  DG  J N2    1 
ATOM   4724  N N3    . DG  B 1 87  ? -113.970 -44.208 27.967 1.00 154.93 ? 231  DG  J N3    1 
ATOM   4725  C C4    . DG  B 1 87  ? -114.941 -43.463 27.399 1.00 155.23 ? 231  DG  J C4    1 
ATOM   4726  P P     . DC  B 1 88  ? -117.965 -48.592 27.458 1.00 177.14 ? 232  DC  J P     1 
ATOM   4727  O OP1   . DC  B 1 88  ? -117.981 -50.079 27.450 1.00 151.54 ? 232  DC  J OP1   1 
ATOM   4728  O OP2   . DC  B 1 88  ? -119.227 -47.840 27.701 1.00 150.79 ? 232  DC  J OP2   1 
ATOM   4729  O "O5'" . DC  B 1 88  ? -116.892 -48.122 28.536 1.00 176.34 ? 232  DC  J "O5'" 1 
ATOM   4730  C "C5'" . DC  B 1 88  ? -115.552 -48.610 28.488 1.00 172.41 ? 232  DC  J "C5'" 1 
ATOM   4731  C "C4'" . DC  B 1 88  ? -114.868 -48.380 29.814 1.00 169.41 ? 232  DC  J "C4'" 1 
ATOM   4732  O "O4'" . DC  B 1 88  ? -114.597 -46.969 29.995 1.00 169.09 ? 232  DC  J "O4'" 1 
ATOM   4733  C "C3'" . DC  B 1 88  ? -115.697 -48.815 31.022 1.00 168.13 ? 232  DC  J "C3'" 1 
ATOM   4734  O "O3'" . DC  B 1 88  ? -114.843 -49.397 32.006 1.00 167.37 ? 232  DC  J "O3'" 1 
ATOM   4735  C "C2'" . DC  B 1 88  ? -116.274 -47.507 31.535 1.00 167.21 ? 232  DC  J "C2'" 1 
ATOM   4736  C "C1'" . DC  B 1 88  ? -115.154 -46.529 31.223 1.00 166.63 ? 232  DC  J "C1'" 1 
ATOM   4737  N N1    . DC  B 1 88  ? -115.565 -45.121 31.061 1.00 139.17 ? 232  DC  J N1    1 
ATOM   4738  C C2    . DC  B 1 88  ? -114.757 -44.115 31.612 1.00 138.35 ? 232  DC  J C2    1 
ATOM   4739  O O2    . DC  B 1 88  ? -113.724 -44.437 32.212 1.00 139.01 ? 232  DC  J O2    1 
ATOM   4740  N N3    . DC  B 1 88  ? -115.121 -42.822 31.472 1.00 136.93 ? 232  DC  J N3    1 
ATOM   4741  C C4    . DC  B 1 88  ? -116.234 -42.512 30.807 1.00 136.32 ? 232  DC  J C4    1 
ATOM   4742  N N4    . DC  B 1 88  ? -116.546 -41.221 30.684 1.00 135.28 ? 232  DC  J N4    1 
ATOM   4743  C C5    . DC  B 1 88  ? -117.077 -43.511 30.237 1.00 137.09 ? 232  DC  J C5    1 
ATOM   4744  C C6    . DC  B 1 88  ? -116.709 -44.792 30.387 1.00 137.66 ? 232  DC  J C6    1 
ATOM   4745  P P     . DC  B 1 89  ? -114.822 -50.991 32.204 1.00 149.05 ? 233  DC  J P     1 
ATOM   4746  O OP1   . DC  B 1 89  ? -114.815 -51.607 30.851 1.00 141.21 ? 233  DC  J OP1   1 
ATOM   4747  O OP2   . DC  B 1 89  ? -115.870 -51.376 33.186 1.00 141.27 ? 233  DC  J OP2   1 
ATOM   4748  O "O5'" . DC  B 1 89  ? -113.406 -51.257 32.879 1.00 149.71 ? 233  DC  J "O5'" 1 
ATOM   4749  C "C5'" . DC  B 1 89  ? -112.198 -50.913 32.200 1.00 148.40 ? 233  DC  J "C5'" 1 
ATOM   4750  C "C4'" . DC  B 1 89  ? -111.278 -50.146 33.121 1.00 146.54 ? 233  DC  J "C4'" 1 
ATOM   4751  O "O4'" . DC  B 1 89  ? -111.773 -48.799 33.318 1.00 146.18 ? 233  DC  J "O4'" 1 
ATOM   4752  C "C3'" . DC  B 1 89  ? -111.122 -50.747 34.519 1.00 145.75 ? 233  DC  J "C3'" 1 
ATOM   4753  O "O3'" . DC  B 1 89  ? -109.756 -50.689 34.930 1.00 144.55 ? 233  DC  J "O3'" 1 
ATOM   4754  C "C2'" . DC  B 1 89  ? -111.982 -49.851 35.393 1.00 145.08 ? 233  DC  J "C2'" 1 
ATOM   4755  C "C1'" . DC  B 1 89  ? -111.832 -48.509 34.706 1.00 145.78 ? 233  DC  J "C1'" 1 
ATOM   4756  N N1    . DC  B 1 89  ? -112.932 -47.554 34.932 1.00 139.24 ? 233  DC  J N1    1 
ATOM   4757  C C2    . DC  B 1 89  ? -112.827 -46.269 34.386 1.00 140.11 ? 233  DC  J C2    1 
ATOM   4758  O O2    . DC  B 1 89  ? -111.834 -45.989 33.695 1.00 141.08 ? 233  DC  J O2    1 
ATOM   4759  N N3    . DC  B 1 89  ? -113.810 -45.366 34.619 1.00 140.48 ? 233  DC  J N3    1 
ATOM   4760  C C4    . DC  B 1 89  ? -114.870 -45.709 35.351 1.00 140.34 ? 233  DC  J C4    1 
ATOM   4761  N N4    . DC  B 1 89  ? -115.809 -44.784 35.560 1.00 140.63 ? 233  DC  J N4    1 
ATOM   4762  C C5    . DC  B 1 89  ? -115.013 -47.016 35.903 1.00 139.81 ? 233  DC  J C5    1 
ATOM   4763  C C6    . DC  B 1 89  ? -114.029 -47.899 35.671 1.00 138.81 ? 233  DC  J C6    1 
ATOM   4764  P P     . DT  B 1 90  ? -109.376 -50.988 36.459 1.00 153.75 ? 234  DT  J P     1 
ATOM   4765  O OP1   . DT  B 1 90  ? -107.992 -51.524 36.478 1.00 171.95 ? 234  DT  J OP1   1 
ATOM   4766  O OP2   . DT  B 1 90  ? -110.472 -51.762 37.099 1.00 171.50 ? 234  DT  J OP2   1 
ATOM   4767  O "O5'" . DT  B 1 90  ? -109.367 -49.535 37.101 1.00 151.35 ? 234  DT  J "O5'" 1 
ATOM   4768  C "C5'" . DT  B 1 90  ? -108.630 -48.484 36.487 1.00 147.34 ? 234  DT  J "C5'" 1 
ATOM   4769  C "C4'" . DT  B 1 90  ? -108.453 -47.344 37.460 1.00 144.95 ? 234  DT  J "C4'" 1 
ATOM   4770  O "O4'" . DT  B 1 90  ? -109.714 -46.660 37.643 1.00 144.40 ? 234  DT  J "O4'" 1 
ATOM   4771  C "C3'" . DT  B 1 90  ? -108.003 -47.785 38.853 1.00 144.09 ? 234  DT  J "C3'" 1 
ATOM   4772  O "O3'" . DT  B 1 90  ? -107.159 -46.778 39.400 1.00 142.12 ? 234  DT  J "O3'" 1 
ATOM   4773  C "C2'" . DT  B 1 90  ? -109.305 -47.832 39.626 1.00 144.68 ? 234  DT  J "C2'" 1 
ATOM   4774  C "C1'" . DT  B 1 90  ? -110.069 -46.670 39.015 1.00 145.44 ? 234  DT  J "C1'" 1 
ATOM   4775  N N1    . DT  B 1 90  ? -111.537 -46.778 39.103 1.00 164.16 ? 234  DT  J N1    1 
ATOM   4776  C C2    . DT  B 1 90  ? -112.256 -45.644 39.413 1.00 164.79 ? 234  DT  J C2    1 
ATOM   4777  O O2    . DT  B 1 90  ? -111.738 -44.558 39.618 1.00 163.60 ? 234  DT  J O2    1 
ATOM   4778  N N3    . DT  B 1 90  ? -113.614 -45.828 39.475 1.00 166.10 ? 234  DT  J N3    1 
ATOM   4779  C C4    . DT  B 1 90  ? -114.308 -47.004 39.265 1.00 166.68 ? 234  DT  J C4    1 
ATOM   4780  O O4    . DT  B 1 90  ? -115.533 -47.014 39.357 1.00 167.44 ? 234  DT  J O4    1 
ATOM   4781  C C5    . DT  B 1 90  ? -113.490 -48.155 38.944 1.00 166.20 ? 234  DT  J C5    1 
ATOM   4782  C C7    . DT  B 1 90  ? -114.153 -49.474 38.699 1.00 166.05 ? 234  DT  J C7    1 
ATOM   4783  C C6    . DT  B 1 90  ? -112.164 -47.985 38.880 1.00 165.30 ? 234  DT  J C6    1 
ATOM   4784  P P     . DT  B 1 91  ? -106.048 -47.152 40.500 1.00 109.90 ? 235  DT  J P     1 
ATOM   4785  O OP1   . DT  B 1 91  ? -104.875 -47.747 39.808 1.00 110.72 ? 235  DT  J OP1   1 
ATOM   4786  O OP2   . DT  B 1 91  ? -106.670 -47.870 41.634 1.00 111.93 ? 235  DT  J OP2   1 
ATOM   4787  O "O5'" . DT  B 1 91  ? -105.652 -45.701 40.997 1.00 107.10 ? 235  DT  J "O5'" 1 
ATOM   4788  C "C5'" . DT  B 1 91  ? -105.643 -44.626 40.066 1.00 102.76 ? 235  DT  J "C5'" 1 
ATOM   4789  C "C4'" . DT  B 1 91  ? -106.419 -43.452 40.608 1.00 99.80  ? 235  DT  J "C4'" 1 
ATOM   4790  O "O4'" . DT  B 1 91  ? -107.841 -43.741 40.629 1.00 98.84  ? 235  DT  J "O4'" 1 
ATOM   4791  C "C3'" . DT  B 1 91  ? -106.037 -43.062 42.037 1.00 98.13  ? 235  DT  J "C3'" 1 
ATOM   4792  O "O3'" . DT  B 1 91  ? -105.905 -41.638 42.144 1.00 94.30  ? 235  DT  J "O3'" 1 
ATOM   4793  C "C2'" . DT  B 1 91  ? -107.209 -43.559 42.861 1.00 98.61  ? 235  DT  J "C2'" 1 
ATOM   4794  C "C1'" . DT  B 1 91  ? -108.356 -43.364 41.894 1.00 99.79  ? 235  DT  J "C1'" 1 
ATOM   4795  N N1    . DT  B 1 91  ? -109.559 -44.173 42.184 1.00 102.70 ? 235  DT  J N1    1 
ATOM   4796  C C2    . DT  B 1 91  ? -110.722 -43.493 42.479 1.00 102.69 ? 235  DT  J C2    1 
ATOM   4797  O O2    . DT  B 1 91  ? -110.797 -42.279 42.498 1.00 101.05 ? 235  DT  J O2    1 
ATOM   4798  N N3    . DT  B 1 91  ? -111.796 -44.288 42.755 1.00 103.33 ? 235  DT  J N3    1 
ATOM   4799  C C4    . DT  B 1 91  ? -111.830 -45.662 42.770 1.00 103.84 ? 235  DT  J C4    1 
ATOM   4800  O O4    . DT  B 1 91  ? -112.876 -46.238 43.039 1.00 105.88 ? 235  DT  J O4    1 
ATOM   4801  C C5    . DT  B 1 91  ? -110.583 -46.318 42.454 1.00 103.38 ? 235  DT  J C5    1 
ATOM   4802  C C7    . DT  B 1 91  ? -110.534 -47.813 42.455 1.00 102.30 ? 235  DT  J C7    1 
ATOM   4803  C C6    . DT  B 1 91  ? -109.520 -45.551 42.175 1.00 103.50 ? 235  DT  J C6    1 
ATOM   4804  P P     . DT  B 1 92  ? -105.676 -40.961 43.584 1.00 86.21  ? 236  DT  J P     1 
ATOM   4805  O OP1   . DT  B 1 92  ? -105.004 -39.649 43.373 1.00 87.17  ? 236  DT  J OP1   1 
ATOM   4806  O OP2   . DT  B 1 92  ? -105.068 -41.964 44.503 1.00 86.96  ? 236  DT  J OP2   1 
ATOM   4807  O "O5'" . DT  B 1 92  ? -107.162 -40.637 44.039 1.00 90.86  ? 236  DT  J "O5'" 1 
ATOM   4808  C "C5'" . DT  B 1 92  ? -108.000 -39.876 43.176 1.00 95.67  ? 236  DT  J "C5'" 1 
ATOM   4809  C "C4'" . DT  B 1 92  ? -109.176 -39.321 43.938 1.00 98.87  ? 236  DT  J "C4'" 1 
ATOM   4810  O "O4'" . DT  B 1 92  ? -110.180 -40.341 44.112 1.00 99.65  ? 236  DT  J "O4'" 1 
ATOM   4811  C "C3'" . DT  B 1 92  ? -108.842 -38.806 45.330 1.00 102.37 ? 236  DT  J "C3'" 1 
ATOM   4812  O "O3'" . DT  B 1 92  ? -109.565 -37.601 45.557 1.00 108.97 ? 236  DT  J "O3'" 1 
ATOM   4813  C "C2'" . DT  B 1 92  ? -109.296 -39.934 46.242 1.00 101.08 ? 236  DT  J "C2'" 1 
ATOM   4814  C "C1'" . DT  B 1 92  ? -110.467 -40.529 45.480 1.00 100.44 ? 236  DT  J "C1'" 1 
ATOM   4815  N N1    . DT  B 1 92  ? -110.676 -41.969 45.668 1.00 101.88 ? 236  DT  J N1    1 
ATOM   4816  C C2    . DT  B 1 92  ? -111.933 -42.400 46.028 1.00 102.14 ? 236  DT  J C2    1 
ATOM   4817  O O2    . DT  B 1 92  ? -112.871 -41.639 46.223 1.00 102.31 ? 236  DT  J O2    1 
ATOM   4818  N N3    . DT  B 1 92  ? -112.055 -43.765 46.148 1.00 101.80 ? 236  DT  J N3    1 
ATOM   4819  C C4    . DT  B 1 92  ? -111.068 -44.713 45.949 1.00 101.61 ? 236  DT  J C4    1 
ATOM   4820  O O4    . DT  B 1 92  ? -111.325 -45.907 46.086 1.00 102.02 ? 236  DT  J O4    1 
ATOM   4821  C C5    . DT  B 1 92  ? -109.775 -44.185 45.584 1.00 102.05 ? 236  DT  J C5    1 
ATOM   4822  C C7    . DT  B 1 92  ? -108.647 -45.139 45.352 1.00 102.81 ? 236  DT  J C7    1 
ATOM   4823  C C6    . DT  B 1 92  ? -109.643 -42.857 45.469 1.00 101.99 ? 236  DT  J C6    1 
ATOM   4824  P P     . DT  B 1 93  ? -109.571 -36.948 47.016 1.00 135.65 ? 237  DT  J P     1 
ATOM   4825  O OP1   . DT  B 1 93  ? -109.891 -35.505 46.862 1.00 111.81 ? 237  DT  J OP1   1 
ATOM   4826  O OP2   . DT  B 1 93  ? -108.327 -37.352 47.714 1.00 112.24 ? 237  DT  J OP2   1 
ATOM   4827  O "O5'" . DT  B 1 93  ? -110.796 -37.683 47.717 1.00 140.42 ? 237  DT  J "O5'" 1 
ATOM   4828  C "C5'" . DT  B 1 93  ? -112.131 -37.485 47.253 1.00 146.06 ? 237  DT  J "C5'" 1 
ATOM   4829  C "C4'" . DT  B 1 93  ? -113.113 -37.918 48.314 1.00 149.83 ? 237  DT  J "C4'" 1 
ATOM   4830  O "O4'" . DT  B 1 93  ? -113.252 -39.359 48.296 1.00 150.14 ? 237  DT  J "O4'" 1 
ATOM   4831  C "C3'" . DT  B 1 93  ? -112.665 -37.543 49.727 1.00 152.85 ? 237  DT  J "C3'" 1 
ATOM   4832  O "O3'" . DT  B 1 93  ? -113.762 -37.062 50.507 1.00 158.16 ? 237  DT  J "O3'" 1 
ATOM   4833  C "C2'" . DT  B 1 93  ? -112.121 -38.847 50.284 1.00 151.32 ? 237  DT  J "C2'" 1 
ATOM   4834  C "C1'" . DT  B 1 93  ? -112.973 -39.891 49.581 1.00 149.60 ? 237  DT  J "C1'" 1 
ATOM   4835  N N1    . DT  B 1 93  ? -112.328 -41.210 49.396 1.00 125.14 ? 237  DT  J N1    1 
ATOM   4836  C C2    . DT  B 1 93  ? -113.127 -42.278 49.048 1.00 124.78 ? 237  DT  J C2    1 
ATOM   4837  O O2    . DT  B 1 93  ? -114.329 -42.182 48.877 1.00 125.08 ? 237  DT  J O2    1 
ATOM   4838  N N3    . DT  B 1 93  ? -112.462 -43.469 48.903 1.00 124.93 ? 237  DT  J N3    1 
ATOM   4839  C C4    . DT  B 1 93  ? -111.110 -43.695 49.063 1.00 125.17 ? 237  DT  J C4    1 
ATOM   4840  O O4    . DT  B 1 93  ? -110.657 -44.825 48.898 1.00 123.51 ? 237  DT  J O4    1 
ATOM   4841  C C5    . DT  B 1 93  ? -110.329 -42.532 49.422 1.00 125.61 ? 237  DT  J C5    1 
ATOM   4842  C C7    . DT  B 1 93  ? -108.853 -42.680 49.611 1.00 126.41 ? 237  DT  J C7    1 
ATOM   4843  C C6    . DT  B 1 93  ? -110.969 -41.364 49.569 1.00 125.26 ? 237  DT  J C6    1 
ATOM   4844  P P     . DG  B 1 94  ? -113.524 -35.878 51.570 1.00 182.09 ? 238  DG  J P     1 
ATOM   4845  O OP1   . DG  B 1 94  ? -114.315 -34.701 51.134 1.00 144.26 ? 238  DG  J OP1   1 
ATOM   4846  O OP2   . DG  B 1 94  ? -112.069 -35.729 51.811 1.00 144.13 ? 238  DG  J OP2   1 
ATOM   4847  O "O5'" . DG  B 1 94  ? -114.195 -36.440 52.896 1.00 186.03 ? 238  DG  J "O5'" 1 
ATOM   4848  C "C5'" . DG  B 1 94  ? -115.601 -36.652 52.963 1.00 192.38 ? 238  DG  J "C5'" 1 
ATOM   4849  C "C4'" . DG  B 1 94  ? -115.914 -37.728 53.975 1.00 197.50 ? 238  DG  J "C4'" 1 
ATOM   4850  O "O4'" . DG  B 1 94  ? -115.659 -39.046 53.427 1.00 199.08 ? 238  DG  J "O4'" 1 
ATOM   4851  C "C3'" . DG  B 1 94  ? -115.076 -37.631 55.249 1.00 199.08 ? 238  DG  J "C3'" 1 
ATOM   4852  O "O3'" . DG  B 1 94  ? -115.883 -37.959 56.373 1.00 199.08 ? 238  DG  J "O3'" 1 
ATOM   4853  C "C2'" . DG  B 1 94  ? -114.027 -38.710 55.057 1.00 199.08 ? 238  DG  J "C2'" 1 
ATOM   4854  C "C1'" . DG  B 1 94  ? -114.828 -39.767 54.325 1.00 199.08 ? 238  DG  J "C1'" 1 
ATOM   4855  N N9    . DG  B 1 94  ? -114.037 -40.721 53.553 1.00 165.28 ? 238  DG  J N9    1 
ATOM   4856  C C8    . DG  B 1 94  ? -112.850 -40.482 52.904 1.00 165.79 ? 238  DG  J C8    1 
ATOM   4857  N N7    . DG  B 1 94  ? -112.374 -41.538 52.300 1.00 166.35 ? 238  DG  J N7    1 
ATOM   4858  C C5    . DG  B 1 94  ? -113.302 -42.535 52.567 1.00 167.01 ? 238  DG  J C5    1 
ATOM   4859  C C6    . DG  B 1 94  ? -113.325 -43.902 52.175 1.00 167.74 ? 238  DG  J C6    1 
ATOM   4860  O O6    . DG  B 1 94  ? -112.502 -44.523 51.494 1.00 168.12 ? 238  DG  J O6    1 
ATOM   4861  N N1    . DG  B 1 94  ? -114.450 -44.554 52.664 1.00 167.89 ? 238  DG  J N1    1 
ATOM   4862  C C2    . DG  B 1 94  ? -115.430 -43.973 53.428 1.00 167.36 ? 238  DG  J C2    1 
ATOM   4863  N N2    . DG  B 1 94  ? -116.439 -44.772 53.800 1.00 167.14 ? 238  DG  J N2    1 
ATOM   4864  N N3    . DG  B 1 94  ? -115.422 -42.702 53.801 1.00 166.87 ? 238  DG  J N3    1 
ATOM   4865  C C4    . DG  B 1 94  ? -114.336 -42.047 53.338 1.00 166.45 ? 238  DG  J C4    1 
ATOM   4866  P P     . DA  B 1 95  ? -115.367 -37.604 57.845 1.00 200.16 ? 239  DA  J P     1 
ATOM   4867  O OP1   . DA  B 1 95  ? -116.009 -36.319 58.222 1.00 172.05 ? 239  DA  J OP1   1 
ATOM   4868  O OP2   . DA  B 1 95  ? -113.886 -37.722 57.865 1.00 172.06 ? 239  DA  J OP2   1 
ATOM   4869  O "O5'" . DA  B 1 95  ? -115.983 -38.768 58.737 1.00 200.16 ? 239  DA  J "O5'" 1 
ATOM   4870  C "C5'" . DA  B 1 95  ? -117.315 -39.220 58.516 1.00 200.16 ? 239  DA  J "C5'" 1 
ATOM   4871  C "C4'" . DA  B 1 95  ? -117.420 -40.697 58.815 1.00 200.16 ? 239  DA  J "C4'" 1 
ATOM   4872  O "O4'" . DA  B 1 95  ? -116.663 -41.448 57.834 1.00 200.16 ? 239  DA  J "O4'" 1 
ATOM   4873  C "C3'" . DA  B 1 95  ? -116.859 -41.096 60.179 1.00 200.16 ? 239  DA  J "C3'" 1 
ATOM   4874  O "O3'" . DA  B 1 95  ? -117.671 -42.114 60.764 1.00 200.16 ? 239  DA  J "O3'" 1 
ATOM   4875  C "C2'" . DA  B 1 95  ? -115.483 -41.642 59.846 1.00 200.16 ? 239  DA  J "C2'" 1 
ATOM   4876  C "C1'" . DA  B 1 95  ? -115.714 -42.278 58.489 1.00 200.16 ? 239  DA  J "C1'" 1 
ATOM   4877  N N9    . DA  B 1 95  ? -114.516 -42.349 57.650 1.00 179.46 ? 239  DA  J N9    1 
ATOM   4878  C C8    . DA  B 1 95  ? -113.695 -41.317 57.269 1.00 179.33 ? 239  DA  J C8    1 
ATOM   4879  N N7    . DA  B 1 95  ? -112.685 -41.694 56.523 1.00 179.24 ? 239  DA  J N7    1 
ATOM   4880  C C5    . DA  B 1 95  ? -112.853 -43.068 56.402 1.00 178.95 ? 239  DA  J C5    1 
ATOM   4881  C C6    . DA  B 1 95  ? -112.109 -44.058 55.735 1.00 178.57 ? 239  DA  J C6    1 
ATOM   4882  N N6    . DA  B 1 95  ? -110.999 -43.806 55.038 1.00 178.34 ? 239  DA  J N6    1 
ATOM   4883  N N1    . DA  B 1 95  ? -112.549 -45.334 55.810 1.00 178.26 ? 239  DA  J N1    1 
ATOM   4884  C C2    . DA  B 1 95  ? -113.659 -45.586 56.512 1.00 178.26 ? 239  DA  J C2    1 
ATOM   4885  N N3    . DA  B 1 95  ? -114.443 -44.744 57.184 1.00 178.58 ? 239  DA  J N3    1 
ATOM   4886  C C4    . DA  B 1 95  ? -113.979 -43.484 57.088 1.00 179.10 ? 239  DA  J C4    1 
ATOM   4887  P P     . DT  B 1 96  ? -117.246 -42.756 62.172 1.00 200.16 ? 240  DT  J P     1 
ATOM   4888  O OP1   . DT  B 1 96  ? -118.494 -42.978 62.949 1.00 160.04 ? 240  DT  J OP1   1 
ATOM   4889  O OP2   . DT  B 1 96  ? -116.154 -41.933 62.753 1.00 159.74 ? 240  DT  J OP2   1 
ATOM   4890  O "O5'" . DT  B 1 96  ? -116.652 -44.178 61.768 1.00 200.16 ? 240  DT  J "O5'" 1 
ATOM   4891  C "C5'" . DT  B 1 96  ? -117.467 -45.145 61.108 1.00 200.16 ? 240  DT  J "C5'" 1 
ATOM   4892  C "C4'" . DT  B 1 96  ? -116.765 -46.482 61.076 1.00 200.16 ? 240  DT  J "C4'" 1 
ATOM   4893  O "O4'" . DT  B 1 96  ? -115.636 -46.414 60.173 1.00 200.16 ? 240  DT  J "O4'" 1 
ATOM   4894  C "C3'" . DT  B 1 96  ? -116.200 -46.921 62.427 1.00 200.16 ? 240  DT  J "C3'" 1 
ATOM   4895  O "O3'" . DT  B 1 96  ? -116.312 -48.340 62.569 1.00 200.16 ? 240  DT  J "O3'" 1 
ATOM   4896  C "C2'" . DT  B 1 96  ? -114.740 -46.518 62.336 1.00 200.16 ? 240  DT  J "C2'" 1 
ATOM   4897  C "C1'" . DT  B 1 96  ? -114.445 -46.751 60.866 1.00 200.16 ? 240  DT  J "C1'" 1 
ATOM   4898  N N1    . DT  B 1 96  ? -113.356 -45.930 60.311 1.00 155.09 ? 240  DT  J N1    1 
ATOM   4899  C C2    . DT  B 1 96  ? -112.404 -46.564 59.549 1.00 154.47 ? 240  DT  J C2    1 
ATOM   4900  O O2    . DT  B 1 96  ? -112.414 -47.763 59.337 1.00 154.21 ? 240  DT  J O2    1 
ATOM   4901  N N3    . DT  B 1 96  ? -111.435 -45.738 59.041 1.00 153.78 ? 240  DT  J N3    1 
ATOM   4902  C C4    . DT  B 1 96  ? -111.323 -44.374 59.221 1.00 153.39 ? 240  DT  J C4    1 
ATOM   4903  O O4    . DT  B 1 96  ? -110.404 -43.761 58.688 1.00 152.35 ? 240  DT  J O4    1 
ATOM   4904  C C5    . DT  B 1 96  ? -112.344 -43.776 60.048 1.00 153.40 ? 240  DT  J C5    1 
ATOM   4905  C C7    . DT  B 1 96  ? -112.290 -42.305 60.316 1.00 153.17 ? 240  DT  J C7    1 
ATOM   4906  C C6    . DT  B 1 96  ? -113.299 -44.573 60.544 1.00 154.13 ? 240  DT  J C6    1 
ATOM   4907  P P     . DG  B 1 97  ? -116.834 -48.962 63.957 1.00 198.88 ? 241  DG  J P     1 
ATOM   4908  O OP1   . DG  B 1 97  ? -118.310 -49.094 63.857 1.00 193.46 ? 241  DG  J OP1   1 
ATOM   4909  O OP2   . DG  B 1 97  ? -116.240 -48.177 65.074 1.00 193.75 ? 241  DG  J OP2   1 
ATOM   4910  O "O5'" . DG  B 1 97  ? -116.215 -50.431 63.982 1.00 198.88 ? 241  DG  J "O5'" 1 
ATOM   4911  C "C5'" . DG  B 1 97  ? -115.930 -51.075 65.220 1.00 198.88 ? 241  DG  J "C5'" 1 
ATOM   4912  C "C4'" . DG  B 1 97  ? -114.532 -51.646 65.199 1.00 198.88 ? 241  DG  J "C4'" 1 
ATOM   4913  O "O4'" . DG  B 1 97  ? -113.633 -50.696 64.585 1.00 198.88 ? 241  DG  J "O4'" 1 
ATOM   4914  C "C3'" . DG  B 1 97  ? -113.964 -51.926 66.590 1.00 198.88 ? 241  DG  J "C3'" 1 
ATOM   4915  O "O3'" . DG  B 1 97  ? -113.024 -53.004 66.541 1.00 198.88 ? 241  DG  J "O3'" 1 
ATOM   4916  C "C2'" . DG  B 1 97  ? -113.207 -50.645 66.890 1.00 198.88 ? 241  DG  J "C2'" 1 
ATOM   4917  C "C1'" . DG  B 1 97  ? -112.642 -50.303 65.518 1.00 198.88 ? 241  DG  J "C1'" 1 
ATOM   4918  N N9    . DG  B 1 97  ? -112.345 -48.893 65.279 1.00 199.18 ? 241  DG  J N9    1 
ATOM   4919  C C8    . DG  B 1 97  ? -112.759 -47.812 66.022 1.00 199.80 ? 241  DG  J C8    1 
ATOM   4920  N N7    . DG  B 1 97  ? -112.325 -46.672 65.554 1.00 200.16 ? 241  DG  J N7    1 
ATOM   4921  C C5    . DG  B 1 97  ? -111.581 -47.021 64.434 1.00 200.16 ? 241  DG  J C5    1 
ATOM   4922  C C6    . DG  B 1 97  ? -110.865 -46.209 63.517 1.00 200.16 ? 241  DG  J C6    1 
ATOM   4923  O O6    . DG  B 1 97  ? -110.737 -44.980 63.513 1.00 200.16 ? 241  DG  J O6    1 
ATOM   4924  N N1    . DG  B 1 97  ? -110.255 -46.973 62.527 1.00 200.16 ? 241  DG  J N1    1 
ATOM   4925  C C2    . DG  B 1 97  ? -110.322 -48.340 62.431 1.00 200.16 ? 241  DG  J C2    1 
ATOM   4926  N N2    . DG  B 1 97  ? -109.666 -48.892 61.405 1.00 200.16 ? 241  DG  J N2    1 
ATOM   4927  N N3    . DG  B 1 97  ? -110.984 -49.108 63.279 1.00 200.16 ? 241  DG  J N3    1 
ATOM   4928  C C4    . DG  B 1 97  ? -111.585 -48.387 64.249 1.00 200.16 ? 241  DG  J C4    1 
ATOM   4929  P P     . DG  B 1 98  ? -113.461 -54.439 65.960 1.00 181.15 ? 242  DG  J P     1 
ATOM   4930  O OP1   . DG  B 1 98  ? -114.772 -54.312 65.275 1.00 180.01 ? 242  DG  J OP1   1 
ATOM   4931  O OP2   . DG  B 1 98  ? -113.290 -55.455 67.029 1.00 180.01 ? 242  DG  J OP2   1 
ATOM   4932  O "O5'" . DG  B 1 98  ? -112.347 -54.705 64.857 1.00 177.53 ? 242  DG  J "O5'" 1 
ATOM   4933  C "C5'" . DG  B 1 98  ? -111.383 -53.696 64.568 1.00 170.37 ? 242  DG  J "C5'" 1 
ATOM   4934  C "C4'" . DG  B 1 98  ? -109.991 -54.203 64.857 1.00 165.30 ? 242  DG  J "C4'" 1 
ATOM   4935  O "O4'" . DG  B 1 98  ? -109.062 -53.105 64.690 1.00 164.62 ? 242  DG  J "O4'" 1 
ATOM   4936  C "C3'" . DG  B 1 98  ? -109.777 -54.712 66.282 1.00 161.51 ? 242  DG  J "C3'" 1 
ATOM   4937  O "O3'" . DG  B 1 98  ? -108.848 -55.801 66.247 1.00 155.69 ? 242  DG  J "O3'" 1 
ATOM   4938  C "C2'" . DG  B 1 98  ? -109.206 -53.505 67.002 1.00 161.78 ? 242  DG  J "C2'" 1 
ATOM   4939  C "C1'" . DG  B 1 98  ? -108.403 -52.814 65.915 1.00 163.30 ? 242  DG  J "C1'" 1 
ATOM   4940  N N9    . DG  B 1 98  ? -108.356 -51.362 66.055 1.00 163.25 ? 242  DG  J N9    1 
ATOM   4941  C C8    . DG  B 1 98  ? -108.801 -50.616 67.121 1.00 163.02 ? 242  DG  J C8    1 
ATOM   4942  N N7    . DG  B 1 98  ? -108.648 -49.331 66.947 1.00 162.53 ? 242  DG  J N7    1 
ATOM   4943  C C5    . DG  B 1 98  ? -108.064 -49.223 65.693 1.00 162.28 ? 242  DG  J C5    1 
ATOM   4944  C C6    . DG  B 1 98  ? -107.671 -48.076 64.961 1.00 161.40 ? 242  DG  J C6    1 
ATOM   4945  O O6    . DG  B 1 98  ? -107.772 -46.886 65.282 1.00 160.37 ? 242  DG  J O6    1 
ATOM   4946  N N1    . DG  B 1 98  ? -107.113 -48.418 63.733 1.00 161.01 ? 242  DG  J N1    1 
ATOM   4947  C C2    . DG  B 1 98  ? -106.955 -49.699 63.267 1.00 161.34 ? 242  DG  J C2    1 
ATOM   4948  N N2    . DG  B 1 98  ? -106.389 -49.823 62.056 1.00 160.93 ? 242  DG  J N2    1 
ATOM   4949  N N3    . DG  B 1 98  ? -107.324 -50.779 63.937 1.00 161.86 ? 242  DG  J N3    1 
ATOM   4950  C C4    . DG  B 1 98  ? -107.868 -50.468 65.134 1.00 162.63 ? 242  DG  J C4    1 
ATOM   4951  P P     . DA  B 1 99  ? -108.244 -56.402 67.613 1.00 131.52 ? 243  DA  J P     1 
ATOM   4952  O OP1   . DA  B 1 99  ? -108.702 -57.810 67.732 1.00 168.04 ? 243  DA  J OP1   1 
ATOM   4953  O OP2   . DA  B 1 99  ? -108.468 -55.460 68.740 1.00 167.48 ? 243  DA  J OP2   1 
ATOM   4954  O "O5'" . DA  B 1 99  ? -106.685 -56.444 67.305 1.00 128.09 ? 243  DA  J "O5'" 1 
ATOM   4955  C "C5'" . DA  B 1 99  ? -106.225 -56.739 65.985 1.00 121.57 ? 243  DA  J "C5'" 1 
ATOM   4956  C "C4'" . DA  B 1 99  ? -104.894 -56.074 65.721 1.00 116.59 ? 243  DA  J "C4'" 1 
ATOM   4957  O "O4'" . DA  B 1 99  ? -105.035 -54.633 65.694 1.00 115.42 ? 243  DA  J "O4'" 1 
ATOM   4958  C "C3'" . DA  B 1 99  ? -103.799 -56.372 66.743 1.00 113.81 ? 243  DA  J "C3'" 1 
ATOM   4959  O "O3'" . DA  B 1 99  ? -102.577 -56.533 66.041 1.00 111.35 ? 243  DA  J "O3'" 1 
ATOM   4960  C "C2'" . DA  B 1 99  ? -103.747 -55.109 67.583 1.00 112.72 ? 243  DA  J "C2'" 1 
ATOM   4961  C "C1'" . DA  B 1 99  ? -104.060 -54.052 66.544 1.00 113.45 ? 243  DA  J "C1'" 1 
ATOM   4962  N N9    . DA  B 1 99  ? -104.600 -52.795 67.063 1.00 148.65 ? 243  DA  J N9    1 
ATOM   4963  C C8    . DA  B 1 99  ? -105.456 -52.605 68.120 1.00 148.14 ? 243  DA  J C8    1 
ATOM   4964  N N7    . DA  B 1 99  ? -105.744 -51.346 68.348 1.00 148.34 ? 243  DA  J N7    1 
ATOM   4965  C C5    . DA  B 1 99  ? -105.031 -50.659 67.375 1.00 148.82 ? 243  DA  J C5    1 
ATOM   4966  C C6    . DA  B 1 99  ? -104.906 -49.290 67.083 1.00 148.92 ? 243  DA  J C6    1 
ATOM   4967  N N6    . DA  B 1 99  ? -105.518 -48.327 67.774 1.00 148.51 ? 243  DA  J N6    1 
ATOM   4968  N N1    . DA  B 1 99  ? -104.118 -48.939 66.044 1.00 148.56 ? 243  DA  J N1    1 
ATOM   4969  C C2    . DA  B 1 99  ? -103.501 -49.904 65.352 1.00 148.91 ? 243  DA  J C2    1 
ATOM   4970  N N3    . DA  B 1 99  ? -103.536 -51.222 65.531 1.00 148.31 ? 243  DA  J N3    1 
ATOM   4971  C C4    . DA  B 1 99  ? -104.328 -51.539 66.572 1.00 148.52 ? 243  DA  J C4    1 
ATOM   4972  P P     . DG  B 1 100 ? -101.342 -57.254 66.753 1.00 129.36 ? 244  DG  J P     1 
ATOM   4973  O OP1   . DG  B 1 100 ? -101.537 -58.716 66.609 1.00 143.82 ? 244  DG  J OP1   1 
ATOM   4974  O OP2   . DG  B 1 100 ? -101.173 -56.661 68.106 1.00 143.97 ? 244  DG  J OP2   1 
ATOM   4975  O "O5'" . DG  B 1 100 ? -100.118 -56.827 65.833 1.00 128.68 ? 244  DG  J "O5'" 1 
ATOM   4976  C "C5'" . DG  B 1 100 ? -100.312 -56.607 64.435 1.00 127.06 ? 244  DG  J "C5'" 1 
ATOM   4977  C "C4'" . DG  B 1 100 ? -99.590  -55.356 63.995 1.00 125.86 ? 244  DG  J "C4'" 1 
ATOM   4978  O "O4'" . DG  B 1 100 ? -100.200 -54.191 64.603 1.00 125.55 ? 244  DG  J "O4'" 1 
ATOM   4979  C "C3'" . DG  B 1 100 ? -98.119  -55.319 64.400 1.00 124.70 ? 244  DG  J "C3'" 1 
ATOM   4980  O "O3'" . DG  B 1 100 ? -97.341  -54.704 63.374 1.00 121.64 ? 244  DG  J "O3'" 1 
ATOM   4981  C "C2'" . DG  B 1 100 ? -98.119  -54.478 65.661 1.00 125.37 ? 244  DG  J "C2'" 1 
ATOM   4982  C "C1'" . DG  B 1 100 ? -99.261  -53.506 65.421 1.00 125.91 ? 244  DG  J "C1'" 1 
ATOM   4983  N N9    . DG  B 1 100 ? -99.946  -53.124 66.651 1.00 141.79 ? 244  DG  J N9    1 
ATOM   4984  C C8    . DG  B 1 100 ? -100.354 -53.967 67.656 1.00 142.86 ? 244  DG  J C8    1 
ATOM   4985  N N7    . DG  B 1 100 ? -100.952 -53.347 68.635 1.00 143.10 ? 244  DG  J N7    1 
ATOM   4986  C C5    . DG  B 1 100 ? -100.938 -52.012 68.256 1.00 142.46 ? 244  DG  J C5    1 
ATOM   4987  C C6    . DG  B 1 100 ? -101.450 -50.866 68.917 1.00 142.11 ? 244  DG  J C6    1 
ATOM   4988  O O6    . DG  B 1 100 ? -102.049 -50.804 70.000 1.00 141.63 ? 244  DG  J O6    1 
ATOM   4989  N N1    . DG  B 1 100 ? -101.212 -49.707 68.186 1.00 141.57 ? 244  DG  J N1    1 
ATOM   4990  C C2    . DG  B 1 100 ? -100.570 -49.657 66.974 1.00 142.28 ? 244  DG  J C2    1 
ATOM   4991  N N2    . DG  B 1 100 ? -100.434 -48.441 66.432 1.00 142.84 ? 244  DG  J N2    1 
ATOM   4992  N N3    . DG  B 1 100 ? -100.096 -50.719 66.342 1.00 142.55 ? 244  DG  J N3    1 
ATOM   4993  C C4    . DG  B 1 100 ? -100.313 -51.856 67.036 1.00 142.18 ? 244  DG  J C4    1 
ATOM   4994  P P     . DC  B 1 101 ? -95.778  -54.452 63.614 1.00 114.98 ? 245  DC  J P     1 
ATOM   4995  O OP1   . DC  B 1 101 ? -95.193  -54.123 62.292 1.00 118.93 ? 245  DC  J OP1   1 
ATOM   4996  O OP2   . DC  B 1 101 ? -95.229  -55.584 64.401 1.00 120.12 ? 245  DC  J OP2   1 
ATOM   4997  O "O5'" . DC  B 1 101 ? -95.754  -53.158 64.539 1.00 113.81 ? 245  DC  J "O5'" 1 
ATOM   4998  C "C5'" . DC  B 1 101 ? -96.342  -51.939 64.100 1.00 112.56 ? 245  DC  J "C5'" 1 
ATOM   4999  C "C4'" . DC  B 1 101 ? -96.035  -50.838 65.085 1.00 111.74 ? 245  DC  J "C4'" 1 
ATOM   5000  O "O4'" . DC  B 1 101 ? -96.964  -50.849 66.200 1.00 112.27 ? 245  DC  J "O4'" 1 
ATOM   5001  C "C3'" . DC  B 1 101 ? -94.636  -50.954 65.692 1.00 110.90 ? 245  DC  J "C3'" 1 
ATOM   5002  O "O3'" . DC  B 1 101 ? -94.060  -49.658 65.807 1.00 108.94 ? 245  DC  J "O3'" 1 
ATOM   5003  C "C2'" . DC  B 1 101 ? -94.903  -51.506 67.080 1.00 111.85 ? 245  DC  J "C2'" 1 
ATOM   5004  C "C1'" . DC  B 1 101 ? -96.225  -50.835 67.416 1.00 113.17 ? 245  DC  J "C1'" 1 
ATOM   5005  N N1    . DC  B 1 101 ? -97.020  -51.499 68.472 1.00 119.81 ? 245  DC  J N1    1 
ATOM   5006  C C2    . DC  B 1 101 ? -97.878  -50.722 69.269 1.00 120.03 ? 245  DC  J C2    1 
ATOM   5007  O O2    . DC  B 1 101 ? -97.993  -49.511 69.027 1.00 118.33 ? 245  DC  J O2    1 
ATOM   5008  N N3    . DC  B 1 101 ? -98.562  -51.318 70.279 1.00 121.31 ? 245  DC  J N3    1 
ATOM   5009  C C4    . DC  B 1 101 ? -98.424  -52.632 70.496 1.00 122.02 ? 245  DC  J C4    1 
ATOM   5010  N N4    . DC  B 1 101 ? -99.100  -53.177 71.508 1.00 121.97 ? 245  DC  J N4    1 
ATOM   5011  C C5    . DC  B 1 101 ? -97.584  -53.446 69.686 1.00 121.75 ? 245  DC  J C5    1 
ATOM   5012  C C6    . DC  B 1 101 ? -96.908  -52.845 68.694 1.00 121.31 ? 245  DC  J C6    1 
ATOM   5013  P P     . DA  B 1 102 ? -92.612  -49.374 65.189 1.00 83.36  ? 246  DA  J P     1 
ATOM   5014  O OP1   . DA  B 1 102 ? -92.430  -50.209 63.975 1.00 104.64 ? 246  DA  J OP1   1 
ATOM   5015  O OP2   . DA  B 1 102 ? -91.608  -49.428 66.284 1.00 102.34 ? 246  DA  J OP2   1 
ATOM   5016  O "O5'" . DA  B 1 102 ? -92.727  -47.864 64.741 1.00 85.22  ? 246  DA  J "O5'" 1 
ATOM   5017  C "C5'" . DA  B 1 102 ? -92.044  -46.874 65.473 1.00 91.03  ? 246  DA  J "C5'" 1 
ATOM   5018  C "C4'" . DA  B 1 102 ? -93.024  -45.953 66.151 1.00 94.58  ? 246  DA  J "C4'" 1 
ATOM   5019  O "O4'" . DA  B 1 102 ? -94.002  -46.727 66.887 1.00 93.85  ? 246  DA  J "O4'" 1 
ATOM   5020  C "C3'" . DA  B 1 102 ? -92.317  -45.073 67.174 1.00 98.27  ? 246  DA  J "C3'" 1 
ATOM   5021  O "O3'" . DA  B 1 102 ? -92.760  -43.725 67.090 1.00 102.51 ? 246  DA  J "O3'" 1 
ATOM   5022  C "C2'" . DA  B 1 102 ? -92.648  -45.713 68.511 1.00 97.02  ? 246  DA  J "C2'" 1 
ATOM   5023  C "C1'" . DA  B 1 102 ? -93.995  -46.365 68.262 1.00 95.70  ? 246  DA  J "C1'" 1 
ATOM   5024  N N9    . DA  B 1 102 ? -94.225  -47.580 69.051 1.00 118.08 ? 246  DA  J N9    1 
ATOM   5025  C C8    . DA  B 1 102 ? -93.564  -48.783 68.957 1.00 118.95 ? 246  DA  J C8    1 
ATOM   5026  N N7    . DA  B 1 102 ? -94.018  -49.704 69.776 1.00 119.56 ? 246  DA  J N7    1 
ATOM   5027  C C5    . DA  B 1 102 ? -95.042  -49.066 70.462 1.00 119.96 ? 246  DA  J C5    1 
ATOM   5028  C C6    . DA  B 1 102 ? -95.930  -49.506 71.467 1.00 120.71 ? 246  DA  J C6    1 
ATOM   5029  N N6    . DA  B 1 102 ? -95.936  -50.746 71.966 1.00 120.97 ? 246  DA  J N6    1 
ATOM   5030  N N1    . DA  B 1 102 ? -96.828  -48.616 71.943 1.00 121.40 ? 246  DA  J N1    1 
ATOM   5031  C C2    . DA  B 1 102 ? -96.830  -47.373 71.438 1.00 121.12 ? 246  DA  J C2    1 
ATOM   5032  N N3    . DA  B 1 102 ? -96.053  -46.843 70.491 1.00 120.15 ? 246  DA  J N3    1 
ATOM   5033  C C4    . DA  B 1 102 ? -95.172  -47.752 70.036 1.00 119.68 ? 246  DA  J C4    1 
ATOM   5034  P P     . DG  B 1 103 ? -91.840  -42.568 67.705 1.00 139.57 ? 247  DG  J P     1 
ATOM   5035  O OP1   . DG  B 1 103 ? -92.340  -41.279 67.164 1.00 140.35 ? 247  DG  J OP1   1 
ATOM   5036  O OP2   . DG  B 1 103 ? -90.417  -42.946 67.520 1.00 138.93 ? 247  DG  J OP2   1 
ATOM   5037  O "O5'" . DG  B 1 103 ? -92.171  -42.633 69.260 1.00 142.33 ? 247  DG  J "O5'" 1 
ATOM   5038  C "C5'" . DG  B 1 103 ? -93.388  -42.085 69.760 1.00 146.27 ? 247  DG  J "C5'" 1 
ATOM   5039  C "C4'" . DG  B 1 103 ? -93.374  -42.072 71.270 1.00 148.25 ? 247  DG  J "C4'" 1 
ATOM   5040  O "O4'" . DG  B 1 103 ? -93.570  -43.415 71.769 1.00 148.47 ? 247  DG  J "O4'" 1 
ATOM   5041  C "C3'" . DG  B 1 103 ? -92.064  -41.575 71.879 1.00 149.85 ? 247  DG  J "C3'" 1 
ATOM   5042  O "O3'" . DG  B 1 103 ? -92.339  -40.775 73.029 1.00 152.13 ? 247  DG  J "O3'" 1 
ATOM   5043  C "C2'" . DG  B 1 103 ? -91.343  -42.859 72.247 1.00 149.38 ? 247  DG  J "C2'" 1 
ATOM   5044  C "C1'" . DG  B 1 103 ? -92.484  -43.791 72.600 1.00 149.20 ? 247  DG  J "C1'" 1 
ATOM   5045  N N9    . DG  B 1 103 ? -92.196  -45.196 72.339 1.00 149.97 ? 247  DG  J N9    1 
ATOM   5046  C C8    . DG  B 1 103 ? -91.207  -45.709 71.536 1.00 149.73 ? 247  DG  J C8    1 
ATOM   5047  N N7    . DG  B 1 103 ? -91.197  -47.014 71.507 1.00 149.49 ? 247  DG  J N7    1 
ATOM   5048  C C5    . DG  B 1 103 ? -92.245  -47.382 72.340 1.00 149.82 ? 247  DG  J C5    1 
ATOM   5049  C C6    . DG  B 1 103 ? -92.722  -48.665 72.703 1.00 149.97 ? 247  DG  J C6    1 
ATOM   5050  O O6    . DG  B 1 103 ? -92.305  -49.772 72.345 1.00 150.40 ? 247  DG  J O6    1 
ATOM   5051  N N1    . DG  B 1 103 ? -93.802  -48.579 73.574 1.00 150.00 ? 247  DG  J N1    1 
ATOM   5052  C C2    . DG  B 1 103 ? -94.355  -47.409 74.034 1.00 150.31 ? 247  DG  J C2    1 
ATOM   5053  N N2    . DG  B 1 103 ? -95.399  -47.535 74.868 1.00 150.71 ? 247  DG  J N2    1 
ATOM   5054  N N3    . DG  B 1 103 ? -93.920  -46.208 73.702 1.00 150.45 ? 247  DG  J N3    1 
ATOM   5055  C C4    . DG  B 1 103 ? -92.871  -46.268 72.859 1.00 150.09 ? 247  DG  J C4    1 
ATOM   5056  P P     . DT  B 1 104 ? -91.185  -40.496 74.111 1.00 154.63 ? 248  DT  J P     1 
ATOM   5057  O OP1   . DT  B 1 104 ? -91.160  -39.029 74.341 1.00 141.97 ? 248  DT  J OP1   1 
ATOM   5058  O OP2   . DT  B 1 104 ? -89.930  -41.196 73.738 1.00 141.34 ? 248  DT  J OP2   1 
ATOM   5059  O "O5'" . DT  B 1 104 ? -91.781  -41.192 75.410 1.00 157.01 ? 248  DT  J "O5'" 1 
ATOM   5060  C "C5'" . DT  B 1 104 ? -93.160  -41.033 75.736 1.00 160.06 ? 248  DT  J "C5'" 1 
ATOM   5061  C "C4'" . DT  B 1 104 ? -93.428  -41.541 77.131 1.00 162.07 ? 248  DT  J "C4'" 1 
ATOM   5062  O "O4'" . DT  B 1 104 ? -93.542  -42.984 77.128 1.00 163.20 ? 248  DT  J "O4'" 1 
ATOM   5063  C "C3'" . DT  B 1 104 ? -92.325  -41.199 78.129 1.00 163.66 ? 248  DT  J "C3'" 1 
ATOM   5064  O "O3'" . DT  B 1 104 ? -92.894  -40.803 79.376 1.00 165.88 ? 248  DT  J "O3'" 1 
ATOM   5065  C "C2'" . DT  B 1 104 ? -91.561  -42.503 78.274 1.00 163.38 ? 248  DT  J "C2'" 1 
ATOM   5066  C "C1'" . DT  B 1 104 ? -92.655  -43.539 78.085 1.00 163.39 ? 248  DT  J "C1'" 1 
ATOM   5067  N N1    . DT  B 1 104 ? -92.195  -44.845 77.574 1.00 150.93 ? 248  DT  J N1    1 
ATOM   5068  C C2    . DT  B 1 104 ? -92.567  -45.985 78.260 1.00 150.83 ? 248  DT  J C2    1 
ATOM   5069  O O2    . DT  B 1 104 ? -93.247  -45.964 79.273 1.00 151.51 ? 248  DT  J O2    1 
ATOM   5070  N N3    . DT  B 1 104 ? -92.110  -47.158 77.713 1.00 150.66 ? 248  DT  J N3    1 
ATOM   5071  C C4    . DT  B 1 104 ? -91.333  -47.304 76.580 1.00 150.95 ? 248  DT  J C4    1 
ATOM   5072  O O4    . DT  B 1 104 ? -91.003  -48.428 76.208 1.00 151.48 ? 248  DT  J O4    1 
ATOM   5073  C C5    . DT  B 1 104 ? -90.970  -46.068 75.917 1.00 150.80 ? 248  DT  J C5    1 
ATOM   5074  C C7    . DT  B 1 104 ? -90.113  -46.124 74.692 1.00 150.64 ? 248  DT  J C7    1 
ATOM   5075  C C6    . DT  B 1 104 ? -91.418  -44.918 76.439 1.00 150.69 ? 248  DT  J C6    1 
ATOM   5076  P P     . DT  B 1 105 ? -91.951  -40.173 80.510 1.00 164.44 ? 249  DT  J P     1 
ATOM   5077  O OP1   . DT  B 1 105 ? -92.652  -38.981 81.056 1.00 162.23 ? 249  DT  J OP1   1 
ATOM   5078  O OP2   . DT  B 1 105 ? -90.577  -40.032 79.961 1.00 162.46 ? 249  DT  J OP2   1 
ATOM   5079  O "O5'" . DT  B 1 105 ? -91.931  -41.308 81.624 1.00 166.14 ? 249  DT  J "O5'" 1 
ATOM   5080  C "C5'" . DT  B 1 105 ? -93.149  -41.856 82.114 1.00 169.13 ? 249  DT  J "C5'" 1 
ATOM   5081  C "C4'" . DT  B 1 105 ? -92.874  -43.093 82.933 1.00 171.30 ? 249  DT  J "C4'" 1 
ATOM   5082  O "O4'" . DT  B 1 105 ? -92.531  -44.205 82.071 1.00 172.74 ? 249  DT  J "O4'" 1 
ATOM   5083  C "C3'" . DT  B 1 105 ? -91.716  -42.945 83.919 1.00 172.19 ? 249  DT  J "C3'" 1 
ATOM   5084  O "O3'" . DT  B 1 105 ? -92.062  -43.556 85.160 1.00 173.05 ? 249  DT  J "O3'" 1 
ATOM   5085  C "C2'" . DT  B 1 105 ? -90.582  -43.701 83.251 1.00 172.25 ? 249  DT  J "C2'" 1 
ATOM   5086  C "C1'" . DT  B 1 105 ? -91.329  -44.802 82.525 1.00 172.60 ? 249  DT  J "C1'" 1 
ATOM   5087  N N1    . DT  B 1 105 ? -90.626  -45.365 81.357 1.00 170.98 ? 249  DT  J N1    1 
ATOM   5088  C C2    . DT  B 1 105 ? -90.604  -46.735 81.219 1.00 171.04 ? 249  DT  J C2    1 
ATOM   5089  O O2    . DT  B 1 105 ? -91.142  -47.493 82.008 1.00 171.61 ? 249  DT  J O2    1 
ATOM   5090  N N3    . DT  B 1 105 ? -89.924  -47.189 80.116 1.00 170.70 ? 249  DT  J N3    1 
ATOM   5091  C C4    . DT  B 1 105 ? -89.277  -46.429 79.163 1.00 170.79 ? 249  DT  J C4    1 
ATOM   5092  O O4    . DT  B 1 105 ? -88.699  -46.981 78.231 1.00 170.31 ? 249  DT  J O4    1 
ATOM   5093  C C5    . DT  B 1 105 ? -89.343  -44.997 79.367 1.00 170.85 ? 249  DT  J C5    1 
ATOM   5094  C C7    . DT  B 1 105 ? -88.671  -44.092 78.383 1.00 171.29 ? 249  DT  J C7    1 
ATOM   5095  C C6    . DT  B 1 105 ? -90.008  -44.544 80.439 1.00 170.80 ? 249  DT  J C6    1 
ATOM   5096  P P     . DT  B 1 106 ? -91.105  -43.364 86.433 1.00 167.89 ? 250  DT  J P     1 
ATOM   5097  O OP1   . DT  B 1 106 ? -91.976  -43.307 87.635 1.00 159.58 ? 250  DT  J OP1   1 
ATOM   5098  O OP2   . DT  B 1 106 ? -90.153  -42.257 86.162 1.00 159.25 ? 250  DT  J OP2   1 
ATOM   5099  O "O5'" . DT  B 1 106 ? -90.283  -44.723 86.472 1.00 167.65 ? 250  DT  J "O5'" 1 
ATOM   5100  C "C5'" . DT  B 1 106 ? -90.955  -45.965 86.632 1.00 166.77 ? 250  DT  J "C5'" 1 
ATOM   5101  C "C4'" . DT  B 1 106 ? -89.947  -47.084 86.677 1.00 166.43 ? 250  DT  J "C4'" 1 
ATOM   5102  O "O4'" . DT  B 1 106 ? -89.450  -47.359 85.346 1.00 167.69 ? 250  DT  J "O4'" 1 
ATOM   5103  C "C3'" . DT  B 1 106 ? -88.725  -46.740 87.527 1.00 165.56 ? 250  DT  J "C3'" 1 
ATOM   5104  O "O3'" . DT  B 1 106 ? -88.291  -47.907 88.208 1.00 163.73 ? 250  DT  J "O3'" 1 
ATOM   5105  C "C2'" . DT  B 1 106 ? -87.689  -46.342 86.494 1.00 166.05 ? 250  DT  J "C2'" 1 
ATOM   5106  C "C1'" . DT  B 1 106 ? -88.034  -47.275 85.347 1.00 167.43 ? 250  DT  J "C1'" 1 
ATOM   5107  N N1    . DT  B 1 106 ? -87.594  -46.822 84.011 1.00 160.17 ? 250  DT  J N1    1 
ATOM   5108  C C2    . DT  B 1 106 ? -87.137  -47.772 83.120 1.00 160.38 ? 250  DT  J C2    1 
ATOM   5109  O O2    . DT  B 1 106 ? -87.085  -48.962 83.379 1.00 160.79 ? 250  DT  J O2    1 
ATOM   5110  N N3    . DT  B 1 106 ? -86.737  -47.272 81.908 1.00 160.61 ? 250  DT  J N3    1 
ATOM   5111  C C4    . DT  B 1 106 ? -86.749  -45.953 81.503 1.00 160.84 ? 250  DT  J C4    1 
ATOM   5112  O O4    . DT  B 1 106 ? -86.359  -45.658 80.377 1.00 160.44 ? 250  DT  J O4    1 
ATOM   5113  C C5    . DT  B 1 106 ? -87.240  -45.009 82.484 1.00 160.73 ? 250  DT  J C5    1 
ATOM   5114  C C7    . DT  B 1 106 ? -87.284  -43.554 82.137 1.00 160.96 ? 250  DT  J C7    1 
ATOM   5115  C C6    . DT  B 1 106 ? -87.635  -45.486 83.671 1.00 160.53 ? 250  DT  J C6    1 
ATOM   5116  P P     . DC  B 1 107 ? -87.635  -47.787 89.666 1.00 199.84 ? 251  DC  J P     1 
ATOM   5117  O OP1   . DC  B 1 107 ? -88.755  -47.775 90.647 1.00 132.84 ? 251  DC  J OP1   1 
ATOM   5118  O OP2   . DC  B 1 107 ? -86.642  -46.679 89.674 1.00 133.56 ? 251  DC  J OP2   1 
ATOM   5119  O "O5'" . DC  B 1 107 ? -86.856  -49.171 89.787 1.00 199.84 ? 251  DC  J "O5'" 1 
ATOM   5120  C "C5'" . DC  B 1 107 ? -87.479  -50.380 89.351 1.00 197.97 ? 251  DC  J "C5'" 1 
ATOM   5121  C "C4'" . DC  B 1 107 ? -86.507  -51.238 88.574 1.00 196.27 ? 251  DC  J "C4'" 1 
ATOM   5122  O "O4'" . DC  B 1 107 ? -86.207  -50.658 87.278 1.00 195.76 ? 251  DC  J "O4'" 1 
ATOM   5123  C "C3'" . DC  B 1 107 ? -85.160  -51.481 89.254 1.00 195.37 ? 251  DC  J "C3'" 1 
ATOM   5124  O "O3'" . DC  B 1 107 ? -84.795  -52.853 89.111 1.00 194.59 ? 251  DC  J "O3'" 1 
ATOM   5125  C "C2'" . DC  B 1 107 ? -84.200  -50.609 88.465 1.00 195.02 ? 251  DC  J "C2'" 1 
ATOM   5126  C "C1'" . DC  B 1 107 ? -84.802  -50.669 87.074 1.00 195.09 ? 251  DC  J "C1'" 1 
ATOM   5127  N N1    . DC  B 1 107 ? -84.452  -49.538 86.195 1.00 128.53 ? 251  DC  J N1    1 
ATOM   5128  C C2    . DC  B 1 107 ? -84.143  -49.793 84.851 1.00 128.71 ? 251  DC  J C2    1 
ATOM   5129  O O2    . DC  B 1 107 ? -84.159  -50.962 84.443 1.00 129.68 ? 251  DC  J O2    1 
ATOM   5130  N N3    . DC  B 1 107 ? -83.830  -48.759 84.037 1.00 128.25 ? 251  DC  J N3    1 
ATOM   5131  C C4    . DC  B 1 107 ? -83.816  -47.512 84.518 1.00 127.79 ? 251  DC  J C4    1 
ATOM   5132  N N4    . DC  B 1 107 ? -83.510  -46.521 83.681 1.00 127.03 ? 251  DC  J N4    1 
ATOM   5133  C C5    . DC  B 1 107 ? -84.118  -47.225 85.879 1.00 127.76 ? 251  DC  J C5    1 
ATOM   5134  C C6    . DC  B 1 107 ? -84.430  -48.257 86.674 1.00 128.23 ? 251  DC  J C6    1 
ATOM   5135  P P     . DC  B 1 108 ? -83.595  -53.446 89.990 1.00 152.12 ? 252  DC  J P     1 
ATOM   5136  O OP1   . DC  B 1 108 ? -83.953  -54.844 90.348 1.00 150.52 ? 252  DC  J OP1   1 
ATOM   5137  O OP2   . DC  B 1 108 ? -83.299  -52.465 91.066 1.00 150.78 ? 252  DC  J OP2   1 
ATOM   5138  O "O5'" . DC  B 1 108 ? -82.367  -53.482 88.974 1.00 150.55 ? 252  DC  J "O5'" 1 
ATOM   5139  C "C5'" . DC  B 1 108 ? -82.302  -54.478 87.958 1.00 147.80 ? 252  DC  J "C5'" 1 
ATOM   5140  C "C4'" . DC  B 1 108 ? -80.967  -54.432 87.250 1.00 146.21 ? 252  DC  J "C4'" 1 
ATOM   5141  O "O4'" . DC  B 1 108 ? -80.892  -53.298 86.357 1.00 145.65 ? 252  DC  J "O4'" 1 
ATOM   5142  C "C3'" . DC  B 1 108 ? -79.742  -54.340 88.156 1.00 145.30 ? 252  DC  J "C3'" 1 
ATOM   5143  O "O3'" . DC  B 1 108 ? -78.710  -55.155 87.607 1.00 144.02 ? 252  DC  J "O3'" 1 
ATOM   5144  C "C2'" . DC  B 1 108 ? -79.342  -52.880 88.044 1.00 145.16 ? 252  DC  J "C2'" 1 
ATOM   5145  C "C1'" . DC  B 1 108 ? -79.686  -52.596 86.595 1.00 145.23 ? 252  DC  J "C1'" 1 
ATOM   5146  N N1    . DC  B 1 108 ? -79.908  -51.184 86.244 1.00 143.65 ? 252  DC  J N1    1 
ATOM   5147  C C2    . DC  B 1 108 ? -79.597  -50.765 84.948 1.00 143.49 ? 252  DC  J C2    1 
ATOM   5148  O O2    . DC  B 1 108 ? -79.134  -51.590 84.148 1.00 143.01 ? 252  DC  J O2    1 
ATOM   5149  N N3    . DC  B 1 108 ? -79.810  -49.474 84.599 1.00 143.29 ? 252  DC  J N3    1 
ATOM   5150  C C4    . DC  B 1 108 ? -80.314  -48.618 85.489 1.00 142.84 ? 252  DC  J C4    1 
ATOM   5151  N N4    . DC  B 1 108 ? -80.520  -47.357 85.098 1.00 141.92 ? 252  DC  J N4    1 
ATOM   5152  C C5    . DC  B 1 108 ? -80.632  -49.016 86.820 1.00 142.87 ? 252  DC  J C5    1 
ATOM   5153  C C6    . DC  B 1 108 ? -80.414  -50.297 87.153 1.00 143.30 ? 252  DC  J C6    1 
ATOM   5154  P P     . DA  B 1 109 ? -78.310  -56.527 88.335 1.00 135.85 ? 253  DA  J P     1 
ATOM   5155  O OP1   . DA  B 1 109 ? -79.573  -57.239 88.661 1.00 157.11 ? 253  DA  J OP1   1 
ATOM   5156  O OP2   . DA  B 1 109 ? -77.332  -56.220 89.411 1.00 157.18 ? 253  DA  J OP2   1 
ATOM   5157  O "O5'" . DA  B 1 109 ? -77.550  -57.350 87.207 1.00 134.78 ? 253  DA  J "O5'" 1 
ATOM   5158  C "C5'" . DA  B 1 109 ? -78.167  -57.603 85.950 1.00 132.73 ? 253  DA  J "C5'" 1 
ATOM   5159  C "C4'" . DA  B 1 109 ? -77.211  -57.270 84.828 1.00 131.47 ? 253  DA  J "C4'" 1 
ATOM   5160  O "O4'" . DA  B 1 109 ? -77.115  -55.835 84.635 1.00 131.23 ? 253  DA  J "O4'" 1 
ATOM   5161  C "C3'" . DA  B 1 109 ? -75.782  -57.760 85.056 1.00 130.37 ? 253  DA  J "C3'" 1 
ATOM   5162  O "O3'" . DA  B 1 109 ? -75.256  -58.238 83.825 1.00 129.68 ? 253  DA  J "O3'" 1 
ATOM   5163  C "C2'" . DA  B 1 109 ? -75.044  -56.506 85.490 1.00 130.17 ? 253  DA  J "C2'" 1 
ATOM   5164  C "C1'" . DA  B 1 109 ? -75.755  -55.426 84.699 1.00 130.20 ? 253  DA  J "C1'" 1 
ATOM   5165  N N9    . DA  B 1 109 ? -75.714  -54.100 85.315 1.00 150.90 ? 253  DA  J N9    1 
ATOM   5166  C C8    . DA  B 1 109 ? -75.470  -53.787 86.629 1.00 150.51 ? 253  DA  J C8    1 
ATOM   5167  N N7    . DA  B 1 109 ? -75.510  -52.502 86.882 1.00 150.59 ? 253  DA  J N7    1 
ATOM   5168  C C5    . DA  B 1 109 ? -75.797  -51.928 85.652 1.00 150.32 ? 253  DA  J C5    1 
ATOM   5169  C C6    . DA  B 1 109 ? -75.976  -50.591 85.249 1.00 150.13 ? 253  DA  J C6    1 
ATOM   5170  N N6    . DA  B 1 109 ? -75.897  -49.549 86.078 1.00 149.04 ? 253  DA  J N6    1 
ATOM   5171  N N1    . DA  B 1 109 ? -76.245  -50.359 83.947 1.00 150.31 ? 253  DA  J N1    1 
ATOM   5172  C C2    . DA  B 1 109 ? -76.333  -51.405 83.115 1.00 150.46 ? 253  DA  J C2    1 
ATOM   5173  N N3    . DA  B 1 109 ? -76.191  -52.705 83.375 1.00 150.41 ? 253  DA  J N3    1 
ATOM   5174  C C4    . DA  B 1 109 ? -75.921  -52.900 84.677 1.00 150.53 ? 253  DA  J C4    1 
ATOM   5175  P P     . DA  B 1 110 ? -73.742  -58.756 83.754 1.00 166.07 ? 254  DA  J P     1 
ATOM   5176  O OP1   . DA  B 1 110 ? -73.804  -60.234 83.622 1.00 139.35 ? 254  DA  J OP1   1 
ATOM   5177  O OP2   . DA  B 1 110 ? -72.950  -58.146 84.857 1.00 139.48 ? 254  DA  J OP2   1 
ATOM   5178  O "O5'" . DA  B 1 110 ? -73.238  -58.140 82.375 1.00 166.85 ? 254  DA  J "O5'" 1 
ATOM   5179  C "C5'" . DA  B 1 110 ? -74.166  -57.877 81.321 1.00 167.03 ? 254  DA  J "C5'" 1 
ATOM   5180  C "C4'" . DA  B 1 110 ? -73.642  -56.786 80.418 1.00 166.84 ? 254  DA  J "C4'" 1 
ATOM   5181  O "O4'" . DA  B 1 110 ? -73.651  -55.516 81.112 1.00 167.69 ? 254  DA  J "O4'" 1 
ATOM   5182  C "C3'" . DA  B 1 110 ? -72.205  -57.001 79.950 1.00 166.01 ? 254  DA  J "C3'" 1 
ATOM   5183  O "O3'" . DA  B 1 110 ? -72.076  -56.584 78.592 1.00 163.72 ? 254  DA  J "O3'" 1 
ATOM   5184  C "C2'" . DA  B 1 110 ? -71.396  -56.113 80.878 1.00 166.69 ? 254  DA  J "C2'" 1 
ATOM   5185  C "C1'" . DA  B 1 110 ? -72.344  -54.959 81.128 1.00 168.13 ? 254  DA  J "C1'" 1 
ATOM   5186  N N9    . DA  B 1 110 ? -72.156  -54.297 82.417 1.00 142.85 ? 254  DA  J N9    1 
ATOM   5187  C C8    . DA  B 1 110 ? -71.741  -54.850 83.603 1.00 143.14 ? 254  DA  J C8    1 
ATOM   5188  N N7    . DA  B 1 110 ? -71.678  -53.993 84.593 1.00 143.09 ? 254  DA  J N7    1 
ATOM   5189  C C5    . DA  B 1 110 ? -72.079  -52.795 84.021 1.00 143.46 ? 254  DA  J C5    1 
ATOM   5190  C C6    . DA  B 1 110 ? -72.227  -51.503 84.545 1.00 143.59 ? 254  DA  J C6    1 
ATOM   5191  N N6    . DA  B 1 110 ? -71.986  -51.190 85.817 1.00 144.16 ? 254  DA  J N6    1 
ATOM   5192  N N1    . DA  B 1 110 ? -72.638  -50.527 83.705 1.00 143.33 ? 254  DA  J N1    1 
ATOM   5193  C C2    . DA  B 1 110 ? -72.884  -50.842 82.428 1.00 143.26 ? 254  DA  J C2    1 
ATOM   5194  N N3    . DA  B 1 110 ? -72.784  -52.020 81.818 1.00 143.34 ? 254  DA  J N3    1 
ATOM   5195  C C4    . DA  B 1 110 ? -72.372  -52.966 82.681 1.00 143.36 ? 254  DA  J C4    1 
ATOM   5196  P P     . DA  B 1 111 ? -70.620  -56.479 77.931 1.00 117.55 ? 255  DA  J P     1 
ATOM   5197  O OP1   . DA  B 1 111 ? -70.699  -57.008 76.544 1.00 119.91 ? 255  DA  J OP1   1 
ATOM   5198  O OP2   . DA  B 1 111 ? -69.626  -57.046 78.874 1.00 119.86 ? 255  DA  J OP2   1 
ATOM   5199  O "O5'" . DA  B 1 111 ? -70.382  -54.910 77.858 1.00 115.62 ? 255  DA  J "O5'" 1 
ATOM   5200  C "C5'" . DA  B 1 111 ? -71.411  -54.047 77.390 1.00 112.15 ? 255  DA  J "C5'" 1 
ATOM   5201  C "C4'" . DA  B 1 111 ? -70.961  -52.610 77.485 1.00 109.69 ? 255  DA  J "C4'" 1 
ATOM   5202  O "O4'" . DA  B 1 111 ? -70.989  -52.171 78.866 1.00 109.64 ? 255  DA  J "O4'" 1 
ATOM   5203  C "C3'" . DA  B 1 111 ? -69.535  -52.371 76.983 1.00 107.77 ? 255  DA  J "C3'" 1 
ATOM   5204  O "O3'" . DA  B 1 111 ? -69.489  -51.153 76.236 1.00 104.61 ? 255  DA  J "O3'" 1 
ATOM   5205  C "C2'" . DA  B 1 111 ? -68.728  -52.253 78.263 1.00 108.74 ? 255  DA  J "C2'" 1 
ATOM   5206  C "C1'" . DA  B 1 111 ? -69.729  -51.619 79.213 1.00 109.45 ? 255  DA  J "C1'" 1 
ATOM   5207  N N9    . DA  B 1 111 ? -69.480  -51.893 80.630 1.00 111.80 ? 255  DA  J N9    1 
ATOM   5208  C C8    . DA  B 1 111 ? -69.085  -53.074 81.210 1.00 112.06 ? 255  DA  J C8    1 
ATOM   5209  N N7    . DA  B 1 111 ? -68.914  -52.994 82.507 1.00 112.55 ? 255  DA  J N7    1 
ATOM   5210  C C5    . DA  B 1 111 ? -69.222  -51.674 82.802 1.00 113.05 ? 255  DA  J C5    1 
ATOM   5211  C C6    . DA  B 1 111 ? -69.228  -50.952 84.006 1.00 113.76 ? 255  DA  J C6    1 
ATOM   5212  N N6    . DA  B 1 111 ? -68.883  -51.476 85.182 1.00 115.11 ? 255  DA  J N6    1 
ATOM   5213  N N1    . DA  B 1 111 ? -69.600  -49.653 83.958 1.00 113.56 ? 255  DA  J N1    1 
ATOM   5214  C C2    . DA  B 1 111 ? -69.931  -49.126 82.775 1.00 112.82 ? 255  DA  J C2    1 
ATOM   5215  N N3    . DA  B 1 111 ? -69.952  -49.698 81.574 1.00 112.76 ? 255  DA  J N3    1 
ATOM   5216  C C4    . DA  B 1 111 ? -69.584  -50.988 81.657 1.00 112.39 ? 255  DA  J C4    1 
ATOM   5217  P P     . DT  B 1 112 ? -68.108  -50.663 75.576 1.00 114.99 ? 256  DT  J P     1 
ATOM   5218  O OP1   . DT  B 1 112 ? -68.245  -50.813 74.105 1.00 110.34 ? 256  DT  J OP1   1 
ATOM   5219  O OP2   . DT  B 1 112 ? -66.959  -51.288 76.279 1.00 108.25 ? 256  DT  J OP2   1 
ATOM   5220  O "O5'" . DT  B 1 112 ? -68.118  -49.120 75.939 1.00 114.90 ? 256  DT  J "O5'" 1 
ATOM   5221  C "C5'" . DT  B 1 112 ? -68.648  -48.719 77.188 1.00 113.71 ? 256  DT  J "C5'" 1 
ATOM   5222  C "C4'" . DT  B 1 112 ? -68.441  -47.245 77.408 1.00 112.30 ? 256  DT  J "C4'" 1 
ATOM   5223  O "O4'" . DT  B 1 112 ? -68.537  -47.078 78.842 1.00 111.73 ? 256  DT  J "O4'" 1 
ATOM   5224  C "C3'" . DT  B 1 112 ? -67.045  -46.763 77.023 1.00 111.46 ? 256  DT  J "C3'" 1 
ATOM   5225  O "O3'" . DT  B 1 112 ? -67.072  -45.383 76.627 1.00 110.64 ? 256  DT  J "O3'" 1 
ATOM   5226  C "C2'" . DT  B 1 112 ? -66.233  -47.003 78.279 1.00 111.30 ? 256  DT  J "C2'" 1 
ATOM   5227  C "C1'" . DT  B 1 112 ? -67.249  -46.874 79.410 1.00 112.82 ? 256  DT  J "C1'" 1 
ATOM   5228  N N1    . DT  B 1 112 ? -67.053  -47.877 80.486 1.00 109.28 ? 256  DT  J N1    1 
ATOM   5229  C C2    . DT  B 1 112 ? -67.283  -47.499 81.793 1.00 110.06 ? 256  DT  J C2    1 
ATOM   5230  O O2    . DT  B 1 112 ? -67.674  -46.387 82.116 1.00 110.85 ? 256  DT  J O2    1 
ATOM   5231  N N3    . DT  B 1 112 ? -67.038  -48.479 82.719 1.00 109.69 ? 256  DT  J N3    1 
ATOM   5232  C C4    . DT  B 1 112 ? -66.601  -49.767 82.481 1.00 109.45 ? 256  DT  J C4    1 
ATOM   5233  O O4    . DT  B 1 112 ? -66.420  -50.538 83.423 1.00 109.51 ? 256  DT  J O4    1 
ATOM   5234  C C5    . DT  B 1 112 ? -66.393  -50.099 81.094 1.00 109.19 ? 256  DT  J C5    1 
ATOM   5235  C C7    . DT  B 1 112 ? -65.918  -51.475 80.746 1.00 108.06 ? 256  DT  J C7    1 
ATOM   5236  C C6    . DT  B 1 112 ? -66.631  -49.153 80.178 1.00 109.55 ? 256  DT  J C6    1 
ATOM   5237  P P     . DA  B 1 113 ? -65.700  -44.544 76.537 1.00 78.16  ? 257  DA  J P     1 
ATOM   5238  O OP1   . DA  B 1 113 ? -65.886  -43.456 75.542 1.00 114.93 ? 257  DA  J OP1   1 
ATOM   5239  O OP2   . DA  B 1 113 ? -64.561  -45.483 76.390 1.00 115.13 ? 257  DA  J OP2   1 
ATOM   5240  O "O5'" . DA  B 1 113 ? -65.605  -43.871 77.973 1.00 81.64  ? 257  DA  J "O5'" 1 
ATOM   5241  C "C5'" . DA  B 1 113 ? -66.772  -43.338 78.603 1.00 85.08  ? 257  DA  J "C5'" 1 
ATOM   5242  C "C4'" . DA  B 1 113 ? -66.413  -42.733 79.940 1.00 87.29  ? 257  DA  J "C4'" 1 
ATOM   5243  O "O4'" . DA  B 1 113 ? -66.261  -43.762 80.949 1.00 86.75  ? 257  DA  J "O4'" 1 
ATOM   5244  C "C3'" . DA  B 1 113 ? -65.105  -41.947 79.929 1.00 90.40  ? 257  DA  J "C3'" 1 
ATOM   5245  O "O3'" . DA  B 1 113 ? -65.230  -40.772 80.722 1.00 96.32  ? 257  DA  J "O3'" 1 
ATOM   5246  C "C2'" . DA  B 1 113 ? -64.105  -42.907 80.546 1.00 88.13  ? 257  DA  J "C2'" 1 
ATOM   5247  C "C1'" . DA  B 1 113 ? -64.955  -43.716 81.514 1.00 86.78  ? 257  DA  J "C1'" 1 
ATOM   5248  N N9    . DA  B 1 113 ? -64.502  -45.099 81.697 1.00 122.85 ? 257  DA  J N9    1 
ATOM   5249  C C8    . DA  B 1 113 ? -64.352  -46.071 80.735 1.00 122.45 ? 257  DA  J C8    1 
ATOM   5250  N N7    . DA  B 1 113 ? -63.961  -47.229 81.207 1.00 122.98 ? 257  DA  J N7    1 
ATOM   5251  C C5    . DA  B 1 113 ? -63.837  -47.007 82.571 1.00 123.06 ? 257  DA  J C5    1 
ATOM   5252  C C6    . DA  B 1 113 ? -63.454  -47.845 83.637 1.00 123.69 ? 257  DA  J C6    1 
ATOM   5253  N N6    . DA  B 1 113 ? -63.133  -49.133 83.488 1.00 122.65 ? 257  DA  J N6    1 
ATOM   5254  N N1    . DA  B 1 113 ? -63.416  -47.308 84.879 1.00 124.72 ? 257  DA  J N1    1 
ATOM   5255  C C2    . DA  B 1 113 ? -63.748  -46.016 85.028 1.00 124.41 ? 257  DA  J C2    1 
ATOM   5256  N N3    . DA  B 1 113 ? -64.130  -45.131 84.107 1.00 123.82 ? 257  DA  J N3    1 
ATOM   5257  C C4    . DA  B 1 113 ? -64.155  -45.695 82.886 1.00 123.10 ? 257  DA  J C4    1 
ATOM   5258  P P     . DC  B 1 114 ? -63.989  -39.770 80.848 1.00 131.60 ? 258  DC  J P     1 
ATOM   5259  O OP1   . DC  B 1 114 ? -64.575  -38.449 81.201 1.00 93.70  ? 258  DC  J OP1   1 
ATOM   5260  O OP2   . DC  B 1 114 ? -63.109  -39.894 79.657 1.00 92.91  ? 258  DC  J OP2   1 
ATOM   5261  O "O5'" . DC  B 1 114 ? -63.186  -40.351 82.091 1.00 136.22 ? 258  DC  J "O5'" 1 
ATOM   5262  C "C5'" . DC  B 1 114 ? -63.786  -40.407 83.381 1.00 144.65 ? 258  DC  J "C5'" 1 
ATOM   5263  C "C4'" . DC  B 1 114 ? -62.756  -40.800 84.413 1.00 149.85 ? 258  DC  J "C4'" 1 
ATOM   5264  O "O4'" . DC  B 1 114 ? -62.554  -42.234 84.407 1.00 151.03 ? 258  DC  J "O4'" 1 
ATOM   5265  C "C3'" . DC  B 1 114 ? -61.380  -40.172 84.185 1.00 152.94 ? 258  DC  J "C3'" 1 
ATOM   5266  O "O3'" . DC  B 1 114 ? -60.814  -39.760 85.429 1.00 157.58 ? 258  DC  J "O3'" 1 
ATOM   5267  C "C2'" . DC  B 1 114 ? -60.571  -41.312 83.593 1.00 152.70 ? 258  DC  J "C2'" 1 
ATOM   5268  C "C1'" . DC  B 1 114 ? -61.169  -42.511 84.302 1.00 152.23 ? 258  DC  J "C1'" 1 
ATOM   5269  N N1    . DC  B 1 114 ? -61.016  -43.796 83.603 1.00 115.59 ? 258  DC  J N1    1 
ATOM   5270  C C2    . DC  B 1 114 ? -60.559  -44.905 84.327 1.00 115.94 ? 258  DC  J C2    1 
ATOM   5271  O O2    . DC  B 1 114 ? -60.285  -44.769 85.529 1.00 116.26 ? 258  DC  J O2    1 
ATOM   5272  N N3    . DC  B 1 114 ? -60.425  -46.096 83.697 1.00 115.82 ? 258  DC  J N3    1 
ATOM   5273  C C4    . DC  B 1 114 ? -60.725  -46.203 82.400 1.00 115.53 ? 258  DC  J C4    1 
ATOM   5274  N N4    . DC  B 1 114 ? -60.584  -47.401 81.822 1.00 114.85 ? 258  DC  J N4    1 
ATOM   5275  C C5    . DC  B 1 114 ? -61.184  -45.087 81.638 1.00 115.44 ? 258  DC  J C5    1 
ATOM   5276  C C6    . DC  B 1 114 ? -61.315  -43.914 82.275 1.00 115.41 ? 258  DC  J C6    1 
ATOM   5277  P P     . DA  B 1 115 ? -59.681  -38.624 85.448 1.00 167.25 ? 259  DA  J P     1 
ATOM   5278  O OP1   . DA  B 1 115 ? -60.171  -37.519 86.314 1.00 112.93 ? 259  DA  J OP1   1 
ATOM   5279  O OP2   . DA  B 1 115 ? -59.270  -38.338 84.054 1.00 111.60 ? 259  DA  J OP2   1 
ATOM   5280  O "O5'" . DA  B 1 115 ? -58.455  -39.334 86.170 1.00 169.69 ? 259  DA  J "O5'" 1 
ATOM   5281  C "C5'" . DA  B 1 115 ? -58.479  -39.595 87.568 1.00 174.72 ? 259  DA  J "C5'" 1 
ATOM   5282  C "C4'" . DA  B 1 115 ? -57.252  -40.381 87.961 1.00 178.63 ? 259  DA  J "C4'" 1 
ATOM   5283  O "O4'" . DA  B 1 115 ? -57.384  -41.741 87.484 1.00 180.15 ? 259  DA  J "O4'" 1 
ATOM   5284  C "C3'" . DA  B 1 115 ? -55.965  -39.837 87.344 1.00 180.72 ? 259  DA  J "C3'" 1 
ATOM   5285  O "O3'" . DA  B 1 115 ? -54.878  -39.953 88.264 1.00 182.30 ? 259  DA  J "O3'" 1 
ATOM   5286  C "C2'" . DA  B 1 115 ? -55.748  -40.731 86.137 1.00 181.08 ? 259  DA  J "C2'" 1 
ATOM   5287  C "C1'" . DA  B 1 115 ? -56.313  -42.059 86.607 1.00 181.72 ? 259  DA  J "C1'" 1 
ATOM   5288  N N9    . DA  B 1 115 ? -56.850  -42.889 85.529 1.00 128.16 ? 259  DA  J N9    1 
ATOM   5289  C C8    . DA  B 1 115 ? -57.671  -42.504 84.500 1.00 128.63 ? 259  DA  J C8    1 
ATOM   5290  N N7    . DA  B 1 115 ? -57.984  -43.478 83.681 1.00 128.80 ? 259  DA  J N7    1 
ATOM   5291  C C5    . DA  B 1 115 ? -57.324  -44.579 84.206 1.00 129.03 ? 259  DA  J C5    1 
ATOM   5292  C C6    . DA  B 1 115 ? -57.248  -45.922 83.795 1.00 129.11 ? 259  DA  J C6    1 
ATOM   5293  N N6    . DA  B 1 115 ? -57.865  -46.403 82.717 1.00 129.05 ? 259  DA  J N6    1 
ATOM   5294  N N1    . DA  B 1 115 ? -56.503  -46.765 84.541 1.00 129.32 ? 259  DA  J N1    1 
ATOM   5295  C C2    . DA  B 1 115 ? -55.884  -46.283 85.623 1.00 129.38 ? 259  DA  J C2    1 
ATOM   5296  N N3    . DA  B 1 115 ? -55.877  -45.044 86.109 1.00 129.25 ? 259  DA  J N3    1 
ATOM   5297  C C4    . DA  B 1 115 ? -56.624  -44.231 85.345 1.00 128.90 ? 259  DA  J C4    1 
ATOM   5298  P P     . DC  B 1 116 ? -53.460  -39.286 87.909 1.00 180.60 ? 260  DC  J P     1 
ATOM   5299  O OP1   . DC  B 1 116 ? -53.178  -38.248 88.935 1.00 164.30 ? 260  DC  J OP1   1 
ATOM   5300  O OP2   . DC  B 1 116 ? -53.454  -38.916 86.470 1.00 164.26 ? 260  DC  J OP2   1 
ATOM   5301  O "O5'" . DC  B 1 116 ? -52.447  -40.496 88.102 1.00 180.19 ? 260  DC  J "O5'" 1 
ATOM   5302  C "C5'" . DC  B 1 116 ? -52.786  -41.786 87.615 1.00 179.52 ? 260  DC  J "C5'" 1 
ATOM   5303  C "C4'" . DC  B 1 116 ? -51.996  -42.850 88.336 1.00 179.08 ? 260  DC  J "C4'" 1 
ATOM   5304  O "O4'" . DC  B 1 116 ? -52.455  -44.129 87.851 1.00 179.37 ? 260  DC  J "O4'" 1 
ATOM   5305  C "C3'" . DC  B 1 116 ? -50.499  -42.819 88.049 1.00 178.86 ? 260  DC  J "C3'" 1 
ATOM   5306  O "O3'" . DC  B 1 116 ? -49.768  -43.345 89.164 1.00 178.51 ? 260  DC  J "O3'" 1 
ATOM   5307  C "C2'" . DC  B 1 116 ? -50.368  -43.696 86.818 1.00 178.86 ? 260  DC  J "C2'" 1 
ATOM   5308  C "C1'" . DC  B 1 116 ? -51.497  -44.709 86.976 1.00 178.85 ? 260  DC  J "C1'" 1 
ATOM   5309  N N1    . DC  B 1 116 ? -52.191  -45.019 85.715 1.00 162.40 ? 260  DC  J N1    1 
ATOM   5310  C C2    . DC  B 1 116 ? -52.404  -46.356 85.368 1.00 162.28 ? 260  DC  J C2    1 
ATOM   5311  O O2    . DC  B 1 116 ? -51.987  -47.247 86.123 1.00 162.79 ? 260  DC  J O2    1 
ATOM   5312  N N3    . DC  B 1 116 ? -53.056  -46.644 84.220 1.00 162.07 ? 260  DC  J N3    1 
ATOM   5313  C C4    . DC  B 1 116 ? -53.484  -45.657 83.431 1.00 161.95 ? 260  DC  J C4    1 
ATOM   5314  N N4    . DC  B 1 116 ? -54.124  -45.989 82.310 1.00 161.65 ? 260  DC  J N4    1 
ATOM   5315  C C5    . DC  B 1 116 ? -53.274  -44.285 83.757 1.00 161.80 ? 260  DC  J C5    1 
ATOM   5316  C C6    . DC  B 1 116 ? -52.630  -44.014 84.897 1.00 161.98 ? 260  DC  J C6    1 
ATOM   5317  P P     . DT  B 1 117 ? -48.177  -43.535 89.055 1.00 171.23 ? 261  DT  J P     1 
ATOM   5318  O OP1   . DT  B 1 117 ? -47.644  -43.632 90.437 1.00 148.40 ? 261  DT  J OP1   1 
ATOM   5319  O OP2   . DT  B 1 117 ? -47.634  -42.509 88.127 1.00 148.67 ? 261  DT  J OP2   1 
ATOM   5320  O "O5'" . DT  B 1 117 ? -48.019  -44.960 88.365 1.00 171.23 ? 261  DT  J "O5'" 1 
ATOM   5321  C "C5'" . DT  B 1 117 ? -48.427  -46.149 89.042 1.00 170.72 ? 261  DT  J "C5'" 1 
ATOM   5322  C "C4'" . DT  B 1 117 ? -48.036  -47.368 88.238 1.00 169.69 ? 261  DT  J "C4'" 1 
ATOM   5323  O "O4'" . DT  B 1 117 ? -48.913  -47.519 87.092 1.00 171.23 ? 261  DT  J "O4'" 1 
ATOM   5324  C "C3'" . DT  B 1 117 ? -46.614  -47.309 87.679 1.00 167.44 ? 261  DT  J "C3'" 1 
ATOM   5325  O "O3'" . DT  B 1 117 ? -45.986  -48.588 87.759 1.00 161.54 ? 261  DT  J "O3'" 1 
ATOM   5326  C "C2'" . DT  B 1 117 ? -46.820  -46.923 86.226 1.00 169.82 ? 261  DT  J "C2'" 1 
ATOM   5327  C "C1'" . DT  B 1 117 ? -48.140  -47.598 85.900 1.00 171.23 ? 261  DT  J "C1'" 1 
ATOM   5328  N N1    . DT  B 1 117 ? -48.904  -46.952 84.806 1.00 150.58 ? 261  DT  J N1    1 
ATOM   5329  C C2    . DT  B 1 117 ? -49.727  -47.738 84.029 1.00 151.23 ? 261  DT  J C2    1 
ATOM   5330  O O2    . DT  B 1 117 ? -49.860  -48.938 84.199 1.00 150.45 ? 261  DT  J O2    1 
ATOM   5331  N N3    . DT  B 1 117 ? -50.395  -47.062 83.039 1.00 151.92 ? 261  DT  J N3    1 
ATOM   5332  C C4    . DT  B 1 117 ? -50.322  -45.710 82.753 1.00 152.57 ? 261  DT  J C4    1 
ATOM   5333  O O4    . DT  B 1 117 ? -50.987  -45.242 81.833 1.00 152.23 ? 261  DT  J O4    1 
ATOM   5334  C C5    . DT  B 1 117 ? -49.439  -44.947 83.602 1.00 152.61 ? 261  DT  J C5    1 
ATOM   5335  C C7    . DT  B 1 117 ? -49.290  -43.477 83.363 1.00 153.16 ? 261  DT  J C7    1 
ATOM   5336  C C6    . DT  B 1 117 ? -48.785  -45.597 84.574 1.00 152.11 ? 261  DT  J C6    1 
ATOM   5337  P P     . DT  B 1 118 ? -44.571  -48.817 87.040 1.00 150.96 ? 262  DT  J P     1 
ATOM   5338  O OP1   . DT  B 1 118 ? -43.765  -49.712 87.912 1.00 122.56 ? 262  DT  J OP1   1 
ATOM   5339  O OP2   . DT  B 1 118 ? -44.022  -47.492 86.641 1.00 122.40 ? 262  DT  J OP2   1 
ATOM   5340  O "O5'" . DT  B 1 118 ? -44.957  -49.613 85.716 1.00 149.90 ? 262  DT  J "O5'" 1 
ATOM   5341  C "C5'" . DT  B 1 118 ? -45.705  -50.826 85.792 1.00 147.04 ? 262  DT  J "C5'" 1 
ATOM   5342  C "C4'" . DT  B 1 118 ? -45.553  -51.618 84.514 1.00 144.41 ? 262  DT  J "C4'" 1 
ATOM   5343  O "O4'" . DT  B 1 118 ? -46.258  -50.953 83.441 1.00 143.81 ? 262  DT  J "O4'" 1 
ATOM   5344  C "C3'" . DT  B 1 118 ? -44.112  -51.784 84.036 1.00 142.40 ? 262  DT  J "C3'" 1 
ATOM   5345  O "O3'" . DT  B 1 118 ? -43.927  -53.094 83.493 1.00 138.99 ? 262  DT  J "O3'" 1 
ATOM   5346  C "C2'" . DT  B 1 118 ? -43.970  -50.713 82.971 1.00 142.38 ? 262  DT  J "C2'" 1 
ATOM   5347  C "C1'" . DT  B 1 118 ? -45.368  -50.644 82.380 1.00 142.86 ? 262  DT  J "C1'" 1 
ATOM   5348  N N1    . DT  B 1 118 ? -45.728  -49.310 81.875 1.00 114.11 ? 262  DT  J N1    1 
ATOM   5349  C C2    . DT  B 1 118 ? -46.250  -49.198 80.604 1.00 114.29 ? 262  DT  J C2    1 
ATOM   5350  O O2    . DT  B 1 118 ? -46.431  -50.154 79.865 1.00 114.14 ? 262  DT  J O2    1 
ATOM   5351  N N3    . DT  B 1 118 ? -46.551  -47.915 80.226 1.00 114.14 ? 262  DT  J N3    1 
ATOM   5352  C C4    . DT  B 1 118 ? -46.383  -46.762 80.973 1.00 113.90 ? 262  DT  J C4    1 
ATOM   5353  O O4    . DT  B 1 118 ? -46.696  -45.673 80.499 1.00 113.58 ? 262  DT  J O4    1 
ATOM   5354  C C5    . DT  B 1 118 ? -45.833  -46.957 82.292 1.00 113.68 ? 262  DT  J C5    1 
ATOM   5355  C C7    . DT  B 1 118 ? -45.616  -45.766 83.171 1.00 113.68 ? 262  DT  J C7    1 
ATOM   5356  C C6    . DT  B 1 118 ? -45.538  -48.204 82.672 1.00 113.83 ? 262  DT  J C6    1 
ATOM   5357  P P     . DT  B 1 119 ? -42.654  -53.399 82.560 1.00 153.32 ? 263  DT  J P     1 
ATOM   5358  O OP1   . DT  B 1 119 ? -42.268  -54.820 82.767 1.00 138.90 ? 263  DT  J OP1   1 
ATOM   5359  O OP2   . DT  B 1 119 ? -41.638  -52.325 82.746 1.00 138.78 ? 263  DT  J OP2   1 
ATOM   5360  O "O5'" . DT  B 1 119 ? -43.258  -53.272 81.093 1.00 152.04 ? 263  DT  J "O5'" 1 
ATOM   5361  C "C5'" . DT  B 1 119 ? -44.457  -53.962 80.740 1.00 148.83 ? 263  DT  J "C5'" 1 
ATOM   5362  C "C4'" . DT  B 1 119 ? -44.710  -53.836 79.257 1.00 146.20 ? 263  DT  J "C4'" 1 
ATOM   5363  O "O4'" . DT  B 1 119 ? -45.100  -52.477 78.945 1.00 145.71 ? 263  DT  J "O4'" 1 
ATOM   5364  C "C3'" . DT  B 1 119 ? -43.482  -54.134 78.400 1.00 144.36 ? 263  DT  J "C3'" 1 
ATOM   5365  O "O3'" . DT  B 1 119 ? -43.860  -54.865 77.235 1.00 140.72 ? 263  DT  J "O3'" 1 
ATOM   5366  C "C2'" . DT  B 1 119 ? -42.954  -52.759 78.039 1.00 144.95 ? 263  DT  J "C2'" 1 
ATOM   5367  C "C1'" . DT  B 1 119 ? -44.214  -51.912 77.990 1.00 145.78 ? 263  DT  J "C1'" 1 
ATOM   5368  N N1    . DT  B 1 119 ? -43.986  -50.504 78.366 1.00 132.26 ? 263  DT  J N1    1 
ATOM   5369  C C2    . DT  B 1 119 ? -44.565  -49.503 77.612 1.00 132.61 ? 263  DT  J C2    1 
ATOM   5370  O O2    . DT  B 1 119 ? -45.261  -49.717 76.631 1.00 131.64 ? 263  DT  J O2    1 
ATOM   5371  N N3    . DT  B 1 119 ? -44.296  -48.230 78.054 1.00 133.14 ? 263  DT  J N3    1 
ATOM   5372  C C4    . DT  B 1 119 ? -43.522  -47.867 79.145 1.00 133.67 ? 263  DT  J C4    1 
ATOM   5373  O O4    . DT  B 1 119 ? -43.376  -46.681 79.427 1.00 133.11 ? 263  DT  J O4    1 
ATOM   5374  C C5    . DT  B 1 119 ? -42.941  -48.967 79.880 1.00 133.62 ? 263  DT  J C5    1 
ATOM   5375  C C7    . DT  B 1 119 ? -42.079  -48.677 81.068 1.00 133.85 ? 263  DT  J C7    1 
ATOM   5376  C C6    . DT  B 1 119 ? -43.200  -50.211 79.460 1.00 133.19 ? 263  DT  J C6    1 
ATOM   5377  P P     . DT  B 1 120 ? -42.789  -55.105 76.063 1.00 130.42 ? 264  DT  J P     1 
ATOM   5378  O OP1   . DT  B 1 120 ? -43.004  -56.476 75.540 1.00 126.08 ? 264  DT  J OP1   1 
ATOM   5379  O OP2   . DT  B 1 120 ? -41.437  -54.699 76.530 1.00 125.68 ? 264  DT  J OP2   1 
ATOM   5380  O "O5'" . DT  B 1 120 ? -43.265  -54.082 74.943 1.00 129.39 ? 264  DT  J "O5'" 1 
ATOM   5381  C "C5'" . DT  B 1 120 ? -44.646  -53.966 74.616 1.00 126.05 ? 264  DT  J "C5'" 1 
ATOM   5382  C "C4'" . DT  B 1 120 ? -44.823  -53.003 73.469 1.00 123.41 ? 264  DT  J "C4'" 1 
ATOM   5383  O "O4'" . DT  B 1 120 ? -44.559  -51.652 73.923 1.00 124.10 ? 264  DT  J "O4'" 1 
ATOM   5384  C "C3'" . DT  B 1 120 ? -43.854  -53.266 72.318 1.00 121.50 ? 264  DT  J "C3'" 1 
ATOM   5385  O "O3'" . DT  B 1 120 ? -44.512  -53.066 71.070 1.00 117.21 ? 264  DT  J "O3'" 1 
ATOM   5386  C "C2'" . DT  B 1 120 ? -42.776  -52.216 72.520 1.00 123.03 ? 264  DT  J "C2'" 1 
ATOM   5387  C "C1'" . DT  B 1 120 ? -43.568  -51.058 73.101 1.00 124.85 ? 264  DT  J "C1'" 1 
ATOM   5388  N N1    . DT  B 1 120 ? -42.784  -50.111 73.925 1.00 122.18 ? 264  DT  J N1    1 
ATOM   5389  C C2    . DT  B 1 120 ? -43.213  -48.803 73.997 1.00 123.28 ? 264  DT  J C2    1 
ATOM   5390  O O2    . DT  B 1 120 ? -44.215  -48.395 73.433 1.00 123.68 ? 264  DT  J O2    1 
ATOM   5391  N N3    . DT  B 1 120 ? -42.420  -47.983 74.759 1.00 123.97 ? 264  DT  J N3    1 
ATOM   5392  C C4    . DT  B 1 120 ? -41.270  -48.330 75.440 1.00 124.25 ? 264  DT  J C4    1 
ATOM   5393  O O4    . DT  B 1 120 ? -40.658  -47.482 76.077 1.00 124.42 ? 264  DT  J O4    1 
ATOM   5394  C C5    . DT  B 1 120 ? -40.882  -49.714 75.330 1.00 123.98 ? 264  DT  J C5    1 
ATOM   5395  C C7    . DT  B 1 120 ? -39.647  -50.177 76.037 1.00 123.57 ? 264  DT  J C7    1 
ATOM   5396  C C6    . DT  B 1 120 ? -41.648  -50.527 74.591 1.00 123.53 ? 264  DT  J C6    1 
ATOM   5397  P P     . DG  B 1 121 ? -44.504  -54.233 69.970 1.00 121.85 ? 265  DG  J P     1 
ATOM   5398  O OP1   . DG  B 1 121 ? -45.035  -55.460 70.606 1.00 132.59 ? 265  DG  J OP1   1 
ATOM   5399  O OP2   . DG  B 1 121 ? -43.175  -54.257 69.314 1.00 132.41 ? 265  DG  J OP2   1 
ATOM   5400  O "O5'" . DG  B 1 121 ? -45.584  -53.729 68.927 1.00 119.19 ? 265  DG  J "O5'" 1 
ATOM   5401  C "C5'" . DG  B 1 121 ? -46.771  -53.103 69.393 1.00 114.73 ? 265  DG  J "C5'" 1 
ATOM   5402  C "C4'" . DG  B 1 121 ? -46.849  -51.676 68.896 1.00 111.42 ? 265  DG  J "C4'" 1 
ATOM   5403  O "O4'" . DG  B 1 121 ? -45.833  -50.834 69.499 1.00 110.12 ? 265  DG  J "O4'" 1 
ATOM   5404  C "C3'" . DG  B 1 121 ? -46.704  -51.494 67.388 1.00 108.70 ? 265  DG  J "C3'" 1 
ATOM   5405  O "O3'" . DG  B 1 121 ? -47.677  -50.545 66.962 1.00 104.13 ? 265  DG  J "O3'" 1 
ATOM   5406  C "C2'" . DG  B 1 121 ? -45.295  -50.951 67.228 1.00 108.49 ? 265  DG  J "C2'" 1 
ATOM   5407  C "C1'" . DG  B 1 121 ? -45.111  -50.138 68.490 1.00 110.25 ? 265  DG  J "C1'" 1 
ATOM   5408  N N9    . DG  B 1 121 ? -43.730  -50.036 68.941 1.00 122.60 ? 265  DG  J N9    1 
ATOM   5409  C C8    . DG  B 1 121 ? -42.817  -51.059 69.049 1.00 123.96 ? 265  DG  J C8    1 
ATOM   5410  N N7    . DG  B 1 121 ? -41.676  -50.676 69.554 1.00 123.76 ? 265  DG  J N7    1 
ATOM   5411  C C5    . DG  B 1 121 ? -41.842  -49.314 69.780 1.00 124.68 ? 265  DG  J C5    1 
ATOM   5412  C C6    . DG  B 1 121 ? -40.952  -48.355 70.339 1.00 125.21 ? 265  DG  J C6    1 
ATOM   5413  O O6    . DG  B 1 121 ? -39.808  -48.526 70.782 1.00 125.64 ? 265  DG  J O6    1 
ATOM   5414  N N1    . DG  B 1 121 ? -41.521  -47.088 70.368 1.00 125.14 ? 265  DG  J N1    1 
ATOM   5415  C C2    . DG  B 1 121 ? -42.782  -46.782 69.931 1.00 123.90 ? 265  DG  J C2    1 
ATOM   5416  N N2    . DG  B 1 121 ? -43.135  -45.500 70.029 1.00 121.72 ? 265  DG  J N2    1 
ATOM   5417  N N3    . DG  B 1 121 ? -43.630  -47.666 69.431 1.00 123.81 ? 265  DG  J N3    1 
ATOM   5418  C C4    . DG  B 1 121 ? -43.097  -48.902 69.384 1.00 123.91 ? 265  DG  J C4    1 
ATOM   5419  P P     . DG  B 1 122 ? -47.628  -49.966 65.473 1.00 94.70  ? 266  DG  J P     1 
ATOM   5420  O OP1   . DG  B 1 122 ? -48.998  -49.456 65.196 1.00 97.66  ? 266  DG  J OP1   1 
ATOM   5421  O OP2   . DG  B 1 122 ? -47.010  -50.961 64.556 1.00 100.07 ? 266  DG  J OP2   1 
ATOM   5422  O "O5'" . DG  B 1 122 ? -46.641  -48.729 65.611 1.00 92.96  ? 266  DG  J "O5'" 1 
ATOM   5423  C "C5'" . DG  B 1 122 ? -46.227  -48.028 64.465 1.00 90.19  ? 266  DG  J "C5'" 1 
ATOM   5424  C "C4'" . DG  B 1 122 ? -46.143  -46.554 64.757 1.00 86.88  ? 266  DG  J "C4'" 1 
ATOM   5425  O "O4'" . DG  B 1 122 ? -45.135  -46.329 65.765 1.00 87.52  ? 266  DG  J "O4'" 1 
ATOM   5426  C "C3'" . DG  B 1 122 ? -45.670  -45.812 63.520 1.00 85.35  ? 266  DG  J "C3'" 1 
ATOM   5427  O "O3'" . DG  B 1 122 ? -46.291  -44.550 63.389 1.00 81.11  ? 266  DG  J "O3'" 1 
ATOM   5428  C "C2'" . DG  B 1 122 ? -44.172  -45.689 63.701 1.00 87.39  ? 266  DG  J "C2'" 1 
ATOM   5429  C "C1'" . DG  B 1 122 ? -43.973  -45.718 65.206 1.00 90.80  ? 266  DG  J "C1'" 1 
ATOM   5430  N N9    . DG  B 1 122 ? -42.825  -46.542 65.573 1.00 99.24  ? 266  DG  J N9    1 
ATOM   5431  C C8    . DG  B 1 122 ? -42.569  -47.825 65.145 1.00 100.70 ? 266  DG  J C8    1 
ATOM   5432  N N7    . DG  B 1 122 ? -41.471  -48.322 65.640 1.00 100.60 ? 266  DG  J N7    1 
ATOM   5433  C C5    . DG  B 1 122 ? -40.970  -47.308 66.441 1.00 101.72 ? 266  DG  J C5    1 
ATOM   5434  C C6    . DG  B 1 122 ? -39.808  -47.270 67.229 1.00 102.28 ? 266  DG  J C6    1 
ATOM   5435  O O6    . DG  B 1 122 ? -38.963  -48.154 67.382 1.00 102.22 ? 266  DG  J O6    1 
ATOM   5436  N N1    . DG  B 1 122 ? -39.672  -46.047 67.882 1.00 103.42 ? 266  DG  J N1    1 
ATOM   5437  C C2    . DG  B 1 122 ? -40.553  -44.997 67.783 1.00 103.49 ? 266  DG  J C2    1 
ATOM   5438  N N2    . DG  B 1 122 ? -40.257  -43.904 68.485 1.00 104.05 ? 266  DG  J N2    1 
ATOM   5439  N N3    . DG  B 1 122 ? -41.647  -45.022 67.046 1.00 102.89 ? 266  DG  J N3    1 
ATOM   5440  C C4    . DG  B 1 122 ? -41.793  -46.200 66.406 1.00 101.50 ? 266  DG  J C4    1 
ATOM   5441  P P     . DT  B 1 123 ? -45.950  -43.667 62.112 1.00 77.38  ? 267  DT  J P     1 
ATOM   5442  O OP1   . DT  B 1 123 ? -47.116  -42.778 61.876 1.00 91.14  ? 267  DT  J OP1   1 
ATOM   5443  O OP2   . DT  B 1 123 ? -45.461  -44.569 61.036 1.00 91.32  ? 267  DT  J OP2   1 
ATOM   5444  O "O5'" . DT  B 1 123 ? -44.701  -42.818 62.586 1.00 80.24  ? 267  DT  J "O5'" 1 
ATOM   5445  C "C5'" . DT  B 1 123 ? -44.767  -42.053 63.779 1.00 84.88  ? 267  DT  J "C5'" 1 
ATOM   5446  C "C4'" . DT  B 1 123 ? -43.475  -41.301 63.962 1.00 88.15  ? 267  DT  J "C4'" 1 
ATOM   5447  O "O4'" . DT  B 1 123 ? -42.457  -42.190 64.483 1.00 90.66  ? 267  DT  J "O4'" 1 
ATOM   5448  C "C3'" . DT  B 1 123 ? -42.935  -40.749 62.647 1.00 90.08  ? 267  DT  J "C3'" 1 
ATOM   5449  O "O3'" . DT  B 1 123 ? -42.482  -39.419 62.840 1.00 91.49  ? 267  DT  J "O3'" 1 
ATOM   5450  C "C2'" . DT  B 1 123 ? -41.782  -41.682 62.306 1.00 91.44  ? 267  DT  J "C2'" 1 
ATOM   5451  C "C1'" . DT  B 1 123 ? -41.294  -42.126 63.677 1.00 93.06  ? 267  DT  J "C1'" 1 
ATOM   5452  N N1    . DT  B 1 123 ? -40.644  -43.452 63.733 1.00 108.05 ? 267  DT  J N1    1 
ATOM   5453  C C2    . DT  B 1 123 ? -39.585  -43.634 64.600 1.00 110.31 ? 267  DT  J C2    1 
ATOM   5454  O O2    . DT  B 1 123 ? -39.120  -42.741 65.292 1.00 112.07 ? 267  DT  J O2    1 
ATOM   5455  N N3    . DT  B 1 123 ? -39.084  -44.910 64.624 1.00 111.75 ? 267  DT  J N3    1 
ATOM   5456  C C4    . DT  B 1 123 ? -39.518  -45.994 63.880 1.00 112.41 ? 267  DT  J C4    1 
ATOM   5457  O O4    . DT  B 1 123 ? -38.986  -47.094 64.028 1.00 114.53 ? 267  DT  J O4    1 
ATOM   5458  C C5    . DT  B 1 123 ? -40.605  -45.722 62.971 1.00 111.64 ? 267  DT  J C5    1 
ATOM   5459  C C7    . DT  B 1 123 ? -41.121  -46.827 62.100 1.00 111.09 ? 267  DT  J C7    1 
ATOM   5460  C C6    . DT  B 1 123 ? -41.107  -44.482 62.946 1.00 110.25 ? 267  DT  J C6    1 
ATOM   5461  P P     . DA  B 1 124 ? -42.190  -38.500 61.570 1.00 85.92  ? 268  DA  J P     1 
ATOM   5462  O OP1   . DA  B 1 124 ? -43.093  -37.326 61.660 1.00 89.24  ? 268  DA  J OP1   1 
ATOM   5463  O OP2   . DA  B 1 124 ? -42.231  -39.374 60.376 1.00 89.32  ? 268  DA  J OP2   1 
ATOM   5464  O "O5'" . DA  B 1 124 ? -40.684  -38.043 61.802 1.00 91.63  ? 268  DA  J "O5'" 1 
ATOM   5465  C "C5'" . DA  B 1 124 ? -40.261  -37.530 63.068 1.00 98.36  ? 268  DA  J "C5'" 1 
ATOM   5466  C "C4'" . DA  B 1 124 ? -38.754  -37.560 63.163 1.00 102.18 ? 268  DA  J "C4'" 1 
ATOM   5467  O "O4'" . DA  B 1 124 ? -38.319  -38.919 63.398 1.00 103.70 ? 268  DA  J "O4'" 1 
ATOM   5468  C "C3'" . DA  B 1 124 ? -38.040  -37.094 61.893 1.00 105.01 ? 268  DA  J "C3'" 1 
ATOM   5469  O "O3'" . DA  B 1 124 ? -36.901  -36.284 62.194 1.00 107.99 ? 268  DA  J "O3'" 1 
ATOM   5470  C "C2'" . DA  B 1 124 ? -37.608  -38.386 61.227 1.00 105.11 ? 268  DA  J "C2'" 1 
ATOM   5471  C "C1'" . DA  B 1 124 ? -37.404  -39.329 62.398 1.00 105.31 ? 268  DA  J "C1'" 1 
ATOM   5472  N N9    . DA  B 1 124 ? -37.713  -40.715 62.059 1.00 110.89 ? 268  DA  J N9    1 
ATOM   5473  C C8    . DA  B 1 124 ? -38.700  -41.157 61.212 1.00 111.88 ? 268  DA  J C8    1 
ATOM   5474  N N7    . DA  B 1 124 ? -38.736  -42.459 61.075 1.00 111.74 ? 268  DA  J N7    1 
ATOM   5475  C C5    . DA  B 1 124 ? -37.706  -42.908 61.889 1.00 111.02 ? 268  DA  J C5    1 
ATOM   5476  C C6    . DA  B 1 124 ? -37.220  -44.194 62.171 1.00 110.47 ? 268  DA  J C6    1 
ATOM   5477  N N6    . DA  B 1 124 ? -37.714  -45.306 61.622 1.00 110.32 ? 268  DA  J N6    1 
ATOM   5478  N N1    . DA  B 1 124 ? -36.189  -44.298 63.038 1.00 110.32 ? 268  DA  J N1    1 
ATOM   5479  C C2    . DA  B 1 124 ? -35.678  -43.175 63.567 1.00 111.25 ? 268  DA  J C2    1 
ATOM   5480  N N3    . DA  B 1 124 ? -36.039  -41.909 63.367 1.00 111.05 ? 268  DA  J N3    1 
ATOM   5481  C C4    . DA  B 1 124 ? -37.072  -41.843 62.509 1.00 111.16 ? 268  DA  J C4    1 
ATOM   5482  P P     . DG  B 1 125 ? -35.952  -35.777 61.000 1.00 148.57 ? 269  DG  J P     1 
ATOM   5483  O OP1   . DG  B 1 125 ? -35.452  -34.437 61.389 1.00 139.42 ? 269  DG  J OP1   1 
ATOM   5484  O OP2   . DG  B 1 125 ? -36.661  -35.946 59.707 1.00 137.69 ? 269  DG  J OP2   1 
ATOM   5485  O "O5'" . DG  B 1 125 ? -34.740  -36.807 61.042 1.00 151.01 ? 269  DG  J "O5'" 1 
ATOM   5486  C "C5'" . DG  B 1 125 ? -34.044  -37.047 62.260 1.00 156.22 ? 269  DG  J "C5'" 1 
ATOM   5487  C "C4'" . DG  B 1 125 ? -32.896  -38.000 62.030 1.00 160.19 ? 269  DG  J "C4'" 1 
ATOM   5488  O "O4'" . DG  B 1 125 ? -33.398  -39.342 61.816 1.00 161.73 ? 269  DG  J "O4'" 1 
ATOM   5489  C "C3'" . DG  B 1 125 ? -32.030  -37.669 60.812 1.00 162.49 ? 269  DG  J "C3'" 1 
ATOM   5490  O "O3'" . DG  B 1 125 ? -30.649  -37.894 61.113 1.00 164.45 ? 269  DG  J "O3'" 1 
ATOM   5491  C "C2'" . DG  B 1 125 ? -32.506  -38.660 59.767 1.00 162.79 ? 269  DG  J "C2'" 1 
ATOM   5492  C "C1'" . DG  B 1 125 ? -32.846  -39.866 60.619 1.00 163.37 ? 269  DG  J "C1'" 1 
ATOM   5493  N N9    . DG  B 1 125 ? -33.824  -40.771 60.026 1.00 154.80 ? 269  DG  J N9    1 
ATOM   5494  C C8    . DG  B 1 125 ? -34.760  -40.476 59.063 1.00 154.81 ? 269  DG  J C8    1 
ATOM   5495  N N7    . DG  B 1 125 ? -35.488  -41.505 58.724 1.00 155.14 ? 269  DG  J N7    1 
ATOM   5496  C C5    . DG  B 1 125 ? -35.005  -42.541 59.512 1.00 155.35 ? 269  DG  J C5    1 
ATOM   5497  C C6    . DG  B 1 125 ? -35.403  -43.904 59.589 1.00 155.22 ? 269  DG  J C6    1 
ATOM   5498  O O6    . DG  B 1 125 ? -36.296  -44.488 58.955 1.00 154.46 ? 269  DG  J O6    1 
ATOM   5499  N N1    . DG  B 1 125 ? -34.644  -44.605 60.523 1.00 155.35 ? 269  DG  J N1    1 
ATOM   5500  C C2    . DG  B 1 125 ? -33.636  -44.067 61.286 1.00 155.71 ? 269  DG  J C2    1 
ATOM   5501  N N2    . DG  B 1 125 ? -33.028  -44.905 62.139 1.00 155.77 ? 269  DG  J N2    1 
ATOM   5502  N N3    . DG  B 1 125 ? -33.255  -42.803 61.222 1.00 155.86 ? 269  DG  J N3    1 
ATOM   5503  C C4    . DG  B 1 125 ? -33.978  -42.103 60.321 1.00 155.32 ? 269  DG  J C4    1 
ATOM   5504  P P     . DA  B 1 126 ? -29.544  -37.741 59.955 1.00 178.21 ? 270  DA  J P     1 
ATOM   5505  O OP1   . DA  B 1 126 ? -28.395  -37.011 60.544 1.00 144.59 ? 270  DA  J OP1   1 
ATOM   5506  O OP2   . DA  B 1 126 ? -30.189  -37.224 58.721 1.00 144.93 ? 270  DA  J OP2   1 
ATOM   5507  O "O5'" . DA  B 1 126 ? -29.090  -39.240 59.683 1.00 177.22 ? 270  DA  J "O5'" 1 
ATOM   5508  C "C5'" . DA  B 1 126 ? -28.541  -40.031 60.731 1.00 175.57 ? 270  DA  J "C5'" 1 
ATOM   5509  C "C4'" . DA  B 1 126 ? -28.113  -41.373 60.190 1.00 175.32 ? 270  DA  J "C4'" 1 
ATOM   5510  O "O4'" . DA  B 1 126 ? -29.292  -42.119 59.800 1.00 174.53 ? 270  DA  J "O4'" 1 
ATOM   5511  C "C3'" . DA  B 1 126 ? -27.238  -41.280 58.938 1.00 176.13 ? 270  DA  J "C3'" 1 
ATOM   5512  O "O3'" . DA  B 1 126 ? -26.256  -42.322 58.938 1.00 178.45 ? 270  DA  J "O3'" 1 
ATOM   5513  C "C2'" . DA  B 1 126 ? -28.228  -41.501 57.810 1.00 175.39 ? 270  DA  J "C2'" 1 
ATOM   5514  C "C1'" . DA  B 1 126 ? -29.186  -42.493 58.438 1.00 173.83 ? 270  DA  J "C1'" 1 
ATOM   5515  N N9    . DA  B 1 126 ? -30.526  -42.487 57.864 1.00 138.89 ? 270  DA  J N9    1 
ATOM   5516  C C8    . DA  B 1 126 ? -31.267  -41.421 57.420 1.00 138.67 ? 270  DA  J C8    1 
ATOM   5517  N N7    . DA  B 1 126 ? -32.440  -41.756 56.943 1.00 138.67 ? 270  DA  J N7    1 
ATOM   5518  C C5    . DA  B 1 126 ? -32.474  -43.137 57.086 1.00 138.88 ? 270  DA  J C5    1 
ATOM   5519  C C6    . DA  B 1 126 ? -33.449  -44.102 56.766 1.00 139.07 ? 270  DA  J C6    1 
ATOM   5520  N N6    . DA  B 1 126 ? -34.630  -43.809 56.207 1.00 138.57 ? 270  DA  J N6    1 
ATOM   5521  N N1    . DA  B 1 126 ? -33.165  -45.397 57.044 1.00 138.44 ? 270  DA  J N1    1 
ATOM   5522  C C2    . DA  B 1 126 ? -31.982  -45.688 57.601 1.00 138.21 ? 270  DA  J C2    1 
ATOM   5523  N N3    . DA  B 1 126 ? -30.989  -44.872 57.943 1.00 138.06 ? 270  DA  J N3    1 
ATOM   5524  C C4    . DA  B 1 126 ? -31.303  -43.597 57.656 1.00 138.47 ? 270  DA  J C4    1 
ATOM   5525  P P     . DA  B 1 127 ? -24.961  -42.202 57.992 1.00 184.08 ? 271  DA  J P     1 
ATOM   5526  O OP1   . DA  B 1 127 ? -23.823  -41.767 58.839 1.00 156.99 ? 271  DA  J OP1   1 
ATOM   5527  O OP2   . DA  B 1 127 ? -25.325  -41.411 56.791 1.00 156.78 ? 271  DA  J OP2   1 
ATOM   5528  O "O5'" . DA  B 1 127 ? -24.694  -43.704 57.535 1.00 185.23 ? 271  DA  J "O5'" 1 
ATOM   5529  C "C5'" . DA  B 1 127 ? -24.765  -44.772 58.477 1.00 187.50 ? 271  DA  J "C5'" 1 
ATOM   5530  C "C4'" . DA  B 1 127 ? -25.332  -46.011 57.822 1.00 188.94 ? 271  DA  J "C4'" 1 
ATOM   5531  O "O4'" . DA  B 1 127 ? -26.719  -45.783 57.466 1.00 189.81 ? 271  DA  J "O4'" 1 
ATOM   5532  C "C3'" . DA  B 1 127 ? -24.626  -46.425 56.530 1.00 189.61 ? 271  DA  J "C3'" 1 
ATOM   5533  O "O3'" . DA  B 1 127 ? -24.532  -47.850 56.449 1.00 189.73 ? 271  DA  J "O3'" 1 
ATOM   5534  C "C2'" . DA  B 1 127 ? -25.549  -45.905 55.445 1.00 190.22 ? 271  DA  J "C2'" 1 
ATOM   5535  C "C1'" . DA  B 1 127 ? -26.910  -46.075 56.090 1.00 191.40 ? 271  DA  J "C1'" 1 
ATOM   5536  N N9    . DA  B 1 127 ? -27.934  -45.173 55.564 1.00 165.28 ? 271  DA  J N9    1 
ATOM   5537  C C8    . DA  B 1 127 ? -27.870  -43.809 55.415 1.00 165.55 ? 271  DA  J C8    1 
ATOM   5538  N N7    . DA  B 1 127 ? -28.943  -43.286 54.872 1.00 165.45 ? 271  DA  J N7    1 
ATOM   5539  C C5    . DA  B 1 127 ? -29.772  -44.378 54.656 1.00 165.53 ? 271  DA  J C5    1 
ATOM   5540  C C6    . DA  B 1 127 ? -31.057  -44.495 54.098 1.00 165.19 ? 271  DA  J C6    1 
ATOM   5541  N N6    . DA  B 1 127 ? -31.759  -43.461 53.630 1.00 165.57 ? 271  DA  J N6    1 
ATOM   5542  N N1    . DA  B 1 127 ? -31.602  -45.729 54.032 1.00 164.88 ? 271  DA  J N1    1 
ATOM   5543  C C2    . DA  B 1 127 ? -30.896  -46.767 54.497 1.00 164.99 ? 271  DA  J C2    1 
ATOM   5544  N N3    . DA  B 1 127 ? -29.682  -46.785 55.039 1.00 165.49 ? 271  DA  J N3    1 
ATOM   5545  C C4    . DA  B 1 127 ? -29.168  -45.544 55.088 1.00 165.76 ? 271  DA  J C4    1 
ATOM   5546  P P     . DT  B 1 128 ? -23.954  -48.534 55.116 1.00 180.00 ? 272  DT  J P     1 
ATOM   5547  O OP1   . DT  B 1 128 ? -23.364  -49.837 55.512 1.00 149.89 ? 272  DT  J OP1   1 
ATOM   5548  O OP2   . DT  B 1 128 ? -23.115  -47.532 54.404 1.00 149.99 ? 272  DT  J OP2   1 
ATOM   5549  O "O5'" . DT  B 1 128 ? -25.256  -48.822 54.241 1.00 180.00 ? 272  DT  J "O5'" 1 
ATOM   5550  C "C5'" . DT  B 1 128 ? -26.271  -49.712 54.711 1.00 179.84 ? 272  DT  J "C5'" 1 
ATOM   5551  C "C4'" . DT  B 1 128 ? -27.245  -50.039 53.601 1.00 178.30 ? 272  DT  J "C4'" 1 
ATOM   5552  O "O4'" . DT  B 1 128 ? -28.073  -48.890 53.294 1.00 178.77 ? 272  DT  J "O4'" 1 
ATOM   5553  C "C3'" . DT  B 1 128 ? -26.603  -50.462 52.279 1.00 176.77 ? 272  DT  J "C3'" 1 
ATOM   5554  O "O3'" . DT  B 1 128 ? -27.381  -51.500 51.678 1.00 174.19 ? 272  DT  J "O3'" 1 
ATOM   5555  C "C2'" . DT  B 1 128 ? -26.695  -49.206 51.432 1.00 177.80 ? 272  DT  J "C2'" 1 
ATOM   5556  C "C1'" . DT  B 1 128 ? -28.014  -48.618 51.899 1.00 179.06 ? 272  DT  J "C1'" 1 
ATOM   5557  N N1    . DT  B 1 128 ? -28.164  -47.158 51.707 1.00 146.24 ? 272  DT  J N1    1 
ATOM   5558  C C2    . DT  B 1 128 ? -29.420  -46.666 51.419 1.00 146.30 ? 272  DT  J C2    1 
ATOM   5559  O O2    . DT  B 1 128 ? -30.403  -47.377 51.283 1.00 146.08 ? 272  DT  J O2    1 
ATOM   5560  N N3    . DT  B 1 128 ? -29.482  -45.300 51.291 1.00 146.53 ? 272  DT  J N3    1 
ATOM   5561  C C4    . DT  B 1 128 ? -28.438  -44.400 51.410 1.00 146.85 ? 272  DT  J C4    1 
ATOM   5562  O O4    . DT  B 1 128 ? -28.647  -43.198 51.284 1.00 147.36 ? 272  DT  J O4    1 
ATOM   5563  C C5    . DT  B 1 128 ? -27.150  -44.984 51.687 1.00 146.39 ? 272  DT  J C5    1 
ATOM   5564  C C7    . DT  B 1 128 ? -25.961  -44.085 51.808 1.00 146.14 ? 272  DT  J C7    1 
ATOM   5565  C C6    . DT  B 1 128 ? -27.077  -46.316 51.822 1.00 146.14 ? 272  DT  J C6    1 
ATOM   5566  P P     . DC  B 1 129 ? -26.707  -52.486 50.603 1.00 178.14 ? 273  DC  J P     1 
ATOM   5567  O OP1   . DC  B 1 129 ? -26.284  -53.705 51.337 1.00 159.44 ? 273  DC  J OP1   1 
ATOM   5568  O OP2   . DC  B 1 129 ? -25.714  -51.729 49.796 1.00 160.10 ? 273  DC  J OP2   1 
ATOM   5569  O "O5'" . DC  B 1 129 ? -27.921  -52.875 49.648 1.00 176.52 ? 273  DC  J "O5'" 1 
ATOM   5570  C "C5'" . DC  B 1 129 ? -29.156  -53.352 50.187 1.00 171.87 ? 273  DC  J "C5'" 1 
ATOM   5571  C "C4'" . DC  B 1 129 ? -30.276  -53.147 49.193 1.00 167.48 ? 273  DC  J "C4'" 1 
ATOM   5572  O "O4'" . DC  B 1 129 ? -30.577  -51.736 49.077 1.00 166.64 ? 273  DC  J "O4'" 1 
ATOM   5573  C "C3'" . DC  B 1 129 ? -29.949  -53.625 47.780 1.00 165.09 ? 273  DC  J "C3'" 1 
ATOM   5574  O "O3'" . DC  B 1 129 ? -31.103  -54.203 47.170 1.00 162.01 ? 273  DC  J "O3'" 1 
ATOM   5575  C "C2'" . DC  B 1 129 ? -29.534  -52.354 47.063 1.00 164.97 ? 273  DC  J "C2'" 1 
ATOM   5576  C "C1'" . DC  B 1 129 ? -30.387  -51.297 47.739 1.00 165.18 ? 273  DC  J "C1'" 1 
ATOM   5577  N N1    . DC  B 1 129 ? -29.760  -49.966 47.786 1.00 145.79 ? 273  DC  J N1    1 
ATOM   5578  C C2    . DC  B 1 129 ? -30.506  -48.858 47.367 1.00 146.24 ? 273  DC  J C2    1 
ATOM   5579  O O2    . DC  B 1 129 ? -31.671  -49.033 46.972 1.00 147.04 ? 273  DC  J O2    1 
ATOM   5580  N N3    . DC  B 1 129 ? -29.940  -47.628 47.404 1.00 146.53 ? 273  DC  J N3    1 
ATOM   5581  C C4    . DC  B 1 129 ? -28.687  -47.482 47.841 1.00 146.04 ? 273  DC  J C4    1 
ATOM   5582  N N4    . DC  B 1 129 ? -28.173  -46.248 47.864 1.00 146.10 ? 273  DC  J N4    1 
ATOM   5583  C C5    . DC  B 1 129 ? -27.905  -48.595 48.274 1.00 146.39 ? 273  DC  J C5    1 
ATOM   5584  C C6    . DC  B 1 129 ? -28.476  -49.806 48.232 1.00 145.97 ? 273  DC  J C6    1 
ATOM   5585  P P     . DT  B 1 130 ? -31.064  -54.599 45.614 1.00 131.59 ? 274  DT  J P     1 
ATOM   5586  O OP1   . DT  B 1 130 ? -31.914  -55.807 45.450 1.00 130.11 ? 274  DT  J OP1   1 
ATOM   5587  O OP2   . DT  B 1 130 ? -29.658  -54.621 45.133 1.00 131.08 ? 274  DT  J OP2   1 
ATOM   5588  O "O5'" . DT  B 1 130 ? -31.783  -53.367 44.903 1.00 130.26 ? 274  DT  J "O5'" 1 
ATOM   5589  C "C5'" . DT  B 1 130 ? -33.183  -53.135 45.073 1.00 124.68 ? 274  DT  J "C5'" 1 
ATOM   5590  C "C4'" . DT  B 1 130 ? -33.716  -52.320 43.919 1.00 120.31 ? 274  DT  J "C4'" 1 
ATOM   5591  O "O4'" . DT  B 1 130 ? -33.185  -50.980 43.991 1.00 119.00 ? 274  DT  J "O4'" 1 
ATOM   5592  C "C3'" . DT  B 1 130 ? -33.321  -52.855 42.544 1.00 117.36 ? 274  DT  J "C3'" 1 
ATOM   5593  O "O3'" . DT  B 1 130 ? -34.366  -52.583 41.623 1.00 115.22 ? 274  DT  J "O3'" 1 
ATOM   5594  C "C2'" . DT  B 1 130 ? -32.120  -52.005 42.182 1.00 116.59 ? 274  DT  J "C2'" 1 
ATOM   5595  C "C1'" . DT  B 1 130 ? -32.503  -50.673 42.791 1.00 118.04 ? 274  DT  J "C1'" 1 
ATOM   5596  N N1    . DT  B 1 130 ? -31.375  -49.813 43.141 1.00 118.96 ? 274  DT  J N1    1 
ATOM   5597  C C2    . DT  B 1 130 ? -31.384  -48.525 42.671 1.00 119.53 ? 274  DT  J C2    1 
ATOM   5598  O O2    . DT  B 1 130 ? -32.257  -48.094 41.935 1.00 119.83 ? 274  DT  J O2    1 
ATOM   5599  N N3    . DT  B 1 130 ? -30.326  -47.756 43.090 1.00 119.04 ? 274  DT  J N3    1 
ATOM   5600  C C4    . DT  B 1 130 ? -29.278  -48.152 43.899 1.00 118.76 ? 274  DT  J C4    1 
ATOM   5601  O O4    . DT  B 1 130 ? -28.411  -47.341 44.216 1.00 118.87 ? 274  DT  J O4    1 
ATOM   5602  C C5    . DT  B 1 130 ? -29.313  -49.537 44.318 1.00 118.61 ? 274  DT  J C5    1 
ATOM   5603  C C7    . DT  B 1 130 ? -28.195  -50.074 45.153 1.00 118.06 ? 274  DT  J C7    1 
ATOM   5604  C C6    . DT  B 1 130 ? -30.351  -50.285 43.929 1.00 118.65 ? 274  DT  J C6    1 
ATOM   5605  P P     . DG  B 1 131 ? -35.597  -53.599 41.496 1.00 97.66  ? 275  DG  J P     1 
ATOM   5606  O OP1   . DG  B 1 131 ? -35.918  -54.081 42.866 1.00 128.91 ? 275  DG  J OP1   1 
ATOM   5607  O OP2   . DG  B 1 131 ? -35.276  -54.579 40.426 1.00 129.21 ? 275  DG  J OP2   1 
ATOM   5608  O "O5'" . DG  B 1 131 ? -36.786  -52.662 40.991 1.00 96.72  ? 275  DG  J "O5'" 1 
ATOM   5609  C "C5'" . DG  B 1 131 ? -37.501  -51.812 41.903 1.00 93.79  ? 275  DG  J "C5'" 1 
ATOM   5610  C "C4'" . DG  B 1 131 ? -37.886  -50.507 41.236 1.00 92.11  ? 275  DG  J "C4'" 1 
ATOM   5611  O "O4'" . DG  B 1 131 ? -36.715  -49.671 41.080 1.00 91.47  ? 275  DG  J "O4'" 1 
ATOM   5612  C "C3'" . DG  B 1 131 ? -38.497  -50.654 39.841 1.00 91.23  ? 275  DG  J "C3'" 1 
ATOM   5613  O "O3'" . DG  B 1 131 ? -39.576  -49.736 39.633 1.00 89.05  ? 275  DG  J "O3'" 1 
ATOM   5614  C "C2'" . DG  B 1 131 ? -37.336  -50.360 38.908 1.00 91.20  ? 275  DG  J "C2'" 1 
ATOM   5615  C "C1'" . DG  B 1 131 ? -36.464  -49.403 39.708 1.00 92.17  ? 275  DG  J "C1'" 1 
ATOM   5616  N N9    . DG  B 1 131 ? -35.040  -49.613 39.474 1.00 124.47 ? 275  DG  J N9    1 
ATOM   5617  C C8    . DG  B 1 131 ? -34.396  -50.822 39.356 1.00 124.97 ? 275  DG  J C8    1 
ATOM   5618  N N7    . DG  B 1 131 ? -33.114  -50.702 39.147 1.00 125.76 ? 275  DG  J N7    1 
ATOM   5619  C C5    . DG  B 1 131 ? -32.896  -49.331 39.125 1.00 126.08 ? 275  DG  J C5    1 
ATOM   5620  C C6    . DG  B 1 131 ? -31.703  -48.597 38.932 1.00 126.81 ? 275  DG  J C6    1 
ATOM   5621  O O6    . DG  B 1 131 ? -30.562  -49.020 38.741 1.00 126.81 ? 275  DG  J O6    1 
ATOM   5622  N N1    . DG  B 1 131 ? -31.932  -47.230 38.977 1.00 127.33 ? 275  DG  J N1    1 
ATOM   5623  C C2    . DG  B 1 131 ? -33.151  -46.641 39.182 1.00 128.00 ? 275  DG  J C2    1 
ATOM   5624  N N2    . DG  B 1 131 ? -33.163  -45.303 39.185 1.00 128.54 ? 275  DG  J N2    1 
ATOM   5625  N N3    . DG  B 1 131 ? -34.274  -47.313 39.367 1.00 127.72 ? 275  DG  J N3    1 
ATOM   5626  C C4    . DG  B 1 131 ? -34.075  -48.646 39.325 1.00 126.03 ? 275  DG  J C4    1 
ATOM   5627  P P     . DC  B 1 132 ? -40.369  -49.752 38.234 1.00 80.95  ? 276  DC  J P     1 
ATOM   5628  O OP1   . DC  B 1 132 ? -41.787  -49.416 38.522 1.00 123.75 ? 276  DC  J OP1   1 
ATOM   5629  O OP2   . DC  B 1 132 ? -40.046  -51.007 37.507 1.00 122.51 ? 276  DC  J OP2   1 
ATOM   5630  O "O5'" . DC  B 1 132 ? -39.703  -48.546 37.429 1.00 83.42  ? 276  DC  J "O5'" 1 
ATOM   5631  C "C5'" . DC  B 1 132 ? -39.461  -47.285 38.073 1.00 87.14  ? 276  DC  J "C5'" 1 
ATOM   5632  C "C4'" . DC  B 1 132 ? -38.634  -46.378 37.188 1.00 89.79  ? 276  DC  J "C4'" 1 
ATOM   5633  O "O4'" . DC  B 1 132 ? -37.233  -46.733 37.216 1.00 92.01  ? 276  DC  J "O4'" 1 
ATOM   5634  C "C3'" . DC  B 1 132 ? -39.036  -46.369 35.717 1.00 91.86  ? 276  DC  J "C3'" 1 
ATOM   5635  O "O3'" . DC  B 1 132 ? -38.874  -45.047 35.211 1.00 95.55  ? 276  DC  J "O3'" 1 
ATOM   5636  C "C2'" . DC  B 1 132 ? -37.998  -47.270 35.079 1.00 90.99  ? 276  DC  J "C2'" 1 
ATOM   5637  C "C1'" . DC  B 1 132 ? -36.769  -46.907 35.889 1.00 92.45  ? 276  DC  J "C1'" 1 
ATOM   5638  N N1    . DC  B 1 132 ? -35.712  -47.928 35.907 1.00 137.03 ? 276  DC  J N1    1 
ATOM   5639  C C2    . DC  B 1 132 ? -34.383  -47.511 36.023 1.00 137.89 ? 276  DC  J C2    1 
ATOM   5640  O O2    . DC  B 1 132 ? -34.142  -46.299 36.119 1.00 137.80 ? 276  DC  J O2    1 
ATOM   5641  N N3    . DC  B 1 132 ? -33.396  -48.437 36.032 1.00 138.10 ? 276  DC  J N3    1 
ATOM   5642  C C4    . DC  B 1 132 ? -33.699  -49.734 35.933 1.00 137.95 ? 276  DC  J C4    1 
ATOM   5643  N N4    . DC  B 1 132 ? -32.693  -50.618 35.942 1.00 136.88 ? 276  DC  J N4    1 
ATOM   5644  C C5    . DC  B 1 132 ? -35.048  -50.186 35.821 1.00 138.07 ? 276  DC  J C5    1 
ATOM   5645  C C6    . DC  B 1 132 ? -36.013  -49.257 35.810 1.00 137.30 ? 276  DC  J C6    1 
ATOM   5646  P P     . DA  B 1 133 ? -40.156  -44.225 34.714 1.00 112.67 ? 277  DA  J P     1 
ATOM   5647  O OP1   . DA  B 1 133 ? -41.120  -44.184 35.845 1.00 113.56 ? 277  DA  J OP1   1 
ATOM   5648  O OP2   . DA  B 1 133 ? -40.588  -44.747 33.390 1.00 113.84 ? 277  DA  J OP2   1 
ATOM   5649  O "O5'" . DA  B 1 133 ? -39.595  -42.756 34.515 1.00 114.69 ? 277  DA  J "O5'" 1 
ATOM   5650  C "C5'" . DA  B 1 133 ? -38.975  -42.061 35.589 1.00 118.09 ? 277  DA  J "C5'" 1 
ATOM   5651  C "C4'" . DA  B 1 133 ? -37.839  -41.228 35.052 1.00 119.73 ? 277  DA  J "C4'" 1 
ATOM   5652  O "O4'" . DA  B 1 133 ? -36.720  -42.089 34.736 1.00 119.63 ? 277  DA  J "O4'" 1 
ATOM   5653  C "C3'" . DA  B 1 133 ? -38.200  -40.520 33.751 1.00 121.52 ? 277  DA  J "C3'" 1 
ATOM   5654  O "O3'" . DA  B 1 133 ? -37.572  -39.242 33.699 1.00 124.62 ? 277  DA  J "O3'" 1 
ATOM   5655  C "C2'" . DA  B 1 133 ? -37.669  -41.455 32.678 1.00 120.84 ? 277  DA  J "C2'" 1 
ATOM   5656  C "C1'" . DA  B 1 133 ? -36.451  -42.080 33.341 1.00 120.42 ? 277  DA  J "C1'" 1 
ATOM   5657  N N9    . DA  B 1 133 ? -36.185  -43.463 32.948 1.00 122.87 ? 277  DA  J N9    1 
ATOM   5658  C C8    . DA  B 1 133 ? -37.056  -44.370 32.398 1.00 123.51 ? 277  DA  J C8    1 
ATOM   5659  N N7    . DA  B 1 133 ? -36.534  -45.558 32.214 1.00 123.29 ? 277  DA  J N7    1 
ATOM   5660  C C5    . DA  B 1 133 ? -35.228  -45.421 32.662 1.00 122.24 ? 277  DA  J C5    1 
ATOM   5661  C C6    . DA  B 1 133 ? -34.156  -46.329 32.746 1.00 121.97 ? 277  DA  J C6    1 
ATOM   5662  N N6    . DA  B 1 133 ? -34.240  -47.610 32.376 1.00 121.66 ? 277  DA  J N6    1 
ATOM   5663  N N1    . DA  B 1 133 ? -32.981  -45.870 33.234 1.00 122.03 ? 277  DA  J N1    1 
ATOM   5664  C C2    . DA  B 1 133 ? -32.902  -44.588 33.613 1.00 122.52 ? 277  DA  J C2    1 
ATOM   5665  N N3    . DA  B 1 133 ? -33.841  -43.642 33.588 1.00 122.20 ? 277  DA  J N3    1 
ATOM   5666  C C4    . DA  B 1 133 ? -34.994  -44.130 33.098 1.00 122.45 ? 277  DA  J C4    1 
ATOM   5667  P P     . DG  B 1 134 ? -37.653  -38.381 32.352 1.00 139.59 ? 278  DG  J P     1 
ATOM   5668  O OP1   . DG  B 1 134 ? -37.582  -36.952 32.748 1.00 142.29 ? 278  DG  J OP1   1 
ATOM   5669  O OP2   . DG  B 1 134 ? -38.799  -38.868 31.539 1.00 141.64 ? 278  DG  J OP2   1 
ATOM   5670  O "O5'" . DG  B 1 134 ? -36.302  -38.762 31.607 1.00 140.35 ? 278  DG  J "O5'" 1 
ATOM   5671  C "C5'" . DG  B 1 134 ? -35.049  -38.353 32.139 1.00 141.24 ? 278  DG  J "C5'" 1 
ATOM   5672  C "C4'" . DG  B 1 134 ? -33.961  -38.576 31.119 1.00 142.38 ? 278  DG  J "C4'" 1 
ATOM   5673  O "O4'" . DG  B 1 134 ? -33.641  -39.987 31.055 1.00 142.13 ? 278  DG  J "O4'" 1 
ATOM   5674  C "C3'" . DG  B 1 134 ? -34.366  -38.160 29.705 1.00 143.25 ? 278  DG  J "C3'" 1 
ATOM   5675  O "O3'" . DG  B 1 134 ? -33.273  -37.528 29.034 1.00 145.96 ? 278  DG  J "O3'" 1 
ATOM   5676  C "C2'" . DG  B 1 134 ? -34.733  -39.476 29.046 1.00 142.34 ? 278  DG  J "C2'" 1 
ATOM   5677  C "C1'" . DG  B 1 134 ? -33.795  -40.457 29.728 1.00 141.44 ? 278  DG  J "C1'" 1 
ATOM   5678  N N9    . DG  B 1 134 ? -34.300  -41.826 29.787 1.00 143.22 ? 278  DG  J N9    1 
ATOM   5679  C C8    . DG  B 1 134 ? -35.602  -42.225 29.980 1.00 143.10 ? 278  DG  J C8    1 
ATOM   5680  N N7    . DG  B 1 134 ? -35.751  -43.520 29.942 1.00 142.50 ? 278  DG  J N7    1 
ATOM   5681  C C5    . DG  B 1 134 ? -34.470  -44.005 29.722 1.00 142.38 ? 278  DG  J C5    1 
ATOM   5682  C C6    . DG  B 1 134 ? -34.008  -45.333 29.580 1.00 142.26 ? 278  DG  J C6    1 
ATOM   5683  O O6    . DG  B 1 134 ? -34.659  -46.384 29.616 1.00 142.22 ? 278  DG  J O6    1 
ATOM   5684  N N1    . DG  B 1 134 ? -32.635  -45.376 29.372 1.00 141.51 ? 278  DG  J N1    1 
ATOM   5685  C C2    . DG  B 1 134 ? -31.812  -44.281 29.303 1.00 140.27 ? 278  DG  J C2    1 
ATOM   5686  N N2    . DG  B 1 134 ? -30.511  -44.532 29.089 1.00 138.94 ? 278  DG  J N2    1 
ATOM   5687  N N3    . DG  B 1 134 ? -32.233  -43.034 29.432 1.00 140.51 ? 278  DG  J N3    1 
ATOM   5688  C C4    . DG  B 1 134 ? -33.563  -42.972 29.635 1.00 142.03 ? 278  DG  J C4    1 
ATOM   5689  P P     . DG  B 1 135 ? -33.429  -37.082 27.498 1.00 143.29 ? 279  DG  J P     1 
ATOM   5690  O OP1   . DG  B 1 135 ? -32.920  -35.691 27.402 1.00 141.07 ? 279  DG  J OP1   1 
ATOM   5691  O OP2   . DG  B 1 135 ? -34.805  -37.391 27.037 1.00 140.99 ? 279  DG  J OP2   1 
ATOM   5692  O "O5'" . DG  B 1 135 ? -32.418  -38.053 26.744 1.00 145.12 ? 279  DG  J "O5'" 1 
ATOM   5693  C "C5'" . DG  B 1 135 ? -31.121  -38.289 27.286 1.00 148.22 ? 279  DG  J "C5'" 1 
ATOM   5694  C "C4'" . DG  B 1 135 ? -30.396  -39.358 26.501 1.00 150.92 ? 279  DG  J "C4'" 1 
ATOM   5695  O "O4'" . DG  B 1 135 ? -30.886  -40.681 26.831 1.00 150.92 ? 279  DG  J "O4'" 1 
ATOM   5696  C "C3'" . DG  B 1 135 ? -30.478  -39.234 24.979 1.00 153.62 ? 279  DG  J "C3'" 1 
ATOM   5697  O "O3'" . DG  B 1 135 ? -29.176  -39.443 24.419 1.00 158.52 ? 279  DG  J "O3'" 1 
ATOM   5698  C "C2'" . DG  B 1 135 ? -31.434  -40.348 24.582 1.00 152.27 ? 279  DG  J "C2'" 1 
ATOM   5699  C "C1'" . DG  B 1 135 ? -31.160  -41.404 25.639 1.00 150.68 ? 279  DG  J "C1'" 1 
ATOM   5700  N N9    . DG  B 1 135 ? -32.279  -42.306 25.905 1.00 147.57 ? 279  DG  J N9    1 
ATOM   5701  C C8    . DG  B 1 135 ? -33.569  -41.952 26.223 1.00 147.64 ? 279  DG  J C8    1 
ATOM   5702  N N7    . DG  B 1 135 ? -34.355  -42.980 26.404 1.00 147.41 ? 279  DG  J N7    1 
ATOM   5703  C C5    . DG  B 1 135 ? -33.537  -44.082 26.193 1.00 147.02 ? 279  DG  J C5    1 
ATOM   5704  C C6    . DG  B 1 135 ? -33.834  -45.474 26.248 1.00 146.78 ? 279  DG  J C6    1 
ATOM   5705  O O6    . DG  B 1 135 ? -34.915  -46.026 26.499 1.00 146.48 ? 279  DG  J O6    1 
ATOM   5706  N N1    . DG  B 1 135 ? -32.711  -46.244 25.972 1.00 146.19 ? 279  DG  J N1    1 
ATOM   5707  C C2    . DG  B 1 135 ? -31.465  -45.748 25.681 1.00 146.51 ? 279  DG  J C2    1 
ATOM   5708  N N2    . DG  B 1 135 ? -30.511  -46.661 25.451 1.00 146.82 ? 279  DG  J N2    1 
ATOM   5709  N N3    . DG  B 1 135 ? -31.174  -44.456 25.621 1.00 146.89 ? 279  DG  J N3    1 
ATOM   5710  C C4    . DG  B 1 135 ? -32.250  -43.685 25.886 1.00 147.11 ? 279  DG  J C4    1 
ATOM   5711  P P     . DT  B 1 136 ? -29.007  -39.644 22.837 1.00 183.39 ? 280  DT  J P     1 
ATOM   5712  O OP1   . DT  B 1 136 ? -27.645  -39.173 22.472 1.00 148.42 ? 280  DT  J OP1   1 
ATOM   5713  O OP2   . DT  B 1 136 ? -30.193  -39.078 22.140 1.00 148.37 ? 280  DT  J OP2   1 
ATOM   5714  O "O5'" . DT  B 1 136 ? -29.035  -41.226 22.682 1.00 185.04 ? 280  DT  J "O5'" 1 
ATOM   5715  C "C5'" . DT  B 1 136 ? -27.836  -41.982 22.781 1.00 186.74 ? 280  DT  J "C5'" 1 
ATOM   5716  C "C4'" . DT  B 1 136 ? -27.789  -42.989 21.660 1.00 188.14 ? 280  DT  J "C4'" 1 
ATOM   5717  O "O4'" . DT  B 1 136 ? -28.708  -44.068 21.962 1.00 189.46 ? 280  DT  J "O4'" 1 
ATOM   5718  C "C3'" . DT  B 1 136 ? -28.251  -42.395 20.329 1.00 189.13 ? 280  DT  J "C3'" 1 
ATOM   5719  O "O3'" . DT  B 1 136 ? -27.449  -42.879 19.246 1.00 189.28 ? 280  DT  J "O3'" 1 
ATOM   5720  C "C2'" . DT  B 1 136 ? -29.695  -42.853 20.218 1.00 189.51 ? 280  DT  J "C2'" 1 
ATOM   5721  C "C1'" . DT  B 1 136 ? -29.665  -44.197 20.920 1.00 189.72 ? 280  DT  J "C1'" 1 
ATOM   5722  N N1    . DT  B 1 136 ? -30.952  -44.610 21.521 1.00 156.32 ? 280  DT  J N1    1 
ATOM   5723  C C2    . DT  B 1 136 ? -31.217  -45.961 21.635 1.00 156.84 ? 280  DT  J C2    1 
ATOM   5724  O O2    . DT  B 1 136 ? -30.441  -46.830 21.266 1.00 158.71 ? 280  DT  J O2    1 
ATOM   5725  N N3    . DT  B 1 136 ? -32.434  -46.259 22.200 1.00 156.45 ? 280  DT  J N3    1 
ATOM   5726  C C4    . DT  B 1 136 ? -33.390  -45.367 22.644 1.00 156.17 ? 280  DT  J C4    1 
ATOM   5727  O O4    . DT  B 1 136 ? -34.439  -45.785 23.129 1.00 155.78 ? 280  DT  J O4    1 
ATOM   5728  C C5    . DT  B 1 136 ? -33.049  -43.970 22.490 1.00 155.96 ? 280  DT  J C5    1 
ATOM   5729  C C7    . DT  B 1 136 ? -34.027  -42.931 22.936 1.00 155.84 ? 280  DT  J C7    1 
ATOM   5730  C C6    . DT  B 1 136 ? -31.863  -43.666 21.948 1.00 155.84 ? 280  DT  J C6    1 
ATOM   5731  P P     . DG  B 1 137 ? -28.096  -43.041 17.784 1.00 197.66 ? 281  DG  J P     1 
ATOM   5732  O OP1   . DG  B 1 137 ? -26.985  -43.252 16.822 1.00 172.60 ? 281  DG  J OP1   1 
ATOM   5733  O OP2   . DG  B 1 137 ? -29.074  -41.951 17.545 1.00 172.41 ? 281  DG  J OP2   1 
ATOM   5734  O "O5'" . DG  B 1 137 ? -28.893  -44.408 17.918 1.00 197.66 ? 281  DG  J "O5'" 1 
ATOM   5735  C "C5'" . DG  B 1 137 ? -28.244  -45.563 18.440 1.00 197.66 ? 281  DG  J "C5'" 1 
ATOM   5736  C "C4'" . DG  B 1 137 ? -28.892  -46.803 17.881 1.00 197.66 ? 281  DG  J "C4'" 1 
ATOM   5737  O "O4'" . DG  B 1 137 ? -30.111  -47.105 18.600 1.00 197.66 ? 281  DG  J "O4'" 1 
ATOM   5738  C "C3'" . DG  B 1 137 ? -29.292  -46.627 16.418 1.00 197.66 ? 281  DG  J "C3'" 1 
ATOM   5739  O "O3'" . DG  B 1 137 ? -29.060  -47.836 15.706 1.00 197.66 ? 281  DG  J "O3'" 1 
ATOM   5740  C "C2'" . DG  B 1 137 ? -30.779  -46.335 16.499 1.00 197.66 ? 281  DG  J "C2'" 1 
ATOM   5741  C "C1'" . DG  B 1 137 ? -31.184  -47.198 17.677 1.00 197.66 ? 281  DG  J "C1'" 1 
ATOM   5742  N N9    . DG  B 1 137 ? -32.412  -46.802 18.360 1.00 170.21 ? 281  DG  J N9    1 
ATOM   5743  C C8    . DG  B 1 137 ? -32.854  -45.527 18.629 1.00 170.47 ? 281  DG  J C8    1 
ATOM   5744  N N7    . DG  B 1 137 ? -34.002  -45.503 19.250 1.00 169.90 ? 281  DG  J N7    1 
ATOM   5745  C C5    . DG  B 1 137 ? -34.338  -46.843 19.403 1.00 169.14 ? 281  DG  J C5    1 
ATOM   5746  C C6    . DG  B 1 137 ? -35.475  -47.447 20.001 1.00 168.23 ? 281  DG  J C6    1 
ATOM   5747  O O6    . DG  B 1 137 ? -36.444  -46.901 20.541 1.00 167.67 ? 281  DG  J O6    1 
ATOM   5748  N N1    . DG  B 1 137 ? -35.415  -48.835 19.927 1.00 167.49 ? 281  DG  J N1    1 
ATOM   5749  C C2    . DG  B 1 137 ? -34.394  -49.553 19.356 1.00 167.88 ? 281  DG  J C2    1 
ATOM   5750  N N2    . DG  B 1 137 ? -34.521  -50.889 19.378 1.00 166.74 ? 281  DG  J N2    1 
ATOM   5751  N N3    . DG  B 1 137 ? -33.328  -49.004 18.801 1.00 168.58 ? 281  DG  J N3    1 
ATOM   5752  C C4    . DG  B 1 137 ? -33.366  -47.655 18.858 1.00 169.45 ? 281  DG  J C4    1 
ATOM   5753  P P     . DG  B 1 138 ? -29.215  -47.855 14.114 1.00 189.03 ? 282  DG  J P     1 
ATOM   5754  O OP1   . DG  B 1 138 ? -27.940  -48.373 13.559 1.00 160.34 ? 282  DG  J OP1   1 
ATOM   5755  O OP2   . DG  B 1 138 ? -29.717  -46.522 13.687 1.00 160.45 ? 282  DG  J OP2   1 
ATOM   5756  O "O5'" . DG  B 1 138 ? -30.355  -48.941 13.876 1.00 187.65 ? 282  DG  J "O5'" 1 
ATOM   5757  C "C5'" . DG  B 1 138 ? -30.309  -50.204 14.542 1.00 185.90 ? 282  DG  J "C5'" 1 
ATOM   5758  C "C4'" . DG  B 1 138 ? -31.662  -50.872 14.481 1.00 184.85 ? 282  DG  J "C4'" 1 
ATOM   5759  O "O4'" . DG  B 1 138 ? -32.600  -50.176 15.339 1.00 184.28 ? 282  DG  J "O4'" 1 
ATOM   5760  C "C3'" . DG  B 1 138 ? -32.282  -50.867 13.086 1.00 184.68 ? 282  DG  J "C3'" 1 
ATOM   5761  O "O3'" . DG  B 1 138 ? -32.998  -52.082 12.863 1.00 186.50 ? 282  DG  J "O3'" 1 
ATOM   5762  C "C2'" . DG  B 1 138 ? -33.242  -49.693 13.140 1.00 183.71 ? 282  DG  J "C2'" 1 
ATOM   5763  C "C1'" . DG  B 1 138 ? -33.723  -49.749 14.578 1.00 183.11 ? 282  DG  J "C1'" 1 
ATOM   5764  N N9    . DG  B 1 138 ? -34.184  -48.473 15.123 1.00 152.17 ? 282  DG  J N9    1 
ATOM   5765  C C8    . DG  B 1 138 ? -33.569  -47.248 15.006 1.00 151.50 ? 282  DG  J C8    1 
ATOM   5766  N N7    . DG  B 1 138 ? -34.215  -46.289 15.614 1.00 150.68 ? 282  DG  J N7    1 
ATOM   5767  C C5    . DG  B 1 138 ? -35.326  -46.916 16.163 1.00 150.90 ? 282  DG  J C5    1 
ATOM   5768  C C6    . DG  B 1 138 ? -36.388  -46.386 16.941 1.00 150.32 ? 282  DG  J C6    1 
ATOM   5769  O O6    . DG  B 1 138 ? -36.561  -45.220 17.321 1.00 150.12 ? 282  DG  J O6    1 
ATOM   5770  N N1    . DG  B 1 138 ? -37.309  -47.373 17.285 1.00 149.11 ? 282  DG  J N1    1 
ATOM   5771  C C2    . DG  B 1 138 ? -37.217  -48.699 16.932 1.00 148.24 ? 282  DG  J C2    1 
ATOM   5772  N N2    . DG  B 1 138 ? -38.209  -49.496 17.358 1.00 146.75 ? 282  DG  J N2    1 
ATOM   5773  N N3    . DG  B 1 138 ? -36.228  -49.205 16.214 1.00 149.04 ? 282  DG  J N3    1 
ATOM   5774  C C4    . DG  B 1 138 ? -35.324  -48.264 15.865 1.00 151.01 ? 282  DG  J C4    1 
ATOM   5775  P P     . DA  B 1 139 ? -33.021  -52.733 11.394 1.00 165.58 ? 283  DA  J P     1 
ATOM   5776  O OP1   . DA  B 1 139 ? -31.913  -53.722 11.322 1.00 153.76 ? 283  DA  J OP1   1 
ATOM   5777  O OP2   . DA  B 1 139 ? -33.083  -51.631 10.399 1.00 153.10 ? 283  DA  J OP2   1 
ATOM   5778  O "O5'" . DA  B 1 139 ? -34.400  -53.531 11.362 1.00 164.05 ? 283  DA  J "O5'" 1 
ATOM   5779  C "C5'" . DA  B 1 139 ? -34.656  -54.580 12.291 1.00 163.09 ? 283  DA  J "C5'" 1 
ATOM   5780  C "C4'" . DA  B 1 139 ? -36.114  -54.584 12.689 1.00 162.34 ? 283  DA  J "C4'" 1 
ATOM   5781  O "O4'" . DA  B 1 139 ? -36.424  -53.366 13.413 1.00 162.16 ? 283  DA  J "O4'" 1 
ATOM   5782  C "C3'" . DA  B 1 139 ? -37.111  -54.651 11.531 1.00 161.44 ? 283  DA  J "C3'" 1 
ATOM   5783  O "O3'" . DA  B 1 139 ? -38.196  -55.517 11.880 1.00 160.66 ? 283  DA  J "O3'" 1 
ATOM   5784  C "C2'" . DA  B 1 139 ? -37.603  -53.220 11.405 1.00 161.88 ? 283  DA  J "C2'" 1 
ATOM   5785  C "C1'" . DA  B 1 139 ? -37.576  -52.757 12.847 1.00 162.35 ? 283  DA  J "C1'" 1 
ATOM   5786  N N9    . DA  B 1 139 ? -37.464  -51.307 13.029 1.00 151.07 ? 283  DA  J N9    1 
ATOM   5787  C C8    . DA  B 1 139 ? -36.371  -50.511 12.797 1.00 150.75 ? 283  DA  J C8    1 
ATOM   5788  N N7    . DA  B 1 139 ? -36.573  -49.242 13.061 1.00 150.47 ? 283  DA  J N7    1 
ATOM   5789  C C5    . DA  B 1 139 ? -37.891  -49.197 13.493 1.00 150.64 ? 283  DA  J C5    1 
ATOM   5790  C C6    . DA  B 1 139 ? -38.710  -48.137 13.923 1.00 150.46 ? 283  DA  J C6    1 
ATOM   5791  N N6    . DA  B 1 139 ? -38.307  -46.866 13.988 1.00 150.31 ? 283  DA  J N6    1 
ATOM   5792  N N1    . DA  B 1 139 ? -39.976  -48.432 14.289 1.00 150.20 ? 283  DA  J N1    1 
ATOM   5793  C C2    . DA  B 1 139 ? -40.382  -49.706 14.223 1.00 150.17 ? 283  DA  J C2    1 
ATOM   5794  N N3    . DA  B 1 139 ? -39.708  -50.787 13.834 1.00 150.78 ? 283  DA  J N3    1 
ATOM   5795  C C4    . DA  B 1 139 ? -38.453  -50.461 13.477 1.00 150.94 ? 283  DA  J C4    1 
ATOM   5796  P P     . DT  B 1 140 ? -39.549  -55.491 11.014 1.00 159.19 ? 284  DT  J P     1 
ATOM   5797  O OP1   . DT  B 1 140 ? -40.270  -56.763 11.276 1.00 166.53 ? 284  DT  J OP1   1 
ATOM   5798  O OP2   . DT  B 1 140 ? -39.218  -55.109 9.618  1.00 167.36 ? 284  DT  J OP2   1 
ATOM   5799  O "O5'" . DT  B 1 140 ? -40.395  -54.314 11.676 1.00 156.99 ? 284  DT  J "O5'" 1 
ATOM   5800  C "C5'" . DT  B 1 140 ? -40.817  -54.402 13.036 1.00 153.85 ? 284  DT  J "C5'" 1 
ATOM   5801  C "C4'" . DT  B 1 140 ? -42.141  -53.700 13.225 1.00 151.00 ? 284  DT  J "C4'" 1 
ATOM   5802  O "O4'" . DT  B 1 140 ? -41.968  -52.263 13.182 1.00 150.93 ? 284  DT  J "O4'" 1 
ATOM   5803  C "C3'" . DT  B 1 140 ? -43.197  -54.025 12.170 1.00 148.22 ? 284  DT  J "C3'" 1 
ATOM   5804  O "O3'" . DT  B 1 140 ? -44.481  -54.084 12.789 1.00 145.09 ? 284  DT  J "O3'" 1 
ATOM   5805  C "C2'" . DT  B 1 140 ? -43.130  -52.831 11.237 1.00 148.89 ? 284  DT  J "C2'" 1 
ATOM   5806  C "C1'" . DT  B 1 140 ? -42.849  -51.713 12.216 1.00 150.25 ? 284  DT  J "C1'" 1 
ATOM   5807  N N1    . DT  B 1 140 ? -42.198  -50.536 11.626 1.00 158.40 ? 284  DT  J N1    1 
ATOM   5808  C C2    . DT  B 1 140 ? -42.821  -49.323 11.782 1.00 158.27 ? 284  DT  J C2    1 
ATOM   5809  O O2    . DT  B 1 140 ? -43.878  -49.190 12.378 1.00 157.37 ? 284  DT  J O2    1 
ATOM   5810  N N3    . DT  B 1 140 ? -42.161  -48.264 11.210 1.00 158.71 ? 284  DT  J N3    1 
ATOM   5811  C C4    . DT  B 1 140 ? -40.967  -48.303 10.516 1.00 158.45 ? 284  DT  J C4    1 
ATOM   5812  O O4    . DT  B 1 140 ? -40.494  -47.266 10.061 1.00 158.95 ? 284  DT  J O4    1 
ATOM   5813  C C5    . DT  B 1 140 ? -40.369  -49.613 10.388 1.00 157.66 ? 284  DT  J C5    1 
ATOM   5814  C C7    . DT  B 1 140 ? -39.076  -49.752 9.649  1.00 156.53 ? 284  DT  J C7    1 
ATOM   5815  C C6    . DT  B 1 140 ? -41.006  -50.650 10.943 1.00 157.86 ? 284  DT  J C6    1 
ATOM   5816  P P     . DA  B 1 141 ? -45.802  -54.073 11.880 1.00 138.00 ? 285  DA  J P     1 
ATOM   5817  O OP1   . DA  B 1 141 ? -46.751  -55.048 12.476 1.00 136.61 ? 285  DA  J OP1   1 
ATOM   5818  O OP2   . DA  B 1 141 ? -45.410  -54.206 10.452 1.00 136.50 ? 285  DA  J OP2   1 
ATOM   5819  O "O5'" . DA  B 1 141 ? -46.390  -52.612 12.104 1.00 136.38 ? 285  DA  J "O5'" 1 
ATOM   5820  C "C5'" . DA  B 1 141 ? -46.846  -52.203 13.389 1.00 131.82 ? 285  DA  J "C5'" 1 
ATOM   5821  C "C4'" . DA  B 1 141 ? -47.759  -51.007 13.258 1.00 127.80 ? 285  DA  J "C4'" 1 
ATOM   5822  O "O4'" . DA  B 1 141 ? -46.984  -49.909 12.728 1.00 126.62 ? 285  DA  J "O4'" 1 
ATOM   5823  C "C3'" . DA  B 1 141 ? -48.941  -51.196 12.304 1.00 125.74 ? 285  DA  J "C3'" 1 
ATOM   5824  O "O3'" . DA  B 1 141 ? -50.121  -50.574 12.833 1.00 124.11 ? 285  DA  J "O3'" 1 
ATOM   5825  C "C2'" . DA  B 1 141 ? -48.473  -50.537 11.020 1.00 124.92 ? 285  DA  J "C2'" 1 
ATOM   5826  C "C1'" . DA  B 1 141 ? -47.532  -49.450 11.503 1.00 124.78 ? 285  DA  J "C1'" 1 
ATOM   5827  N N9    . DA  B 1 141 ? -46.419  -49.204 10.590 1.00 121.62 ? 285  DA  J N9    1 
ATOM   5828  C C8    . DA  B 1 141 ? -45.640  -50.133 9.948  1.00 120.99 ? 285  DA  J C8    1 
ATOM   5829  N N7    . DA  B 1 141 ? -44.716  -49.609 9.181  1.00 120.86 ? 285  DA  J N7    1 
ATOM   5830  C C5    . DA  B 1 141 ? -44.897  -48.241 9.328  1.00 120.44 ? 285  DA  J C5    1 
ATOM   5831  C C6    . DA  B 1 141 ? -44.237  -47.135 8.773  1.00 119.62 ? 285  DA  J C6    1 
ATOM   5832  N N6    . DA  B 1 141 ? -43.220  -47.233 7.919  1.00 116.72 ? 285  DA  J N6    1 
ATOM   5833  N N1    . DA  B 1 141 ? -44.663  -45.906 9.129  1.00 120.54 ? 285  DA  J N1    1 
ATOM   5834  C C2    . DA  B 1 141 ? -45.687  -45.807 9.982  1.00 121.02 ? 285  DA  J C2    1 
ATOM   5835  N N3    . DA  B 1 141 ? -46.392  -46.769 10.568 1.00 120.71 ? 285  DA  J N3    1 
ATOM   5836  C C4    . DA  B 1 141 ? -45.941  -47.978 10.196 1.00 121.45 ? 285  DA  J C4    1 
ATOM   5837  P P     . DT  B 1 142 ? -51.292  -50.091 11.840 1.00 110.82 ? 286  DT  J P     1 
ATOM   5838  O OP1   . DT  B 1 142 ? -52.558  -50.013 12.615 1.00 135.55 ? 286  DT  J OP1   1 
ATOM   5839  O OP2   . DT  B 1 142 ? -51.250  -50.887 10.589 1.00 135.06 ? 286  DT  J OP2   1 
ATOM   5840  O "O5'" . DT  B 1 142 ? -50.845  -48.607 11.492 1.00 109.21 ? 286  DT  J "O5'" 1 
ATOM   5841  C "C5'" . DT  B 1 142 ? -50.416  -47.730 12.531 1.00 104.74 ? 286  DT  J "C5'" 1 
ATOM   5842  C "C4'" . DT  B 1 142 ? -50.525  -46.296 12.076 1.00 101.32 ? 286  DT  J "C4'" 1 
ATOM   5843  O "O4'" . DT  B 1 142 ? -49.413  -45.962 11.213 1.00 100.44 ? 286  DT  J "O4'" 1 
ATOM   5844  C "C3'" . DT  B 1 142 ? -51.794  -45.998 11.280 1.00 99.13  ? 286  DT  J "C3'" 1 
ATOM   5845  O "O3'" . DT  B 1 142 ? -52.288  -44.711 11.645 1.00 98.41  ? 286  DT  J "O3'" 1 
ATOM   5846  C "C2'" . DT  B 1 142 ? -51.311  -46.014 9.843  1.00 98.60  ? 286  DT  J "C2'" 1 
ATOM   5847  C "C1'" . DT  B 1 142 ? -49.899  -45.471 9.975  1.00 99.76  ? 286  DT  J "C1'" 1 
ATOM   5848  N N1    . DT  B 1 142 ? -48.970  -45.904 8.906  1.00 124.05 ? 286  DT  J N1    1 
ATOM   5849  C C2    . DT  B 1 142 ? -48.190  -44.945 8.294  1.00 124.02 ? 286  DT  J C2    1 
ATOM   5850  O O2    . DT  B 1 142 ? -48.220  -43.765 8.597  1.00 125.23 ? 286  DT  J O2    1 
ATOM   5851  N N3    . DT  B 1 142 ? -47.366  -45.424 7.308  1.00 123.63 ? 286  DT  J N3    1 
ATOM   5852  C C4    . DT  B 1 142 ? -47.247  -46.731 6.880  1.00 123.77 ? 286  DT  J C4    1 
ATOM   5853  O O4    . DT  B 1 142 ? -46.458  -47.009 5.983  1.00 123.75 ? 286  DT  J O4    1 
ATOM   5854  C C5    . DT  B 1 142 ? -48.097  -47.681 7.559  1.00 123.67 ? 286  DT  J C5    1 
ATOM   5855  C C7    . DT  B 1 142 ? -48.052  -49.118 7.149  1.00 123.44 ? 286  DT  J C7    1 
ATOM   5856  C C6    . DT  B 1 142 ? -48.899  -47.228 8.530  1.00 123.56 ? 286  DT  J C6    1 
ATOM   5857  P P     . DT  B 1 143 ? -53.559  -44.089 10.884 1.00 92.45  ? 287  DT  J P     1 
ATOM   5858  O OP1   . DT  B 1 143 ? -54.570  -43.738 11.914 1.00 109.52 ? 287  DT  J OP1   1 
ATOM   5859  O OP2   . DT  B 1 143 ? -53.946  -44.962 9.745  1.00 108.09 ? 287  DT  J OP2   1 
ATOM   5860  O "O5'" . DT  B 1 143 ? -52.949  -42.755 10.275 1.00 90.78  ? 287  DT  J "O5'" 1 
ATOM   5861  C "C5'" . DT  B 1 143 ? -51.708  -42.816 9.593  1.00 87.81  ? 287  DT  J "C5'" 1 
ATOM   5862  C "C4'" . DT  B 1 143 ? -51.398  -41.502 8.925  1.00 86.11  ? 287  DT  J "C4'" 1 
ATOM   5863  O "O4'" . DT  B 1 143 ? -50.345  -41.768 7.972  1.00 86.42  ? 287  DT  J "O4'" 1 
ATOM   5864  C "C3'" . DT  B 1 143 ? -52.545  -40.924 8.107  1.00 85.64  ? 287  DT  J "C3'" 1 
ATOM   5865  O "O3'" . DT  B 1 143 ? -52.425  -39.496 8.100  1.00 84.23  ? 287  DT  J "O3'" 1 
ATOM   5866  C "C2'" . DT  B 1 143 ? -52.352  -41.557 6.739  1.00 85.42  ? 287  DT  J "C2'" 1 
ATOM   5867  C "C1'" . DT  B 1 143 ? -50.847  -41.777 6.640  1.00 85.81  ? 287  DT  J "C1'" 1 
ATOM   5868  N N1    . DT  B 1 143 ? -50.451  -43.070 6.039  1.00 101.83 ? 287  DT  J N1    1 
ATOM   5869  C C2    . DT  B 1 143 ? -49.314  -43.111 5.265  1.00 101.41 ? 287  DT  J C2    1 
ATOM   5870  O O2    . DT  B 1 143 ? -48.653  -42.120 5.000  1.00 102.22 ? 287  DT  J O2    1 
ATOM   5871  N N3    . DT  B 1 143 ? -48.978  -44.362 4.808  1.00 100.66 ? 287  DT  J N3    1 
ATOM   5872  C C4    . DT  B 1 143 ? -49.655  -45.544 5.035  1.00 99.27  ? 287  DT  J C4    1 
ATOM   5873  O O4    . DT  B 1 143 ? -49.220  -46.598 4.583  1.00 99.38  ? 287  DT  J O4    1 
ATOM   5874  C C5    . DT  B 1 143 ? -50.855  -45.421 5.820  1.00 99.38  ? 287  DT  J C5    1 
ATOM   5875  C C7    . DT  B 1 143 ? -51.666  -46.647 6.092  1.00 99.87  ? 287  DT  J C7    1 
ATOM   5876  C C6    . DT  B 1 143 ? -51.191  -44.207 6.275  1.00 100.58 ? 287  DT  J C6    1 
ATOM   5877  P P     . DG  B 1 144 ? -53.334  -38.619 7.115  1.00 91.03  ? 288  DG  J P     1 
ATOM   5878  O OP1   . DG  B 1 144 ? -53.309  -37.213 7.612  1.00 87.52  ? 288  DG  J OP1   1 
ATOM   5879  O OP2   . DG  B 1 144 ? -54.632  -39.311 6.913  1.00 86.83  ? 288  DG  J OP2   1 
ATOM   5880  O "O5'" . DG  B 1 144 ? -52.520  -38.642 5.751  1.00 94.11  ? 288  DG  J "O5'" 1 
ATOM   5881  C "C5'" . DG  B 1 144 ? -51.326  -37.880 5.618  1.00 95.55  ? 288  DG  J "C5'" 1 
ATOM   5882  C "C4'" . DG  B 1 144 ? -50.938  -37.761 4.164  1.00 96.41  ? 288  DG  J "C4'" 1 
ATOM   5883  O "O4'" . DG  B 1 144 ? -50.478  -39.040 3.674  1.00 95.48  ? 288  DG  J "O4'" 1 
ATOM   5884  C "C3'" . DG  B 1 144 ? -52.048  -37.315 3.209  1.00 97.68  ? 288  DG  J "C3'" 1 
ATOM   5885  O "O3'" . DG  B 1 144 ? -51.463  -36.467 2.218  1.00 100.37 ? 288  DG  J "O3'" 1 
ATOM   5886  C "C2'" . DG  B 1 144 ? -52.505  -38.620 2.587  1.00 95.97  ? 288  DG  J "C2'" 1 
ATOM   5887  C "C1'" . DG  B 1 144 ? -51.195  -39.376 2.506  1.00 95.12  ? 288  DG  J "C1'" 1 
ATOM   5888  N N9    . DG  B 1 144 ? -51.311  -40.822 2.472  1.00 91.28  ? 288  DG  J N9    1 
ATOM   5889  C C8    . DG  B 1 144 ? -52.325  -41.596 2.973  1.00 90.92  ? 288  DG  J C8    1 
ATOM   5890  N N7    . DG  B 1 144 ? -52.127  -42.873 2.796  1.00 90.50  ? 288  DG  J N7    1 
ATOM   5891  C C5    . DG  B 1 144 ? -50.908  -42.939 2.137  1.00 91.71  ? 288  DG  J C5    1 
ATOM   5892  C C6    . DG  B 1 144 ? -50.168  -44.058 1.688  1.00 92.47  ? 288  DG  J C6    1 
ATOM   5893  O O6    . DG  B 1 144 ? -50.450  -45.255 1.787  1.00 93.60  ? 288  DG  J O6    1 
ATOM   5894  N N1    . DG  B 1 144 ? -48.983  -43.672 1.069  1.00 93.03  ? 288  DG  J N1    1 
ATOM   5895  C C2    . DG  B 1 144 ? -48.567  -42.372 0.901  1.00 91.94  ? 288  DG  J C2    1 
ATOM   5896  N N2    . DG  B 1 144 ? -47.397  -42.194 0.261  1.00 92.37  ? 288  DG  J N2    1 
ATOM   5897  N N3    . DG  B 1 144 ? -49.248  -41.323 1.323  1.00 91.16  ? 288  DG  J N3    1 
ATOM   5898  C C4    . DG  B 1 144 ? -50.399  -41.679 1.928  1.00 91.59  ? 288  DG  J C4    1 
ATOM   5899  P P     . DA  B 1 145 ? -52.349  -35.897 1.009  1.00 113.95 ? 289  DA  J P     1 
ATOM   5900  O OP1   . DA  B 1 145 ? -52.552  -34.439 1.223  1.00 99.52  ? 289  DA  J OP1   1 
ATOM   5901  O OP2   . DA  B 1 145 ? -53.526  -36.779 0.796  1.00 99.00  ? 289  DA  J OP2   1 
ATOM   5902  O "O5'" . DA  B 1 145 ? -51.344  -36.045 -0.211 1.00 114.53 ? 289  DA  J "O5'" 1 
ATOM   5903  C "C5'" . DA  B 1 145 ? -49.950  -35.804 -0.019 1.00 112.33 ? 289  DA  J "C5'" 1 
ATOM   5904  C "C4'" . DA  B 1 145 ? -49.148  -36.473 -1.109 1.00 111.73 ? 289  DA  J "C4'" 1 
ATOM   5905  O "O4'" . DA  B 1 145 ? -49.172  -37.914 -0.934 1.00 110.37 ? 289  DA  J "O4'" 1 
ATOM   5906  C "C3'" . DA  B 1 145 ? -49.684  -36.206 -2.515 1.00 112.61 ? 289  DA  J "C3'" 1 
ATOM   5907  O "O3'" . DA  B 1 145 ? -48.605  -36.010 -3.432 1.00 118.01 ? 289  DA  J "O3'" 1 
ATOM   5908  C "C2'" . DA  B 1 145 ? -50.449  -37.473 -2.848 1.00 110.84 ? 289  DA  J "C2'" 1 
ATOM   5909  C "C1'" . DA  B 1 145 ? -49.641  -38.532 -2.124 1.00 108.40 ? 289  DA  J "C1'" 1 
ATOM   5910  N N9    . DA  B 1 145 ? -50.406  -39.728 -1.761 1.00 93.57  ? 289  DA  J N9    1 
ATOM   5911  C C8    . DA  B 1 145 ? -51.634  -39.804 -1.146 1.00 92.86  ? 289  DA  J C8    1 
ATOM   5912  N N7    . DA  B 1 145 ? -52.073  -41.031 -0.988 1.00 92.07  ? 289  DA  J N7    1 
ATOM   5913  C C5    . DA  B 1 145 ? -51.064  -41.818 -1.529 1.00 92.08  ? 289  DA  J C5    1 
ATOM   5914  C C6    . DA  B 1 145 ? -50.926  -43.211 -1.682 1.00 91.15  ? 289  DA  J C6    1 
ATOM   5915  N N6    . DA  B 1 145 ? -51.839  -44.097 -1.283 1.00 90.85  ? 289  DA  J N6    1 
ATOM   5916  N N1    . DA  B 1 145 ? -49.800  -43.670 -2.271 1.00 90.93  ? 289  DA  J N1    1 
ATOM   5917  C C2    . DA  B 1 145 ? -48.878  -42.784 -2.670 1.00 91.37  ? 289  DA  J C2    1 
ATOM   5918  N N3    . DA  B 1 145 ? -48.892  -41.457 -2.584 1.00 91.93  ? 289  DA  J N3    1 
ATOM   5919  C C4    . DA  B 1 145 ? -50.028  -41.031 -2.000 1.00 92.71  ? 289  DA  J C4    1 
ATOM   5920  P P     . DT  B 1 146 ? -48.914  -35.826 -4.997 1.00 127.27 ? 290  DT  J P     1 
ATOM   5921  O OP1   . DT  B 1 146 ? -47.756  -35.108 -5.583 1.00 96.44  ? 290  DT  J OP1   1 
ATOM   5922  O OP2   . DT  B 1 146 ? -50.288  -35.278 -5.170 1.00 96.97  ? 290  DT  J OP2   1 
ATOM   5923  O "O5'" . DT  B 1 146 ? -48.890  -37.316 -5.555 1.00 128.24 ? 290  DT  J "O5'" 1 
ATOM   5924  C "C5'" . DT  B 1 146 ? -47.654  -38.007 -5.720 1.00 129.93 ? 290  DT  J "C5'" 1 
ATOM   5925  C "C4'" . DT  B 1 146 ? -47.815  -39.111 -6.737 1.00 130.71 ? 290  DT  J "C4'" 1 
ATOM   5926  O "O4'" . DT  B 1 146 ? -48.550  -40.212 -6.152 1.00 129.93 ? 290  DT  J "O4'" 1 
ATOM   5927  C "C3'" . DT  B 1 146 ? -48.612  -38.690 -7.972 1.00 131.01 ? 290  DT  J "C3'" 1 
ATOM   5928  O "O3'" . DT  B 1 146 ? -48.260  -39.491 -9.099 1.00 132.61 ? 290  DT  J "O3'" 1 
ATOM   5929  C "C2'" . DT  B 1 146 ? -50.018  -39.127 -7.616 1.00 129.97 ? 290  DT  J "C2'" 1 
ATOM   5930  C "C1'" . DT  B 1 146 ? -49.737  -40.430 -6.893 1.00 129.53 ? 290  DT  J "C1'" 1 
ATOM   5931  N N1    . DT  B 1 146 ? -50.784  -40.861 -5.958 1.00 100.77 ? 290  DT  J N1    1 
ATOM   5932  C C2    . DT  B 1 146 ? -50.872  -42.204 -5.672 1.00 101.48 ? 290  DT  J C2    1 
ATOM   5933  O O2    . DT  B 1 146 ? -50.137  -43.038 -6.166 1.00 102.73 ? 290  DT  J O2    1 
ATOM   5934  N N3    . DT  B 1 146 ? -51.864  -42.537 -4.790 1.00 100.49 ? 290  DT  J N3    1 
ATOM   5935  C C4    . DT  B 1 146 ? -52.764  -41.682 -4.188 1.00 99.67  ? 290  DT  J C4    1 
ATOM   5936  O O4    . DT  B 1 146 ? -53.595  -42.128 -3.409 1.00 98.95  ? 290  DT  J O4    1 
ATOM   5937  C C5    . DT  B 1 146 ? -52.630  -40.287 -4.547 1.00 99.92  ? 290  DT  J C5    1 
ATOM   5938  C C7    . DT  B 1 146 ? -53.587  -39.293 -3.970 1.00 99.64  ? 290  DT  J C7    1 
ATOM   5939  C C6    . DT  B 1 146 ? -51.650  -39.949 -5.394 1.00 99.90  ? 290  DT  J C6    1 
ATOM   5940  N N     . PRO C 2 39  ? -115.689 -26.199 11.557 1.00 184.33 ? 438  PRO A N     1 
ATOM   5941  C CA    . PRO C 2 39  ? -115.444 -26.738 12.917 1.00 184.30 ? 438  PRO A CA    1 
ATOM   5942  C C     . PRO C 2 39  ? -114.309 -25.988 13.620 1.00 184.47 ? 438  PRO A C     1 
ATOM   5943  O O     . PRO C 2 39  ? -113.899 -24.918 13.169 1.00 185.31 ? 438  PRO A O     1 
ATOM   5944  C CB    . PRO C 2 39  ? -115.109 -28.212 12.748 1.00 116.85 ? 438  PRO A CB    1 
ATOM   5945  C CG    . PRO C 2 39  ? -114.570 -28.246 11.319 1.00 117.04 ? 438  PRO A CG    1 
ATOM   5946  C CD    . PRO C 2 39  ? -115.426 -27.238 10.545 1.00 116.86 ? 438  PRO A CD    1 
ATOM   5947  N N     . HIS C 2 40  ? -113.813 -26.538 14.727 1.00 134.92 ? 439  HIS A N     1 
ATOM   5948  C CA    . HIS C 2 40  ? -112.718 -25.904 15.466 1.00 131.89 ? 439  HIS A CA    1 
ATOM   5949  C C     . HIS C 2 40  ? -111.675 -26.928 15.887 1.00 128.79 ? 439  HIS A C     1 
ATOM   5950  O O     . HIS C 2 40  ? -111.985 -28.111 16.040 1.00 127.77 ? 439  HIS A O     1 
ATOM   5951  C CB    . HIS C 2 40  ? -113.250 -25.174 16.705 1.00 159.39 ? 439  HIS A CB    1 
ATOM   5952  C CG    . HIS C 2 40  ? -112.183 -24.503 17.520 1.00 161.68 ? 439  HIS A CG    1 
ATOM   5953  N ND1   . HIS C 2 40  ? -111.233 -25.206 18.230 1.00 161.43 ? 439  HIS A ND1   1 
ATOM   5954  C CD2   . HIS C 2 40  ? -111.919 -23.192 17.736 1.00 162.52 ? 439  HIS A CD2   1 
ATOM   5955  C CE1   . HIS C 2 40  ? -110.431 -24.358 18.848 1.00 161.98 ? 439  HIS A CE1   1 
ATOM   5956  N NE2   . HIS C 2 40  ? -110.825 -23.129 18.565 1.00 162.39 ? 439  HIS A NE2   1 
ATOM   5957  N N     . ARG C 2 41  ? -110.440 -26.466 16.078 1.00 132.54 ? 440  ARG A N     1 
ATOM   5958  C CA    . ARG C 2 41  ? -109.344 -27.347 16.472 1.00 128.56 ? 440  ARG A CA    1 
ATOM   5959  C C     . ARG C 2 41  ? -108.063 -26.554 16.710 1.00 126.67 ? 440  ARG A C     1 
ATOM   5960  O O     . ARG C 2 41  ? -107.685 -25.692 15.909 1.00 126.55 ? 440  ARG A O     1 
ATOM   5961  C CB    . ARG C 2 41  ? -109.112 -28.380 15.375 1.00 84.35  ? 440  ARG A CB    1 
ATOM   5962  C CG    . ARG C 2 41  ? -108.270 -29.575 15.742 1.00 82.85  ? 440  ARG A CG    1 
ATOM   5963  C CD    . ARG C 2 41  ? -108.303 -30.538 14.568 1.00 80.98  ? 440  ARG A CD    1 
ATOM   5964  N NE    . ARG C 2 41  ? -107.410 -31.686 14.697 1.00 81.17  ? 440  ARG A NE    1 
ATOM   5965  C CZ    . ARG C 2 41  ? -107.502 -32.635 15.627 1.00 81.21  ? 440  ARG A CZ    1 
ATOM   5966  N NH1   . ARG C 2 41  ? -108.449 -32.600 16.553 1.00 80.64  ? 440  ARG A NH1   1 
ATOM   5967  N NH2   . ARG C 2 41  ? -106.656 -33.653 15.602 1.00 82.39  ? 440  ARG A NH2   1 
ATOM   5968  N N     . TYR C 2 42  ? -107.397 -26.856 17.819 1.00 86.18  ? 441  TYR A N     1 
ATOM   5969  C CA    . TYR C 2 42  ? -106.164 -26.171 18.161 1.00 82.27  ? 441  TYR A CA    1 
ATOM   5970  C C     . TYR C 2 42  ? -104.938 -26.746 17.432 1.00 81.94  ? 441  TYR A C     1 
ATOM   5971  O O     . TYR C 2 42  ? -104.788 -27.965 17.309 1.00 81.70  ? 441  TYR A O     1 
ATOM   5972  C CB    . TYR C 2 42  ? -105.968 -26.176 19.684 1.00 84.48  ? 441  TYR A CB    1 
ATOM   5973  C CG    . TYR C 2 42  ? -106.740 -25.073 20.407 1.00 81.38  ? 441  TYR A CG    1 
ATOM   5974  C CD1   . TYR C 2 42  ? -107.626 -25.371 21.446 1.00 79.46  ? 441  TYR A CD1   1 
ATOM   5975  C CD2   . TYR C 2 42  ? -106.564 -23.719 20.065 1.00 81.36  ? 441  TYR A CD2   1 
ATOM   5976  C CE1   . TYR C 2 42  ? -108.323 -24.345 22.131 1.00 79.46  ? 441  TYR A CE1   1 
ATOM   5977  C CE2   . TYR C 2 42  ? -107.251 -22.687 20.740 1.00 80.15  ? 441  TYR A CE2   1 
ATOM   5978  C CZ    . TYR C 2 42  ? -108.130 -23.009 21.771 1.00 80.25  ? 441  TYR A CZ    1 
ATOM   5979  O OH    . TYR C 2 42  ? -108.816 -22.001 22.425 1.00 79.56  ? 441  TYR A OH    1 
ATOM   5980  N N     . ARG C 2 43  ? -104.084 -25.861 16.918 1.00 68.52  ? 442  ARG A N     1 
ATOM   5981  C CA    . ARG C 2 43  ? -102.892 -26.277 16.190 1.00 68.12  ? 442  ARG A CA    1 
ATOM   5982  C C     . ARG C 2 43  ? -101.887 -26.970 17.101 1.00 67.32  ? 442  ARG A C     1 
ATOM   5983  O O     . ARG C 2 43  ? -101.789 -26.667 18.299 1.00 67.02  ? 442  ARG A O     1 
ATOM   5984  C CB    . ARG C 2 43  ? -102.248 -25.077 15.483 1.00 101.12 ? 442  ARG A CB    1 
ATOM   5985  C CG    . ARG C 2 43  ? -103.049 -24.616 14.268 1.00 105.86 ? 442  ARG A CG    1 
ATOM   5986  C CD    . ARG C 2 43  ? -102.234 -23.821 13.250 1.00 110.30 ? 442  ARG A CD    1 
ATOM   5987  N NE    . ARG C 2 43  ? -102.153 -22.400 13.568 1.00 115.76 ? 442  ARG A NE    1 
ATOM   5988  C CZ    . ARG C 2 43  ? -101.673 -21.474 12.740 1.00 119.45 ? 442  ARG A CZ    1 
ATOM   5989  N NH1   . ARG C 2 43  ? -101.232 -21.818 11.535 1.00 120.61 ? 442  ARG A NH1   1 
ATOM   5990  N NH2   . ARG C 2 43  ? -101.627 -20.202 13.118 1.00 120.60 ? 442  ARG A NH2   1 
ATOM   5991  N N     . PRO C 2 44  ? -101.123 -27.921 16.543 1.00 108.67 ? 443  PRO A N     1 
ATOM   5992  C CA    . PRO C 2 44  ? -100.119 -28.683 17.282 1.00 107.00 ? 443  PRO A CA    1 
ATOM   5993  C C     . PRO C 2 44  ? -99.201  -27.828 18.141 1.00 105.61 ? 443  PRO A C     1 
ATOM   5994  O O     . PRO C 2 44  ? -98.583  -26.876 17.661 1.00 106.93 ? 443  PRO A O     1 
ATOM   5995  C CB    . PRO C 2 44  ? -99.357  -29.405 16.177 1.00 91.53  ? 443  PRO A CB    1 
ATOM   5996  C CG    . PRO C 2 44  ? -100.376 -29.590 15.129 1.00 91.41  ? 443  PRO A CG    1 
ATOM   5997  C CD    . PRO C 2 44  ? -101.049 -28.245 15.109 1.00 92.70  ? 443  PRO A CD    1 
ATOM   5998  N N     . GLY C 2 45  ? -99.119  -28.172 19.418 1.00 90.05  ? 444  GLY A N     1 
ATOM   5999  C CA    . GLY C 2 45  ? -98.240  -27.438 20.299 1.00 86.14  ? 444  GLY A CA    1 
ATOM   6000  C C     . GLY C 2 45  ? -98.830  -26.235 20.994 1.00 83.78  ? 444  GLY A C     1 
ATOM   6001  O O     . GLY C 2 45  ? -98.141  -25.576 21.779 1.00 85.43  ? 444  GLY A O     1 
ATOM   6002  N N     . THR C 2 46  ? -100.093 -25.932 20.728 1.00 70.06  ? 445  THR A N     1 
ATOM   6003  C CA    . THR C 2 46  ? -100.693 -24.785 21.391 1.00 66.00  ? 445  THR A CA    1 
ATOM   6004  C C     . THR C 2 46  ? -101.217 -25.193 22.754 1.00 63.86  ? 445  THR A C     1 
ATOM   6005  O O     . THR C 2 46  ? -101.010 -24.487 23.742 1.00 62.49  ? 445  THR A O     1 
ATOM   6006  C CB    . THR C 2 46  ? -101.852 -24.202 20.592 1.00 71.29  ? 445  THR A CB    1 
ATOM   6007  O OG1   . THR C 2 46  ? -101.529 -24.230 19.200 1.00 70.34  ? 445  THR A OG1   1 
ATOM   6008  C CG2   . THR C 2 46  ? -102.098 -22.765 21.018 1.00 70.94  ? 445  THR A CG2   1 
ATOM   6009  N N     . VAL C 2 47  ? -101.894 -26.336 22.800 1.00 79.67  ? 446  VAL A N     1 
ATOM   6010  C CA    . VAL C 2 47  ? -102.448 -26.834 24.047 1.00 81.14  ? 446  VAL A CA    1 
ATOM   6011  C C     . VAL C 2 47  ? -101.297 -27.138 24.997 1.00 82.43  ? 446  VAL A C     1 
ATOM   6012  O O     . VAL C 2 47  ? -101.400 -26.894 26.205 1.00 82.69  ? 446  VAL A O     1 
ATOM   6013  C CB    . VAL C 2 47  ? -103.270 -28.108 23.821 1.00 62.28  ? 446  VAL A CB    1 
ATOM   6014  C CG1   . VAL C 2 47  ? -104.082 -28.430 25.067 1.00 61.57  ? 446  VAL A CG1   1 
ATOM   6015  C CG2   . VAL C 2 47  ? -104.174 -27.927 22.619 1.00 63.48  ? 446  VAL A CG2   1 
ATOM   6016  N N     . ALA C 2 48  ? -100.202 -27.659 24.439 1.00 74.35  ? 447  ALA A N     1 
ATOM   6017  C CA    . ALA C 2 48  ? -99.002  -27.981 25.216 1.00 72.45  ? 447  ALA A CA    1 
ATOM   6018  C C     . ALA C 2 48  ? -98.427  -26.724 25.875 1.00 71.49  ? 447  ALA A C     1 
ATOM   6019  O O     . ALA C 2 48  ? -98.101  -26.719 27.069 1.00 72.66  ? 447  ALA A O     1 
ATOM   6020  C CB    . ALA C 2 48  ? -97.954  -28.609 24.315 1.00 46.98  ? 447  ALA A CB    1 
ATOM   6021  N N     . LEU C 2 49  ? -98.292  -25.661 25.092 1.00 68.95  ? 448  LEU A N     1 
ATOM   6022  C CA    . LEU C 2 49  ? -97.766  -24.422 25.630 1.00 67.92  ? 448  LEU A CA    1 
ATOM   6023  C C     . LEU C 2 49  ? -98.697  -23.972 26.728 1.00 68.07  ? 448  LEU A C     1 
ATOM   6024  O O     . LEU C 2 49  ? -98.263  -23.438 27.749 1.00 68.60  ? 448  LEU A O     1 
ATOM   6025  C CB    . LEU C 2 49  ? -97.683  -23.350 24.542 1.00 58.89  ? 448  LEU A CB    1 
ATOM   6026  C CG    . LEU C 2 49  ? -96.273  -22.906 24.156 1.00 56.78  ? 448  LEU A CG    1 
ATOM   6027  C CD1   . LEU C 2 49  ? -95.377  -24.112 24.053 1.00 56.82  ? 448  LEU A CD1   1 
ATOM   6028  C CD2   . LEU C 2 49  ? -96.302  -22.177 22.841 1.00 56.18  ? 448  LEU A CD2   1 
ATOM   6029  N N     . ARG C 2 50  ? -99.987  -24.207 26.522 1.00 80.73  ? 449  ARG A N     1 
ATOM   6030  C CA    . ARG C 2 50  ? -100.981 -23.812 27.507 1.00 83.20  ? 449  ARG A CA    1 
ATOM   6031  C C     . ARG C 2 50  ? -100.852 -24.709 28.730 1.00 83.10  ? 449  ARG A C     1 
ATOM   6032  O O     . ARG C 2 50  ? -100.972 -24.236 29.853 1.00 83.05  ? 449  ARG A O     1 
ATOM   6033  C CB    . ARG C 2 50  ? -102.387 -23.893 26.901 1.00 94.55  ? 449  ARG A CB    1 
ATOM   6034  C CG    . ARG C 2 50  ? -103.435 -23.048 27.622 1.00 99.35  ? 449  ARG A CG    1 
ATOM   6035  C CD    . ARG C 2 50  ? -104.602 -22.708 26.692 1.00 103.73 ? 449  ARG A CD    1 
ATOM   6036  N NE    . ARG C 2 50  ? -105.297 -23.896 26.208 1.00 106.38 ? 449  ARG A NE    1 
ATOM   6037  C CZ    . ARG C 2 50  ? -105.783 -24.020 24.978 1.00 106.64 ? 449  ARG A CZ    1 
ATOM   6038  N NH1   . ARG C 2 50  ? -105.647 -23.026 24.107 1.00 106.26 ? 449  ARG A NH1   1 
ATOM   6039  N NH2   . ARG C 2 50  ? -106.395 -25.142 24.618 1.00 106.89 ? 449  ARG A NH2   1 
ATOM   6040  N N     . GLU C 2 51  ? -100.597 -25.997 28.511 1.00 86.87  ? 450  GLU A N     1 
ATOM   6041  C CA    . GLU C 2 51  ? -100.431 -26.924 29.624 1.00 87.48  ? 450  GLU A CA    1 
ATOM   6042  C C     . GLU C 2 51  ? -99.214  -26.492 30.420 1.00 87.09  ? 450  GLU A C     1 
ATOM   6043  O O     . GLU C 2 51  ? -99.267  -26.437 31.651 1.00 85.45  ? 450  GLU A O     1 
ATOM   6044  C CB    . GLU C 2 51  ? -100.219 -28.352 29.138 1.00 73.67  ? 450  GLU A CB    1 
ATOM   6045  C CG    . GLU C 2 51  ? -101.411 -28.988 28.472 1.00 76.22  ? 450  GLU A CG    1 
ATOM   6046  C CD    . GLU C 2 51  ? -101.055 -30.327 27.853 1.00 81.20  ? 450  GLU A CD    1 
ATOM   6047  O OE1   . GLU C 2 51  ? -100.870 -31.303 28.611 1.00 81.55  ? 450  GLU A OE1   1 
ATOM   6048  O OE2   . GLU C 2 51  ? -100.939 -30.400 26.607 1.00 84.27  ? 450  GLU A OE2   1 
ATOM   6049  N N     . ILE C 2 52  ? -98.115  -26.196 29.724 1.00 66.76  ? 451  ILE A N     1 
ATOM   6050  C CA    . ILE C 2 52  ? -96.908  -25.739 30.410 1.00 66.00  ? 451  ILE A CA    1 
ATOM   6051  C C     . ILE C 2 52  ? -97.240  -24.558 31.311 1.00 66.19  ? 451  ILE A C     1 
ATOM   6052  O O     . ILE C 2 52  ? -97.084  -24.650 32.524 1.00 66.66  ? 451  ILE A O     1 
ATOM   6053  C CB    . ILE C 2 52  ? -95.781  -25.303 29.424 1.00 57.76  ? 451  ILE A CB    1 
ATOM   6054  C CG1   . ILE C 2 52  ? -95.078  -26.557 28.869 1.00 56.38  ? 451  ILE A CG1   1 
ATOM   6055  C CG2   . ILE C 2 52  ? -94.787  -24.348 30.132 1.00 54.64  ? 451  ILE A CG2   1 
ATOM   6056  C CD1   . ILE C 2 52  ? -93.930  -26.302 27.896 1.00 54.92  ? 451  ILE A CD1   1 
ATOM   6057  N N     . ARG C 2 53  ? -97.712  -23.459 30.723 1.00 73.38  ? 452  ARG A N     1 
ATOM   6058  C CA    . ARG C 2 53  ? -98.048  -22.266 31.501 1.00 74.27  ? 452  ARG A CA    1 
ATOM   6059  C C     . ARG C 2 53  ? -98.927  -22.578 32.705 1.00 74.25  ? 452  ARG A C     1 
ATOM   6060  O O     . ARG C 2 53  ? -98.838  -21.930 33.753 1.00 72.54  ? 452  ARG A O     1 
ATOM   6061  C CB    . ARG C 2 53  ? -98.755  -21.232 30.625 1.00 84.16  ? 452  ARG A CB    1 
ATOM   6062  C CG    . ARG C 2 53  ? -97.882  -20.643 29.542 1.00 85.87  ? 452  ARG A CG    1 
ATOM   6063  C CD    . ARG C 2 53  ? -98.442  -19.312 29.066 1.00 87.14  ? 452  ARG A CD    1 
ATOM   6064  N NE    . ARG C 2 53  ? -97.674  -18.751 27.959 1.00 90.60  ? 452  ARG A NE    1 
ATOM   6065  C CZ    . ARG C 2 53  ? -97.591  -19.302 26.751 1.00 92.40  ? 452  ARG A CZ    1 
ATOM   6066  N NH1   . ARG C 2 53  ? -98.233  -20.438 26.484 1.00 91.52  ? 452  ARG A NH1   1 
ATOM   6067  N NH2   . ARG C 2 53  ? -96.862  -18.716 25.807 1.00 93.72  ? 452  ARG A NH2   1 
ATOM   6068  N N     . ARG C 2 54  ? -99.769  -23.584 32.550 1.00 70.75  ? 453  ARG A N     1 
ATOM   6069  C CA    . ARG C 2 54  ? -100.670 -23.959 33.606 1.00 70.72  ? 453  ARG A CA    1 
ATOM   6070  C C     . ARG C 2 54  ? -99.938  -24.586 34.782 1.00 71.57  ? 453  ARG A C     1 
ATOM   6071  O O     . ARG C 2 54  ? -99.766  -23.961 35.838 1.00 73.99  ? 453  ARG A O     1 
ATOM   6072  C CB    . ARG C 2 54  ? -101.712 -24.928 33.065 1.00 73.29  ? 453  ARG A CB    1 
ATOM   6073  C CG    . ARG C 2 54  ? -102.674 -25.443 34.109 1.00 70.60  ? 453  ARG A CG    1 
ATOM   6074  C CD    . ARG C 2 54  ? -103.509 -26.530 33.513 1.00 71.53  ? 453  ARG A CD    1 
ATOM   6075  N NE    . ARG C 2 54  ? -104.131 -27.367 34.524 1.00 72.28  ? 453  ARG A NE    1 
ATOM   6076  C CZ    . ARG C 2 54  ? -104.687 -28.546 34.260 1.00 71.85  ? 453  ARG A CZ    1 
ATOM   6077  N NH1   . ARG C 2 54  ? -104.691 -29.024 33.015 1.00 71.75  ? 453  ARG A NH1   1 
ATOM   6078  N NH2   . ARG C 2 54  ? -105.250 -29.246 35.237 1.00 69.12  ? 453  ARG A NH2   1 
ATOM   6079  N N     . TYR C 2 55  ? -99.513  -25.827 34.591 1.00 68.74  ? 454  TYR A N     1 
ATOM   6080  C CA    . TYR C 2 55  ? -98.820  -26.561 35.631 1.00 67.66  ? 454  TYR A CA    1 
ATOM   6081  C C     . TYR C 2 55  ? -97.624  -25.824 36.206 1.00 67.69  ? 454  TYR A C     1 
ATOM   6082  O O     . TYR C 2 55  ? -97.250  -26.028 37.361 1.00 66.27  ? 454  TYR A O     1 
ATOM   6083  C CB    . TYR C 2 55  ? -98.407  -27.915 35.085 1.00 80.45  ? 454  TYR A CB    1 
ATOM   6084  C CG    . TYR C 2 55  ? -99.596  -28.792 34.818 1.00 82.70  ? 454  TYR A CG    1 
ATOM   6085  C CD1   . TYR C 2 55  ? -99.827  -29.316 33.552 1.00 83.85  ? 454  TYR A CD1   1 
ATOM   6086  C CD2   . TYR C 2 55  ? -100.500 -29.090 35.837 1.00 83.11  ? 454  TYR A CD2   1 
ATOM   6087  C CE1   . TYR C 2 55  ? -100.932 -30.120 33.304 1.00 82.91  ? 454  TYR A CE1   1 
ATOM   6088  C CE2   . TYR C 2 55  ? -101.601 -29.884 35.602 1.00 82.43  ? 454  TYR A CE2   1 
ATOM   6089  C CZ    . TYR C 2 55  ? -101.814 -30.400 34.335 1.00 83.12  ? 454  TYR A CZ    1 
ATOM   6090  O OH    . TYR C 2 55  ? -102.900 -31.211 34.103 1.00 85.88  ? 454  TYR A OH    1 
ATOM   6091  N N     . GLN C 2 56  ? -97.032  -24.955 35.403 1.00 66.99  ? 455  GLN A N     1 
ATOM   6092  C CA    . GLN C 2 56  ? -95.890  -24.182 35.854 1.00 66.92  ? 455  GLN A CA    1 
ATOM   6093  C C     . GLN C 2 56  ? -96.340  -23.090 36.806 1.00 67.36  ? 455  GLN A C     1 
ATOM   6094  O O     . GLN C 2 56  ? -95.520  -22.399 37.401 1.00 68.48  ? 455  GLN A O     1 
ATOM   6095  C CB    . GLN C 2 56  ? -95.175  -23.553 34.663 1.00 64.02  ? 455  GLN A CB    1 
ATOM   6096  C CG    . GLN C 2 56  ? -93.703  -23.366 34.906 1.00 60.30  ? 455  GLN A CG    1 
ATOM   6097  C CD    . GLN C 2 56  ? -92.896  -23.438 33.634 1.00 58.20  ? 455  GLN A CD    1 
ATOM   6098  O OE1   . GLN C 2 56  ? -92.771  -22.456 32.906 1.00 59.68  ? 455  GLN A OE1   1 
ATOM   6099  N NE2   . GLN C 2 56  ? -92.350  -24.615 33.351 1.00 56.53  ? 455  GLN A NE2   1 
ATOM   6100  N N     . LYS C 2 57  ? -97.651  -22.939 36.954 1.00 70.81  ? 456  LYS A N     1 
ATOM   6101  C CA    . LYS C 2 57  ? -98.196  -21.911 37.824 1.00 72.41  ? 456  LYS A CA    1 
ATOM   6102  C C     . LYS C 2 57  ? -98.734  -22.521 39.098 1.00 71.46  ? 456  LYS A C     1 
ATOM   6103  O O     . LYS C 2 57  ? -98.883  -21.832 40.100 1.00 70.33  ? 456  LYS A O     1 
ATOM   6104  C CB    . LYS C 2 57  ? -99.317  -21.171 37.104 1.00 89.55  ? 456  LYS A CB    1 
ATOM   6105  C CG    . LYS C 2 57  ? -99.835  -19.954 37.843 1.00 95.31  ? 456  LYS A CG    1 
ATOM   6106  C CD    . LYS C 2 57  ? -100.972 -19.276 37.063 1.00 98.69  ? 456  LYS A CD    1 
ATOM   6107  C CE    . LYS C 2 57  ? -100.527 -18.776 35.683 1.00 102.60 ? 456  LYS A CE    1 
ATOM   6108  N NZ    . LYS C 2 57  ? -101.669 -18.232 34.886 1.00 103.94 ? 456  LYS A NZ    1 
ATOM   6109  N N     . SER C 2 58  ? -99.013  -23.820 39.047 1.00 73.72  ? 457  SER A N     1 
ATOM   6110  C CA    . SER C 2 58  ? -99.568  -24.550 40.181 1.00 73.87  ? 457  SER A CA    1 
ATOM   6111  C C     . SER C 2 58  ? -98.510  -25.343 40.926 1.00 74.15  ? 457  SER A C     1 
ATOM   6112  O O     . SER C 2 58  ? -97.362  -25.402 40.484 1.00 73.87  ? 457  SER A O     1 
ATOM   6113  C CB    . SER C 2 58  ? -100.649 -25.505 39.687 1.00 65.90  ? 457  SER A CB    1 
ATOM   6114  O OG    . SER C 2 58  ? -100.120 -26.410 38.733 1.00 66.23  ? 457  SER A OG    1 
ATOM   6115  N N     . THR C 2 59  ? -98.904  -25.973 42.036 1.00 66.92  ? 458  THR A N     1 
ATOM   6116  C CA    . THR C 2 59  ? -97.965  -26.751 42.851 1.00 68.15  ? 458  THR A CA    1 
ATOM   6117  C C     . THR C 2 59  ? -98.472  -28.110 43.332 1.00 68.73  ? 458  THR A C     1 
ATOM   6118  O O     . THR C 2 59  ? -97.763  -28.823 44.047 1.00 68.15  ? 458  THR A O     1 
ATOM   6119  C CB    . THR C 2 59  ? -97.532  -25.972 44.121 1.00 78.27  ? 458  THR A CB    1 
ATOM   6120  O OG1   . THR C 2 59  ? -98.437  -26.266 45.196 1.00 80.75  ? 458  THR A OG1   1 
ATOM   6121  C CG2   . THR C 2 59  ? -97.534  -24.473 43.860 1.00 78.30  ? 458  THR A CG2   1 
ATOM   6122  N N     . GLU C 2 60  ? -99.696  -28.473 42.975 1.00 71.40  ? 459  GLU A N     1 
ATOM   6123  C CA    . GLU C 2 60  ? -100.209 -29.761 43.423 1.00 72.80  ? 459  GLU A CA    1 
ATOM   6124  C C     . GLU C 2 60  ? -99.400  -30.875 42.778 1.00 72.29  ? 459  GLU A C     1 
ATOM   6125  O O     . GLU C 2 60  ? -98.742  -30.654 41.758 1.00 72.70  ? 459  GLU A O     1 
ATOM   6126  C CB    . GLU C 2 60  ? -101.696 -29.890 43.087 1.00 96.70  ? 459  GLU A CB    1 
ATOM   6127  C CG    . GLU C 2 60  ? -102.218 -28.842 42.122 1.00 102.93 ? 459  GLU A CG    1 
ATOM   6128  C CD    . GLU C 2 60  ? -101.810 -29.114 40.695 1.00 106.95 ? 459  GLU A CD    1 
ATOM   6129  O OE1   . GLU C 2 60  ? -102.075 -30.236 40.214 1.00 109.85 ? 459  GLU A OE1   1 
ATOM   6130  O OE2   . GLU C 2 60  ? -101.235 -28.211 40.053 1.00 107.41 ? 459  GLU A OE2   1 
ATOM   6131  N N     . LEU C 2 61  ? -99.415  -32.061 43.377 1.00 81.40  ? 460  LEU A N     1 
ATOM   6132  C CA    . LEU C 2 61  ? -98.656  -33.163 42.807 1.00 80.05  ? 460  LEU A CA    1 
ATOM   6133  C C     . LEU C 2 61  ? -99.265  -33.556 41.461 1.00 80.20  ? 460  LEU A C     1 
ATOM   6134  O O     . LEU C 2 61  ? -100.420 -33.221 41.177 1.00 79.59  ? 460  LEU A O     1 
ATOM   6135  C CB    . LEU C 2 61  ? -98.620  -34.348 43.775 1.00 73.24  ? 460  LEU A CB    1 
ATOM   6136  C CG    . LEU C 2 61  ? -97.946  -34.044 45.121 1.00 73.17  ? 460  LEU A CG    1 
ATOM   6137  C CD1   . LEU C 2 61  ? -97.747  -35.319 45.901 1.00 74.63  ? 460  LEU A CD1   1 
ATOM   6138  C CD2   . LEU C 2 61  ? -96.606  -33.383 44.896 1.00 73.21  ? 460  LEU A CD2   1 
ATOM   6139  N N     . LEU C 2 62  ? -98.492  -34.254 40.629 1.00 63.41  ? 461  LEU A N     1 
ATOM   6140  C CA    . LEU C 2 62  ? -98.965  -34.625 39.301 1.00 64.35  ? 461  LEU A CA    1 
ATOM   6141  C C     . LEU C 2 62  ? -98.995  -36.125 39.038 1.00 64.74  ? 461  LEU A C     1 
ATOM   6142  O O     . LEU C 2 62  ? -99.420  -36.579 37.974 1.00 64.03  ? 461  LEU A O     1 
ATOM   6143  C CB    . LEU C 2 62  ? -98.113  -33.911 38.251 1.00 77.46  ? 461  LEU A CB    1 
ATOM   6144  C CG    . LEU C 2 62  ? -97.913  -32.418 38.540 1.00 76.17  ? 461  LEU A CG    1 
ATOM   6145  C CD1   . LEU C 2 62  ? -97.143  -31.770 37.400 1.00 75.40  ? 461  LEU A CD1   1 
ATOM   6146  C CD2   . LEU C 2 62  ? -99.256  -31.739 38.724 1.00 74.67  ? 461  LEU A CD2   1 
ATOM   6147  N N     . ILE C 2 63  ? -98.527  -36.900 40.000 1.00 71.11  ? 462  ILE A N     1 
ATOM   6148  C CA    . ILE C 2 63  ? -98.573  -38.339 39.854 1.00 74.46  ? 462  ILE A CA    1 
ATOM   6149  C C     . ILE C 2 63  ? -99.754  -38.741 40.732 1.00 77.80  ? 462  ILE A C     1 
ATOM   6150  O O     . ILE C 2 63  ? -100.049 -38.066 41.721 1.00 78.97  ? 462  ILE A O     1 
ATOM   6151  C CB    . ILE C 2 63  ? -97.268  -38.986 40.351 1.00 78.83  ? 462  ILE A CB    1 
ATOM   6152  C CG1   . ILE C 2 63  ? -96.099  -38.473 39.508 1.00 78.13  ? 462  ILE A CG1   1 
ATOM   6153  C CG2   . ILE C 2 63  ? -97.355  -40.507 40.256 1.00 78.16  ? 462  ILE A CG2   1 
ATOM   6154  C CD1   . ILE C 2 63  ? -94.752  -38.966 39.969 1.00 78.38  ? 462  ILE A CD1   1 
ATOM   6155  N N     . ARG C 2 64  ? -100.454 -39.807 40.357 1.00 77.85  ? 463  ARG A N     1 
ATOM   6156  C CA    . ARG C 2 64  ? -101.598 -40.270 41.137 1.00 81.20  ? 463  ARG A CA    1 
ATOM   6157  C C     . ARG C 2 64  ? -101.142 -40.903 42.453 1.00 79.80  ? 463  ARG A C     1 
ATOM   6158  O O     . ARG C 2 64  ? -100.345 -41.846 42.467 1.00 79.53  ? 463  ARG A O     1 
ATOM   6159  C CB    . ARG C 2 64  ? -102.413 -41.275 40.324 1.00 113.38 ? 463  ARG A CB    1 
ATOM   6160  C CG    . ARG C 2 64  ? -103.293 -40.651 39.253 1.00 121.93 ? 463  ARG A CG    1 
ATOM   6161  C CD    . ARG C 2 64  ? -104.386 -39.796 39.874 1.00 129.18 ? 463  ARG A CD    1 
ATOM   6162  N NE    . ARG C 2 64  ? -105.528 -39.639 38.975 1.00 137.60 ? 463  ARG A NE    1 
ATOM   6163  C CZ    . ARG C 2 64  ? -106.695 -39.104 39.326 1.00 142.92 ? 463  ARG A CZ    1 
ATOM   6164  N NH1   . ARG C 2 64  ? -106.881 -38.666 40.565 1.00 145.76 ? 463  ARG A NH1   1 
ATOM   6165  N NH2   . ARG C 2 64  ? -107.682 -39.020 38.442 1.00 145.96 ? 463  ARG A NH2   1 
ATOM   6166  N N     . LYS C 2 65  ? -101.659 -40.376 43.557 1.00 91.10  ? 464  LYS A N     1 
ATOM   6167  C CA    . LYS C 2 65  ? -101.302 -40.853 44.889 1.00 89.57  ? 464  LYS A CA    1 
ATOM   6168  C C     . LYS C 2 65  ? -101.293 -42.372 45.023 1.00 87.14  ? 464  LYS A C     1 
ATOM   6169  O O     . LYS C 2 65  ? -100.235 -42.985 45.202 1.00 86.71  ? 464  LYS A O     1 
ATOM   6170  C CB    . LYS C 2 65  ? -102.260 -40.281 45.929 1.00 96.63  ? 464  LYS A CB    1 
ATOM   6171  C CG    . LYS C 2 65  ? -102.744 -38.879 45.627 1.00 100.66 ? 464  LYS A CG    1 
ATOM   6172  C CD    . LYS C 2 65  ? -101.666 -37.822 45.770 1.00 103.75 ? 464  LYS A CD    1 
ATOM   6173  C CE    . LYS C 2 65  ? -102.282 -36.447 45.539 1.00 105.72 ? 464  LYS A CE    1 
ATOM   6174  N NZ    . LYS C 2 65  ? -101.346 -35.328 45.810 1.00 106.52 ? 464  LYS A NZ    1 
ATOM   6175  N N     . LEU C 2 66  ? -102.475 -42.976 44.947 1.00 88.02  ? 465  LEU A N     1 
ATOM   6176  C CA    . LEU C 2 66  ? -102.581 -44.418 45.097 1.00 87.19  ? 465  LEU A CA    1 
ATOM   6177  C C     . LEU C 2 66  ? -101.469 -45.152 44.361 1.00 85.78  ? 465  LEU A C     1 
ATOM   6178  O O     . LEU C 2 66  ? -100.684 -45.874 44.973 1.00 84.88  ? 465  LEU A O     1 
ATOM   6179  C CB    . LEU C 2 66  ? -103.941 -44.914 44.614 1.00 89.30  ? 465  LEU A CB    1 
ATOM   6180  C CG    . LEU C 2 66  ? -104.192 -46.365 45.018 1.00 88.82  ? 465  LEU A CG    1 
ATOM   6181  C CD1   . LEU C 2 66  ? -104.222 -46.467 46.538 1.00 87.73  ? 465  LEU A CD1   1 
ATOM   6182  C CD2   . LEU C 2 66  ? -105.499 -46.845 44.417 1.00 88.43  ? 465  LEU A CD2   1 
ATOM   6183  N N     . PRO C 2 67  ? -101.379 -44.967 43.037 1.00 64.54  ? 466  PRO A N     1 
ATOM   6184  C CA    . PRO C 2 67  ? -100.347 -45.620 42.222 1.00 64.49  ? 466  PRO A CA    1 
ATOM   6185  C C     . PRO C 2 67  ? -98.944  -45.459 42.807 1.00 63.75  ? 466  PRO A C     1 
ATOM   6186  O O     . PRO C 2 67  ? -98.181  -46.431 42.879 1.00 64.85  ? 466  PRO A O     1 
ATOM   6187  C CB    . PRO C 2 67  ? -100.481 -44.924 40.874 1.00 63.91  ? 466  PRO A CB    1 
ATOM   6188  C CG    . PRO C 2 67  ? -101.926 -44.596 40.827 1.00 64.30  ? 466  PRO A CG    1 
ATOM   6189  C CD    . PRO C 2 67  ? -102.204 -44.076 42.212 1.00 63.73  ? 466  PRO A CD    1 
ATOM   6190  N N     . PHE C 2 68  ? -98.610  -44.230 43.212 1.00 68.39  ? 467  PHE A N     1 
ATOM   6191  C CA    . PHE C 2 68  ? -97.304  -43.942 43.806 1.00 65.74  ? 467  PHE A CA    1 
ATOM   6192  C C     . PHE C 2 68  ? -97.102  -44.804 45.054 1.00 65.75  ? 467  PHE A C     1 
ATOM   6193  O O     . PHE C 2 68  ? -96.131  -45.555 45.162 1.00 63.53  ? 467  PHE A O     1 
ATOM   6194  C CB    . PHE C 2 68  ? -97.194  -42.464 44.204 1.00 94.79  ? 467  PHE A CB    1 
ATOM   6195  C CG    . PHE C 2 68  ? -95.793  -42.042 44.571 1.00 93.26  ? 467  PHE A CG    1 
ATOM   6196  C CD1   . PHE C 2 68  ? -94.848  -41.792 43.581 1.00 92.16  ? 467  PHE A CD1   1 
ATOM   6197  C CD2   . PHE C 2 68  ? -95.403  -41.954 45.900 1.00 92.18  ? 467  PHE A CD2   1 
ATOM   6198  C CE1   . PHE C 2 68  ? -93.538  -41.469 43.909 1.00 91.77  ? 467  PHE A CE1   1 
ATOM   6199  C CE2   . PHE C 2 68  ? -94.090  -41.632 46.236 1.00 90.76  ? 467  PHE A CE2   1 
ATOM   6200  C CZ    . PHE C 2 68  ? -93.157  -41.390 45.237 1.00 92.02  ? 467  PHE A CZ    1 
ATOM   6201  N N     . GLN C 2 69  ? -98.034  -44.682 45.991 1.00 58.61  ? 468  GLN A N     1 
ATOM   6202  C CA    . GLN C 2 69  ? -97.986  -45.441 47.231 1.00 60.49  ? 468  GLN A CA    1 
ATOM   6203  C C     . GLN C 2 69  ? -97.740  -46.921 46.947 1.00 61.59  ? 468  GLN A C     1 
ATOM   6204  O O     . GLN C 2 69  ? -97.032  -47.604 47.689 1.00 60.59  ? 468  GLN A O     1 
ATOM   6205  C CB    . GLN C 2 69  ? -99.302  -45.265 47.997 1.00 59.53  ? 468  GLN A CB    1 
ATOM   6206  C CG    . GLN C 2 69  ? -99.381  -46.092 49.261 1.00 63.95  ? 468  GLN A CG    1 
ATOM   6207  C CD    . GLN C 2 69  ? -99.655  -45.259 50.484 1.00 68.53  ? 468  GLN A CD    1 
ATOM   6208  O OE1   . GLN C 2 69  ? -99.627  -45.766 51.603 1.00 70.86  ? 468  GLN A OE1   1 
ATOM   6209  N NE2   . GLN C 2 69  ? -99.921  -43.973 50.285 1.00 70.13  ? 468  GLN A NE2   1 
ATOM   6210  N N     . ARG C 2 70  ? -98.330  -47.418 45.869 1.00 66.81  ? 469  ARG A N     1 
ATOM   6211  C CA    . ARG C 2 70  ? -98.148  -48.818 45.519 1.00 67.82  ? 469  ARG A CA    1 
ATOM   6212  C C     . ARG C 2 70  ? -96.730  -49.049 45.040 1.00 67.32  ? 469  ARG A C     1 
ATOM   6213  O O     . ARG C 2 70  ? -96.147  -50.098 45.296 1.00 69.10  ? 469  ARG A O     1 
ATOM   6214  C CB    . ARG C 2 70  ? -99.141  -49.253 44.427 1.00 94.64  ? 469  ARG A CB    1 
ATOM   6215  C CG    . ARG C 2 70  ? -100.379 -49.988 44.946 1.00 97.19  ? 469  ARG A CG    1 
ATOM   6216  C CD    . ARG C 2 70  ? -101.132 -50.685 43.818 1.00 97.41  ? 469  ARG A CD    1 
ATOM   6217  N NE    . ARG C 2 70  ? -101.834 -49.754 42.937 1.00 99.35  ? 469  ARG A NE    1 
ATOM   6218  C CZ    . ARG C 2 70  ? -102.968 -49.134 43.250 1.00 98.99  ? 469  ARG A CZ    1 
ATOM   6219  N NH1   . ARG C 2 70  ? -103.539 -49.339 44.429 1.00 99.60  ? 469  ARG A NH1   1 
ATOM   6220  N NH2   . ARG C 2 70  ? -103.540 -48.317 42.376 1.00 96.54  ? 469  ARG A NH2   1 
ATOM   6221  N N     . LEU C 2 71  ? -96.175  -48.064 44.342 1.00 72.06  ? 470  LEU A N     1 
ATOM   6222  C CA    . LEU C 2 71  ? -94.811  -48.177 43.841 1.00 69.30  ? 470  LEU A CA    1 
ATOM   6223  C C     . LEU C 2 71  ? -93.836  -48.218 45.020 1.00 69.82  ? 470  LEU A C     1 
ATOM   6224  O O     . LEU C 2 71  ? -92.964  -49.090 45.098 1.00 69.13  ? 470  LEU A O     1 
ATOM   6225  C CB    . LEU C 2 71  ? -94.500  -46.994 42.923 1.00 64.02  ? 470  LEU A CB    1 
ATOM   6226  C CG    . LEU C 2 71  ? -93.177  -46.989 42.155 1.00 63.13  ? 470  LEU A CG    1 
ATOM   6227  C CD1   . LEU C 2 71  ? -92.897  -48.336 41.506 1.00 60.11  ? 470  LEU A CD1   1 
ATOM   6228  C CD2   . LEU C 2 71  ? -93.263  -45.879 41.133 1.00 60.41  ? 470  LEU A CD2   1 
ATOM   6229  N N     . VAL C 2 72  ? -94.007  -47.280 45.944 1.00 76.46  ? 471  VAL A N     1 
ATOM   6230  C CA    . VAL C 2 72  ? -93.160  -47.211 47.122 1.00 78.31  ? 471  VAL A CA    1 
ATOM   6231  C C     . VAL C 2 72  ? -93.102  -48.559 47.826 1.00 80.36  ? 471  VAL A C     1 
ATOM   6232  O O     . VAL C 2 72  ? -92.049  -49.205 47.876 1.00 79.71  ? 471  VAL A O     1 
ATOM   6233  C CB    . VAL C 2 72  ? -93.679  -46.166 48.127 1.00 66.51  ? 471  VAL A CB    1 
ATOM   6234  C CG1   . VAL C 2 72  ? -92.809  -46.169 49.383 1.00 64.92  ? 471  VAL A CG1   1 
ATOM   6235  C CG2   . VAL C 2 72  ? -93.692  -44.795 47.477 1.00 64.82  ? 471  VAL A CG2   1 
ATOM   6236  N N     . ARG C 2 73  ? -94.242  -48.975 48.368 1.00 78.67  ? 472  ARG A N     1 
ATOM   6237  C CA    . ARG C 2 73  ? -94.341  -50.240 49.082 1.00 78.06  ? 472  ARG A CA    1 
ATOM   6238  C C     . ARG C 2 73  ? -93.793  -51.402 48.264 1.00 79.53  ? 472  ARG A C     1 
ATOM   6239  O O     . ARG C 2 73  ? -93.176  -52.315 48.821 1.00 79.52  ? 472  ARG A O     1 
ATOM   6240  C CB    . ARG C 2 73  ? -95.791  -50.484 49.467 1.00 75.15  ? 472  ARG A CB    1 
ATOM   6241  C CG    . ARG C 2 73  ? -96.317  -49.434 50.424 1.00 72.57  ? 472  ARG A CG    1 
ATOM   6242  C CD    . ARG C 2 73  ? -97.836  -49.480 50.570 1.00 70.58  ? 472  ARG A CD    1 
ATOM   6243  N NE    . ARG C 2 73  ? -98.324  -48.432 51.469 1.00 67.24  ? 472  ARG A NE    1 
ATOM   6244  C CZ    . ARG C 2 73  ? -98.079  -48.393 52.778 1.00 66.84  ? 472  ARG A CZ    1 
ATOM   6245  N NH1   . ARG C 2 73  ? -97.348  -49.352 53.351 1.00 64.61  ? 472  ARG A NH1   1 
ATOM   6246  N NH2   . ARG C 2 73  ? -98.560  -47.395 53.515 1.00 65.29  ? 472  ARG A NH2   1 
ATOM   6247  N N     . GLU C 2 74  ? -93.998  -51.359 46.948 1.00 67.56  ? 473  GLU A N     1 
ATOM   6248  C CA    . GLU C 2 74  ? -93.496  -52.420 46.084 1.00 69.88  ? 473  GLU A CA    1 
ATOM   6249  C C     . GLU C 2 74  ? -91.980  -52.483 46.185 1.00 70.52  ? 473  GLU A C     1 
ATOM   6250  O O     . GLU C 2 74  ? -91.412  -53.544 46.477 1.00 70.80  ? 473  GLU A O     1 
ATOM   6251  C CB    . GLU C 2 74  ? -93.873  -52.200 44.619 1.00 92.69  ? 473  GLU A CB    1 
ATOM   6252  C CG    . GLU C 2 74  ? -93.672  -53.473 43.799 1.00 98.66  ? 473  GLU A CG    1 
ATOM   6253  C CD    . GLU C 2 74  ? -93.080  -53.243 42.419 1.00 103.41 ? 473  GLU A CD    1 
ATOM   6254  O OE1   . GLU C 2 74  ? -93.769  -52.662 41.553 1.00 104.81 ? 473  GLU A OE1   1 
ATOM   6255  O OE2   . GLU C 2 74  ? -91.918  -53.653 42.199 1.00 105.07 ? 473  GLU A OE2   1 
ATOM   6256  N N     . ILE C 2 75  ? -91.328  -51.342 45.947 1.00 65.53  ? 474  ILE A N     1 
ATOM   6257  C CA    . ILE C 2 75  ? -89.864  -51.252 46.003 1.00 64.93  ? 474  ILE A CA    1 
ATOM   6258  C C     . ILE C 2 75  ? -89.330  -51.535 47.410 1.00 65.04  ? 474  ILE A C     1 
ATOM   6259  O O     . ILE C 2 75  ? -88.422  -52.342 47.600 1.00 64.68  ? 474  ILE A O     1 
ATOM   6260  C CB    . ILE C 2 75  ? -89.378  -49.846 45.568 1.00 78.06  ? 474  ILE A CB    1 
ATOM   6261  C CG1   . ILE C 2 75  ? -89.874  -49.540 44.161 1.00 77.60  ? 474  ILE A CG1   1 
ATOM   6262  C CG2   . ILE C 2 75  ? -87.860  -49.781 45.582 1.00 77.02  ? 474  ILE A CG2   1 
ATOM   6263  C CD1   . ILE C 2 75  ? -89.477  -48.171 43.671 1.00 76.77  ? 474  ILE A CD1   1 
ATOM   6264  N N     . ALA C 2 76  ? -89.915  -50.857 48.389 1.00 63.62  ? 475  ALA A N     1 
ATOM   6265  C CA    . ALA C 2 76  ? -89.519  -50.997 49.784 1.00 65.57  ? 475  ALA A CA    1 
ATOM   6266  C C     . ALA C 2 76  ? -89.434  -52.464 50.222 1.00 66.75  ? 475  ALA A C     1 
ATOM   6267  O O     . ALA C 2 76  ? -88.540  -52.859 50.983 1.00 67.31  ? 475  ALA A O     1 
ATOM   6268  C CB    . ALA C 2 76  ? -90.521  -50.218 50.684 1.00 51.00  ? 475  ALA A CB    1 
ATOM   6269  N N     . GLN C 2 77  ? -90.375  -53.264 49.737 1.00 97.61  ? 476  GLN A N     1 
ATOM   6270  C CA    . GLN C 2 77  ? -90.420  -54.669 50.088 1.00 99.66  ? 476  GLN A CA    1 
ATOM   6271  C C     . GLN C 2 77  ? -89.077  -55.357 49.838 1.00 100.57 ? 476  GLN A C     1 
ATOM   6272  O O     . GLN C 2 77  ? -88.502  -55.950 50.750 1.00 100.32 ? 476  GLN A O     1 
ATOM   6273  C CB    . GLN C 2 77  ? -91.519  -55.369 49.291 1.00 112.81 ? 476  GLN A CB    1 
ATOM   6274  C CG    . GLN C 2 77  ? -91.919  -56.718 49.859 1.00 114.33 ? 476  GLN A CG    1 
ATOM   6275  C CD    . GLN C 2 77  ? -92.693  -56.587 51.151 1.00 116.55 ? 476  GLN A CD    1 
ATOM   6276  O OE1   . GLN C 2 77  ? -92.297  -55.855 52.059 1.00 117.26 ? 476  GLN A OE1   1 
ATOM   6277  N NE2   . GLN C 2 77  ? -93.804  -57.302 51.242 1.00 117.09 ? 476  GLN A NE2   1 
ATOM   6278  N N     . ASP C 2 78  ? -88.575  -55.265 48.608 1.00 79.41  ? 477  ASP A N     1 
ATOM   6279  C CA    . ASP C 2 78  ? -87.314  -55.898 48.246 1.00 81.82  ? 477  ASP A CA    1 
ATOM   6280  C C     . ASP C 2 78  ? -86.150  -55.635 49.198 1.00 81.19  ? 477  ASP A C     1 
ATOM   6281  O O     . ASP C 2 78  ? -85.103  -56.277 49.101 1.00 79.64  ? 477  ASP A O     1 
ATOM   6282  C CB    . ASP C 2 78  ? -86.922  -55.513 46.819 1.00 129.52 ? 477  ASP A CB    1 
ATOM   6283  C CG    . ASP C 2 78  ? -87.621  -56.365 45.775 1.00 135.17 ? 477  ASP A CG    1 
ATOM   6284  O OD1   . ASP C 2 78  ? -88.852  -56.229 45.614 1.00 139.56 ? 477  ASP A OD1   1 
ATOM   6285  O OD2   . ASP C 2 78  ? -86.939  -57.185 45.123 1.00 137.94 ? 477  ASP A OD2   1 
ATOM   6286  N N     . PHE C 2 79  ? -86.318  -54.701 50.123 1.00 69.07  ? 478  PHE A N     1 
ATOM   6287  C CA    . PHE C 2 79  ? -85.250  -54.426 51.067 1.00 70.00  ? 478  PHE A CA    1 
ATOM   6288  C C     . PHE C 2 79  ? -85.614  -54.907 52.467 1.00 71.31  ? 478  PHE A C     1 
ATOM   6289  O O     . PHE C 2 79  ? -84.781  -55.485 53.164 1.00 71.02  ? 478  PHE A O     1 
ATOM   6290  C CB    . PHE C 2 79  ? -84.938  -52.929 51.124 1.00 76.57  ? 478  PHE A CB    1 
ATOM   6291  C CG    . PHE C 2 79  ? -84.514  -52.336 49.811 1.00 75.46  ? 478  PHE A CG    1 
ATOM   6292  C CD1   . PHE C 2 79  ? -85.381  -51.513 49.095 1.00 75.10  ? 478  PHE A CD1   1 
ATOM   6293  C CD2   . PHE C 2 79  ? -83.240  -52.576 49.305 1.00 75.31  ? 478  PHE A CD2   1 
ATOM   6294  C CE1   . PHE C 2 79  ? -84.982  -50.938 47.898 1.00 75.00  ? 478  PHE A CE1   1 
ATOM   6295  C CE2   . PHE C 2 79  ? -82.831  -52.005 48.108 1.00 74.64  ? 478  PHE A CE2   1 
ATOM   6296  C CZ    . PHE C 2 79  ? -83.702  -51.185 47.401 1.00 74.32  ? 478  PHE A CZ    1 
ATOM   6297  N N     . LYS C 2 80  ? -86.856  -54.653 52.880 1.00 96.08  ? 479  LYS A N     1 
ATOM   6298  C CA    . LYS C 2 80  ? -87.328  -55.046 54.208 1.00 99.51  ? 479  LYS A CA    1 
ATOM   6299  C C     . LYS C 2 80  ? -88.805  -55.441 54.118 1.00 101.74 ? 479  LYS A C     1 
ATOM   6300  O O     . LYS C 2 80  ? -89.640  -54.646 53.676 1.00 103.04 ? 479  LYS A O     1 
ATOM   6301  C CB    . LYS C 2 80  ? -87.151  -53.873 55.181 1.00 89.79  ? 479  LYS A CB    1 
ATOM   6302  C CG    . LYS C 2 80  ? -86.729  -54.250 56.601 1.00 92.00  ? 479  LYS A CG    1 
ATOM   6303  C CD    . LYS C 2 80  ? -87.853  -54.891 57.409 1.00 93.57  ? 479  LYS A CD    1 
ATOM   6304  C CE    . LYS C 2 80  ? -87.381  -55.289 58.809 1.00 95.15  ? 479  LYS A CE    1 
ATOM   6305  N NZ    . LYS C 2 80  ? -86.984  -54.138 59.675 1.00 95.31  ? 479  LYS A NZ    1 
ATOM   6306  N N     . THR C 2 81  ? -89.115  -56.671 54.536 1.00 94.81  ? 480  THR A N     1 
ATOM   6307  C CA    . THR C 2 81  ? -90.485  -57.199 54.501 1.00 94.98  ? 480  THR A CA    1 
ATOM   6308  C C     . THR C 2 81  ? -91.337  -56.737 55.670 1.00 95.24  ? 480  THR A C     1 
ATOM   6309  O O     . THR C 2 81  ? -90.817  -56.409 56.741 1.00 93.64  ? 480  THR A O     1 
ATOM   6310  C CB    . THR C 2 81  ? -90.514  -58.748 54.495 1.00 133.82 ? 480  THR A CB    1 
ATOM   6311  O OG1   . THR C 2 81  ? -89.682  -59.250 55.550 1.00 134.82 ? 480  THR A OG1   1 
ATOM   6312  C CG2   . THR C 2 81  ? -90.046  -59.290 53.153 1.00 132.57 ? 480  THR A CG2   1 
ATOM   6313  N N     . ASP C 2 82  ? -92.652  -56.737 55.447 1.00 113.64 ? 481  ASP A N     1 
ATOM   6314  C CA    . ASP C 2 82  ? -93.633  -56.318 56.443 1.00 113.71 ? 481  ASP A CA    1 
ATOM   6315  C C     . ASP C 2 82  ? -93.244  -54.956 56.991 1.00 111.72 ? 481  ASP A C     1 
ATOM   6316  O O     . ASP C 2 82  ? -92.919  -54.812 58.170 1.00 112.97 ? 481  ASP A O     1 
ATOM   6317  C CB    . ASP C 2 82  ? -93.722  -57.341 57.587 1.00 174.22 ? 481  ASP A CB    1 
ATOM   6318  C CG    . ASP C 2 82  ? -94.832  -57.016 58.585 1.00 176.90 ? 481  ASP A CG    1 
ATOM   6319  O OD1   . ASP C 2 82  ? -96.002  -56.903 58.164 1.00 178.14 ? 481  ASP A OD1   1 
ATOM   6320  O OD2   . ASP C 2 82  ? -94.537  -56.880 59.792 1.00 177.20 ? 481  ASP A OD2   1 
ATOM   6321  N N     . LEU C 2 83  ? -93.264  -53.955 56.121 1.00 84.83  ? 482  LEU A N     1 
ATOM   6322  C CA    . LEU C 2 83  ? -92.913  -52.606 56.530 1.00 80.13  ? 482  LEU A CA    1 
ATOM   6323  C C     . LEU C 2 83  ? -94.147  -51.747 56.685 1.00 78.42  ? 482  LEU A C     1 
ATOM   6324  O O     . LEU C 2 83  ? -95.216  -52.082 56.178 1.00 78.73  ? 482  LEU A O     1 
ATOM   6325  C CB    . LEU C 2 83  ? -91.981  -51.959 55.507 1.00 94.36  ? 482  LEU A CB    1 
ATOM   6326  C CG    . LEU C 2 83  ? -90.481  -52.129 55.731 1.00 93.10  ? 482  LEU A CG    1 
ATOM   6327  C CD1   . LEU C 2 83  ? -89.720  -51.402 54.633 1.00 92.83  ? 482  LEU A CD1   1 
ATOM   6328  C CD2   . LEU C 2 83  ? -90.112  -51.583 57.107 1.00 92.07  ? 482  LEU A CD2   1 
ATOM   6329  N N     . ARG C 2 84  ? -93.991  -50.631 57.382 1.00 85.25  ? 483  ARG A N     1 
ATOM   6330  C CA    . ARG C 2 84  ? -95.096  -49.717 57.589 1.00 83.47  ? 483  ARG A CA    1 
ATOM   6331  C C     . ARG C 2 84  ? -94.697  -48.277 57.295 1.00 80.22  ? 483  ARG A C     1 
ATOM   6332  O O     . ARG C 2 84  ? -93.861  -47.700 57.980 1.00 79.36  ? 483  ARG A O     1 
ATOM   6333  C CB    . ARG C 2 84  ? -95.605  -49.820 59.024 1.00 133.94 ? 483  ARG A CB    1 
ATOM   6334  C CG    . ARG C 2 84  ? -96.791  -50.741 59.212 1.00 135.71 ? 483  ARG A CG    1 
ATOM   6335  C CD    . ARG C 2 84  ? -97.285  -50.647 60.641 1.00 138.21 ? 483  ARG A CD    1 
ATOM   6336  N NE    . ARG C 2 84  ? -98.619  -51.211 60.814 1.00 139.58 ? 483  ARG A NE    1 
ATOM   6337  C CZ    . ARG C 2 84  ? -99.285  -51.203 61.966 1.00 141.18 ? 483  ARG A CZ    1 
ATOM   6338  N NH1   . ARG C 2 84  ? -98.738  -50.659 63.045 1.00 140.40 ? 483  ARG A NH1   1 
ATOM   6339  N NH2   . ARG C 2 84  ? -100.499 -51.734 62.040 1.00 142.74 ? 483  ARG A NH2   1 
ATOM   6340  N N     . PHE C 2 85  ? -95.287  -47.691 56.265 1.00 81.35  ? 484  PHE A N     1 
ATOM   6341  C CA    . PHE C 2 85  ? -94.967  -46.307 55.951 1.00 77.94  ? 484  PHE A CA    1 
ATOM   6342  C C     . PHE C 2 85  ? -95.911  -45.342 56.655 1.00 75.79  ? 484  PHE A C     1 
ATOM   6343  O O     . PHE C 2 85  ? -97.113  -45.626 56.791 1.00 74.98  ? 484  PHE A O     1 
ATOM   6344  C CB    . PHE C 2 85  ? -95.030  -46.059 54.440 1.00 87.89  ? 484  PHE A CB    1 
ATOM   6345  C CG    . PHE C 2 85  ? -93.805  -46.510 53.707 1.00 87.98  ? 484  PHE A CG    1 
ATOM   6346  C CD1   . PHE C 2 85  ? -93.577  -47.859 53.461 1.00 87.32  ? 484  PHE A CD1   1 
ATOM   6347  C CD2   . PHE C 2 85  ? -92.858  -45.583 53.283 1.00 89.91  ? 484  PHE A CD2   1 
ATOM   6348  C CE1   . PHE C 2 85  ? -92.418  -48.283 52.803 1.00 88.93  ? 484  PHE A CE1   1 
ATOM   6349  C CE2   . PHE C 2 85  ? -91.696  -45.994 52.626 1.00 87.68  ? 484  PHE A CE2   1 
ATOM   6350  C CZ    . PHE C 2 85  ? -91.477  -47.348 52.385 1.00 88.73  ? 484  PHE A CZ    1 
ATOM   6351  N N     . GLN C 2 86  ? -95.368  -44.210 57.105 1.00 82.80  ? 485  GLN A N     1 
ATOM   6352  C CA    . GLN C 2 86  ? -96.193  -43.210 57.751 1.00 83.63  ? 485  GLN A CA    1 
ATOM   6353  C C     . GLN C 2 86  ? -96.873  -42.516 56.600 1.00 84.68  ? 485  GLN A C     1 
ATOM   6354  O O     . GLN C 2 86  ? -96.487  -42.686 55.441 1.00 85.39  ? 485  GLN A O     1 
ATOM   6355  C CB    . GLN C 2 86  ? -95.371  -42.152 58.486 1.00 59.96  ? 485  GLN A CB    1 
ATOM   6356  C CG    . GLN C 2 86  ? -94.413  -42.638 59.530 1.00 63.01  ? 485  GLN A CG    1 
ATOM   6357  C CD    . GLN C 2 86  ? -93.934  -41.517 60.409 1.00 66.42  ? 485  GLN A CD    1 
ATOM   6358  O OE1   . GLN C 2 86  ? -93.548  -40.452 59.927 1.00 68.39  ? 485  GLN A OE1   1 
ATOM   6359  N NE2   . GLN C 2 86  ? -93.946  -41.751 61.715 1.00 66.71  ? 485  GLN A NE2   1 
ATOM   6360  N N     . SER C 2 87  ? -97.866  -41.705 56.921 1.00 103.91 ? 486  SER A N     1 
ATOM   6361  C CA    . SER C 2 87  ? -98.557  -40.974 55.887 1.00 104.51 ? 486  SER A CA    1 
ATOM   6362  C C     . SER C 2 87  ? -97.546  -40.012 55.263 1.00 103.66 ? 486  SER A C     1 
ATOM   6363  O O     . SER C 2 87  ? -97.378  -39.965 54.043 1.00 104.25 ? 486  SER A O     1 
ATOM   6364  C CB    . SER C 2 87  ? -99.721  -40.197 56.498 1.00 121.34 ? 486  SER A CB    1 
ATOM   6365  O OG    . SER C 2 87  ? -100.447 -39.505 55.502 1.00 123.65 ? 486  SER A OG    1 
ATOM   6366  N N     . SER C 2 88  ? -96.863  -39.271 56.131 1.00 82.70  ? 487  SER A N     1 
ATOM   6367  C CA    . SER C 2 88  ? -95.877  -38.273 55.737 1.00 79.33  ? 487  SER A CA    1 
ATOM   6368  C C     . SER C 2 88  ? -94.675  -38.806 54.968 1.00 79.40  ? 487  SER A C     1 
ATOM   6369  O O     . SER C 2 88  ? -94.226  -38.192 54.001 1.00 81.07  ? 487  SER A O     1 
ATOM   6370  C CB    . SER C 2 88  ? -95.402  -37.533 56.986 1.00 91.42  ? 487  SER A CB    1 
ATOM   6371  O OG    . SER C 2 88  ? -95.165  -38.449 58.046 1.00 91.53  ? 487  SER A OG    1 
ATOM   6372  N N     . ALA C 2 89  ? -94.147  -39.942 55.399 1.00 67.55  ? 488  ALA A N     1 
ATOM   6373  C CA    . ALA C 2 89  ? -92.981  -40.520 54.745 1.00 64.99  ? 488  ALA A CA    1 
ATOM   6374  C C     . ALA C 2 89  ? -93.246  -40.875 53.289 1.00 63.45  ? 488  ALA A C     1 
ATOM   6375  O O     . ALA C 2 89  ? -92.319  -41.096 52.520 1.00 63.02  ? 488  ALA A O     1 
ATOM   6376  C CB    . ALA C 2 89  ? -92.514  -41.747 55.501 1.00 54.18  ? 488  ALA A CB    1 
ATOM   6377  N N     . VAL C 2 90  ? -94.516  -40.937 52.911 1.00 60.36  ? 489  VAL A N     1 
ATOM   6378  C CA    . VAL C 2 90  ? -94.875  -41.270 51.537 1.00 59.59  ? 489  VAL A CA    1 
ATOM   6379  C C     . VAL C 2 90  ? -95.027  -39.951 50.822 1.00 58.55  ? 489  VAL A C     1 
ATOM   6380  O O     . VAL C 2 90  ? -94.621  -39.809 49.671 1.00 58.65  ? 489  VAL A O     1 
ATOM   6381  C CB    . VAL C 2 90  ? -96.204  -42.076 51.458 1.00 91.26  ? 489  VAL A CB    1 
ATOM   6382  C CG1   . VAL C 2 90  ? -96.480  -42.505 50.023 1.00 90.09  ? 489  VAL A CG1   1 
ATOM   6383  C CG2   . VAL C 2 90  ? -96.120  -43.306 52.355 1.00 89.26  ? 489  VAL A CG2   1 
ATOM   6384  N N     . MET C 2 91  ? -95.603  -38.978 51.514 1.00 73.77  ? 490  MET A N     1 
ATOM   6385  C CA    . MET C 2 91  ? -95.756  -37.665 50.918 1.00 74.57  ? 490  MET A CA    1 
ATOM   6386  C C     . MET C 2 91  ? -94.363  -37.166 50.596 1.00 72.42  ? 490  MET A C     1 
ATOM   6387  O O     . MET C 2 91  ? -94.072  -36.840 49.446 1.00 71.57  ? 490  MET A O     1 
ATOM   6388  C CB    . MET C 2 91  ? -96.473  -36.694 51.865 1.00 102.58 ? 490  MET A CB    1 
ATOM   6389  C CG    . MET C 2 91  ? -97.973  -36.902 51.898 1.00 108.37 ? 490  MET A CG    1 
ATOM   6390  S SD    . MET C 2 91  ? -98.558  -37.423 50.258 1.00 116.59 ? 490  MET A SD    1 
ATOM   6391  C CE    . MET C 2 91  ? -98.396  -35.900 49.339 1.00 116.44 ? 490  MET A CE    1 
ATOM   6392  N N     . ALA C 2 92  ? -93.500  -37.136 51.607 1.00 71.46  ? 491  ALA A N     1 
ATOM   6393  C CA    . ALA C 2 92  ? -92.125  -36.697 51.421 1.00 69.01  ? 491  ALA A CA    1 
ATOM   6394  C C     . ALA C 2 92  ? -91.464  -37.467 50.262 1.00 69.18  ? 491  ALA A C     1 
ATOM   6395  O O     . ALA C 2 92  ? -90.812  -36.873 49.394 1.00 71.04  ? 491  ALA A O     1 
ATOM   6396  C CB    . ALA C 2 92  ? -91.336  -36.900 52.710 1.00 59.99  ? 491  ALA A CB    1 
ATOM   6397  N N     . LEU C 2 93  ? -91.633  -38.783 50.238 1.00 63.09  ? 492  LEU A N     1 
ATOM   6398  C CA    . LEU C 2 93  ? -91.047  -39.571 49.168 1.00 63.34  ? 492  LEU A CA    1 
ATOM   6399  C C     . LEU C 2 93  ? -91.514  -39.062 47.790 1.00 65.22  ? 492  LEU A C     1 
ATOM   6400  O O     . LEU C 2 93  ? -90.699  -38.840 46.890 1.00 65.94  ? 492  LEU A O     1 
ATOM   6401  C CB    . LEU C 2 93  ? -91.417  -41.047 49.345 1.00 61.38  ? 492  LEU A CB    1 
ATOM   6402  C CG    . LEU C 2 93  ? -90.258  -42.048 49.325 1.00 61.56  ? 492  LEU A CG    1 
ATOM   6403  C CD1   . LEU C 2 93  ? -89.233  -41.624 50.328 1.00 62.54  ? 492  LEU A CD1   1 
ATOM   6404  C CD2   . LEU C 2 93  ? -90.732  -43.456 49.668 1.00 60.73  ? 492  LEU A CD2   1 
ATOM   6405  N N     . GLN C 2 94  ? -92.820  -38.860 47.624 1.00 80.27  ? 493  GLN A N     1 
ATOM   6406  C CA    . GLN C 2 94  ? -93.354  -38.404 46.339 1.00 81.19  ? 493  GLN A CA    1 
ATOM   6407  C C     . GLN C 2 94  ? -92.919  -36.985 45.979 1.00 80.28  ? 493  GLN A C     1 
ATOM   6408  O O     . GLN C 2 94  ? -92.537  -36.712 44.840 1.00 79.68  ? 493  GLN A O     1 
ATOM   6409  C CB    . GLN C 2 94  ? -94.881  -38.502 46.347 1.00 64.05  ? 493  GLN A CB    1 
ATOM   6410  C CG    . GLN C 2 94  ? -95.535  -38.156 45.010 1.00 67.26  ? 493  GLN A CG    1 
ATOM   6411  C CD    . GLN C 2 94  ? -97.039  -38.345 45.020 1.00 68.77  ? 493  GLN A CD    1 
ATOM   6412  O OE1   . GLN C 2 94  ? -97.701  -38.073 46.019 1.00 71.07  ? 493  GLN A OE1   1 
ATOM   6413  N NE2   . GLN C 2 94  ? -97.586  -38.796 43.901 1.00 68.44  ? 493  GLN A NE2   1 
ATOM   6414  N N     . GLU C 2 95  ? -92.989  -36.087 46.955 1.00 70.73  ? 494  GLU A N     1 
ATOM   6415  C CA    . GLU C 2 95  ? -92.594  -34.700 46.765 1.00 68.70  ? 494  GLU A CA    1 
ATOM   6416  C C     . GLU C 2 95  ? -91.171  -34.659 46.217 1.00 64.66  ? 494  GLU A C     1 
ATOM   6417  O O     . GLU C 2 95  ? -90.861  -33.930 45.267 1.00 62.94  ? 494  GLU A O     1 
ATOM   6418  C CB    . GLU C 2 95  ? -92.662  -33.954 48.105 1.00 62.35  ? 494  GLU A CB    1 
ATOM   6419  C CG    . GLU C 2 95  ? -94.069  -33.518 48.501 1.00 68.81  ? 494  GLU A CG    1 
ATOM   6420  C CD    . GLU C 2 95  ? -94.484  -32.192 47.858 1.00 71.83  ? 494  GLU A CD    1 
ATOM   6421  O OE1   . GLU C 2 95  ? -95.704  -31.937 47.717 1.00 73.66  ? 494  GLU A OE1   1 
ATOM   6422  O OE2   . GLU C 2 95  ? -93.585  -31.396 47.507 1.00 70.53  ? 494  GLU A OE2   1 
ATOM   6423  N N     . ALA C 2 96  ? -90.304  -35.455 46.825 1.00 49.28  ? 495  ALA A N     1 
ATOM   6424  C CA    . ALA C 2 96  ? -88.929  -35.492 46.395 1.00 48.94  ? 495  ALA A CA    1 
ATOM   6425  C C     . ALA C 2 96  ? -88.880  -35.960 44.952 1.00 51.65  ? 495  ALA A C     1 
ATOM   6426  O O     . ALA C 2 96  ? -88.328  -35.268 44.096 1.00 50.68  ? 495  ALA A O     1 
ATOM   6427  C CB    . ALA C 2 96  ? -88.122  -36.413 47.301 1.00 30.08  ? 495  ALA A CB    1 
ATOM   6428  N N     . SER C 2 97  ? -89.477  -37.118 44.681 1.00 56.69  ? 496  SER A N     1 
ATOM   6429  C CA    . SER C 2 97  ? -89.507  -37.680 43.331 1.00 60.97  ? 496  SER A CA    1 
ATOM   6430  C C     . SER C 2 97  ? -90.010  -36.739 42.239 1.00 60.20  ? 496  SER A C     1 
ATOM   6431  O O     . SER C 2 97  ? -89.357  -36.561 41.205 1.00 60.28  ? 496  SER A O     1 
ATOM   6432  C CB    . SER C 2 97  ? -90.354  -38.935 43.318 1.00 107.86 ? 496  SER A CB    1 
ATOM   6433  O OG    . SER C 2 97  ? -89.732  -39.911 44.107 1.00 54.20  ? 496  SER A OG    1 
ATOM   6434  N N     . GLU C 2 98  ? -91.172  -36.138 42.449 1.00 53.22  ? 497  GLU A N     1 
ATOM   6435  C CA    . GLU C 2 98  ? -91.703  -35.243 41.436 1.00 53.54  ? 497  GLU A CA    1 
ATOM   6436  C C     . GLU C 2 98  ? -90.784  -34.050 41.206 1.00 50.69  ? 497  GLU A C     1 
ATOM   6437  O O     . GLU C 2 98  ? -90.497  -33.671 40.057 1.00 49.87  ? 497  GLU A O     1 
ATOM   6438  C CB    . GLU C 2 98  ? -93.124  -34.809 41.808 1.00 70.69  ? 497  GLU A CB    1 
ATOM   6439  C CG    . GLU C 2 98  ? -94.144  -35.899 41.463 1.00 78.62  ? 497  GLU A CG    1 
ATOM   6440  C CD    . GLU C 2 98  ? -95.575  -35.492 41.709 1.00 83.81  ? 497  GLU A CD    1 
ATOM   6441  O OE1   . GLU C 2 98  ? -95.928  -34.346 41.369 1.00 85.58  ? 497  GLU A OE1   1 
ATOM   6442  O OE2   . GLU C 2 98  ? -96.347  -36.328 42.227 1.00 86.07  ? 497  GLU A OE2   1 
ATOM   6443  N N     . ALA C 2 99  ? -90.294  -33.477 42.297 1.00 60.29  ? 498  ALA A N     1 
ATOM   6444  C CA    . ALA C 2 99  ? -89.387  -32.348 42.201 1.00 57.92  ? 498  ALA A CA    1 
ATOM   6445  C C     . ALA C 2 99  ? -88.134  -32.791 41.448 1.00 58.01  ? 498  ALA A C     1 
ATOM   6446  O O     . ALA C 2 99  ? -87.546  -32.035 40.674 1.00 57.79  ? 498  ALA A O     1 
ATOM   6447  C CB    . ALA C 2 99  ? -89.027  -31.893 43.564 1.00 28.02  ? 498  ALA A CB    1 
ATOM   6448  N N     . TYR C 2 100 ? -87.733  -34.030 41.686 1.00 48.06  ? 499  TYR A N     1 
ATOM   6449  C CA    . TYR C 2 100 ? -86.568  -34.575 41.028 1.00 47.68  ? 499  TYR A CA    1 
ATOM   6450  C C     . TYR C 2 100 ? -86.808  -34.622 39.538 1.00 48.97  ? 499  TYR A C     1 
ATOM   6451  O O     . TYR C 2 100 ? -86.027  -34.070 38.760 1.00 52.36  ? 499  TYR A O     1 
ATOM   6452  C CB    . TYR C 2 100 ? -86.263  -35.990 41.537 1.00 51.75  ? 499  TYR A CB    1 
ATOM   6453  C CG    . TYR C 2 100 ? -85.269  -36.730 40.672 1.00 53.15  ? 499  TYR A CG    1 
ATOM   6454  C CD1   . TYR C 2 100 ? -83.910  -36.445 40.732 1.00 54.45  ? 499  TYR A CD1   1 
ATOM   6455  C CD2   . TYR C 2 100 ? -85.701  -37.695 39.758 1.00 53.91  ? 499  TYR A CD2   1 
ATOM   6456  C CE1   . TYR C 2 100 ? -83.004  -37.112 39.904 1.00 54.15  ? 499  TYR A CE1   1 
ATOM   6457  C CE2   . TYR C 2 100 ? -84.808  -38.362 38.927 1.00 55.01  ? 499  TYR A CE2   1 
ATOM   6458  C CZ    . TYR C 2 100 ? -83.463  -38.069 39.002 1.00 54.50  ? 499  TYR A CZ    1 
ATOM   6459  O OH    . TYR C 2 100 ? -82.581  -38.744 38.186 1.00 53.91  ? 499  TYR A OH    1 
ATOM   6460  N N     . LEU C 2 101 ? -87.881  -35.295 39.133 1.00 51.51  ? 500  LEU A N     1 
ATOM   6461  C CA    . LEU C 2 101 ? -88.192  -35.404 37.714 1.00 50.63  ? 500  LEU A CA    1 
ATOM   6462  C C     . LEU C 2 101 ? -88.423  -34.023 37.085 1.00 50.13  ? 500  LEU A C     1 
ATOM   6463  O O     . LEU C 2 101 ? -87.895  -33.740 36.010 1.00 48.49  ? 500  LEU A O     1 
ATOM   6464  C CB    . LEU C 2 101 ? -89.408  -36.311 37.503 1.00 59.72  ? 500  LEU A CB    1 
ATOM   6465  C CG    . LEU C 2 101 ? -89.181  -37.783 37.868 1.00 58.71  ? 500  LEU A CG    1 
ATOM   6466  C CD1   . LEU C 2 101 ? -90.489  -38.531 37.803 1.00 57.20  ? 500  LEU A CD1   1 
ATOM   6467  C CD2   . LEU C 2 101 ? -88.173  -38.417 36.919 1.00 57.08  ? 500  LEU A CD2   1 
ATOM   6468  N N     . VAL C 2 102 ? -89.188  -33.156 37.746 1.00 49.54  ? 501  VAL A N     1 
ATOM   6469  C CA    . VAL C 2 102 ? -89.423  -31.832 37.173 1.00 50.19  ? 501  VAL A CA    1 
ATOM   6470  C C     . VAL C 2 102 ? -88.108  -31.111 36.870 1.00 50.32  ? 501  VAL A C     1 
ATOM   6471  O O     . VAL C 2 102 ? -88.007  -30.408 35.854 1.00 49.17  ? 501  VAL A O     1 
ATOM   6472  C CB    . VAL C 2 102 ? -90.289  -30.948 38.090 1.00 54.07  ? 501  VAL A CB    1 
ATOM   6473  C CG1   . VAL C 2 102 ? -90.292  -29.518 37.578 1.00 53.27  ? 501  VAL A CG1   1 
ATOM   6474  C CG2   . VAL C 2 102 ? -91.716  -31.476 38.109 1.00 55.03  ? 501  VAL A CG2   1 
ATOM   6475  N N     . GLY C 2 103 ? -87.117  -31.290 37.755 1.00 56.49  ? 502  GLY A N     1 
ATOM   6476  C CA    . GLY C 2 103 ? -85.800  -30.698 37.567 1.00 57.33  ? 502  GLY A CA    1 
ATOM   6477  C C     . GLY C 2 103 ? -85.104  -31.383 36.393 1.00 55.67  ? 502  GLY A C     1 
ATOM   6478  O O     . GLY C 2 103 ? -84.604  -30.726 35.478 1.00 53.44  ? 502  GLY A O     1 
ATOM   6479  N N     . LEU C 2 104 ? -85.089  -32.714 36.406 1.00 63.39  ? 503  LEU A N     1 
ATOM   6480  C CA    . LEU C 2 104 ? -84.461  -33.482 35.329 1.00 62.43  ? 503  LEU A CA    1 
ATOM   6481  C C     . LEU C 2 104 ? -85.043  -33.129 33.966 1.00 62.70  ? 503  LEU A C     1 
ATOM   6482  O O     . LEU C 2 104 ? -84.334  -33.134 32.965 1.00 61.91  ? 503  LEU A O     1 
ATOM   6483  C CB    . LEU C 2 104 ? -84.618  -34.988 35.579 1.00 41.79  ? 503  LEU A CB    1 
ATOM   6484  C CG    . LEU C 2 104 ? -84.184  -35.969 34.475 1.00 41.59  ? 503  LEU A CG    1 
ATOM   6485  C CD1   . LEU C 2 104 ? -82.763  -35.656 34.067 1.00 41.83  ? 503  LEU A CD1   1 
ATOM   6486  C CD2   . LEU C 2 104 ? -84.297  -37.429 34.949 1.00 40.31  ? 503  LEU A CD2   1 
ATOM   6487  N N     . PHE C 2 105 ? -86.336  -32.828 33.915 1.00 58.68  ? 504  PHE A N     1 
ATOM   6488  C CA    . PHE C 2 105 ? -86.940  -32.482 32.646 1.00 60.56  ? 504  PHE A CA    1 
ATOM   6489  C C     . PHE C 2 105 ? -86.431  -31.113 32.218 1.00 61.76  ? 504  PHE A C     1 
ATOM   6490  O O     . PHE C 2 105 ? -86.277  -30.858 31.031 1.00 63.11  ? 504  PHE A O     1 
ATOM   6491  C CB    . PHE C 2 105 ? -88.482  -32.521 32.733 1.00 44.21  ? 504  PHE A CB    1 
ATOM   6492  C CG    . PHE C 2 105 ? -89.076  -33.896 32.457 1.00 43.41  ? 504  PHE A CG    1 
ATOM   6493  C CD1   . PHE C 2 105 ? -89.979  -34.480 33.352 1.00 43.56  ? 504  PHE A CD1   1 
ATOM   6494  C CD2   . PHE C 2 105 ? -88.674  -34.641 31.332 1.00 41.15  ? 504  PHE A CD2   1 
ATOM   6495  C CE1   . PHE C 2 105 ? -90.454  -35.796 33.139 1.00 41.82  ? 504  PHE A CE1   1 
ATOM   6496  C CE2   . PHE C 2 105 ? -89.148  -35.960 31.112 1.00 40.25  ? 504  PHE A CE2   1 
ATOM   6497  C CZ    . PHE C 2 105 ? -90.032  -36.535 32.013 1.00 39.70  ? 504  PHE A CZ    1 
ATOM   6498  N N     . GLU C 2 106 ? -86.135  -30.230 33.163 1.00 60.16  ? 505  GLU A N     1 
ATOM   6499  C CA    . GLU C 2 106 ? -85.636  -28.912 32.770 1.00 59.60  ? 505  GLU A CA    1 
ATOM   6500  C C     . GLU C 2 106 ? -84.284  -29.045 32.074 1.00 59.83  ? 505  GLU A C     1 
ATOM   6501  O O     . GLU C 2 106 ? -84.043  -28.441 31.016 1.00 59.63  ? 505  GLU A O     1 
ATOM   6502  C CB    . GLU C 2 106 ? -85.481  -27.996 33.981 1.00 57.07  ? 505  GLU A CB    1 
ATOM   6503  C CG    . GLU C 2 106 ? -86.746  -27.322 34.438 1.00 61.82  ? 505  GLU A CG    1 
ATOM   6504  C CD    . GLU C 2 106 ? -86.681  -26.926 35.903 1.00 67.29  ? 505  GLU A CD    1 
ATOM   6505  O OE1   . GLU C 2 106 ? -85.683  -26.299 36.320 1.00 69.33  ? 505  GLU A OE1   1 
ATOM   6506  O OE2   . GLU C 2 106 ? -87.630  -27.240 36.642 1.00 69.24  ? 505  GLU A OE2   1 
ATOM   6507  N N     . ASP C 2 107 ? -83.403  -29.845 32.664 1.00 61.47  ? 506  ASP A N     1 
ATOM   6508  C CA    . ASP C 2 107 ? -82.086  -30.022 32.098 1.00 63.14  ? 506  ASP A CA    1 
ATOM   6509  C C     . ASP C 2 107 ? -82.198  -30.744 30.762 1.00 64.08  ? 506  ASP A C     1 
ATOM   6510  O O     . ASP C 2 107 ? -81.477  -30.419 29.802 1.00 63.64  ? 506  ASP A O     1 
ATOM   6511  C CB    . ASP C 2 107 ? -81.187  -30.794 33.072 1.00 58.23  ? 506  ASP A CB    1 
ATOM   6512  C CG    . ASP C 2 107 ? -80.828  -29.983 34.327 1.00 60.88  ? 506  ASP A CG    1 
ATOM   6513  O OD1   . ASP C 2 107 ? -81.030  -28.742 34.349 1.00 63.32  ? 506  ASP A OD1   1 
ATOM   6514  O OD2   . ASP C 2 107 ? -80.322  -30.595 35.295 1.00 59.71  ? 506  ASP A OD2   1 
ATOM   6515  N N     . THR C 2 108 ? -83.117  -31.706 30.694 1.00 57.92  ? 507  THR A N     1 
ATOM   6516  C CA    . THR C 2 108 ? -83.330  -32.473 29.470 1.00 57.25  ? 507  THR A CA    1 
ATOM   6517  C C     . THR C 2 108 ? -83.824  -31.556 28.358 1.00 55.93  ? 507  THR A C     1 
ATOM   6518  O O     . THR C 2 108 ? -83.420  -31.695 27.204 1.00 54.28  ? 507  THR A O     1 
ATOM   6519  C CB    . THR C 2 108 ? -84.355  -33.611 29.683 1.00 55.72  ? 507  THR A CB    1 
ATOM   6520  O OG1   . THR C 2 108 ? -83.935  -34.430 30.780 1.00 57.46  ? 507  THR A OG1   1 
ATOM   6521  C CG2   . THR C 2 108 ? -84.451  -34.484 28.447 1.00 56.18  ? 507  THR A CG2   1 
ATOM   6522  N N     . ASN C 2 109 ? -84.685  -30.608 28.712 1.00 64.90  ? 508  ASN A N     1 
ATOM   6523  C CA    . ASN C 2 109 ? -85.214  -29.666 27.736 1.00 63.29  ? 508  ASN A CA    1 
ATOM   6524  C C     . ASN C 2 109 ? -84.040  -28.843 27.173 1.00 62.26  ? 508  ASN A C     1 
ATOM   6525  O O     . ASN C 2 109 ? -83.962  -28.586 25.963 1.00 61.20  ? 508  ASN A O     1 
ATOM   6526  C CB    . ASN C 2 109 ? -86.257  -28.761 28.402 1.00 69.93  ? 508  ASN A CB    1 
ATOM   6527  C CG    . ASN C 2 109 ? -87.263  -28.202 27.414 1.00 68.55  ? 508  ASN A CG    1 
ATOM   6528  O OD1   . ASN C 2 109 ? -87.860  -28.943 26.652 1.00 64.99  ? 508  ASN A OD1   1 
ATOM   6529  N ND2   . ASN C 2 109 ? -87.457  -26.893 27.431 1.00 70.86  ? 508  ASN A ND2   1 
ATOM   6530  N N     . LEU C 2 110 ? -83.120  -28.445 28.047 1.00 58.80  ? 509  LEU A N     1 
ATOM   6531  C CA    . LEU C 2 110 ? -81.953  -27.696 27.604 1.00 58.67  ? 509  LEU A CA    1 
ATOM   6532  C C     . LEU C 2 110 ? -81.135  -28.535 26.608 1.00 60.45  ? 509  LEU A C     1 
ATOM   6533  O O     . LEU C 2 110 ? -80.600  -28.020 25.624 1.00 61.83  ? 509  LEU A O     1 
ATOM   6534  C CB    . LEU C 2 110 ? -81.075  -27.326 28.798 1.00 47.86  ? 509  LEU A CB    1 
ATOM   6535  C CG    . LEU C 2 110 ? -81.545  -26.212 29.745 1.00 45.15  ? 509  LEU A CG    1 
ATOM   6536  C CD1   . LEU C 2 110 ? -80.764  -26.298 31.046 1.00 42.01  ? 509  LEU A CD1   1 
ATOM   6537  C CD2   . LEU C 2 110 ? -81.368  -24.855 29.118 1.00 43.80  ? 509  LEU A CD2   1 
ATOM   6538  N N     . CYS C 2 111 ? -81.036  -29.831 26.858 1.00 61.33  ? 510  CYS A N     1 
ATOM   6539  C CA    . CYS C 2 111 ? -80.268  -30.679 25.965 1.00 62.21  ? 510  CYS A CA    1 
ATOM   6540  C C     . CYS C 2 111 ? -80.920  -30.871 24.604 1.00 61.54  ? 510  CYS A C     1 
ATOM   6541  O O     . CYS C 2 111 ? -80.235  -31.101 23.601 1.00 62.72  ? 510  CYS A O     1 
ATOM   6542  C CB    . CYS C 2 111 ? -80.007  -32.024 26.633 1.00 59.80  ? 510  CYS A CB    1 
ATOM   6543  S SG    . CYS C 2 111 ? -78.857  -31.863 27.992 1.00 63.28  ? 510  CYS A SG    1 
ATOM   6544  N N     . ALA C 2 112 ? -82.244  -30.788 24.564 1.00 65.51  ? 511  ALA A N     1 
ATOM   6545  C CA    . ALA C 2 112 ? -82.947  -30.928 23.295 1.00 59.99  ? 511  ALA A CA    1 
ATOM   6546  C C     . ALA C 2 112 ? -82.725  -29.627 22.522 1.00 59.94  ? 511  ALA A C     1 
ATOM   6547  O O     . ALA C 2 112 ? -82.301  -29.624 21.367 1.00 56.52  ? 511  ALA A O     1 
ATOM   6548  C CB    . ALA C 2 112 ? -84.432  -31.150 23.544 1.00 30.37  ? 511  ALA A CB    1 
ATOM   6549  N N     . ILE C 2 113 ? -82.999  -28.518 23.196 1.00 44.70  ? 512  ILE A N     1 
ATOM   6550  C CA    . ILE C 2 113 ? -82.846  -27.224 22.592 1.00 46.83  ? 512  ILE A CA    1 
ATOM   6551  C C     . ILE C 2 113 ? -81.422  -27.093 22.107 1.00 50.26  ? 512  ILE A C     1 
ATOM   6552  O O     . ILE C 2 113 ? -81.175  -26.524 21.049 1.00 53.15  ? 512  ILE A O     1 
ATOM   6553  C CB    . ILE C 2 113 ? -83.202  -26.105 23.609 1.00 35.03  ? 512  ILE A CB    1 
ATOM   6554  C CG1   . ILE C 2 113 ? -84.634  -26.344 24.111 1.00 32.65  ? 512  ILE A CG1   1 
ATOM   6555  C CG2   . ILE C 2 113 ? -83.061  -24.728 22.981 1.00 32.50  ? 512  ILE A CG2   1 
ATOM   6556  C CD1   . ILE C 2 113 ? -85.264  -25.189 24.889 1.00 29.05  ? 512  ILE A CD1   1 
ATOM   6557  N N     . HIS C 2 114 ? -80.483  -27.651 22.856 1.00 49.27  ? 513  HIS A N     1 
ATOM   6558  C CA    . HIS C 2 114 ? -79.079  -27.546 22.471 1.00 49.81  ? 513  HIS A CA    1 
ATOM   6559  C C     . HIS C 2 114 ? -78.853  -28.168 21.117 1.00 50.68  ? 513  HIS A C     1 
ATOM   6560  O O     . HIS C 2 114 ? -78.000  -27.720 20.357 1.00 47.68  ? 513  HIS A O     1 
ATOM   6561  C CB    . HIS C 2 114 ? -78.173  -28.232 23.493 1.00 61.56  ? 513  HIS A CB    1 
ATOM   6562  C CG    . HIS C 2 114 ? -76.716  -28.002 23.250 1.00 62.08  ? 513  HIS A CG    1 
ATOM   6563  N ND1   . HIS C 2 114 ? -76.126  -26.768 23.403 1.00 63.67  ? 513  HIS A ND1   1 
ATOM   6564  C CD2   . HIS C 2 114 ? -75.736  -28.837 22.828 1.00 61.45  ? 513  HIS A CD2   1 
ATOM   6565  C CE1   . HIS C 2 114 ? -74.845  -26.850 23.081 1.00 63.82  ? 513  HIS A CE1   1 
ATOM   6566  N NE2   . HIS C 2 114 ? -74.582  -28.095 22.728 1.00 62.84  ? 513  HIS A NE2   1 
ATOM   6567  N N     . ALA C 2 115 ? -79.634  -29.197 20.821 1.00 64.87  ? 514  ALA A N     1 
ATOM   6568  C CA    . ALA C 2 115 ? -79.513  -29.908 19.565 1.00 67.43  ? 514  ALA A CA    1 
ATOM   6569  C C     . ALA C 2 115 ? -80.457  -29.390 18.479 1.00 70.13  ? 514  ALA A C     1 
ATOM   6570  O O     . ALA C 2 115 ? -80.834  -30.125 17.564 1.00 69.07  ? 514  ALA A O     1 
ATOM   6571  C CB    . ALA C 2 115 ? -79.748  -31.382 19.801 1.00 62.06  ? 514  ALA A CB    1 
ATOM   6572  N N     . LYS C 2 116 ? -80.848  -28.127 18.579 1.00 72.01  ? 515  LYS A N     1 
ATOM   6573  C CA    . LYS C 2 116 ? -81.729  -27.541 17.581 1.00 70.95  ? 515  LYS A CA    1 
ATOM   6574  C C     . LYS C 2 116 ? -83.119  -28.173 17.529 1.00 70.80  ? 515  LYS A C     1 
ATOM   6575  O O     . LYS C 2 116 ? -83.893  -27.881 16.622 1.00 72.05  ? 515  LYS A O     1 
ATOM   6576  C CB    . LYS C 2 116 ? -81.084  -27.647 16.204 1.00 70.85  ? 515  LYS A CB    1 
ATOM   6577  C CG    . LYS C 2 116 ? -79.723  -26.990 16.087 1.00 70.70  ? 515  LYS A CG    1 
ATOM   6578  C CD    . LYS C 2 116 ? -79.783  -25.476 16.212 1.00 75.77  ? 515  LYS A CD    1 
ATOM   6579  C CE    . LYS C 2 116 ? -78.473  -24.841 15.724 1.00 78.68  ? 515  LYS A CE    1 
ATOM   6580  N NZ    . LYS C 2 116 ? -78.384  -23.363 15.975 1.00 80.49  ? 515  LYS A NZ    1 
ATOM   6581  N N     . ARG C 2 117 ? -83.434  -29.038 18.490 1.00 64.20  ? 516  ARG A N     1 
ATOM   6582  C CA    . ARG C 2 117 ? -84.745  -29.693 18.556 1.00 62.88  ? 516  ARG A CA    1 
ATOM   6583  C C     . ARG C 2 117 ? -85.652  -29.012 19.599 1.00 62.53  ? 516  ARG A C     1 
ATOM   6584  O O     . ARG C 2 117 ? -85.278  -28.000 20.192 1.00 62.92  ? 516  ARG A O     1 
ATOM   6585  C CB    . ARG C 2 117 ? -84.577  -31.175 18.921 1.00 56.05  ? 516  ARG A CB    1 
ATOM   6586  C CG    . ARG C 2 117 ? -83.718  -31.987 17.954 1.00 56.80  ? 516  ARG A CG    1 
ATOM   6587  C CD    . ARG C 2 117 ? -83.853  -33.511 18.189 1.00 60.81  ? 516  ARG A CD    1 
ATOM   6588  N NE    . ARG C 2 117 ? -82.777  -34.078 19.002 1.00 63.39  ? 516  ARG A NE    1 
ATOM   6589  C CZ    . ARG C 2 117 ? -82.690  -33.990 20.331 1.00 65.25  ? 516  ARG A CZ    1 
ATOM   6590  N NH1   . ARG C 2 117 ? -83.623  -33.360 21.028 1.00 68.05  ? 516  ARG A NH1   1 
ATOM   6591  N NH2   . ARG C 2 117 ? -81.653  -34.523 20.968 1.00 64.27  ? 516  ARG A NH2   1 
ATOM   6592  N N     . VAL C 2 118 ? -86.848  -29.558 19.799 1.00 53.40  ? 517  VAL A N     1 
ATOM   6593  C CA    . VAL C 2 118 ? -87.795  -29.038 20.789 1.00 52.33  ? 517  VAL A CA    1 
ATOM   6594  C C     . VAL C 2 118 ? -88.629  -30.217 21.259 1.00 56.19  ? 517  VAL A C     1 
ATOM   6595  O O     . VAL C 2 118 ? -89.649  -30.042 21.907 1.00 56.46  ? 517  VAL A O     1 
ATOM   6596  C CB    . VAL C 2 118 ? -88.799  -28.027 20.214 1.00 44.04  ? 517  VAL A CB    1 
ATOM   6597  C CG1   . VAL C 2 118 ? -88.092  -26.864 19.514 1.00 38.07  ? 517  VAL A CG1   1 
ATOM   6598  C CG2   . VAL C 2 118 ? -89.725  -28.762 19.276 1.00 42.42  ? 517  VAL A CG2   1 
ATOM   6599  N N     . THR C 2 119 ? -88.202  -31.414 20.890 1.00 54.10  ? 518  THR A N     1 
ATOM   6600  C CA    . THR C 2 119 ? -88.879  -32.646 21.262 1.00 59.22  ? 518  THR A CA    1 
ATOM   6601  C C     . THR C 2 119 ? -87.878  -33.309 22.158 1.00 58.77  ? 518  THR A C     1 
ATOM   6602  O O     . THR C 2 119 ? -86.778  -33.619 21.708 1.00 59.25  ? 518  THR A O     1 
ATOM   6603  C CB    . THR C 2 119 ? -89.027  -33.589 20.068 1.00 115.77 ? 518  THR A CB    1 
ATOM   6604  O OG1   . THR C 2 119 ? -89.341  -32.832 18.899 1.00 59.80  ? 518  THR A OG1   1 
ATOM   6605  C CG2   . THR C 2 119 ? -90.098  -34.635 20.330 1.00 59.80  ? 518  THR A CG2   1 
ATOM   6606  N N     . ILE C 2 120 ? -88.209  -33.543 23.414 1.00 62.31  ? 519  ILE A N     1 
ATOM   6607  C CA    . ILE C 2 120 ? -87.215  -34.199 24.242 1.00 59.82  ? 519  ILE A CA    1 
ATOM   6608  C C     . ILE C 2 120 ? -87.234  -35.699 23.947 1.00 60.17  ? 519  ILE A C     1 
ATOM   6609  O O     . ILE C 2 120 ? -88.280  -36.345 23.976 1.00 59.98  ? 519  ILE A O     1 
ATOM   6610  C CB    . ILE C 2 120 ? -87.448  -33.927 25.751 1.00 56.94  ? 519  ILE A CB    1 
ATOM   6611  C CG1   . ILE C 2 120 ? -88.840  -34.383 26.172 1.00 56.54  ? 519  ILE A CG1   1 
ATOM   6612  C CG2   . ILE C 2 120 ? -87.285  -32.450 26.032 1.00 55.64  ? 519  ILE A CG2   1 
ATOM   6613  C CD1   . ILE C 2 120 ? -89.026  -34.424 27.650 1.00 56.62  ? 519  ILE A CD1   1 
ATOM   6614  N N     . MET C 2 121 ? -86.062  -36.227 23.619 1.00 55.52  ? 520  MET A N     1 
ATOM   6615  C CA    . MET C 2 121 ? -85.883  -37.643 23.318 1.00 54.15  ? 520  MET A CA    1 
ATOM   6616  C C     . MET C 2 121 ? -85.083  -38.288 24.458 1.00 53.70  ? 520  MET A C     1 
ATOM   6617  O O     . MET C 2 121 ? -84.421  -37.601 25.237 1.00 53.74  ? 520  MET A O     1 
ATOM   6618  C CB    . MET C 2 121 ? -85.117  -37.813 22.002 1.00 80.10  ? 520  MET A CB    1 
ATOM   6619  C CG    . MET C 2 121 ? -85.754  -37.131 20.806 1.00 85.97  ? 520  MET A CG    1 
ATOM   6620  S SD    . MET C 2 121 ? -84.725  -37.231 19.320 1.00 92.30  ? 520  MET A SD    1 
ATOM   6621  C CE    . MET C 2 121 ? -85.284  -38.784 18.621 1.00 90.81  ? 520  MET A CE    1 
ATOM   6622  N N     . PRO C 2 122 ? -85.135  -39.621 24.568 1.00 77.56  ? 521  PRO A N     1 
ATOM   6623  C CA    . PRO C 2 122 ? -84.412  -40.335 25.619 1.00 76.46  ? 521  PRO A CA    1 
ATOM   6624  C C     . PRO C 2 122 ? -82.949  -39.948 25.804 1.00 74.65  ? 521  PRO A C     1 
ATOM   6625  O O     . PRO C 2 122 ? -82.475  -39.841 26.936 1.00 74.20  ? 521  PRO A O     1 
ATOM   6626  C CB    . PRO C 2 122 ? -84.590  -41.790 25.208 1.00 58.52  ? 521  PRO A CB    1 
ATOM   6627  C CG    . PRO C 2 122 ? -85.997  -41.791 24.733 1.00 59.90  ? 521  PRO A CG    1 
ATOM   6628  C CD    . PRO C 2 122 ? -86.035  -40.543 23.854 1.00 60.43  ? 521  PRO A CD    1 
ATOM   6629  N N     . LYS C 2 123 ? -82.244  -39.729 24.701 1.00 60.86  ? 522  LYS A N     1 
ATOM   6630  C CA    . LYS C 2 123 ? -80.834  -39.380 24.772 1.00 61.49  ? 522  LYS A CA    1 
ATOM   6631  C C     . LYS C 2 123 ? -80.591  -38.011 25.393 1.00 61.94  ? 522  LYS A C     1 
ATOM   6632  O O     . LYS C 2 123 ? -79.462  -37.699 25.784 1.00 64.73  ? 522  LYS A O     1 
ATOM   6633  C CB    . LYS C 2 123 ? -80.191  -39.452 23.390 1.00 49.97  ? 522  LYS A CB    1 
ATOM   6634  C CG    . LYS C 2 123 ? -80.379  -38.229 22.518 1.00 49.88  ? 522  LYS A CG    1 
ATOM   6635  C CD    . LYS C 2 123 ? -79.977  -38.578 21.097 1.00 52.35  ? 522  LYS A CD    1 
ATOM   6636  C CE    . LYS C 2 123 ? -80.297  -37.458 20.112 1.00 57.47  ? 522  LYS A CE    1 
ATOM   6637  N NZ    . LYS C 2 123 ? -80.498  -37.993 18.720 1.00 60.47  ? 522  LYS A NZ    1 
ATOM   6638  N N     . ASP C 2 124 ? -81.628  -37.182 25.479 1.00 57.75  ? 523  ASP A N     1 
ATOM   6639  C CA    . ASP C 2 124 ? -81.450  -35.881 26.118 1.00 56.68  ? 523  ASP A CA    1 
ATOM   6640  C C     . ASP C 2 124 ? -81.374  -36.136 27.615 1.00 54.89  ? 523  ASP A C     1 
ATOM   6641  O O     . ASP C 2 124 ? -80.611  -35.491 28.323 1.00 53.12  ? 523  ASP A O     1 
ATOM   6642  C CB    . ASP C 2 124 ? -82.604  -34.936 25.798 1.00 54.96  ? 523  ASP A CB    1 
ATOM   6643  C CG    . ASP C 2 124 ? -82.597  -34.490 24.357 1.00 59.53  ? 523  ASP A CG    1 
ATOM   6644  O OD1   . ASP C 2 124 ? -81.522  -34.054 23.888 1.00 59.21  ? 523  ASP A OD1   1 
ATOM   6645  O OD2   . ASP C 2 124 ? -83.659  -34.572 23.698 1.00 60.93  ? 523  ASP A OD2   1 
ATOM   6646  N N     . ILE C 2 125 ? -82.157  -37.108 28.079 1.00 49.94  ? 524  ILE A N     1 
ATOM   6647  C CA    . ILE C 2 125 ? -82.176  -37.490 29.484 1.00 48.02  ? 524  ILE A CA    1 
ATOM   6648  C C     . ILE C 2 125 ? -80.842  -38.140 29.847 1.00 46.86  ? 524  ILE A C     1 
ATOM   6649  O O     . ILE C 2 125 ? -80.297  -37.907 30.918 1.00 45.93  ? 524  ILE A O     1 
ATOM   6650  C CB    . ILE C 2 125 ? -83.323  -38.468 29.769 1.00 64.14  ? 524  ILE A CB    1 
ATOM   6651  C CG1   . ILE C 2 125 ? -84.651  -37.788 29.455 1.00 64.30  ? 524  ILE A CG1   1 
ATOM   6652  C CG2   . ILE C 2 125 ? -83.307  -38.884 31.224 1.00 64.34  ? 524  ILE A CG2   1 
ATOM   6653  C CD1   . ILE C 2 125 ? -85.859  -38.612 29.826 1.00 62.36  ? 524  ILE A CD1   1 
ATOM   6654  N N     . GLN C 2 126 ? -80.309  -38.951 28.944 1.00 67.28  ? 525  GLN A N     1 
ATOM   6655  C CA    . GLN C 2 126 ? -79.025  -39.594 29.190 1.00 67.98  ? 525  GLN A CA    1 
ATOM   6656  C C     . GLN C 2 126 ? -77.934  -38.542 29.350 1.00 66.71  ? 525  GLN A C     1 
ATOM   6657  O O     . GLN C 2 126 ? -77.264  -38.504 30.377 1.00 65.12  ? 525  GLN A O     1 
ATOM   6658  C CB    . GLN C 2 126 ? -78.687  -40.560 28.054 1.00 67.27  ? 525  GLN A CB    1 
ATOM   6659  C CG    . GLN C 2 126 ? -79.408  -41.894 28.185 1.00 72.38  ? 525  GLN A CG    1 
ATOM   6660  C CD    . GLN C 2 126 ? -79.969  -42.409 26.871 1.00 74.91  ? 525  GLN A CD    1 
ATOM   6661  O OE1   . GLN C 2 126 ? -79.248  -42.563 25.878 1.00 74.86  ? 525  GLN A OE1   1 
ATOM   6662  N NE2   . GLN C 2 126 ? -81.269  -42.687 26.863 1.00 76.57  ? 525  GLN A NE2   1 
ATOM   6663  N N     . LEU C 2 127 ? -77.763  -37.679 28.350 1.00 52.06  ? 526  LEU A N     1 
ATOM   6664  C CA    . LEU C 2 127 ? -76.750  -36.632 28.438 1.00 50.72  ? 526  LEU A CA    1 
ATOM   6665  C C     . LEU C 2 127 ? -76.907  -35.852 29.730 1.00 52.22  ? 526  LEU A C     1 
ATOM   6666  O O     . LEU C 2 127 ? -75.960  -35.704 30.504 1.00 52.81  ? 526  LEU A O     1 
ATOM   6667  C CB    . LEU C 2 127 ? -76.845  -35.657 27.264 1.00 43.40  ? 526  LEU A CB    1 
ATOM   6668  C CG    . LEU C 2 127 ? -75.790  -34.539 27.327 1.00 45.94  ? 526  LEU A CG    1 
ATOM   6669  C CD1   . LEU C 2 127 ? -74.401  -35.101 27.642 1.00 45.84  ? 526  LEU A CD1   1 
ATOM   6670  C CD2   . LEU C 2 127 ? -75.776  -33.790 26.021 1.00 42.76  ? 526  LEU A CD2   1 
ATOM   6671  N N     . ALA C 2 128 ? -78.110  -35.351 29.960 1.00 46.53  ? 527  ALA A N     1 
ATOM   6672  C CA    . ALA C 2 128 ? -78.385  -34.592 31.169 1.00 47.21  ? 527  ALA A CA    1 
ATOM   6673  C C     . ALA C 2 128 ? -77.920  -35.338 32.430 1.00 46.95  ? 527  ALA A C     1 
ATOM   6674  O O     . ALA C 2 128 ? -77.206  -34.784 33.266 1.00 46.35  ? 527  ALA A O     1 
ATOM   6675  C CB    . ALA C 2 128 ? -79.874  -34.283 31.256 1.00 55.77  ? 527  ALA A CB    1 
ATOM   6676  N N     . ARG C 2 129 ? -78.316  -36.593 32.572 1.00 50.86  ? 528  ARG A N     1 
ATOM   6677  C CA    . ARG C 2 129 ? -77.900  -37.347 33.743 1.00 53.74  ? 528  ARG A CA    1 
ATOM   6678  C C     . ARG C 2 129 ? -76.397  -37.639 33.691 1.00 52.62  ? 528  ARG A C     1 
ATOM   6679  O O     . ARG C 2 129 ? -75.723  -37.638 34.723 1.00 52.23  ? 528  ARG A O     1 
ATOM   6680  C CB    . ARG C 2 129 ? -78.724  -38.638 33.869 1.00 57.24  ? 528  ARG A CB    1 
ATOM   6681  C CG    . ARG C 2 129 ? -80.178  -38.356 34.228 1.00 62.30  ? 528  ARG A CG    1 
ATOM   6682  C CD    . ARG C 2 129 ? -81.006  -39.606 34.385 1.00 65.27  ? 528  ARG A CD    1 
ATOM   6683  N NE    . ARG C 2 129 ? -80.620  -40.383 35.559 1.00 65.64  ? 528  ARG A NE    1 
ATOM   6684  C CZ    . ARG C 2 129 ? -80.061  -41.589 35.512 1.00 64.70  ? 528  ARG A CZ    1 
ATOM   6685  N NH1   . ARG C 2 129 ? -79.807  -42.176 34.348 1.00 60.07  ? 528  ARG A NH1   1 
ATOM   6686  N NH2   . ARG C 2 129 ? -79.766  -42.217 36.636 1.00 64.02  ? 528  ARG A NH2   1 
ATOM   6687  N N     . ARG C 2 130 ? -75.862  -37.866 32.498 1.00 53.61  ? 529  ARG A N     1 
ATOM   6688  C CA    . ARG C 2 130 ? -74.443  -38.132 32.394 1.00 53.55  ? 529  ARG A CA    1 
ATOM   6689  C C     . ARG C 2 130 ? -73.727  -36.910 32.948 1.00 54.01  ? 529  ARG A C     1 
ATOM   6690  O O     . ARG C 2 130 ? -72.908  -37.009 33.855 1.00 55.44  ? 529  ARG A O     1 
ATOM   6691  C CB    . ARG C 2 130 ? -74.016  -38.336 30.942 1.00 70.76  ? 529  ARG A CB    1 
ATOM   6692  C CG    . ARG C 2 130 ? -72.615  -38.905 30.786 1.00 74.57  ? 529  ARG A CG    1 
ATOM   6693  C CD    . ARG C 2 130 ? -72.665  -40.402 30.422 1.00 81.85  ? 529  ARG A CD    1 
ATOM   6694  N NE    . ARG C 2 130 ? -72.288  -40.668 29.029 1.00 87.70  ? 529  ARG A NE    1 
ATOM   6695  C CZ    . ARG C 2 130 ? -71.031  -40.715 28.582 1.00 89.36  ? 529  ARG A CZ    1 
ATOM   6696  N NH1   . ARG C 2 130 ? -70.008  -40.526 29.417 1.00 90.91  ? 529  ARG A NH1   1 
ATOM   6697  N NH2   . ARG C 2 130 ? -70.793  -40.922 27.288 1.00 89.26  ? 529  ARG A NH2   1 
ATOM   6698  N N     . ILE C 2 131 ? -74.051  -35.739 32.425 1.00 50.54  ? 530  ILE A N     1 
ATOM   6699  C CA    . ILE C 2 131 ? -73.365  -34.557 32.888 1.00 50.45  ? 530  ILE A CA    1 
ATOM   6700  C C     . ILE C 2 131 ? -73.594  -34.293 34.361 1.00 51.86  ? 530  ILE A C     1 
ATOM   6701  O O     . ILE C 2 131 ? -72.727  -33.742 35.044 1.00 52.63  ? 530  ILE A O     1 
ATOM   6702  C CB    . ILE C 2 131 ? -73.733  -33.331 32.020 1.00 57.06  ? 530  ILE A CB    1 
ATOM   6703  C CG1   . ILE C 2 131 ? -72.843  -33.326 30.771 1.00 57.72  ? 530  ILE A CG1   1 
ATOM   6704  C CG2   . ILE C 2 131 ? -73.510  -32.045 32.784 1.00 53.14  ? 530  ILE A CG2   1 
ATOM   6705  C CD1   . ILE C 2 131 ? -73.336  -32.441 29.653 1.00 58.83  ? 530  ILE A CD1   1 
ATOM   6706  N N     . ARG C 2 132 ? -74.739  -34.716 34.867 1.00 53.09  ? 531  ARG A N     1 
ATOM   6707  C CA    . ARG C 2 132 ? -75.050  -34.496 36.277 1.00 53.25  ? 531  ARG A CA    1 
ATOM   6708  C C     . ARG C 2 132 ? -74.145  -35.294 37.208 1.00 55.77  ? 531  ARG A C     1 
ATOM   6709  O O     . ARG C 2 132 ? -73.793  -34.842 38.296 1.00 55.45  ? 531  ARG A O     1 
ATOM   6710  C CB    . ARG C 2 132 ? -76.505  -34.870 36.562 1.00 53.97  ? 531  ARG A CB    1 
ATOM   6711  C CG    . ARG C 2 132 ? -77.545  -33.854 36.131 1.00 51.77  ? 531  ARG A CG    1 
ATOM   6712  C CD    . ARG C 2 132 ? -78.885  -34.283 36.664 1.00 53.94  ? 531  ARG A CD    1 
ATOM   6713  N NE    . ARG C 2 132 ? -79.922  -33.277 36.500 1.00 54.91  ? 531  ARG A NE    1 
ATOM   6714  C CZ    . ARG C 2 132 ? -81.074  -33.305 37.159 1.00 55.39  ? 531  ARG A CZ    1 
ATOM   6715  N NH1   . ARG C 2 132 ? -81.324  -34.285 38.016 1.00 53.32  ? 531  ARG A NH1   1 
ATOM   6716  N NH2   . ARG C 2 132 ? -81.971  -32.353 36.972 1.00 56.34  ? 531  ARG A NH2   1 
ATOM   6717  N N     . GLY C 2 133 ? -73.768  -36.488 36.771 1.00 48.08  ? 532  GLY A N     1 
ATOM   6718  C CA    . GLY C 2 133 ? -72.940  -37.329 37.597 1.00 53.02  ? 532  GLY A CA    1 
ATOM   6719  C C     . GLY C 2 133 ? -73.761  -38.523 38.005 1.00 57.10  ? 532  GLY A C     1 
ATOM   6720  O O     . GLY C 2 133 ? -73.248  -39.468 38.580 1.00 59.49  ? 532  GLY A O     1 
ATOM   6721  N N     . GLU C 2 134 ? -75.053  -38.483 37.713 1.00 71.20  ? 533  GLU A N     1 
ATOM   6722  C CA    . GLU C 2 134 ? -75.921  -39.599 38.033 1.00 75.95  ? 533  GLU A CA    1 
ATOM   6723  C C     . GLU C 2 134 ? -75.514  -40.756 37.141 1.00 83.23  ? 533  GLU A C     1 
ATOM   6724  O O     . GLU C 2 134 ? -75.036  -41.780 37.624 1.00 81.88  ? 533  GLU A O     1 
ATOM   6725  C CB    . GLU C 2 134 ? -77.376  -39.241 37.757 1.00 81.57  ? 533  GLU A CB    1 
ATOM   6726  C CG    . GLU C 2 134 ? -78.004  -38.335 38.783 1.00 80.31  ? 533  GLU A CG    1 
ATOM   6727  C CD    . GLU C 2 134 ? -79.329  -37.776 38.314 1.00 79.08  ? 533  GLU A CD    1 
ATOM   6728  O OE1   . GLU C 2 134 ? -80.028  -38.483 37.546 1.00 77.75  ? 533  GLU A OE1   1 
ATOM   6729  O OE2   . GLU C 2 134 ? -79.670  -36.638 38.723 1.00 76.26  ? 533  GLU A OE2   1 
ATOM   6730  N N     . ARG C 2 135 ? -75.704  -40.568 35.837 1.00 133.15 ? 534  ARG A N     1 
ATOM   6731  C CA    . ARG C 2 135 ? -75.384  -41.566 34.821 1.00 141.73 ? 534  ARG A CA    1 
ATOM   6732  C C     . ARG C 2 135 ? -75.428  -42.994 35.356 1.00 144.52 ? 534  ARG A C     1 
ATOM   6733  O O     . ARG C 2 135 ? -74.395  -43.596 35.646 1.00 145.49 ? 534  ARG A O     1 
ATOM   6734  C CB    . ARG C 2 135 ? -74.012  -41.270 34.202 1.00 125.04 ? 534  ARG A CB    1 
ATOM   6735  C CG    . ARG C 2 135 ? -72.855  -41.215 35.192 1.00 133.04 ? 534  ARG A CG    1 
ATOM   6736  C CD    . ARG C 2 135 ? -71.565  -40.823 34.492 1.00 138.79 ? 534  ARG A CD    1 
ATOM   6737  N NE    . ARG C 2 135 ? -71.281  -41.690 33.350 1.00 144.38 ? 534  ARG A NE    1 
ATOM   6738  C CZ    . ARG C 2 135 ? -70.285  -41.497 32.488 1.00 146.50 ? 534  ARG A CZ    1 
ATOM   6739  N NH1   . ARG C 2 135 ? -69.463  -40.462 32.629 1.00 147.92 ? 534  ARG A NH1   1 
ATOM   6740  N NH2   . ARG C 2 135 ? -70.112  -42.338 31.477 1.00 147.57 ? 534  ARG A NH2   1 
ATOM   6741  N N     . ALA C 2 136 ? -76.637  -43.529 35.490 1.00 200.16 ? 535  ALA A N     1 
ATOM   6742  C CA    . ALA C 2 136 ? -76.826  -44.885 35.990 1.00 200.16 ? 535  ALA A CA    1 
ATOM   6743  C C     . ALA C 2 136 ? -77.342  -45.795 34.877 1.00 200.16 ? 535  ALA A C     1 
ATOM   6744  O O     . ALA C 2 136 ? -78.436  -46.375 35.044 1.00 200.16 ? 535  ALA A O     1 
ATOM   6745  C CB    . ALA C 2 136 ? -77.803  -44.879 37.166 1.00 94.09  ? 535  ALA A CB    1 
ATOM   6746  O OXT   . ALA C 2 136 ? -76.641  -45.914 33.849 1.00 96.51  ? 535  ALA A OXT   1 
ATOM   6747  N N     . ASP D 3 25  ? -98.533  -54.719 38.502 1.00 185.96 ? 24   ASP B N     1 
ATOM   6748  C CA    . ASP D 3 25  ? -97.836  -53.851 37.506 1.00 185.52 ? 24   ASP B CA    1 
ATOM   6749  C C     . ASP D 3 25  ? -97.538  -52.449 38.043 1.00 183.90 ? 24   ASP B C     1 
ATOM   6750  O O     . ASP D 3 25  ? -97.951  -51.455 37.449 1.00 185.20 ? 24   ASP B O     1 
ATOM   6751  C CB    . ASP D 3 25  ? -98.678  -53.739 36.227 1.00 177.66 ? 24   ASP B CB    1 
ATOM   6752  C CG    . ASP D 3 25  ? -98.771  -55.052 35.464 1.00 178.59 ? 24   ASP B CG    1 
ATOM   6753  O OD1   . ASP D 3 25  ? -97.717  -55.586 35.061 1.00 179.21 ? 24   ASP B OD1   1 
ATOM   6754  O OD2   . ASP D 3 25  ? -99.900  -55.546 35.260 1.00 177.46 ? 24   ASP B OD2   1 
ATOM   6755  N N     . ASN D 3 26  ? -96.834  -52.371 39.168 1.00 136.63 ? 25   ASN B N     1 
ATOM   6756  C CA    . ASN D 3 26  ? -96.483  -51.082 39.732 1.00 132.18 ? 25   ASN B CA    1 
ATOM   6757  C C     . ASN D 3 26  ? -95.267  -50.629 38.927 1.00 129.31 ? 25   ASN B C     1 
ATOM   6758  O O     . ASN D 3 26  ? -94.320  -51.398 38.748 1.00 129.64 ? 25   ASN B O     1 
ATOM   6759  C CB    . ASN D 3 26  ? -96.151  -51.219 41.225 1.00 125.38 ? 25   ASN B CB    1 
ATOM   6760  C CG    . ASN D 3 26  ? -97.342  -51.714 42.059 1.00 125.49 ? 25   ASN B CG    1 
ATOM   6761  O OD1   . ASN D 3 26  ? -98.435  -51.152 41.994 1.00 124.56 ? 25   ASN B OD1   1 
ATOM   6762  N ND2   . ASN D 3 26  ? -97.121  -52.759 42.859 1.00 124.55 ? 25   ASN B ND2   1 
ATOM   6763  N N     . ILE D 3 27  ? -95.308  -49.363 38.453 1.00 108.72 ? 26   ILE B N     1 
ATOM   6764  C CA    . ILE D 3 27  ? -94.292  -48.733 37.578 1.00 104.39 ? 26   ILE B CA    1 
ATOM   6765  C C     . ILE D 3 27  ? -94.826  -48.833 36.162 1.00 102.11 ? 26   ILE B C     1 
ATOM   6766  O O     . ILE D 3 27  ? -94.157  -49.288 35.243 1.00 103.08 ? 26   ILE B O     1 
ATOM   6767  C CB    . ILE D 3 27  ? -92.876  -49.356 37.731 1.00 89.60  ? 26   ILE B CB    1 
ATOM   6768  C CG1   . ILE D 3 27  ? -91.821  -48.254 37.780 1.00 87.65  ? 26   ILE B CG1   1 
ATOM   6769  C CG2   . ILE D 3 27  ? -92.568  -50.346 36.616 1.00 89.32  ? 26   ILE B CG2   1 
ATOM   6770  C CD1   . ILE D 3 27  ? -92.214  -47.071 38.637 1.00 89.54  ? 26   ILE B CD1   1 
ATOM   6771  N N     . GLN D 3 28  ? -96.081  -48.410 36.073 1.00 97.50  ? 27   GLN B N     1 
ATOM   6772  C CA    . GLN D 3 28  ? -96.895  -48.333 34.890 1.00 92.97  ? 27   GLN B CA    1 
ATOM   6773  C C     . GLN D 3 28  ? -98.087  -47.573 35.360 1.00 90.12  ? 27   GLN B C     1 
ATOM   6774  O O     . GLN D 3 28  ? -98.865  -46.998 34.609 1.00 89.43  ? 27   GLN B O     1 
ATOM   6775  C CB    . GLN D 3 28  ? -97.294  -49.695 34.370 1.00 84.91  ? 27   GLN B CB    1 
ATOM   6776  C CG    . GLN D 3 28  ? -96.146  -50.595 33.966 1.00 85.27  ? 27   GLN B CG    1 
ATOM   6777  C CD    . GLN D 3 28  ? -95.438  -50.066 32.727 1.00 86.47  ? 27   GLN B CD    1 
ATOM   6778  O OE1   . GLN D 3 28  ? -95.785  -49.014 32.204 1.00 85.48  ? 27   GLN B OE1   1 
ATOM   6779  N NE2   . GLN D 3 28  ? -94.428  -50.657 32.108 1.00 85.31  ? 27   GLN B NE2   1 
ATOM   6780  N N     . GLY D 3 29  ? -98.175  -47.638 36.691 1.00 84.84  ? 28   GLY B N     1 
ATOM   6781  C CA    . GLY D 3 29  ? -99.148  -46.887 37.408 1.00 82.96  ? 28   GLY B CA    1 
ATOM   6782  C C     . GLY D 3 29  ? -98.720  -45.452 37.170 1.00 81.96  ? 28   GLY B C     1 
ATOM   6783  O O     . GLY D 3 29  ? -99.566  -44.559 37.110 1.00 83.13  ? 28   GLY B O     1 
ATOM   6784  N N     . ILE D 3 30  ? -97.409  -45.243 37.026 1.00 86.49  ? 29   ILE B N     1 
ATOM   6785  C CA    . ILE D 3 30  ? -96.881  -43.924 36.698 1.00 82.16  ? 29   ILE B CA    1 
ATOM   6786  C C     . ILE D 3 30  ? -97.217  -43.775 35.220 1.00 80.74  ? 29   ILE B C     1 
ATOM   6787  O O     . ILE D 3 30  ? -96.438  -44.140 34.342 1.00 78.22  ? 29   ILE B O     1 
ATOM   6788  C CB    . ILE D 3 30  ? -95.351  -43.840 36.880 1.00 62.42  ? 29   ILE B CB    1 
ATOM   6789  C CG1   . ILE D 3 30  ? -94.932  -44.539 38.170 1.00 62.76  ? 29   ILE B CG1   1 
ATOM   6790  C CG2   . ILE D 3 30  ? -94.912  -42.352 36.880 1.00 61.30  ? 29   ILE B CG2   1 
ATOM   6791  C CD1   . ILE D 3 30  ? -95.361  -43.807 39.424 1.00 64.10  ? 29   ILE B CD1   1 
ATOM   6792  N N     . THR D 3 31  ? -98.409  -43.251 34.973 1.00 68.35  ? 30   THR B N     1 
ATOM   6793  C CA    . THR D 3 31  ? -98.944  -43.085 33.629 1.00 68.12  ? 30   THR B CA    1 
ATOM   6794  C C     . THR D 3 31  ? -98.369  -41.986 32.731 1.00 67.69  ? 30   THR B C     1 
ATOM   6795  O O     . THR D 3 31  ? -97.880  -40.948 33.200 1.00 67.63  ? 30   THR B O     1 
ATOM   6796  C CB    . THR D 3 31  ? -100.461 -42.868 33.698 1.00 73.39  ? 30   THR B CB    1 
ATOM   6797  O OG1   . THR D 3 31  ? -100.725 -41.525 34.116 1.00 72.07  ? 30   THR B OG1   1 
ATOM   6798  C CG2   . THR D 3 31  ? -101.084 -43.825 34.704 1.00 72.20  ? 30   THR B CG2   1 
ATOM   6799  N N     . LYS D 3 32  ? -98.460  -42.228 31.426 1.00 77.78  ? 31   LYS B N     1 
ATOM   6800  C CA    . LYS D 3 32  ? -97.997  -41.282 30.424 1.00 76.86  ? 31   LYS B CA    1 
ATOM   6801  C C     . LYS D 3 32  ? -98.598  -39.896 30.676 1.00 76.15  ? 31   LYS B C     1 
ATOM   6802  O O     . LYS D 3 32  ? -97.902  -38.882 30.597 1.00 76.79  ? 31   LYS B O     1 
ATOM   6803  C CB    . LYS D 3 32  ? -98.381  -41.774 29.028 1.00 74.19  ? 31   LYS B CB    1 
ATOM   6804  C CG    . LYS D 3 32  ? -98.333  -40.698 27.944 1.00 75.39  ? 31   LYS B CG    1 
ATOM   6805  C CD    . LYS D 3 32  ? -98.591  -41.270 26.539 1.00 74.44  ? 31   LYS B CD    1 
ATOM   6806  C CE    . LYS D 3 32  ? -98.604  -40.173 25.472 1.00 74.42  ? 31   LYS B CE    1 
ATOM   6807  N NZ    . LYS D 3 32  ? -98.555  -40.718 24.080 1.00 74.93  ? 31   LYS B NZ    1 
ATOM   6808  N N     . PRO D 3 33  ? -99.900  -39.830 30.991 1.00 83.22  ? 32   PRO B N     1 
ATOM   6809  C CA    . PRO D 3 33  ? -100.500 -38.514 31.240 1.00 82.04  ? 32   PRO B CA    1 
ATOM   6810  C C     . PRO D 3 33  ? -99.773  -37.782 32.358 1.00 79.78  ? 32   PRO B C     1 
ATOM   6811  O O     . PRO D 3 33  ? -99.532  -36.584 32.276 1.00 80.41  ? 32   PRO B O     1 
ATOM   6812  C CB    . PRO D 3 33  ? -101.936 -38.853 31.626 1.00 92.22  ? 32   PRO B CB    1 
ATOM   6813  C CG    . PRO D 3 33  ? -102.195 -40.104 30.854 1.00 93.96  ? 32   PRO B CG    1 
ATOM   6814  C CD    . PRO D 3 33  ? -100.920 -40.890 31.058 1.00 92.70  ? 32   PRO B CD    1 
ATOM   6815  N N     . ALA D 3 34  ? -99.421  -38.516 33.406 1.00 84.44  ? 33   ALA B N     1 
ATOM   6816  C CA    . ALA D 3 34  ? -98.731  -37.921 34.538 1.00 82.99  ? 33   ALA B CA    1 
ATOM   6817  C C     . ALA D 3 34  ? -97.344  -37.433 34.136 1.00 81.46  ? 33   ALA B C     1 
ATOM   6818  O O     . ALA D 3 34  ? -96.999  -36.262 34.346 1.00 80.48  ? 33   ALA B O     1 
ATOM   6819  C CB    . ALA D 3 34  ? -98.633  -38.928 35.656 1.00 66.88  ? 33   ALA B CB    1 
ATOM   6820  N N     . ILE D 3 35  ? -96.552  -38.336 33.566 1.00 65.05  ? 34   ILE B N     1 
ATOM   6821  C CA    . ILE D 3 35  ? -95.210  -37.992 33.120 1.00 62.79  ? 34   ILE B CA    1 
ATOM   6822  C C     . ILE D 3 35  ? -95.262  -36.728 32.263 1.00 63.82  ? 34   ILE B C     1 
ATOM   6823  O O     . ILE D 3 35  ? -94.436  -35.821 32.385 1.00 64.49  ? 34   ILE B O     1 
ATOM   6824  C CB    . ILE D 3 35  ? -94.609  -39.137 32.300 1.00 53.35  ? 34   ILE B CB    1 
ATOM   6825  C CG1   . ILE D 3 35  ? -94.332  -40.324 33.233 1.00 50.54  ? 34   ILE B CG1   1 
ATOM   6826  C CG2   . ILE D 3 35  ? -93.362  -38.654 31.560 1.00 51.46  ? 34   ILE B CG2   1 
ATOM   6827  C CD1   . ILE D 3 35  ? -93.847  -41.592 32.522 1.00 49.74  ? 34   ILE B CD1   1 
ATOM   6828  N N     . ARG D 3 36  ? -96.249  -36.674 31.388 1.00 51.93  ? 35   ARG B N     1 
ATOM   6829  C CA    . ARG D 3 36  ? -96.407  -35.515 30.542 1.00 52.43  ? 35   ARG B CA    1 
ATOM   6830  C C     . ARG D 3 36  ? -96.674  -34.312 31.453 1.00 51.14  ? 35   ARG B C     1 
ATOM   6831  O O     . ARG D 3 36  ? -96.121  -33.233 31.263 1.00 48.43  ? 35   ARG B O     1 
ATOM   6832  C CB    . ARG D 3 36  ? -97.575  -35.742 29.578 1.00 109.94 ? 35   ARG B CB    1 
ATOM   6833  C CG    . ARG D 3 36  ? -97.757  -34.654 28.544 1.00 117.28 ? 35   ARG B CG    1 
ATOM   6834  C CD    . ARG D 3 36  ? -99.087  -34.801 27.821 1.00 124.71 ? 35   ARG B CD    1 
ATOM   6835  N NE    . ARG D 3 36  ? -99.135  -35.951 26.920 1.00 130.58 ? 35   ARG B NE    1 
ATOM   6836  C CZ    . ARG D 3 36  ? -98.448  -36.048 25.783 1.00 134.05 ? 35   ARG B CZ    1 
ATOM   6837  N NH1   . ARG D 3 36  ? -97.646  -35.062 25.399 1.00 135.08 ? 35   ARG B NH1   1 
ATOM   6838  N NH2   . ARG D 3 36  ? -98.576  -37.124 25.016 1.00 135.31 ? 35   ARG B NH2   1 
ATOM   6839  N N     . ARG D 3 37  ? -97.512  -34.481 32.460 1.00 61.36  ? 36   ARG B N     1 
ATOM   6840  C CA    . ARG D 3 37  ? -97.778  -33.337 33.314 1.00 63.27  ? 36   ARG B CA    1 
ATOM   6841  C C     . ARG D 3 37  ? -96.467  -32.854 33.890 1.00 62.55  ? 36   ARG B C     1 
ATOM   6842  O O     . ARG D 3 37  ? -96.156  -31.661 33.827 1.00 61.72  ? 36   ARG B O     1 
ATOM   6843  C CB    . ARG D 3 37  ? -98.777  -33.683 34.427 1.00 63.82  ? 36   ARG B CB    1 
ATOM   6844  C CG    . ARG D 3 37  ? -100.225 -33.510 33.989 1.00 66.21  ? 36   ARG B CG    1 
ATOM   6845  C CD    . ARG D 3 37  ? -101.176 -33.484 35.155 1.00 69.67  ? 36   ARG B CD    1 
ATOM   6846  N NE    . ARG D 3 37  ? -101.174 -34.738 35.896 1.00 73.54  ? 36   ARG B NE    1 
ATOM   6847  C CZ    . ARG D 3 37  ? -101.509 -35.916 35.379 1.00 73.65  ? 36   ARG B CZ    1 
ATOM   6848  N NH1   . ARG D 3 37  ? -101.874 -36.011 34.110 1.00 75.64  ? 36   ARG B NH1   1 
ATOM   6849  N NH2   . ARG D 3 37  ? -101.489 -37.003 36.136 1.00 71.71  ? 36   ARG B NH2   1 
ATOM   6850  N N     . LEU D 3 38  ? -95.691  -33.794 34.423 1.00 60.55  ? 37   LEU B N     1 
ATOM   6851  C CA    . LEU D 3 38  ? -94.395  -33.478 35.005 1.00 59.99  ? 37   LEU B CA    1 
ATOM   6852  C C     . LEU D 3 38  ? -93.553  -32.664 34.013 1.00 61.77  ? 37   LEU B C     1 
ATOM   6853  O O     . LEU D 3 38  ? -93.228  -31.495 34.260 1.00 63.56  ? 37   LEU B O     1 
ATOM   6854  C CB    . LEU D 3 38  ? -93.672  -34.775 35.394 1.00 47.58  ? 37   LEU B CB    1 
ATOM   6855  C CG    . LEU D 3 38  ? -94.248  -35.484 36.630 1.00 46.31  ? 37   LEU B CG    1 
ATOM   6856  C CD1   . LEU D 3 38  ? -93.531  -36.808 36.887 1.00 46.39  ? 37   LEU B CD1   1 
ATOM   6857  C CD2   . LEU D 3 38  ? -94.117  -34.554 37.839 1.00 40.69  ? 37   LEU B CD2   1 
ATOM   6858  N N     . ALA D 3 39  ? -93.226  -33.282 32.882 1.00 55.69  ? 38   ALA B N     1 
ATOM   6859  C CA    . ALA D 3 39  ? -92.430  -32.633 31.860 1.00 54.85  ? 38   ALA B CA    1 
ATOM   6860  C C     . ALA D 3 39  ? -92.956  -31.240 31.534 1.00 54.95  ? 38   ALA B C     1 
ATOM   6861  O O     . ALA D 3 39  ? -92.182  -30.315 31.245 1.00 55.56  ? 38   ALA B O     1 
ATOM   6862  C CB    . ALA D 3 39  ? -92.406  -33.493 30.618 1.00 56.05  ? 38   ALA B CB    1 
ATOM   6863  N N     . ARG D 3 40  ? -94.274  -31.086 31.575 1.00 64.61  ? 39   ARG B N     1 
ATOM   6864  C CA    . ARG D 3 40  ? -94.889  -29.793 31.293 1.00 65.11  ? 39   ARG B CA    1 
ATOM   6865  C C     . ARG D 3 40  ? -94.443  -28.779 32.343 1.00 63.19  ? 39   ARG B C     1 
ATOM   6866  O O     . ARG D 3 40  ? -94.004  -27.675 32.011 1.00 63.44  ? 39   ARG B O     1 
ATOM   6867  C CB    . ARG D 3 40  ? -96.410  -29.925 31.307 1.00 67.75  ? 39   ARG B CB    1 
ATOM   6868  C CG    . ARG D 3 40  ? -97.005  -30.462 30.021 1.00 68.97  ? 39   ARG B CG    1 
ATOM   6869  C CD    . ARG D 3 40  ? -97.001  -29.406 28.918 1.00 71.54  ? 39   ARG B CD    1 
ATOM   6870  N NE    . ARG D 3 40  ? -97.656  -29.870 27.693 1.00 74.81  ? 39   ARG B NE    1 
ATOM   6871  C CZ    . ARG D 3 40  ? -97.197  -30.842 26.906 1.00 78.32  ? 39   ARG B CZ    1 
ATOM   6872  N NH1   . ARG D 3 40  ? -96.071  -31.472 27.199 1.00 79.91  ? 39   ARG B NH1   1 
ATOM   6873  N NH2   . ARG D 3 40  ? -97.866  -31.186 25.816 1.00 80.25  ? 39   ARG B NH2   1 
ATOM   6874  N N     . ARG D 3 41  ? -94.558  -29.169 33.612 1.00 65.36  ? 40   ARG B N     1 
ATOM   6875  C CA    . ARG D 3 41  ? -94.163  -28.303 34.715 1.00 64.15  ? 40   ARG B CA    1 
ATOM   6876  C C     . ARG D 3 41  ? -92.685  -28.013 34.562 1.00 63.81  ? 40   ARG B C     1 
ATOM   6877  O O     . ARG D 3 41  ? -92.157  -27.061 35.137 1.00 65.36  ? 40   ARG B O     1 
ATOM   6878  C CB    . ARG D 3 41  ? -94.428  -28.993 36.054 1.00 66.62  ? 40   ARG B CB    1 
ATOM   6879  C CG    . ARG D 3 41  ? -93.970  -28.222 37.286 1.00 66.26  ? 40   ARG B CG    1 
ATOM   6880  C CD    . ARG D 3 41  ? -94.610  -28.812 38.547 1.00 69.18  ? 40   ARG B CD    1 
ATOM   6881  N NE    . ARG D 3 41  ? -95.946  -28.265 38.799 1.00 70.79  ? 40   ARG B NE    1 
ATOM   6882  C CZ    . ARG D 3 41  ? -96.848  -28.803 39.618 1.00 70.59  ? 40   ARG B CZ    1 
ATOM   6883  N NH1   . ARG D 3 41  ? -96.578  -29.925 40.274 1.00 70.43  ? 40   ARG B NH1   1 
ATOM   6884  N NH2   . ARG D 3 41  ? -98.013  -28.199 39.801 1.00 69.96  ? 40   ARG B NH2   1 
ATOM   6885  N N     . GLY D 3 42  ? -92.030  -28.849 33.768 1.00 62.54  ? 41   GLY B N     1 
ATOM   6886  C CA    . GLY D 3 42  ? -90.617  -28.687 33.523 1.00 60.27  ? 41   GLY B CA    1 
ATOM   6887  C C     . GLY D 3 42  ? -90.350  -27.883 32.274 1.00 61.44  ? 41   GLY B C     1 
ATOM   6888  O O     . GLY D 3 42  ? -89.214  -27.834 31.822 1.00 64.01  ? 41   GLY B O     1 
ATOM   6889  N N     . GLY D 3 43  ? -91.388  -27.265 31.710 1.00 53.89  ? 42   GLY B N     1 
ATOM   6890  C CA    . GLY D 3 43  ? -91.229  -26.456 30.507 1.00 53.36  ? 42   GLY B CA    1 
ATOM   6891  C C     . GLY D 3 43  ? -91.096  -27.205 29.184 1.00 54.09  ? 42   GLY B C     1 
ATOM   6892  O O     . GLY D 3 43  ? -90.724  -26.601 28.175 1.00 52.84  ? 42   GLY B O     1 
ATOM   6893  N N     . VAL D 3 44  ? -91.403  -28.502 29.173 1.00 61.47  ? 43   VAL B N     1 
ATOM   6894  C CA    . VAL D 3 44  ? -91.287  -29.315 27.963 1.00 62.55  ? 43   VAL B CA    1 
ATOM   6895  C C     . VAL D 3 44  ? -92.473  -29.180 26.975 1.00 64.42  ? 43   VAL B C     1 
ATOM   6896  O O     . VAL D 3 44  ? -93.638  -29.307 27.358 1.00 64.35  ? 43   VAL B O     1 
ATOM   6897  C CB    . VAL D 3 44  ? -91.097  -30.785 28.354 1.00 83.08  ? 43   VAL B CB    1 
ATOM   6898  C CG1   . VAL D 3 44  ? -90.769  -31.624 27.137 1.00 84.56  ? 43   VAL B CG1   1 
ATOM   6899  C CG2   . VAL D 3 44  ? -89.988  -30.889 29.366 1.00 85.10  ? 43   VAL B CG2   1 
ATOM   6900  N N     . LYS D 3 45  ? -92.165  -28.944 25.698 1.00 73.50  ? 44   LYS B N     1 
ATOM   6901  C CA    . LYS D 3 45  ? -93.199  -28.754 24.678 1.00 75.82  ? 44   LYS B CA    1 
ATOM   6902  C C     . LYS D 3 45  ? -93.559  -30.023 23.889 1.00 77.56  ? 44   LYS B C     1 
ATOM   6903  O O     . LYS D 3 45  ? -94.730  -30.339 23.738 1.00 81.00  ? 44   LYS B O     1 
ATOM   6904  C CB    . LYS D 3 45  ? -92.753  -27.627 23.735 1.00 73.19  ? 44   LYS B CB    1 
ATOM   6905  C CG    . LYS D 3 45  ? -93.850  -26.951 22.929 1.00 73.79  ? 44   LYS B CG    1 
ATOM   6906  C CD    . LYS D 3 45  ? -93.273  -25.771 22.133 1.00 74.33  ? 44   LYS B CD    1 
ATOM   6907  C CE    . LYS D 3 45  ? -94.285  -25.122 21.166 1.00 74.12  ? 44   LYS B CE    1 
ATOM   6908  N NZ    . LYS D 3 45  ? -94.540  -25.901 19.915 1.00 75.53  ? 44   LYS B NZ    1 
ATOM   6909  N N     . ARG D 3 46  ? -92.559  -30.736 23.379 1.00 65.91  ? 45   ARG B N     1 
ATOM   6910  C CA    . ARG D 3 46  ? -92.775  -31.979 22.632 1.00 67.46  ? 45   ARG B CA    1 
ATOM   6911  C C     . ARG D 3 46  ? -92.221  -33.149 23.442 1.00 67.77  ? 45   ARG B C     1 
ATOM   6912  O O     . ARG D 3 46  ? -91.481  -32.936 24.390 1.00 68.91  ? 45   ARG B O     1 
ATOM   6913  C CB    . ARG D 3 46  ? -92.054  -31.940 21.283 1.00 91.56  ? 45   ARG B CB    1 
ATOM   6914  C CG    . ARG D 3 46  ? -92.677  -31.034 20.243 1.00 96.27  ? 45   ARG B CG    1 
ATOM   6915  C CD    . ARG D 3 46  ? -94.027  -31.554 19.759 1.00 100.08 ? 45   ARG B CD    1 
ATOM   6916  N NE    . ARG D 3 46  ? -93.943  -32.822 19.031 1.00 102.93 ? 45   ARG B NE    1 
ATOM   6917  C CZ    . ARG D 3 46  ? -93.193  -33.024 17.953 1.00 102.86 ? 45   ARG B CZ    1 
ATOM   6918  N NH1   . ARG D 3 46  ? -92.447  -32.044 17.475 1.00 103.04 ? 45   ARG B NH1   1 
ATOM   6919  N NH2   . ARG D 3 46  ? -93.207  -34.198 17.341 1.00 102.10 ? 45   ARG B NH2   1 
ATOM   6920  N N     . ILE D 3 47  ? -92.551  -34.383 23.070 1.00 64.36  ? 46   ILE B N     1 
ATOM   6921  C CA    . ILE D 3 47  ? -92.052  -35.533 23.817 1.00 62.51  ? 46   ILE B CA    1 
ATOM   6922  C C     . ILE D 3 47  ? -91.932  -36.821 23.004 1.00 63.63  ? 46   ILE B C     1 
ATOM   6923  O O     . ILE D 3 47  ? -92.938  -37.372 22.555 1.00 63.54  ? 46   ILE B O     1 
ATOM   6924  C CB    . ILE D 3 47  ? -92.971  -35.867 25.040 1.00 42.30  ? 46   ILE B CB    1 
ATOM   6925  C CG1   . ILE D 3 47  ? -93.109  -34.655 25.974 1.00 40.98  ? 46   ILE B CG1   1 
ATOM   6926  C CG2   . ILE D 3 47  ? -92.411  -37.091 25.804 1.00 40.66  ? 46   ILE B CG2   1 
ATOM   6927  C CD1   . ILE D 3 47  ? -93.969  -34.928 27.207 1.00 39.48  ? 46   ILE B CD1   1 
ATOM   6928  N N     . SER D 3 48  ? -90.709  -37.312 22.827 1.00 59.38  ? 47   SER B N     1 
ATOM   6929  C CA    . SER D 3 48  ? -90.512  -38.574 22.126 1.00 57.79  ? 47   SER B CA    1 
ATOM   6930  C C     . SER D 3 48  ? -91.440  -39.581 22.779 1.00 58.73  ? 47   SER B C     1 
ATOM   6931  O O     . SER D 3 48  ? -91.748  -39.475 23.964 1.00 58.92  ? 47   SER B O     1 
ATOM   6932  C CB    . SER D 3 48  ? -89.082  -39.080 22.301 1.00 72.45  ? 47   SER B CB    1 
ATOM   6933  O OG    . SER D 3 48  ? -89.002  -40.469 22.011 1.00 71.22  ? 47   SER B OG    1 
ATOM   6934  N N     . GLY D 3 49  ? -91.876  -40.571 22.015 1.00 69.29  ? 48   GLY B N     1 
ATOM   6935  C CA    . GLY D 3 49  ? -92.767  -41.562 22.572 1.00 71.45  ? 48   GLY B CA    1 
ATOM   6936  C C     . GLY D 3 49  ? -92.005  -42.383 23.575 1.00 73.58  ? 48   GLY B C     1 
ATOM   6937  O O     . GLY D 3 49  ? -92.551  -42.798 24.598 1.00 74.94  ? 48   GLY B O     1 
ATOM   6938  N N     . LEU D 3 50  ? -90.729  -42.605 23.281 1.00 71.61  ? 49   LEU B N     1 
ATOM   6939  C CA    . LEU D 3 50  ? -89.850  -43.392 24.142 1.00 72.25  ? 49   LEU B CA    1 
ATOM   6940  C C     . LEU D 3 50  ? -89.553  -42.758 25.516 1.00 71.61  ? 49   LEU B C     1 
ATOM   6941  O O     . LEU D 3 50  ? -89.105  -43.438 26.445 1.00 72.18  ? 49   LEU B O     1 
ATOM   6942  C CB    . LEU D 3 50  ? -88.539  -43.655 23.402 1.00 74.40  ? 49   LEU B CB    1 
ATOM   6943  C CG    . LEU D 3 50  ? -88.640  -44.511 22.138 1.00 76.41  ? 49   LEU B CG    1 
ATOM   6944  C CD1   . LEU D 3 50  ? -87.322  -44.455 21.365 1.00 75.67  ? 49   LEU B CD1   1 
ATOM   6945  C CD2   . LEU D 3 50  ? -88.975  -45.941 22.528 1.00 76.50  ? 49   LEU B CD2   1 
ATOM   6946  N N     . ILE D 3 51  ? -89.805  -41.461 25.640 1.00 51.96  ? 50   ILE B N     1 
ATOM   6947  C CA    . ILE D 3 51  ? -89.547  -40.753 26.883 1.00 50.69  ? 50   ILE B CA    1 
ATOM   6948  C C     . ILE D 3 51  ? -90.244  -41.392 28.067 1.00 51.16  ? 50   ILE B C     1 
ATOM   6949  O O     . ILE D 3 51  ? -89.654  -41.624 29.124 1.00 50.37  ? 50   ILE B O     1 
ATOM   6950  C CB    . ILE D 3 51  ? -90.024  -39.287 26.784 1.00 64.76  ? 50   ILE B CB    1 
ATOM   6951  C CG1   . ILE D 3 51  ? -89.022  -38.476 25.963 1.00 65.31  ? 50   ILE B CG1   1 
ATOM   6952  C CG2   . ILE D 3 51  ? -90.241  -38.705 28.179 1.00 61.91  ? 50   ILE B CG2   1 
ATOM   6953  C CD1   . ILE D 3 51  ? -87.621  -38.486 26.530 1.00 63.15  ? 50   ILE B CD1   1 
ATOM   6954  N N     . TYR D 3 52  ? -91.523  -41.654 27.869 1.00 93.14  ? 51   TYR B N     1 
ATOM   6955  C CA    . TYR D 3 52  ? -92.361  -42.226 28.899 1.00 93.16  ? 51   TYR B CA    1 
ATOM   6956  C C     . TYR D 3 52  ? -91.721  -43.401 29.624 1.00 94.33  ? 51   TYR B C     1 
ATOM   6957  O O     . TYR D 3 52  ? -91.512  -43.345 30.840 1.00 94.60  ? 51   TYR B O     1 
ATOM   6958  C CB    . TYR D 3 52  ? -93.715  -42.596 28.312 1.00 68.89  ? 51   TYR B CB    1 
ATOM   6959  C CG    . TYR D 3 52  ? -94.315  -41.365 27.637 1.00 67.87  ? 51   TYR B CG    1 
ATOM   6960  C CD1   . TYR D 3 52  ? -94.844  -40.325 28.415 1.00 66.68  ? 51   TYR B CD1   1 
ATOM   6961  C CD2   . TYR D 3 52  ? -94.365  -41.248 26.254 1.00 65.19  ? 51   TYR B CD2   1 
ATOM   6962  C CE1   . TYR D 3 52  ? -95.346  -39.192 27.827 1.00 66.02  ? 51   TYR B CE1   1 
ATOM   6963  C CE2   . TYR D 3 52  ? -94.878  -40.099 25.664 1.00 64.72  ? 51   TYR B CE2   1 
ATOM   6964  C CZ    . TYR D 3 52  ? -95.364  -39.075 26.452 1.00 66.48  ? 51   TYR B CZ    1 
ATOM   6965  O OH    . TYR D 3 52  ? -95.861  -37.946 25.846 1.00 66.47  ? 51   TYR B OH    1 
ATOM   6966  N N     . GLU D 3 53  ? -91.397  -44.464 28.900 1.00 74.67  ? 52   GLU B N     1 
ATOM   6967  C CA    . GLU D 3 53  ? -90.785  -45.601 29.568 1.00 76.08  ? 52   GLU B CA    1 
ATOM   6968  C C     . GLU D 3 53  ? -89.475  -45.187 30.207 1.00 76.51  ? 52   GLU B C     1 
ATOM   6969  O O     . GLU D 3 53  ? -89.182  -45.597 31.323 1.00 75.36  ? 52   GLU B O     1 
ATOM   6970  C CB    . GLU D 3 53  ? -90.549  -46.760 28.592 1.00 80.57  ? 52   GLU B CB    1 
ATOM   6971  C CG    . GLU D 3 53  ? -91.707  -47.747 28.542 1.00 85.08  ? 52   GLU B CG    1 
ATOM   6972  C CD    . GLU D 3 53  ? -91.933  -48.451 29.877 1.00 86.74  ? 52   GLU B CD    1 
ATOM   6973  O OE1   . GLU D 3 53  ? -91.086  -49.287 30.257 1.00 89.06  ? 52   GLU B OE1   1 
ATOM   6974  O OE2   . GLU D 3 53  ? -92.948  -48.170 30.556 1.00 87.22  ? 52   GLU B OE2   1 
ATOM   6975  N N     . GLU D 3 54  ? -88.709  -44.351 29.501 1.00 60.46  ? 53   GLU B N     1 
ATOM   6976  C CA    . GLU D 3 54  ? -87.399  -43.874 29.959 1.00 58.65  ? 53   GLU B CA    1 
ATOM   6977  C C     . GLU D 3 54  ? -87.496  -43.170 31.310 1.00 56.68  ? 53   GLU B C     1 
ATOM   6978  O O     . GLU D 3 54  ? -86.773  -43.504 32.245 1.00 55.70  ? 53   GLU B O     1 
ATOM   6979  C CB    . GLU D 3 54  ? -86.794  -42.946 28.894 1.00 78.76  ? 53   GLU B CB    1 
ATOM   6980  C CG    . GLU D 3 54  ? -85.341  -42.545 29.124 1.00 86.81  ? 53   GLU B CG    1 
ATOM   6981  C CD    . GLU D 3 54  ? -84.408  -43.733 29.248 1.00 91.22  ? 53   GLU B CD    1 
ATOM   6982  O OE1   . GLU D 3 54  ? -84.637  -44.572 30.149 1.00 96.65  ? 53   GLU B OE1   1 
ATOM   6983  O OE2   . GLU D 3 54  ? -83.444  -43.825 28.454 1.00 92.01  ? 53   GLU B OE2   1 
ATOM   6984  N N     . THR D 3 55  ? -88.394  -42.198 31.403 1.00 47.83  ? 54   THR B N     1 
ATOM   6985  C CA    . THR D 3 55  ? -88.613  -41.472 32.641 1.00 46.74  ? 54   THR B CA    1 
ATOM   6986  C C     . THR D 3 55  ? -88.953  -42.525 33.663 1.00 48.83  ? 54   THR B C     1 
ATOM   6987  O O     . THR D 3 55  ? -88.411  -42.551 34.761 1.00 48.68  ? 54   THR B O     1 
ATOM   6988  C CB    . THR D 3 55  ? -89.790  -40.526 32.502 1.00 51.32  ? 54   THR B CB    1 
ATOM   6989  O OG1   . THR D 3 55  ? -89.639  -39.785 31.287 1.00 51.28  ? 54   THR B OG1   1 
ATOM   6990  C CG2   . THR D 3 55  ? -89.838  -39.557 33.652 1.00 49.90  ? 54   THR B CG2   1 
ATOM   6991  N N     . ARG D 3 56  ? -89.853  -43.415 33.270 1.00 55.07  ? 55   ARG B N     1 
ATOM   6992  C CA    . ARG D 3 56  ? -90.300  -44.517 34.115 1.00 56.38  ? 55   ARG B CA    1 
ATOM   6993  C C     . ARG D 3 56  ? -89.080  -45.259 34.686 1.00 55.65  ? 55   ARG B C     1 
ATOM   6994  O O     . ARG D 3 56  ? -89.041  -45.600 35.860 1.00 55.28  ? 55   ARG B O     1 
ATOM   6995  C CB    . ARG D 3 56  ? -91.187  -45.449 33.275 1.00 63.01  ? 55   ARG B CB    1 
ATOM   6996  C CG    . ARG D 3 56  ? -92.127  -46.359 34.068 1.00 67.49  ? 55   ARG B CG    1 
ATOM   6997  C CD    . ARG D 3 56  ? -93.261  -46.920 33.173 1.00 68.99  ? 55   ARG B CD    1 
ATOM   6998  N NE    . ARG D 3 56  ? -94.336  -45.945 32.975 1.00 70.56  ? 55   ARG B NE    1 
ATOM   6999  C CZ    . ARG D 3 56  ? -94.908  -45.681 31.805 1.00 72.51  ? 55   ARG B CZ    1 
ATOM   7000  N NH1   . ARG D 3 56  ? -94.513  -46.318 30.713 1.00 71.74  ? 55   ARG B NH1   1 
ATOM   7001  N NH2   . ARG D 3 56  ? -95.866  -44.766 31.726 1.00 76.37  ? 55   ARG B NH2   1 
ATOM   7002  N N     . GLY D 3 57  ? -88.073  -45.477 33.853 1.00 60.07  ? 56   GLY B N     1 
ATOM   7003  C CA    . GLY D 3 57  ? -86.883  -46.162 34.314 1.00 60.16  ? 56   GLY B CA    1 
ATOM   7004  C C     . GLY D 3 57  ? -86.148  -45.342 35.352 1.00 60.61  ? 56   GLY B C     1 
ATOM   7005  O O     . GLY D 3 57  ? -85.839  -45.839 36.438 1.00 61.82  ? 56   GLY B O     1 
ATOM   7006  N N     . VAL D 3 58  ? -85.877  -44.084 35.008 1.00 65.92  ? 57   VAL B N     1 
ATOM   7007  C CA    . VAL D 3 58  ? -85.181  -43.145 35.878 1.00 62.32  ? 57   VAL B CA    1 
ATOM   7008  C C     . VAL D 3 58  ? -85.841  -43.051 37.259 1.00 63.16  ? 57   VAL B C     1 
ATOM   7009  O O     . VAL D 3 58  ? -85.164  -43.149 38.292 1.00 62.96  ? 57   VAL B O     1 
ATOM   7010  C CB    . VAL D 3 58  ? -85.144  -41.735 35.235 1.00 53.79  ? 57   VAL B CB    1 
ATOM   7011  C CG1   . VAL D 3 58  ? -84.581  -40.728 36.208 1.00 54.42  ? 57   VAL B CG1   1 
ATOM   7012  C CG2   . VAL D 3 58  ? -84.295  -41.758 33.976 1.00 51.77  ? 57   VAL B CG2   1 
ATOM   7013  N N     . LEU D 3 59  ? -87.159  -42.865 37.282 1.00 58.90  ? 58   LEU B N     1 
ATOM   7014  C CA    . LEU D 3 59  ? -87.882  -42.759 38.545 1.00 57.84  ? 58   LEU B CA    1 
ATOM   7015  C C     . LEU D 3 59  ? -87.707  -43.990 39.445 1.00 58.41  ? 58   LEU B C     1 
ATOM   7016  O O     . LEU D 3 59  ? -87.664  -43.874 40.677 1.00 59.61  ? 58   LEU B O     1 
ATOM   7017  C CB    . LEU D 3 59  ? -89.367  -42.526 38.281 1.00 48.46  ? 58   LEU B CB    1 
ATOM   7018  C CG    . LEU D 3 59  ? -90.244  -42.595 39.531 1.00 45.57  ? 58   LEU B CG    1 
ATOM   7019  C CD1   . LEU D 3 59  ? -89.768  -41.611 40.574 1.00 44.07  ? 58   LEU B CD1   1 
ATOM   7020  C CD2   . LEU D 3 59  ? -91.679  -42.308 39.144 1.00 45.14  ? 58   LEU B CD2   1 
ATOM   7021  N N     . LYS D 3 60  ? -87.608  -45.165 38.829 1.00 66.06  ? 59   LYS B N     1 
ATOM   7022  C CA    . LYS D 3 60  ? -87.433  -46.401 39.588 1.00 67.09  ? 59   LYS B CA    1 
ATOM   7023  C C     . LYS D 3 60  ? -86.105  -46.357 40.341 1.00 65.21  ? 59   LYS B C     1 
ATOM   7024  O O     . LYS D 3 60  ? -86.077  -46.522 41.559 1.00 65.43  ? 59   LYS B O     1 
ATOM   7025  C CB    . LYS D 3 60  ? -87.473  -47.615 38.649 1.00 65.79  ? 59   LYS B CB    1 
ATOM   7026  C CG    . LYS D 3 60  ? -87.547  -48.961 39.350 1.00 69.19  ? 59   LYS B CG    1 
ATOM   7027  C CD    . LYS D 3 60  ? -87.468  -50.074 38.333 1.00 72.23  ? 59   LYS B CD    1 
ATOM   7028  C CE    . LYS D 3 60  ? -87.325  -51.431 38.997 1.00 74.11  ? 59   LYS B CE    1 
ATOM   7029  N NZ    . LYS D 3 60  ? -87.260  -52.538 37.998 1.00 73.93  ? 59   LYS B NZ    1 
ATOM   7030  N N     . VAL D 3 61  ? -85.012  -46.128 39.613 1.00 64.38  ? 60   VAL B N     1 
ATOM   7031  C CA    . VAL D 3 61  ? -83.688  -46.047 40.225 1.00 63.58  ? 60   VAL B CA    1 
ATOM   7032  C C     . VAL D 3 61  ? -83.694  -44.976 41.329 1.00 62.44  ? 60   VAL B C     1 
ATOM   7033  O O     . VAL D 3 61  ? -83.132  -45.182 42.412 1.00 62.43  ? 60   VAL B O     1 
ATOM   7034  C CB    . VAL D 3 61  ? -82.585  -45.698 39.175 1.00 48.27  ? 60   VAL B CB    1 
ATOM   7035  C CG1   . VAL D 3 61  ? -81.274  -45.348 39.879 1.00 48.93  ? 60   VAL B CG1   1 
ATOM   7036  C CG2   . VAL D 3 61  ? -82.344  -46.866 38.261 1.00 47.99  ? 60   VAL B CG2   1 
ATOM   7037  N N     . PHE D 3 62  ? -84.335  -43.839 41.068 1.00 62.33  ? 61   PHE B N     1 
ATOM   7038  C CA    . PHE D 3 62  ? -84.388  -42.795 42.078 1.00 62.59  ? 61   PHE B CA    1 
ATOM   7039  C C     . PHE D 3 62  ? -84.927  -43.322 43.393 1.00 63.03  ? 61   PHE B C     1 
ATOM   7040  O O     . PHE D 3 62  ? -84.267  -43.203 44.417 1.00 62.56  ? 61   PHE B O     1 
ATOM   7041  C CB    . PHE D 3 62  ? -85.269  -41.648 41.639 1.00 56.17  ? 61   PHE B CB    1 
ATOM   7042  C CG    . PHE D 3 62  ? -85.270  -40.494 42.593 1.00 58.31  ? 61   PHE B CG    1 
ATOM   7043  C CD1   . PHE D 3 62  ? -84.218  -39.599 42.613 1.00 58.52  ? 61   PHE B CD1   1 
ATOM   7044  C CD2   . PHE D 3 62  ? -86.334  -40.302 43.472 1.00 59.42  ? 61   PHE B CD2   1 
ATOM   7045  C CE1   . PHE D 3 62  ? -84.227  -38.515 43.497 1.00 56.70  ? 61   PHE B CE1   1 
ATOM   7046  C CE2   . PHE D 3 62  ? -86.355  -39.219 44.365 1.00 59.05  ? 61   PHE B CE2   1 
ATOM   7047  C CZ    . PHE D 3 62  ? -85.303  -38.327 44.379 1.00 57.57  ? 61   PHE B CZ    1 
ATOM   7048  N N     . LEU D 3 63  ? -86.126  -43.901 43.373 1.00 63.00  ? 62   LEU B N     1 
ATOM   7049  C CA    . LEU D 3 63  ? -86.723  -44.432 44.602 1.00 63.21  ? 62   LEU B CA    1 
ATOM   7050  C C     . LEU D 3 63  ? -85.908  -45.582 45.188 1.00 64.98  ? 62   LEU B C     1 
ATOM   7051  O O     . LEU D 3 63  ? -85.753  -45.679 46.405 1.00 65.05  ? 62   LEU B O     1 
ATOM   7052  C CB    . LEU D 3 63  ? -88.161  -44.874 44.342 1.00 58.42  ? 62   LEU B CB    1 
ATOM   7053  C CG    . LEU D 3 63  ? -89.071  -43.718 43.916 1.00 59.72  ? 62   LEU B CG    1 
ATOM   7054  C CD1   . LEU D 3 63  ? -90.360  -44.255 43.326 1.00 60.41  ? 62   LEU B CD1   1 
ATOM   7055  C CD2   . LEU D 3 63  ? -89.364  -42.841 45.101 1.00 58.47  ? 62   LEU B CD2   1 
ATOM   7056  N N     . GLU D 3 64  ? -85.372  -46.450 44.340 1.00 66.84  ? 63   GLU B N     1 
ATOM   7057  C CA    . GLU D 3 64  ? -84.570  -47.542 44.869 1.00 69.23  ? 63   GLU B CA    1 
ATOM   7058  C C     . GLU D 3 64  ? -83.478  -46.981 45.760 1.00 69.07  ? 63   GLU B C     1 
ATOM   7059  O O     . GLU D 3 64  ? -83.289  -47.455 46.883 1.00 67.88  ? 63   GLU B O     1 
ATOM   7060  C CB    . GLU D 3 64  ? -83.925  -48.367 43.754 1.00 64.23  ? 63   GLU B CB    1 
ATOM   7061  C CG    . GLU D 3 64  ? -84.906  -49.232 43.032 1.00 71.00  ? 63   GLU B CG    1 
ATOM   7062  C CD    . GLU D 3 64  ? -84.383  -49.722 41.710 1.00 75.36  ? 63   GLU B CD    1 
ATOM   7063  O OE1   . GLU D 3 64  ? -83.835  -48.890 40.953 1.00 79.33  ? 63   GLU B OE1   1 
ATOM   7064  O OE2   . GLU D 3 64  ? -84.537  -50.930 41.420 1.00 76.83  ? 63   GLU B OE2   1 
ATOM   7065  N N     . ASN D 3 65  ? -82.776  -45.958 45.275 1.00 66.71  ? 64   ASN B N     1 
ATOM   7066  C CA    . ASN D 3 65  ? -81.686  -45.370 46.041 1.00 67.12  ? 64   ASN B CA    1 
ATOM   7067  C C     . ASN D 3 65  ? -82.082  -44.685 47.332 1.00 66.37  ? 64   ASN B C     1 
ATOM   7068  O O     . ASN D 3 65  ? -81.437  -44.887 48.367 1.00 66.21  ? 64   ASN B O     1 
ATOM   7069  C CB    . ASN D 3 65  ? -80.896  -44.392 45.185 1.00 58.36  ? 64   ASN B CB    1 
ATOM   7070  C CG    . ASN D 3 65  ? -80.145  -45.081 44.081 1.00 60.26  ? 64   ASN B CG    1 
ATOM   7071  O OD1   . ASN D 3 65  ? -79.611  -46.175 44.270 1.00 63.30  ? 64   ASN B OD1   1 
ATOM   7072  N ND2   . ASN D 3 65  ? -80.085  -44.444 42.913 1.00 61.91  ? 64   ASN B ND2   1 
ATOM   7073  N N     . VAL D 3 66  ? -83.135  -43.883 47.292 1.00 54.83  ? 65   VAL B N     1 
ATOM   7074  C CA    . VAL D 3 66  ? -83.522  -43.191 48.495 1.00 54.91  ? 65   VAL B CA    1 
ATOM   7075  C C     . VAL D 3 66  ? -84.256  -44.093 49.489 1.00 54.47  ? 65   VAL B C     1 
ATOM   7076  O O     . VAL D 3 66  ? -84.008  -44.022 50.700 1.00 53.68  ? 65   VAL B O     1 
ATOM   7077  C CB    . VAL D 3 66  ? -84.335  -41.915 48.147 1.00 50.86  ? 65   VAL B CB    1 
ATOM   7078  C CG1   . VAL D 3 66  ? -84.834  -42.016 46.742 1.00 51.01  ? 65   VAL B CG1   1 
ATOM   7079  C CG2   . VAL D 3 66  ? -85.489  -41.708 49.135 1.00 52.23  ? 65   VAL B CG2   1 
ATOM   7080  N N     . ILE D 3 67  ? -85.134  -44.963 49.001 1.00 65.90  ? 66   ILE B N     1 
ATOM   7081  C CA    . ILE D 3 67  ? -85.853  -45.848 49.912 1.00 64.47  ? 66   ILE B CA    1 
ATOM   7082  C C     . ILE D 3 67  ? -84.881  -46.810 50.578 1.00 64.93  ? 66   ILE B C     1 
ATOM   7083  O O     . ILE D 3 67  ? -84.973  -47.050 51.778 1.00 64.60  ? 66   ILE B O     1 
ATOM   7084  C CB    . ILE D 3 67  ? -86.969  -46.633 49.178 1.00 57.98  ? 66   ILE B CB    1 
ATOM   7085  C CG1   . ILE D 3 67  ? -88.162  -45.705 48.927 1.00 56.33  ? 66   ILE B CG1   1 
ATOM   7086  C CG2   . ILE D 3 67  ? -87.417  -47.821 50.000 1.00 55.72  ? 66   ILE B CG2   1 
ATOM   7087  C CD1   . ILE D 3 67  ? -89.274  -46.323 48.130 1.00 52.82  ? 66   ILE B CD1   1 
ATOM   7088  N N     . ARG D 3 68  ? -83.937  -47.345 49.812 1.00 54.97  ? 67   ARG B N     1 
ATOM   7089  C CA    . ARG D 3 68  ? -82.980  -48.269 50.390 1.00 57.32  ? 67   ARG B CA    1 
ATOM   7090  C C     . ARG D 3 68  ? -82.305  -47.650 51.608 1.00 58.61  ? 67   ARG B C     1 
ATOM   7091  O O     . ARG D 3 68  ? -82.228  -48.281 52.665 1.00 57.57  ? 67   ARG B O     1 
ATOM   7092  C CB    . ARG D 3 68  ? -81.913  -48.665 49.381 1.00 70.72  ? 67   ARG B CB    1 
ATOM   7093  C CG    . ARG D 3 68  ? -80.901  -49.643 49.952 1.00 73.87  ? 67   ARG B CG    1 
ATOM   7094  C CD    . ARG D 3 68  ? -79.617  -49.678 49.131 1.00 78.03  ? 67   ARG B CD    1 
ATOM   7095  N NE    . ARG D 3 68  ? -79.841  -50.151 47.767 1.00 84.12  ? 67   ARG B NE    1 
ATOM   7096  C CZ    . ARG D 3 68  ? -79.586  -49.435 46.675 1.00 87.30  ? 67   ARG B CZ    1 
ATOM   7097  N NH1   . ARG D 3 68  ? -79.097  -48.206 46.790 1.00 89.98  ? 67   ARG B NH1   1 
ATOM   7098  N NH2   . ARG D 3 68  ? -79.818  -49.948 45.470 1.00 88.80  ? 67   ARG B NH2   1 
ATOM   7099  N N     . ASP D 3 69  ? -81.812  -46.420 51.474 1.00 70.13  ? 68   ASP B N     1 
ATOM   7100  C CA    . ASP D 3 69  ? -81.154  -45.780 52.613 1.00 70.34  ? 68   ASP B CA    1 
ATOM   7101  C C     . ASP D 3 69  ? -82.176  -45.498 53.709 1.00 67.95  ? 68   ASP B C     1 
ATOM   7102  O O     . ASP D 3 69  ? -81.897  -45.707 54.891 1.00 67.21  ? 68   ASP B O     1 
ATOM   7103  C CB    . ASP D 3 69  ? -80.448  -44.467 52.212 1.00 69.78  ? 68   ASP B CB    1 
ATOM   7104  C CG    . ASP D 3 69  ? -79.164  -44.694 51.407 1.00 74.84  ? 68   ASP B CG    1 
ATOM   7105  O OD1   . ASP D 3 69  ? -78.626  -45.822 51.398 1.00 79.42  ? 68   ASP B OD1   1 
ATOM   7106  O OD2   . ASP D 3 69  ? -78.681  -43.726 50.786 1.00 75.75  ? 68   ASP B OD2   1 
ATOM   7107  N N     . ALA D 3 70  ? -83.363  -45.034 53.317 1.00 60.12  ? 69   ALA B N     1 
ATOM   7108  C CA    . ALA D 3 70  ? -84.420  -44.733 54.288 1.00 58.10  ? 69   ALA B CA    1 
ATOM   7109  C C     . ALA D 3 70  ? -84.696  -45.946 55.136 1.00 58.08  ? 69   ALA B C     1 
ATOM   7110  O O     . ALA D 3 70  ? -84.687  -45.868 56.348 1.00 57.52  ? 69   ALA B O     1 
ATOM   7111  C CB    . ALA D 3 70  ? -85.685  -44.317 53.585 1.00 47.41  ? 69   ALA B CB    1 
ATOM   7112  N N     . VAL D 3 71  ? -84.947  -47.069 54.477 1.00 69.80  ? 70   VAL B N     1 
ATOM   7113  C CA    . VAL D 3 71  ? -85.220  -48.320 55.160 1.00 70.66  ? 70   VAL B CA    1 
ATOM   7114  C C     . VAL D 3 71  ? -84.035  -48.701 56.040 1.00 71.26  ? 70   VAL B C     1 
ATOM   7115  O O     . VAL D 3 71  ? -84.206  -49.246 57.135 1.00 72.89  ? 70   VAL B O     1 
ATOM   7116  C CB    . VAL D 3 71  ? -85.506  -49.425 54.135 1.00 66.01  ? 70   VAL B CB    1 
ATOM   7117  C CG1   . VAL D 3 71  ? -85.125  -50.783 54.695 1.00 64.48  ? 70   VAL B CG1   1 
ATOM   7118  C CG2   . VAL D 3 71  ? -86.983  -49.393 53.768 1.00 64.99  ? 70   VAL B CG2   1 
ATOM   7119  N N     . THR D 3 72  ? -82.832  -48.404 55.564 1.00 56.36  ? 71   THR B N     1 
ATOM   7120  C CA    . THR D 3 72  ? -81.638  -48.700 56.340 1.00 55.70  ? 71   THR B CA    1 
ATOM   7121  C C     . THR D 3 72  ? -81.640  -47.931 57.657 1.00 56.63  ? 71   THR B C     1 
ATOM   7122  O O     . THR D 3 72  ? -81.128  -48.399 58.665 1.00 54.78  ? 71   THR B O     1 
ATOM   7123  C CB    . THR D 3 72  ? -80.384  -48.351 55.558 1.00 45.35  ? 71   THR B CB    1 
ATOM   7124  O OG1   . THR D 3 72  ? -80.213  -49.309 54.512 1.00 48.26  ? 71   THR B OG1   1 
ATOM   7125  C CG2   . THR D 3 72  ? -79.167  -48.376 56.455 1.00 41.74  ? 71   THR B CG2   1 
ATOM   7126  N N     . TYR D 3 73  ? -82.178  -46.707 57.611 1.00 60.23  ? 72   TYR B N     1 
ATOM   7127  C CA    . TYR D 3 73  ? -82.276  -45.966 58.855 1.00 64.06  ? 72   TYR B CA    1 
ATOM   7128  C C     . TYR D 3 73  ? -83.316  -46.675 59.697 1.00 66.84  ? 72   TYR B C     1 
ATOM   7129  O O     . TYR D 3 73  ? -83.056  -47.069 60.845 1.00 66.82  ? 72   TYR B O     1 
ATOM   7130  C CB    . TYR D 3 73  ? -82.668  -44.482 58.614 1.00 63.53  ? 72   TYR B CB    1 
ATOM   7131  C CG    . TYR D 3 73  ? -81.461  -43.666 58.244 1.00 64.40  ? 72   TYR B CG    1 
ATOM   7132  C CD1   . TYR D 3 73  ? -81.359  -42.944 57.045 1.00 64.02  ? 72   TYR B CD1   1 
ATOM   7133  C CD2   . TYR D 3 73  ? -80.365  -43.652 59.118 1.00 66.00  ? 72   TYR B CD2   1 
ATOM   7134  C CE1   . TYR D 3 73  ? -80.185  -42.242 56.732 1.00 64.53  ? 72   TYR B CE1   1 
ATOM   7135  C CE2   . TYR D 3 73  ? -79.197  -42.956 58.800 1.00 66.51  ? 72   TYR B CE2   1 
ATOM   7136  C CZ    . TYR D 3 73  ? -79.113  -42.264 57.618 1.00 65.26  ? 72   TYR B CZ    1 
ATOM   7137  O OH    . TYR D 3 73  ? -77.941  -41.586 57.318 1.00 64.41  ? 72   TYR B OH    1 
ATOM   7138  N N     . THR D 3 74  ? -84.513  -46.837 59.140 1.00 71.72  ? 73   THR B N     1 
ATOM   7139  C CA    . THR D 3 74  ? -85.603  -47.525 59.827 1.00 74.24  ? 73   THR B CA    1 
ATOM   7140  C C     . THR D 3 74  ? -85.070  -48.811 60.453 1.00 76.65  ? 73   THR B C     1 
ATOM   7141  O O     . THR D 3 74  ? -85.332  -49.098 61.619 1.00 76.97  ? 73   THR B O     1 
ATOM   7142  C CB    . THR D 3 74  ? -86.749  -47.878 58.848 1.00 79.88  ? 73   THR B CB    1 
ATOM   7143  O OG1   . THR D 3 74  ? -87.397  -46.678 58.414 1.00 81.38  ? 73   THR B OG1   1 
ATOM   7144  C CG2   . THR D 3 74  ? -87.769  -48.771 59.517 1.00 79.74  ? 73   THR B CG2   1 
ATOM   7145  N N     . GLU D 3 75  ? -84.311  -49.581 59.684 1.00 64.43  ? 74   GLU B N     1 
ATOM   7146  C CA    . GLU D 3 75  ? -83.765  -50.808 60.226 1.00 68.53  ? 74   GLU B CA    1 
ATOM   7147  C C     . GLU D 3 75  ? -82.919  -50.482 61.454 1.00 67.97  ? 74   GLU B C     1 
ATOM   7148  O O     . GLU D 3 75  ? -83.319  -50.774 62.569 1.00 66.63  ? 74   GLU B O     1 
ATOM   7149  C CB    . GLU D 3 75  ? -82.898  -51.530 59.201 1.00 106.40 ? 74   GLU B CB    1 
ATOM   7150  C CG    . GLU D 3 75  ? -82.439  -52.892 59.683 1.00 115.47 ? 74   GLU B CG    1 
ATOM   7151  C CD    . GLU D 3 75  ? -83.235  -54.017 59.066 1.00 120.93 ? 74   GLU B CD    1 
ATOM   7152  O OE1   . GLU D 3 75  ? -83.237  -55.133 59.631 1.00 122.89 ? 74   GLU B OE1   1 
ATOM   7153  O OE2   . GLU D 3 75  ? -83.847  -53.787 58.003 1.00 123.84 ? 74   GLU B OE2   1 
ATOM   7154  N N     . HIS D 3 76  ? -81.756  -49.869 61.249 1.00 74.98  ? 75   HIS B N     1 
ATOM   7155  C CA    . HIS D 3 76  ? -80.857  -49.515 62.346 1.00 75.15  ? 75   HIS B CA    1 
ATOM   7156  C C     . HIS D 3 76  ? -81.592  -49.050 63.603 1.00 77.33  ? 75   HIS B C     1 
ATOM   7157  O O     . HIS D 3 76  ? -81.114  -49.244 64.721 1.00 77.95  ? 75   HIS B O     1 
ATOM   7158  C CB    . HIS D 3 76  ? -79.886  -48.408 61.909 1.00 69.61  ? 75   HIS B CB    1 
ATOM   7159  C CG    . HIS D 3 76  ? -78.946  -47.978 62.993 1.00 64.98  ? 75   HIS B CG    1 
ATOM   7160  N ND1   . HIS D 3 76  ? -77.775  -48.650 63.273 1.00 65.09  ? 75   HIS B ND1   1 
ATOM   7161  C CD2   . HIS D 3 76  ? -79.055  -47.007 63.933 1.00 62.42  ? 75   HIS B CD2   1 
ATOM   7162  C CE1   . HIS D 3 76  ? -77.207  -48.116 64.340 1.00 64.71  ? 75   HIS B CE1   1 
ATOM   7163  N NE2   . HIS D 3 76  ? -77.965  -47.118 64.761 1.00 62.45  ? 75   HIS B NE2   1 
ATOM   7164  N N     . ALA D 3 77  ? -82.748  -48.424 63.410 1.00 86.68  ? 76   ALA B N     1 
ATOM   7165  C CA    . ALA D 3 77  ? -83.558  -47.915 64.515 1.00 86.87  ? 76   ALA B CA    1 
ATOM   7166  C C     . ALA D 3 77  ? -84.427  -49.004 65.159 1.00 86.59  ? 76   ALA B C     1 
ATOM   7167  O O     . ALA D 3 77  ? -85.159  -48.748 66.115 1.00 86.55  ? 76   ALA B O     1 
ATOM   7168  C CB    . ALA D 3 77  ? -84.445  -46.773 64.009 1.00 49.82  ? 76   ALA B CB    1 
ATOM   7169  N N     . LYS D 3 78  ? -84.334  -50.218 64.637 1.00 80.92  ? 77   LYS B N     1 
ATOM   7170  C CA    . LYS D 3 78  ? -85.126  -51.316 65.143 1.00 80.05  ? 77   LYS B CA    1 
ATOM   7171  C C     . LYS D 3 78  ? -86.579  -50.876 65.080 1.00 79.37  ? 77   LYS B C     1 
ATOM   7172  O O     . LYS D 3 78  ? -87.244  -50.705 66.100 1.00 78.64  ? 77   LYS B O     1 
ATOM   7173  C CB    . LYS D 3 78  ? -84.712  -51.654 66.575 1.00 82.91  ? 77   LYS B CB    1 
ATOM   7174  C CG    . LYS D 3 78  ? -83.353  -52.337 66.664 1.00 84.06  ? 77   LYS B CG    1 
ATOM   7175  C CD    . LYS D 3 78  ? -82.743  -52.190 68.053 1.00 85.78  ? 77   LYS B CD    1 
ATOM   7176  C CE    . LYS D 3 78  ? -81.297  -52.674 68.090 1.00 86.61  ? 77   LYS B CE    1 
ATOM   7177  N NZ    . LYS D 3 78  ? -80.610  -52.256 69.353 1.00 85.58  ? 77   LYS B NZ    1 
ATOM   7178  N N     . ARG D 3 79  ? -87.059  -50.658 63.864 1.00 66.38  ? 78   ARG B N     1 
ATOM   7179  C CA    . ARG D 3 79  ? -88.435  -50.252 63.661 1.00 65.06  ? 78   ARG B CA    1 
ATOM   7180  C C     . ARG D 3 79  ? -88.995  -51.019 62.495 1.00 64.42  ? 78   ARG B C     1 
ATOM   7181  O O     . ARG D 3 79  ? -88.255  -51.676 61.773 1.00 62.65  ? 78   ARG B O     1 
ATOM   7182  C CB    . ARG D 3 79  ? -88.534  -48.752 63.388 1.00 95.91  ? 78   ARG B CB    1 
ATOM   7183  C CG    . ARG D 3 79  ? -88.415  -47.905 64.637 1.00 96.50  ? 78   ARG B CG    1 
ATOM   7184  C CD    . ARG D 3 79  ? -88.907  -46.473 64.415 1.00 96.03  ? 78   ARG B CD    1 
ATOM   7185  N NE    . ARG D 3 79  ? -87.815  -45.513 64.255 1.00 96.08  ? 78   ARG B NE    1 
ATOM   7186  C CZ    . ARG D 3 79  ? -87.301  -45.138 63.088 1.00 95.20  ? 78   ARG B CZ    1 
ATOM   7187  N NH1   . ARG D 3 79  ? -87.778  -45.632 61.953 1.00 96.22  ? 78   ARG B NH1   1 
ATOM   7188  N NH2   . ARG D 3 79  ? -86.295  -44.277 63.064 1.00 93.15  ? 78   ARG B NH2   1 
ATOM   7189  N N     . LYS D 3 80  ? -90.308  -50.953 62.326 1.00 80.28  ? 79   LYS B N     1 
ATOM   7190  C CA    . LYS D 3 80  ? -90.976  -51.634 61.229 1.00 81.15  ? 79   LYS B CA    1 
ATOM   7191  C C     . LYS D 3 80  ? -91.765  -50.569 60.495 1.00 80.23  ? 79   LYS B C     1 
ATOM   7192  O O     . LYS D 3 80  ? -92.571  -50.857 59.606 1.00 79.34  ? 79   LYS B O     1 
ATOM   7193  C CB    . LYS D 3 80  ? -91.913  -52.722 61.766 1.00 125.13 ? 79   LYS B CB    1 
ATOM   7194  C CG    . LYS D 3 80  ? -91.236  -54.063 62.030 1.00 128.13 ? 79   LYS B CG    1 
ATOM   7195  C CD    . LYS D 3 80  ? -90.787  -54.706 60.721 1.00 132.46 ? 79   LYS B CD    1 
ATOM   7196  C CE    . LYS D 3 80  ? -90.097  -56.043 60.950 1.00 134.90 ? 79   LYS B CE    1 
ATOM   7197  N NZ    . LYS D 3 80  ? -89.696  -56.687 59.664 1.00 135.00 ? 79   LYS B NZ    1 
ATOM   7198  N N     . THR D 3 81  ? -91.496  -49.325 60.868 1.00 92.18  ? 80   THR B N     1 
ATOM   7199  C CA    . THR D 3 81  ? -92.178  -48.190 60.278 1.00 91.17  ? 80   THR B CA    1 
ATOM   7200  C C     . THR D 3 81  ? -91.254  -47.108 59.702 1.00 89.42  ? 80   THR B C     1 
ATOM   7201  O O     . THR D 3 81  ? -90.532  -46.434 60.438 1.00 90.54  ? 80   THR B O     1 
ATOM   7202  C CB    . THR D 3 81  ? -93.097  -47.548 61.323 1.00 86.90  ? 80   THR B CB    1 
ATOM   7203  O OG1   . THR D 3 81  ? -93.927  -48.562 61.897 1.00 86.93  ? 80   THR B OG1   1 
ATOM   7204  C CG2   . THR D 3 81  ? -93.965  -46.471 60.700 1.00 85.32  ? 80   THR B CG2   1 
ATOM   7205  N N     . VAL D 3 82  ? -91.279  -46.948 58.384 1.00 61.88  ? 81   VAL B N     1 
ATOM   7206  C CA    . VAL D 3 82  ? -90.479  -45.921 57.732 1.00 57.59  ? 81   VAL B CA    1 
ATOM   7207  C C     . VAL D 3 82  ? -91.055  -44.542 58.046 1.00 56.21  ? 81   VAL B C     1 
ATOM   7208  O O     . VAL D 3 82  ? -92.167  -44.229 57.632 1.00 55.56  ? 81   VAL B O     1 
ATOM   7209  C CB    . VAL D 3 82  ? -90.498  -46.089 56.219 1.00 56.22  ? 81   VAL B CB    1 
ATOM   7210  C CG1   . VAL D 3 82  ? -89.970  -44.815 55.569 1.00 53.46  ? 81   VAL B CG1   1 
ATOM   7211  C CG2   . VAL D 3 82  ? -89.668  -47.301 55.821 1.00 55.89  ? 81   VAL B CG2   1 
ATOM   7212  N N     . THR D 3 83  ? -90.299  -43.706 58.745 1.00 57.44  ? 82   THR B N     1 
ATOM   7213  C CA    . THR D 3 83  ? -90.792  -42.382 59.109 1.00 56.78  ? 82   THR B CA    1 
ATOM   7214  C C     . THR D 3 83  ? -90.395  -41.273 58.143 1.00 57.94  ? 82   THR B C     1 
ATOM   7215  O O     . THR D 3 83  ? -89.452  -41.416 57.346 1.00 56.89  ? 82   THR B O     1 
ATOM   7216  C CB    . THR D 3 83  ? -90.340  -42.014 60.527 1.00 59.03  ? 82   THR B CB    1 
ATOM   7217  O OG1   . THR D 3 83  ? -88.920  -42.168 60.651 1.00 57.78  ? 82   THR B OG1   1 
ATOM   7218  C CG2   . THR D 3 83  ? -90.998  -42.944 61.527 1.00 60.58  ? 82   THR B CG2   1 
ATOM   7219  N N     . ALA D 3 84  ? -91.127  -40.165 58.198 1.00 67.44  ? 83   ALA B N     1 
ATOM   7220  C CA    . ALA D 3 84  ? -90.830  -39.052 57.311 1.00 69.84  ? 83   ALA B CA    1 
ATOM   7221  C C     . ALA D 3 84  ? -89.350  -38.733 57.432 1.00 71.04  ? 83   ALA B C     1 
ATOM   7222  O O     . ALA D 3 84  ? -88.670  -38.541 56.429 1.00 71.29  ? 83   ALA B O     1 
ATOM   7223  C CB    . ALA D 3 84  ? -91.672  -37.841 57.674 1.00 59.19  ? 83   ALA B CB    1 
ATOM   7224  N N     . MET D 3 85  ? -88.849  -38.695 58.661 1.00 67.44  ? 84   MET B N     1 
ATOM   7225  C CA    . MET D 3 85  ? -87.440  -38.414 58.878 1.00 67.12  ? 84   MET B CA    1 
ATOM   7226  C C     . MET D 3 85  ? -86.543  -39.398 58.132 1.00 65.92  ? 84   MET B C     1 
ATOM   7227  O O     . MET D 3 85  ? -85.635  -38.973 57.421 1.00 65.34  ? 84   MET B O     1 
ATOM   7228  C CB    . MET D 3 85  ? -87.107  -38.426 60.365 1.00 64.05  ? 84   MET B CB    1 
ATOM   7229  C CG    . MET D 3 85  ? -87.669  -37.244 61.099 1.00 70.70  ? 84   MET B CG    1 
ATOM   7230  S SD    . MET D 3 85  ? -87.319  -35.723 60.204 1.00 77.52  ? 84   MET B SD    1 
ATOM   7231  C CE    . MET D 3 85  ? -85.830  -35.222 60.956 1.00 74.14  ? 84   MET B CE    1 
ATOM   7232  N N     . ASP D 3 86  ? -86.783  -40.701 58.281 1.00 64.34  ? 85   ASP B N     1 
ATOM   7233  C CA    . ASP D 3 86  ? -85.976  -41.693 57.568 1.00 65.44  ? 85   ASP B CA    1 
ATOM   7234  C C     . ASP D 3 86  ? -85.775  -41.223 56.127 1.00 64.67  ? 85   ASP B C     1 
ATOM   7235  O O     . ASP D 3 86  ? -84.668  -41.253 55.585 1.00 63.75  ? 85   ASP B O     1 
ATOM   7236  C CB    . ASP D 3 86  ? -86.678  -43.050 57.547 1.00 72.12  ? 85   ASP B CB    1 
ATOM   7237  C CG    . ASP D 3 86  ? -86.809  -43.654 58.917 1.00 74.10  ? 85   ASP B CG    1 
ATOM   7238  O OD1   . ASP D 3 86  ? -85.786  -43.730 59.626 1.00 76.34  ? 85   ASP B OD1   1 
ATOM   7239  O OD2   . ASP D 3 86  ? -87.927  -44.062 59.282 1.00 77.25  ? 85   ASP B OD2   1 
ATOM   7240  N N     . VAL D 3 87  ? -86.863  -40.788 55.507 1.00 73.47  ? 86   VAL B N     1 
ATOM   7241  C CA    . VAL D 3 87  ? -86.794  -40.299 54.147 1.00 71.62  ? 86   VAL B CA    1 
ATOM   7242  C C     . VAL D 3 87  ? -85.961  -39.020 54.102 1.00 70.56  ? 86   VAL B C     1 
ATOM   7243  O O     . VAL D 3 87  ? -85.027  -38.912 53.319 1.00 70.42  ? 86   VAL B O     1 
ATOM   7244  C CB    . VAL D 3 87  ? -88.210  -40.055 53.601 1.00 74.17  ? 86   VAL B CB    1 
ATOM   7245  C CG1   . VAL D 3 87  ? -88.158  -39.304 52.293 1.00 73.18  ? 86   VAL B CG1   1 
ATOM   7246  C CG2   . VAL D 3 87  ? -88.897  -41.389 53.405 1.00 73.74  ? 86   VAL B CG2   1 
ATOM   7247  N N     . VAL D 3 88  ? -86.280  -38.062 54.960 1.00 58.12  ? 87   VAL B N     1 
ATOM   7248  C CA    . VAL D 3 88  ? -85.539  -36.805 54.989 1.00 58.27  ? 87   VAL B CA    1 
ATOM   7249  C C     . VAL D 3 88  ? -84.032  -37.001 55.080 1.00 58.91  ? 87   VAL B C     1 
ATOM   7250  O O     . VAL D 3 88  ? -83.273  -36.353 54.357 1.00 60.56  ? 87   VAL B O     1 
ATOM   7251  C CB    . VAL D 3 88  ? -85.938  -35.922 56.179 1.00 59.99  ? 87   VAL B CB    1 
ATOM   7252  C CG1   . VAL D 3 88  ? -85.120  -34.646 56.150 1.00 58.95  ? 87   VAL B CG1   1 
ATOM   7253  C CG2   . VAL D 3 88  ? -87.427  -35.607 56.137 1.00 55.86  ? 87   VAL B CG2   1 
ATOM   7254  N N     . TYR D 3 89  ? -83.608  -37.877 55.989 1.00 60.56  ? 88   TYR B N     1 
ATOM   7255  C CA    . TYR D 3 89  ? -82.195  -38.174 56.206 1.00 59.68  ? 88   TYR B CA    1 
ATOM   7256  C C     . TYR D 3 89  ? -81.610  -38.857 54.974 1.00 57.91  ? 88   TYR B C     1 
ATOM   7257  O O     . TYR D 3 89  ? -80.497  -38.534 54.528 1.00 56.95  ? 88   TYR B O     1 
ATOM   7258  C CB    . TYR D 3 89  ? -82.026  -39.086 57.436 1.00 70.62  ? 88   TYR B CB    1 
ATOM   7259  C CG    . TYR D 3 89  ? -82.217  -38.384 58.771 1.00 73.99  ? 88   TYR B CG    1 
ATOM   7260  C CD1   . TYR D 3 89  ? -81.130  -38.089 59.591 1.00 75.78  ? 88   TYR B CD1   1 
ATOM   7261  C CD2   . TYR D 3 89  ? -83.479  -37.977 59.193 1.00 77.35  ? 88   TYR B CD2   1 
ATOM   7262  C CE1   . TYR D 3 89  ? -81.300  -37.403 60.799 1.00 79.93  ? 88   TYR B CE1   1 
ATOM   7263  C CE2   . TYR D 3 89  ? -83.656  -37.294 60.386 1.00 79.42  ? 88   TYR B CE2   1 
ATOM   7264  C CZ    . TYR D 3 89  ? -82.567  -37.011 61.186 1.00 80.09  ? 88   TYR B CZ    1 
ATOM   7265  O OH    . TYR D 3 89  ? -82.747  -36.357 62.387 1.00 81.42  ? 88   TYR B OH    1 
ATOM   7266  N N     . ALA D 3 90  ? -82.364  -39.804 54.428 1.00 58.96  ? 89   ALA B N     1 
ATOM   7267  C CA    . ALA D 3 90  ? -81.919  -40.528 53.249 1.00 57.82  ? 89   ALA B CA    1 
ATOM   7268  C C     . ALA D 3 90  ? -81.707  -39.526 52.111 1.00 58.04  ? 89   ALA B C     1 
ATOM   7269  O O     . ALA D 3 90  ? -80.694  -39.553 51.402 1.00 56.91  ? 89   ALA B O     1 
ATOM   7270  C CB    . ALA D 3 90  ? -82.958  -41.581 52.861 1.00 34.48  ? 89   ALA B CB    1 
ATOM   7271  N N     . LEU D 3 91  ? -82.671  -38.631 51.954 1.00 63.84  ? 90   LEU B N     1 
ATOM   7272  C CA    . LEU D 3 91  ? -82.596  -37.616 50.921 1.00 63.41  ? 90   LEU B CA    1 
ATOM   7273  C C     . LEU D 3 91  ? -81.371  -36.739 51.147 1.00 64.75  ? 90   LEU B C     1 
ATOM   7274  O O     . LEU D 3 91  ? -80.567  -36.513 50.236 1.00 66.96  ? 90   LEU B O     1 
ATOM   7275  C CB    . LEU D 3 91  ? -83.871  -36.765 50.946 1.00 50.71  ? 90   LEU B CB    1 
ATOM   7276  C CG    . LEU D 3 91  ? -85.048  -37.355 50.160 1.00 47.65  ? 90   LEU B CG    1 
ATOM   7277  C CD1   . LEU D 3 91  ? -86.320  -36.567 50.411 1.00 48.44  ? 90   LEU B CD1   1 
ATOM   7278  C CD2   . LEU D 3 91  ? -84.697  -37.331 48.681 1.00 43.30  ? 90   LEU B CD2   1 
ATOM   7279  N N     . LYS D 3 92  ? -81.232  -36.256 52.377 1.00 64.75  ? 91   LYS B N     1 
ATOM   7280  C CA    . LYS D 3 92  ? -80.120  -35.396 52.716 1.00 66.80  ? 91   LYS B CA    1 
ATOM   7281  C C     . LYS D 3 92  ? -78.843  -35.982 52.186 1.00 67.93  ? 91   LYS B C     1 
ATOM   7282  O O     . LYS D 3 92  ? -78.186  -35.398 51.339 1.00 68.07  ? 91   LYS B O     1 
ATOM   7283  C CB    . LYS D 3 92  ? -80.001  -35.224 54.230 1.00 66.54  ? 91   LYS B CB    1 
ATOM   7284  C CG    . LYS D 3 92  ? -78.988  -34.172 54.671 1.00 68.09  ? 91   LYS B CG    1 
ATOM   7285  C CD    . LYS D 3 92  ? -79.664  -33.059 55.480 1.00 74.08  ? 91   LYS B CD    1 
ATOM   7286  C CE    . LYS D 3 92  ? -80.364  -33.596 56.754 1.00 79.76  ? 91   LYS B CE    1 
ATOM   7287  N NZ    . LYS D 3 92  ? -81.232  -32.612 57.516 1.00 80.48  ? 91   LYS B NZ    1 
ATOM   7288  N N     . ARG D 3 93  ? -78.514  -37.165 52.661 1.00 48.43  ? 92   ARG B N     1 
ATOM   7289  C CA    . ARG D 3 93  ? -77.268  -37.790 52.266 1.00 50.65  ? 92   ARG B CA    1 
ATOM   7290  C C     . ARG D 3 93  ? -77.138  -38.073 50.796 1.00 51.01  ? 92   ARG B C     1 
ATOM   7291  O O     . ARG D 3 93  ? -76.067  -38.458 50.342 1.00 52.62  ? 92   ARG B O     1 
ATOM   7292  C CB    . ARG D 3 93  ? -77.046  -39.072 53.053 1.00 63.28  ? 92   ARG B CB    1 
ATOM   7293  C CG    . ARG D 3 93  ? -78.012  -40.174 52.734 1.00 66.63  ? 92   ARG B CG    1 
ATOM   7294  C CD    . ARG D 3 93  ? -77.732  -41.338 53.649 1.00 70.33  ? 92   ARG B CD    1 
ATOM   7295  N NE    . ARG D 3 93  ? -76.298  -41.620 53.725 1.00 70.85  ? 92   ARG B NE    1 
ATOM   7296  C CZ    . ARG D 3 93  ? -75.542  -41.999 52.697 1.00 71.93  ? 92   ARG B CZ    1 
ATOM   7297  N NH1   . ARG D 3 93  ? -76.067  -42.152 51.488 1.00 69.60  ? 92   ARG B NH1   1 
ATOM   7298  N NH2   . ARG D 3 93  ? -74.251  -42.221 52.887 1.00 70.01  ? 92   ARG B NH2   1 
ATOM   7299  N N     . GLN D 3 94  ? -78.216  -37.904 50.045 1.00 57.48  ? 93   GLN B N     1 
ATOM   7300  C CA    . GLN D 3 94  ? -78.141  -38.121 48.608 1.00 57.71  ? 93   GLN B CA    1 
ATOM   7301  C C     . GLN D 3 94  ? -77.924  -36.761 47.954 1.00 58.20  ? 93   GLN B C     1 
ATOM   7302  O O     . GLN D 3 94  ? -77.850  -36.635 46.737 1.00 58.77  ? 93   GLN B O     1 
ATOM   7303  C CB    . GLN D 3 94  ? -79.414  -38.783 48.114 1.00 83.61  ? 93   GLN B CB    1 
ATOM   7304  C CG    . GLN D 3 94  ? -79.616  -40.138 48.753 1.00 91.37  ? 93   GLN B CG    1 
ATOM   7305  C CD    . GLN D 3 94  ? -79.905  -41.204 47.735 1.00 94.44  ? 93   GLN B CD    1 
ATOM   7306  O OE1   . GLN D 3 94  ? -80.915  -41.144 47.029 1.00 95.51  ? 93   GLN B OE1   1 
ATOM   7307  N NE2   . GLN D 3 94  ? -79.016  -42.186 47.638 1.00 93.99  ? 93   GLN B NE2   1 
ATOM   7308  N N     . GLY D 3 95  ? -77.808  -35.742 48.796 1.00 52.44  ? 94   GLY B N     1 
ATOM   7309  C CA    . GLY D 3 95  ? -77.574  -34.396 48.325 1.00 53.63  ? 94   GLY B CA    1 
ATOM   7310  C C     . GLY D 3 95  ? -78.836  -33.606 48.087 1.00 55.70  ? 94   GLY B C     1 
ATOM   7311  O O     . GLY D 3 95  ? -78.793  -32.378 47.898 1.00 57.27  ? 94   GLY B O     1 
ATOM   7312  N N     . ARG D 3 96  ? -79.966  -34.304 48.139 1.00 70.72  ? 95   ARG B N     1 
ATOM   7313  C CA    . ARG D 3 96  ? -81.242  -33.673 47.880 1.00 71.04  ? 95   ARG B CA    1 
ATOM   7314  C C     . ARG D 3 96  ? -82.055  -33.204 49.085 1.00 71.26  ? 95   ARG B C     1 
ATOM   7315  O O     . ARG D 3 96  ? -83.198  -33.627 49.262 1.00 72.57  ? 95   ARG B O     1 
ATOM   7316  C CB    . ARG D 3 96  ? -82.090  -34.603 47.019 1.00 57.00  ? 95   ARG B CB    1 
ATOM   7317  C CG    . ARG D 3 96  ? -81.282  -35.523 46.134 1.00 59.64  ? 95   ARG B CG    1 
ATOM   7318  C CD    . ARG D 3 96  ? -82.138  -36.119 45.039 1.00 60.31  ? 95   ARG B CD    1 
ATOM   7319  N NE    . ARG D 3 96  ? -82.478  -35.085 44.070 1.00 65.47  ? 95   ARG B NE    1 
ATOM   7320  C CZ    . ARG D 3 96  ? -81.686  -34.715 43.064 1.00 68.36  ? 95   ARG B CZ    1 
ATOM   7321  N NH1   . ARG D 3 96  ? -80.508  -35.312 42.886 1.00 68.56  ? 95   ARG B NH1   1 
ATOM   7322  N NH2   . ARG D 3 96  ? -82.058  -33.720 42.254 1.00 69.21  ? 95   ARG B NH2   1 
ATOM   7323  N N     . THR D 3 97  ? -81.479  -32.313 49.894 1.00 67.06  ? 96   THR B N     1 
ATOM   7324  C CA    . THR D 3 97  ? -82.173  -31.756 51.060 1.00 65.39  ? 96   THR B CA    1 
ATOM   7325  C C     . THR D 3 97  ? -83.613  -31.379 50.727 1.00 63.33  ? 96   THR B C     1 
ATOM   7326  O O     . THR D 3 97  ? -83.884  -30.724 49.717 1.00 65.59  ? 96   THR B O     1 
ATOM   7327  C CB    . THR D 3 97  ? -81.487  -30.499 51.569 1.00 63.23  ? 96   THR B CB    1 
ATOM   7328  O OG1   . THR D 3 97  ? -80.259  -30.851 52.216 1.00 65.62  ? 96   THR B OG1   1 
ATOM   7329  C CG2   . THR D 3 97  ? -82.382  -29.777 52.546 1.00 62.21  ? 96   THR B CG2   1 
ATOM   7330  N N     . LEU D 3 98  ? -84.533  -31.782 51.597 1.00 58.01  ? 97   LEU B N     1 
ATOM   7331  C CA    . LEU D 3 98  ? -85.964  -31.529 51.410 1.00 54.92  ? 97   LEU B CA    1 
ATOM   7332  C C     . LEU D 3 98  ? -86.573  -30.829 52.633 1.00 56.25  ? 97   LEU B C     1 
ATOM   7333  O O     . LEU D 3 98  ? -86.277  -31.201 53.763 1.00 56.75  ? 97   LEU B O     1 
ATOM   7334  C CB    . LEU D 3 98  ? -86.653  -32.876 51.155 1.00 43.03  ? 97   LEU B CB    1 
ATOM   7335  C CG    . LEU D 3 98  ? -88.145  -33.064 51.415 1.00 40.69  ? 97   LEU B CG    1 
ATOM   7336  C CD1   . LEU D 3 98  ? -88.931  -32.065 50.581 1.00 39.62  ? 97   LEU B CD1   1 
ATOM   7337  C CD2   . LEU D 3 98  ? -88.538  -34.485 51.082 1.00 38.08  ? 97   LEU B CD2   1 
ATOM   7338  N N     . TYR D 3 99  ? -87.410  -29.817 52.408 1.00 72.53  ? 98   TYR B N     1 
ATOM   7339  C CA    . TYR D 3 99  ? -88.045  -29.092 53.515 1.00 73.01  ? 98   TYR B CA    1 
ATOM   7340  C C     . TYR D 3 99  ? -89.524  -29.402 53.708 1.00 75.13  ? 98   TYR B C     1 
ATOM   7341  O O     . TYR D 3 99  ? -90.198  -29.881 52.799 1.00 74.47  ? 98   TYR B O     1 
ATOM   7342  C CB    . TYR D 3 99  ? -87.924  -27.579 53.329 1.00 58.62  ? 98   TYR B CB    1 
ATOM   7343  C CG    . TYR D 3 99  ? -86.541  -27.022 53.489 1.00 58.56  ? 98   TYR B CG    1 
ATOM   7344  C CD1   . TYR D 3 99  ? -85.476  -27.843 53.815 1.00 56.07  ? 98   TYR B CD1   1 
ATOM   7345  C CD2   . TYR D 3 99  ? -86.300  -25.655 53.321 1.00 58.85  ? 98   TYR B CD2   1 
ATOM   7346  C CE1   . TYR D 3 99  ? -84.202  -27.326 53.976 1.00 55.49  ? 98   TYR B CE1   1 
ATOM   7347  C CE2   . TYR D 3 99  ? -85.026  -25.126 53.477 1.00 58.75  ? 98   TYR B CE2   1 
ATOM   7348  C CZ    . TYR D 3 99  ? -83.984  -25.972 53.805 1.00 57.44  ? 98   TYR B CZ    1 
ATOM   7349  O OH    . TYR D 3 99  ? -82.720  -25.481 53.960 1.00 57.94  ? 98   TYR B OH    1 
ATOM   7350  N N     . GLY D 3 100 ? -90.024  -29.107 54.903 1.00 76.30  ? 99   GLY B N     1 
ATOM   7351  C CA    . GLY D 3 100 ? -91.426  -29.321 55.192 1.00 78.47  ? 99   GLY B CA    1 
ATOM   7352  C C     . GLY D 3 100 ? -91.832  -30.675 55.722 1.00 78.92  ? 99   GLY B C     1 
ATOM   7353  O O     . GLY D 3 100 ? -93.010  -31.001 55.680 1.00 79.97  ? 99   GLY B O     1 
ATOM   7354  N N     . PHE D 3 101 ? -90.881  -31.467 56.206 1.00 52.43  ? 100  PHE B N     1 
ATOM   7355  C CA    . PHE D 3 101 ? -91.190  -32.789 56.761 1.00 54.41  ? 100  PHE B CA    1 
ATOM   7356  C C     . PHE D 3 101 ? -90.342  -33.108 57.980 1.00 58.41  ? 100  PHE B C     1 
ATOM   7357  O O     . PHE D 3 101 ? -90.242  -34.264 58.397 1.00 56.48  ? 100  PHE B O     1 
ATOM   7358  C CB    . PHE D 3 101 ? -90.995  -33.890 55.715 1.00 64.90  ? 100  PHE B CB    1 
ATOM   7359  C CG    . PHE D 3 101 ? -92.057  -33.910 54.654 1.00 64.39  ? 100  PHE B CG    1 
ATOM   7360  C CD1   . PHE D 3 101 ? -91.971  -33.074 53.545 1.00 64.43  ? 100  PHE B CD1   1 
ATOM   7361  C CD2   . PHE D 3 101 ? -93.152  -34.762 54.770 1.00 64.07  ? 100  PHE B CD2   1 
ATOM   7362  C CE1   . PHE D 3 101 ? -92.953  -33.087 52.570 1.00 63.21  ? 100  PHE B CE1   1 
ATOM   7363  C CE2   . PHE D 3 101 ? -94.141  -34.782 53.803 1.00 63.84  ? 100  PHE B CE2   1 
ATOM   7364  C CZ    . PHE D 3 101 ? -94.041  -33.942 52.698 1.00 61.99  ? 100  PHE B CZ    1 
ATOM   7365  N N     . GLY D 3 102 ? -89.720  -32.073 58.536 1.00 125.39 ? 101  GLY B N     1 
ATOM   7366  C CA    . GLY D 3 102 ? -88.901  -32.250 59.717 1.00 132.93 ? 101  GLY B CA    1 
ATOM   7367  C C     . GLY D 3 102 ? -89.807  -32.199 60.930 1.00 139.48 ? 101  GLY B C     1 
ATOM   7368  O O     . GLY D 3 102 ? -89.352  -32.333 62.066 1.00 140.78 ? 101  GLY B O     1 
ATOM   7369  N N     . GLY D 3 103 ? -91.100  -31.997 60.678 1.00 110.53 ? 102  GLY B N     1 
ATOM   7370  C CA    . GLY D 3 103 ? -92.081  -31.933 61.748 1.00 113.64 ? 102  GLY B CA    1 
ATOM   7371  C C     . GLY D 3 103 ? -92.374  -33.297 62.349 1.00 116.15 ? 102  GLY B C     1 
ATOM   7372  O O     . GLY D 3 103 ? -92.387  -33.416 63.593 1.00 117.44 ? 102  GLY B O     1 
ATOM   7373  O OXT   . GLY D 3 103 ? -92.605  -34.254 61.580 1.00 147.60 ? 102  GLY B OXT   1 
ATOM   7374  N N     . ARG E 4 34  ? -44.162  -35.128 65.760 1.00 104.73 ? 1230 ARG D N     1 
ATOM   7375  C CA    . ARG E 4 34  ? -44.058  -36.227 64.763 1.00 104.63 ? 1230 ARG D CA    1 
ATOM   7376  C C     . ARG E 4 34  ? -45.379  -36.364 64.003 1.00 103.42 ? 1230 ARG D C     1 
ATOM   7377  O O     . ARG E 4 34  ? -46.460  -36.318 64.599 1.00 103.66 ? 1230 ARG D O     1 
ATOM   7378  C CB    . ARG E 4 34  ? -43.741  -37.537 65.482 1.00 124.39 ? 1230 ARG D CB    1 
ATOM   7379  C CG    . ARG E 4 34  ? -44.852  -38.001 66.420 1.00 124.09 ? 1230 ARG D CG    1 
ATOM   7380  C CD    . ARG E 4 34  ? -44.569  -39.387 66.971 1.00 126.25 ? 1230 ARG D CD    1 
ATOM   7381  N NE    . ARG E 4 34  ? -45.795  -40.085 67.352 1.00 128.02 ? 1230 ARG D NE    1 
ATOM   7382  C CZ    . ARG E 4 34  ? -45.846  -41.366 67.707 1.00 129.20 ? 1230 ARG D CZ    1 
ATOM   7383  N NH1   . ARG E 4 34  ? -44.737  -42.097 67.736 1.00 129.09 ? 1230 ARG D NH1   1 
ATOM   7384  N NH2   . ARG E 4 34  ? -47.007  -41.925 68.018 1.00 129.30 ? 1230 ARG D NH2   1 
ATOM   7385  N N     . LYS E 4 35  ? -45.296  -36.526 62.687 1.00 99.80  ? 1231 LYS D N     1 
ATOM   7386  C CA    . LYS E 4 35  ? -46.502  -36.672 61.887 1.00 96.75  ? 1231 LYS D CA    1 
ATOM   7387  C C     . LYS E 4 35  ? -46.783  -38.150 61.641 1.00 93.03  ? 1231 LYS D C     1 
ATOM   7388  O O     . LYS E 4 35  ? -45.980  -38.856 61.024 1.00 92.56  ? 1231 LYS D O     1 
ATOM   7389  C CB    . LYS E 4 35  ? -46.352  -35.938 60.555 1.00 105.55 ? 1231 LYS D CB    1 
ATOM   7390  C CG    . LYS E 4 35  ? -47.685  -35.490 59.965 1.00 107.40 ? 1231 LYS D CG    1 
ATOM   7391  C CD    . LYS E 4 35  ? -47.492  -34.569 58.765 1.00 110.49 ? 1231 LYS D CD    1 
ATOM   7392  C CE    . LYS E 4 35  ? -48.722  -33.702 58.511 1.00 111.77 ? 1231 LYS D CE    1 
ATOM   7393  N NZ    . LYS E 4 35  ? -48.974  -32.738 59.618 1.00 113.10 ? 1231 LYS D NZ    1 
ATOM   7394  N N     . GLU E 4 36  ? -47.920  -38.623 62.134 1.00 91.10  ? 1232 GLU D N     1 
ATOM   7395  C CA    . GLU E 4 36  ? -48.280  -40.019 61.954 1.00 86.87  ? 1232 GLU D CA    1 
ATOM   7396  C C     . GLU E 4 36  ? -49.081  -40.203 60.663 1.00 86.22  ? 1232 GLU D C     1 
ATOM   7397  O O     . GLU E 4 36  ? -49.732  -39.266 60.187 1.00 85.52  ? 1232 GLU D O     1 
ATOM   7398  C CB    . GLU E 4 36  ? -49.095  -40.507 63.154 1.00 92.76  ? 1232 GLU D CB    1 
ATOM   7399  C CG    . GLU E 4 36  ? -50.484  -39.896 63.257 1.00 90.86  ? 1232 GLU D CG    1 
ATOM   7400  C CD    . GLU E 4 36  ? -51.204  -40.286 64.543 1.00 91.23  ? 1232 GLU D CD    1 
ATOM   7401  O OE1   . GLU E 4 36  ? -52.426  -40.012 64.662 1.00 88.09  ? 1232 GLU D OE1   1 
ATOM   7402  O OE2   . GLU E 4 36  ? -50.541  -40.863 65.436 1.00 91.43  ? 1232 GLU D OE2   1 
ATOM   7403  N N     . SER E 4 37  ? -49.011  -41.408 60.092 1.00 72.93  ? 1233 SER D N     1 
ATOM   7404  C CA    . SER E 4 37  ? -49.745  -41.733 58.872 1.00 71.41  ? 1233 SER D CA    1 
ATOM   7405  C C     . SER E 4 37  ? -49.888  -43.246 58.759 1.00 70.63  ? 1233 SER D C     1 
ATOM   7406  O O     . SER E 4 37  ? -49.309  -43.975 59.550 1.00 70.48  ? 1233 SER D O     1 
ATOM   7407  C CB    . SER E 4 37  ? -49.018  -41.190 57.651 1.00 49.31  ? 1233 SER D CB    1 
ATOM   7408  O OG    . SER E 4 37  ? -47.992  -42.068 57.257 1.00 47.66  ? 1233 SER D OG    1 
ATOM   7409  N N     . TYR E 4 38  ? -50.649  -43.715 57.775 1.00 57.82  ? 1234 TYR D N     1 
ATOM   7410  C CA    . TYR E 4 38  ? -50.858  -45.146 57.602 1.00 53.10  ? 1234 TYR D CA    1 
ATOM   7411  C C     . TYR E 4 38  ? -49.834  -45.882 56.754 1.00 52.14  ? 1234 TYR D C     1 
ATOM   7412  O O     . TYR E 4 38  ? -50.035  -47.062 56.434 1.00 50.80  ? 1234 TYR D O     1 
ATOM   7413  C CB    . TYR E 4 38  ? -52.227  -45.416 57.007 1.00 51.86  ? 1234 TYR D CB    1 
ATOM   7414  C CG    . TYR E 4 38  ? -53.350  -45.047 57.913 1.00 51.76  ? 1234 TYR D CG    1 
ATOM   7415  C CD1   . TYR E 4 38  ? -53.929  -43.792 57.845 1.00 51.16  ? 1234 TYR D CD1   1 
ATOM   7416  C CD2   . TYR E 4 38  ? -53.816  -45.939 58.864 1.00 52.11  ? 1234 TYR D CD2   1 
ATOM   7417  C CE1   . TYR E 4 38  ? -54.941  -43.432 58.698 1.00 52.53  ? 1234 TYR D CE1   1 
ATOM   7418  C CE2   . TYR E 4 38  ? -54.823  -45.587 59.723 1.00 52.69  ? 1234 TYR D CE2   1 
ATOM   7419  C CZ    . TYR E 4 38  ? -55.382  -44.329 59.634 1.00 53.41  ? 1234 TYR D CZ    1 
ATOM   7420  O OH    . TYR E 4 38  ? -56.390  -43.951 60.487 1.00 52.83  ? 1234 TYR D OH    1 
ATOM   7421  N N     . SER E 4 39  ? -48.737  -45.216 56.407 1.00 61.15  ? 1235 SER D N     1 
ATOM   7422  C CA    . SER E 4 39  ? -47.722  -45.832 55.561 1.00 60.54  ? 1235 SER D CA    1 
ATOM   7423  C C     . SER E 4 39  ? -47.338  -47.286 55.869 1.00 57.94  ? 1235 SER D C     1 
ATOM   7424  O O     . SER E 4 39  ? -47.429  -48.155 54.997 1.00 57.83  ? 1235 SER D O     1 
ATOM   7425  C CB    . SER E 4 39  ? -46.469  -44.971 55.549 1.00 80.22  ? 1235 SER D CB    1 
ATOM   7426  O OG    . SER E 4 39  ? -46.739  -43.735 54.924 1.00 88.00  ? 1235 SER D OG    1 
ATOM   7427  N N     . ILE E 4 40  ? -46.914  -47.560 57.096 1.00 66.98  ? 1236 ILE D N     1 
ATOM   7428  C CA    . ILE E 4 40  ? -46.507  -48.915 57.436 1.00 67.18  ? 1236 ILE D CA    1 
ATOM   7429  C C     . ILE E 4 40  ? -47.673  -49.893 57.345 1.00 67.56  ? 1236 ILE D C     1 
ATOM   7430  O O     . ILE E 4 40  ? -47.500  -51.057 56.989 1.00 67.86  ? 1236 ILE D O     1 
ATOM   7431  C CB    . ILE E 4 40  ? -45.891  -48.997 58.861 1.00 58.69  ? 1236 ILE D CB    1 
ATOM   7432  C CG1   . ILE E 4 40  ? -46.947  -48.671 59.907 1.00 58.57  ? 1236 ILE D CG1   1 
ATOM   7433  C CG2   . ILE E 4 40  ? -44.734  -48.033 58.995 1.00 54.10  ? 1236 ILE D CG2   1 
ATOM   7434  C CD1   . ILE E 4 40  ? -46.505  -48.996 61.298 1.00 55.65  ? 1236 ILE D CD1   1 
ATOM   7435  N N     . TYR E 4 41  ? -48.868  -49.421 57.657 1.00 66.24  ? 1237 TYR D N     1 
ATOM   7436  C CA    . TYR E 4 41  ? -50.014  -50.301 57.606 1.00 66.06  ? 1237 TYR D CA    1 
ATOM   7437  C C     . TYR E 4 41  ? -50.399  -50.598 56.177 1.00 64.43  ? 1237 TYR D C     1 
ATOM   7438  O O     . TYR E 4 41  ? -50.706  -51.738 55.840 1.00 61.67  ? 1237 TYR D O     1 
ATOM   7439  C CB    . TYR E 4 41  ? -51.164  -49.667 58.358 1.00 71.39  ? 1237 TYR D CB    1 
ATOM   7440  C CG    . TYR E 4 41  ? -50.739  -49.206 59.733 1.00 76.03  ? 1237 TYR D CG    1 
ATOM   7441  C CD1   . TYR E 4 41  ? -50.860  -47.871 60.106 1.00 77.67  ? 1237 TYR D CD1   1 
ATOM   7442  C CD2   . TYR E 4 41  ? -50.229  -50.108 60.666 1.00 77.09  ? 1237 TYR D CD2   1 
ATOM   7443  C CE1   . TYR E 4 41  ? -50.494  -47.449 61.363 1.00 76.93  ? 1237 TYR D CE1   1 
ATOM   7444  C CE2   . TYR E 4 41  ? -49.860  -49.694 61.927 1.00 76.40  ? 1237 TYR D CE2   1 
ATOM   7445  C CZ    . TYR E 4 41  ? -49.999  -48.364 62.271 1.00 77.02  ? 1237 TYR D CZ    1 
ATOM   7446  O OH    . TYR E 4 41  ? -49.680  -47.940 63.537 1.00 78.92  ? 1237 TYR D OH    1 
ATOM   7447  N N     . VAL E 4 42  ? -50.384  -49.575 55.330 1.00 66.35  ? 1238 VAL D N     1 
ATOM   7448  C CA    . VAL E 4 42  ? -50.718  -49.774 53.928 1.00 66.41  ? 1238 VAL D CA    1 
ATOM   7449  C C     . VAL E 4 42  ? -49.662  -50.710 53.360 1.00 66.73  ? 1238 VAL D C     1 
ATOM   7450  O O     . VAL E 4 42  ? -49.981  -51.679 52.675 1.00 66.83  ? 1238 VAL D O     1 
ATOM   7451  C CB    . VAL E 4 42  ? -50.697  -48.451 53.159 1.00 45.16  ? 1238 VAL D CB    1 
ATOM   7452  C CG1   . VAL E 4 42  ? -50.960  -48.692 51.683 1.00 43.15  ? 1238 VAL D CG1   1 
ATOM   7453  C CG2   . VAL E 4 42  ? -51.726  -47.520 53.731 1.00 43.79  ? 1238 VAL D CG2   1 
ATOM   7454  N N     . TYR E 4 43  ? -48.402  -50.436 53.677 1.00 45.38  ? 1239 TYR D N     1 
ATOM   7455  C CA    . TYR E 4 43  ? -47.316  -51.268 53.190 1.00 45.93  ? 1239 TYR D CA    1 
ATOM   7456  C C     . TYR E 4 43  ? -47.506  -52.741 53.597 1.00 44.96  ? 1239 TYR D C     1 
ATOM   7457  O O     . TYR E 4 43  ? -47.234  -53.664 52.813 1.00 41.33  ? 1239 TYR D O     1 
ATOM   7458  C CB    . TYR E 4 43  ? -45.966  -50.763 53.709 1.00 68.79  ? 1239 TYR D CB    1 
ATOM   7459  C CG    . TYR E 4 43  ? -44.821  -51.253 52.860 1.00 73.13  ? 1239 TYR D CG    1 
ATOM   7460  C CD1   . TYR E 4 43  ? -44.390  -50.522 51.752 1.00 74.98  ? 1239 TYR D CD1   1 
ATOM   7461  C CD2   . TYR E 4 43  ? -44.214  -52.489 53.113 1.00 76.06  ? 1239 TYR D CD2   1 
ATOM   7462  C CE1   . TYR E 4 43  ? -43.380  -51.005 50.905 1.00 78.18  ? 1239 TYR D CE1   1 
ATOM   7463  C CE2   . TYR E 4 43  ? -43.206  -52.986 52.274 1.00 77.95  ? 1239 TYR D CE2   1 
ATOM   7464  C CZ    . TYR E 4 43  ? -42.794  -52.241 51.169 1.00 80.95  ? 1239 TYR D CZ    1 
ATOM   7465  O OH    . TYR E 4 43  ? -41.807  -52.735 50.329 1.00 83.91  ? 1239 TYR D OH    1 
ATOM   7466  N N     . LYS E 4 44  ? -47.955  -52.977 54.821 1.00 51.94  ? 1240 LYS D N     1 
ATOM   7467  C CA    . LYS E 4 44  ? -48.146  -54.350 55.232 1.00 53.36  ? 1240 LYS D CA    1 
ATOM   7468  C C     . LYS E 4 44  ? -49.146  -54.972 54.277 1.00 54.36  ? 1240 LYS D C     1 
ATOM   7469  O O     . LYS E 4 44  ? -48.832  -55.952 53.593 1.00 57.31  ? 1240 LYS D O     1 
ATOM   7470  C CB    . LYS E 4 44  ? -48.621  -54.426 56.685 1.00 70.69  ? 1240 LYS D CB    1 
ATOM   7471  C CG    . LYS E 4 44  ? -47.468  -54.176 57.661 1.00 74.89  ? 1240 LYS D CG    1 
ATOM   7472  C CD    . LYS E 4 44  ? -47.868  -54.185 59.134 1.00 78.43  ? 1240 LYS D CD    1 
ATOM   7473  C CE    . LYS E 4 44  ? -46.649  -53.894 60.017 1.00 78.68  ? 1240 LYS D CE    1 
ATOM   7474  N NZ    . LYS E 4 44  ? -47.000  -53.702 61.458 1.00 82.71  ? 1240 LYS D NZ    1 
ATOM   7475  N N     . VAL E 4 45  ? -50.337  -54.383 54.191 1.00 56.37  ? 1241 VAL D N     1 
ATOM   7476  C CA    . VAL E 4 45  ? -51.362  -54.903 53.293 1.00 52.95  ? 1241 VAL D CA    1 
ATOM   7477  C C     . VAL E 4 45  ? -50.816  -55.014 51.869 1.00 51.82  ? 1241 VAL D C     1 
ATOM   7478  O O     . VAL E 4 45  ? -51.117  -55.967 51.167 1.00 50.84  ? 1241 VAL D O     1 
ATOM   7479  C CB    . VAL E 4 45  ? -52.635  -54.006 53.312 1.00 40.91  ? 1241 VAL D CB    1 
ATOM   7480  C CG1   . VAL E 4 45  ? -53.695  -54.530 52.336 1.00 38.84  ? 1241 VAL D CG1   1 
ATOM   7481  C CG2   . VAL E 4 45  ? -53.207  -53.964 54.722 1.00 38.77  ? 1241 VAL D CG2   1 
ATOM   7482  N N     . LEU E 4 46  ? -49.998  -54.061 51.436 1.00 49.58  ? 1242 LEU D N     1 
ATOM   7483  C CA    . LEU E 4 46  ? -49.479  -54.151 50.072 1.00 51.10  ? 1242 LEU D CA    1 
ATOM   7484  C C     . LEU E 4 46  ? -48.674  -55.423 49.890 1.00 52.87  ? 1242 LEU D C     1 
ATOM   7485  O O     . LEU E 4 46  ? -48.852  -56.146 48.915 1.00 51.41  ? 1242 LEU D O     1 
ATOM   7486  C CB    . LEU E 4 46  ? -48.619  -52.934 49.691 1.00 38.71  ? 1242 LEU D CB    1 
ATOM   7487  C CG    . LEU E 4 46  ? -47.808  -53.088 48.389 1.00 39.99  ? 1242 LEU D CG    1 
ATOM   7488  C CD1   . LEU E 4 46  ? -48.707  -53.418 47.211 1.00 38.11  ? 1242 LEU D CD1   1 
ATOM   7489  C CD2   . LEU E 4 46  ? -47.048  -51.801 48.103 1.00 41.54  ? 1242 LEU D CD2   1 
ATOM   7490  N N     . LYS E 4 47  ? -47.803  -55.724 50.836 1.00 62.72  ? 1243 LYS D N     1 
ATOM   7491  C CA    . LYS E 4 47  ? -46.997  -56.923 50.694 1.00 64.12  ? 1243 LYS D CA    1 
ATOM   7492  C C     . LYS E 4 47  ? -47.766  -58.249 50.664 1.00 63.27  ? 1243 LYS D C     1 
ATOM   7493  O O     . LYS E 4 47  ? -47.266  -59.249 50.144 1.00 62.99  ? 1243 LYS D O     1 
ATOM   7494  C CB    . LYS E 4 47  ? -45.920  -56.937 51.767 1.00 45.02  ? 1243 LYS D CB    1 
ATOM   7495  C CG    . LYS E 4 47  ? -44.830  -55.928 51.490 1.00 49.07  ? 1243 LYS D CG    1 
ATOM   7496  C CD    . LYS E 4 47  ? -44.372  -56.066 50.055 1.00 51.77  ? 1243 LYS D CD    1 
ATOM   7497  C CE    . LYS E 4 47  ? -43.130  -55.263 49.764 1.00 54.55  ? 1243 LYS D CE    1 
ATOM   7498  N NZ    . LYS E 4 47  ? -42.809  -55.405 48.322 1.00 56.25  ? 1243 LYS D NZ    1 
ATOM   7499  N N     . GLN E 4 48  ? -48.978  -58.259 51.206 1.00 50.26  ? 1244 GLN D N     1 
ATOM   7500  C CA    . GLN E 4 48  ? -49.789  -59.460 51.184 1.00 49.82  ? 1244 GLN D CA    1 
ATOM   7501  C C     . GLN E 4 48  ? -50.456  -59.624 49.824 1.00 52.02  ? 1244 GLN D C     1 
ATOM   7502  O O     . GLN E 4 48  ? -50.456  -60.736 49.270 1.00 54.67  ? 1244 GLN D O     1 
ATOM   7503  C CB    . GLN E 4 48  ? -50.882  -59.424 52.246 1.00 45.49  ? 1244 GLN D CB    1 
ATOM   7504  C CG    . GLN E 4 48  ? -50.425  -59.102 53.612 1.00 45.93  ? 1244 GLN D CG    1 
ATOM   7505  C CD    . GLN E 4 48  ? -51.567  -59.170 54.586 1.00 46.89  ? 1244 GLN D CD    1 
ATOM   7506  O OE1   . GLN E 4 48  ? -52.643  -58.607 54.347 1.00 50.32  ? 1244 GLN D OE1   1 
ATOM   7507  N NE2   . GLN E 4 48  ? -51.348  -59.856 55.703 1.00 43.27  ? 1244 GLN D NE2   1 
ATOM   7508  N N     . VAL E 4 49  ? -51.046  -58.552 49.286 1.00 57.73  ? 1245 VAL D N     1 
ATOM   7509  C CA    . VAL E 4 49  ? -51.713  -58.673 47.990 1.00 59.88  ? 1245 VAL D CA    1 
ATOM   7510  C C     . VAL E 4 49  ? -50.681  -59.081 46.958 1.00 61.08  ? 1245 VAL D C     1 
ATOM   7511  O O     . VAL E 4 49  ? -50.906  -60.003 46.166 1.00 58.61  ? 1245 VAL D O     1 
ATOM   7512  C CB    . VAL E 4 49  ? -52.449  -57.378 47.575 1.00 76.18  ? 1245 VAL D CB    1 
ATOM   7513  C CG1   . VAL E 4 49  ? -53.716  -57.248 48.387 1.00 74.07  ? 1245 VAL D CG1   1 
ATOM   7514  C CG2   . VAL E 4 49  ? -51.572  -56.173 47.790 1.00 74.75  ? 1245 VAL D CG2   1 
ATOM   7515  N N     . HIS E 4 50  ? -49.542  -58.403 46.982 1.00 74.16  ? 1246 HIS D N     1 
ATOM   7516  C CA    . HIS E 4 50  ? -48.456  -58.759 46.096 1.00 75.85  ? 1246 HIS D CA    1 
ATOM   7517  C C     . HIS E 4 50  ? -47.082  -58.437 46.664 1.00 77.33  ? 1246 HIS D C     1 
ATOM   7518  O O     . HIS E 4 50  ? -46.682  -57.276 46.764 1.00 77.68  ? 1246 HIS D O     1 
ATOM   7519  C CB    . HIS E 4 50  ? -48.605  -58.148 44.708 1.00 140.46 ? 1246 HIS D CB    1 
ATOM   7520  C CG    . HIS E 4 50  ? -47.929  -58.962 43.649 1.00 142.36 ? 1246 HIS D CG    1 
ATOM   7521  N ND1   . HIS E 4 50  ? -46.568  -59.188 43.642 1.00 143.41 ? 1246 HIS D ND1   1 
ATOM   7522  C CD2   . HIS E 4 50  ? -48.435  -59.687 42.622 1.00 141.11 ? 1246 HIS D CD2   1 
ATOM   7523  C CE1   . HIS E 4 50  ? -46.266  -60.019 42.660 1.00 142.43 ? 1246 HIS D CE1   1 
ATOM   7524  N NE2   . HIS E 4 50  ? -47.381  -60.337 42.027 1.00 141.36 ? 1246 HIS D NE2   1 
ATOM   7525  N N     . PRO E 4 51  ? -46.336  -59.494 47.027 1.00 72.59  ? 1247 PRO D N     1 
ATOM   7526  C CA    . PRO E 4 51  ? -44.996  -59.492 47.603 1.00 73.86  ? 1247 PRO D CA    1 
ATOM   7527  C C     . PRO E 4 51  ? -43.905  -58.748 46.853 1.00 74.99  ? 1247 PRO D C     1 
ATOM   7528  O O     . PRO E 4 51  ? -43.085  -58.077 47.475 1.00 76.00  ? 1247 PRO D O     1 
ATOM   7529  C CB    . PRO E 4 51  ? -44.682  -60.981 47.725 1.00 68.18  ? 1247 PRO D CB    1 
ATOM   7530  C CG    . PRO E 4 51  ? -46.020  -61.591 47.946 1.00 68.58  ? 1247 PRO D CG    1 
ATOM   7531  C CD    . PRO E 4 51  ? -46.829  -60.879 46.907 1.00 66.90  ? 1247 PRO D CD    1 
ATOM   7532  N N     . ASP E 4 52  ? -43.883  -58.851 45.530 1.00 61.61  ? 1248 ASP D N     1 
ATOM   7533  C CA    . ASP E 4 52  ? -42.816  -58.192 44.782 1.00 62.67  ? 1248 ASP D CA    1 
ATOM   7534  C C     . ASP E 4 52  ? -43.099  -56.798 44.240 1.00 63.10  ? 1248 ASP D C     1 
ATOM   7535  O O     . ASP E 4 52  ? -42.366  -56.299 43.373 1.00 63.83  ? 1248 ASP D O     1 
ATOM   7536  C CB    . ASP E 4 52  ? -42.367  -59.076 43.629 1.00 72.95  ? 1248 ASP D CB    1 
ATOM   7537  C CG    . ASP E 4 52  ? -42.120  -60.489 44.060 1.00 76.40  ? 1248 ASP D CG    1 
ATOM   7538  O OD1   . ASP E 4 52  ? -41.545  -60.670 45.156 1.00 76.90  ? 1248 ASP D OD1   1 
ATOM   7539  O OD2   . ASP E 4 52  ? -42.499  -61.408 43.297 1.00 77.62  ? 1248 ASP D OD2   1 
ATOM   7540  N N     . THR E 4 53  ? -44.135  -56.150 44.756 1.00 57.70  ? 1249 THR D N     1 
ATOM   7541  C CA    . THR E 4 53  ? -44.463  -54.833 44.262 1.00 56.56  ? 1249 THR D CA    1 
ATOM   7542  C C     . THR E 4 53  ? -44.139  -53.778 45.271 1.00 56.28  ? 1249 THR D C     1 
ATOM   7543  O O     . THR E 4 53  ? -44.249  -54.018 46.469 1.00 57.67  ? 1249 THR D O     1 
ATOM   7544  C CB    . THR E 4 53  ? -45.934  -54.740 43.915 1.00 43.62  ? 1249 THR D CB    1 
ATOM   7545  O OG1   . THR E 4 53  ? -46.256  -55.787 42.999 1.00 42.67  ? 1249 THR D OG1   1 
ATOM   7546  C CG2   . THR E 4 53  ? -46.245  -53.420 43.253 1.00 41.46  ? 1249 THR D CG2   1 
ATOM   7547  N N     . GLY E 4 54  ? -43.730  -52.612 44.774 1.00 72.57  ? 1250 GLY D N     1 
ATOM   7548  C CA    . GLY E 4 54  ? -43.408  -51.494 45.642 1.00 71.67  ? 1250 GLY D CA    1 
ATOM   7549  C C     . GLY E 4 54  ? -44.372  -50.341 45.423 1.00 68.85  ? 1250 GLY D C     1 
ATOM   7550  O O     . GLY E 4 54  ? -45.261  -50.413 44.561 1.00 70.51  ? 1250 GLY D O     1 
ATOM   7551  N N     . ILE E 4 55  ? -44.206  -49.272 46.197 1.00 53.56  ? 1251 ILE D N     1 
ATOM   7552  C CA    . ILE E 4 55  ? -45.079  -48.115 46.045 1.00 49.58  ? 1251 ILE D CA    1 
ATOM   7553  C C     . ILE E 4 55  ? -44.312  -46.803 46.191 1.00 47.64  ? 1251 ILE D C     1 
ATOM   7554  O O     . ILE E 4 55  ? -43.498  -46.650 47.101 1.00 46.82  ? 1251 ILE D O     1 
ATOM   7555  C CB    . ILE E 4 55  ? -46.266  -48.170 47.074 1.00 50.99  ? 1251 ILE D CB    1 
ATOM   7556  C CG1   . ILE E 4 55  ? -47.355  -47.174 46.659 1.00 49.69  ? 1251 ILE D CG1   1 
ATOM   7557  C CG2   . ILE E 4 55  ? -45.767  -47.899 48.499 1.00 47.36  ? 1251 ILE D CG2   1 
ATOM   7558  C CD1   . ILE E 4 55  ? -48.580  -47.238 47.525 1.00 48.68  ? 1251 ILE D CD1   1 
ATOM   7559  N N     . SER E 4 56  ? -44.569  -45.867 45.279 1.00 39.36  ? 1252 SER D N     1 
ATOM   7560  C CA    . SER E 4 56  ? -43.914  -44.542 45.280 1.00 39.59  ? 1252 SER D CA    1 
ATOM   7561  C C     . SER E 4 56  ? -44.415  -43.732 46.447 1.00 39.69  ? 1252 SER D C     1 
ATOM   7562  O O     . SER E 4 56  ? -45.542  -43.942 46.922 1.00 39.47  ? 1252 SER D O     1 
ATOM   7563  C CB    . SER E 4 56  ? -44.240  -43.766 44.006 1.00 33.34  ? 1252 SER D CB    1 
ATOM   7564  O OG    . SER E 4 56  ? -45.576  -43.246 44.022 1.00 36.83  ? 1252 SER D OG    1 
ATOM   7565  N N     . SER E 4 57  ? -43.599  -42.793 46.909 1.00 48.60  ? 1253 SER D N     1 
ATOM   7566  C CA    . SER E 4 57  ? -44.026  -41.980 48.037 1.00 49.45  ? 1253 SER D CA    1 
ATOM   7567  C C     . SER E 4 57  ? -45.264  -41.154 47.603 1.00 48.92  ? 1253 SER D C     1 
ATOM   7568  O O     . SER E 4 57  ? -46.188  -40.933 48.403 1.00 48.25  ? 1253 SER D O     1 
ATOM   7569  C CB    . SER E 4 57  ? -42.874  -41.087 48.517 1.00 53.04  ? 1253 SER D CB    1 
ATOM   7570  O OG    . SER E 4 57  ? -42.536  -40.124 47.542 1.00 55.31  ? 1253 SER D OG    1 
ATOM   7571  N N     . LYS E 4 58  ? -45.289  -40.725 46.335 1.00 52.54  ? 1254 LYS D N     1 
ATOM   7572  C CA    . LYS E 4 58  ? -46.442  -39.979 45.837 1.00 51.76  ? 1254 LYS D CA    1 
ATOM   7573  C C     . LYS E 4 58  ? -47.663  -40.899 45.896 1.00 51.80  ? 1254 LYS D C     1 
ATOM   7574  O O     . LYS E 4 58  ? -48.760  -40.483 46.262 1.00 50.93  ? 1254 LYS D O     1 
ATOM   7575  C CB    . LYS E 4 58  ? -46.237  -39.499 44.396 1.00 83.21  ? 1254 LYS D CB    1 
ATOM   7576  C CG    . LYS E 4 58  ? -45.438  -38.208 44.232 1.00 84.89  ? 1254 LYS D CG    1 
ATOM   7577  C CD    . LYS E 4 58  ? -45.720  -37.590 42.854 1.00 87.33  ? 1254 LYS D CD    1 
ATOM   7578  C CE    . LYS E 4 58  ? -44.637  -36.617 42.388 1.00 88.12  ? 1254 LYS D CE    1 
ATOM   7579  N NZ    . LYS E 4 58  ? -44.418  -35.476 43.321 1.00 94.01  ? 1254 LYS D NZ    1 
ATOM   7580  N N     . ALA E 4 59  ? -47.481  -42.164 45.547 1.00 47.89  ? 1255 ALA D N     1 
ATOM   7581  C CA    . ALA E 4 59  ? -48.612  -43.087 45.608 1.00 46.27  ? 1255 ALA D CA    1 
ATOM   7582  C C     . ALA E 4 59  ? -49.004  -43.393 47.052 1.00 45.07  ? 1255 ALA D C     1 
ATOM   7583  O O     . ALA E 4 59  ? -50.181  -43.515 47.376 1.00 45.79  ? 1255 ALA D O     1 
ATOM   7584  C CB    . ALA E 4 59  ? -48.289  -44.359 44.868 1.00 32.23  ? 1255 ALA D CB    1 
ATOM   7585  N N     . MET E 4 60  ? -48.023  -43.517 47.930 1.00 50.30  ? 1256 MET D N     1 
ATOM   7586  C CA    . MET E 4 60  ? -48.369  -43.793 49.312 1.00 52.14  ? 1256 MET D CA    1 
ATOM   7587  C C     . MET E 4 60  ? -49.210  -42.630 49.839 1.00 51.41  ? 1256 MET D C     1 
ATOM   7588  O O     . MET E 4 60  ? -50.102  -42.849 50.676 1.00 50.53  ? 1256 MET D O     1 
ATOM   7589  C CB    . MET E 4 60  ? -47.109  -43.979 50.168 1.00 46.47  ? 1256 MET D CB    1 
ATOM   7590  C CG    . MET E 4 60  ? -47.388  -44.269 51.643 1.00 48.05  ? 1256 MET D CG    1 
ATOM   7591  S SD    . MET E 4 60  ? -48.369  -45.769 51.933 1.00 55.49  ? 1256 MET D SD    1 
ATOM   7592  C CE    . MET E 4 60  ? -47.122  -47.074 51.692 1.00 51.73  ? 1256 MET D CE    1 
ATOM   7593  N N     . GLY E 4 61  ? -48.917  -41.412 49.332 1.00 43.30  ? 1257 GLY D N     1 
ATOM   7594  C CA    . GLY E 4 61  ? -49.625  -40.192 49.720 1.00 44.51  ? 1257 GLY D CA    1 
ATOM   7595  C C     . GLY E 4 61  ? -51.104  -40.377 49.454 1.00 45.89  ? 1257 GLY D C     1 
ATOM   7596  O O     . GLY E 4 61  ? -51.939  -40.277 50.354 1.00 45.25  ? 1257 GLY D O     1 
ATOM   7597  N N     . ILE E 4 62  ? -51.430  -40.665 48.202 1.00 49.46  ? 1258 ILE D N     1 
ATOM   7598  C CA    . ILE E 4 62  ? -52.808  -40.925 47.815 1.00 49.33  ? 1258 ILE D CA    1 
ATOM   7599  C C     . ILE E 4 62  ? -53.453  -41.922 48.793 1.00 49.40  ? 1258 ILE D C     1 
ATOM   7600  O O     . ILE E 4 62  ? -54.528  -41.652 49.362 1.00 51.00  ? 1258 ILE D O     1 
ATOM   7601  C CB    . ILE E 4 62  ? -52.835  -41.513 46.401 1.00 54.31  ? 1258 ILE D CB    1 
ATOM   7602  C CG1   . ILE E 4 62  ? -52.296  -40.462 45.438 1.00 57.36  ? 1258 ILE D CG1   1 
ATOM   7603  C CG2   . ILE E 4 62  ? -54.235  -41.978 46.023 1.00 49.05  ? 1258 ILE D CG2   1 
ATOM   7604  C CD1   . ILE E 4 62  ? -52.137  -40.969 44.042 1.00 65.57  ? 1258 ILE D CD1   1 
ATOM   7605  N N     . MET E 4 63  ? -52.774  -43.063 48.978 1.00 37.65  ? 1259 MET D N     1 
ATOM   7606  C CA    . MET E 4 63  ? -53.225  -44.127 49.867 1.00 38.51  ? 1259 MET D CA    1 
ATOM   7607  C C     . MET E 4 63  ? -53.580  -43.548 51.222 1.00 40.39  ? 1259 MET D C     1 
ATOM   7608  O O     . MET E 4 63  ? -54.600  -43.903 51.827 1.00 38.79  ? 1259 MET D O     1 
ATOM   7609  C CB    . MET E 4 63  ? -52.127  -45.169 50.009 1.00 55.70  ? 1259 MET D CB    1 
ATOM   7610  C CG    . MET E 4 63  ? -52.571  -46.566 49.618 1.00 55.39  ? 1259 MET D CG    1 
ATOM   7611  S SD    . MET E 4 63  ? -53.570  -46.547 48.122 1.00 53.93  ? 1259 MET D SD    1 
ATOM   7612  C CE    . MET E 4 63  ? -55.066  -47.301 48.720 1.00 52.75  ? 1259 MET D CE    1 
ATOM   7613  N N     . ASN E 4 64  ? -52.743  -42.635 51.696 1.00 50.18  ? 1260 ASN D N     1 
ATOM   7614  C CA    . ASN E 4 64  ? -52.995  -42.003 52.975 1.00 53.96  ? 1260 ASN D CA    1 
ATOM   7615  C C     . ASN E 4 64  ? -54.291  -41.196 52.881 1.00 53.34  ? 1260 ASN D C     1 
ATOM   7616  O O     . ASN E 4 64  ? -55.228  -41.359 53.676 1.00 52.22  ? 1260 ASN D O     1 
ATOM   7617  C CB    . ASN E 4 64  ? -51.835  -41.089 53.332 1.00 68.84  ? 1260 ASN D CB    1 
ATOM   7618  C CG    . ASN E 4 64  ? -51.204  -41.444 54.657 1.00 73.36  ? 1260 ASN D CG    1 
ATOM   7619  O OD1   . ASN E 4 64  ? -51.850  -41.374 55.715 1.00 77.80  ? 1260 ASN D OD1   1 
ATOM   7620  N ND2   . ASN E 4 64  ? -49.928  -41.828 54.614 1.00 73.02  ? 1260 ASN D ND2   1 
ATOM   7621  N N     . SER E 4 65  ? -54.347  -40.334 51.882 1.00 51.03  ? 1261 SER D N     1 
ATOM   7622  C CA    . SER E 4 65  ? -55.520  -39.509 51.690 1.00 50.22  ? 1261 SER D CA    1 
ATOM   7623  C C     . SER E 4 65  ? -56.763  -40.390 51.635 1.00 49.55  ? 1261 SER D C     1 
ATOM   7624  O O     . SER E 4 65  ? -57.794  -40.045 52.203 1.00 48.17  ? 1261 SER D O     1 
ATOM   7625  C CB    . SER E 4 65  ? -55.366  -38.702 50.405 1.00 51.84  ? 1261 SER D CB    1 
ATOM   7626  O OG    . SER E 4 65  ? -54.128  -38.013 50.401 1.00 52.45  ? 1261 SER D OG    1 
ATOM   7627  N N     . PHE E 4 66  ? -56.652  -41.535 50.968 1.00 47.03  ? 1262 PHE D N     1 
ATOM   7628  C CA    . PHE E 4 66  ? -57.781  -42.450 50.854 1.00 45.06  ? 1262 PHE D CA    1 
ATOM   7629  C C     . PHE E 4 66  ? -58.267  -42.919 52.220 1.00 44.19  ? 1262 PHE D C     1 
ATOM   7630  O O     . PHE E 4 66  ? -59.436  -42.696 52.595 1.00 42.80  ? 1262 PHE D O     1 
ATOM   7631  C CB    . PHE E 4 66  ? -57.406  -43.671 50.031 1.00 44.70  ? 1262 PHE D CB    1 
ATOM   7632  C CG    . PHE E 4 66  ? -58.484  -44.699 49.982 1.00 44.82  ? 1262 PHE D CG    1 
ATOM   7633  C CD1   . PHE E 4 66  ? -59.679  -44.429 49.333 1.00 43.21  ? 1262 PHE D CD1   1 
ATOM   7634  C CD2   . PHE E 4 66  ? -58.327  -45.922 50.646 1.00 45.84  ? 1262 PHE D CD2   1 
ATOM   7635  C CE1   . PHE E 4 66  ? -60.705  -45.351 49.346 1.00 44.81  ? 1262 PHE D CE1   1 
ATOM   7636  C CE2   . PHE E 4 66  ? -59.342  -46.858 50.672 1.00 43.16  ? 1262 PHE D CE2   1 
ATOM   7637  C CZ    . PHE E 4 66  ? -60.538  -46.578 50.021 1.00 43.75  ? 1262 PHE D CZ    1 
ATOM   7638  N N     . VAL E 4 67  ? -57.374  -43.580 52.958 1.00 46.85  ? 1263 VAL D N     1 
ATOM   7639  C CA    . VAL E 4 67  ? -57.709  -44.075 54.294 1.00 47.23  ? 1263 VAL D CA    1 
ATOM   7640  C C     . VAL E 4 67  ? -58.329  -42.978 55.177 1.00 48.00  ? 1263 VAL D C     1 
ATOM   7641  O O     . VAL E 4 67  ? -59.353  -43.209 55.851 1.00 45.56  ? 1263 VAL D O     1 
ATOM   7642  C CB    . VAL E 4 67  ? -56.463  -44.627 55.007 1.00 41.81  ? 1263 VAL D CB    1 
ATOM   7643  C CG1   . VAL E 4 67  ? -56.780  -44.924 56.471 1.00 40.80  ? 1263 VAL D CG1   1 
ATOM   7644  C CG2   . VAL E 4 67  ? -55.964  -45.865 54.273 1.00 42.66  ? 1263 VAL D CG2   1 
ATOM   7645  N N     . ASN E 4 68  ? -57.713  -41.790 55.162 1.00 41.97  ? 1264 ASN D N     1 
ATOM   7646  C CA    . ASN E 4 68  ? -58.208  -40.673 55.964 1.00 42.55  ? 1264 ASN D CA    1 
ATOM   7647  C C     . ASN E 4 68  ? -59.586  -40.203 55.525 1.00 42.21  ? 1264 ASN D C     1 
ATOM   7648  O O     . ASN E 4 68  ? -60.453  -39.885 56.360 1.00 42.23  ? 1264 ASN D O     1 
ATOM   7649  C CB    . ASN E 4 68  ? -57.225  -39.517 55.917 1.00 46.81  ? 1264 ASN D CB    1 
ATOM   7650  C CG    . ASN E 4 68  ? -56.033  -39.756 56.798 1.00 46.14  ? 1264 ASN D CG    1 
ATOM   7651  O OD1   . ASN E 4 68  ? -56.156  -39.779 58.015 1.00 46.04  ? 1264 ASN D OD1   1 
ATOM   7652  N ND2   . ASN E 4 68  ? -54.868  -39.957 56.190 1.00 48.02  ? 1264 ASN D ND2   1 
ATOM   7653  N N     . ASP E 4 69  ? -59.798  -40.168 54.213 1.00 40.62  ? 1265 ASP D N     1 
ATOM   7654  C CA    . ASP E 4 69  ? -61.086  -39.747 53.725 1.00 40.86  ? 1265 ASP D CA    1 
ATOM   7655  C C     . ASP E 4 69  ? -62.164  -40.721 54.231 1.00 41.16  ? 1265 ASP D C     1 
ATOM   7656  O O     . ASP E 4 69  ? -63.073  -40.308 54.969 1.00 37.47  ? 1265 ASP D O     1 
ATOM   7657  C CB    . ASP E 4 69  ? -61.070  -39.647 52.194 1.00 42.88  ? 1265 ASP D CB    1 
ATOM   7658  C CG    . ASP E 4 69  ? -62.443  -39.341 51.612 1.00 47.32  ? 1265 ASP D CG    1 
ATOM   7659  O OD1   . ASP E 4 69  ? -63.347  -38.939 52.381 1.00 50.09  ? 1265 ASP D OD1   1 
ATOM   7660  O OD2   . ASP E 4 69  ? -62.618  -39.504 50.381 1.00 46.89  ? 1265 ASP D OD2   1 
ATOM   7661  N N     . ILE E 4 70  ? -62.054  -42.011 53.877 1.00 48.58  ? 1266 ILE D N     1 
ATOM   7662  C CA    . ILE E 4 70  ? -63.058  -42.982 54.314 1.00 47.61  ? 1266 ILE D CA    1 
ATOM   7663  C C     . ILE E 4 70  ? -63.180  -42.961 55.831 1.00 48.53  ? 1266 ILE D C     1 
ATOM   7664  O O     . ILE E 4 70  ? -64.290  -42.992 56.376 1.00 46.97  ? 1266 ILE D O     1 
ATOM   7665  C CB    . ILE E 4 70  ? -62.736  -44.424 53.852 1.00 58.82  ? 1266 ILE D CB    1 
ATOM   7666  C CG1   . ILE E 4 70  ? -62.487  -44.443 52.355 1.00 56.39  ? 1266 ILE D CG1   1 
ATOM   7667  C CG2   . ILE E 4 70  ? -63.923  -45.348 54.121 1.00 62.54  ? 1266 ILE D CG2   1 
ATOM   7668  C CD1   . ILE E 4 70  ? -63.586  -43.795 51.586 1.00 50.73  ? 1266 ILE D CD1   1 
ATOM   7669  N N     . PHE E 4 71  ? -62.057  -42.901 56.528 1.00 40.14  ? 1267 PHE D N     1 
ATOM   7670  C CA    . PHE E 4 71  ? -62.173  -42.870 57.966 1.00 42.13  ? 1267 PHE D CA    1 
ATOM   7671  C C     . PHE E 4 71  ? -63.154  -41.765 58.339 1.00 42.50  ? 1267 PHE D C     1 
ATOM   7672  O O     . PHE E 4 71  ? -64.032  -41.946 59.193 1.00 42.65  ? 1267 PHE D O     1 
ATOM   7673  C CB    . PHE E 4 71  ? -60.836  -42.592 58.623 1.00 57.62  ? 1267 PHE D CB    1 
ATOM   7674  C CG    . PHE E 4 71  ? -60.890  -42.617 60.125 1.00 63.80  ? 1267 PHE D CG    1 
ATOM   7675  C CD1   . PHE E 4 71  ? -60.131  -43.533 60.841 1.00 66.61  ? 1267 PHE D CD1   1 
ATOM   7676  C CD2   . PHE E 4 71  ? -61.679  -41.706 60.824 1.00 65.67  ? 1267 PHE D CD2   1 
ATOM   7677  C CE1   . PHE E 4 71  ? -60.152  -43.541 62.231 1.00 68.66  ? 1267 PHE D CE1   1 
ATOM   7678  C CE2   . PHE E 4 71  ? -61.711  -41.701 62.210 1.00 66.02  ? 1267 PHE D CE2   1 
ATOM   7679  C CZ    . PHE E 4 71  ? -60.947  -42.618 62.919 1.00 67.99  ? 1267 PHE D CZ    1 
ATOM   7680  N N     . GLU E 4 72  ? -63.010  -40.616 57.687 1.00 51.24  ? 1268 GLU D N     1 
ATOM   7681  C CA    . GLU E 4 72  ? -63.878  -39.482 57.965 1.00 52.19  ? 1268 GLU D CA    1 
ATOM   7682  C C     . GLU E 4 72  ? -65.333  -39.760 57.604 1.00 49.86  ? 1268 GLU D C     1 
ATOM   7683  O O     . GLU E 4 72  ? -66.224  -39.586 58.434 1.00 50.47  ? 1268 GLU D O     1 
ATOM   7684  C CB    . GLU E 4 72  ? -63.386  -38.247 57.207 1.00 100.33 ? 1268 GLU D CB    1 
ATOM   7685  C CG    . GLU E 4 72  ? -64.218  -37.009 57.465 1.00 108.72 ? 1268 GLU D CG    1 
ATOM   7686  C CD    . GLU E 4 72  ? -64.387  -36.743 58.944 1.00 113.98 ? 1268 GLU D CD    1 
ATOM   7687  O OE1   . GLU E 4 72  ? -63.361  -36.664 59.645 1.00 115.73 ? 1268 GLU D OE1   1 
ATOM   7688  O OE2   . GLU E 4 72  ? -65.540  -36.615 59.406 1.00 115.76 ? 1268 GLU D OE2   1 
ATOM   7689  N N     . ARG E 4 73  ? -65.562  -40.199 56.369 1.00 44.71  ? 1269 ARG D N     1 
ATOM   7690  C CA    . ARG E 4 73  ? -66.910  -40.473 55.892 1.00 43.61  ? 1269 ARG D CA    1 
ATOM   7691  C C     . ARG E 4 73  ? -67.712  -41.399 56.797 1.00 44.88  ? 1269 ARG D C     1 
ATOM   7692  O O     . ARG E 4 73  ? -68.868  -41.096 57.152 1.00 44.91  ? 1269 ARG D O     1 
ATOM   7693  C CB    . ARG E 4 73  ? -66.866  -41.076 54.499 1.00 36.80  ? 1269 ARG D CB    1 
ATOM   7694  C CG    . ARG E 4 73  ? -65.998  -40.319 53.525 1.00 36.85  ? 1269 ARG D CG    1 
ATOM   7695  C CD    . ARG E 4 73  ? -66.582  -40.451 52.134 1.00 38.92  ? 1269 ARG D CD    1 
ATOM   7696  N NE    . ARG E 4 73  ? -65.565  -40.298 51.105 1.00 38.88  ? 1269 ARG D NE    1 
ATOM   7697  C CZ    . ARG E 4 73  ? -65.709  -40.755 49.869 1.00 39.70  ? 1269 ARG D CZ    1 
ATOM   7698  N NH1   . ARG E 4 73  ? -66.831  -41.379 49.536 1.00 36.14  ? 1269 ARG D NH1   1 
ATOM   7699  N NH2   . ARG E 4 73  ? -64.726  -40.625 48.985 1.00 43.54  ? 1269 ARG D NH2   1 
ATOM   7700  N N     . ILE E 4 74  ? -67.094  -42.520 57.172 1.00 54.75  ? 1270 ILE D N     1 
ATOM   7701  C CA    . ILE E 4 74  ? -67.736  -43.502 58.025 1.00 56.08  ? 1270 ILE D CA    1 
ATOM   7702  C C     . ILE E 4 74  ? -67.985  -42.960 59.421 1.00 56.79  ? 1270 ILE D C     1 
ATOM   7703  O O     . ILE E 4 74  ? -69.127  -42.943 59.877 1.00 57.98  ? 1270 ILE D O     1 
ATOM   7704  C CB    . ILE E 4 74  ? -66.898  -44.798 58.078 1.00 48.69  ? 1270 ILE D CB    1 
ATOM   7705  C CG1   . ILE E 4 74  ? -66.859  -45.413 56.680 1.00 47.07  ? 1270 ILE D CG1   1 
ATOM   7706  C CG2   . ILE E 4 74  ? -67.501  -45.794 59.051 1.00 46.26  ? 1270 ILE D CG2   1 
ATOM   7707  C CD1   . ILE E 4 74  ? -65.927  -46.568 56.541 1.00 47.60  ? 1270 ILE D CD1   1 
ATOM   7708  N N     . ALA E 4 75  ? -66.935  -42.508 60.098 1.00 47.70  ? 1271 ALA D N     1 
ATOM   7709  C CA    . ALA E 4 75  ? -67.089  -41.957 61.455 1.00 48.87  ? 1271 ALA D CA    1 
ATOM   7710  C C     . ALA E 4 75  ? -68.213  -40.910 61.497 1.00 51.53  ? 1271 ALA D C     1 
ATOM   7711  O O     . ALA E 4 75  ? -69.055  -40.907 62.400 1.00 49.14  ? 1271 ALA D O     1 
ATOM   7712  C CB    . ALA E 4 75  ? -65.771  -41.314 61.924 1.00 24.13  ? 1271 ALA D CB    1 
ATOM   7713  N N     . SER E 4 76  ? -68.205  -40.021 60.504 1.00 53.71  ? 1272 SER D N     1 
ATOM   7714  C CA    . SER E 4 76  ? -69.189  -38.954 60.392 1.00 59.00  ? 1272 SER D CA    1 
ATOM   7715  C C     . SER E 4 76  ? -70.605  -39.527 60.260 1.00 61.44  ? 1272 SER D C     1 
ATOM   7716  O O     . SER E 4 76  ? -71.492  -39.218 61.068 1.00 62.75  ? 1272 SER D O     1 
ATOM   7717  C CB    . SER E 4 76  ? -68.840  -38.081 59.184 1.00 93.25  ? 1272 SER D CB    1 
ATOM   7718  O OG    . SER E 4 76  ? -69.586  -36.881 59.188 1.00 99.33  ? 1272 SER D OG    1 
ATOM   7719  N N     . GLU E 4 77  ? -70.809  -40.365 59.244 1.00 59.95  ? 1273 GLU D N     1 
ATOM   7720  C CA    . GLU E 4 77  ? -72.112  -40.984 59.023 1.00 59.29  ? 1273 GLU D CA    1 
ATOM   7721  C C     . GLU E 4 77  ? -72.516  -41.698 60.301 1.00 59.37  ? 1273 GLU D C     1 
ATOM   7722  O O     . GLU E 4 77  ? -73.628  -41.544 60.791 1.00 59.38  ? 1273 GLU D O     1 
ATOM   7723  C CB    . GLU E 4 77  ? -72.043  -41.980 57.868 1.00 72.13  ? 1273 GLU D CB    1 
ATOM   7724  C CG    . GLU E 4 77  ? -73.385  -42.583 57.485 1.00 78.44  ? 1273 GLU D CG    1 
ATOM   7725  C CD    . GLU E 4 77  ? -74.513  -41.556 57.442 1.00 80.50  ? 1273 GLU D CD    1 
ATOM   7726  O OE1   . GLU E 4 77  ? -75.057  -41.215 58.513 1.00 80.06  ? 1273 GLU D OE1   1 
ATOM   7727  O OE2   . GLU E 4 77  ? -74.853  -41.081 56.336 1.00 83.39  ? 1273 GLU D OE2   1 
ATOM   7728  N N     . ALA E 4 78  ? -71.597  -42.475 60.849 1.00 52.23  ? 1274 ALA D N     1 
ATOM   7729  C CA    . ALA E 4 78  ? -71.871  -43.181 62.079 1.00 52.04  ? 1274 ALA D CA    1 
ATOM   7730  C C     . ALA E 4 78  ? -72.296  -42.163 63.135 1.00 52.50  ? 1274 ALA D C     1 
ATOM   7731  O O     . ALA E 4 78  ? -73.292  -42.336 63.830 1.00 53.16  ? 1274 ALA D O     1 
ATOM   7732  C CB    . ALA E 4 78  ? -70.630  -43.911 62.529 1.00 61.98  ? 1274 ALA D CB    1 
ATOM   7733  N N     . SER E 4 79  ? -71.552  -41.078 63.248 1.00 68.06  ? 1275 SER D N     1 
ATOM   7734  C CA    . SER E 4 79  ? -71.900  -40.089 64.248 1.00 70.33  ? 1275 SER D CA    1 
ATOM   7735  C C     . SER E 4 79  ? -73.355  -39.662 64.124 1.00 70.41  ? 1275 SER D C     1 
ATOM   7736  O O     . SER E 4 79  ? -74.132  -39.837 65.056 1.00 69.76  ? 1275 SER D O     1 
ATOM   7737  C CB    . SER E 4 79  ? -70.988  -38.873 64.138 1.00 72.64  ? 1275 SER D CB    1 
ATOM   7738  O OG    . SER E 4 79  ? -71.246  -37.989 65.210 1.00 75.40  ? 1275 SER D OG    1 
ATOM   7739  N N     . ARG E 4 80  ? -73.725  -39.117 62.970 1.00 50.23  ? 1276 ARG D N     1 
ATOM   7740  C CA    . ARG E 4 80  ? -75.094  -38.663 62.752 1.00 54.47  ? 1276 ARG D CA    1 
ATOM   7741  C C     . ARG E 4 80  ? -76.055  -39.757 63.170 1.00 54.52  ? 1276 ARG D C     1 
ATOM   7742  O O     . ARG E 4 80  ? -76.958  -39.538 63.980 1.00 54.95  ? 1276 ARG D O     1 
ATOM   7743  C CB    . ARG E 4 80  ? -75.312  -38.331 61.282 1.00 87.96  ? 1276 ARG D CB    1 
ATOM   7744  C CG    . ARG E 4 80  ? -74.265  -37.403 60.708 1.00 92.04  ? 1276 ARG D CG    1 
ATOM   7745  C CD    . ARG E 4 80  ? -74.371  -37.384 59.208 1.00 95.15  ? 1276 ARG D CD    1 
ATOM   7746  N NE    . ARG E 4 80  ? -73.146  -36.916 58.575 1.00 98.80  ? 1276 ARG D NE    1 
ATOM   7747  C CZ    . ARG E 4 80  ? -72.840  -37.159 57.305 1.00 100.86 ? 1276 ARG D CZ    1 
ATOM   7748  N NH1   . ARG E 4 80  ? -73.669  -37.869 56.544 1.00 103.24 ? 1276 ARG D NH1   1 
ATOM   7749  N NH2   . ARG E 4 80  ? -71.710  -36.688 56.793 1.00 101.59 ? 1276 ARG D NH2   1 
ATOM   7750  N N     . LEU E 4 81  ? -75.836  -40.946 62.623 1.00 58.88  ? 1277 LEU D N     1 
ATOM   7751  C CA    . LEU E 4 81  ? -76.667  -42.103 62.911 1.00 57.79  ? 1277 LEU D CA    1 
ATOM   7752  C C     . LEU E 4 81  ? -77.006  -42.196 64.399 1.00 59.26  ? 1277 LEU D C     1 
ATOM   7753  O O     . LEU E 4 81  ? -78.179  -42.280 64.787 1.00 59.31  ? 1277 LEU D O     1 
ATOM   7754  C CB    . LEU E 4 81  ? -75.937  -43.354 62.470 1.00 64.83  ? 1277 LEU D CB    1 
ATOM   7755  C CG    . LEU E 4 81  ? -76.800  -44.590 62.283 1.00 62.63  ? 1277 LEU D CG    1 
ATOM   7756  C CD1   . LEU E 4 81  ? -77.868  -44.314 61.255 1.00 60.39  ? 1277 LEU D CD1   1 
ATOM   7757  C CD2   . LEU E 4 81  ? -75.918  -45.747 61.844 1.00 60.51  ? 1277 LEU D CD2   1 
ATOM   7758  N N     . ALA E 4 82  ? -75.974  -42.179 65.233 1.00 52.37  ? 1278 ALA D N     1 
ATOM   7759  C CA    . ALA E 4 82  ? -76.181  -42.253 66.668 1.00 54.94  ? 1278 ALA D CA    1 
ATOM   7760  C C     . ALA E 4 82  ? -77.057  -41.100 67.155 1.00 56.94  ? 1278 ALA D C     1 
ATOM   7761  O O     . ALA E 4 82  ? -77.968  -41.306 67.951 1.00 57.06  ? 1278 ALA D O     1 
ATOM   7762  C CB    . ALA E 4 82  ? -74.841  -42.232 67.394 1.00 63.90  ? 1278 ALA D CB    1 
ATOM   7763  N N     . HIS E 4 83  ? -76.798  -39.885 66.679 1.00 66.28  ? 1279 HIS D N     1 
ATOM   7764  C CA    . HIS E 4 83  ? -77.595  -38.753 67.134 1.00 68.51  ? 1279 HIS D CA    1 
ATOM   7765  C C     . HIS E 4 83  ? -79.029  -38.781 66.642 1.00 68.52  ? 1279 HIS D C     1 
ATOM   7766  O O     . HIS E 4 83  ? -79.949  -38.417 67.374 1.00 66.73  ? 1279 HIS D O     1 
ATOM   7767  C CB    . HIS E 4 83  ? -76.893  -37.434 66.804 1.00 114.19 ? 1279 HIS D CB    1 
ATOM   7768  C CG    . HIS E 4 83  ? -75.732  -37.155 67.708 1.00 116.53 ? 1279 HIS D CG    1 
ATOM   7769  N ND1   . HIS E 4 83  ? -74.737  -36.254 67.398 1.00 117.81 ? 1279 HIS D ND1   1 
ATOM   7770  C CD2   . HIS E 4 83  ? -75.393  -37.693 68.905 1.00 116.99 ? 1279 HIS D CD2   1 
ATOM   7771  C CE1   . HIS E 4 83  ? -73.830  -36.255 68.362 1.00 118.37 ? 1279 HIS D CE1   1 
ATOM   7772  N NE2   . HIS E 4 83  ? -74.205  -37.120 69.287 1.00 118.99 ? 1279 HIS D NE2   1 
ATOM   7773  N N     . TYR E 4 84  ? -79.244  -39.244 65.421 1.00 90.21  ? 1280 TYR D N     1 
ATOM   7774  C CA    . TYR E 4 84  ? -80.611  -39.321 64.940 1.00 92.36  ? 1280 TYR D CA    1 
ATOM   7775  C C     . TYR E 4 84  ? -81.361  -40.219 65.922 1.00 91.90  ? 1280 TYR D C     1 
ATOM   7776  O O     . TYR E 4 84  ? -82.509  -39.963 66.266 1.00 91.90  ? 1280 TYR D O     1 
ATOM   7777  C CB    . TYR E 4 84  ? -80.661  -39.913 63.527 1.00 137.09 ? 1280 TYR D CB    1 
ATOM   7778  C CG    . TYR E 4 84  ? -82.060  -40.265 63.054 1.00 142.76 ? 1280 TYR D CG    1 
ATOM   7779  C CD1   . TYR E 4 84  ? -83.109  -39.349 63.159 1.00 144.68 ? 1280 TYR D CD1   1 
ATOM   7780  C CD2   . TYR E 4 84  ? -82.336  -41.517 62.496 1.00 145.01 ? 1280 TYR D CD2   1 
ATOM   7781  C CE1   . TYR E 4 84  ? -84.398  -39.668 62.716 1.00 146.38 ? 1280 TYR D CE1   1 
ATOM   7782  C CE2   . TYR E 4 84  ? -83.621  -41.845 62.051 1.00 146.13 ? 1280 TYR D CE2   1 
ATOM   7783  C CZ    . TYR E 4 84  ? -84.645  -40.916 62.165 1.00 146.88 ? 1280 TYR D CZ    1 
ATOM   7784  O OH    . TYR E 4 84  ? -85.910  -41.235 61.725 1.00 148.28 ? 1280 TYR D OH    1 
ATOM   7785  N N     . ASN E 4 85  ? -80.688  -41.259 66.395 1.00 92.03  ? 1281 ASN D N     1 
ATOM   7786  C CA    . ASN E 4 85  ? -81.301  -42.189 67.323 1.00 91.53  ? 1281 ASN D CA    1 
ATOM   7787  C C     . ASN E 4 85  ? -81.062  -41.836 68.772 1.00 91.18  ? 1281 ASN D C     1 
ATOM   7788  O O     . ASN E 4 85  ? -81.038  -42.710 69.639 1.00 91.31  ? 1281 ASN D O     1 
ATOM   7789  C CB    . ASN E 4 85  ? -80.812  -43.594 67.022 1.00 63.13  ? 1281 ASN D CB    1 
ATOM   7790  C CG    . ASN E 4 85  ? -81.367  -44.104 65.733 1.00 64.24  ? 1281 ASN D CG    1 
ATOM   7791  O OD1   . ASN E 4 85  ? -82.571  -44.329 65.625 1.00 64.29  ? 1281 ASN D OD1   1 
ATOM   7792  N ND2   . ASN E 4 85  ? -80.510  -44.260 64.727 1.00 65.44  ? 1281 ASN D ND2   1 
ATOM   7793  N N     . LYS E 4 86  ? -80.881  -40.543 69.023 1.00 83.88  ? 1282 LYS D N     1 
ATOM   7794  C CA    . LYS E 4 86  ? -80.679  -40.044 70.373 1.00 82.52  ? 1282 LYS D CA    1 
ATOM   7795  C C     . LYS E 4 86  ? -79.745  -40.895 71.230 1.00 81.45  ? 1282 LYS D C     1 
ATOM   7796  O O     . LYS E 4 86  ? -79.916  -40.975 72.448 1.00 81.21  ? 1282 LYS D O     1 
ATOM   7797  C CB    . LYS E 4 86  ? -82.036  -39.909 71.063 1.00 88.27  ? 1282 LYS D CB    1 
ATOM   7798  C CG    . LYS E 4 86  ? -82.852  -38.721 70.577 1.00 86.91  ? 1282 LYS D CG    1 
ATOM   7799  C CD    . LYS E 4 86  ? -84.272  -38.762 71.115 1.00 86.65  ? 1282 LYS D CD    1 
ATOM   7800  C CE    . LYS E 4 86  ? -84.907  -37.373 71.142 1.00 86.21  ? 1282 LYS D CE    1 
ATOM   7801  N NZ    . LYS E 4 86  ? -84.281  -36.459 72.160 1.00 85.25  ? 1282 LYS D NZ    1 
ATOM   7802  N N     . ARG E 4 87  ? -78.762  -41.531 70.596 1.00 87.92  ? 1283 ARG D N     1 
ATOM   7803  C CA    . ARG E 4 87  ? -77.790  -42.353 71.317 1.00 87.06  ? 1283 ARG D CA    1 
ATOM   7804  C C     . ARG E 4 87  ? -76.541  -41.535 71.594 1.00 84.96  ? 1283 ARG D C     1 
ATOM   7805  O O     . ARG E 4 87  ? -76.247  -40.573 70.882 1.00 83.76  ? 1283 ARG D O     1 
ATOM   7806  C CB    . ARG E 4 87  ? -77.412  -43.600 70.511 1.00 95.35  ? 1283 ARG D CB    1 
ATOM   7807  C CG    . ARG E 4 87  ? -78.473  -44.668 70.519 1.00 99.04  ? 1283 ARG D CG    1 
ATOM   7808  C CD    . ARG E 4 87  ? -78.726  -45.140 71.936 1.00 103.42 ? 1283 ARG D CD    1 
ATOM   7809  N NE    . ARG E 4 87  ? -79.810  -46.112 72.008 1.00 109.10 ? 1283 ARG D NE    1 
ATOM   7810  C CZ    . ARG E 4 87  ? -81.067  -45.861 71.652 1.00 112.28 ? 1283 ARG D CZ    1 
ATOM   7811  N NH1   . ARG E 4 87  ? -81.407  -44.663 71.193 1.00 113.82 ? 1283 ARG D NH1   1 
ATOM   7812  N NH2   . ARG E 4 87  ? -81.988  -46.811 71.760 1.00 114.45 ? 1283 ARG D NH2   1 
ATOM   7813  N N     . SER E 4 88  ? -75.806  -41.930 72.628 1.00 96.10  ? 1284 SER D N     1 
ATOM   7814  C CA    . SER E 4 88  ? -74.591  -41.231 73.014 1.00 93.97  ? 1284 SER D CA    1 
ATOM   7815  C C     . SER E 4 88  ? -73.339  -42.044 72.727 1.00 92.94  ? 1284 SER D C     1 
ATOM   7816  O O     . SER E 4 88  ? -72.228  -41.596 73.008 1.00 91.15  ? 1284 SER D O     1 
ATOM   7817  C CB    . SER E 4 88  ? -74.642  -40.890 74.502 1.00 123.82 ? 1284 SER D CB    1 
ATOM   7818  O OG    . SER E 4 88  ? -74.786  -42.067 75.277 1.00 123.92 ? 1284 SER D OG    1 
ATOM   7819  N N     . THR E 4 89  ? -73.510  -43.230 72.151 1.00 73.40  ? 1285 THR D N     1 
ATOM   7820  C CA    . THR E 4 89  ? -72.359  -44.074 71.862 1.00 71.78  ? 1285 THR D CA    1 
ATOM   7821  C C     . THR E 4 89  ? -72.214  -44.602 70.444 1.00 69.79  ? 1285 THR D C     1 
ATOM   7822  O O     . THR E 4 89  ? -73.162  -45.136 69.861 1.00 70.49  ? 1285 THR D O     1 
ATOM   7823  C CB    . THR E 4 89  ? -72.345  -45.290 72.770 1.00 73.04  ? 1285 THR D CB    1 
ATOM   7824  O OG1   . THR E 4 89  ? -72.749  -44.899 74.091 1.00 73.19  ? 1285 THR D OG1   1 
ATOM   7825  C CG2   . THR E 4 89  ? -70.940  -45.914 72.783 1.00 71.81  ? 1285 THR D CG2   1 
ATOM   7826  N N     . ILE E 4 90  ? -71.013  -44.459 69.898 1.00 68.13  ? 1286 ILE D N     1 
ATOM   7827  C CA    . ILE E 4 90  ? -70.738  -44.984 68.573 1.00 65.43  ? 1286 ILE D CA    1 
ATOM   7828  C C     . ILE E 4 90  ? -70.215  -46.377 68.841 1.00 64.67  ? 1286 ILE D C     1 
ATOM   7829  O O     . ILE E 4 90  ? -69.171  -46.535 69.471 1.00 64.09  ? 1286 ILE D O     1 
ATOM   7830  C CB    . ILE E 4 90  ? -69.635  -44.215 67.848 1.00 50.16  ? 1286 ILE D CB    1 
ATOM   7831  C CG1   . ILE E 4 90  ? -70.022  -42.738 67.765 1.00 49.21  ? 1286 ILE D CG1   1 
ATOM   7832  C CG2   . ILE E 4 90  ? -69.378  -44.847 66.483 1.00 47.96  ? 1286 ILE D CG2   1 
ATOM   7833  C CD1   . ILE E 4 90  ? -70.022  -42.118 66.356 1.00 49.80  ? 1286 ILE D CD1   1 
ATOM   7834  N N     . THR E 4 91  ? -70.937  -47.388 68.384 1.00 68.30  ? 1287 THR D N     1 
ATOM   7835  C CA    . THR E 4 91  ? -70.510  -48.761 68.600 1.00 66.66  ? 1287 THR D CA    1 
ATOM   7836  C C     . THR E 4 91  ? -70.241  -49.429 67.266 1.00 65.92  ? 1287 THR D C     1 
ATOM   7837  O O     . THR E 4 91  ? -70.403  -48.815 66.215 1.00 65.87  ? 1287 THR D O     1 
ATOM   7838  C CB    . THR E 4 91  ? -71.596  -49.557 69.312 1.00 62.87  ? 1287 THR D CB    1 
ATOM   7839  O OG1   . THR E 4 91  ? -72.725  -49.695 68.440 1.00 62.18  ? 1287 THR D OG1   1 
ATOM   7840  C CG2   . THR E 4 91  ? -72.032  -48.830 70.568 1.00 61.06  ? 1287 THR D CG2   1 
ATOM   7841  N N     . SER E 4 92  ? -69.833  -50.692 67.300 1.00 69.66  ? 1288 SER D N     1 
ATOM   7842  C CA    . SER E 4 92  ? -69.584  -51.400 66.059 1.00 69.70  ? 1288 SER D CA    1 
ATOM   7843  C C     . SER E 4 92  ? -70.876  -51.415 65.233 1.00 70.49  ? 1288 SER D C     1 
ATOM   7844  O O     . SER E 4 92  ? -70.842  -51.455 64.005 1.00 71.04  ? 1288 SER D O     1 
ATOM   7845  C CB    . SER E 4 92  ? -69.100  -52.826 66.343 1.00 90.09  ? 1288 SER D CB    1 
ATOM   7846  O OG    . SER E 4 92  ? -69.996  -53.522 67.188 1.00 89.84  ? 1288 SER D OG    1 
ATOM   7847  N N     . ARG E 4 93  ? -72.013  -51.343 65.914 1.00 64.97  ? 1289 ARG D N     1 
ATOM   7848  C CA    . ARG E 4 93  ? -73.301  -51.356 65.235 1.00 65.79  ? 1289 ARG D CA    1 
ATOM   7849  C C     . ARG E 4 93  ? -73.516  -50.112 64.375 1.00 65.82  ? 1289 ARG D C     1 
ATOM   7850  O O     . ARG E 4 93  ? -74.017  -50.218 63.248 1.00 65.31  ? 1289 ARG D O     1 
ATOM   7851  C CB    . ARG E 4 93  ? -74.439  -51.496 66.250 1.00 71.35  ? 1289 ARG D CB    1 
ATOM   7852  C CG    . ARG E 4 93  ? -75.814  -51.557 65.612 1.00 72.74  ? 1289 ARG D CG    1 
ATOM   7853  C CD    . ARG E 4 93  ? -76.769  -52.429 66.410 1.00 75.08  ? 1289 ARG D CD    1 
ATOM   7854  N NE    . ARG E 4 93  ? -78.056  -52.564 65.735 1.00 75.61  ? 1289 ARG D NE    1 
ATOM   7855  C CZ    . ARG E 4 93  ? -78.944  -51.582 65.613 1.00 76.46  ? 1289 ARG D CZ    1 
ATOM   7856  N NH1   . ARG E 4 93  ? -78.688  -50.384 66.131 1.00 75.81  ? 1289 ARG D NH1   1 
ATOM   7857  N NH2   . ARG E 4 93  ? -80.083  -51.793 64.961 1.00 76.32  ? 1289 ARG D NH2   1 
ATOM   7858  N N     . GLU E 4 94  ? -73.150  -48.937 64.898 1.00 69.40  ? 1290 GLU D N     1 
ATOM   7859  C CA    . GLU E 4 94  ? -73.305  -47.704 64.126 1.00 68.19  ? 1290 GLU D CA    1 
ATOM   7860  C C     . GLU E 4 94  ? -72.337  -47.791 62.942 1.00 66.14  ? 1290 GLU D C     1 
ATOM   7861  O O     . GLU E 4 94  ? -72.722  -47.608 61.785 1.00 68.52  ? 1290 GLU D O     1 
ATOM   7862  C CB    . GLU E 4 94  ? -72.964  -46.468 64.963 1.00 75.97  ? 1290 GLU D CB    1 
ATOM   7863  C CG    . GLU E 4 94  ? -73.125  -46.621 66.463 1.00 81.98  ? 1290 GLU D CG    1 
ATOM   7864  C CD    . GLU E 4 94  ? -74.471  -47.157 66.870 1.00 86.39  ? 1290 GLU D CD    1 
ATOM   7865  O OE1   . GLU E 4 94  ? -75.484  -46.766 66.256 1.00 88.30  ? 1290 GLU D OE1   1 
ATOM   7866  O OE2   . GLU E 4 94  ? -74.518  -47.959 67.821 1.00 89.93  ? 1290 GLU D OE2   1 
ATOM   7867  N N     . VAL E 4 95  ? -71.080  -48.088 63.239 1.00 55.68  ? 1291 VAL D N     1 
ATOM   7868  C CA    . VAL E 4 95  ? -70.081  -48.208 62.195 1.00 52.67  ? 1291 VAL D CA    1 
ATOM   7869  C C     . VAL E 4 95  ? -70.584  -49.069 61.018 1.00 51.41  ? 1291 VAL D C     1 
ATOM   7870  O O     . VAL E 4 95  ? -70.389  -48.723 59.857 1.00 48.80  ? 1291 VAL D O     1 
ATOM   7871  C CB    . VAL E 4 95  ? -68.755  -48.805 62.754 1.00 54.10  ? 1291 VAL D CB    1 
ATOM   7872  C CG1   . VAL E 4 95  ? -67.779  -49.065 61.606 1.00 52.65  ? 1291 VAL D CG1   1 
ATOM   7873  C CG2   . VAL E 4 95  ? -68.124  -47.839 63.785 1.00 53.89  ? 1291 VAL D CG2   1 
ATOM   7874  N N     . GLN E 4 96  ? -71.255  -50.175 61.308 1.00 68.05  ? 1292 GLN D N     1 
ATOM   7875  C CA    . GLN E 4 96  ? -71.755  -51.039 60.241 1.00 69.97  ? 1292 GLN D CA    1 
ATOM   7876  C C     . GLN E 4 96  ? -72.822  -50.395 59.359 1.00 70.68  ? 1292 GLN D C     1 
ATOM   7877  O O     . GLN E 4 96  ? -72.716  -50.436 58.136 1.00 69.99  ? 1292 GLN D O     1 
ATOM   7878  C CB    . GLN E 4 96  ? -72.318  -52.323 60.823 1.00 63.97  ? 1292 GLN D CB    1 
ATOM   7879  C CG    . GLN E 4 96  ? -72.568  -53.379 59.784 1.00 64.18  ? 1292 GLN D CG    1 
ATOM   7880  C CD    . GLN E 4 96  ? -73.110  -54.645 60.380 1.00 63.78  ? 1292 GLN D CD    1 
ATOM   7881  O OE1   . GLN E 4 96  ? -74.306  -54.750 60.637 1.00 65.31  ? 1292 GLN D OE1   1 
ATOM   7882  N NE2   . GLN E 4 96  ? -72.234  -55.613 60.616 1.00 62.04  ? 1292 GLN D NE2   1 
ATOM   7883  N N     . THR E 4 97  ? -73.858  -49.824 59.975 1.00 61.41  ? 1293 THR D N     1 
ATOM   7884  C CA    . THR E 4 97  ? -74.931  -49.167 59.222 1.00 61.69  ? 1293 THR D CA    1 
ATOM   7885  C C     . THR E 4 97  ? -74.282  -48.122 58.321 1.00 60.60  ? 1293 THR D C     1 
ATOM   7886  O O     . THR E 4 97  ? -74.621  -47.990 57.138 1.00 60.32  ? 1293 THR D O     1 
ATOM   7887  C CB    . THR E 4 97  ? -75.944  -48.453 60.168 1.00 63.75  ? 1293 THR D CB    1 
ATOM   7888  O OG1   . THR E 4 97  ? -76.609  -49.421 60.984 1.00 64.69  ? 1293 THR D OG1   1 
ATOM   7889  C CG2   . THR E 4 97  ? -76.984  -47.673 59.369 1.00 63.41  ? 1293 THR D CG2   1 
ATOM   7890  N N     . ALA E 4 98  ? -73.339  -47.388 58.908 1.00 65.05  ? 1294 ALA D N     1 
ATOM   7891  C CA    . ALA E 4 98  ? -72.595  -46.355 58.204 1.00 64.42  ? 1294 ALA D CA    1 
ATOM   7892  C C     . ALA E 4 98  ? -71.943  -46.957 56.960 1.00 65.98  ? 1294 ALA D C     1 
ATOM   7893  O O     . ALA E 4 98  ? -72.095  -46.457 55.836 1.00 65.75  ? 1294 ALA D O     1 
ATOM   7894  C CB    . ALA E 4 98  ? -71.538  -45.797 59.115 1.00 52.02  ? 1294 ALA D CB    1 
ATOM   7895  N N     . VAL E 4 99  ? -71.202  -48.033 57.182 1.00 46.42  ? 1295 VAL D N     1 
ATOM   7896  C CA    . VAL E 4 99  ? -70.544  -48.718 56.101 1.00 43.35  ? 1295 VAL D CA    1 
ATOM   7897  C C     . VAL E 4 99  ? -71.591  -49.084 55.065 1.00 43.57  ? 1295 VAL D C     1 
ATOM   7898  O O     . VAL E 4 99  ? -71.331  -48.996 53.860 1.00 43.70  ? 1295 VAL D O     1 
ATOM   7899  C CB    . VAL E 4 99  ? -69.816  -49.956 56.633 1.00 40.28  ? 1295 VAL D CB    1 
ATOM   7900  C CG1   . VAL E 4 99  ? -69.029  -50.651 55.542 1.00 39.21  ? 1295 VAL D CG1   1 
ATOM   7901  C CG2   . VAL E 4 99  ? -68.862  -49.516 57.690 1.00 38.51  ? 1295 VAL D CG2   1 
ATOM   7902  N N     . ARG E 4 100 ? -72.782  -49.468 55.524 1.00 61.72  ? 1296 ARG D N     1 
ATOM   7903  C CA    . ARG E 4 100 ? -73.857  -49.831 54.599 1.00 62.52  ? 1296 ARG D CA    1 
ATOM   7904  C C     . ARG E 4 100 ? -74.285  -48.611 53.800 1.00 61.96  ? 1296 ARG D C     1 
ATOM   7905  O O     . ARG E 4 100 ? -74.333  -48.649 52.575 1.00 61.51  ? 1296 ARG D O     1 
ATOM   7906  C CB    . ARG E 4 100 ? -75.074  -50.409 55.340 1.00 71.69  ? 1296 ARG D CB    1 
ATOM   7907  C CG    . ARG E 4 100 ? -74.822  -51.752 55.996 1.00 74.86  ? 1296 ARG D CG    1 
ATOM   7908  C CD    . ARG E 4 100 ? -76.021  -52.687 55.895 1.00 77.99  ? 1296 ARG D CD    1 
ATOM   7909  N NE    . ARG E 4 100 ? -75.683  -54.063 56.278 1.00 81.17  ? 1296 ARG D NE    1 
ATOM   7910  C CZ    . ARG E 4 100 ? -75.666  -54.531 57.529 1.00 82.46  ? 1296 ARG D CZ    1 
ATOM   7911  N NH1   . ARG E 4 100 ? -75.971  -53.748 58.564 1.00 81.40  ? 1296 ARG D NH1   1 
ATOM   7912  N NH2   . ARG E 4 100 ? -75.343  -55.800 57.752 1.00 81.27  ? 1296 ARG D NH2   1 
ATOM   7913  N N     . LEU E 4 101 ? -74.581  -47.522 54.498 1.00 46.44  ? 1297 LEU D N     1 
ATOM   7914  C CA    . LEU E 4 101 ? -75.013  -46.288 53.849 1.00 46.53  ? 1297 LEU D CA    1 
ATOM   7915  C C     . LEU E 4 101 ? -73.989  -45.703 52.892 1.00 47.92  ? 1297 LEU D C     1 
ATOM   7916  O O     . LEU E 4 101 ? -74.364  -45.110 51.902 1.00 48.52  ? 1297 LEU D O     1 
ATOM   7917  C CB    . LEU E 4 101 ? -75.346  -45.224 54.892 1.00 50.99  ? 1297 LEU D CB    1 
ATOM   7918  C CG    . LEU E 4 101 ? -76.570  -45.453 55.772 1.00 49.72  ? 1297 LEU D CG    1 
ATOM   7919  C CD1   . LEU E 4 101 ? -76.475  -44.568 57.023 1.00 46.53  ? 1297 LEU D CD1   1 
ATOM   7920  C CD2   . LEU E 4 101 ? -77.842  -45.173 54.977 1.00 48.50  ? 1297 LEU D CD2   1 
ATOM   7921  N N     . LEU E 4 102 ? -72.702  -45.868 53.192 1.00 60.47  ? 1298 LEU D N     1 
ATOM   7922  C CA    . LEU E 4 102 ? -71.623  -45.301 52.372 1.00 61.36  ? 1298 LEU D CA    1 
ATOM   7923  C C     . LEU E 4 102 ? -71.071  -46.100 51.206 1.00 61.89  ? 1298 LEU D C     1 
ATOM   7924  O O     . LEU E 4 102 ? -70.770  -45.532 50.158 1.00 62.89  ? 1298 LEU D O     1 
ATOM   7925  C CB    . LEU E 4 102 ? -70.430  -44.945 53.261 1.00 68.07  ? 1298 LEU D CB    1 
ATOM   7926  C CG    . LEU E 4 102 ? -70.226  -43.574 53.912 1.00 70.24  ? 1298 LEU D CG    1 
ATOM   7927  C CD1   . LEU E 4 102 ? -71.496  -42.735 53.942 1.00 69.46  ? 1298 LEU D CD1   1 
ATOM   7928  C CD2   . LEU E 4 102 ? -69.695  -43.830 55.319 1.00 67.63  ? 1298 LEU D CD2   1 
ATOM   7929  N N     . LEU E 4 103 ? -70.921  -47.407 51.384 1.00 54.61  ? 1299 LEU D N     1 
ATOM   7930  C CA    . LEU E 4 103 ? -70.314  -48.226 50.353 1.00 54.01  ? 1299 LEU D CA    1 
ATOM   7931  C C     . LEU E 4 103 ? -71.193  -48.899 49.318 1.00 55.42  ? 1299 LEU D C     1 
ATOM   7932  O O     . LEU E 4 103 ? -72.348  -49.234 49.582 1.00 60.10  ? 1299 LEU D O     1 
ATOM   7933  C CB    . LEU E 4 103 ? -69.436  -49.289 51.004 1.00 50.36  ? 1299 LEU D CB    1 
ATOM   7934  C CG    . LEU E 4 103 ? -68.304  -48.808 51.917 1.00 49.07  ? 1299 LEU D CG    1 
ATOM   7935  C CD1   . LEU E 4 103 ? -67.389  -49.982 52.210 1.00 47.30  ? 1299 LEU D CD1   1 
ATOM   7936  C CD2   . LEU E 4 103 ? -67.529  -47.662 51.257 1.00 48.29  ? 1299 LEU D CD2   1 
ATOM   7937  N N     . PRO E 4 104 ? -70.643  -49.091 48.103 1.00 55.39  ? 1300 PRO D N     1 
ATOM   7938  C CA    . PRO E 4 104 ? -71.299  -49.729 46.961 1.00 56.90  ? 1300 PRO D CA    1 
ATOM   7939  C C     . PRO E 4 104 ? -71.534  -51.216 47.255 1.00 60.19  ? 1300 PRO D C     1 
ATOM   7940  O O     . PRO E 4 104 ? -70.615  -51.954 47.636 1.00 64.58  ? 1300 PRO D O     1 
ATOM   7941  C CB    . PRO E 4 104 ? -70.294  -49.528 45.830 1.00 58.55  ? 1300 PRO D CB    1 
ATOM   7942  C CG    . PRO E 4 104 ? -69.622  -48.271 46.191 1.00 58.74  ? 1300 PRO D CG    1 
ATOM   7943  C CD    . PRO E 4 104 ? -69.392  -48.437 47.670 1.00 60.58  ? 1300 PRO D CD    1 
ATOM   7944  N N     . GLY E 4 105 ? -72.782  -51.627 47.069 1.00 55.20  ? 1301 GLY D N     1 
ATOM   7945  C CA    . GLY E 4 105 ? -73.212  -52.994 47.294 1.00 56.08  ? 1301 GLY D CA    1 
ATOM   7946  C C     . GLY E 4 105 ? -72.211  -54.106 47.520 1.00 57.08  ? 1301 GLY D C     1 
ATOM   7947  O O     . GLY E 4 105 ? -72.124  -54.641 48.624 1.00 56.37  ? 1301 GLY D O     1 
ATOM   7948  N N     . GLU E 4 106 ? -71.473  -54.489 46.490 1.00 52.11  ? 1302 GLU D N     1 
ATOM   7949  C CA    . GLU E 4 106 ? -70.520  -55.567 46.680 1.00 54.70  ? 1302 GLU D CA    1 
ATOM   7950  C C     . GLU E 4 106 ? -69.385  -55.158 47.631 1.00 55.57  ? 1302 GLU D C     1 
ATOM   7951  O O     . GLU E 4 106 ? -68.988  -55.931 48.518 1.00 54.93  ? 1302 GLU D O     1 
ATOM   7952  C CB    . GLU E 4 106 ? -69.975  -56.035 45.326 1.00 72.98  ? 1302 GLU D CB    1 
ATOM   7953  C CG    . GLU E 4 106 ? -69.851  -57.558 45.204 1.00 81.86  ? 1302 GLU D CG    1 
ATOM   7954  C CD    . GLU E 4 106 ? -70.983  -58.293 45.916 1.00 87.14  ? 1302 GLU D CD    1 
ATOM   7955  O OE1   . GLU E 4 106 ? -72.155  -57.860 45.820 1.00 87.51  ? 1302 GLU D OE1   1 
ATOM   7956  O OE2   . GLU E 4 106 ? -70.701  -59.314 46.572 1.00 92.11  ? 1302 GLU D OE2   1 
ATOM   7957  N N     . LEU E 4 107 ? -68.862  -53.947 47.466 1.00 70.53  ? 1303 LEU D N     1 
ATOM   7958  C CA    . LEU E 4 107 ? -67.804  -53.508 48.356 1.00 68.43  ? 1303 LEU D CA    1 
ATOM   7959  C C     . LEU E 4 107 ? -68.353  -53.492 49.769 1.00 68.11  ? 1303 LEU D C     1 
ATOM   7960  O O     . LEU E 4 107 ? -67.645  -53.808 50.735 1.00 69.71  ? 1303 LEU D O     1 
ATOM   7961  C CB    . LEU E 4 107 ? -67.319  -52.116 47.988 1.00 56.71  ? 1303 LEU D CB    1 
ATOM   7962  C CG    . LEU E 4 107 ? -66.029  -52.067 47.169 1.00 54.74  ? 1303 LEU D CG    1 
ATOM   7963  C CD1   . LEU E 4 107 ? -65.614  -50.591 46.960 1.00 52.78  ? 1303 LEU D CD1   1 
ATOM   7964  C CD2   . LEU E 4 107 ? -64.934  -52.846 47.883 1.00 53.30  ? 1303 LEU D CD2   1 
ATOM   7965  N N     . ALA E 4 108 ? -69.627  -53.133 49.880 1.00 44.83  ? 1304 ALA D N     1 
ATOM   7966  C CA    . ALA E 4 108 ? -70.278  -53.071 51.184 1.00 45.19  ? 1304 ALA D CA    1 
ATOM   7967  C C     . ALA E 4 108 ? -70.303  -54.438 51.879 1.00 47.20  ? 1304 ALA D C     1 
ATOM   7968  O O     . ALA E 4 108 ? -69.923  -54.562 53.057 1.00 47.33  ? 1304 ALA D O     1 
ATOM   7969  C CB    . ALA E 4 108 ? -71.710  -52.524 51.033 1.00 41.60  ? 1304 ALA D CB    1 
ATOM   7970  N N     . LYS E 4 109 ? -70.748  -55.455 51.132 1.00 60.89  ? 1305 LYS D N     1 
ATOM   7971  C CA    . LYS E 4 109 ? -70.857  -56.829 51.624 1.00 61.26  ? 1305 LYS D CA    1 
ATOM   7972  C C     . LYS E 4 109 ? -69.553  -57.291 52.232 1.00 59.69  ? 1305 LYS D C     1 
ATOM   7973  O O     . LYS E 4 109 ? -69.474  -57.549 53.430 1.00 57.17  ? 1305 LYS D O     1 
ATOM   7974  C CB    . LYS E 4 109 ? -71.269  -57.781 50.494 1.00 92.41  ? 1305 LYS D CB    1 
ATOM   7975  C CG    . LYS E 4 109 ? -72.609  -57.422 49.868 1.00 96.94  ? 1305 LYS D CG    1 
ATOM   7976  C CD    . LYS E 4 109 ? -73.544  -58.616 49.738 1.00 101.33 ? 1305 LYS D CD    1 
ATOM   7977  C CE    . LYS E 4 109 ? -73.019  -59.638 48.742 1.00 105.05 ? 1305 LYS D CE    1 
ATOM   7978  N NZ    . LYS E 4 109 ? -73.968  -60.781 48.541 1.00 105.09 ? 1305 LYS D NZ    1 
ATOM   7979  N N     . HIS E 4 110 ? -68.521  -57.375 51.410 1.00 55.61  ? 1306 HIS D N     1 
ATOM   7980  C CA    . HIS E 4 110 ? -67.221  -57.820 51.891 1.00 58.70  ? 1306 HIS D CA    1 
ATOM   7981  C C     . HIS E 4 110 ? -66.723  -56.919 53.024 1.00 57.83  ? 1306 HIS D C     1 
ATOM   7982  O O     . HIS E 4 110 ? -66.051  -57.363 53.966 1.00 58.15  ? 1306 HIS D O     1 
ATOM   7983  C CB    . HIS E 4 110 ? -66.271  -57.866 50.701 1.00 75.37  ? 1306 HIS D CB    1 
ATOM   7984  C CG    . HIS E 4 110 ? -66.768  -58.748 49.597 1.00 80.99  ? 1306 HIS D CG    1 
ATOM   7985  N ND1   . HIS E 4 110 ? -66.402  -58.580 48.279 1.00 84.82  ? 1306 HIS D ND1   1 
ATOM   7986  C CD2   . HIS E 4 110 ? -67.626  -59.797 49.617 1.00 82.10  ? 1306 HIS D CD2   1 
ATOM   7987  C CE1   . HIS E 4 110 ? -67.015  -59.485 47.534 1.00 86.19  ? 1306 HIS D CE1   1 
ATOM   7988  N NE2   . HIS E 4 110 ? -67.764  -60.235 48.322 1.00 85.80  ? 1306 HIS D NE2   1 
ATOM   7989  N N     . ALA E 4 111 ? -67.092  -55.647 52.944 1.00 69.06  ? 1307 ALA D N     1 
ATOM   7990  C CA    . ALA E 4 111 ? -66.723  -54.699 53.975 1.00 65.68  ? 1307 ALA D CA    1 
ATOM   7991  C C     . ALA E 4 111 ? -67.309  -55.213 55.283 1.00 65.42  ? 1307 ALA D C     1 
ATOM   7992  O O     . ALA E 4 111 ? -66.583  -55.415 56.252 1.00 66.11  ? 1307 ALA D O     1 
ATOM   7993  C CB    . ALA E 4 111 ? -67.284  -53.324 53.645 1.00 97.79  ? 1307 ALA D CB    1 
ATOM   7994  N N     . VAL E 4 112 ? -68.617  -55.456 55.296 1.00 58.04  ? 1308 VAL D N     1 
ATOM   7995  C CA    . VAL E 4 112 ? -69.275  -55.941 56.506 1.00 55.89  ? 1308 VAL D CA    1 
ATOM   7996  C C     . VAL E 4 112 ? -68.856  -57.335 56.992 1.00 56.55  ? 1308 VAL D C     1 
ATOM   7997  O O     . VAL E 4 112 ? -69.050  -57.665 58.162 1.00 54.94  ? 1308 VAL D O     1 
ATOM   7998  C CB    . VAL E 4 112 ? -70.794  -55.908 56.371 1.00 52.99  ? 1308 VAL D CB    1 
ATOM   7999  C CG1   . VAL E 4 112 ? -71.424  -56.453 57.650 1.00 48.98  ? 1308 VAL D CG1   1 
ATOM   8000  C CG2   . VAL E 4 112 ? -71.260  -54.465 56.114 1.00 50.97  ? 1308 VAL D CG2   1 
ATOM   8001  N N     . SER E 4 113 ? -68.294  -58.156 56.108 1.00 69.18  ? 1309 SER D N     1 
ATOM   8002  C CA    . SER E 4 113 ? -67.815  -59.465 56.527 1.00 70.48  ? 1309 SER D CA    1 
ATOM   8003  C C     . SER E 4 113 ? -66.668  -59.142 57.471 1.00 71.34  ? 1309 SER D C     1 
ATOM   8004  O O     . SER E 4 113 ? -66.758  -59.328 58.692 1.00 72.89  ? 1309 SER D O     1 
ATOM   8005  C CB    . SER E 4 113 ? -67.249  -60.257 55.351 1.00 93.00  ? 1309 SER D CB    1 
ATOM   8006  O OG    . SER E 4 113 ? -68.241  -60.547 54.392 1.00 93.78  ? 1309 SER D OG    1 
ATOM   8007  N N     . GLU E 4 114 ? -65.592  -58.632 56.873 1.00 67.01  ? 1310 GLU D N     1 
ATOM   8008  C CA    . GLU E 4 114 ? -64.385  -58.254 57.592 1.00 66.46  ? 1310 GLU D CA    1 
ATOM   8009  C C     . GLU E 4 114 ? -64.714  -57.601 58.920 1.00 64.58  ? 1310 GLU D C     1 
ATOM   8010  O O     . GLU E 4 114 ? -64.167  -57.970 59.955 1.00 63.48  ? 1310 GLU D O     1 
ATOM   8011  C CB    . GLU E 4 114 ? -63.583  -57.266 56.765 1.00 61.25  ? 1310 GLU D CB    1 
ATOM   8012  C CG    . GLU E 4 114 ? -63.431  -57.655 55.330 1.00 64.89  ? 1310 GLU D CG    1 
ATOM   8013  C CD    . GLU E 4 114 ? -62.672  -58.940 55.163 1.00 67.61  ? 1310 GLU D CD    1 
ATOM   8014  O OE1   . GLU E 4 114 ? -63.250  -59.993 55.481 1.00 69.16  ? 1310 GLU D OE1   1 
ATOM   8015  O OE2   . GLU E 4 114 ? -61.504  -58.893 54.721 1.00 68.36  ? 1310 GLU D OE2   1 
ATOM   8016  N N     . GLY E 4 115 ? -65.605  -56.617 58.873 1.00 65.49  ? 1311 GLY D N     1 
ATOM   8017  C CA    . GLY E 4 115 ? -65.977  -55.908 60.080 1.00 66.03  ? 1311 GLY D CA    1 
ATOM   8018  C C     . GLY E 4 115 ? -66.343  -56.877 61.169 1.00 66.32  ? 1311 GLY D C     1 
ATOM   8019  O O     . GLY E 4 115 ? -65.698  -56.945 62.213 1.00 64.33  ? 1311 GLY D O     1 
ATOM   8020  N N     . THR E 4 116 ? -67.389  -57.641 60.900 1.00 64.51  ? 1312 THR D N     1 
ATOM   8021  C CA    . THR E 4 116 ? -67.872  -58.636 61.829 1.00 66.21  ? 1312 THR D CA    1 
ATOM   8022  C C     . THR E 4 116 ? -66.745  -59.612 62.165 1.00 66.41  ? 1312 THR D C     1 
ATOM   8023  O O     . THR E 4 116 ? -66.379  -59.783 63.331 1.00 68.21  ? 1312 THR D O     1 
ATOM   8024  C CB    . THR E 4 116 ? -69.032  -59.401 61.208 1.00 67.04  ? 1312 THR D CB    1 
ATOM   8025  O OG1   . THR E 4 116 ? -70.020  -58.470 60.752 1.00 67.93  ? 1312 THR D OG1   1 
ATOM   8026  C CG2   . THR E 4 116 ? -69.652  -60.341 62.228 1.00 66.37  ? 1312 THR D CG2   1 
ATOM   8027  N N     . LYS E 4 117 ? -66.195  -60.252 61.140 1.00 69.90  ? 1313 LYS D N     1 
ATOM   8028  C CA    . LYS E 4 117 ? -65.118  -61.205 61.350 1.00 68.11  ? 1313 LYS D CA    1 
ATOM   8029  C C     . LYS E 4 117 ? -64.146  -60.655 62.395 1.00 68.32  ? 1313 LYS D C     1 
ATOM   8030  O O     . LYS E 4 117 ? -63.769  -61.357 63.330 1.00 67.69  ? 1313 LYS D O     1 
ATOM   8031  C CB    . LYS E 4 117 ? -64.391  -61.477 60.030 1.00 89.34  ? 1313 LYS D CB    1 
ATOM   8032  C CG    . LYS E 4 117 ? -63.293  -62.531 60.114 1.00 87.68  ? 1313 LYS D CG    1 
ATOM   8033  C CD    . LYS E 4 117 ? -62.620  -62.719 58.752 1.00 89.85  ? 1313 LYS D CD    1 
ATOM   8034  C CE    . LYS E 4 117 ? -61.392  -63.621 58.838 1.00 93.38  ? 1313 LYS D CE    1 
ATOM   8035  N NZ    . LYS E 4 117 ? -60.698  -63.746 57.519 1.00 91.98  ? 1313 LYS D NZ    1 
ATOM   8036  N N     . ALA E 4 118 ? -63.769  -59.389 62.261 1.00 68.75  ? 1314 ALA D N     1 
ATOM   8037  C CA    . ALA E 4 118 ? -62.839  -58.777 63.204 1.00 69.64  ? 1314 ALA D CA    1 
ATOM   8038  C C     . ALA E 4 118 ? -63.419  -58.570 64.608 1.00 70.28  ? 1314 ALA D C     1 
ATOM   8039  O O     . ALA E 4 118 ? -62.831  -59.007 65.596 1.00 69.21  ? 1314 ALA D O     1 
ATOM   8040  C CB    . ALA E 4 118 ? -62.330  -57.444 62.648 1.00 79.20  ? 1314 ALA D CB    1 
ATOM   8041  N N     . VAL E 4 119 ? -64.559  -57.895 64.702 1.00 69.33  ? 1315 VAL D N     1 
ATOM   8042  C CA    . VAL E 4 119 ? -65.154  -57.648 66.007 1.00 69.91  ? 1315 VAL D CA    1 
ATOM   8043  C C     . VAL E 4 119 ? -65.398  -58.970 66.714 1.00 69.99  ? 1315 VAL D C     1 
ATOM   8044  O O     . VAL E 4 119 ? -65.119  -59.111 67.905 1.00 70.50  ? 1315 VAL D O     1 
ATOM   8045  C CB    . VAL E 4 119 ? -66.511  -56.871 65.918 1.00 67.19  ? 1315 VAL D CB    1 
ATOM   8046  C CG1   . VAL E 4 119 ? -67.644  -57.795 65.435 1.00 71.23  ? 1315 VAL D CG1   1 
ATOM   8047  C CG2   . VAL E 4 119 ? -66.863  -56.286 67.276 1.00 66.51  ? 1315 VAL D CG2   1 
ATOM   8048  N N     . THR E 4 120 ? -65.915  -59.942 65.976 1.00 87.22  ? 1316 THR D N     1 
ATOM   8049  C CA    . THR E 4 120 ? -66.199  -61.239 66.563 1.00 88.19  ? 1316 THR D CA    1 
ATOM   8050  C C     . THR E 4 120 ? -64.931  -61.858 67.144 1.00 89.11  ? 1316 THR D C     1 
ATOM   8051  O O     . THR E 4 120 ? -64.878  -62.169 68.334 1.00 89.60  ? 1316 THR D O     1 
ATOM   8052  C CB    . THR E 4 120 ? -66.856  -62.169 65.521 1.00 86.56  ? 1316 THR D CB    1 
ATOM   8053  O OG1   . THR E 4 120 ? -68.277  -62.168 65.733 1.00 85.24  ? 1316 THR D OG1   1 
ATOM   8054  C CG2   . THR E 4 120 ? -66.296  -63.590 65.608 1.00 83.95  ? 1316 THR D CG2   1 
ATOM   8055  N N     . LYS E 4 121 ? -63.908  -62.016 66.310 1.00 78.27  ? 1317 LYS D N     1 
ATOM   8056  C CA    . LYS E 4 121 ? -62.646  -62.580 66.768 1.00 80.40  ? 1317 LYS D CA    1 
ATOM   8057  C C     . LYS E 4 121 ? -62.189  -61.833 68.008 1.00 84.08  ? 1317 LYS D C     1 
ATOM   8058  O O     . LYS E 4 121 ? -61.929  -62.436 69.041 1.00 85.60  ? 1317 LYS D O     1 
ATOM   8059  C CB    . LYS E 4 121 ? -61.582  -62.462 65.686 1.00 67.12  ? 1317 LYS D CB    1 
ATOM   8060  C CG    . LYS E 4 121 ? -60.300  -63.114 66.066 1.00 68.29  ? 1317 LYS D CG    1 
ATOM   8061  C CD    . LYS E 4 121 ? -59.231  -62.881 65.030 1.00 68.82  ? 1317 LYS D CD    1 
ATOM   8062  C CE    . LYS E 4 121 ? -57.934  -63.591 65.435 1.00 72.83  ? 1317 LYS D CE    1 
ATOM   8063  N NZ    . LYS E 4 121 ? -57.565  -63.368 66.886 1.00 77.60  ? 1317 LYS D NZ    1 
ATOM   8064  N N     . TYR E 4 122 ? -62.102  -60.513 67.892 1.00 87.08  ? 1318 TYR D N     1 
ATOM   8065  C CA    . TYR E 4 122 ? -61.696  -59.645 68.995 1.00 90.73  ? 1318 TYR D CA    1 
ATOM   8066  C C     . TYR E 4 122 ? -62.418  -60.035 70.290 1.00 92.80  ? 1318 TYR D C     1 
ATOM   8067  O O     . TYR E 4 122 ? -61.796  -60.143 71.350 1.00 92.10  ? 1318 TYR D O     1 
ATOM   8068  C CB    . TYR E 4 122 ? -61.988  -58.180 68.644 1.00 64.53  ? 1318 TYR D CB    1 
ATOM   8069  C CG    . TYR E 4 122 ? -61.632  -57.170 69.746 1.00 65.68  ? 1318 TYR D CG    1 
ATOM   8070  C CD1   . TYR E 4 122 ? -60.288  -56.839 69.967 1.00 66.51  ? 1318 TYR D CD1   1 
ATOM   8071  C CD2   . TYR E 4 122 ? -62.605  -56.583 70.539 1.00 64.71  ? 1318 TYR D CD2   1 
ATOM   8072  C CE1   . TYR E 4 122 ? -59.922  -55.961 70.980 1.00 68.10  ? 1318 TYR D CE1   1 
ATOM   8073  C CE2   . TYR E 4 122 ? -62.249  -55.704 71.557 1.00 66.87  ? 1318 TYR D CE2   1 
ATOM   8074  C CZ    . TYR E 4 122 ? -60.904  -55.402 71.761 1.00 68.42  ? 1318 TYR D CZ    1 
ATOM   8075  O OH    . TYR E 4 122 ? -60.560  -54.521 72.746 1.00 70.41  ? 1318 TYR D OH    1 
ATOM   8076  N N     . THR E 4 123 ? -63.731  -60.248 70.187 1.00 92.50  ? 1319 THR D N     1 
ATOM   8077  C CA    . THR E 4 123 ? -64.557  -60.610 71.337 1.00 97.22  ? 1319 THR D CA    1 
ATOM   8078  C C     . THR E 4 123 ? -64.404  -62.073 71.720 1.00 100.16 ? 1319 THR D C     1 
ATOM   8079  O O     . THR E 4 123 ? -65.345  -62.859 71.626 1.00 101.32 ? 1319 THR D O     1 
ATOM   8080  C CB    . THR E 4 123 ? -66.054  -60.304 71.074 1.00 106.30 ? 1319 THR D CB    1 
ATOM   8081  O OG1   . THR E 4 123 ? -66.224  -58.894 70.892 1.00 109.09 ? 1319 THR D OG1   1 
ATOM   8082  C CG2   . THR E 4 123 ? -66.909  -60.731 72.251 1.00 105.59 ? 1319 THR D CG2   1 
ATOM   8083  N N     . SER E 4 124 ? -63.201  -62.425 72.154 1.00 82.63  ? 1320 SER D N     1 
ATOM   8084  C CA    . SER E 4 124 ? -62.880  -63.780 72.576 1.00 87.49  ? 1320 SER D CA    1 
ATOM   8085  C C     . SER E 4 124 ? -61.375  -63.886 72.732 1.00 92.90  ? 1320 SER D C     1 
ATOM   8086  O O     . SER E 4 124 ? -60.886  -64.693 73.520 1.00 93.27  ? 1320 SER D O     1 
ATOM   8087  C CB    . SER E 4 124 ? -63.359  -64.819 71.553 1.00 82.75  ? 1320 SER D CB    1 
ATOM   8088  O OG    . SER E 4 124 ? -62.563  -64.794 70.382 1.00 81.72  ? 1320 SER D OG    1 
ATOM   8089  N N     . SER E 4 125 ? -60.640  -63.068 71.981 1.00 119.79 ? 1321 SER D N     1 
ATOM   8090  C CA    . SER E 4 125 ? -59.183  -63.074 72.064 1.00 125.56 ? 1321 SER D CA    1 
ATOM   8091  C C     . SER E 4 125 ? -58.820  -62.720 73.500 1.00 128.65 ? 1321 SER D C     1 
ATOM   8092  O O     . SER E 4 125 ? -57.646  -62.675 73.879 1.00 131.10 ? 1321 SER D O     1 
ATOM   8093  C CB    . SER E 4 125 ? -58.582  -62.069 71.078 1.00 140.71 ? 1321 SER D CB    1 
ATOM   8094  O OG    . SER E 4 125 ? -58.743  -62.516 69.740 1.00 143.75 ? 1321 SER D OG    1 
ATOM   8095  N N     . LYS E 4 126 ? -59.874  -62.473 74.275 1.00 115.64 ? 1322 LYS D N     1 
ATOM   8096  C CA    . LYS E 4 126 ? -59.830  -62.159 75.697 1.00 118.32 ? 1322 LYS D CA    1 
ATOM   8097  C C     . LYS E 4 126 ? -61.074  -61.346 76.028 1.00 119.58 ? 1322 LYS D C     1 
ATOM   8098  O O     . LYS E 4 126 ? -61.829  -61.040 75.078 1.00 119.32 ? 1322 LYS D O     1 
ATOM   8099  C CB    . LYS E 4 126 ? -58.570  -61.373 76.079 1.00 137.14 ? 1322 LYS D CB    1 
ATOM   8100  C CG    . LYS E 4 126 ? -58.248  -61.477 77.566 1.00 139.97 ? 1322 LYS D CG    1 
ATOM   8101  C CD    . LYS E 4 126 ? -56.987  -60.731 77.953 1.00 142.62 ? 1322 LYS D CD    1 
ATOM   8102  C CE    . LYS E 4 126 ? -56.731  -60.865 79.450 1.00 143.89 ? 1322 LYS D CE    1 
ATOM   8103  N NZ    . LYS E 4 126 ? -55.588  -60.036 79.930 1.00 144.93 ? 1322 LYS D NZ    1 
ATOM   8104  O OXT   . LYS E 4 126 ? -61.281  -61.035 77.220 1.00 137.45 ? 1322 LYS D OXT   1 
ATOM   8105  N N     . PRO F 2 39  ? -43.507  -32.169 -0.478 1.00 190.60 ? 638  PRO E N     1 
ATOM   8106  C CA    . PRO F 2 39  ? -43.624  -31.779 0.953  1.00 189.59 ? 638  PRO E CA    1 
ATOM   8107  C C     . PRO F 2 39  ? -44.711  -32.612 1.622  1.00 189.07 ? 638  PRO E C     1 
ATOM   8108  O O     . PRO F 2 39  ? -45.724  -32.933 1.000  1.00 190.03 ? 638  PRO E O     1 
ATOM   8109  C CB    . PRO F 2 39  ? -43.997  -30.299 1.013  1.00 80.23  ? 638  PRO E CB    1 
ATOM   8110  C CG    . PRO F 2 39  ? -43.750  -29.832 -0.448 1.00 81.48  ? 638  PRO E CG    1 
ATOM   8111  C CD    . PRO F 2 39  ? -43.962  -31.069 -1.347 1.00 81.58  ? 638  PRO E CD    1 
ATOM   8112  N N     . HIS F 2 40  ? -44.507  -32.958 2.889  1.00 134.54 ? 639  HIS E N     1 
ATOM   8113  C CA    . HIS F 2 40  ? -45.496  -33.747 3.614  1.00 131.11 ? 639  HIS E CA    1 
ATOM   8114  C C     . HIS F 2 40  ? -46.318  -32.901 4.577  1.00 126.95 ? 639  HIS E C     1 
ATOM   8115  O O     . HIS F 2 40  ? -45.835  -31.904 5.116  1.00 127.55 ? 639  HIS E O     1 
ATOM   8116  C CB    . HIS F 2 40  ? -44.826  -34.879 4.393  1.00 110.91 ? 639  HIS E CB    1 
ATOM   8117  C CG    . HIS F 2 40  ? -45.785  -35.678 5.221  1.00 113.10 ? 639  HIS E CG    1 
ATOM   8118  N ND1   . HIS F 2 40  ? -46.463  -35.147 6.296  1.00 113.70 ? 639  HIS E ND1   1 
ATOM   8119  C CD2   . HIS F 2 40  ? -46.221  -36.955 5.096  1.00 114.80 ? 639  HIS E CD2   1 
ATOM   8120  C CE1   . HIS F 2 40  ? -47.277  -36.058 6.797  1.00 115.62 ? 639  HIS E CE1   1 
ATOM   8121  N NE2   . HIS F 2 40  ? -47.148  -37.165 6.085  1.00 115.94 ? 639  HIS E NE2   1 
ATOM   8122  N N     . ARG F 2 41  ? -47.559  -33.319 4.808  1.00 96.22  ? 640  ARG E N     1 
ATOM   8123  C CA    . ARG F 2 41  ? -48.448  -32.593 5.699  1.00 88.06  ? 640  ARG E CA    1 
ATOM   8124  C C     . ARG F 2 41  ? -49.696  -33.404 6.024  1.00 85.90  ? 640  ARG E C     1 
ATOM   8125  O O     . ARG F 2 41  ? -50.426  -33.828 5.123  1.00 84.32  ? 640  ARG E O     1 
ATOM   8126  C CB    . ARG F 2 41  ? -48.809  -31.257 5.049  1.00 75.35  ? 640  ARG E CB    1 
ATOM   8127  C CG    . ARG F 2 41  ? -50.247  -30.804 5.177  1.00 69.28  ? 640  ARG E CG    1 
ATOM   8128  C CD    . ARG F 2 41  ? -50.401  -29.439 4.515  1.00 67.02  ? 640  ARG E CD    1 
ATOM   8129  N NE    . ARG F 2 41  ? -49.621  -28.424 5.212  1.00 63.58  ? 640  ARG E NE    1 
ATOM   8130  C CZ    . ARG F 2 41  ? -50.143  -27.561 6.075  1.00 62.90  ? 640  ARG E CZ    1 
ATOM   8131  N NH1   . ARG F 2 41  ? -51.448  -27.593 6.321  1.00 62.79  ? 640  ARG E NH1   1 
ATOM   8132  N NH2   . ARG F 2 41  ? -49.365  -26.695 6.714  1.00 63.44  ? 640  ARG E NH2   1 
ATOM   8133  N N     . TYR F 2 42  ? -49.935  -33.614 7.319  1.00 73.39  ? 641  TYR E N     1 
ATOM   8134  C CA    . TYR F 2 42  ? -51.092  -34.379 7.779  1.00 69.10  ? 641  TYR E CA    1 
ATOM   8135  C C     . TYR F 2 42  ? -52.422  -33.658 7.601  1.00 67.54  ? 641  TYR E C     1 
ATOM   8136  O O     . TYR F 2 42  ? -52.487  -32.421 7.603  1.00 66.85  ? 641  TYR E O     1 
ATOM   8137  C CB    . TYR F 2 42  ? -50.931  -34.750 9.250  1.00 80.99  ? 641  TYR E CB    1 
ATOM   8138  C CG    . TYR F 2 42  ? -49.788  -35.693 9.525  1.00 80.10  ? 641  TYR E CG    1 
ATOM   8139  C CD1   . TYR F 2 42  ? -48.522  -35.212 9.867  1.00 82.00  ? 641  TYR E CD1   1 
ATOM   8140  C CD2   . TYR F 2 42  ? -49.970  -37.071 9.434  1.00 79.50  ? 641  TYR E CD2   1 
ATOM   8141  C CE1   . TYR F 2 42  ? -47.467  -36.089 10.110 1.00 81.82  ? 641  TYR E CE1   1 
ATOM   8142  C CE2   . TYR F 2 42  ? -48.927  -37.951 9.672  1.00 81.03  ? 641  TYR E CE2   1 
ATOM   8143  C CZ    . TYR F 2 42  ? -47.681  -37.460 10.009 1.00 80.48  ? 641  TYR E CZ    1 
ATOM   8144  O OH    . TYR F 2 42  ? -46.654  -38.347 10.239 1.00 81.48  ? 641  TYR E OH    1 
ATOM   8145  N N     . ARG F 2 43  ? -53.486  -34.442 7.463  1.00 60.83  ? 642  ARG E N     1 
ATOM   8146  C CA    . ARG F 2 43  ? -54.825  -33.891 7.295  1.00 60.12  ? 642  ARG E CA    1 
ATOM   8147  C C     . ARG F 2 43  ? -55.348  -33.374 8.643  1.00 57.86  ? 642  ARG E C     1 
ATOM   8148  O O     . ARG F 2 43  ? -55.001  -33.907 9.701  1.00 55.03  ? 642  ARG E O     1 
ATOM   8149  C CB    . ARG F 2 43  ? -55.737  -34.974 6.738  1.00 78.09  ? 642  ARG E CB    1 
ATOM   8150  C CG    . ARG F 2 43  ? -55.123  -35.701 5.553  1.00 84.60  ? 642  ARG E CG    1 
ATOM   8151  C CD    . ARG F 2 43  ? -56.005  -36.833 5.084  1.00 90.94  ? 642  ARG E CD    1 
ATOM   8152  N NE    . ARG F 2 43  ? -57.282  -36.335 4.590  1.00 97.01  ? 642  ARG E NE    1 
ATOM   8153  C CZ    . ARG F 2 43  ? -58.371  -37.084 4.464  1.00 99.79  ? 642  ARG E CZ    1 
ATOM   8154  N NH1   . ARG F 2 43  ? -58.330  -38.366 4.802  1.00 101.42 ? 642  ARG E NH1   1 
ATOM   8155  N NH2   . ARG F 2 43  ? -59.497  -36.553 4.001  1.00 99.93  ? 642  ARG E NH2   1 
ATOM   8156  N N     . PRO F 2 44  ? -56.185  -32.321 8.631  1.00 58.38  ? 643  PRO E N     1 
ATOM   8157  C CA    . PRO F 2 44  ? -56.676  -31.826 9.925  1.00 57.51  ? 643  PRO E CA    1 
ATOM   8158  C C     . PRO F 2 44  ? -57.457  -32.826 10.777 1.00 57.89  ? 643  PRO E C     1 
ATOM   8159  O O     . PRO F 2 44  ? -58.525  -33.315 10.390 1.00 58.23  ? 643  PRO E O     1 
ATOM   8160  C CB    . PRO F 2 44  ? -57.496  -30.584 9.546  1.00 52.29  ? 643  PRO E CB    1 
ATOM   8161  C CG    . PRO F 2 44  ? -57.826  -30.791 8.079  1.00 53.00  ? 643  PRO E CG    1 
ATOM   8162  C CD    . PRO F 2 44  ? -56.601  -31.443 7.523  1.00 52.73  ? 643  PRO E CD    1 
ATOM   8163  N N     . GLY F 2 45  ? -56.890  -33.117 11.948 1.00 58.40  ? 644  GLY E N     1 
ATOM   8164  C CA    . GLY F 2 45  ? -57.494  -34.042 12.890 1.00 54.79  ? 644  GLY E CA    1 
ATOM   8165  C C     . GLY F 2 45  ? -56.515  -35.141 13.243 1.00 54.13  ? 644  GLY E C     1 
ATOM   8166  O O     . GLY F 2 45  ? -56.472  -35.650 14.365 1.00 54.62  ? 644  GLY E O     1 
ATOM   8167  N N     . THR F 2 46  ? -55.699  -35.496 12.265 1.00 56.48  ? 645  THR E N     1 
ATOM   8168  C CA    . THR F 2 46  ? -54.730  -36.559 12.433 1.00 54.76  ? 645  THR E CA    1 
ATOM   8169  C C     . THR F 2 46  ? -53.786  -36.223 13.556 1.00 55.04  ? 645  THR E C     1 
ATOM   8170  O O     . THR F 2 46  ? -53.469  -37.068 14.391 1.00 56.64  ? 645  THR E O     1 
ATOM   8171  C CB    . THR F 2 46  ? -53.963  -36.781 11.120 1.00 51.15  ? 645  THR E CB    1 
ATOM   8172  O OG1   . THR F 2 46  ? -54.917  -36.941 10.064 1.00 52.52  ? 645  THR E OG1   1 
ATOM   8173  C CG2   . THR F 2 46  ? -53.086  -38.025 11.185 1.00 48.56  ? 645  THR E CG2   1 
ATOM   8174  N N     . VAL F 2 47  ? -53.341  -34.982 13.599 1.00 50.51  ? 646  VAL E N     1 
ATOM   8175  C CA    . VAL F 2 47  ? -52.440  -34.638 14.663 1.00 51.15  ? 646  VAL E CA    1 
ATOM   8176  C C     . VAL F 2 47  ? -53.226  -34.499 15.956 1.00 50.80  ? 646  VAL E C     1 
ATOM   8177  O O     . VAL F 2 47  ? -52.738  -34.885 17.024 1.00 48.64  ? 646  VAL E O     1 
ATOM   8178  C CB    . VAL F 2 47  ? -51.690  -33.344 14.372 1.00 49.80  ? 646  VAL E CB    1 
ATOM   8179  C CG1   . VAL F 2 47  ? -50.666  -33.090 15.466 1.00 48.05  ? 646  VAL E CG1   1 
ATOM   8180  C CG2   . VAL F 2 47  ? -51.013  -33.448 13.026 1.00 49.98  ? 646  VAL E CG2   1 
ATOM   8181  N N     . ALA F 2 48  ? -54.443  -33.964 15.860 1.00 45.19  ? 647  ALA E N     1 
ATOM   8182  C CA    . ALA F 2 48  ? -55.278  -33.785 17.045 1.00 45.33  ? 647  ALA E CA    1 
ATOM   8183  C C     . ALA F 2 48  ? -55.508  -35.106 17.778 1.00 47.56  ? 647  ALA E C     1 
ATOM   8184  O O     . ALA F 2 48  ? -55.346  -35.182 19.011 1.00 48.11  ? 647  ALA E O     1 
ATOM   8185  C CB    . ALA F 2 48  ? -56.612  -33.164 16.664 1.00 43.59  ? 647  ALA E CB    1 
ATOM   8186  N N     . LEU F 2 49  ? -55.894  -36.141 17.029 1.00 50.30  ? 648  LEU E N     1 
ATOM   8187  C CA    . LEU F 2 49  ? -56.120  -37.452 17.633 1.00 48.34  ? 648  LEU E CA    1 
ATOM   8188  C C     . LEU F 2 49  ? -54.799  -37.951 18.188 1.00 48.74  ? 648  LEU E C     1 
ATOM   8189  O O     . LEU F 2 49  ? -54.773  -38.603 19.210 1.00 49.45  ? 648  LEU E O     1 
ATOM   8190  C CB    . LEU F 2 49  ? -56.698  -38.444 16.610 1.00 49.96  ? 648  LEU E CB    1 
ATOM   8191  C CG    . LEU F 2 49  ? -58.154  -38.150 16.221 1.00 48.24  ? 648  LEU E CG    1 
ATOM   8192  C CD1   . LEU F 2 49  ? -58.552  -38.928 14.988 1.00 49.20  ? 648  LEU E CD1   1 
ATOM   8193  C CD2   . LEU F 2 49  ? -59.057  -38.485 17.393 1.00 48.35  ? 648  LEU E CD2   1 
ATOM   8194  N N     . ARG F 2 50  ? -53.699  -37.621 17.522 1.00 53.24  ? 649  ARG E N     1 
ATOM   8195  C CA    . ARG F 2 50  ? -52.382  -38.026 17.998 1.00 54.05  ? 649  ARG E CA    1 
ATOM   8196  C C     . ARG F 2 50  ? -52.183  -37.495 19.424 1.00 53.78  ? 649  ARG E C     1 
ATOM   8197  O O     . ARG F 2 50  ? -51.799  -38.237 20.333 1.00 53.03  ? 649  ARG E O     1 
ATOM   8198  C CB    . ARG F 2 50  ? -51.286  -37.459 17.088 1.00 69.91  ? 649  ARG E CB    1 
ATOM   8199  C CG    . ARG F 2 50  ? -50.464  -38.509 16.372 1.00 73.13  ? 649  ARG E CG    1 
ATOM   8200  C CD    . ARG F 2 50  ? -48.979  -38.147 16.346 1.00 76.09  ? 649  ARG E CD    1 
ATOM   8201  N NE    . ARG F 2 50  ? -48.630  -37.094 15.392 1.00 78.50  ? 649  ARG E NE    1 
ATOM   8202  C CZ    . ARG F 2 50  ? -48.750  -37.200 14.069 1.00 79.80  ? 649  ARG E CZ    1 
ATOM   8203  N NH1   . ARG F 2 50  ? -49.220  -38.317 13.520 1.00 78.66  ? 649  ARG E NH1   1 
ATOM   8204  N NH2   . ARG F 2 50  ? -48.386  -36.191 13.291 1.00 79.58  ? 649  ARG E NH2   1 
ATOM   8205  N N     . GLU F 2 51  ? -52.454  -36.204 19.598 1.00 52.05  ? 650  GLU E N     1 
ATOM   8206  C CA    . GLU F 2 51  ? -52.325  -35.542 20.887 1.00 51.09  ? 650  GLU E CA    1 
ATOM   8207  C C     . GLU F 2 51  ? -53.267  -36.137 21.919 1.00 48.32  ? 650  GLU E C     1 
ATOM   8208  O O     . GLU F 2 51  ? -52.851  -36.438 23.043 1.00 45.99  ? 650  GLU E O     1 
ATOM   8209  C CB    . GLU F 2 51  ? -52.584  -34.044 20.721 1.00 55.03  ? 650  GLU E CB    1 
ATOM   8210  C CG    . GLU F 2 51  ? -51.488  -33.391 19.917 1.00 61.28  ? 650  GLU E CG    1 
ATOM   8211  C CD    . GLU F 2 51  ? -51.718  -31.927 19.602 1.00 64.79  ? 650  GLU E CD    1 
ATOM   8212  O OE1   . GLU F 2 51  ? -50.897  -31.372 18.828 1.00 65.95  ? 650  GLU E OE1   1 
ATOM   8213  O OE2   . GLU F 2 51  ? -52.699  -31.335 20.117 1.00 67.61  ? 650  GLU E OE2   1 
ATOM   8214  N N     . ILE F 2 52  ? -54.532  -36.315 21.547 1.00 41.07  ? 651  ILE E N     1 
ATOM   8215  C CA    . ILE F 2 52  ? -55.483  -36.884 22.485 1.00 40.67  ? 651  ILE E CA    1 
ATOM   8216  C C     . ILE F 2 52  ? -54.899  -38.167 23.072 1.00 42.53  ? 651  ILE E C     1 
ATOM   8217  O O     . ILE F 2 52  ? -54.900  -38.369 24.290 1.00 42.79  ? 651  ILE E O     1 
ATOM   8218  C CB    . ILE F 2 52  ? -56.840  -37.193 21.813 1.00 49.83  ? 651  ILE E CB    1 
ATOM   8219  C CG1   . ILE F 2 52  ? -57.520  -35.883 21.415 1.00 49.18  ? 651  ILE E CG1   1 
ATOM   8220  C CG2   . ILE F 2 52  ? -57.739  -38.002 22.765 1.00 47.73  ? 651  ILE E CG2   1 
ATOM   8221  C CD1   . ILE F 2 52  ? -58.948  -36.048 20.938 1.00 46.73  ? 651  ILE E CD1   1 
ATOM   8222  N N     . ARG F 2 53  ? -54.379  -39.029 22.209 1.00 55.35  ? 652  ARG E N     1 
ATOM   8223  C CA    . ARG F 2 53  ? -53.796  -40.277 22.683 1.00 56.12  ? 652  ARG E CA    1 
ATOM   8224  C C     . ARG F 2 53  ? -52.634  -39.944 23.617 1.00 55.93  ? 652  ARG E C     1 
ATOM   8225  O O     . ARG F 2 53  ? -52.577  -40.403 24.751 1.00 54.72  ? 652  ARG E O     1 
ATOM   8226  C CB    . ARG F 2 53  ? -53.295  -41.123 21.504 1.00 70.67  ? 652  ARG E CB    1 
ATOM   8227  C CG    . ARG F 2 53  ? -54.365  -41.550 20.504 1.00 75.58  ? 652  ARG E CG    1 
ATOM   8228  C CD    . ARG F 2 53  ? -53.734  -42.235 19.285 1.00 80.23  ? 652  ARG E CD    1 
ATOM   8229  N NE    . ARG F 2 53  ? -54.505  -42.039 18.052 1.00 84.04  ? 652  ARG E NE    1 
ATOM   8230  C CZ    . ARG F 2 53  ? -55.701  -42.575 17.811 1.00 86.26  ? 652  ARG E CZ    1 
ATOM   8231  N NH1   . ARG F 2 53  ? -56.283  -43.355 18.716 1.00 87.29  ? 652  ARG E NH1   1 
ATOM   8232  N NH2   . ARG F 2 53  ? -56.320  -42.326 16.664 1.00 85.82  ? 652  ARG E NH2   1 
ATOM   8233  N N     . ARG F 2 54  ? -51.724  -39.116 23.129 1.00 55.60  ? 653  ARG E N     1 
ATOM   8234  C CA    . ARG F 2 54  ? -50.547  -38.716 23.883 1.00 55.76  ? 653  ARG E CA    1 
ATOM   8235  C C     . ARG F 2 54  ? -50.802  -38.227 25.295 1.00 57.15  ? 653  ARG E C     1 
ATOM   8236  O O     . ARG F 2 54  ? -50.274  -38.777 26.266 1.00 56.16  ? 653  ARG E O     1 
ATOM   8237  C CB    . ARG F 2 54  ? -49.811  -37.609 23.147 1.00 52.11  ? 653  ARG E CB    1 
ATOM   8238  C CG    . ARG F 2 54  ? -48.689  -37.025 23.961 1.00 54.33  ? 653  ARG E CG    1 
ATOM   8239  C CD    . ARG F 2 54  ? -48.039  -35.863 23.257 1.00 58.68  ? 653  ARG E CD    1 
ATOM   8240  N NE    . ARG F 2 54  ? -46.957  -35.327 24.075 1.00 66.20  ? 653  ARG E NE    1 
ATOM   8241  C CZ    . ARG F 2 54  ? -46.264  -34.227 23.791 1.00 70.75  ? 653  ARG E CZ    1 
ATOM   8242  N NH1   . ARG F 2 54  ? -46.543  -33.525 22.691 1.00 71.05  ? 653  ARG E NH1   1 
ATOM   8243  N NH2   . ARG F 2 54  ? -45.286  -33.838 24.613 1.00 71.65  ? 653  ARG E NH2   1 
ATOM   8244  N N     . TYR F 2 55  ? -51.596  -37.165 25.386 1.00 65.93  ? 654  TYR E N     1 
ATOM   8245  C CA    . TYR F 2 55  ? -51.903  -36.531 26.653 1.00 67.54  ? 654  TYR E CA    1 
ATOM   8246  C C     . TYR F 2 55  ? -52.822  -37.302 27.587 1.00 68.29  ? 654  TYR E C     1 
ATOM   8247  O O     . TYR F 2 55  ? -52.924  -36.967 28.776 1.00 68.43  ? 654  TYR E O     1 
ATOM   8248  C CB    . TYR F 2 55  ? -52.458  -35.134 26.387 1.00 53.09  ? 654  TYR E CB    1 
ATOM   8249  C CG    . TYR F 2 55  ? -51.393  -34.177 25.888 1.00 53.95  ? 654  TYR E CG    1 
ATOM   8250  C CD1   . TYR F 2 55  ? -51.459  -33.622 24.607 1.00 54.08  ? 654  TYR E CD1   1 
ATOM   8251  C CD2   . TYR F 2 55  ? -50.298  -33.856 26.687 1.00 55.04  ? 654  TYR E CD2   1 
ATOM   8252  C CE1   . TYR F 2 55  ? -50.447  -32.771 24.138 1.00 56.07  ? 654  TYR E CE1   1 
ATOM   8253  C CE2   . TYR F 2 55  ? -49.293  -33.013 26.234 1.00 54.47  ? 654  TYR E CE2   1 
ATOM   8254  C CZ    . TYR F 2 55  ? -49.367  -32.472 24.962 1.00 54.94  ? 654  TYR E CZ    1 
ATOM   8255  O OH    . TYR F 2 55  ? -48.366  -31.632 24.520 1.00 53.22  ? 654  TYR E OH    1 
ATOM   8256  N N     . GLN F 2 56  ? -53.490  -38.327 27.055 1.00 54.57  ? 655  GLN E N     1 
ATOM   8257  C CA    . GLN F 2 56  ? -54.384  -39.148 27.862 1.00 53.27  ? 655  GLN E CA    1 
ATOM   8258  C C     . GLN F 2 56  ? -53.595  -40.287 28.492 1.00 54.90  ? 655  GLN E C     1 
ATOM   8259  O O     . GLN F 2 56  ? -54.021  -40.911 29.456 1.00 58.27  ? 655  GLN E O     1 
ATOM   8260  C CB    . GLN F 2 56  ? -55.517  -39.706 27.004 1.00 43.95  ? 655  GLN E CB    1 
ATOM   8261  C CG    . GLN F 2 56  ? -56.637  -38.721 26.721 1.00 42.19  ? 655  GLN E CG    1 
ATOM   8262  C CD    . GLN F 2 56  ? -57.924  -39.416 26.257 1.00 41.96  ? 655  GLN E CD    1 
ATOM   8263  O OE1   . GLN F 2 56  ? -59.023  -38.869 26.395 1.00 42.65  ? 655  GLN E OE1   1 
ATOM   8264  N NE2   . GLN F 2 56  ? -57.788  -40.620 25.699 1.00 40.58  ? 655  GLN E NE2   1 
ATOM   8265  N N     . LYS F 2 57  ? -52.420  -40.532 27.942 1.00 54.86  ? 656  LYS E N     1 
ATOM   8266  C CA    . LYS F 2 57  ? -51.559  -41.592 28.417 1.00 54.29  ? 656  LYS E CA    1 
ATOM   8267  C C     . LYS F 2 57  ? -50.626  -41.051 29.482 1.00 52.80  ? 656  LYS E C     1 
ATOM   8268  O O     . LYS F 2 57  ? -50.163  -41.801 30.337 1.00 54.85  ? 656  LYS E O     1 
ATOM   8269  C CB    . LYS F 2 57  ? -50.765  -42.144 27.233 1.00 75.41  ? 656  LYS E CB    1 
ATOM   8270  C CG    . LYS F 2 57  ? -49.698  -43.161 27.555 1.00 83.00  ? 656  LYS E CG    1 
ATOM   8271  C CD    . LYS F 2 57  ? -48.989  -43.572 26.257 1.00 89.71  ? 656  LYS E CD    1 
ATOM   8272  C CE    . LYS F 2 57  ? -47.911  -44.636 26.488 1.00 93.14  ? 656  LYS E CE    1 
ATOM   8273  N NZ    . LYS F 2 57  ? -47.262  -45.108 25.221 1.00 92.99  ? 656  LYS E NZ    1 
ATOM   8274  N N     . SER F 2 58  ? -50.358  -39.748 29.440 1.00 55.47  ? 657  SER E N     1 
ATOM   8275  C CA    . SER F 2 58  ? -49.458  -39.136 30.409 1.00 52.81  ? 657  SER E CA    1 
ATOM   8276  C C     . SER F 2 58  ? -50.214  -38.499 31.561 1.00 51.42  ? 657  SER E C     1 
ATOM   8277  O O     . SER F 2 58  ? -51.441  -38.424 31.532 1.00 53.85  ? 657  SER E O     1 
ATOM   8278  C CB    . SER F 2 58  ? -48.577  -38.088 29.733 1.00 45.57  ? 657  SER E CB    1 
ATOM   8279  O OG    . SER F 2 58  ? -49.327  -36.976 29.295 1.00 49.05  ? 657  SER E OG    1 
ATOM   8280  N N     . THR F 2 59  ? -49.484  -38.023 32.569 1.00 49.99  ? 658  THR E N     1 
ATOM   8281  C CA    . THR F 2 59  ? -50.130  -37.420 33.734 1.00 48.79  ? 658  THR E CA    1 
ATOM   8282  C C     . THR F 2 59  ? -49.534  -36.097 34.200 1.00 48.43  ? 658  THR E C     1 
ATOM   8283  O O     . THR F 2 59  ? -49.942  -35.558 35.226 1.00 48.46  ? 658  THR E O     1 
ATOM   8284  C CB    . THR F 2 59  ? -50.127  -38.409 34.955 1.00 49.45  ? 658  THR E CB    1 
ATOM   8285  O OG1   . THR F 2 59  ? -48.779  -38.717 35.336 1.00 47.58  ? 658  THR E OG1   1 
ATOM   8286  C CG2   . THR F 2 59  ? -50.871  -39.707 34.601 1.00 46.34  ? 658  THR E CG2   1 
ATOM   8287  N N     . GLU F 2 60  ? -48.593  -35.560 33.440 1.00 34.48  ? 659  GLU E N     1 
ATOM   8288  C CA    . GLU F 2 60  ? -47.948  -34.327 33.849 1.00 35.10  ? 659  GLU E CA    1 
ATOM   8289  C C     . GLU F 2 60  ? -48.876  -33.141 33.722 1.00 34.78  ? 659  GLU E C     1 
ATOM   8290  O O     . GLU F 2 60  ? -49.788  -33.151 32.889 1.00 37.54  ? 659  GLU E O     1 
ATOM   8291  C CB    . GLU F 2 60  ? -46.664  -34.086 33.039 1.00 51.76  ? 659  GLU E CB    1 
ATOM   8292  C CG    . GLU F 2 60  ? -46.852  -33.457 31.685 1.00 58.42  ? 659  GLU E CG    1 
ATOM   8293  C CD    . GLU F 2 60  ? -47.340  -34.426 30.635 1.00 63.16  ? 659  GLU E CD    1 
ATOM   8294  O OE1   . GLU F 2 60  ? -48.219  -35.259 30.956 1.00 67.50  ? 659  GLU E OE1   1 
ATOM   8295  O OE2   . GLU F 2 60  ? -46.853  -34.340 29.478 1.00 64.19  ? 659  GLU E OE2   1 
ATOM   8296  N N     . LEU F 2 61  ? -48.652  -32.126 34.561 1.00 45.48  ? 660  LEU E N     1 
ATOM   8297  C CA    . LEU F 2 61  ? -49.450  -30.905 34.521 1.00 45.36  ? 660  LEU E CA    1 
ATOM   8298  C C     . LEU F 2 61  ? -49.265  -30.234 33.161 1.00 47.01  ? 660  LEU E C     1 
ATOM   8299  O O     . LEU F 2 61  ? -48.130  -30.096 32.674 1.00 46.31  ? 660  LEU E O     1 
ATOM   8300  C CB    . LEU F 2 61  ? -49.012  -29.956 35.624 1.00 40.52  ? 660  LEU E CB    1 
ATOM   8301  C CG    . LEU F 2 61  ? -49.498  -30.347 37.010 1.00 41.44  ? 660  LEU E CG    1 
ATOM   8302  C CD1   . LEU F 2 61  ? -48.715  -29.559 38.051 1.00 39.70  ? 660  LEU E CD1   1 
ATOM   8303  C CD2   . LEU F 2 61  ? -51.017  -30.100 37.115 1.00 41.44  ? 660  LEU E CD2   1 
ATOM   8304  N N     . LEU F 2 62  ? -50.373  -29.793 32.565 1.00 43.45  ? 661  LEU E N     1 
ATOM   8305  C CA    . LEU F 2 62  ? -50.322  -29.187 31.242 1.00 44.85  ? 661  LEU E CA    1 
ATOM   8306  C C     . LEU F 2 62  ? -50.109  -27.686 31.189 1.00 46.00  ? 661  LEU E C     1 
ATOM   8307  O O     . LEU F 2 62  ? -49.737  -27.158 30.149 1.00 47.64  ? 661  LEU E O     1 
ATOM   8308  C CB    . LEU F 2 62  ? -51.576  -29.584 30.460 1.00 52.70  ? 661  LEU E CB    1 
ATOM   8309  C CG    . LEU F 2 62  ? -51.859  -31.102 30.531 1.00 51.96  ? 661  LEU E CG    1 
ATOM   8310  C CD1   . LEU F 2 62  ? -53.088  -31.457 29.691 1.00 46.39  ? 661  LEU E CD1   1 
ATOM   8311  C CD2   . LEU F 2 62  ? -50.623  -31.881 30.072 1.00 50.27  ? 661  LEU E CD2   1 
ATOM   8312  N N     . ILE F 2 63  ? -50.327  -26.994 32.299 1.00 47.80  ? 662  ILE E N     1 
ATOM   8313  C CA    . ILE F 2 63  ? -50.130  -25.546 32.337 1.00 46.76  ? 662  ILE E CA    1 
ATOM   8314  C C     . ILE F 2 63  ? -48.716  -25.261 32.857 1.00 49.52  ? 662  ILE E C     1 
ATOM   8315  O O     . ILE F 2 63  ? -48.211  -26.033 33.688 1.00 50.28  ? 662  ILE E O     1 
ATOM   8316  C CB    . ILE F 2 63  ? -51.172  -24.900 33.281 1.00 43.94  ? 662  ILE E CB    1 
ATOM   8317  C CG1   . ILE F 2 63  ? -52.571  -25.211 32.757 1.00 40.79  ? 662  ILE E CG1   1 
ATOM   8318  C CG2   . ILE F 2 63  ? -50.939  -23.391 33.413 1.00 42.98  ? 662  ILE E CG2   1 
ATOM   8319  C CD1   . ILE F 2 63  ? -53.670  -24.677 33.595 1.00 37.71  ? 662  ILE E CD1   1 
ATOM   8320  N N     . ARG F 2 64  ? -48.082  -24.179 32.368 1.00 40.93  ? 663  ARG E N     1 
ATOM   8321  C CA    . ARG F 2 64  ? -46.729  -23.788 32.814 1.00 41.91  ? 663  ARG E CA    1 
ATOM   8322  C C     . ARG F 2 64  ? -46.775  -23.423 34.302 1.00 41.97  ? 663  ARG E C     1 
ATOM   8323  O O     . ARG F 2 64  ? -47.636  -22.646 34.735 1.00 39.48  ? 663  ARG E O     1 
ATOM   8324  C CB    . ARG F 2 64  ? -46.212  -22.579 32.034 1.00 64.04  ? 663  ARG E CB    1 
ATOM   8325  C CG    . ARG F 2 64  ? -45.840  -22.825 30.596 1.00 70.31  ? 663  ARG E CG    1 
ATOM   8326  C CD    . ARG F 2 64  ? -44.838  -23.931 30.492 1.00 74.96  ? 663  ARG E CD    1 
ATOM   8327  N NE    . ARG F 2 64  ? -45.476  -25.150 30.004 1.00 78.61  ? 663  ARG E NE    1 
ATOM   8328  C CZ    . ARG F 2 64  ? -45.061  -26.382 30.284 1.00 81.05  ? 663  ARG E CZ    1 
ATOM   8329  N NH1   . ARG F 2 64  ? -43.996  -26.563 31.062 1.00 83.36  ? 663  ARG E NH1   1 
ATOM   8330  N NH2   . ARG F 2 64  ? -45.712  -27.432 29.781 1.00 79.87  ? 663  ARG E NH2   1 
ATOM   8331  N N     . LYS F 2 65  ? -45.849  -23.959 35.088 1.00 42.57  ? 664  LYS E N     1 
ATOM   8332  C CA    . LYS F 2 65  ? -45.854  -23.701 36.521 1.00 42.01  ? 664  LYS E CA    1 
ATOM   8333  C C     . LYS F 2 65  ? -45.838  -22.231 36.941 1.00 42.59  ? 664  LYS E C     1 
ATOM   8334  O O     . LYS F 2 65  ? -46.778  -21.767 37.579 1.00 45.15  ? 664  LYS E O     1 
ATOM   8335  C CB    . LYS F 2 65  ? -44.693  -24.431 37.176 1.00 50.63  ? 664  LYS E CB    1 
ATOM   8336  C CG    . LYS F 2 65  ? -44.593  -25.880 36.755 1.00 61.17  ? 664  LYS E CG    1 
ATOM   8337  C CD    . LYS F 2 65  ? -45.825  -26.689 37.130 1.00 69.44  ? 664  LYS E CD    1 
ATOM   8338  C CE    . LYS F 2 65  ? -45.710  -28.145 36.646 1.00 73.21  ? 664  LYS E CE    1 
ATOM   8339  N NZ    . LYS F 2 65  ? -44.683  -28.990 37.339 1.00 76.68  ? 664  LYS E NZ    1 
ATOM   8340  N N     . LEU F 2 66  ? -44.787  -21.508 36.571 1.00 47.80  ? 665  LEU E N     1 
ATOM   8341  C CA    . LEU F 2 66  ? -44.624  -20.104 36.942 1.00 46.55  ? 665  LEU E CA    1 
ATOM   8342  C C     . LEU F 2 66  ? -45.849  -19.250 36.604 1.00 45.26  ? 665  LEU E C     1 
ATOM   8343  O O     . LEU F 2 66  ? -46.436  -18.601 37.475 1.00 46.00  ? 665  LEU E O     1 
ATOM   8344  C CB    . LEU F 2 66  ? -43.393  -19.535 36.237 1.00 57.42  ? 665  LEU E CB    1 
ATOM   8345  C CG    . LEU F 2 66  ? -42.501  -18.484 36.901 1.00 56.35  ? 665  LEU E CG    1 
ATOM   8346  C CD1   . LEU F 2 66  ? -42.139  -17.465 35.842 1.00 58.58  ? 665  LEU E CD1   1 
ATOM   8347  C CD2   . LEU F 2 66  ? -43.189  -17.840 38.084 1.00 56.46  ? 665  LEU E CD2   1 
ATOM   8348  N N     . PRO F 2 67  ? -46.238  -19.225 35.327 1.00 45.43  ? 666  PRO E N     1 
ATOM   8349  C CA    . PRO F 2 67  ? -47.400  -18.445 34.915 1.00 45.48  ? 666  PRO E CA    1 
ATOM   8350  C C     . PRO F 2 67  ? -48.579  -18.729 35.858 1.00 47.29  ? 666  PRO E C     1 
ATOM   8351  O O     . PRO F 2 67  ? -49.309  -17.813 36.251 1.00 50.45  ? 666  PRO E O     1 
ATOM   8352  C CB    . PRO F 2 67  ? -47.673  -18.961 33.501 1.00 34.35  ? 666  PRO E CB    1 
ATOM   8353  C CG    . PRO F 2 67  ? -46.337  -19.330 33.022 1.00 33.08  ? 666  PRO E CG    1 
ATOM   8354  C CD    . PRO F 2 67  ? -45.728  -20.031 34.208 1.00 36.74  ? 666  PRO E CD    1 
ATOM   8355  N N     . PHE F 2 68  ? -48.760  -20.001 36.217 1.00 43.58  ? 667  PHE E N     1 
ATOM   8356  C CA    . PHE F 2 68  ? -49.857  -20.373 37.100 1.00 41.82  ? 667  PHE E CA    1 
ATOM   8357  C C     . PHE F 2 68  ? -49.664  -19.816 38.513 1.00 41.73  ? 667  PHE E C     1 
ATOM   8358  O O     . PHE F 2 68  ? -50.616  -19.342 39.133 1.00 40.30  ? 667  PHE E O     1 
ATOM   8359  C CB    . PHE F 2 68  ? -50.000  -21.901 37.176 1.00 45.69  ? 667  PHE E CB    1 
ATOM   8360  C CG    . PHE F 2 68  ? -51.227  -22.364 37.931 1.00 43.24  ? 667  PHE E CG    1 
ATOM   8361  C CD1   . PHE F 2 68  ? -52.480  -22.347 37.329 1.00 42.73  ? 667  PHE E CD1   1 
ATOM   8362  C CD2   . PHE F 2 68  ? -51.136  -22.764 39.249 1.00 40.98  ? 667  PHE E CD2   1 
ATOM   8363  C CE1   . PHE F 2 68  ? -53.633  -22.723 38.042 1.00 40.90  ? 667  PHE E CE1   1 
ATOM   8364  C CE2   . PHE F 2 68  ? -52.284  -23.138 39.967 1.00 40.81  ? 667  PHE E CE2   1 
ATOM   8365  C CZ    . PHE F 2 68  ? -53.529  -23.117 39.362 1.00 40.42  ? 667  PHE E CZ    1 
ATOM   8366  N N     . GLN F 2 69  ? -48.435  -19.865 39.019 1.00 40.83  ? 668  GLN E N     1 
ATOM   8367  C CA    . GLN F 2 69  ? -48.184  -19.380 40.350 1.00 42.22  ? 668  GLN E CA    1 
ATOM   8368  C C     . GLN F 2 69  ? -48.555  -17.895 40.462 1.00 42.77  ? 668  GLN E C     1 
ATOM   8369  O O     . GLN F 2 69  ? -49.158  -17.464 41.465 1.00 41.68  ? 668  GLN E O     1 
ATOM   8370  C CB    . GLN F 2 69  ? -46.719  -19.599 40.730 1.00 64.51  ? 668  GLN E CB    1 
ATOM   8371  C CG    . GLN F 2 69  ? -46.520  -19.517 42.239 1.00 75.96  ? 668  GLN E CG    1 
ATOM   8372  C CD    . GLN F 2 69  ? -45.148  -19.946 42.698 1.00 79.84  ? 668  GLN E CD    1 
ATOM   8373  O OE1   . GLN F 2 69  ? -44.150  -19.274 42.423 1.00 82.12  ? 668  GLN E OE1   1 
ATOM   8374  N NE2   . GLN F 2 69  ? -45.087  -21.072 43.412 1.00 81.42  ? 668  GLN E NE2   1 
ATOM   8375  N N     . ARG F 2 70  ? -48.196  -17.114 39.441 1.00 49.45  ? 669  ARG E N     1 
ATOM   8376  C CA    . ARG F 2 70  ? -48.504  -15.693 39.438 1.00 47.67  ? 669  ARG E CA    1 
ATOM   8377  C C     . ARG F 2 70  ? -50.009  -15.497 39.502 1.00 47.69  ? 669  ARG E C     1 
ATOM   8378  O O     . ARG F 2 70  ? -50.531  -14.790 40.371 1.00 47.60  ? 669  ARG E O     1 
ATOM   8379  C CB    . ARG F 2 70  ? -48.024  -15.036 38.165 1.00 44.08  ? 669  ARG E CB    1 
ATOM   8380  C CG    . ARG F 2 70  ? -46.546  -14.995 37.954 1.00 44.80  ? 669  ARG E CG    1 
ATOM   8381  C CD    . ARG F 2 70  ? -46.296  -14.155 36.716 1.00 44.53  ? 669  ARG E CD    1 
ATOM   8382  N NE    . ARG F 2 70  ? -45.185  -14.639 35.918 1.00 45.37  ? 669  ARG E NE    1 
ATOM   8383  C CZ    . ARG F 2 70  ? -45.318  -14.992 34.647 1.00 48.89  ? 669  ARG E CZ    1 
ATOM   8384  N NH1   . ARG F 2 70  ? -46.511  -14.905 34.068 1.00 48.56  ? 669  ARG E NH1   1 
ATOM   8385  N NH2   . ARG F 2 70  ? -44.271  -15.431 33.952 1.00 54.09  ? 669  ARG E NH2   1 
ATOM   8386  N N     . LEU F 2 71  ? -50.705  -16.113 38.557 1.00 45.68  ? 670  LEU E N     1 
ATOM   8387  C CA    . LEU F 2 71  ? -52.149  -16.012 38.508 1.00 45.60  ? 670  LEU E CA    1 
ATOM   8388  C C     . LEU F 2 71  ? -52.745  -16.292 39.883 1.00 45.13  ? 670  LEU E C     1 
ATOM   8389  O O     . LEU F 2 71  ? -53.688  -15.637 40.315 1.00 46.66  ? 670  LEU E O     1 
ATOM   8390  C CB    . LEU F 2 71  ? -52.702  -17.010 37.494 1.00 41.04  ? 670  LEU E CB    1 
ATOM   8391  C CG    . LEU F 2 71  ? -54.212  -17.216 37.477 1.00 41.10  ? 670  LEU E CG    1 
ATOM   8392  C CD1   . LEU F 2 71  ? -54.926  -15.864 37.367 1.00 40.49  ? 670  LEU E CD1   1 
ATOM   8393  C CD2   . LEU F 2 71  ? -54.560  -18.109 36.306 1.00 40.43  ? 670  LEU E CD2   1 
ATOM   8394  N N     . VAL F 2 72  ? -52.181  -17.264 40.579 1.00 34.19  ? 671  VAL E N     1 
ATOM   8395  C CA    . VAL F 2 72  ? -52.696  -17.622 41.876 1.00 34.30  ? 671  VAL E CA    1 
ATOM   8396  C C     . VAL F 2 72  ? -52.397  -16.553 42.892 1.00 36.42  ? 671  VAL E C     1 
ATOM   8397  O O     . VAL F 2 72  ? -53.264  -16.191 43.693 1.00 35.24  ? 671  VAL E O     1 
ATOM   8398  C CB    . VAL F 2 72  ? -52.127  -18.976 42.319 1.00 21.90  ? 671  VAL E CB    1 
ATOM   8399  C CG1   . VAL F 2 72  ? -52.519  -19.291 43.731 1.00 19.52  ? 671  VAL E CG1   1 
ATOM   8400  C CG2   . VAL F 2 72  ? -52.670  -20.043 41.412 1.00 22.05  ? 671  VAL E CG2   1 
ATOM   8401  N N     . ARG F 2 73  ? -51.168  -16.055 42.870 1.00 49.23  ? 672  ARG E N     1 
ATOM   8402  C CA    . ARG F 2 73  ? -50.781  -15.004 43.790 1.00 52.54  ? 672  ARG E CA    1 
ATOM   8403  C C     . ARG F 2 73  ? -51.553  -13.730 43.454 1.00 51.88  ? 672  ARG E C     1 
ATOM   8404  O O     . ARG F 2 73  ? -51.975  -13.003 44.359 1.00 49.86  ? 672  ARG E O     1 
ATOM   8405  C CB    . ARG F 2 73  ? -49.283  -14.774 43.715 1.00 48.79  ? 672  ARG E CB    1 
ATOM   8406  C CG    . ARG F 2 73  ? -48.510  -15.958 44.232 1.00 50.90  ? 672  ARG E CG    1 
ATOM   8407  C CD    . ARG F 2 73  ? -47.031  -15.739 44.069 1.00 57.40  ? 672  ARG E CD    1 
ATOM   8408  N NE    . ARG F 2 73  ? -46.269  -16.951 44.332 1.00 59.83  ? 672  ARG E NE    1 
ATOM   8409  C CZ    . ARG F 2 73  ? -45.958  -17.396 45.542 1.00 60.28  ? 672  ARG E CZ    1 
ATOM   8410  N NH1   . ARG F 2 73  ? -46.334  -16.729 46.627 1.00 57.20  ? 672  ARG E NH1   1 
ATOM   8411  N NH2   . ARG F 2 73  ? -45.273  -18.523 45.664 1.00 62.33  ? 672  ARG E NH2   1 
ATOM   8412  N N     . GLU F 2 74  ? -51.756  -13.472 42.163 1.00 36.54  ? 673  GLU E N     1 
ATOM   8413  C CA    . GLU F 2 74  ? -52.508  -12.294 41.761 1.00 38.11  ? 673  GLU E CA    1 
ATOM   8414  C C     . GLU F 2 74  ? -53.872  -12.340 42.446 1.00 38.97  ? 673  GLU E C     1 
ATOM   8415  O O     . GLU F 2 74  ? -54.216  -11.448 43.218 1.00 41.29  ? 673  GLU E O     1 
ATOM   8416  C CB    . GLU F 2 74  ? -52.685  -12.228 40.244 1.00 45.22  ? 673  GLU E CB    1 
ATOM   8417  C CG    . GLU F 2 74  ? -53.384  -10.963 39.793 1.00 47.11  ? 673  GLU E CG    1 
ATOM   8418  C CD    . GLU F 2 74  ? -53.731  -10.936 38.299 1.00 50.49  ? 673  GLU E CD    1 
ATOM   8419  O OE1   . GLU F 2 74  ? -52.805  -10.960 37.444 1.00 49.61  ? 673  GLU E OE1   1 
ATOM   8420  O OE2   . GLU F 2 74  ? -54.944  -10.878 37.983 1.00 52.20  ? 673  GLU E OE2   1 
ATOM   8421  N N     . ILE F 2 75  ? -54.637  -13.393 42.178 1.00 39.31  ? 674  ILE E N     1 
ATOM   8422  C CA    . ILE F 2 75  ? -55.966  -13.580 42.766 1.00 38.39  ? 674  ILE E CA    1 
ATOM   8423  C C     . ILE F 2 75  ? -55.943  -13.538 44.301 1.00 39.48  ? 674  ILE E C     1 
ATOM   8424  O O     . ILE F 2 75  ? -56.781  -12.894 44.938 1.00 39.18  ? 674  ILE E O     1 
ATOM   8425  C CB    . ILE F 2 75  ? -56.568  -14.935 42.303 1.00 35.83  ? 674  ILE E CB    1 
ATOM   8426  C CG1   . ILE F 2 75  ? -56.756  -14.919 40.791 1.00 35.40  ? 674  ILE E CG1   1 
ATOM   8427  C CG2   . ILE F 2 75  ? -57.907  -15.181 42.943 1.00 31.79  ? 674  ILE E CG2   1 
ATOM   8428  C CD1   . ILE F 2 75  ? -57.433  -16.155 40.248 1.00 38.82  ? 674  ILE E CD1   1 
ATOM   8429  N N     . ALA F 2 76  ? -54.974  -14.224 44.897 1.00 43.18  ? 675  ALA E N     1 
ATOM   8430  C CA    . ALA F 2 76  ? -54.889  -14.264 46.343 1.00 42.79  ? 675  ALA E CA    1 
ATOM   8431  C C     . ALA F 2 76  ? -54.611  -12.893 46.863 1.00 43.20  ? 675  ALA E C     1 
ATOM   8432  O O     . ALA F 2 76  ? -55.205  -12.496 47.850 1.00 43.98  ? 675  ALA E O     1 
ATOM   8433  C CB    . ALA F 2 76  ? -53.803  -15.225 46.807 1.00 43.92  ? 675  ALA E CB    1 
ATOM   8434  N N     . GLN F 2 77  ? -53.717  -12.162 46.204 1.00 58.82  ? 676  GLN E N     1 
ATOM   8435  C CA    . GLN F 2 77  ? -53.363  -10.819 46.656 1.00 60.03  ? 676  GLN E CA    1 
ATOM   8436  C C     . GLN F 2 77  ? -54.550  -9.879  46.511 1.00 56.61  ? 676  GLN E C     1 
ATOM   8437  O O     . GLN F 2 77  ? -54.772  -9.029  47.373 1.00 54.23  ? 676  GLN E O     1 
ATOM   8438  C CB    . GLN F 2 77  ? -52.140  -10.290 45.869 1.00 56.07  ? 676  GLN E CB    1 
ATOM   8439  C CG    . GLN F 2 77  ? -51.631  -8.929  46.268 1.00 62.88  ? 676  GLN E CG    1 
ATOM   8440  C CD    . GLN F 2 77  ? -50.310  -8.567  45.583 1.00 70.09  ? 676  GLN E CD    1 
ATOM   8441  O OE1   . GLN F 2 77  ? -50.033  -8.952  44.451 1.00 73.09  ? 676  GLN E OE1   1 
ATOM   8442  N NE2   . GLN F 2 77  ? -49.504  -7.802  46.274 1.00 73.76  ? 676  GLN E NE2   1 
ATOM   8443  N N     . ASP F 2 78  ? -55.315  -10.036 45.431 1.00 76.70  ? 677  ASP E N     1 
ATOM   8444  C CA    . ASP F 2 78  ? -56.450  -9.160  45.178 1.00 77.12  ? 677  ASP E CA    1 
ATOM   8445  C C     . ASP F 2 78  ? -57.566  -9.709  46.044 1.00 77.34  ? 677  ASP E C     1 
ATOM   8446  O O     . ASP F 2 78  ? -58.719  -9.697  45.668 1.00 78.80  ? 677  ASP E O     1 
ATOM   8447  C CB    . ASP F 2 78  ? -56.835  -9.168  43.661 1.00 51.24  ? 677  ASP E CB    1 
ATOM   8448  C CG    . ASP F 2 78  ? -56.002  -8.157  42.769 1.00 54.22  ? 677  ASP E CG    1 
ATOM   8449  O OD1   . ASP F 2 78  ? -56.331  -8.015  41.571 1.00 56.84  ? 677  ASP E OD1   1 
ATOM   8450  O OD2   . ASP F 2 78  ? -55.044  -7.504  43.221 1.00 47.63  ? 677  ASP E OD2   1 
ATOM   8451  N N     . PHE F 2 79  ? -57.196  -10.150 47.234 1.00 54.42  ? 678  PHE E N     1 
ATOM   8452  C CA    . PHE F 2 79  ? -58.113  -10.788 48.180 1.00 56.33  ? 678  PHE E CA    1 
ATOM   8453  C C     . PHE F 2 79  ? -57.682  -10.522 49.614 1.00 56.93  ? 678  PHE E C     1 
ATOM   8454  O O     . PHE F 2 79  ? -58.474  -10.244 50.504 1.00 58.68  ? 678  PHE E O     1 
ATOM   8455  C CB    . PHE F 2 79  ? -58.089  -12.316 47.976 1.00 59.66  ? 678  PHE E CB    1 
ATOM   8456  C CG    . PHE F 2 79  ? -59.414  -12.900 47.591 1.00 66.17  ? 678  PHE E CG    1 
ATOM   8457  C CD1   . PHE F 2 79  ? -59.504  -13.860 46.576 1.00 68.94  ? 678  PHE E CD1   1 
ATOM   8458  C CD2   . PHE F 2 79  ? -60.580  -12.452 48.199 1.00 67.25  ? 678  PHE E CD2   1 
ATOM   8459  C CE1   . PHE F 2 79  ? -60.743  -14.360 46.173 1.00 69.66  ? 678  PHE E CE1   1 
ATOM   8460  C CE2   . PHE F 2 79  ? -61.816  -12.944 47.805 1.00 67.89  ? 678  PHE E CE2   1 
ATOM   8461  C CZ    . PHE F 2 79  ? -61.901  -13.897 46.789 1.00 68.05  ? 678  PHE E CZ    1 
ATOM   8462  N N     . LYS F 2 80  ? -56.387  -10.648 49.817 1.00 69.61  ? 679  LYS E N     1 
ATOM   8463  C CA    . LYS F 2 80  ? -55.785  -10.433 51.100 1.00 69.09  ? 679  LYS E CA    1 
ATOM   8464  C C     . LYS F 2 80  ? -54.316  -10.259 50.757 1.00 68.42  ? 679  LYS E C     1 
ATOM   8465  O O     . LYS F 2 80  ? -53.741  -11.093 50.076 1.00 68.17  ? 679  LYS E O     1 
ATOM   8466  C CB    . LYS F 2 80  ? -56.028  -11.662 51.949 1.00 58.27  ? 679  LYS E CB    1 
ATOM   8467  C CG    . LYS F 2 80  ? -56.116  -11.423 53.408 1.00 63.37  ? 679  LYS E CG    1 
ATOM   8468  C CD    . LYS F 2 80  ? -54.753  -11.318 54.064 1.00 68.87  ? 679  LYS E CD    1 
ATOM   8469  C CE    . LYS F 2 80  ? -54.917  -11.113 55.577 1.00 71.23  ? 679  LYS E CE    1 
ATOM   8470  N NZ    . LYS F 2 80  ? -53.629  -11.210 56.315 1.00 75.69  ? 679  LYS E NZ    1 
ATOM   8471  N N     . THR F 2 81  ? -53.715  -9.160  51.197 1.00 72.47  ? 680  THR E N     1 
ATOM   8472  C CA    . THR F 2 81  ? -52.309  -8.887  50.894 1.00 72.53  ? 680  THR E CA    1 
ATOM   8473  C C     . THR F 2 81  ? -51.337  -9.511  51.879 1.00 74.04  ? 680  THR E C     1 
ATOM   8474  O O     . THR F 2 81  ? -51.722  -9.924  52.979 1.00 73.66  ? 680  THR E O     1 
ATOM   8475  C CB    . THR F 2 81  ? -52.045  -7.373  50.850 1.00 57.52  ? 680  THR E CB    1 
ATOM   8476  O OG1   . THR F 2 81  ? -52.686  -6.756  51.963 1.00 53.28  ? 680  THR E OG1   1 
ATOM   8477  C CG2   . THR F 2 81  ? -52.599  -6.763  49.589 1.00 55.06  ? 680  THR E CG2   1 
ATOM   8478  N N     . ASP F 2 82  ? -50.073  -9.574  51.466 1.00 80.68  ? 681  ASP E N     1 
ATOM   8479  C CA    . ASP F 2 82  ? -48.995  -10.116 52.295 1.00 83.03  ? 681  ASP E CA    1 
ATOM   8480  C C     . ASP F 2 82  ? -49.165  -11.576 52.655 1.00 81.63  ? 681  ASP E C     1 
ATOM   8481  O O     . ASP F 2 82  ? -48.973  -11.959 53.810 1.00 84.03  ? 681  ASP E O     1 
ATOM   8482  C CB    . ASP F 2 82  ? -48.862  -9.313  53.587 1.00 131.65 ? 681  ASP E CB    1 
ATOM   8483  C CG    . ASP F 2 82  ? -48.396  -7.906  53.344 1.00 137.47 ? 681  ASP E CG    1 
ATOM   8484  O OD1   . ASP F 2 82  ? -48.392  -7.118  54.308 1.00 141.67 ? 681  ASP E OD1   1 
ATOM   8485  O OD2   . ASP F 2 82  ? -48.029  -7.591  52.192 1.00 139.43 ? 681  ASP E OD2   1 
ATOM   8486  N N     . LEU F 2 83  ? -49.530  -12.387 51.672 1.00 59.82  ? 682  LEU E N     1 
ATOM   8487  C CA    . LEU F 2 83  ? -49.709  -13.808 51.907 1.00 57.89  ? 682  LEU E CA    1 
ATOM   8488  C C     . LEU F 2 83  ? -48.517  -14.576 51.394 1.00 57.49  ? 682  LEU E C     1 
ATOM   8489  O O     . LEU F 2 83  ? -47.838  -14.148 50.454 1.00 58.05  ? 682  LEU E O     1 
ATOM   8490  C CB    . LEU F 2 83  ? -50.957  -14.315 51.196 1.00 48.87  ? 682  LEU E CB    1 
ATOM   8491  C CG    . LEU F 2 83  ? -52.268  -13.939 51.856 1.00 47.42  ? 682  LEU E CG    1 
ATOM   8492  C CD1   . LEU F 2 83  ? -53.439  -14.359 50.977 1.00 46.97  ? 682  LEU E CD1   1 
ATOM   8493  C CD2   . LEU F 2 83  ? -52.320  -14.601 53.222 1.00 44.82  ? 682  LEU E CD2   1 
ATOM   8494  N N     . ARG F 2 84  ? -48.255  -15.709 52.026 1.00 62.33  ? 683  ARG E N     1 
ATOM   8495  C CA    . ARG F 2 84  ? -47.174  -16.567 51.589 1.00 61.89  ? 683  ARG E CA    1 
ATOM   8496  C C     . ARG F 2 84  ? -47.845  -17.868 51.190 1.00 59.38  ? 683  ARG E C     1 
ATOM   8497  O O     . ARG F 2 84  ? -48.936  -18.171 51.658 1.00 57.85  ? 683  ARG E O     1 
ATOM   8498  C CB    . ARG F 2 84  ? -46.168  -16.802 52.712 1.00 93.50  ? 683  ARG E CB    1 
ATOM   8499  C CG    . ARG F 2 84  ? -45.174  -15.676 52.867 1.00 96.94  ? 683  ARG E CG    1 
ATOM   8500  C CD    . ARG F 2 84  ? -44.060  -16.055 53.819 1.00 99.16  ? 683  ARG E CD    1 
ATOM   8501  N NE    . ARG F 2 84  ? -42.865  -15.258 53.570 1.00 102.13 ? 683  ARG E NE    1 
ATOM   8502  C CZ    . ARG F 2 84  ? -41.641  -15.603 53.960 1.00 106.39 ? 683  ARG E CZ    1 
ATOM   8503  N NH1   . ARG F 2 84  ? -41.444  -16.737 54.628 1.00 107.00 ? 683  ARG E NH1   1 
ATOM   8504  N NH2   . ARG F 2 84  ? -40.608  -14.824 53.662 1.00 108.83 ? 683  ARG E NH2   1 
ATOM   8505  N N     . PHE F 2 85  ? -47.219  -18.617 50.298 1.00 48.92  ? 684  PHE E N     1 
ATOM   8506  C CA    . PHE F 2 85  ? -47.770  -19.892 49.865 1.00 48.65  ? 684  PHE E CA    1 
ATOM   8507  C C     . PHE F 2 85  ? -46.737  -20.997 49.985 1.00 49.43  ? 684  PHE E C     1 
ATOM   8508  O O     . PHE F 2 85  ? -45.605  -20.846 49.523 1.00 49.30  ? 684  PHE E O     1 
ATOM   8509  C CB    . PHE F 2 85  ? -48.207  -19.827 48.400 1.00 58.68  ? 684  PHE E CB    1 
ATOM   8510  C CG    . PHE F 2 85  ? -49.570  -19.260 48.192 1.00 58.66  ? 684  PHE E CG    1 
ATOM   8511  C CD1   . PHE F 2 85  ? -49.749  -17.908 47.952 1.00 57.41  ? 684  PHE E CD1   1 
ATOM   8512  C CD2   . PHE F 2 85  ? -50.693  -20.086 48.238 1.00 58.92  ? 684  PHE E CD2   1 
ATOM   8513  C CE1   . PHE F 2 85  ? -51.035  -17.397 47.760 1.00 57.05  ? 684  PHE E CE1   1 
ATOM   8514  C CE2   . PHE F 2 85  ? -51.972  -19.573 48.046 1.00 55.28  ? 684  PHE E CE2   1 
ATOM   8515  C CZ    . PHE F 2 85  ? -52.142  -18.240 47.809 1.00 56.23  ? 684  PHE E CZ    1 
ATOM   8516  N N     . GLN F 2 86  ? -47.123  -22.103 50.615 1.00 42.78  ? 685  GLN E N     1 
ATOM   8517  C CA    . GLN F 2 86  ? -46.230  -23.215 50.659 1.00 43.54  ? 685  GLN E CA    1 
ATOM   8518  C C     . GLN F 2 86  ? -46.254  -23.726 49.233 1.00 43.77  ? 685  GLN E C     1 
ATOM   8519  O O     . GLN F 2 86  ? -47.286  -23.655 48.562 1.00 45.01  ? 685  GLN E O     1 
ATOM   8520  C CB    . GLN F 2 86  ? -46.664  -24.340 51.610 1.00 50.16  ? 685  GLN E CB    1 
ATOM   8521  C CG    . GLN F 2 86  ? -47.202  -23.899 52.967 1.00 53.06  ? 685  GLN E CG    1 
ATOM   8522  C CD    . GLN F 2 86  ? -47.391  -25.063 53.898 1.00 54.14  ? 685  GLN E CD    1 
ATOM   8523  O OE1   . GLN F 2 86  ? -48.011  -26.056 53.514 1.00 57.07  ? 685  GLN E OE1   1 
ATOM   8524  N NE2   . GLN F 2 86  ? -46.950  -25.165 55.160 1.00 54.54  ? 685  GLN E NE2   1 
ATOM   8525  N N     . SER F 2 87  ? -45.136  -24.220 48.725 1.00 58.90  ? 686  SER E N     1 
ATOM   8526  C CA    . SER F 2 87  ? -45.131  -24.689 47.348 1.00 60.26  ? 686  SER E CA    1 
ATOM   8527  C C     . SER F 2 87  ? -46.288  -25.682 47.099 1.00 56.84  ? 686  SER E C     1 
ATOM   8528  O O     . SER F 2 87  ? -47.007  -25.574 46.099 1.00 55.76  ? 686  SER E O     1 
ATOM   8529  C CB    . SER F 2 87  ? -43.779  -25.326 47.031 1.00 68.07  ? 686  SER E CB    1 
ATOM   8530  O OG    . SER F 2 87  ? -43.345  -26.139 48.112 1.00 77.53  ? 686  SER E OG    1 
ATOM   8531  N N     . SER F 2 88  ? -46.479  -26.629 48.014 1.00 51.48  ? 687  SER E N     1 
ATOM   8532  C CA    . SER F 2 88  ? -47.542  -27.614 47.858 1.00 51.56  ? 687  SER E CA    1 
ATOM   8533  C C     . SER F 2 88  ? -48.946  -27.021 47.639 1.00 50.37  ? 687  SER E C     1 
ATOM   8534  O O     . SER F 2 88  ? -49.715  -27.549 46.833 1.00 49.57  ? 687  SER E O     1 
ATOM   8535  C CB    . SER F 2 88  ? -47.554  -28.558 49.052 1.00 52.45  ? 687  SER E CB    1 
ATOM   8536  O OG    . SER F 2 88  ? -47.320  -27.820 50.226 1.00 56.29  ? 687  SER E OG    1 
ATOM   8537  N N     . ALA F 2 89  ? -49.295  -25.951 48.354 1.00 43.15  ? 688  ALA E N     1 
ATOM   8538  C CA    . ALA F 2 89  ? -50.609  -25.335 48.156 1.00 41.24  ? 688  ALA E CA    1 
ATOM   8539  C C     . ALA F 2 89  ? -50.735  -24.928 46.687 1.00 41.10  ? 688  ALA E C     1 
ATOM   8540  O O     . ALA F 2 89  ? -51.742  -25.219 46.024 1.00 41.07  ? 688  ALA E O     1 
ATOM   8541  C CB    . ALA F 2 89  ? -50.775  -24.114 49.050 1.00 43.07  ? 688  ALA E CB    1 
ATOM   8542  N N     . VAL F 2 90  ? -49.715  -24.251 46.172 1.00 40.51  ? 689  VAL E N     1 
ATOM   8543  C CA    . VAL F 2 90  ? -49.776  -23.863 44.773 1.00 40.03  ? 689  VAL E CA    1 
ATOM   8544  C C     . VAL F 2 90  ? -49.925  -25.154 43.974 1.00 41.48  ? 689  VAL E C     1 
ATOM   8545  O O     . VAL F 2 90  ? -50.736  -25.220 43.059 1.00 41.99  ? 689  VAL E O     1 
ATOM   8546  C CB    . VAL F 2 90  ? -48.493  -23.095 44.300 1.00 29.26  ? 689  VAL E CB    1 
ATOM   8547  C CG1   . VAL F 2 90  ? -48.593  -22.768 42.831 1.00 26.02  ? 689  VAL E CG1   1 
ATOM   8548  C CG2   . VAL F 2 90  ? -48.335  -21.813 45.072 1.00 30.81  ? 689  VAL E CG2   1 
ATOM   8549  N N     . MET F 2 91  ? -49.156  -26.185 44.342 1.00 36.19  ? 690  MET E N     1 
ATOM   8550  C CA    . MET F 2 91  ? -49.225  -27.451 43.623 1.00 38.52  ? 690  MET E CA    1 
ATOM   8551  C C     . MET F 2 91  ? -50.586  -28.069 43.799 1.00 36.44  ? 690  MET E C     1 
ATOM   8552  O O     . MET F 2 91  ? -51.157  -28.617 42.859 1.00 35.79  ? 690  MET E O     1 
ATOM   8553  C CB    . MET F 2 91  ? -48.134  -28.415 44.078 1.00 63.22  ? 690  MET E CB    1 
ATOM   8554  C CG    . MET F 2 91  ? -46.940  -28.418 43.145 1.00 70.43  ? 690  MET E CG    1 
ATOM   8555  S SD    . MET F 2 91  ? -47.293  -27.411 41.657 1.00 81.80  ? 690  MET E SD    1 
ATOM   8556  C CE    . MET F 2 91  ? -46.638  -28.443 40.305 1.00 78.26  ? 690  MET E CE    1 
ATOM   8557  N N     . ALA F 2 92  ? -51.120  -27.964 45.004 1.00 42.07  ? 691  ALA E N     1 
ATOM   8558  C CA    . ALA F 2 92  ? -52.442  -28.491 45.269 1.00 40.52  ? 691  ALA E CA    1 
ATOM   8559  C C     . ALA F 2 92  ? -53.404  -27.761 44.330 1.00 41.55  ? 691  ALA E C     1 
ATOM   8560  O O     . ALA F 2 92  ? -54.131  -28.396 43.575 1.00 43.10  ? 691  ALA E O     1 
ATOM   8561  C CB    . ALA F 2 92  ? -52.819  -28.252 46.721 1.00 29.82  ? 691  ALA E CB    1 
ATOM   8562  N N     . LEU F 2 93  ? -53.387  -26.432 44.353 1.00 42.55  ? 692  LEU E N     1 
ATOM   8563  C CA    . LEU F 2 93  ? -54.278  -25.656 43.489 1.00 42.04  ? 692  LEU E CA    1 
ATOM   8564  C C     . LEU F 2 93  ? -54.204  -26.009 42.003 1.00 44.01  ? 692  LEU E C     1 
ATOM   8565  O O     . LEU F 2 93  ? -55.225  -26.019 41.314 1.00 44.94  ? 692  LEU E O     1 
ATOM   8566  C CB    . LEU F 2 93  ? -54.020  -24.150 43.652 1.00 33.58  ? 692  LEU E CB    1 
ATOM   8567  C CG    . LEU F 2 93  ? -54.556  -23.528 44.937 1.00 32.75  ? 692  LEU E CG    1 
ATOM   8568  C CD1   . LEU F 2 93  ? -54.074  -22.139 45.051 1.00 32.72  ? 692  LEU E CD1   1 
ATOM   8569  C CD2   . LEU F 2 93  ? -56.060  -23.556 44.930 1.00 31.67  ? 692  LEU E CD2   1 
ATOM   8570  N N     . GLN F 2 94  ? -53.014  -26.294 41.495 1.00 51.14  ? 693  GLN E N     1 
ATOM   8571  C CA    . GLN F 2 94  ? -52.908  -26.618 40.084 1.00 49.84  ? 693  GLN E CA    1 
ATOM   8572  C C     . GLN F 2 94  ? -53.458  -28.010 39.791 1.00 53.03  ? 693  GLN E C     1 
ATOM   8573  O O     . GLN F 2 94  ? -54.172  -28.201 38.806 1.00 56.06  ? 693  GLN E O     1 
ATOM   8574  C CB    . GLN F 2 94  ? -51.464  -26.524 39.620 1.00 44.41  ? 693  GLN E CB    1 
ATOM   8575  C CG    . GLN F 2 94  ? -51.359  -26.506 38.120 1.00 42.54  ? 693  GLN E CG    1 
ATOM   8576  C CD    . GLN F 2 94  ? -49.961  -26.221 37.661 1.00 42.86  ? 693  GLN E CD    1 
ATOM   8577  O OE1   . GLN F 2 94  ? -49.122  -25.861 38.466 1.00 45.16  ? 693  GLN E OE1   1 
ATOM   8578  N NE2   . GLN F 2 94  ? -49.696  -26.369 36.363 1.00 42.29  ? 693  GLN E NE2   1 
ATOM   8579  N N     . GLU F 2 95  ? -53.113  -28.987 40.627 1.00 43.75  ? 694  GLU E N     1 
ATOM   8580  C CA    . GLU F 2 95  ? -53.622  -30.329 40.433 1.00 42.92  ? 694  GLU E CA    1 
ATOM   8581  C C     . GLU F 2 95  ? -55.149  -30.208 40.356 1.00 41.68  ? 694  GLU E C     1 
ATOM   8582  O O     . GLU F 2 95  ? -55.781  -30.721 39.434 1.00 40.41  ? 694  GLU E O     1 
ATOM   8583  C CB    . GLU F 2 95  ? -53.244  -31.235 41.616 1.00 44.75  ? 694  GLU E CB    1 
ATOM   8584  C CG    . GLU F 2 95  ? -51.871  -31.877 41.574 1.00 50.64  ? 694  GLU E CG    1 
ATOM   8585  C CD    . GLU F 2 95  ? -51.654  -32.698 40.320 1.00 54.42  ? 694  GLU E CD    1 
ATOM   8586  O OE1   . GLU F 2 95  ? -52.620  -33.320 39.847 1.00 57.31  ? 694  GLU E OE1   1 
ATOM   8587  O OE2   . GLU F 2 95  ? -50.517  -32.728 39.808 1.00 54.87  ? 694  GLU E OE2   1 
ATOM   8588  N N     . ALA F 2 96  ? -55.729  -29.508 41.327 1.00 37.98  ? 695  ALA E N     1 
ATOM   8589  C CA    . ALA F 2 96  ? -57.174  -29.313 41.400 1.00 39.07  ? 695  ALA E CA    1 
ATOM   8590  C C     . ALA F 2 96  ? -57.725  -28.558 40.183 1.00 39.98  ? 695  ALA E C     1 
ATOM   8591  O O     . ALA F 2 96  ? -58.727  -28.977 39.590 1.00 39.78  ? 695  ALA E O     1 
ATOM   8592  C CB    . ALA F 2 96  ? -57.538  -28.562 42.710 1.00 17.11  ? 695  ALA E CB    1 
ATOM   8593  N N     . SER F 2 97  ? -57.067  -27.452 39.820 1.00 43.43  ? 696  SER E N     1 
ATOM   8594  C CA    . SER F 2 97  ? -57.479  -26.633 38.679 1.00 44.35  ? 696  SER E CA    1 
ATOM   8595  C C     . SER F 2 97  ? -57.414  -27.368 37.344 1.00 44.40  ? 696  SER E C     1 
ATOM   8596  O O     . SER F 2 97  ? -58.308  -27.229 36.507 1.00 43.38  ? 696  SER E O     1 
ATOM   8597  C CB    . SER F 2 97  ? -56.624  -25.371 38.589 1.00 72.06  ? 696  SER E CB    1 
ATOM   8598  O OG    . SER F 2 97  ? -56.897  -24.504 39.671 1.00 36.64  ? 696  SER E OG    1 
ATOM   8599  N N     . GLU F 2 98  ? -56.366  -28.154 37.132 1.00 49.35  ? 697  GLU E N     1 
ATOM   8600  C CA    . GLU F 2 98  ? -56.256  -28.860 35.877 1.00 49.65  ? 697  GLU E CA    1 
ATOM   8601  C C     . GLU F 2 98  ? -57.227  -30.059 35.796 1.00 46.59  ? 697  GLU E C     1 
ATOM   8602  O O     . GLU F 2 98  ? -57.809  -30.333 34.729 1.00 47.12  ? 697  GLU E O     1 
ATOM   8603  C CB    . GLU F 2 98  ? -54.797  -29.269 35.631 1.00 45.18  ? 697  GLU E CB    1 
ATOM   8604  C CG    . GLU F 2 98  ? -53.966  -28.154 35.006 1.00 52.59  ? 697  GLU E CG    1 
ATOM   8605  C CD    . GLU F 2 98  ? -52.575  -28.589 34.501 1.00 58.58  ? 697  GLU E CD    1 
ATOM   8606  O OE1   . GLU F 2 98  ? -52.480  -29.519 33.672 1.00 61.65  ? 697  GLU E OE1   1 
ATOM   8607  O OE2   . GLU F 2 98  ? -51.567  -27.984 34.918 1.00 60.49  ? 697  GLU E OE2   1 
ATOM   8608  N N     . ALA F 2 99  ? -57.433  -30.763 36.908 1.00 39.45  ? 698  ALA E N     1 
ATOM   8609  C CA    . ALA F 2 99  ? -58.357  -31.906 36.879 1.00 38.41  ? 698  ALA E CA    1 
ATOM   8610  C C     . ALA F 2 99  ? -59.774  -31.408 36.591 1.00 40.45  ? 698  ALA E C     1 
ATOM   8611  O O     . ALA F 2 99  ? -60.509  -32.003 35.803 1.00 39.67  ? 698  ALA E O     1 
ATOM   8612  C CB    . ALA F 2 99  ? -58.326  -32.652 38.197 1.00 21.15  ? 698  ALA E CB    1 
ATOM   8613  N N     . TYR F 2 100 ? -60.139  -30.311 37.247 1.00 31.87  ? 699  TYR E N     1 
ATOM   8614  C CA    . TYR F 2 100 ? -61.432  -29.684 37.056 1.00 31.51  ? 699  TYR E CA    1 
ATOM   8615  C C     . TYR F 2 100 ? -61.675  -29.358 35.561 1.00 32.91  ? 699  TYR E C     1 
ATOM   8616  O O     . TYR F 2 100 ? -62.706  -29.739 34.976 1.00 35.63  ? 699  TYR E O     1 
ATOM   8617  C CB    . TYR F 2 100 ? -61.503  -28.395 37.874 1.00 38.68  ? 699  TYR E CB    1 
ATOM   8618  C CG    . TYR F 2 100 ? -62.706  -27.556 37.542 1.00 38.61  ? 699  TYR E CG    1 
ATOM   8619  C CD1   . TYR F 2 100 ? -63.979  -27.926 37.968 1.00 36.88  ? 699  TYR E CD1   1 
ATOM   8620  C CD2   . TYR F 2 100 ? -62.579  -26.431 36.728 1.00 40.24  ? 699  TYR E CD2   1 
ATOM   8621  C CE1   . TYR F 2 100 ? -65.098  -27.201 37.590 1.00 37.65  ? 699  TYR E CE1   1 
ATOM   8622  C CE2   . TYR F 2 100 ? -63.690  -25.701 36.341 1.00 42.36  ? 699  TYR E CE2   1 
ATOM   8623  C CZ    . TYR F 2 100 ? -64.950  -26.090 36.773 1.00 42.74  ? 699  TYR E CZ    1 
ATOM   8624  O OH    . TYR F 2 100 ? -66.055  -25.363 36.369 1.00 45.98  ? 699  TYR E OH    1 
ATOM   8625  N N     . LEU F 2 101 ? -60.738  -28.648 34.936 1.00 43.68  ? 700  LEU E N     1 
ATOM   8626  C CA    . LEU F 2 101 ? -60.923  -28.313 33.529 1.00 42.68  ? 700  LEU E CA    1 
ATOM   8627  C C     . LEU F 2 101 ? -60.945  -29.562 32.634 1.00 41.88  ? 700  LEU E C     1 
ATOM   8628  O O     . LEU F 2 101 ? -61.727  -29.635 31.690 1.00 43.62  ? 700  LEU E O     1 
ATOM   8629  C CB    . LEU F 2 101 ? -59.857  -27.293 33.062 1.00 47.46  ? 700  LEU E CB    1 
ATOM   8630  C CG    . LEU F 2 101 ? -59.941  -25.896 33.731 1.00 47.03  ? 700  LEU E CG    1 
ATOM   8631  C CD1   . LEU F 2 101 ? -58.776  -24.998 33.304 1.00 42.93  ? 700  LEU E CD1   1 
ATOM   8632  C CD2   . LEU F 2 101 ? -61.262  -25.231 33.390 1.00 43.07  ? 700  LEU E CD2   1 
ATOM   8633  N N     . VAL F 2 102 ? -60.125  -30.563 32.926 1.00 41.78  ? 701  VAL E N     1 
ATOM   8634  C CA    . VAL F 2 102 ? -60.153  -31.739 32.067 1.00 40.92  ? 701  VAL E CA    1 
ATOM   8635  C C     . VAL F 2 102 ? -61.528  -32.380 32.140 1.00 42.13  ? 701  VAL E C     1 
ATOM   8636  O O     . VAL F 2 102 ? -62.029  -32.880 31.127 1.00 41.65  ? 701  VAL E O     1 
ATOM   8637  C CB    . VAL F 2 102 ? -59.075  -32.760 32.442 1.00 28.35  ? 701  VAL E CB    1 
ATOM   8638  C CG1   . VAL F 2 102 ? -59.375  -34.095 31.807 1.00 24.44  ? 701  VAL E CG1   1 
ATOM   8639  C CG2   . VAL F 2 102 ? -57.728  -32.278 31.929 1.00 24.69  ? 701  VAL E CG2   1 
ATOM   8640  N N     . GLY F 2 103 ? -62.130  -32.359 33.338 1.00 46.10  ? 702  GLY E N     1 
ATOM   8641  C CA    . GLY F 2 103 ? -63.474  -32.891 33.527 1.00 49.90  ? 702  GLY E CA    1 
ATOM   8642  C C     . GLY F 2 103 ? -64.439  -32.042 32.701 1.00 49.94  ? 702  GLY E C     1 
ATOM   8643  O O     . GLY F 2 103 ? -65.209  -32.562 31.902 1.00 48.21  ? 702  GLY E O     1 
ATOM   8644  N N     . LEU F 2 104 ? -64.376  -30.723 32.875 1.00 42.73  ? 703  LEU E N     1 
ATOM   8645  C CA    . LEU F 2 104 ? -65.230  -29.804 32.133 1.00 39.69  ? 703  LEU E CA    1 
ATOM   8646  C C     . LEU F 2 104 ? -65.135  -30.028 30.626 1.00 42.03  ? 703  LEU E C     1 
ATOM   8647  O O     . LEU F 2 104 ? -66.148  -29.992 29.911 1.00 44.25  ? 703  LEU E O     1 
ATOM   8648  C CB    . LEU F 2 104 ? -64.846  -28.355 32.433 1.00 41.97  ? 703  LEU E CB    1 
ATOM   8649  C CG    . LEU F 2 104 ? -65.874  -27.339 31.934 1.00 42.21  ? 703  LEU E CG    1 
ATOM   8650  C CD1   . LEU F 2 104 ? -67.194  -27.627 32.643 1.00 42.30  ? 703  LEU E CD1   1 
ATOM   8651  C CD2   . LEU F 2 104 ? -65.441  -25.907 32.207 1.00 43.25  ? 703  LEU E CD2   1 
ATOM   8652  N N     . PHE F 2 105 ? -63.920  -30.250 30.129 1.00 38.55  ? 704  PHE E N     1 
ATOM   8653  C CA    . PHE F 2 105 ? -63.756  -30.459 28.700 1.00 38.37  ? 704  PHE E CA    1 
ATOM   8654  C C     . PHE F 2 105 ? -64.460  -31.723 28.219 1.00 38.28  ? 704  PHE E C     1 
ATOM   8655  O O     . PHE F 2 105 ? -65.039  -31.722 27.137 1.00 38.84  ? 704  PHE E O     1 
ATOM   8656  C CB    . PHE F 2 105 ? -62.272  -30.423 28.324 1.00 49.85  ? 704  PHE E CB    1 
ATOM   8657  C CG    . PHE F 2 105 ? -61.744  -29.015 28.113 1.00 47.92  ? 704  PHE E CG    1 
ATOM   8658  C CD1   . PHE F 2 105 ? -60.575  -28.580 28.730 1.00 48.25  ? 704  PHE E CD1   1 
ATOM   8659  C CD2   . PHE F 2 105 ? -62.439  -28.111 27.312 1.00 47.65  ? 704  PHE E CD2   1 
ATOM   8660  C CE1   . PHE F 2 105 ? -60.116  -27.272 28.555 1.00 46.44  ? 704  PHE E CE1   1 
ATOM   8661  C CE2   . PHE F 2 105 ? -61.978  -26.807 27.139 1.00 45.21  ? 704  PHE E CE2   1 
ATOM   8662  C CZ    . PHE F 2 105 ? -60.818  -26.393 27.764 1.00 44.16  ? 704  PHE E CZ    1 
ATOM   8663  N N     . GLU F 2 106 ? -64.450  -32.791 29.022 1.00 44.30  ? 705  GLU E N     1 
ATOM   8664  C CA    . GLU F 2 106 ? -65.148  -34.018 28.629 1.00 45.11  ? 705  GLU E CA    1 
ATOM   8665  C C     . GLU F 2 106 ? -66.647  -33.702 28.509 1.00 47.16  ? 705  GLU E C     1 
ATOM   8666  O O     . GLU F 2 106 ? -67.275  -33.955 27.471 1.00 47.95  ? 705  GLU E O     1 
ATOM   8667  C CB    . GLU F 2 106 ? -64.958  -35.108 29.667 1.00 47.89  ? 705  GLU E CB    1 
ATOM   8668  C CG    . GLU F 2 106 ? -63.618  -35.773 29.676 1.00 50.99  ? 705  GLU E CG    1 
ATOM   8669  C CD    . GLU F 2 106 ? -63.329  -36.349 31.046 1.00 56.37  ? 705  GLU E CD    1 
ATOM   8670  O OE1   . GLU F 2 106 ? -64.316  -36.737 31.712 1.00 61.71  ? 705  GLU E OE1   1 
ATOM   8671  O OE2   . GLU F 2 106 ? -62.145  -36.410 31.466 1.00 58.11  ? 705  GLU E OE2   1 
ATOM   8672  N N     . ASP F 2 107 ? -67.219  -33.150 29.576 1.00 50.55  ? 706  ASP E N     1 
ATOM   8673  C CA    . ASP F 2 107 ? -68.627  -32.786 29.555 1.00 49.21  ? 706  ASP E CA    1 
ATOM   8674  C C     . ASP F 2 107 ? -68.872  -31.806 28.398 1.00 49.56  ? 706  ASP E C     1 
ATOM   8675  O O     . ASP F 2 107 ? -69.890  -31.876 27.705 1.00 51.44  ? 706  ASP E O     1 
ATOM   8676  C CB    . ASP F 2 107 ? -69.039  -32.162 30.895 1.00 42.53  ? 706  ASP E CB    1 
ATOM   8677  C CG    . ASP F 2 107 ? -68.984  -33.158 32.050 1.00 47.70  ? 706  ASP E CG    1 
ATOM   8678  O OD1   . ASP F 2 107 ? -68.911  -34.379 31.791 1.00 52.34  ? 706  ASP E OD1   1 
ATOM   8679  O OD2   . ASP F 2 107 ? -69.031  -32.731 33.225 1.00 51.32  ? 706  ASP E OD2   1 
ATOM   8680  N N     . THR F 2 108 ? -67.931  -30.900 28.172 1.00 60.75  ? 707  THR E N     1 
ATOM   8681  C CA    . THR F 2 108 ? -68.098  -29.954 27.083 1.00 61.16  ? 707  THR E CA    1 
ATOM   8682  C C     . THR F 2 108 ? -68.091  -30.720 25.762 1.00 60.36  ? 707  THR E C     1 
ATOM   8683  O O     . THR F 2 108 ? -68.885  -30.438 24.867 1.00 57.60  ? 707  THR E O     1 
ATOM   8684  C CB    . THR F 2 108 ? -66.967  -28.862 27.082 1.00 45.42  ? 707  THR E CB    1 
ATOM   8685  O OG1   . THR F 2 108 ? -67.115  -28.013 28.229 1.00 45.18  ? 707  THR E OG1   1 
ATOM   8686  C CG2   . THR F 2 108 ? -67.038  -27.995 25.825 1.00 47.12  ? 707  THR E CG2   1 
ATOM   8687  N N     . ASN F 2 109 ? -67.215  -31.712 25.652 1.00 53.11  ? 708  ASN E N     1 
ATOM   8688  C CA    . ASN F 2 109 ? -67.110  -32.479 24.420 1.00 53.84  ? 708  ASN E CA    1 
ATOM   8689  C C     . ASN F 2 109 ? -68.377  -33.274 24.143 1.00 55.34  ? 708  ASN E C     1 
ATOM   8690  O O     . ASN F 2 109 ? -68.794  -33.375 22.988 1.00 53.49  ? 708  ASN E O     1 
ATOM   8691  C CB    . ASN F 2 109 ? -65.882  -33.394 24.473 1.00 48.21  ? 708  ASN E CB    1 
ATOM   8692  C CG    . ASN F 2 109 ? -65.378  -33.787 23.090 1.00 45.33  ? 708  ASN E CG    1 
ATOM   8693  O OD1   . ASN F 2 109 ? -65.206  -32.954 22.203 1.00 46.15  ? 708  ASN E OD1   1 
ATOM   8694  N ND2   . ASN F 2 109 ? -65.122  -35.065 22.913 1.00 44.49  ? 708  ASN E ND2   1 
ATOM   8695  N N     . LEU F 2 110 ? -68.997  -33.826 25.188 1.00 54.75  ? 709  LEU E N     1 
ATOM   8696  C CA    . LEU F 2 110 ? -70.238  -34.587 25.013 1.00 54.73  ? 709  LEU E CA    1 
ATOM   8697  C C     . LEU F 2 110 ? -71.315  -33.653 24.475 1.00 56.18  ? 709  LEU E C     1 
ATOM   8698  O O     . LEU F 2 110 ? -72.075  -34.012 23.584 1.00 57.07  ? 709  LEU E O     1 
ATOM   8699  C CB    . LEU F 2 110 ? -70.726  -35.178 26.335 1.00 47.13  ? 709  LEU E CB    1 
ATOM   8700  C CG    . LEU F 2 110 ? -69.840  -36.164 27.108 1.00 46.25  ? 709  LEU E CG    1 
ATOM   8701  C CD1   . LEU F 2 110 ? -70.581  -36.597 28.339 1.00 44.43  ? 709  LEU E CD1   1 
ATOM   8702  C CD2   . LEU F 2 110 ? -69.469  -37.386 26.261 1.00 46.48  ? 709  LEU E CD2   1 
ATOM   8703  N N     . CYS F 2 111 ? -71.384  -32.448 25.021 1.00 47.90  ? 710  CYS E N     1 
ATOM   8704  C CA    . CYS F 2 111 ? -72.375  -31.502 24.562 1.00 46.92  ? 710  CYS E CA    1 
ATOM   8705  C C     . CYS F 2 111 ? -72.245  -31.188 23.070 1.00 46.82  ? 710  CYS E C     1 
ATOM   8706  O O     . CYS F 2 111 ? -73.245  -31.115 22.352 1.00 46.53  ? 710  CYS E O     1 
ATOM   8707  C CB    . CYS F 2 111 ? -72.295  -30.221 25.390 1.00 39.28  ? 710  CYS E CB    1 
ATOM   8708  S SG    . CYS F 2 111 ? -73.103  -30.408 26.990 1.00 41.73  ? 710  CYS E SG    1 
ATOM   8709  N N     . ALA F 2 112 ? -71.026  -31.005 22.584 1.00 43.54  ? 711  ALA E N     1 
ATOM   8710  C CA    . ALA F 2 112 ? -70.875  -30.704 21.175 1.00 43.02  ? 711  ALA E CA    1 
ATOM   8711  C C     . ALA F 2 112 ? -71.344  -31.891 20.307 1.00 44.24  ? 711  ALA E C     1 
ATOM   8712  O O     . ALA F 2 112 ? -72.076  -31.718 19.327 1.00 44.45  ? 711  ALA E O     1 
ATOM   8713  C CB    . ALA F 2 112 ? -69.454  -30.375 20.888 1.00 14.95  ? 711  ALA E CB    1 
ATOM   8714  N N     . ILE F 2 113 ? -70.931  -33.099 20.679 1.00 50.06  ? 712  ILE E N     1 
ATOM   8715  C CA    . ILE F 2 113 ? -71.320  -34.294 19.945 1.00 48.79  ? 712  ILE E CA    1 
ATOM   8716  C C     . ILE F 2 113 ? -72.832  -34.443 19.917 1.00 49.53  ? 712  ILE E C     1 
ATOM   8717  O O     . ILE F 2 113 ? -73.416  -34.885 18.937 1.00 52.98  ? 712  ILE E O     1 
ATOM   8718  C CB    . ILE F 2 113 ? -70.709  -35.527 20.582 1.00 46.15  ? 712  ILE E CB    1 
ATOM   8719  C CG1   . ILE F 2 113 ? -69.190  -35.496 20.396 1.00 46.40  ? 712  ILE E CG1   1 
ATOM   8720  C CG2   . ILE F 2 113 ? -71.304  -36.758 19.972 1.00 43.56  ? 712  ILE E CG2   1 
ATOM   8721  C CD1   . ILE F 2 113 ? -68.440  -36.565 21.196 1.00 46.25  ? 712  ILE E CD1   1 
ATOM   8722  N N     . HIS F 2 114 ? -73.465  -34.054 21.005 1.00 57.13  ? 713  HIS E N     1 
ATOM   8723  C CA    . HIS F 2 114 ? -74.911  -34.131 21.091 1.00 58.08  ? 713  HIS E CA    1 
ATOM   8724  C C     . HIS F 2 114 ? -75.565  -33.292 19.999 1.00 58.88  ? 713  HIS E C     1 
ATOM   8725  O O     . HIS F 2 114 ? -76.631  -33.637 19.511 1.00 60.27  ? 713  HIS E O     1 
ATOM   8726  C CB    . HIS F 2 114 ? -75.374  -33.620 22.445 1.00 49.31  ? 713  HIS E CB    1 
ATOM   8727  C CG    . HIS F 2 114 ? -76.822  -33.842 22.709 1.00 50.97  ? 713  HIS E CG    1 
ATOM   8728  N ND1   . HIS F 2 114 ? -77.326  -35.066 23.094 1.00 52.15  ? 713  HIS E ND1   1 
ATOM   8729  C CD2   . HIS F 2 114 ? -77.869  -32.987 22.703 1.00 51.61  ? 713  HIS E CD2   1 
ATOM   8730  C CE1   . HIS F 2 114 ? -78.622  -34.953 23.323 1.00 53.27  ? 713  HIS E CE1   1 
ATOM   8731  N NE2   . HIS F 2 114 ? -78.976  -33.700 23.095 1.00 53.62  ? 713  HIS E NE2   1 
ATOM   8732  N N     . ALA F 2 115 ? -74.930  -32.180 19.640 1.00 43.40  ? 714  ALA E N     1 
ATOM   8733  C CA    . ALA F 2 115 ? -75.465  -31.296 18.618 1.00 43.18  ? 714  ALA E CA    1 
ATOM   8734  C C     . ALA F 2 115 ? -74.834  -31.669 17.285 1.00 45.10  ? 714  ALA E C     1 
ATOM   8735  O O     . ALA F 2 115 ? -74.681  -30.841 16.382 1.00 46.34  ? 714  ALA E O     1 
ATOM   8736  C CB    . ALA F 2 115 ? -75.171  -29.838 18.962 1.00 42.62  ? 714  ALA E CB    1 
ATOM   8737  N N     . LYS F 2 116 ? -74.452  -32.931 17.180 1.00 54.88  ? 715  LYS E N     1 
ATOM   8738  C CA    . LYS F 2 116 ? -73.870  -33.408 15.955 1.00 56.26  ? 715  LYS E CA    1 
ATOM   8739  C C     . LYS F 2 116 ? -72.736  -32.521 15.460 1.00 55.24  ? 715  LYS E C     1 
ATOM   8740  O O     . LYS F 2 116 ? -72.691  -32.182 14.289 1.00 56.58  ? 715  LYS E O     1 
ATOM   8741  C CB    . LYS F 2 116 ? -74.960  -33.512 14.896 1.00 68.82  ? 715  LYS E CB    1 
ATOM   8742  C CG    . LYS F 2 116 ? -75.965  -34.604 15.187 1.00 73.63  ? 715  LYS E CG    1 
ATOM   8743  C CD    . LYS F 2 116 ? -77.277  -34.379 14.449 1.00 75.37  ? 715  LYS E CD    1 
ATOM   8744  C CE    . LYS F 2 116 ? -78.190  -35.606 14.536 1.00 78.42  ? 715  LYS E CE    1 
ATOM   8745  N NZ    . LYS F 2 116 ? -77.615  -36.788 13.826 1.00 77.59  ? 715  LYS E NZ    1 
ATOM   8746  N N     . ARG F 2 117 ? -71.829  -32.145 16.359 1.00 56.11  ? 716  ARG E N     1 
ATOM   8747  C CA    . ARG F 2 117 ? -70.659  -31.325 16.026 1.00 54.23  ? 716  ARG E CA    1 
ATOM   8748  C C     . ARG F 2 117 ? -69.484  -31.987 16.709 1.00 55.51  ? 716  ARG E C     1 
ATOM   8749  O O     . ARG F 2 117 ? -69.670  -32.746 17.669 1.00 56.09  ? 716  ARG E O     1 
ATOM   8750  C CB    . ARG F 2 117 ? -70.763  -29.906 16.597 1.00 56.70  ? 716  ARG E CB    1 
ATOM   8751  C CG    . ARG F 2 117 ? -71.603  -28.909 15.829 1.00 56.10  ? 716  ARG E CG    1 
ATOM   8752  C CD    . ARG F 2 117 ? -71.404  -27.467 16.355 1.00 52.58  ? 716  ARG E CD    1 
ATOM   8753  N NE    . ARG F 2 117 ? -72.112  -27.213 17.616 1.00 54.07  ? 716  ARG E NE    1 
ATOM   8754  C CZ    . ARG F 2 117 ? -71.608  -27.351 18.850 1.00 54.06  ? 716  ARG E CZ    1 
ATOM   8755  N NH1   . ARG F 2 117 ? -70.358  -27.746 19.043 1.00 56.30  ? 716  ARG E NH1   1 
ATOM   8756  N NH2   . ARG F 2 117 ? -72.371  -27.094 19.907 1.00 56.16  ? 716  ARG E NH2   1 
ATOM   8757  N N     . VAL F 2 118 ? -68.277  -31.693 16.231 1.00 51.06  ? 717  VAL E N     1 
ATOM   8758  C CA    . VAL F 2 118 ? -67.060  -32.226 16.855 1.00 52.74  ? 717  VAL E CA    1 
ATOM   8759  C C     . VAL F 2 118 ? -66.172  -31.088 17.349 1.00 55.60  ? 717  VAL E C     1 
ATOM   8760  O O     . VAL F 2 118 ? -65.076  -31.320 17.849 1.00 55.83  ? 717  VAL E O     1 
ATOM   8761  C CB    . VAL F 2 118 ? -66.230  -33.095 15.892 1.00 58.64  ? 717  VAL E CB    1 
ATOM   8762  C CG1   . VAL F 2 118 ? -67.034  -34.311 15.479 1.00 57.36  ? 717  VAL E CG1   1 
ATOM   8763  C CG2   . VAL F 2 118 ? -65.779  -32.263 14.694 1.00 55.12  ? 717  VAL E CG2   1 
ATOM   8764  N N     . THR F 2 119 ? -66.668  -29.865 17.199 1.00 49.63  ? 718  THR E N     1 
ATOM   8765  C CA    . THR F 2 119 ? -65.957  -28.665 17.610 1.00 54.06  ? 718  THR E CA    1 
ATOM   8766  C C     . THR F 2 119 ? -66.612  -28.083 18.855 1.00 51.83  ? 718  THR E C     1 
ATOM   8767  O O     . THR F 2 119 ? -67.724  -27.568 18.787 1.00 51.61  ? 718  THR E O     1 
ATOM   8768  C CB    . THR F 2 119 ? -66.008  -27.606 16.510 1.00 93.01  ? 718  THR E CB    1 
ATOM   8769  O OG1   . THR F 2 119 ? -65.509  -28.164 15.298 1.00 42.67  ? 718  THR E OG1   1 
ATOM   8770  C CG2   . THR F 2 119 ? -65.158  -26.419 16.868 1.00 42.67  ? 718  THR E CG2   1 
ATOM   8771  N N     . ILE F 2 120 ? -65.920  -28.160 19.988 1.00 55.71  ? 719  ILE E N     1 
ATOM   8772  C CA    . ILE F 2 120 ? -66.458  -27.631 21.231 1.00 55.44  ? 719  ILE E CA    1 
ATOM   8773  C C     . ILE F 2 120 ? -66.549  -26.128 21.096 1.00 55.47  ? 719  ILE E C     1 
ATOM   8774  O O     . ILE F 2 120 ? -65.615  -25.482 20.629 1.00 57.82  ? 719  ILE E O     1 
ATOM   8775  C CB    . ILE F 2 120 ? -65.558  -27.986 22.425 1.00 39.89  ? 719  ILE E CB    1 
ATOM   8776  C CG1   . ILE F 2 120 ? -64.143  -27.458 22.197 1.00 39.05  ? 719  ILE E CG1   1 
ATOM   8777  C CG2   . ILE F 2 120 ? -65.526  -29.514 22.614 1.00 41.72  ? 719  ILE E CG2   1 
ATOM   8778  C CD1   . ILE F 2 120 ? -63.269  -27.535 23.413 1.00 35.06  ? 719  ILE E CD1   1 
ATOM   8779  N N     . MET F 2 121 ? -67.684  -25.569 21.492 1.00 47.85  ? 720  MET E N     1 
ATOM   8780  C CA    . MET F 2 121 ? -67.890  -24.125 21.390 1.00 45.31  ? 720  MET E CA    1 
ATOM   8781  C C     . MET F 2 121 ? -68.313  -23.548 22.736 1.00 45.08  ? 720  MET E C     1 
ATOM   8782  O O     . MET F 2 121 ? -68.833  -24.261 23.585 1.00 43.99  ? 720  MET E O     1 
ATOM   8783  C CB    . MET F 2 121 ? -68.964  -23.833 20.334 1.00 64.20  ? 720  MET E CB    1 
ATOM   8784  C CG    . MET F 2 121 ? -68.603  -24.305 18.930 1.00 66.80  ? 720  MET E CG    1 
ATOM   8785  S SD    . MET F 2 121 ? -69.964  -24.133 17.759 1.00 71.02  ? 720  MET E SD    1 
ATOM   8786  C CE    . MET F 2 121 ? -69.991  -22.358 17.564 1.00 69.71  ? 720  MET E CE    1 
ATOM   8787  N N     . PRO F 2 122 ? -68.101  -22.242 22.945 1.00 52.16  ? 721  PRO E N     1 
ATOM   8788  C CA    . PRO F 2 122 ? -68.485  -21.634 24.224 1.00 53.26  ? 721  PRO E CA    1 
ATOM   8789  C C     . PRO F 2 122 ? -69.858  -22.080 24.743 1.00 51.70  ? 721  PRO E C     1 
ATOM   8790  O O     . PRO F 2 122 ? -70.006  -22.410 25.927 1.00 54.86  ? 721  PRO E O     1 
ATOM   8791  C CB    . PRO F 2 122 ? -68.405  -20.140 23.923 1.00 35.17  ? 721  PRO E CB    1 
ATOM   8792  C CG    . PRO F 2 122 ? -67.226  -20.059 23.007 1.00 33.66  ? 721  PRO E CG    1 
ATOM   8793  C CD    . PRO F 2 122 ? -67.496  -21.239 22.051 1.00 35.51  ? 721  PRO E CD    1 
ATOM   8794  N N     . LYS F 2 123 ? -70.847  -22.106 23.854 1.00 44.61  ? 722  LYS E N     1 
ATOM   8795  C CA    . LYS F 2 123 ? -72.177  -22.532 24.234 1.00 43.82  ? 722  LYS E CA    1 
ATOM   8796  C C     . LYS F 2 123 ? -72.115  -23.987 24.742 1.00 43.26  ? 722  LYS E C     1 
ATOM   8797  O O     . LYS F 2 123 ? -72.932  -24.400 25.575 1.00 42.55  ? 722  LYS E O     1 
ATOM   8798  C CB    . LYS F 2 123 ? -73.139  -22.408 23.051 1.00 67.82  ? 722  LYS E CB    1 
ATOM   8799  C CG    . LYS F 2 123 ? -72.880  -23.381 21.930 1.00 70.38  ? 722  LYS E CG    1 
ATOM   8800  C CD    . LYS F 2 123 ? -74.170  -23.706 21.169 1.00 71.83  ? 722  LYS E CD    1 
ATOM   8801  C CE    . LYS F 2 123 ? -74.499  -22.693 20.074 1.00 77.49  ? 722  LYS E CE    1 
ATOM   8802  N NZ    . LYS F 2 123 ? -73.522  -22.738 18.943 1.00 78.73  ? 722  LYS E NZ    1 
ATOM   8803  N N     . ASP F 2 124 ? -71.151  -24.768 24.255 1.00 56.20  ? 723  ASP E N     1 
ATOM   8804  C CA    . ASP F 2 124 ? -71.001  -26.146 24.736 1.00 57.65  ? 723  ASP E CA    1 
ATOM   8805  C C     . ASP F 2 124 ? -70.585  -26.115 26.219 1.00 57.77  ? 723  ASP E C     1 
ATOM   8806  O O     . ASP F 2 124 ? -71.189  -26.791 27.060 1.00 57.13  ? 723  ASP E O     1 
ATOM   8807  C CB    . ASP F 2 124 ? -69.939  -26.901 23.938 1.00 49.87  ? 723  ASP E CB    1 
ATOM   8808  C CG    . ASP F 2 124 ? -70.416  -27.310 22.577 1.00 53.22  ? 723  ASP E CG    1 
ATOM   8809  O OD1   . ASP F 2 124 ? -71.559  -27.821 22.508 1.00 52.21  ? 723  ASP E OD1   1 
ATOM   8810  O OD2   . ASP F 2 124 ? -69.648  -27.136 21.599 1.00 54.50  ? 723  ASP E OD2   1 
ATOM   8811  N N     . ILE F 2 125 ? -69.552  -25.325 26.530 1.00 52.68  ? 724  ILE E N     1 
ATOM   8812  C CA    . ILE F 2 125 ? -69.079  -25.185 27.905 1.00 49.84  ? 724  ILE E CA    1 
ATOM   8813  C C     . ILE F 2 125 ? -70.197  -24.652 28.799 1.00 49.28  ? 724  ILE E C     1 
ATOM   8814  O O     . ILE F 2 125 ? -70.281  -24.982 29.996 1.00 49.80  ? 724  ILE E O     1 
ATOM   8815  C CB    . ILE F 2 125 ? -67.909  -24.213 27.990 1.00 38.67  ? 724  ILE E CB    1 
ATOM   8816  C CG1   . ILE F 2 125 ? -66.671  -24.846 27.371 1.00 38.65  ? 724  ILE E CG1   1 
ATOM   8817  C CG2   . ILE F 2 125 ? -67.640  -23.862 29.431 1.00 35.78  ? 724  ILE E CG2   1 
ATOM   8818  C CD1   . ILE F 2 125 ? -65.496  -23.903 27.246 1.00 39.58  ? 724  ILE E CD1   1 
ATOM   8819  N N     . GLN F 2 126 ? -71.049  -23.822 28.199 1.00 52.20  ? 725  GLN E N     1 
ATOM   8820  C CA    . GLN F 2 126 ? -72.167  -23.216 28.900 1.00 53.93  ? 725  GLN E CA    1 
ATOM   8821  C C     . GLN F 2 126 ? -73.266  -24.195 29.293 1.00 53.20  ? 725  GLN E C     1 
ATOM   8822  O O     . GLN F 2 126 ? -73.792  -24.123 30.412 1.00 52.16  ? 725  GLN E O     1 
ATOM   8823  C CB    . GLN F 2 126 ? -72.753  -22.102 28.057 1.00 56.02  ? 725  GLN E CB    1 
ATOM   8824  C CG    . GLN F 2 126 ? -72.056  -20.781 28.228 1.00 61.95  ? 725  GLN E CG    1 
ATOM   8825  C CD    . GLN F 2 126 ? -72.378  -19.840 27.102 1.00 63.53  ? 725  GLN E CD    1 
ATOM   8826  O OE1   . GLN F 2 126 ? -73.537  -19.706 26.722 1.00 65.22  ? 725  GLN E OE1   1 
ATOM   8827  N NE2   . GLN F 2 126 ? -71.358  -19.184 26.555 1.00 62.74  ? 725  GLN E NE2   1 
ATOM   8828  N N     . LEU F 2 127 ? -73.622  -25.101 28.381 1.00 44.55  ? 726  LEU E N     1 
ATOM   8829  C CA    . LEU F 2 127 ? -74.659  -26.089 28.679 1.00 43.02  ? 726  LEU E CA    1 
ATOM   8830  C C     . LEU F 2 127 ? -74.175  -26.969 29.823 1.00 44.35  ? 726  LEU E C     1 
ATOM   8831  O O     . LEU F 2 127 ? -74.861  -27.137 30.829 1.00 46.30  ? 726  LEU E O     1 
ATOM   8832  C CB    . LEU F 2 127 ? -74.959  -26.966 27.454 1.00 33.61  ? 726  LEU E CB    1 
ATOM   8833  C CG    . LEU F 2 127 ? -75.951  -28.093 27.771 1.00 34.90  ? 726  LEU E CG    1 
ATOM   8834  C CD1   . LEU F 2 127 ? -77.250  -27.501 28.318 1.00 31.40  ? 726  LEU E CD1   1 
ATOM   8835  C CD2   . LEU F 2 127 ? -76.199  -28.921 26.530 1.00 32.48  ? 726  LEU E CD2   1 
ATOM   8836  N N     . ALA F 2 128 ? -72.969  -27.508 29.661 1.00 45.78  ? 727  ALA E N     1 
ATOM   8837  C CA    . ALA F 2 128 ? -72.377  -28.380 30.663 1.00 46.02  ? 727  ALA E CA    1 
ATOM   8838  C C     . ALA F 2 128 ? -72.305  -27.723 32.029 1.00 45.70  ? 727  ALA E C     1 
ATOM   8839  O O     . ALA F 2 128 ? -72.656  -28.349 33.020 1.00 44.81  ? 727  ALA E O     1 
ATOM   8840  C CB    . ALA F 2 128 ? -70.993  -28.834 30.226 1.00 42.38  ? 727  ALA E CB    1 
ATOM   8841  N N     . ARG F 2 129 ? -71.859  -26.471 32.102 1.00 49.35  ? 728  ARG E N     1 
ATOM   8842  C CA    . ARG F 2 129 ? -71.788  -25.809 33.409 1.00 48.48  ? 728  ARG E CA    1 
ATOM   8843  C C     . ARG F 2 129 ? -73.170  -25.609 34.033 1.00 48.98  ? 728  ARG E C     1 
ATOM   8844  O O     . ARG F 2 129 ? -73.313  -25.698 35.252 1.00 49.04  ? 728  ARG E O     1 
ATOM   8845  C CB    . ARG F 2 129 ? -71.075  -24.459 33.312 1.00 48.16  ? 728  ARG E CB    1 
ATOM   8846  C CG    . ARG F 2 129 ? -69.592  -24.555 33.017 1.00 47.12  ? 728  ARG E CG    1 
ATOM   8847  C CD    . ARG F 2 129 ? -68.785  -23.833 34.071 1.00 47.55  ? 728  ARG E CD    1 
ATOM   8848  N NE    . ARG F 2 129 ? -68.965  -22.390 33.991 1.00 51.31  ? 728  ARG E NE    1 
ATOM   8849  C CZ    . ARG F 2 129 ? -68.967  -21.576 35.041 1.00 52.57  ? 728  ARG E CZ    1 
ATOM   8850  N NH1   . ARG F 2 129 ? -68.803  -22.065 36.265 1.00 52.72  ? 728  ARG E NH1   1 
ATOM   8851  N NH2   . ARG F 2 129 ? -69.127  -20.272 34.864 1.00 55.22  ? 728  ARG E NH2   1 
ATOM   8852  N N     . ARG F 2 130 ? -74.190  -25.345 33.214 1.00 56.39  ? 729  ARG E N     1 
ATOM   8853  C CA    . ARG F 2 130 ? -75.525  -25.148 33.760 1.00 58.43  ? 729  ARG E CA    1 
ATOM   8854  C C     . ARG F 2 130 ? -76.074  -26.447 34.312 1.00 59.72  ? 729  ARG E C     1 
ATOM   8855  O O     . ARG F 2 130 ? -76.585  -26.501 35.428 1.00 60.69  ? 729  ARG E O     1 
ATOM   8856  C CB    . ARG F 2 130 ? -76.492  -24.624 32.708 1.00 74.97  ? 729  ARG E CB    1 
ATOM   8857  C CG    . ARG F 2 130 ? -77.923  -24.492 33.224 1.00 83.37  ? 729  ARG E CG    1 
ATOM   8858  C CD    . ARG F 2 130 ? -78.786  -23.735 32.236 1.00 92.39  ? 729  ARG E CD    1 
ATOM   8859  N NE    . ARG F 2 130 ? -80.080  -23.320 32.785 1.00 99.09  ? 729  ARG E NE    1 
ATOM   8860  C CZ    . ARG F 2 130 ? -80.939  -22.527 32.141 1.00 102.08 ? 729  ARG E CZ    1 
ATOM   8861  N NH1   . ARG F 2 130 ? -80.637  -22.066 30.931 1.00 103.89 ? 729  ARG E NH1   1 
ATOM   8862  N NH2   . ARG F 2 130 ? -82.098  -22.188 32.700 1.00 101.59 ? 729  ARG E NH2   1 
ATOM   8863  N N     . ILE F 2 131 ? -75.978  -27.504 33.525 1.00 53.29  ? 730  ILE E N     1 
ATOM   8864  C CA    . ILE F 2 131 ? -76.495  -28.770 33.970 1.00 53.95  ? 730  ILE E CA    1 
ATOM   8865  C C     . ILE F 2 131 ? -75.751  -29.205 35.209 1.00 56.07  ? 730  ILE E C     1 
ATOM   8866  O O     . ILE F 2 131 ? -76.313  -29.901 36.052 1.00 57.74  ? 730  ILE E O     1 
ATOM   8867  C CB    . ILE F 2 131 ? -76.401  -29.812 32.843 1.00 45.40  ? 730  ILE E CB    1 
ATOM   8868  C CG1   . ILE F 2 131 ? -77.519  -29.532 31.837 1.00 45.02  ? 730  ILE E CG1   1 
ATOM   8869  C CG2   . ILE F 2 131 ? -76.515  -31.228 33.399 1.00 43.56  ? 730  ILE E CG2   1 
ATOM   8870  C CD1   . ILE F 2 131 ? -77.212  -30.004 30.438 1.00 47.02  ? 730  ILE E CD1   1 
ATOM   8871  N N     . ARG F 2 132 ? -74.497  -28.768 35.328 1.00 48.00  ? 731  ARG E N     1 
ATOM   8872  C CA    . ARG F 2 132 ? -73.646  -29.090 36.487 1.00 48.17  ? 731  ARG E CA    1 
ATOM   8873  C C     . ARG F 2 132 ? -74.080  -28.324 37.741 1.00 50.29  ? 731  ARG E C     1 
ATOM   8874  O O     . ARG F 2 132 ? -73.768  -28.724 38.861 1.00 50.66  ? 731  ARG E O     1 
ATOM   8875  C CB    . ARG F 2 132 ? -72.182  -28.748 36.197 1.00 47.74  ? 731  ARG E CB    1 
ATOM   8876  C CG    . ARG F 2 132 ? -71.439  -29.709 35.286 1.00 43.89  ? 731  ARG E CG    1 
ATOM   8877  C CD    . ARG F 2 132 ? -70.011  -29.219 35.138 1.00 44.28  ? 731  ARG E CD    1 
ATOM   8878  N NE    . ARG F 2 132 ? -69.071  -30.275 34.763 1.00 44.02  ? 731  ARG E NE    1 
ATOM   8879  C CZ    . ARG F 2 132 ? -67.789  -30.275 35.111 1.00 46.31  ? 731  ARG E CZ    1 
ATOM   8880  N NH1   . ARG F 2 132 ? -67.311  -29.280 35.847 1.00 46.07  ? 731  ARG E NH1   1 
ATOM   8881  N NH2   . ARG F 2 132 ? -66.991  -31.254 34.712 1.00 47.09  ? 731  ARG E NH2   1 
ATOM   8882  N N     . GLY F 2 133 ? -74.779  -27.213 37.535 1.00 56.02  ? 732  GLY E N     1 
ATOM   8883  C CA    . GLY F 2 133 ? -75.262  -26.424 38.644 1.00 62.32  ? 732  GLY E CA    1 
ATOM   8884  C C     . GLY F 2 133 ? -74.268  -25.355 38.982 1.00 66.16  ? 732  GLY E C     1 
ATOM   8885  O O     . GLY F 2 133 ? -74.410  -24.642 39.972 1.00 67.14  ? 732  GLY E O     1 
ATOM   8886  N N     . GLU F 2 134 ? -73.246  -25.235 38.153 1.00 44.01  ? 733  GLU E N     1 
ATOM   8887  C CA    . GLU F 2 134 ? -72.223  -24.240 38.406 1.00 50.19  ? 733  GLU E CA    1 
ATOM   8888  C C     . GLU F 2 134 ? -72.739  -22.836 38.156 1.00 58.12  ? 733  GLU E C     1 
ATOM   8889  O O     . GLU F 2 134 ? -72.636  -21.981 39.027 1.00 56.90  ? 733  GLU E O     1 
ATOM   8890  C CB    . GLU F 2 134 ? -70.983  -24.526 37.555 1.00 60.48  ? 733  GLU E CB    1 
ATOM   8891  C CG    . GLU F 2 134 ? -70.207  -25.754 38.013 1.00 56.30  ? 733  GLU E CG    1 
ATOM   8892  C CD    . GLU F 2 134 ? -68.926  -25.985 37.215 1.00 55.32  ? 733  GLU E CD    1 
ATOM   8893  O OE1   . GLU F 2 134 ? -68.383  -25.002 36.655 1.00 53.65  ? 733  GLU E OE1   1 
ATOM   8894  O OE2   . GLU F 2 134 ? -68.454  -27.150 37.169 1.00 54.21  ? 733  GLU E OE2   1 
ATOM   8895  N N     . ARG F 2 135 ? -73.291  -22.599 36.973 1.00 164.54 ? 734  ARG E N     1 
ATOM   8896  C CA    . ARG F 2 135 ? -73.820  -21.285 36.634 1.00 175.44 ? 734  ARG E CA    1 
ATOM   8897  C C     . ARG F 2 135 ? -74.224  -20.524 37.895 1.00 179.47 ? 734  ARG E C     1 
ATOM   8898  O O     . ARG F 2 135 ? -75.228  -20.847 38.530 1.00 180.56 ? 734  ARG E O     1 
ATOM   8899  C CB    . ARG F 2 135 ? -75.038  -21.432 35.722 1.00 146.39 ? 734  ARG E CB    1 
ATOM   8900  C CG    . ARG F 2 135 ? -76.176  -22.235 36.337 1.00 151.92 ? 734  ARG E CG    1 
ATOM   8901  C CD    . ARG F 2 135 ? -77.507  -21.725 35.839 1.00 155.87 ? 734  ARG E CD    1 
ATOM   8902  N NE    . ARG F 2 135 ? -77.626  -20.290 36.072 1.00 158.60 ? 734  ARG E NE    1 
ATOM   8903  C CZ    . ARG F 2 135 ? -78.661  -19.557 35.688 1.00 159.13 ? 734  ARG E CZ    1 
ATOM   8904  N NH1   . ARG F 2 135 ? -79.672  -20.129 35.050 1.00 159.61 ? 734  ARG E NH1   1 
ATOM   8905  N NH2   . ARG F 2 135 ? -78.685  -18.255 35.938 1.00 160.05 ? 734  ARG E NH2   1 
ATOM   8906  N N     . ALA F 2 136 ? -73.433  -19.526 38.271 1.00 166.28 ? 735  ALA E N     1 
ATOM   8907  C CA    . ALA F 2 136 ? -73.743  -18.748 39.463 1.00 168.92 ? 735  ALA E CA    1 
ATOM   8908  C C     . ALA F 2 136 ? -73.853  -17.258 39.152 1.00 171.43 ? 735  ALA E C     1 
ATOM   8909  O O     . ALA F 2 136 ? -74.859  -16.650 39.577 1.00 172.23 ? 735  ALA E O     1 
ATOM   8910  C CB    . ALA F 2 136 ? -72.690  -18.993 40.537 1.00 101.52 ? 735  ALA E CB    1 
ATOM   8911  O OXT   . ALA F 2 136 ? -72.937  -16.718 38.493 1.00 109.43 ? 735  ALA E OXT   1 
ATOM   8912  N N     . ARG G 3 20  ? -40.816  -5.638  44.942 1.00 166.77 ? 219  ARG F N     1 
ATOM   8913  C CA    . ARG G 3 20  ? -42.294  -5.826  44.861 1.00 166.79 ? 219  ARG F CA    1 
ATOM   8914  C C     . ARG G 3 20  ? -42.795  -5.404  43.474 1.00 165.19 ? 219  ARG F C     1 
ATOM   8915  O O     . ARG G 3 20  ? -42.976  -4.217  43.205 1.00 163.10 ? 219  ARG F O     1 
ATOM   8916  C CB    . ARG G 3 20  ? -42.971  -5.001  45.968 1.00 132.86 ? 219  ARG F CB    1 
ATOM   8917  C CG    . ARG G 3 20  ? -44.479  -5.193  46.099 1.00 142.07 ? 219  ARG F CG    1 
ATOM   8918  C CD    . ARG G 3 20  ? -45.263  -4.373  45.076 1.00 147.86 ? 219  ARG F CD    1 
ATOM   8919  N NE    . ARG G 3 20  ? -46.702  -4.596  45.184 1.00 153.74 ? 219  ARG F NE    1 
ATOM   8920  C CZ    . ARG G 3 20  ? -47.429  -4.317  46.262 1.00 159.75 ? 219  ARG F CZ    1 
ATOM   8921  N NH1   . ARG G 3 20  ? -46.859  -3.797  47.340 1.00 160.50 ? 219  ARG F NH1   1 
ATOM   8922  N NH2   . ARG G 3 20  ? -48.731  -4.570  46.267 1.00 161.00 ? 219  ARG F NH2   1 
ATOM   8923  N N     . LYS G 3 21  ? -43.013  -6.384  42.598 1.00 98.80  ? 220  LYS F N     1 
ATOM   8924  C CA    . LYS G 3 21  ? -43.476  -6.129  41.227 1.00 99.59  ? 220  LYS F CA    1 
ATOM   8925  C C     . LYS G 3 21  ? -44.970  -6.404  41.106 1.00 100.40 ? 220  LYS F C     1 
ATOM   8926  O O     . LYS G 3 21  ? -45.395  -7.549  41.211 1.00 100.85 ? 220  LYS F O     1 
ATOM   8927  C CB    . LYS G 3 21  ? -42.723  -7.035  40.263 1.00 96.04  ? 220  LYS F CB    1 
ATOM   8928  C CG    . LYS G 3 21  ? -42.300  -6.369  38.971 1.00 97.24  ? 220  LYS F CG    1 
ATOM   8929  C CD    . LYS G 3 21  ? -43.472  -5.994  38.094 1.00 98.51  ? 220  LYS F CD    1 
ATOM   8930  C CE    . LYS G 3 21  ? -42.987  -5.424  36.755 1.00 99.68  ? 220  LYS F CE    1 
ATOM   8931  N NZ    . LYS G 3 21  ? -42.194  -6.386  35.931 1.00 96.71  ? 220  LYS F NZ    1 
ATOM   8932  N N     . VAL G 3 22  ? -45.764  -5.370  40.848 1.00 58.19  ? 221  VAL F N     1 
ATOM   8933  C CA    . VAL G 3 22  ? -47.209  -5.553  40.776 1.00 58.81  ? 221  VAL F CA    1 
ATOM   8934  C C     . VAL G 3 22  ? -47.611  -6.607  39.772 1.00 59.32  ? 221  VAL F C     1 
ATOM   8935  O O     . VAL G 3 22  ? -47.077  -6.686  38.672 1.00 58.97  ? 221  VAL F O     1 
ATOM   8936  C CB    . VAL G 3 22  ? -47.984  -4.228  40.460 1.00 54.71  ? 221  VAL F CB    1 
ATOM   8937  C CG1   . VAL G 3 22  ? -47.166  -3.022  40.882 1.00 56.39  ? 221  VAL F CG1   1 
ATOM   8938  C CG2   . VAL G 3 22  ? -48.336  -4.144  39.001 1.00 53.93  ? 221  VAL F CG2   1 
ATOM   8939  N N     . LEU G 3 23  ? -48.576  -7.413  40.184 1.00 59.00  ? 222  LEU F N     1 
ATOM   8940  C CA    . LEU G 3 23  ? -49.122  -8.493  39.390 1.00 58.59  ? 222  LEU F CA    1 
ATOM   8941  C C     . LEU G 3 23  ? -50.389  -8.060  38.666 1.00 59.14  ? 222  LEU F C     1 
ATOM   8942  O O     . LEU G 3 23  ? -51.314  -7.529  39.284 1.00 60.97  ? 222  LEU F O     1 
ATOM   8943  C CB    . LEU G 3 23  ? -49.461  -9.646  40.321 1.00 36.40  ? 222  LEU F CB    1 
ATOM   8944  C CG    . LEU G 3 23  ? -48.256  -10.297 40.977 1.00 36.02  ? 222  LEU F CG    1 
ATOM   8945  C CD1   . LEU G 3 23  ? -48.727  -11.233 42.092 1.00 33.11  ? 222  LEU F CD1   1 
ATOM   8946  C CD2   . LEU G 3 23  ? -47.470  -11.041 39.882 1.00 33.66  ? 222  LEU F CD2   1 
ATOM   8947  N N     . ARG G 3 24  ? -50.445  -8.291  37.363 1.00 52.12  ? 223  ARG F N     1 
ATOM   8948  C CA    . ARG G 3 24  ? -51.642  -7.932  36.613 1.00 52.14  ? 223  ARG F CA    1 
ATOM   8949  C C     . ARG G 3 24  ? -51.761  -8.678  35.308 1.00 50.54  ? 223  ARG F C     1 
ATOM   8950  O O     . ARG G 3 24  ? -50.768  -8.924  34.644 1.00 48.45  ? 223  ARG F O     1 
ATOM   8951  C CB    . ARG G 3 24  ? -51.703  -6.413  36.354 1.00 35.83  ? 223  ARG F CB    1 
ATOM   8952  C CG    . ARG G 3 24  ? -50.362  -5.682  36.276 1.00 45.04  ? 223  ARG F CG    1 
ATOM   8953  C CD    . ARG G 3 24  ? -50.590  -4.172  36.360 1.00 50.83  ? 223  ARG F CD    1 
ATOM   8954  N NE    . ARG G 3 24  ? -50.932  -3.567  35.074 1.00 56.71  ? 223  ARG F NE    1 
ATOM   8955  C CZ    . ARG G 3 24  ? -50.041  -3.200  34.155 1.00 62.72  ? 223  ARG F CZ    1 
ATOM   8956  N NH1   . ARG G 3 24  ? -48.746  -3.370  34.363 1.00 63.47  ? 223  ARG F NH1   1 
ATOM   8957  N NH2   . ARG G 3 24  ? -50.449  -2.653  33.024 1.00 63.97  ? 223  ARG F NH2   1 
ATOM   8958  N N     . ASP G 3 25  ? -52.994  -9.033  34.959 1.00 59.75  ? 224  ASP F N     1 
ATOM   8959  C CA    . ASP G 3 25  ? -53.305  -9.756  33.727 1.00 62.34  ? 224  ASP F CA    1 
ATOM   8960  C C     . ASP G 3 25  ? -52.517  -11.059 33.604 1.00 62.64  ? 224  ASP F C     1 
ATOM   8961  O O     . ASP G 3 25  ? -51.962  -11.374 32.550 1.00 62.25  ? 224  ASP F O     1 
ATOM   8962  C CB    . ASP G 3 25  ? -53.025  -8.877  32.518 1.00 79.71  ? 224  ASP F CB    1 
ATOM   8963  C CG    . ASP G 3 25  ? -53.756  -9.345  31.289 1.00 85.93  ? 224  ASP F CG    1 
ATOM   8964  O OD1   . ASP G 3 25  ? -54.971  -9.594  31.413 1.00 87.23  ? 224  ASP F OD1   1 
ATOM   8965  O OD2   . ASP G 3 25  ? -53.133  -9.456  30.207 1.00 88.59  ? 224  ASP F OD2   1 
ATOM   8966  N N     . ASN G 3 26  ? -52.491  -11.821 34.691 1.00 51.81  ? 225  ASN F N     1 
ATOM   8967  C CA    . ASN G 3 26  ? -51.770  -13.071 34.715 1.00 51.08  ? 225  ASN F CA    1 
ATOM   8968  C C     . ASN G 3 26  ? -52.595  -14.251 34.230 1.00 50.93  ? 225  ASN F C     1 
ATOM   8969  O O     . ASN G 3 26  ? -52.098  -15.377 34.115 1.00 49.78  ? 225  ASN F O     1 
ATOM   8970  C CB    . ASN G 3 26  ? -51.262  -13.315 36.113 1.00 60.06  ? 225  ASN F CB    1 
ATOM   8971  C CG    . ASN G 3 26  ? -50.016  -12.553 36.388 1.00 62.45  ? 225  ASN F CG    1 
ATOM   8972  O OD1   . ASN G 3 26  ? -49.018  -12.710 35.670 1.00 63.48  ? 225  ASN F OD1   1 
ATOM   8973  N ND2   . ASN G 3 26  ? -50.043  -11.718 37.425 1.00 63.71  ? 225  ASN F ND2   1 
ATOM   8974  N N     . ILE G 3 27  ? -53.858  -13.976 33.941 1.00 53.50  ? 226  ILE F N     1 
ATOM   8975  C CA    . ILE G 3 27  ? -54.754  -14.991 33.445 1.00 51.95  ? 226  ILE F CA    1 
ATOM   8976  C C     . ILE G 3 27  ? -54.261  -15.289 32.035 1.00 52.97  ? 226  ILE F C     1 
ATOM   8977  O O     . ILE G 3 27  ? -54.302  -16.427 31.571 1.00 56.55  ? 226  ILE F O     1 
ATOM   8978  C CB    . ILE G 3 27  ? -56.206  -14.453 33.388 1.00 49.22  ? 226  ILE F CB    1 
ATOM   8979  C CG1   . ILE G 3 27  ? -57.191  -15.606 33.296 1.00 44.76  ? 226  ILE F CG1   1 
ATOM   8980  C CG2   . ILE G 3 27  ? -56.377  -13.512 32.202 1.00 49.34  ? 226  ILE F CG2   1 
ATOM   8981  C CD1   . ILE G 3 27  ? -57.171  -16.455 34.522 1.00 44.93  ? 226  ILE F CD1   1 
ATOM   8982  N N     . GLN G 3 28  ? -53.777  -14.258 31.356 1.00 53.28  ? 227  GLN F N     1 
ATOM   8983  C CA    . GLN G 3 28  ? -53.307  -14.443 30.000 1.00 53.51  ? 227  GLN F CA    1 
ATOM   8984  C C     . GLN G 3 28  ? -52.123  -15.395 29.951 1.00 53.14  ? 227  GLN F C     1 
ATOM   8985  O O     . GLN G 3 28  ? -51.655  -15.755 28.871 1.00 53.87  ? 227  GLN F O     1 
ATOM   8986  C CB    . GLN G 3 28  ? -52.937  -13.099 29.381 1.00 54.10  ? 227  GLN F CB    1 
ATOM   8987  C CG    . GLN G 3 28  ? -54.132  -12.206 29.119 1.00 55.52  ? 227  GLN F CG    1 
ATOM   8988  C CD    . GLN G 3 28  ? -55.243  -12.912 28.355 1.00 57.72  ? 227  GLN F CD    1 
ATOM   8989  O OE1   . GLN G 3 28  ? -54.990  -13.649 27.399 1.00 58.86  ? 227  GLN F OE1   1 
ATOM   8990  N NE2   . GLN G 3 28  ? -56.486  -12.676 28.769 1.00 57.87  ? 227  GLN F NE2   1 
ATOM   8991  N N     . GLY G 3 29  ? -51.640  -15.803 31.120 1.00 62.77  ? 228  GLY F N     1 
ATOM   8992  C CA    . GLY G 3 29  ? -50.520  -16.728 31.177 1.00 64.35  ? 228  GLY F CA    1 
ATOM   8993  C C     . GLY G 3 29  ? -51.009  -18.127 30.867 1.00 64.66  ? 228  GLY F C     1 
ATOM   8994  O O     . GLY G 3 29  ? -50.249  -18.979 30.437 1.00 67.58  ? 228  GLY F O     1 
ATOM   8995  N N     . ILE G 3 30  ? -52.293  -18.353 31.121 1.00 41.16  ? 229  ILE F N     1 
ATOM   8996  C CA    . ILE G 3 30  ? -52.948  -19.608 30.843 1.00 39.04  ? 229  ILE F CA    1 
ATOM   8997  C C     . ILE G 3 30  ? -53.154  -19.539 29.347 1.00 38.76  ? 229  ILE F C     1 
ATOM   8998  O O     . ILE G 3 30  ? -54.220  -19.154 28.868 1.00 40.06  ? 229  ILE F O     1 
ATOM   8999  C CB    . ILE G 3 30  ? -54.276  -19.641 31.557 1.00 36.49  ? 229  ILE F CB    1 
ATOM   9000  C CG1   . ILE G 3 30  ? -54.032  -19.285 33.012 1.00 33.14  ? 229  ILE F CG1   1 
ATOM   9001  C CG2   . ILE G 3 30  ? -54.922  -21.044 31.449 1.00 34.32  ? 229  ILE F CG2   1 
ATOM   9002  C CD1   . ILE G 3 30  ? -52.827  -19.981 33.601 1.00 34.26  ? 229  ILE F CD1   1 
ATOM   9003  N N     . THR G 3 31  ? -52.113  -19.902 28.617 1.00 47.67  ? 230  THR F N     1 
ATOM   9004  C CA    . THR G 3 31  ? -52.105  -19.804 27.166 1.00 48.02  ? 230  THR F CA    1 
ATOM   9005  C C     . THR G 3 31  ? -52.902  -20.790 26.347 1.00 49.57  ? 230  THR F C     1 
ATOM   9006  O O     . THR G 3 31  ? -53.224  -21.888 26.800 1.00 50.72  ? 230  THR F O     1 
ATOM   9007  C CB    . THR G 3 31  ? -50.673  -19.867 26.638 1.00 56.51  ? 230  THR F CB    1 
ATOM   9008  O OG1   . THR G 3 31  ? -50.211  -21.230 26.680 1.00 57.41  ? 230  THR F OG1   1 
ATOM   9009  C CG2   . THR G 3 31  ? -49.768  -18.982 27.487 1.00 55.80  ? 230  THR F CG2   1 
ATOM   9010  N N     . LYS G 3 32  ? -53.181  -20.382 25.111 1.00 47.59  ? 231  LYS F N     1 
ATOM   9011  C CA    . LYS G 3 32  ? -53.917  -21.201 24.167 1.00 48.38  ? 231  LYS F CA    1 
ATOM   9012  C C     . LYS G 3 32  ? -53.325  -22.633 24.066 1.00 49.19  ? 231  LYS F C     1 
ATOM   9013  O O     . LYS G 3 32  ? -54.071  -23.608 24.190 1.00 49.64  ? 231  LYS F O     1 
ATOM   9014  C CB    . LYS G 3 32  ? -53.951  -20.492 22.823 1.00 50.80  ? 231  LYS F CB    1 
ATOM   9015  C CG    . LYS G 3 32  ? -54.725  -21.216 21.762 1.00 52.00  ? 231  LYS F CG    1 
ATOM   9016  C CD    . LYS G 3 32  ? -54.652  -20.458 20.448 1.00 53.27  ? 231  LYS F CD    1 
ATOM   9017  C CE    . LYS G 3 32  ? -54.889  -21.378 19.271 1.00 54.44  ? 231  LYS F CE    1 
ATOM   9018  N NZ    . LYS G 3 32  ? -54.676  -20.660 18.002 1.00 51.47  ? 231  LYS F NZ    1 
ATOM   9019  N N     . PRO G 3 33  ? -51.987  -22.778 23.860 1.00 46.46  ? 232  PRO F N     1 
ATOM   9020  C CA    . PRO G 3 33  ? -51.323  -24.087 23.766 1.00 45.82  ? 232  PRO F CA    1 
ATOM   9021  C C     . PRO G 3 33  ? -51.701  -24.930 24.971 1.00 48.07  ? 232  PRO F C     1 
ATOM   9022  O O     . PRO G 3 33  ? -51.971  -26.130 24.855 1.00 51.00  ? 232  PRO F O     1 
ATOM   9023  C CB    . PRO G 3 33  ? -49.839  -23.741 23.829 1.00 41.60  ? 232  PRO F CB    1 
ATOM   9024  C CG    . PRO G 3 33  ? -49.773  -22.473 23.175 1.00 44.32  ? 232  PRO F CG    1 
ATOM   9025  C CD    . PRO G 3 33  ? -50.987  -21.709 23.711 1.00 43.64  ? 232  PRO F CD    1 
ATOM   9026  N N     . ALA G 3 34  ? -51.702  -24.292 26.137 1.00 42.25  ? 233  ALA F N     1 
ATOM   9027  C CA    . ALA G 3 34  ? -52.045  -24.997 27.366 1.00 42.98  ? 233  ALA F CA    1 
ATOM   9028  C C     . ALA G 3 34  ? -53.507  -25.379 27.420 1.00 45.25  ? 233  ALA F C     1 
ATOM   9029  O O     . ALA G 3 34  ? -53.832  -26.535 27.689 1.00 47.41  ? 233  ALA F O     1 
ATOM   9030  C CB    . ALA G 3 34  ? -51.695  -24.164 28.577 1.00 53.94  ? 233  ALA F CB    1 
ATOM   9031  N N     . ILE G 3 35  ? -54.389  -24.415 27.166 1.00 63.56  ? 234  ILE F N     1 
ATOM   9032  C CA    . ILE G 3 35  ? -55.820  -24.696 27.209 1.00 61.54  ? 234  ILE F CA    1 
ATOM   9033  C C     . ILE G 3 35  ? -56.080  -25.790 26.201 1.00 61.94  ? 234  ILE F C     1 
ATOM   9034  O O     . ILE G 3 35  ? -57.027  -26.565 26.330 1.00 62.06  ? 234  ILE F O     1 
ATOM   9035  C CB    . ILE G 3 35  ? -56.664  -23.445 26.860 1.00 53.14  ? 234  ILE F CB    1 
ATOM   9036  C CG1   . ILE G 3 35  ? -56.422  -22.356 27.911 1.00 52.25  ? 234  ILE F CG1   1 
ATOM   9037  C CG2   . ILE G 3 35  ? -58.151  -23.791 26.842 1.00 48.47  ? 234  ILE F CG2   1 
ATOM   9038  C CD1   . ILE G 3 35  ? -56.973  -21.002 27.527 1.00 53.87  ? 234  ILE F CD1   1 
ATOM   9039  N N     . ARG G 3 36  ? -55.194  -25.868 25.217 1.00 46.26  ? 235  ARG F N     1 
ATOM   9040  C CA    . ARG G 3 36  ? -55.323  -26.859 24.169 1.00 46.28  ? 235  ARG F CA    1 
ATOM   9041  C C     . ARG G 3 36  ? -54.923  -28.251 24.653 1.00 44.68  ? 235  ARG F C     1 
ATOM   9042  O O     . ARG G 3 36  ? -55.574  -29.236 24.312 1.00 42.59  ? 235  ARG F O     1 
ATOM   9043  C CB    . ARG G 3 36  ? -54.479  -26.454 22.965 1.00 70.60  ? 235  ARG F CB    1 
ATOM   9044  C CG    . ARG G 3 36  ? -54.967  -27.002 21.634 1.00 79.81  ? 235  ARG F CG    1 
ATOM   9045  C CD    . ARG G 3 36  ? -53.914  -26.783 20.562 1.00 85.60  ? 235  ARG F CD    1 
ATOM   9046  N NE    . ARG G 3 36  ? -54.444  -26.982 19.221 1.00 91.48  ? 235  ARG F NE    1 
ATOM   9047  C CZ    . ARG G 3 36  ? -55.437  -26.268 18.699 1.00 97.49  ? 235  ARG F CZ    1 
ATOM   9048  N NH1   . ARG G 3 36  ? -56.011  -25.306 19.409 1.00 98.24  ? 235  ARG F NH1   1 
ATOM   9049  N NH2   . ARG G 3 36  ? -55.853  -26.510 17.463 1.00 98.74  ? 235  ARG F NH2   1 
ATOM   9050  N N     . ARG G 3 37  ? -53.864  -28.349 25.446 1.00 45.45  ? 236  ARG F N     1 
ATOM   9051  C CA    . ARG G 3 37  ? -53.453  -29.667 25.919 1.00 45.90  ? 236  ARG F CA    1 
ATOM   9052  C C     . ARG G 3 37  ? -54.494  -30.215 26.867 1.00 45.27  ? 236  ARG F C     1 
ATOM   9053  O O     . ARG G 3 37  ? -54.855  -31.387 26.793 1.00 46.77  ? 236  ARG F O     1 
ATOM   9054  C CB    . ARG G 3 37  ? -52.098  -29.601 26.602 1.00 42.16  ? 236  ARG F CB    1 
ATOM   9055  C CG    . ARG G 3 37  ? -51.008  -29.200 25.654 1.00 43.65  ? 236  ARG F CG    1 
ATOM   9056  C CD    . ARG G 3 37  ? -49.656  -29.177 26.329 1.00 46.51  ? 236  ARG F CD    1 
ATOM   9057  N NE    . ARG G 3 37  ? -49.502  -28.097 27.308 1.00 48.08  ? 236  ARG F NE    1 
ATOM   9058  C CZ    . ARG G 3 37  ? -49.079  -26.871 27.013 1.00 45.67  ? 236  ARG F CZ    1 
ATOM   9059  N NH1   . ARG G 3 37  ? -48.777  -26.564 25.768 1.00 44.47  ? 236  ARG F NH1   1 
ATOM   9060  N NH2   . ARG G 3 37  ? -48.916  -25.965 27.965 1.00 46.72  ? 236  ARG F NH2   1 
ATOM   9061  N N     . LEU G 3 38  ? -54.994  -29.352 27.743 1.00 50.34  ? 237  LEU F N     1 
ATOM   9062  C CA    . LEU G 3 38  ? -56.006  -29.753 28.703 1.00 49.93  ? 237  LEU F CA    1 
ATOM   9063  C C     . LEU G 3 38  ? -57.183  -30.369 27.949 1.00 50.48  ? 237  LEU F C     1 
ATOM   9064  O O     . LEU G 3 38  ? -57.574  -31.505 28.213 1.00 52.31  ? 237  LEU F O     1 
ATOM   9065  C CB    . LEU G 3 38  ? -56.461  -28.542 29.531 1.00 44.62  ? 237  LEU F CB    1 
ATOM   9066  C CG    . LEU G 3 38  ? -55.466  -27.890 30.514 1.00 44.24  ? 237  LEU F CG    1 
ATOM   9067  C CD1   . LEU G 3 38  ? -55.945  -26.479 30.910 1.00 41.33  ? 237  LEU F CD1   1 
ATOM   9068  C CD2   . LEU G 3 38  ? -55.306  -28.782 31.744 1.00 41.88  ? 237  LEU F CD2   1 
ATOM   9069  N N     . ALA G 3 39  ? -57.723  -29.634 26.986 1.00 48.11  ? 238  ALA F N     1 
ATOM   9070  C CA    . ALA G 3 39  ? -58.850  -30.126 26.202 1.00 47.87  ? 238  ALA F CA    1 
ATOM   9071  C C     . ALA G 3 39  ? -58.573  -31.476 25.500 1.00 47.68  ? 238  ALA F C     1 
ATOM   9072  O O     . ALA G 3 39  ? -59.474  -32.311 25.369 1.00 47.42  ? 238  ALA F O     1 
ATOM   9073  C CB    . ALA G 3 39  ? -59.276  -29.057 25.175 1.00 31.75  ? 238  ALA F CB    1 
ATOM   9074  N N     . ARG G 3 40  ? -57.338  -31.691 25.050 1.00 56.86  ? 239  ARG F N     1 
ATOM   9075  C CA    . ARG G 3 40  ? -56.993  -32.944 24.375 1.00 56.59  ? 239  ARG F CA    1 
ATOM   9076  C C     . ARG G 3 40  ? -57.034  -34.086 25.390 1.00 56.76  ? 239  ARG F C     1 
ATOM   9077  O O     . ARG G 3 40  ? -57.483  -35.190 25.083 1.00 57.16  ? 239  ARG F O     1 
ATOM   9078  C CB    . ARG G 3 40  ? -55.595  -32.862 23.740 1.00 44.69  ? 239  ARG F CB    1 
ATOM   9079  C CG    . ARG G 3 40  ? -55.476  -31.870 22.599 1.00 43.05  ? 239  ARG F CG    1 
ATOM   9080  C CD    . ARG G 3 40  ? -55.363  -32.545 21.232 1.00 44.39  ? 239  ARG F CD    1 
ATOM   9081  N NE    . ARG G 3 40  ? -55.508  -31.589 20.123 1.00 47.46  ? 239  ARG F NE    1 
ATOM   9082  C CZ    . ARG G 3 40  ? -56.643  -30.964 19.831 1.00 49.60  ? 239  ARG F CZ    1 
ATOM   9083  N NH1   . ARG G 3 40  ? -57.712  -31.211 20.565 1.00 53.74  ? 239  ARG F NH1   1 
ATOM   9084  N NH2   . ARG G 3 40  ? -56.712  -30.090 18.835 1.00 48.83  ? 239  ARG F NH2   1 
ATOM   9085  N N     . ARG G 3 41  ? -56.554  -33.819 26.597 1.00 41.82  ? 240  ARG F N     1 
ATOM   9086  C CA    . ARG G 3 41  ? -56.577  -34.832 27.630 1.00 42.73  ? 240  ARG F CA    1 
ATOM   9087  C C     . ARG G 3 41  ? -58.039  -35.017 28.018 1.00 44.05  ? 240  ARG F C     1 
ATOM   9088  O O     . ARG G 3 41  ? -58.421  -36.046 28.572 1.00 45.88  ? 240  ARG F O     1 
ATOM   9089  C CB    . ARG G 3 41  ? -55.739  -34.393 28.844 1.00 36.44  ? 240  ARG F CB    1 
ATOM   9090  C CG    . ARG G 3 41  ? -56.033  -35.154 30.158 1.00 33.59  ? 240  ARG F CG    1 
ATOM   9091  C CD    . ARG G 3 41  ? -55.007  -34.816 31.214 1.00 35.10  ? 240  ARG F CD    1 
ATOM   9092  N NE    . ARG G 3 41  ? -53.657  -35.121 30.741 1.00 40.28  ? 240  ARG F NE    1 
ATOM   9093  C CZ    . ARG G 3 41  ? -52.537  -34.804 31.388 1.00 38.60  ? 240  ARG F CZ    1 
ATOM   9094  N NH1   . ARG G 3 41  ? -52.585  -34.162 32.550 1.00 36.82  ? 240  ARG F NH1   1 
ATOM   9095  N NH2   . ARG G 3 41  ? -51.365  -35.136 30.865 1.00 36.48  ? 240  ARG F NH2   1 
ATOM   9096  N N     . GLY G 3 42  ? -58.854  -34.013 27.722 1.00 47.78  ? 241  GLY F N     1 
ATOM   9097  C CA    . GLY G 3 42  ? -60.270  -34.101 28.038 1.00 46.35  ? 241  GLY F CA    1 
ATOM   9098  C C     . GLY G 3 42  ? -60.933  -34.833 26.894 1.00 47.23  ? 241  GLY F C     1 
ATOM   9099  O O     . GLY G 3 42  ? -62.136  -35.118 26.911 1.00 48.45  ? 241  GLY F O     1 
ATOM   9100  N N     . GLY G 3 43  ? -60.119  -35.125 25.885 1.00 55.87  ? 242  GLY F N     1 
ATOM   9101  C CA    . GLY G 3 43  ? -60.590  -35.834 24.718 1.00 57.03  ? 242  GLY F CA    1 
ATOM   9102  C C     . GLY G 3 43  ? -61.327  -34.981 23.709 1.00 58.68  ? 242  GLY F C     1 
ATOM   9103  O O     . GLY G 3 43  ? -62.332  -35.412 23.153 1.00 59.70  ? 242  GLY F O     1 
ATOM   9104  N N     . VAL G 3 44  ? -60.843  -33.772 23.466 1.00 50.52  ? 243  VAL F N     1 
ATOM   9105  C CA    . VAL G 3 44  ? -61.495  -32.906 22.506 1.00 51.14  ? 243  VAL F CA    1 
ATOM   9106  C C     . VAL G 3 44  ? -60.610  -32.792 21.300 1.00 51.65  ? 243  VAL F C     1 
ATOM   9107  O O     . VAL G 3 44  ? -59.407  -32.553 21.423 1.00 51.30  ? 243  VAL F O     1 
ATOM   9108  C CB    . VAL G 3 44  ? -61.711  -31.534 23.062 1.00 45.81  ? 243  VAL F CB    1 
ATOM   9109  C CG1   . VAL G 3 44  ? -62.378  -30.664 22.022 1.00 47.49  ? 243  VAL F CG1   1 
ATOM   9110  C CG2   . VAL G 3 44  ? -62.550  -31.632 24.303 1.00 45.03  ? 243  VAL F CG2   1 
ATOM   9111  N N     . LYS G 3 45  ? -61.234  -32.948 20.138 1.00 55.79  ? 244  LYS F N     1 
ATOM   9112  C CA    . LYS G 3 45  ? -60.572  -32.925 18.845 1.00 55.55  ? 244  LYS F CA    1 
ATOM   9113  C C     . LYS G 3 45  ? -60.641  -31.586 18.117 1.00 54.98  ? 244  LYS F C     1 
ATOM   9114  O O     . LYS G 3 45  ? -59.718  -31.238 17.399 1.00 54.95  ? 244  LYS F O     1 
ATOM   9115  C CB    . LYS G 3 45  ? -61.200  -34.019 17.994 1.00 59.63  ? 244  LYS F CB    1 
ATOM   9116  C CG    . LYS G 3 45  ? -60.786  -34.061 16.556 1.00 61.51  ? 244  LYS F CG    1 
ATOM   9117  C CD    . LYS G 3 45  ? -61.704  -35.012 15.803 1.00 62.69  ? 244  LYS F CD    1 
ATOM   9118  C CE    . LYS G 3 45  ? -61.063  -35.475 14.517 1.00 64.32  ? 244  LYS F CE    1 
ATOM   9119  N NZ    . LYS G 3 45  ? -59.744  -36.071 14.843 1.00 66.12  ? 244  LYS F NZ    1 
ATOM   9120  N N     . ARG G 3 46  ? -61.733  -30.845 18.288 1.00 64.71  ? 245  ARG F N     1 
ATOM   9121  C CA    . ARG G 3 46  ? -61.903  -29.549 17.624 1.00 64.86  ? 245  ARG F CA    1 
ATOM   9122  C C     . ARG G 3 46  ? -62.300  -28.457 18.589 1.00 63.30  ? 245  ARG F C     1 
ATOM   9123  O O     . ARG G 3 46  ? -63.272  -28.601 19.338 1.00 63.57  ? 245  ARG F O     1 
ATOM   9124  C CB    . ARG G 3 46  ? -62.960  -29.628 16.532 1.00 66.69  ? 245  ARG F CB    1 
ATOM   9125  C CG    . ARG G 3 46  ? -62.435  -30.136 15.218 1.00 73.64  ? 245  ARG F CG    1 
ATOM   9126  C CD    . ARG G 3 46  ? -61.767  -29.029 14.465 1.00 73.55  ? 245  ARG F CD    1 
ATOM   9127  N NE    . ARG G 3 46  ? -62.734  -28.030 14.043 1.00 74.79  ? 245  ARG F NE    1 
ATOM   9128  C CZ    . ARG G 3 46  ? -62.986  -27.733 12.776 1.00 74.67  ? 245  ARG F CZ    1 
ATOM   9129  N NH1   . ARG G 3 46  ? -62.336  -28.370 11.808 1.00 76.59  ? 245  ARG F NH1   1 
ATOM   9130  N NH2   . ARG G 3 46  ? -63.870  -26.787 12.485 1.00 73.77  ? 245  ARG F NH2   1 
ATOM   9131  N N     . ILE G 3 47  ? -61.574  -27.343 18.528 1.00 52.59  ? 246  ILE F N     1 
ATOM   9132  C CA    . ILE G 3 47  ? -61.810  -26.238 19.435 1.00 49.65  ? 246  ILE F CA    1 
ATOM   9133  C C     . ILE G 3 47  ? -62.205  -24.917 18.788 1.00 50.59  ? 246  ILE F C     1 
ATOM   9134  O O     . ILE G 3 47  ? -61.471  -24.347 17.977 1.00 48.11  ? 246  ILE F O     1 
ATOM   9135  C CB    . ILE G 3 47  ? -60.552  -26.029 20.325 1.00 54.24  ? 246  ILE F CB    1 
ATOM   9136  C CG1   . ILE G 3 47  ? -60.104  -27.377 20.909 1.00 50.27  ? 246  ILE F CG1   1 
ATOM   9137  C CG2   . ILE G 3 47  ? -60.857  -25.035 21.442 1.00 50.23  ? 246  ILE F CG2   1 
ATOM   9138  C CD1   . ILE G 3 47  ? -58.849  -27.318 21.807 1.00 48.91  ? 246  ILE F CD1   1 
ATOM   9139  N N     . SER G 3 48  ? -63.372  -24.420 19.160 1.00 61.33  ? 247  SER F N     1 
ATOM   9140  C CA    . SER G 3 48  ? -63.850  -23.140 18.648 1.00 63.04  ? 247  SER F CA    1 
ATOM   9141  C C     . SER G 3 48  ? -62.849  -22.043 19.073 1.00 64.45  ? 247  SER F C     1 
ATOM   9142  O O     . SER G 3 48  ? -62.260  -22.095 20.162 1.00 66.95  ? 247  SER F O     1 
ATOM   9143  C CB    . SER G 3 48  ? -65.251  -22.858 19.228 1.00 68.02  ? 247  SER F CB    1 
ATOM   9144  O OG    . SER G 3 48  ? -65.736  -21.572 18.888 1.00 70.29  ? 247  SER F OG    1 
ATOM   9145  N N     . GLY G 3 49  ? -62.652  -21.048 18.220 1.00 51.51  ? 248  GLY F N     1 
ATOM   9146  C CA    . GLY G 3 49  ? -61.722  -19.988 18.563 1.00 49.90  ? 248  GLY F CA    1 
ATOM   9147  C C     . GLY G 3 49  ? -62.095  -19.163 19.785 1.00 50.77  ? 248  GLY F C     1 
ATOM   9148  O O     . GLY G 3 49  ? -61.240  -18.543 20.416 1.00 51.00  ? 248  GLY F O     1 
ATOM   9149  N N     . LEU G 3 50  ? -63.372  -19.144 20.132 1.00 61.33  ? 249  LEU F N     1 
ATOM   9150  C CA    . LEU G 3 50  ? -63.802  -18.373 21.284 1.00 62.42  ? 249  LEU F CA    1 
ATOM   9151  C C     . LEU G 3 50  ? -63.645  -19.124 22.611 1.00 62.07  ? 249  LEU F C     1 
ATOM   9152  O O     . LEU G 3 50  ? -63.880  -18.564 23.681 1.00 62.16  ? 249  LEU F O     1 
ATOM   9153  C CB    . LEU G 3 50  ? -65.255  -17.945 21.085 1.00 67.41  ? 249  LEU F CB    1 
ATOM   9154  C CG    . LEU G 3 50  ? -65.487  -16.926 19.966 1.00 67.45  ? 249  LEU F CG    1 
ATOM   9155  C CD1   . LEU G 3 50  ? -66.976  -16.715 19.733 1.00 68.55  ? 249  LEU F CD1   1 
ATOM   9156  C CD2   . LEU G 3 50  ? -64.817  -15.625 20.354 1.00 66.98  ? 249  LEU F CD2   1 
ATOM   9157  N N     . ILE G 3 51  ? -63.236  -20.385 22.536 1.00 56.33  ? 250  ILE F N     1 
ATOM   9158  C CA    . ILE G 3 51  ? -63.061  -21.227 23.714 1.00 56.09  ? 250  ILE F CA    1 
ATOM   9159  C C     . ILE G 3 51  ? -61.969  -20.749 24.679 1.00 55.80  ? 250  ILE F C     1 
ATOM   9160  O O     . ILE G 3 51  ? -62.164  -20.711 25.894 1.00 54.65  ? 250  ILE F O     1 
ATOM   9161  C CB    . ILE G 3 51  ? -62.745  -22.696 23.267 1.00 39.55  ? 250  ILE F CB    1 
ATOM   9162  C CG1   . ILE G 3 51  ? -64.003  -23.351 22.695 1.00 38.83  ? 250  ILE F CG1   1 
ATOM   9163  C CG2   . ILE G 3 51  ? -62.193  -23.519 24.432 1.00 35.58  ? 250  ILE F CG2   1 
ATOM   9164  C CD1   . ILE G 3 51  ? -65.027  -23.752 23.757 1.00 40.02  ? 250  ILE F CD1   1 
ATOM   9165  N N     . TYR G 3 52  ? -60.817  -20.376 24.136 1.00 40.42  ? 251  TYR F N     1 
ATOM   9166  C CA    . TYR G 3 52  ? -59.670  -19.973 24.970 1.00 39.70  ? 251  TYR F CA    1 
ATOM   9167  C C     . TYR G 3 52  ? -60.102  -18.938 25.975 1.00 40.12  ? 251  TYR F C     1 
ATOM   9168  O O     . TYR G 3 52  ? -59.996  -19.181 27.168 1.00 41.45  ? 251  TYR F O     1 
ATOM   9169  C CB    . TYR G 3 52  ? -58.472  -19.514 24.101 1.00 44.35  ? 251  TYR F CB    1 
ATOM   9170  C CG    . TYR G 3 52  ? -58.214  -20.570 23.082 1.00 47.42  ? 251  TYR F CG    1 
ATOM   9171  C CD1   . TYR G 3 52  ? -58.213  -20.280 21.725 1.00 46.87  ? 251  TYR F CD1   1 
ATOM   9172  C CD2   . TYR G 3 52  ? -57.987  -21.901 23.436 1.00 51.47  ? 251  TYR F CD2   1 
ATOM   9173  C CE1   . TYR G 3 52  ? -58.028  -21.272 20.765 1.00 51.15  ? 251  TYR F CE1   1 
ATOM   9174  C CE2   . TYR G 3 52  ? -57.786  -22.910 22.506 1.00 52.44  ? 251  TYR F CE2   1 
ATOM   9175  C CZ    . TYR G 3 52  ? -57.824  -22.583 21.158 1.00 53.94  ? 251  TYR F CZ    1 
ATOM   9176  O OH    . TYR G 3 52  ? -57.667  -23.563 20.204 1.00 54.41  ? 251  TYR F OH    1 
ATOM   9177  N N     . GLU G 3 53  ? -60.600  -17.788 25.525 1.00 45.63  ? 252  GLU F N     1 
ATOM   9178  C CA    . GLU G 3 53  ? -61.026  -16.758 26.474 1.00 46.93  ? 252  GLU F CA    1 
ATOM   9179  C C     . GLU G 3 53  ? -62.117  -17.306 27.399 1.00 46.70  ? 252  GLU F C     1 
ATOM   9180  O O     . GLU G 3 53  ? -62.090  -17.047 28.609 1.00 46.18  ? 252  GLU F O     1 
ATOM   9181  C CB    . GLU G 3 53  ? -61.539  -15.508 25.751 1.00 66.52  ? 252  GLU F CB    1 
ATOM   9182  C CG    . GLU G 3 53  ? -60.498  -14.405 25.592 1.00 76.05  ? 252  GLU F CG    1 
ATOM   9183  C CD    . GLU G 3 53  ? -59.970  -13.896 26.933 1.00 80.63  ? 252  GLU F CD    1 
ATOM   9184  O OE1   . GLU G 3 53  ? -60.794  -13.466 27.777 1.00 84.39  ? 252  GLU F OE1   1 
ATOM   9185  O OE2   . GLU G 3 53  ? -58.731  -13.922 27.144 1.00 80.71  ? 252  GLU F OE2   1 
ATOM   9186  N N     . GLU G 3 54  ? -63.064  -18.068 26.843 1.00 44.32  ? 253  GLU F N     1 
ATOM   9187  C CA    . GLU G 3 54  ? -64.144  -18.639 27.637 1.00 45.11  ? 253  GLU F CA    1 
ATOM   9188  C C     . GLU G 3 54  ? -63.546  -19.449 28.776 1.00 43.80  ? 253  GLU F C     1 
ATOM   9189  O O     . GLU G 3 54  ? -63.957  -19.333 29.930 1.00 44.24  ? 253  GLU F O     1 
ATOM   9190  C CB    . GLU G 3 54  ? -65.003  -19.546 26.780 1.00 73.27  ? 253  GLU F CB    1 
ATOM   9191  C CG    . GLU G 3 54  ? -66.194  -20.136 27.500 1.00 80.69  ? 253  GLU F CG    1 
ATOM   9192  C CD    . GLU G 3 54  ? -67.326  -19.141 27.662 1.00 84.97  ? 253  GLU F CD    1 
ATOM   9193  O OE1   . GLU G 3 54  ? -67.417  -18.222 26.819 1.00 85.03  ? 253  GLU F OE1   1 
ATOM   9194  O OE2   . GLU G 3 54  ? -68.130  -19.288 28.614 1.00 88.03  ? 253  GLU F OE2   1 
ATOM   9195  N N     . THR G 3 55  ? -62.553  -20.265 28.458 1.00 47.73  ? 254  THR F N     1 
ATOM   9196  C CA    . THR G 3 55  ? -61.920  -21.082 29.476 1.00 46.04  ? 254  THR F CA    1 
ATOM   9197  C C     . THR G 3 55  ? -61.208  -20.292 30.592 1.00 44.35  ? 254  THR F C     1 
ATOM   9198  O O     . THR G 3 55  ? -61.238  -20.676 31.766 1.00 44.64  ? 254  THR F O     1 
ATOM   9199  C CB    . THR G 3 55  ? -60.929  -22.037 28.826 1.00 46.13  ? 254  THR F CB    1 
ATOM   9200  O OG1   . THR G 3 55  ? -61.626  -22.855 27.876 1.00 49.31  ? 254  THR F OG1   1 
ATOM   9201  C CG2   . THR G 3 55  ? -60.273  -22.914 29.897 1.00 46.94  ? 254  THR F CG2   1 
ATOM   9202  N N     . ARG G 3 56  ? -60.554  -19.195 30.231 1.00 43.02  ? 255  ARG F N     1 
ATOM   9203  C CA    . ARG G 3 56  ? -59.853  -18.397 31.227 1.00 42.59  ? 255  ARG F CA    1 
ATOM   9204  C C     . ARG G 3 56  ? -60.881  -17.857 32.209 1.00 41.32  ? 255  ARG F C     1 
ATOM   9205  O O     . ARG G 3 56  ? -60.642  -17.776 33.420 1.00 42.43  ? 255  ARG F O     1 
ATOM   9206  C CB    . ARG G 3 56  ? -59.118  -17.244 30.559 1.00 47.83  ? 255  ARG F CB    1 
ATOM   9207  C CG    . ARG G 3 56  ? -58.242  -17.653 29.385 1.00 49.52  ? 255  ARG F CG    1 
ATOM   9208  C CD    . ARG G 3 56  ? -57.159  -16.614 29.196 1.00 52.17  ? 255  ARG F CD    1 
ATOM   9209  N NE    . ARG G 3 56  ? -56.142  -17.028 28.245 1.00 54.86  ? 255  ARG F NE    1 
ATOM   9210  C CZ    . ARG G 3 56  ? -56.309  -17.001 26.932 1.00 54.44  ? 255  ARG F CZ    1 
ATOM   9211  N NH1   . ARG G 3 56  ? -57.457  -16.574 26.428 1.00 51.46  ? 255  ARG F NH1   1 
ATOM   9212  N NH2   . ARG G 3 56  ? -55.332  -17.406 26.130 1.00 52.86  ? 255  ARG F NH2   1 
ATOM   9213  N N     . GLY G 3 57  ? -62.040  -17.500 31.674 1.00 36.15  ? 256  GLY F N     1 
ATOM   9214  C CA    . GLY G 3 57  ? -63.087  -16.981 32.522 1.00 36.01  ? 256  GLY F CA    1 
ATOM   9215  C C     . GLY G 3 57  ? -63.483  -18.036 33.519 1.00 36.47  ? 256  GLY F C     1 
ATOM   9216  O O     . GLY G 3 57  ? -63.556  -17.768 34.721 1.00 36.19  ? 256  GLY F O     1 
ATOM   9217  N N     . VAL G 3 58  ? -63.727  -19.247 33.025 1.00 37.28  ? 257  VAL F N     1 
ATOM   9218  C CA    . VAL G 3 58  ? -64.136  -20.322 33.905 1.00 39.87  ? 257  VAL F CA    1 
ATOM   9219  C C     . VAL G 3 58  ? -63.030  -20.653 34.885 1.00 43.63  ? 257  VAL F C     1 
ATOM   9220  O O     . VAL G 3 58  ? -63.278  -20.804 36.090 1.00 45.42  ? 257  VAL F O     1 
ATOM   9221  C CB    . VAL G 3 58  ? -64.537  -21.567 33.111 1.00 41.27  ? 257  VAL F CB    1 
ATOM   9222  C CG1   . VAL G 3 58  ? -64.500  -22.814 34.011 1.00 44.52  ? 257  VAL F CG1   1 
ATOM   9223  C CG2   . VAL G 3 58  ? -65.930  -21.372 32.555 1.00 41.11  ? 257  VAL F CG2   1 
ATOM   9224  N N     . LEU G 3 59  ? -61.805  -20.747 34.388 1.00 47.37  ? 258  LEU F N     1 
ATOM   9225  C CA    . LEU G 3 59  ? -60.699  -21.039 35.280 1.00 48.85  ? 258  LEU F CA    1 
ATOM   9226  C C     . LEU G 3 59  ? -60.636  -19.982 36.392 1.00 50.55  ? 258  LEU F C     1 
ATOM   9227  O O     . LEU G 3 59  ? -60.638  -20.327 37.579 1.00 50.97  ? 258  LEU F O     1 
ATOM   9228  C CB    . LEU G 3 59  ? -59.392  -21.072 34.504 1.00 39.19  ? 258  LEU F CB    1 
ATOM   9229  C CG    . LEU G 3 59  ? -58.162  -21.285 35.384 1.00 39.49  ? 258  LEU F CG    1 
ATOM   9230  C CD1   . LEU G 3 59  ? -58.437  -22.418 36.368 1.00 35.01  ? 258  LEU F CD1   1 
ATOM   9231  C CD2   . LEU G 3 59  ? -56.923  -21.541 34.480 1.00 40.21  ? 258  LEU F CD2   1 
ATOM   9232  N N     . LYS G 3 60  ? -60.599  -18.704 36.002 1.00 43.23  ? 259  LYS F N     1 
ATOM   9233  C CA    . LYS G 3 60  ? -60.548  -17.597 36.957 1.00 41.93  ? 259  LYS F CA    1 
ATOM   9234  C C     . LYS G 3 60  ? -61.597  -17.697 38.071 1.00 39.67  ? 259  LYS F C     1 
ATOM   9235  O O     . LYS G 3 60  ? -61.287  -17.416 39.227 1.00 37.19  ? 259  LYS F O     1 
ATOM   9236  C CB    . LYS G 3 60  ? -60.713  -16.265 36.229 1.00 49.43  ? 259  LYS F CB    1 
ATOM   9237  C CG    . LYS G 3 60  ? -60.677  -15.034 37.121 1.00 52.20  ? 259  LYS F CG    1 
ATOM   9238  C CD    . LYS G 3 60  ? -59.594  -14.079 36.639 1.00 57.99  ? 259  LYS F CD    1 
ATOM   9239  C CE    . LYS G 3 60  ? -59.517  -12.824 37.489 1.00 60.79  ? 259  LYS F CE    1 
ATOM   9240  N NZ    . LYS G 3 60  ? -60.823  -12.092 37.514 1.00 61.91  ? 259  LYS F NZ    1 
ATOM   9241  N N     . VAL G 3 61  ? -62.829  -18.086 37.740 1.00 38.83  ? 260  VAL F N     1 
ATOM   9242  C CA    . VAL G 3 61  ? -63.875  -18.203 38.770 1.00 37.98  ? 260  VAL F CA    1 
ATOM   9243  C C     . VAL G 3 61  ? -63.522  -19.337 39.737 1.00 37.52  ? 260  VAL F C     1 
ATOM   9244  O O     . VAL G 3 61  ? -63.539  -19.156 40.957 1.00 36.47  ? 260  VAL F O     1 
ATOM   9245  C CB    . VAL G 3 61  ? -65.282  -18.497 38.163 1.00 28.34  ? 260  VAL F CB    1 
ATOM   9246  C CG1   . VAL G 3 61  ? -66.302  -18.743 39.297 1.00 24.22  ? 260  VAL F CG1   1 
ATOM   9247  C CG2   . VAL G 3 61  ? -65.719  -17.359 37.282 1.00 23.53  ? 260  VAL F CG2   1 
ATOM   9248  N N     . PHE G 3 62  ? -63.201  -20.496 39.173 1.00 27.68  ? 261  PHE F N     1 
ATOM   9249  C CA    . PHE G 3 62  ? -62.805  -21.650 39.969 1.00 27.94  ? 261  PHE F CA    1 
ATOM   9250  C C     . PHE G 3 62  ? -61.717  -21.260 40.964 1.00 27.99  ? 261  PHE F C     1 
ATOM   9251  O O     . PHE G 3 62  ? -61.849  -21.500 42.160 1.00 29.39  ? 261  PHE F O     1 
ATOM   9252  C CB    . PHE G 3 62  ? -62.278  -22.749 39.061 1.00 48.10  ? 261  PHE F CB    1 
ATOM   9253  C CG    . PHE G 3 62  ? -61.811  -23.963 39.793 1.00 48.03  ? 261  PHE F CG    1 
ATOM   9254  C CD1   . PHE G 3 62  ? -62.694  -24.993 40.075 1.00 46.29  ? 261  PHE F CD1   1 
ATOM   9255  C CD2   . PHE G 3 62  ? -60.475  -24.078 40.198 1.00 47.94  ? 261  PHE F CD2   1 
ATOM   9256  C CE1   . PHE G 3 62  ? -62.266  -26.120 40.741 1.00 47.58  ? 261  PHE F CE1   1 
ATOM   9257  C CE2   . PHE G 3 62  ? -60.039  -25.198 40.863 1.00 48.67  ? 261  PHE F CE2   1 
ATOM   9258  C CZ    . PHE G 3 62  ? -60.936  -26.224 41.138 1.00 49.30  ? 261  PHE F CZ    1 
ATOM   9259  N N     . LEU G 3 63  ? -60.638  -20.653 40.484 1.00 40.50  ? 262  LEU F N     1 
ATOM   9260  C CA    . LEU G 3 63  ? -59.588  -20.235 41.403 1.00 40.22  ? 262  LEU F CA    1 
ATOM   9261  C C     . LEU G 3 63  ? -60.013  -19.194 42.461 1.00 43.24  ? 262  LEU F C     1 
ATOM   9262  O O     . LEU G 3 63  ? -59.667  -19.326 43.640 1.00 43.25  ? 262  LEU F O     1 
ATOM   9263  C CB    . LEU G 3 63  ? -58.378  -19.714 40.637 1.00 45.65  ? 262  LEU F CB    1 
ATOM   9264  C CG    . LEU G 3 63  ? -57.525  -20.814 40.010 1.00 43.60  ? 262  LEU F CG    1 
ATOM   9265  C CD1   . LEU G 3 63  ? -56.316  -20.167 39.343 1.00 43.02  ? 262  LEU F CD1   1 
ATOM   9266  C CD2   . LEU G 3 63  ? -57.077  -21.826 41.068 1.00 44.40  ? 262  LEU F CD2   1 
ATOM   9267  N N     . GLU G 3 64  ? -60.750  -18.157 42.074 1.00 53.47  ? 263  GLU F N     1 
ATOM   9268  C CA    . GLU G 3 64  ? -61.123  -17.177 43.082 1.00 55.59  ? 263  GLU F CA    1 
ATOM   9269  C C     . GLU G 3 64  ? -61.921  -17.867 44.163 1.00 54.22  ? 263  GLU F C     1 
ATOM   9270  O O     . GLU G 3 64  ? -61.791  -17.532 45.341 1.00 54.03  ? 263  GLU F O     1 
ATOM   9271  C CB    . GLU G 3 64  ? -61.928  -16.042 42.476 1.00 40.95  ? 263  GLU F CB    1 
ATOM   9272  C CG    . GLU G 3 64  ? -61.213  -15.370 41.353 1.00 52.65  ? 263  GLU F CG    1 
ATOM   9273  C CD    . GLU G 3 64  ? -62.078  -14.360 40.623 1.00 59.30  ? 263  GLU F CD    1 
ATOM   9274  O OE1   . GLU G 3 64  ? -63.330  -14.493 40.646 1.00 61.06  ? 263  GLU F OE1   1 
ATOM   9275  O OE2   . GLU G 3 64  ? -61.485  -13.446 40.006 1.00 61.34  ? 263  GLU F OE2   1 
ATOM   9276  N N     . ASN G 3 65  ? -62.723  -18.851 43.767 1.00 56.97  ? 264  ASN F N     1 
ATOM   9277  C CA    . ASN G 3 65  ? -63.528  -19.582 44.736 1.00 56.14  ? 264  ASN F CA    1 
ATOM   9278  C C     . ASN G 3 65  ? -62.684  -20.439 45.669 1.00 54.67  ? 264  ASN F C     1 
ATOM   9279  O O     . ASN G 3 65  ? -62.769  -20.296 46.894 1.00 51.92  ? 264  ASN F O     1 
ATOM   9280  C CB    . ASN G 3 65  ? -64.580  -20.446 44.036 1.00 53.96  ? 264  ASN F CB    1 
ATOM   9281  C CG    . ASN G 3 65  ? -65.762  -19.624 43.532 1.00 55.22  ? 264  ASN F CG    1 
ATOM   9282  O OD1   . ASN G 3 65  ? -66.354  -18.852 44.277 1.00 61.32  ? 264  ASN F OD1   1 
ATOM   9283  N ND2   . ASN G 3 65  ? -66.110  -19.793 42.264 1.00 60.42  ? 264  ASN F ND2   1 
ATOM   9284  N N     . VAL G 3 66  ? -61.857  -21.314 45.117 1.00 40.54  ? 265  VAL F N     1 
ATOM   9285  C CA    . VAL G 3 66  ? -61.037  -22.146 45.985 1.00 41.29  ? 265  VAL F CA    1 
ATOM   9286  C C     . VAL G 3 66  ? -60.118  -21.289 46.877 1.00 43.71  ? 265  VAL F C     1 
ATOM   9287  O O     . VAL G 3 66  ? -59.938  -21.569 48.068 1.00 45.64  ? 265  VAL F O     1 
ATOM   9288  C CB    . VAL G 3 66  ? -60.146  -23.138 45.174 1.00 41.85  ? 265  VAL F CB    1 
ATOM   9289  C CG1   . VAL G 3 66  ? -59.373  -24.027 46.126 1.00 41.19  ? 265  VAL F CG1   1 
ATOM   9290  C CG2   . VAL G 3 66  ? -60.994  -23.999 44.281 1.00 40.57  ? 265  VAL F CG2   1 
ATOM   9291  N N     . ILE G 3 67  ? -59.545  -20.234 46.298 1.00 42.42  ? 266  ILE F N     1 
ATOM   9292  C CA    . ILE G 3 67  ? -58.623  -19.389 47.024 1.00 40.11  ? 266  ILE F CA    1 
ATOM   9293  C C     . ILE G 3 67  ? -59.325  -18.564 48.109 1.00 41.39  ? 266  ILE F C     1 
ATOM   9294  O O     . ILE G 3 67  ? -58.820  -18.452 49.239 1.00 42.40  ? 266  ILE F O     1 
ATOM   9295  C CB    . ILE G 3 67  ? -57.827  -18.541 46.023 1.00 39.96  ? 266  ILE F CB    1 
ATOM   9296  C CG1   . ILE G 3 67  ? -56.995  -19.478 45.146 1.00 41.59  ? 266  ILE F CG1   1 
ATOM   9297  C CG2   . ILE G 3 67  ? -56.863  -17.614 46.742 1.00 38.78  ? 266  ILE F CG2   1 
ATOM   9298  C CD1   . ILE G 3 67  ? -56.156  -18.784 44.042 1.00 41.78  ? 266  ILE F CD1   1 
ATOM   9299  N N     . ARG G 3 68  ? -60.493  -18.012 47.793 1.00 40.88  ? 267  ARG F N     1 
ATOM   9300  C CA    . ARG G 3 68  ? -61.228  -17.247 48.794 1.00 41.42  ? 267  ARG F CA    1 
ATOM   9301  C C     . ARG G 3 68  ? -61.479  -18.096 50.056 1.00 42.56  ? 267  ARG F C     1 
ATOM   9302  O O     . ARG G 3 68  ? -61.322  -17.604 51.186 1.00 40.41  ? 267  ARG F O     1 
ATOM   9303  C CB    . ARG G 3 68  ? -62.556  -16.781 48.236 1.00 47.46  ? 267  ARG F CB    1 
ATOM   9304  C CG    . ARG G 3 68  ? -63.464  -16.117 49.258 1.00 52.63  ? 267  ARG F CG    1 
ATOM   9305  C CD    . ARG G 3 68  ? -64.853  -15.910 48.654 1.00 59.73  ? 267  ARG F CD    1 
ATOM   9306  N NE    . ARG G 3 68  ? -64.758  -15.117 47.428 1.00 66.51  ? 267  ARG F NE    1 
ATOM   9307  C CZ    . ARG G 3 68  ? -65.191  -15.514 46.234 1.00 69.36  ? 267  ARG F CZ    1 
ATOM   9308  N NH1   . ARG G 3 68  ? -65.763  -16.704 46.100 1.00 71.31  ? 267  ARG F NH1   1 
ATOM   9309  N NH2   . ARG G 3 68  ? -65.033  -14.727 45.174 1.00 69.69  ? 267  ARG F NH2   1 
ATOM   9310  N N     . ASP G 3 69  ? -61.868  -19.360 49.873 1.00 41.12  ? 268  ASP F N     1 
ATOM   9311  C CA    . ASP G 3 69  ? -62.103  -20.214 51.025 1.00 42.49  ? 268  ASP F CA    1 
ATOM   9312  C C     . ASP G 3 69  ? -60.794  -20.570 51.712 1.00 41.92  ? 268  ASP F C     1 
ATOM   9313  O O     . ASP G 3 69  ? -60.679  -20.443 52.944 1.00 41.83  ? 268  ASP F O     1 
ATOM   9314  C CB    . ASP G 3 69  ? -62.816  -21.505 50.645 1.00 55.74  ? 268  ASP F CB    1 
ATOM   9315  C CG    . ASP G 3 69  ? -64.284  -21.308 50.382 1.00 59.69  ? 268  ASP F CG    1 
ATOM   9316  O OD1   . ASP G 3 69  ? -64.844  -20.296 50.854 1.00 62.07  ? 268  ASP F OD1   1 
ATOM   9317  O OD2   . ASP G 3 69  ? -64.878  -22.185 49.708 1.00 64.16  ? 268  ASP F OD2   1 
ATOM   9318  N N     . ALA G 3 70  ? -59.809  -21.016 50.931 1.00 46.19  ? 269  ALA F N     1 
ATOM   9319  C CA    . ALA G 3 70  ? -58.509  -21.384 51.503 1.00 45.40  ? 269  ALA F CA    1 
ATOM   9320  C C     . ALA G 3 70  ? -57.997  -20.278 52.425 1.00 45.60  ? 269  ALA F C     1 
ATOM   9321  O O     . ALA G 3 70  ? -57.727  -20.520 53.601 1.00 46.91  ? 269  ALA F O     1 
ATOM   9322  C CB    . ALA G 3 70  ? -57.494  -21.644 50.398 1.00 31.88  ? 269  ALA F CB    1 
ATOM   9323  N N     . VAL G 3 71  ? -57.888  -19.064 51.882 1.00 46.90  ? 270  VAL F N     1 
ATOM   9324  C CA    . VAL G 3 71  ? -57.413  -17.923 52.642 1.00 45.21  ? 270  VAL F CA    1 
ATOM   9325  C C     . VAL G 3 71  ? -58.252  -17.645 53.896 1.00 47.27  ? 270  VAL F C     1 
ATOM   9326  O O     . VAL G 3 71  ? -57.710  -17.220 54.934 1.00 49.29  ? 270  VAL F O     1 
ATOM   9327  C CB    . VAL G 3 71  ? -57.342  -16.677 51.757 1.00 38.93  ? 270  VAL F CB    1 
ATOM   9328  C CG1   . VAL G 3 71  ? -57.021  -15.436 52.616 1.00 35.73  ? 270  VAL F CG1   1 
ATOM   9329  C CG2   . VAL G 3 71  ? -56.259  -16.893 50.686 1.00 35.61  ? 270  VAL F CG2   1 
ATOM   9330  N N     . THR G 3 72  ? -59.562  -17.877 53.810 1.00 43.18  ? 271  THR F N     1 
ATOM   9331  C CA    . THR G 3 72  ? -60.401  -17.700 54.986 1.00 43.42  ? 271  THR F CA    1 
ATOM   9332  C C     . THR G 3 72  ? -59.880  -18.645 56.052 1.00 45.07  ? 271  THR F C     1 
ATOM   9333  O O     . THR G 3 72  ? -59.784  -18.267 57.212 1.00 45.53  ? 271  THR F O     1 
ATOM   9334  C CB    . THR G 3 72  ? -61.832  -18.040 54.690 1.00 37.04  ? 271  THR F CB    1 
ATOM   9335  O OG1   . THR G 3 72  ? -62.315  -17.097 53.748 1.00 38.47  ? 271  THR F OG1   1 
ATOM   9336  C CG2   . THR G 3 72  ? -62.695  -17.962 55.934 1.00 31.96  ? 271  THR F CG2   1 
ATOM   9337  N N     . TYR G 3 73  ? -59.552  -19.877 55.656 1.00 35.16  ? 272  TYR F N     1 
ATOM   9338  C CA    . TYR G 3 73  ? -59.010  -20.834 56.595 1.00 38.36  ? 272  TYR F CA    1 
ATOM   9339  C C     . TYR G 3 73  ? -57.694  -20.250 57.098 1.00 41.40  ? 272  TYR F C     1 
ATOM   9340  O O     . TYR G 3 73  ? -57.470  -20.180 58.303 1.00 43.17  ? 272  TYR F O     1 
ATOM   9341  C CB    . TYR G 3 73  ? -58.794  -22.207 55.932 1.00 38.85  ? 272  TYR F CB    1 
ATOM   9342  C CG    . TYR G 3 73  ? -60.054  -23.042 55.856 1.00 40.30  ? 272  TYR F CG    1 
ATOM   9343  C CD1   . TYR G 3 73  ? -60.543  -23.504 54.631 1.00 40.79  ? 272  TYR F CD1   1 
ATOM   9344  C CD2   . TYR G 3 73  ? -60.781  -23.331 57.003 1.00 40.93  ? 272  TYR F CD2   1 
ATOM   9345  C CE1   . TYR G 3 73  ? -61.731  -24.218 54.560 1.00 41.32  ? 272  TYR F CE1   1 
ATOM   9346  C CE2   . TYR G 3 73  ? -61.966  -24.046 56.940 1.00 43.79  ? 272  TYR F CE2   1 
ATOM   9347  C CZ    . TYR G 3 73  ? -62.436  -24.482 55.723 1.00 43.45  ? 272  TYR F CZ    1 
ATOM   9348  O OH    . TYR G 3 73  ? -63.646  -25.135 55.708 1.00 45.96  ? 272  TYR F OH    1 
ATOM   9349  N N     . THR G 3 74  ? -56.834  -19.810 56.184 1.00 47.04  ? 273  THR F N     1 
ATOM   9350  C CA    . THR G 3 74  ? -55.563  -19.217 56.588 1.00 49.79  ? 273  THR F CA    1 
ATOM   9351  C C     . THR G 3 74  ? -55.789  -18.112 57.622 1.00 51.57  ? 273  THR F C     1 
ATOM   9352  O O     . THR G 3 74  ? -55.218  -18.140 58.720 1.00 51.91  ? 273  THR F O     1 
ATOM   9353  C CB    . THR G 3 74  ? -54.817  -18.591 55.402 1.00 50.74  ? 273  THR F CB    1 
ATOM   9354  O OG1   . THR G 3 74  ? -54.674  -19.557 54.352 1.00 50.92  ? 273  THR F OG1   1 
ATOM   9355  C CG2   . THR G 3 74  ? -53.428  -18.112 55.855 1.00 49.81  ? 273  THR F CG2   1 
ATOM   9356  N N     . GLU G 3 75  ? -56.618  -17.134 57.270 1.00 46.04  ? 274  GLU F N     1 
ATOM   9357  C CA    . GLU G 3 75  ? -56.906  -16.059 58.210 1.00 49.73  ? 274  GLU F CA    1 
ATOM   9358  C C     . GLU G 3 75  ? -57.545  -16.566 59.501 1.00 50.26  ? 274  GLU F C     1 
ATOM   9359  O O     . GLU G 3 75  ? -57.240  -16.076 60.565 1.00 49.75  ? 274  GLU F O     1 
ATOM   9360  C CB    . GLU G 3 75  ? -57.810  -14.988 57.592 1.00 79.73  ? 274  GLU F CB    1 
ATOM   9361  C CG    . GLU G 3 75  ? -57.104  -14.097 56.591 1.00 87.35  ? 274  GLU F CG    1 
ATOM   9362  C CD    . GLU G 3 75  ? -57.951  -12.917 56.157 1.00 93.25  ? 274  GLU F CD    1 
ATOM   9363  O OE1   . GLU G 3 75  ? -59.052  -13.137 55.598 1.00 93.79  ? 274  GLU F OE1   1 
ATOM   9364  O OE2   . GLU G 3 75  ? -57.509  -11.767 56.380 1.00 96.30  ? 274  GLU F OE2   1 
ATOM   9365  N N     . HIS G 3 76  ? -58.427  -17.544 59.432 1.00 60.59  ? 275  HIS F N     1 
ATOM   9366  C CA    . HIS G 3 76  ? -59.014  -17.987 60.664 1.00 60.16  ? 275  HIS F CA    1 
ATOM   9367  C C     . HIS G 3 76  ? -57.954  -18.440 61.667 1.00 59.00  ? 275  HIS F C     1 
ATOM   9368  O O     . HIS G 3 76  ? -58.097  -18.222 62.878 1.00 58.54  ? 275  HIS F O     1 
ATOM   9369  C CB    . HIS G 3 76  ? -60.024  -19.137 60.404 1.00 54.19  ? 275  HIS F CB    1 
ATOM   9370  C CG    . HIS G 3 76  ? -60.612  -19.578 61.759 1.00 54.81  ? 275  HIS F CG    1 
ATOM   9371  N ND1   . HIS G 3 76  ? -61.691  -18.942 62.323 1.00 54.33  ? 275  HIS F ND1   1 
ATOM   9372  C CD2   . HIS G 3 76  ? -60.207  -20.502 62.674 1.00 54.39  ? 275  HIS F CD2   1 
ATOM   9373  C CE1   . HIS G 3 76  ? -61.932  -19.447 63.526 1.00 55.37  ? 275  HIS F CE1   1 
ATOM   9374  N NE2   . HIS G 3 76  ? -61.049  -20.390 63.757 1.00 55.24  ? 275  HIS F NE2   1 
ATOM   9375  N N     . ALA G 3 77  ? -56.904  -19.062 61.155 1.00 65.95  ? 276  ALA F N     1 
ATOM   9376  C CA    . ALA G 3 77  ? -55.847  -19.569 61.997 1.00 65.42  ? 276  ALA F CA    1 
ATOM   9377  C C     . ALA G 3 77  ? -54.788  -18.517 62.240 1.00 66.28  ? 276  ALA F C     1 
ATOM   9378  O O     . ALA G 3 77  ? -53.665  -18.851 62.628 1.00 64.71  ? 276  ALA F O     1 
ATOM   9379  C CB    . ALA G 3 77  ? -55.227  -20.766 61.350 1.00 47.23  ? 276  ALA F CB    1 
ATOM   9380  N N     . LYS G 3 78  ? -55.142  -17.250 62.017 1.00 65.83  ? 277  LYS F N     1 
ATOM   9381  C CA    . LYS G 3 78  ? -54.205  -16.132 62.191 1.00 66.70  ? 277  LYS F CA    1 
ATOM   9382  C C     . LYS G 3 78  ? -52.835  -16.579 61.703 1.00 65.59  ? 277  LYS F C     1 
ATOM   9383  O O     . LYS G 3 78  ? -51.928  -16.760 62.493 1.00 67.02  ? 277  LYS F O     1 
ATOM   9384  C CB    . LYS G 3 78  ? -54.081  -15.733 63.660 1.00 78.19  ? 277  LYS F CB    1 
ATOM   9385  C CG    . LYS G 3 78  ? -55.381  -15.475 64.389 1.00 81.40  ? 277  LYS F CG    1 
ATOM   9386  C CD    . LYS G 3 78  ? -55.088  -15.379 65.882 1.00 83.90  ? 277  LYS F CD    1 
ATOM   9387  C CE    . LYS G 3 78  ? -56.338  -15.407 66.738 1.00 85.91  ? 277  LYS F CE    1 
ATOM   9388  N NZ    . LYS G 3 78  ? -55.964  -15.643 68.161 1.00 88.92  ? 277  LYS F NZ    1 
ATOM   9389  N N     . ARG G 3 79  ? -52.698  -16.777 60.404 1.00 49.51  ? 278  ARG F N     1 
ATOM   9390  C CA    . ARG G 3 79  ? -51.445  -17.224 59.829 1.00 48.23  ? 278  ARG F CA    1 
ATOM   9391  C C     . ARG G 3 79  ? -51.227  -16.371 58.589 1.00 48.06  ? 278  ARG F C     1 
ATOM   9392  O O     . ARG G 3 79  ? -52.190  -15.879 57.994 1.00 47.17  ? 278  ARG F O     1 
ATOM   9393  C CB    . ARG G 3 79  ? -51.568  -18.686 59.431 1.00 50.30  ? 278  ARG F CB    1 
ATOM   9394  C CG    . ARG G 3 79  ? -50.496  -19.585 59.986 1.00 49.90  ? 278  ARG F CG    1 
ATOM   9395  C CD    . ARG G 3 79  ? -50.529  -20.961 59.335 1.00 51.28  ? 278  ARG F CD    1 
ATOM   9396  N NE    . ARG G 3 79  ? -51.838  -21.582 59.512 1.00 56.25  ? 278  ARG F NE    1 
ATOM   9397  C CZ    . ARG G 3 79  ? -52.591  -22.040 58.518 1.00 57.31  ? 278  ARG F CZ    1 
ATOM   9398  N NH1   . ARG G 3 79  ? -52.166  -21.956 57.257 1.00 56.75  ? 278  ARG F NH1   1 
ATOM   9399  N NH2   . ARG G 3 79  ? -53.777  -22.557 58.795 1.00 57.19  ? 278  ARG F NH2   1 
ATOM   9400  N N     . LYS G 3 80  ? -49.980  -16.176 58.188 1.00 60.56  ? 279  LYS F N     1 
ATOM   9401  C CA    . LYS G 3 80  ? -49.726  -15.355 57.010 1.00 61.50  ? 279  LYS F CA    1 
ATOM   9402  C C     . LYS G 3 80  ? -49.428  -16.235 55.811 1.00 61.98  ? 279  LYS F C     1 
ATOM   9403  O O     . LYS G 3 80  ? -49.277  -15.741 54.688 1.00 62.88  ? 279  LYS F O     1 
ATOM   9404  C CB    . LYS G 3 80  ? -48.551  -14.407 57.258 1.00 71.34  ? 279  LYS F CB    1 
ATOM   9405  C CG    . LYS G 3 80  ? -48.801  -13.368 58.335 1.00 72.62  ? 279  LYS F CG    1 
ATOM   9406  C CD    . LYS G 3 80  ? -47.857  -12.188 58.174 1.00 76.59  ? 279  LYS F CD    1 
ATOM   9407  C CE    . LYS G 3 80  ? -47.925  -11.637 56.742 1.00 78.83  ? 279  LYS F CE    1 
ATOM   9408  N NZ    . LYS G 3 80  ? -47.001  -10.489 56.464 1.00 78.61  ? 279  LYS F NZ    1 
ATOM   9409  N N     . THR G 3 81  ? -49.360  -17.544 56.058 1.00 71.03  ? 280  THR F N     1 
ATOM   9410  C CA    . THR G 3 81  ? -49.060  -18.518 55.012 1.00 70.30  ? 280  THR F CA    1 
ATOM   9411  C C     . THR G 3 81  ? -50.218  -19.427 54.623 1.00 69.38  ? 280  THR F C     1 
ATOM   9412  O O     . THR G 3 81  ? -50.892  -20.002 55.479 1.00 69.87  ? 280  THR F O     1 
ATOM   9413  C CB    . THR G 3 81  ? -47.895  -19.432 55.424 1.00 80.05  ? 280  THR F CB    1 
ATOM   9414  O OG1   . THR G 3 81  ? -46.781  -18.630 55.835 1.00 81.56  ? 280  THR F OG1   1 
ATOM   9415  C CG2   . THR G 3 81  ? -47.475  -20.323 54.256 1.00 78.37  ? 280  THR F CG2   1 
ATOM   9416  N N     . VAL G 3 82  ? -50.437  -19.548 53.319 1.00 51.18  ? 281  VAL F N     1 
ATOM   9417  C CA    . VAL G 3 82  ? -51.467  -20.428 52.785 1.00 48.56  ? 281  VAL F CA    1 
ATOM   9418  C C     . VAL G 3 82  ? -50.831  -21.818 52.634 1.00 45.26  ? 281  VAL F C     1 
ATOM   9419  O O     . VAL G 3 82  ? -49.918  -22.023 51.826 1.00 44.55  ? 281  VAL F O     1 
ATOM   9420  C CB    . VAL G 3 82  ? -51.985  -19.959 51.391 1.00 37.24  ? 281  VAL F CB    1 
ATOM   9421  C CG1   . VAL G 3 82  ? -52.860  -21.062 50.783 1.00 36.33  ? 281  VAL F CG1   1 
ATOM   9422  C CG2   . VAL G 3 82  ? -52.783  -18.650 51.522 1.00 38.26  ? 281  VAL F CG2   1 
ATOM   9423  N N     . THR G 3 83  ? -51.314  -22.759 53.434 1.00 39.83  ? 282  THR F N     1 
ATOM   9424  C CA    . THR G 3 83  ? -50.816  -24.127 53.424 1.00 37.37  ? 282  THR F CA    1 
ATOM   9425  C C     . THR G 3 83  ? -51.652  -25.013 52.533 1.00 36.97  ? 282  THR F C     1 
ATOM   9426  O O     . THR G 3 83  ? -52.832  -24.734 52.277 1.00 34.15  ? 282  THR F O     1 
ATOM   9427  C CB    . THR G 3 83  ? -50.898  -24.761 54.790 1.00 31.57  ? 282  THR F CB    1 
ATOM   9428  O OG1   . THR G 3 83  ? -52.277  -24.989 55.111 1.00 32.98  ? 282  THR F OG1   1 
ATOM   9429  C CG2   . THR G 3 83  ? -50.283  -23.857 55.824 1.00 30.96  ? 282  THR F CG2   1 
ATOM   9430  N N     . ALA G 3 84  ? -51.051  -26.111 52.099 1.00 50.89  ? 283  ALA F N     1 
ATOM   9431  C CA    . ALA G 3 84  ? -51.765  -27.029 51.244 1.00 52.56  ? 283  ALA F CA    1 
ATOM   9432  C C     . ALA G 3 84  ? -53.031  -27.543 51.949 1.00 54.17  ? 283  ALA F C     1 
ATOM   9433  O O     . ALA G 3 84  ? -54.038  -27.856 51.293 1.00 55.18  ? 283  ALA F O     1 
ATOM   9434  C CB    . ALA G 3 84  ? -50.866  -28.161 50.853 1.00 15.08  ? 283  ALA F CB    1 
ATOM   9435  N N     . MET G 3 85  ? -52.997  -27.622 53.279 1.00 41.58  ? 284  MET F N     1 
ATOM   9436  C CA    . MET G 3 85  ? -54.191  -28.070 53.977 1.00 43.52  ? 284  MET F CA    1 
ATOM   9437  C C     . MET G 3 85  ? -55.292  -27.046 53.806 1.00 42.05  ? 284  MET F C     1 
ATOM   9438  O O     . MET G 3 85  ? -56.456  -27.411 53.699 1.00 40.17  ? 284  MET F O     1 
ATOM   9439  C CB    . MET G 3 85  ? -53.935  -28.320 55.460 1.00 51.72  ? 284  MET F CB    1 
ATOM   9440  C CG    . MET G 3 85  ? -53.288  -29.662 55.727 1.00 61.29  ? 284  MET F CG    1 
ATOM   9441  S SD    . MET G 3 85  ? -54.127  -31.050 54.884 1.00 70.10  ? 284  MET F SD    1 
ATOM   9442  C CE    . MET G 3 85  ? -55.330  -31.520 56.131 1.00 67.63  ? 284  MET F CE    1 
ATOM   9443  N N     . ASP G 3 86  ? -54.931  -25.766 53.762 1.00 42.98  ? 285  ASP F N     1 
ATOM   9444  C CA    . ASP G 3 86  ? -55.938  -24.742 53.585 1.00 42.47  ? 285  ASP F CA    1 
ATOM   9445  C C     . ASP G 3 86  ? -56.594  -25.038 52.243 1.00 40.95  ? 285  ASP F C     1 
ATOM   9446  O O     . ASP G 3 86  ? -57.826  -25.106 52.128 1.00 41.69  ? 285  ASP F O     1 
ATOM   9447  C CB    . ASP G 3 86  ? -55.301  -23.353 53.595 1.00 60.59  ? 285  ASP F CB    1 
ATOM   9448  C CG    . ASP G 3 86  ? -54.739  -22.973 54.967 1.00 63.16  ? 285  ASP F CG    1 
ATOM   9449  O OD1   . ASP G 3 86  ? -55.386  -23.271 55.999 1.00 63.95  ? 285  ASP F OD1   1 
ATOM   9450  O OD2   . ASP G 3 86  ? -53.653  -22.359 55.016 1.00 65.82  ? 285  ASP F OD2   1 
ATOM   9451  N N     . VAL G 3 87  ? -55.777  -25.239 51.220 1.00 37.41  ? 286  VAL F N     1 
ATOM   9452  C CA    . VAL G 3 87  ? -56.331  -25.552 49.919 1.00 35.40  ? 286  VAL F CA    1 
ATOM   9453  C C     . VAL G 3 87  ? -57.127  -26.873 49.965 1.00 36.98  ? 286  VAL F C     1 
ATOM   9454  O O     . VAL G 3 87  ? -58.220  -26.952 49.407 1.00 36.86  ? 286  VAL F O     1 
ATOM   9455  C CB    . VAL G 3 87  ? -55.209  -25.660 48.856 1.00 48.31  ? 286  VAL F CB    1 
ATOM   9456  C CG1   . VAL G 3 87  ? -55.758  -26.190 47.523 1.00 46.39  ? 286  VAL F CG1   1 
ATOM   9457  C CG2   . VAL G 3 87  ? -54.587  -24.307 48.661 1.00 49.15  ? 286  VAL F CG2   1 
ATOM   9458  N N     . VAL G 3 88  ? -56.589  -27.903 50.627 1.00 42.88  ? 287  VAL F N     1 
ATOM   9459  C CA    . VAL G 3 88  ? -57.284  -29.193 50.685 1.00 45.46  ? 287  VAL F CA    1 
ATOM   9460  C C     . VAL G 3 88  ? -58.650  -29.046 51.340 1.00 47.44  ? 287  VAL F C     1 
ATOM   9461  O O     . VAL G 3 88  ? -59.642  -29.601 50.871 1.00 46.13  ? 287  VAL F O     1 
ATOM   9462  C CB    . VAL G 3 88  ? -56.460  -30.287 51.452 1.00 41.50  ? 287  VAL F CB    1 
ATOM   9463  C CG1   . VAL G 3 88  ? -57.308  -31.536 51.655 1.00 42.48  ? 287  VAL F CG1   1 
ATOM   9464  C CG2   . VAL G 3 88  ? -55.221  -30.659 50.661 1.00 41.70  ? 287  VAL F CG2   1 
ATOM   9465  N N     . TYR G 3 89  ? -58.703  -28.308 52.432 1.00 53.02  ? 288  TYR F N     1 
ATOM   9466  C CA    . TYR G 3 89  ? -59.969  -28.106 53.094 1.00 54.71  ? 288  TYR F CA    1 
ATOM   9467  C C     . TYR G 3 89  ? -60.864  -27.280 52.195 1.00 54.42  ? 288  TYR F C     1 
ATOM   9468  O O     . TYR G 3 89  ? -62.073  -27.515 52.121 1.00 55.15  ? 288  TYR F O     1 
ATOM   9469  C CB    . TYR G 3 89  ? -59.754  -27.412 54.425 1.00 56.64  ? 288  TYR F CB    1 
ATOM   9470  C CG    . TYR G 3 89  ? -59.155  -28.340 55.438 1.00 64.61  ? 288  TYR F CG    1 
ATOM   9471  C CD1   . TYR G 3 89  ? -58.146  -27.920 56.290 1.00 69.12  ? 288  TYR F CD1   1 
ATOM   9472  C CD2   . TYR G 3 89  ? -59.620  -29.637 55.569 1.00 67.59  ? 288  TYR F CD2   1 
ATOM   9473  C CE1   . TYR G 3 89  ? -57.615  -28.769 57.255 1.00 72.09  ? 288  TYR F CE1   1 
ATOM   9474  C CE2   . TYR G 3 89  ? -59.100  -30.492 56.531 1.00 69.54  ? 288  TYR F CE2   1 
ATOM   9475  C CZ    . TYR G 3 89  ? -58.101  -30.050 57.373 1.00 71.53  ? 288  TYR F CZ    1 
ATOM   9476  O OH    . TYR G 3 89  ? -57.619  -30.889 58.356 1.00 74.35  ? 288  TYR F OH    1 
ATOM   9477  N N     . ALA G 3 90  ? -60.273  -26.317 51.497 1.00 46.52  ? 289  ALA F N     1 
ATOM   9478  C CA    . ALA G 3 90  ? -61.052  -25.478 50.606 1.00 44.09  ? 289  ALA F CA    1 
ATOM   9479  C C     . ALA G 3 90  ? -61.676  -26.309 49.493 1.00 44.61  ? 289  ALA F C     1 
ATOM   9480  O O     . ALA G 3 90  ? -62.870  -26.217 49.234 1.00 44.07  ? 289  ALA F O     1 
ATOM   9481  C CB    . ALA G 3 90  ? -60.192  -24.415 50.029 1.00 35.22  ? 289  ALA F CB    1 
ATOM   9482  N N     . LEU G 3 91  ? -60.878  -27.132 48.832 1.00 45.64  ? 290  LEU F N     1 
ATOM   9483  C CA    . LEU G 3 91  ? -61.423  -27.948 47.767 1.00 45.67  ? 290  LEU F CA    1 
ATOM   9484  C C     . LEU G 3 91  ? -62.539  -28.830 48.310 1.00 47.22  ? 290  LEU F C     1 
ATOM   9485  O O     . LEU G 3 91  ? -63.490  -29.133 47.597 1.00 47.65  ? 290  LEU F O     1 
ATOM   9486  C CB    . LEU G 3 91  ? -60.325  -28.800 47.113 1.00 35.13  ? 290  LEU F CB    1 
ATOM   9487  C CG    . LEU G 3 91  ? -59.327  -28.027 46.245 1.00 34.30  ? 290  LEU F CG    1 
ATOM   9488  C CD1   . LEU G 3 91  ? -58.121  -28.907 45.880 1.00 34.09  ? 290  LEU F CD1   1 
ATOM   9489  C CD2   . LEU G 3 91  ? -60.042  -27.529 44.996 1.00 30.39  ? 290  LEU F CD2   1 
ATOM   9490  N N     . LYS G 3 92  ? -62.459  -29.228 49.573 1.00 46.08  ? 291  LYS F N     1 
ATOM   9491  C CA    . LYS G 3 92  ? -63.527  -30.073 50.089 1.00 48.25  ? 291  LYS F CA    1 
ATOM   9492  C C     . LYS G 3 92  ? -64.832  -29.334 50.325 1.00 50.22  ? 291  LYS F C     1 
ATOM   9493  O O     . LYS G 3 92  ? -65.886  -29.867 50.044 1.00 50.87  ? 291  LYS F O     1 
ATOM   9494  C CB    . LYS G 3 92  ? -63.125  -30.791 51.375 1.00 71.20  ? 291  LYS F CB    1 
ATOM   9495  C CG    . LYS G 3 92  ? -64.224  -31.715 51.861 1.00 75.02  ? 291  LYS F CG    1 
ATOM   9496  C CD    . LYS G 3 92  ? -63.808  -32.570 53.045 1.00 82.16  ? 291  LYS F CD    1 
ATOM   9497  C CE    . LYS G 3 92  ? -62.885  -33.710 52.640 1.00 86.56  ? 291  LYS F CE    1 
ATOM   9498  N NZ    . LYS G 3 92  ? -61.609  -33.241 52.023 1.00 88.89  ? 291  LYS F NZ    1 
ATOM   9499  N N     . ARG G 3 93  ? -64.783  -28.121 50.851 1.00 59.01  ? 292  ARG F N     1 
ATOM   9500  C CA    . ARG G 3 93  ? -66.034  -27.410 51.073 1.00 59.76  ? 292  ARG F CA    1 
ATOM   9501  C C     . ARG G 3 93  ? -66.809  -27.399 49.774 1.00 58.64  ? 292  ARG F C     1 
ATOM   9502  O O     . ARG G 3 93  ? -68.038  -27.406 49.774 1.00 61.36  ? 292  ARG F O     1 
ATOM   9503  C CB    . ARG G 3 93  ? -65.795  -25.960 51.511 1.00 71.80  ? 292  ARG F CB    1 
ATOM   9504  C CG    . ARG G 3 93  ? -65.635  -25.783 52.992 1.00 76.56  ? 292  ARG F CG    1 
ATOM   9505  C CD    . ARG G 3 93  ? -66.005  -24.379 53.436 1.00 78.84  ? 292  ARG F CD    1 
ATOM   9506  N NE    . ARG G 3 93  ? -67.430  -24.086 53.273 1.00 82.23  ? 292  ARG F NE    1 
ATOM   9507  C CZ    . ARG G 3 93  ? -67.983  -23.634 52.151 1.00 86.84  ? 292  ARG F CZ    1 
ATOM   9508  N NH1   . ARG G 3 93  ? -67.234  -23.416 51.082 1.00 85.72  ? 292  ARG F NH1   1 
ATOM   9509  N NH2   . ARG G 3 93  ? -69.287  -23.405 52.093 1.00 87.98  ? 292  ARG F NH2   1 
ATOM   9510  N N     . GLN G 3 94  ? -66.070  -27.406 48.671 1.00 49.40  ? 293  GLN F N     1 
ATOM   9511  C CA    . GLN G 3 94  ? -66.652  -27.344 47.348 1.00 49.13  ? 293  GLN F CA    1 
ATOM   9512  C C     . GLN G 3 94  ? -66.955  -28.693 46.734 1.00 46.84  ? 293  GLN F C     1 
ATOM   9513  O O     . GLN G 3 94  ? -67.289  -28.798 45.545 1.00 43.63  ? 293  GLN F O     1 
ATOM   9514  C CB    . GLN G 3 94  ? -65.723  -26.538 46.468 1.00 64.49  ? 293  GLN F CB    1 
ATOM   9515  C CG    . GLN G 3 94  ? -65.537  -25.160 47.063 1.00 74.21  ? 293  GLN F CG    1 
ATOM   9516  C CD    . GLN G 3 94  ? -64.646  -24.267 46.252 1.00 79.60  ? 293  GLN F CD    1 
ATOM   9517  O OE1   . GLN G 3 94  ? -64.509  -23.089 46.569 1.00 82.41  ? 293  GLN F OE1   1 
ATOM   9518  N NE2   . GLN G 3 94  ? -64.026  -24.814 45.203 1.00 83.09  ? 293  GLN F NE2   1 
ATOM   9519  N N     . GLY G 3 95  ? -66.842  -29.723 47.559 1.00 49.26  ? 294  GLY F N     1 
ATOM   9520  C CA    . GLY G 3 95  ? -67.124  -31.057 47.109 1.00 49.36  ? 294  GLY F CA    1 
ATOM   9521  C C     . GLY G 3 95  ? -66.066  -31.614 46.195 1.00 51.73  ? 294  GLY F C     1 
ATOM   9522  O O     . GLY G 3 95  ? -66.278  -32.661 45.597 1.00 51.90  ? 294  GLY F O     1 
ATOM   9523  N N     . ARG G 3 96  ? -64.926  -30.954 46.071 1.00 59.58  ? 295  ARG F N     1 
ATOM   9524  C CA    . ARG G 3 96  ? -63.904  -31.494 45.194 1.00 62.02  ? 295  ARG F CA    1 
ATOM   9525  C C     . ARG G 3 96  ? -62.706  -32.063 45.968 1.00 63.34  ? 295  ARG F C     1 
ATOM   9526  O O     . ARG G 3 96  ? -61.597  -31.536 45.868 1.00 65.01  ? 295  ARG F O     1 
ATOM   9527  C CB    . ARG G 3 96  ? -63.441  -30.424 44.198 1.00 46.05  ? 295  ARG F CB    1 
ATOM   9528  C CG    . ARG G 3 96  ? -64.557  -29.541 43.668 1.00 49.48  ? 295  ARG F CG    1 
ATOM   9529  C CD    . ARG G 3 96  ? -64.450  -29.299 42.174 1.00 51.63  ? 295  ARG F CD    1 
ATOM   9530  N NE    . ARG G 3 96  ? -63.073  -29.410 41.722 1.00 57.63  ? 295  ARG F NE    1 
ATOM   9531  C CZ    . ARG G 3 96  ? -62.630  -30.246 40.775 1.00 59.14  ? 295  ARG F CZ    1 
ATOM   9532  N NH1   . ARG G 3 96  ? -63.465  -31.084 40.126 1.00 53.86  ? 295  ARG F NH1   1 
ATOM   9533  N NH2   . ARG G 3 96  ? -61.318  -30.263 40.508 1.00 56.92  ? 295  ARG F NH2   1 
ATOM   9534  N N     . THR G 3 97  ? -62.930  -33.129 46.738 1.00 56.00  ? 296  THR F N     1 
ATOM   9535  C CA    . THR G 3 97  ? -61.854  -33.786 47.502 1.00 57.60  ? 296  THR F CA    1 
ATOM   9536  C C     . THR G 3 97  ? -60.579  -34.074 46.692 1.00 54.46  ? 296  THR F C     1 
ATOM   9537  O O     . THR G 3 97  ? -60.640  -34.637 45.591 1.00 55.09  ? 296  THR F O     1 
ATOM   9538  C CB    . THR G 3 97  ? -62.282  -35.145 48.054 1.00 63.92  ? 296  THR F CB    1 
ATOM   9539  O OG1   . THR G 3 97  ? -63.243  -34.975 49.103 1.00 67.14  ? 296  THR F OG1   1 
ATOM   9540  C CG2   . THR G 3 97  ? -61.071  -35.884 48.577 1.00 66.46  ? 296  THR F CG2   1 
ATOM   9541  N N     . LEU G 3 98  ? -59.430  -33.727 47.270 1.00 42.51  ? 297  LEU F N     1 
ATOM   9542  C CA    . LEU G 3 98  ? -58.142  -33.930 46.615 1.00 40.57  ? 297  LEU F CA    1 
ATOM   9543  C C     . LEU G 3 98  ? -57.229  -34.827 47.423 1.00 42.22  ? 297  LEU F C     1 
ATOM   9544  O O     . LEU G 3 98  ? -57.003  -34.562 48.593 1.00 41.95  ? 297  LEU F O     1 
ATOM   9545  C CB    . LEU G 3 98  ? -57.429  -32.602 46.416 1.00 34.04  ? 297  LEU F CB    1 
ATOM   9546  C CG    . LEU G 3 98  ? -56.043  -32.739 45.792 1.00 31.13  ? 297  LEU F CG    1 
ATOM   9547  C CD1   . LEU G 3 98  ? -56.201  -33.162 44.354 1.00 28.48  ? 297  LEU F CD1   1 
ATOM   9548  C CD2   . LEU G 3 98  ? -55.283  -31.429 45.857 1.00 29.76  ? 297  LEU F CD2   1 
ATOM   9549  N N     . TYR G 3 99  ? -56.707  -35.885 46.793 1.00 44.59  ? 298  TYR F N     1 
ATOM   9550  C CA    . TYR G 3 99  ? -55.779  -36.800 47.462 1.00 45.43  ? 298  TYR F CA    1 
ATOM   9551  C C     . TYR G 3 99  ? -54.333  -36.464 47.055 1.00 47.09  ? 298  TYR F C     1 
ATOM   9552  O O     . TYR G 3 99  ? -54.080  -35.982 45.949 1.00 47.72  ? 298  TYR F O     1 
ATOM   9553  C CB    . TYR G 3 99  ? -56.059  -38.262 47.087 1.00 50.83  ? 298  TYR F CB    1 
ATOM   9554  C CG    . TYR G 3 99  ? -57.304  -38.888 47.674 1.00 50.10  ? 298  TYR F CG    1 
ATOM   9555  C CD1   . TYR G 3 99  ? -58.170  -38.159 48.500 1.00 48.54  ? 298  TYR F CD1   1 
ATOM   9556  C CD2   . TYR G 3 99  ? -57.629  -40.228 47.395 1.00 49.06  ? 298  TYR F CD2   1 
ATOM   9557  C CE1   . TYR G 3 99  ? -59.324  -38.747 49.033 1.00 49.17  ? 298  TYR F CE1   1 
ATOM   9558  C CE2   . TYR G 3 99  ? -58.782  -40.812 47.918 1.00 48.16  ? 298  TYR F CE2   1 
ATOM   9559  C CZ    . TYR G 3 99  ? -59.625  -40.064 48.725 1.00 49.24  ? 298  TYR F CZ    1 
ATOM   9560  O OH    . TYR G 3 99  ? -60.759  -40.629 49.241 1.00 48.96  ? 298  TYR F OH    1 
ATOM   9561  N N     . GLY G 3 100 ? -53.400  -36.757 47.966 1.00 50.80  ? 299  GLY F N     1 
ATOM   9562  C CA    . GLY G 3 100 ? -51.987  -36.538 47.715 1.00 50.00  ? 299  GLY F CA    1 
ATOM   9563  C C     . GLY G 3 100 ? -51.383  -35.255 48.234 1.00 49.92  ? 299  GLY F C     1 
ATOM   9564  O O     . GLY G 3 100 ? -50.383  -34.798 47.687 1.00 51.05  ? 299  GLY F O     1 
ATOM   9565  N N     . PHE G 3 101 ? -51.980  -34.655 49.258 1.00 59.90  ? 300  PHE F N     1 
ATOM   9566  C CA    . PHE G 3 101 ? -51.447  -33.424 49.833 1.00 61.90  ? 300  PHE F CA    1 
ATOM   9567  C C     . PHE G 3 101 ? -51.823  -33.329 51.305 1.00 65.50  ? 300  PHE F C     1 
ATOM   9568  O O     . PHE G 3 101 ? -51.392  -32.415 52.002 1.00 65.09  ? 300  PHE F O     1 
ATOM   9569  C CB    . PHE G 3 101 ? -51.979  -32.170 49.108 1.00 41.47  ? 300  PHE F CB    1 
ATOM   9570  C CG    . PHE G 3 101 ? -51.422  -31.965 47.716 1.00 38.72  ? 300  PHE F CG    1 
ATOM   9571  C CD1   . PHE G 3 101 ? -52.106  -32.433 46.597 1.00 39.31  ? 300  PHE F CD1   1 
ATOM   9572  C CD2   . PHE G 3 101 ? -50.196  -31.320 47.529 1.00 38.66  ? 300  PHE F CD2   1 
ATOM   9573  C CE1   . PHE G 3 101 ? -51.577  -32.264 45.303 1.00 38.74  ? 300  PHE F CE1   1 
ATOM   9574  C CE2   . PHE G 3 101 ? -49.643  -31.139 46.238 1.00 38.95  ? 300  PHE F CE2   1 
ATOM   9575  C CZ    . PHE G 3 101 ? -50.335  -31.614 45.119 1.00 37.98  ? 300  PHE F CZ    1 
ATOM   9576  N N     . GLY G 3 102 ? -52.637  -34.265 51.775 1.00 93.14  ? 301  GLY F N     1 
ATOM   9577  C CA    . GLY G 3 102 ? -53.064  -34.238 53.161 1.00 100.67 ? 301  GLY F CA    1 
ATOM   9578  C C     . GLY G 3 102 ? -51.934  -34.238 54.173 1.00 106.71 ? 301  GLY F C     1 
ATOM   9579  O O     . GLY G 3 102 ? -51.733  -35.226 54.879 1.00 106.84 ? 301  GLY F O     1 
ATOM   9580  N N     . GLY G 3 103 ? -51.199  -33.132 54.256 1.00 200.16 ? 302  GLY F N     1 
ATOM   9581  C CA    . GLY G 3 103 ? -50.099  -33.038 55.202 1.00 200.16 ? 302  GLY F CA    1 
ATOM   9582  C C     . GLY G 3 103 ? -49.187  -34.252 55.221 1.00 200.16 ? 302  GLY F C     1 
ATOM   9583  O O     . GLY G 3 103 ? -49.272  -35.035 56.189 1.00 200.16 ? 302  GLY F O     1 
ATOM   9584  O OXT   . GLY G 3 103 ? -48.394  -34.435 54.270 1.00 80.98  ? 302  GLY F OXT   1 
ATOM   9585  N N     . ARG H 5 31  ? -93.509  -34.119 73.688 1.00 134.39 ? 1430 ARG H N     1 
ATOM   9586  C CA    . ARG H 5 31  ? -93.017  -32.714 73.588 1.00 132.32 ? 1430 ARG H CA    1 
ATOM   9587  C C     . ARG H 5 31  ? -92.926  -32.264 72.135 1.00 130.20 ? 1430 ARG H C     1 
ATOM   9588  O O     . ARG H 5 31  ? -93.947  -31.961 71.527 1.00 133.07 ? 1430 ARG H O     1 
ATOM   9589  C CB    . ARG H 5 31  ? -91.652  -32.584 74.278 1.00 200.16 ? 1430 ARG H CB    1 
ATOM   9590  C CG    . ARG H 5 31  ? -91.706  -32.603 75.807 1.00 200.16 ? 1430 ARG H CG    1 
ATOM   9591  C CD    . ARG H 5 31  ? -92.564  -33.762 76.314 1.00 200.16 ? 1430 ARG H CD    1 
ATOM   9592  N NE    . ARG H 5 31  ? -92.406  -34.058 77.739 1.00 200.16 ? 1430 ARG H NE    1 
ATOM   9593  C CZ    . ARG H 5 31  ? -92.710  -33.230 78.735 1.00 200.16 ? 1430 ARG H CZ    1 
ATOM   9594  N NH1   . ARG H 5 31  ? -93.194  -32.019 78.485 1.00 200.16 ? 1430 ARG H NH1   1 
ATOM   9595  N NH2   . ARG H 5 31  ? -92.551  -33.628 79.993 1.00 200.16 ? 1430 ARG H NH2   1 
ATOM   9596  N N     . LYS H 5 32  ? -91.711  -32.234 71.587 1.00 118.20 ? 1431 LYS H N     1 
ATOM   9597  C CA    . LYS H 5 32  ? -91.447  -31.812 70.198 1.00 112.68 ? 1431 LYS H CA    1 
ATOM   9598  C C     . LYS H 5 32  ? -91.376  -30.293 70.010 1.00 109.15 ? 1431 LYS H C     1 
ATOM   9599  O O     . LYS H 5 32  ? -92.386  -29.632 69.772 1.00 108.16 ? 1431 LYS H O     1 
ATOM   9600  C CB    . LYS H 5 32  ? -92.483  -32.399 69.219 1.00 111.40 ? 1431 LYS H CB    1 
ATOM   9601  C CG    . LYS H 5 32  ? -92.334  -33.900 68.958 1.00 114.44 ? 1431 LYS H CG    1 
ATOM   9602  C CD    . LYS H 5 32  ? -93.199  -34.356 67.785 1.00 116.11 ? 1431 LYS H CD    1 
ATOM   9603  C CE    . LYS H 5 32  ? -92.981  -35.833 67.471 1.00 117.63 ? 1431 LYS H CE    1 
ATOM   9604  N NZ    . LYS H 5 32  ? -93.653  -36.251 66.207 1.00 118.65 ? 1431 LYS H NZ    1 
ATOM   9605  N N     . GLU H 5 33  ? -90.163  -29.757 70.113 1.00 90.13  ? 1432 GLU H N     1 
ATOM   9606  C CA    . GLU H 5 33  ? -89.916  -28.327 69.968 1.00 86.43  ? 1432 GLU H CA    1 
ATOM   9607  C C     . GLU H 5 33  ? -89.746  -27.941 68.495 1.00 84.04  ? 1432 GLU H C     1 
ATOM   9608  O O     . GLU H 5 33  ? -89.699  -28.801 67.618 1.00 83.95  ? 1432 GLU H O     1 
ATOM   9609  C CB    . GLU H 5 33  ? -88.645  -27.946 70.739 1.00 93.70  ? 1432 GLU H CB    1 
ATOM   9610  C CG    . GLU H 5 33  ? -88.692  -28.221 72.242 1.00 94.46  ? 1432 GLU H CG    1 
ATOM   9611  C CD    . GLU H 5 33  ? -87.314  -28.172 72.906 1.00 96.24  ? 1432 GLU H CD    1 
ATOM   9612  O OE1   . GLU H 5 33  ? -87.243  -28.166 74.159 1.00 97.81  ? 1432 GLU H OE1   1 
ATOM   9613  O OE2   . GLU H 5 33  ? -86.302  -28.150 72.178 1.00 96.77  ? 1432 GLU H OE2   1 
ATOM   9614  N N     . SER H 5 34  ? -89.656  -26.640 68.237 1.00 76.81  ? 1433 SER H N     1 
ATOM   9615  C CA    . SER H 5 34  ? -89.457  -26.114 66.885 1.00 73.47  ? 1433 SER H CA    1 
ATOM   9616  C C     . SER H 5 34  ? -89.103  -24.631 66.989 1.00 71.59  ? 1433 SER H C     1 
ATOM   9617  O O     . SER H 5 34  ? -88.922  -24.111 68.088 1.00 71.57  ? 1433 SER H O     1 
ATOM   9618  C CB    . SER H 5 34  ? -90.724  -26.284 66.037 1.00 60.43  ? 1433 SER H CB    1 
ATOM   9619  O OG    . SER H 5 34  ? -91.724  -25.339 66.380 1.00 63.72  ? 1433 SER H OG    1 
ATOM   9620  N N     . TYR H 5 35  ? -88.979  -23.951 65.857 1.00 62.77  ? 1434 TYR H N     1 
ATOM   9621  C CA    . TYR H 5 35  ? -88.681  -22.527 65.901 1.00 59.64  ? 1434 TYR H CA    1 
ATOM   9622  C C     . TYR H 5 35  ? -89.955  -21.797 65.522 1.00 58.18  ? 1434 TYR H C     1 
ATOM   9623  O O     . TYR H 5 35  ? -89.985  -20.568 65.420 1.00 57.47  ? 1434 TYR H O     1 
ATOM   9624  C CB    . TYR H 5 35  ? -87.550  -22.147 64.936 1.00 64.59  ? 1434 TYR H CB    1 
ATOM   9625  C CG    . TYR H 5 35  ? -86.190  -22.716 65.297 1.00 65.61  ? 1434 TYR H CG    1 
ATOM   9626  C CD1   . TYR H 5 35  ? -85.785  -23.954 64.806 1.00 66.58  ? 1434 TYR H CD1   1 
ATOM   9627  C CD2   . TYR H 5 35  ? -85.302  -22.010 66.108 1.00 65.73  ? 1434 TYR H CD2   1 
ATOM   9628  C CE1   . TYR H 5 35  ? -84.540  -24.471 65.102 1.00 66.89  ? 1434 TYR H CE1   1 
ATOM   9629  C CE2   . TYR H 5 35  ? -84.048  -22.520 66.412 1.00 63.72  ? 1434 TYR H CE2   1 
ATOM   9630  C CZ    . TYR H 5 35  ? -83.673  -23.752 65.899 1.00 64.39  ? 1434 TYR H CZ    1 
ATOM   9631  O OH    . TYR H 5 35  ? -82.413  -24.275 66.120 1.00 65.16  ? 1434 TYR H OH    1 
ATOM   9632  N N     . ALA H 5 36  ? -91.014  -22.577 65.346 1.00 74.55  ? 1435 ALA H N     1 
ATOM   9633  C CA    . ALA H 5 36  ? -92.314  -22.054 64.968 1.00 74.32  ? 1435 ALA H CA    1 
ATOM   9634  C C     . ALA H 5 36  ? -92.613  -20.664 65.528 1.00 75.48  ? 1435 ALA H C     1 
ATOM   9635  O O     . ALA H 5 36  ? -92.735  -19.701 64.761 1.00 76.77  ? 1435 ALA H O     1 
ATOM   9636  C CB    . ALA H 5 36  ? -93.393  -23.029 65.386 1.00 62.36  ? 1435 ALA H CB    1 
ATOM   9637  N N     . ILE H 5 37  ? -92.704  -20.551 66.855 1.00 82.07  ? 1436 ILE H N     1 
ATOM   9638  C CA    . ILE H 5 37  ? -93.027  -19.269 67.497 1.00 81.39  ? 1436 ILE H CA    1 
ATOM   9639  C C     . ILE H 5 37  ? -92.102  -18.092 67.149 1.00 82.70  ? 1436 ILE H C     1 
ATOM   9640  O O     . ILE H 5 37  ? -92.571  -16.962 66.946 1.00 84.35  ? 1436 ILE H O     1 
ATOM   9641  C CB    . ILE H 5 37  ? -93.102  -19.411 69.054 1.00 93.31  ? 1436 ILE H CB    1 
ATOM   9642  C CG1   . ILE H 5 37  ? -91.705  -19.402 69.673 1.00 93.76  ? 1436 ILE H CG1   1 
ATOM   9643  C CG2   . ILE H 5 37  ? -93.806  -20.712 69.421 1.00 92.40  ? 1436 ILE H CG2   1 
ATOM   9644  C CD1   . ILE H 5 37  ? -91.705  -19.592 71.180 1.00 88.92  ? 1436 ILE H CD1   1 
ATOM   9645  N N     . TYR H 5 38  ? -90.799  -18.345 67.073 1.00 61.49  ? 1437 TYR H N     1 
ATOM   9646  C CA    . TYR H 5 38  ? -89.876  -17.270 66.753 1.00 63.15  ? 1437 TYR H CA    1 
ATOM   9647  C C     . TYR H 5 38  ? -90.018  -16.887 65.288 1.00 64.08  ? 1437 TYR H C     1 
ATOM   9648  O O     . TYR H 5 38  ? -90.037  -15.700 64.945 1.00 63.18  ? 1437 TYR H O     1 
ATOM   9649  C CB    . TYR H 5 38  ? -88.442  -17.686 67.055 1.00 73.13  ? 1437 TYR H CB    1 
ATOM   9650  C CG    . TYR H 5 38  ? -88.325  -18.509 68.306 1.00 74.11  ? 1437 TYR H CG    1 
ATOM   9651  C CD1   . TYR H 5 38  ? -88.523  -19.885 68.268 1.00 73.62  ? 1437 TYR H CD1   1 
ATOM   9652  C CD2   . TYR H 5 38  ? -88.082  -17.906 69.539 1.00 74.13  ? 1437 TYR H CD2   1 
ATOM   9653  C CE1   . TYR H 5 38  ? -88.485  -20.639 69.418 1.00 74.80  ? 1437 TYR H CE1   1 
ATOM   9654  C CE2   . TYR H 5 38  ? -88.046  -18.654 70.701 1.00 74.44  ? 1437 TYR H CE2   1 
ATOM   9655  C CZ    . TYR H 5 38  ? -88.249  -20.022 70.634 1.00 74.23  ? 1437 TYR H CZ    1 
ATOM   9656  O OH    . TYR H 5 38  ? -88.208  -20.787 71.778 1.00 75.40  ? 1437 TYR H OH    1 
ATOM   9657  N N     . VAL H 5 39  ? -90.107  -17.882 64.412 1.00 66.84  ? 1438 VAL H N     1 
ATOM   9658  C CA    . VAL H 5 39  ? -90.282  -17.575 63.006 1.00 67.00  ? 1438 VAL H CA    1 
ATOM   9659  C C     . VAL H 5 39  ? -91.431  -16.571 62.988 1.00 68.20  ? 1438 VAL H C     1 
ATOM   9660  O O     . VAL H 5 39  ? -91.321  -15.498 62.397 1.00 69.25  ? 1438 VAL H O     1 
ATOM   9661  C CB    . VAL H 5 39  ? -90.688  -18.827 62.193 1.00 56.35  ? 1438 VAL H CB    1 
ATOM   9662  C CG1   . VAL H 5 39  ? -90.803  -18.490 60.707 1.00 55.33  ? 1438 VAL H CG1   1 
ATOM   9663  C CG2   . VAL H 5 39  ? -89.681  -19.911 62.400 1.00 53.37  ? 1438 VAL H CG2   1 
ATOM   9664  N N     . TYR H 5 40  ? -92.512  -16.913 63.689 1.00 76.22  ? 1439 TYR H N     1 
ATOM   9665  C CA    . TYR H 5 40  ? -93.694  -16.059 63.748 1.00 77.41  ? 1439 TYR H CA    1 
ATOM   9666  C C     . TYR H 5 40  ? -93.432  -14.629 64.220 1.00 76.82  ? 1439 TYR H C     1 
ATOM   9667  O O     . TYR H 5 40  ? -93.839  -13.679 63.547 1.00 74.37  ? 1439 TYR H O     1 
ATOM   9668  C CB    . TYR H 5 40  ? -94.758  -16.675 64.646 1.00 89.16  ? 1439 TYR H CB    1 
ATOM   9669  C CG    . TYR H 5 40  ? -96.151  -16.214 64.297 1.00 93.69  ? 1439 TYR H CG    1 
ATOM   9670  C CD1   . TYR H 5 40  ? -96.941  -16.947 63.409 1.00 95.02  ? 1439 TYR H CD1   1 
ATOM   9671  C CD2   . TYR H 5 40  ? -96.676  -15.033 64.831 1.00 94.31  ? 1439 TYR H CD2   1 
ATOM   9672  C CE1   . TYR H 5 40  ? -98.218  -16.520 63.058 1.00 96.61  ? 1439 TYR H CE1   1 
ATOM   9673  C CE2   . TYR H 5 40  ? -97.957  -14.592 64.485 1.00 95.75  ? 1439 TYR H CE2   1 
ATOM   9674  C CZ    . TYR H 5 40  ? -98.719  -15.345 63.597 1.00 97.40  ? 1439 TYR H CZ    1 
ATOM   9675  O OH    . TYR H 5 40  ? -99.976  -14.927 63.234 1.00 97.85  ? 1439 TYR H OH    1 
ATOM   9676  N N     . LYS H 5 41  ? -92.778  -14.470 65.372 1.00 88.06  ? 1440 LYS H N     1 
ATOM   9677  C CA    . LYS H 5 41  ? -92.486  -13.128 65.887 1.00 89.34  ? 1440 LYS H CA    1 
ATOM   9678  C C     . LYS H 5 41  ? -91.827  -12.320 64.777 1.00 89.95  ? 1440 LYS H C     1 
ATOM   9679  O O     . LYS H 5 41  ? -92.321  -11.272 64.357 1.00 91.23  ? 1440 LYS H O     1 
ATOM   9680  C CB    . LYS H 5 41  ? -91.545  -13.188 67.092 1.00 67.88  ? 1440 LYS H CB    1 
ATOM   9681  C CG    . LYS H 5 41  ? -92.074  -14.002 68.249 1.00 70.79  ? 1440 LYS H CG    1 
ATOM   9682  C CD    . LYS H 5 41  ? -91.245  -13.779 69.520 1.00 73.23  ? 1440 LYS H CD    1 
ATOM   9683  C CE    . LYS H 5 41  ? -91.844  -14.526 70.735 1.00 73.68  ? 1440 LYS H CE    1 
ATOM   9684  N NZ    . LYS H 5 41  ? -91.070  -14.384 72.017 1.00 76.03  ? 1440 LYS H NZ    1 
ATOM   9685  N N     . VAL H 5 42  ? -90.703  -12.832 64.304 1.00 65.31  ? 1441 VAL H N     1 
ATOM   9686  C CA    . VAL H 5 42  ? -89.958  -12.201 63.237 1.00 63.93  ? 1441 VAL H CA    1 
ATOM   9687  C C     . VAL H 5 42  ? -90.888  -11.788 62.103 1.00 65.36  ? 1441 VAL H C     1 
ATOM   9688  O O     . VAL H 5 42  ? -90.829  -10.656 61.619 1.00 66.75  ? 1441 VAL H O     1 
ATOM   9689  C CB    . VAL H 5 42  ? -88.903  -13.170 62.692 1.00 62.85  ? 1441 VAL H CB    1 
ATOM   9690  C CG1   . VAL H 5 42  ? -88.211  -12.571 61.484 1.00 59.59  ? 1441 VAL H CG1   1 
ATOM   9691  C CG2   . VAL H 5 42  ? -87.902  -13.483 63.781 1.00 60.52  ? 1441 VAL H CG2   1 
ATOM   9692  N N     . LEU H 5 43  ? -91.748  -12.711 61.682 1.00 74.40  ? 1442 LEU H N     1 
ATOM   9693  C CA    . LEU H 5 43  ? -92.671  -12.430 60.595 1.00 74.54  ? 1442 LEU H CA    1 
ATOM   9694  C C     . LEU H 5 43  ? -93.546  -11.232 60.878 1.00 77.12  ? 1442 LEU H C     1 
ATOM   9695  O O     . LEU H 5 43  ? -93.642  -10.320 60.055 1.00 77.92  ? 1442 LEU H O     1 
ATOM   9696  C CB    . LEU H 5 43  ? -93.554  -13.636 60.313 1.00 60.02  ? 1442 LEU H CB    1 
ATOM   9697  C CG    . LEU H 5 43  ? -94.778  -13.379 59.431 1.00 57.73  ? 1442 LEU H CG    1 
ATOM   9698  C CD1   . LEU H 5 43  ? -94.385  -12.629 58.194 1.00 56.00  ? 1442 LEU H CD1   1 
ATOM   9699  C CD2   . LEU H 5 43  ? -95.433  -14.704 59.070 1.00 58.13  ? 1442 LEU H CD2   1 
ATOM   9700  N N     . LYS H 5 44  ? -94.188  -11.235 62.042 1.00 97.49  ? 1443 LYS H N     1 
ATOM   9701  C CA    . LYS H 5 44  ? -95.069  -10.136 62.419 1.00 98.43  ? 1443 LYS H CA    1 
ATOM   9702  C C     . LYS H 5 44  ? -94.306  -8.836  62.641 1.00 99.13  ? 1443 LYS H C     1 
ATOM   9703  O O     . LYS H 5 44  ? -94.792  -7.752  62.306 1.00 97.50  ? 1443 LYS H O     1 
ATOM   9704  C CB    . LYS H 5 44  ? -95.864  -10.511 63.674 1.00 94.83  ? 1443 LYS H CB    1 
ATOM   9705  C CG    . LYS H 5 44  ? -96.995  -11.486 63.399 1.00 95.90  ? 1443 LYS H CG    1 
ATOM   9706  C CD    . LYS H 5 44  ? -97.957  -10.894 62.375 1.00 97.42  ? 1443 LYS H CD    1 
ATOM   9707  C CE    . LYS H 5 44  ? -99.049  -11.874 61.994 1.00 98.40  ? 1443 LYS H CE    1 
ATOM   9708  N NZ    . LYS H 5 44  ? -99.972  -11.299 60.974 1.00 100.27 ? 1443 LYS H NZ    1 
ATOM   9709  N N     . GLN H 5 45  ? -93.103  -8.958  63.194 1.00 87.54  ? 1444 GLN H N     1 
ATOM   9710  C CA    . GLN H 5 45  ? -92.257  -7.808  63.470 1.00 89.16  ? 1444 GLN H CA    1 
ATOM   9711  C C     . GLN H 5 45  ? -91.975  -6.992  62.211 1.00 89.50  ? 1444 GLN H C     1 
ATOM   9712  O O     . GLN H 5 45  ? -91.460  -5.882  62.285 1.00 92.05  ? 1444 GLN H O     1 
ATOM   9713  C CB    . GLN H 5 45  ? -90.946  -8.278  64.087 1.00 105.09 ? 1444 GLN H CB    1 
ATOM   9714  C CG    . GLN H 5 45  ? -89.918  -7.190  64.255 1.00 105.25 ? 1444 GLN H CG    1 
ATOM   9715  C CD    . GLN H 5 45  ? -88.611  -7.729  64.774 1.00 107.28 ? 1444 GLN H CD    1 
ATOM   9716  O OE1   . GLN H 5 45  ? -88.533  -8.222  65.902 1.00 109.36 ? 1444 GLN H OE1   1 
ATOM   9717  N NE2   . GLN H 5 45  ? -87.571  -7.654  63.950 1.00 108.22 ? 1444 GLN H NE2   1 
ATOM   9718  N N     . VAL H 5 46  ? -92.313  -7.538  61.052 1.00 90.41  ? 1445 VAL H N     1 
ATOM   9719  C CA    . VAL H 5 46  ? -92.080  -6.828  59.807 1.00 89.31  ? 1445 VAL H CA    1 
ATOM   9720  C C     . VAL H 5 46  ? -93.277  -6.933  58.880 1.00 90.81  ? 1445 VAL H C     1 
ATOM   9721  O O     . VAL H 5 46  ? -93.307  -6.304  57.828 1.00 89.54  ? 1445 VAL H O     1 
ATOM   9722  C CB    . VAL H 5 46  ? -90.831  -7.366  59.076 1.00 130.22 ? 1445 VAL H CB    1 
ATOM   9723  C CG1   . VAL H 5 46  ? -89.591  -7.069  59.896 1.00 128.68 ? 1445 VAL H CG1   1 
ATOM   9724  C CG2   . VAL H 5 46  ? -90.963  -8.865  58.835 1.00 132.21 ? 1445 VAL H CG2   1 
ATOM   9725  N N     . HIS H 5 47  ? -94.265  -7.727  59.272 1.00 115.16 ? 1446 HIS H N     1 
ATOM   9726  C CA    . HIS H 5 47  ? -95.463  -7.894  58.459 1.00 118.17 ? 1446 HIS H CA    1 
ATOM   9727  C C     . HIS H 5 47  ? -96.658  -8.178  59.353 1.00 119.52 ? 1446 HIS H C     1 
ATOM   9728  O O     . HIS H 5 47  ? -97.234  -9.268  59.327 1.00 121.31 ? 1446 HIS H O     1 
ATOM   9729  C CB    . HIS H 5 47  ? -95.256  -9.025  57.451 1.00 107.31 ? 1446 HIS H CB    1 
ATOM   9730  C CG    . HIS H 5 47  ? -94.262  -8.698  56.380 1.00 107.52 ? 1446 HIS H CG    1 
ATOM   9731  N ND1   . HIS H 5 47  ? -94.534  -7.812  55.359 1.00 108.49 ? 1446 HIS H ND1   1 
ATOM   9732  C CD2   . HIS H 5 47  ? -92.990  -9.117  56.184 1.00 107.06 ? 1446 HIS H CD2   1 
ATOM   9733  C CE1   . HIS H 5 47  ? -93.472  -7.700  54.580 1.00 107.04 ? 1446 HIS H CE1   1 
ATOM   9734  N NE2   . HIS H 5 47  ? -92.521  -8.483  55.058 1.00 105.22 ? 1446 HIS H NE2   1 
ATOM   9735  N N     . PRO H 5 48  ? -97.043  -7.182  60.164 1.00 100.57 ? 1447 PRO H N     1 
ATOM   9736  C CA    . PRO H 5 48  ? -98.165  -7.253  61.102 1.00 99.85  ? 1447 PRO H CA    1 
ATOM   9737  C C     . PRO H 5 48  ? -99.454  -7.722  60.444 1.00 99.45  ? 1447 PRO H C     1 
ATOM   9738  O O     . PRO H 5 48  ? -100.219 -8.484  61.029 1.00 98.48  ? 1447 PRO H O     1 
ATOM   9739  C CB    . PRO H 5 48  ? -98.266  -5.820  61.612 1.00 106.12 ? 1447 PRO H CB    1 
ATOM   9740  C CG    . PRO H 5 48  ? -96.840  -5.355  61.572 1.00 105.55 ? 1447 PRO H CG    1 
ATOM   9741  C CD    . PRO H 5 48  ? -96.401  -5.857  60.224 1.00 105.42 ? 1447 PRO H CD    1 
ATOM   9742  N N     . ASP H 5 49  ? -99.683  -7.267  59.219 1.00 125.50 ? 1448 ASP H N     1 
ATOM   9743  C CA    . ASP H 5 49  ? -100.884 -7.635  58.489 1.00 127.64 ? 1448 ASP H CA    1 
ATOM   9744  C C     . ASP H 5 49  ? -100.743 -8.882  57.632 1.00 127.27 ? 1448 ASP H C     1 
ATOM   9745  O O     . ASP H 5 49  ? -101.526 -9.078  56.703 1.00 127.85 ? 1448 ASP H O     1 
ATOM   9746  C CB    . ASP H 5 49  ? -101.333 -6.474  57.604 1.00 145.78 ? 1448 ASP H CB    1 
ATOM   9747  C CG    . ASP H 5 49  ? -102.098 -5.425  58.370 1.00 148.59 ? 1448 ASP H CG    1 
ATOM   9748  O OD1   . ASP H 5 49  ? -103.211 -5.739  58.839 1.00 149.81 ? 1448 ASP H OD1   1 
ATOM   9749  O OD2   . ASP H 5 49  ? -101.588 -4.294  58.506 1.00 149.26 ? 1448 ASP H OD2   1 
ATOM   9750  N N     . THR H 5 50  ? -99.760  -9.727  57.931 1.00 110.03 ? 1449 THR H N     1 
ATOM   9751  C CA    . THR H 5 50  ? -99.572  -10.946 57.146 1.00 107.64 ? 1449 THR H CA    1 
ATOM   9752  C C     . THR H 5 50  ? -99.308  -12.162 58.019 1.00 106.10 ? 1449 THR H C     1 
ATOM   9753  O O     . THR H 5 50  ? -98.613  -12.071 59.031 1.00 107.25 ? 1449 THR H O     1 
ATOM   9754  C CB    . THR H 5 50  ? -98.406  -10.813 56.144 1.00 91.72  ? 1449 THR H CB    1 
ATOM   9755  O OG1   . THR H 5 50  ? -98.616  -9.674  55.298 1.00 91.50  ? 1449 THR H OG1   1 
ATOM   9756  C CG2   . THR H 5 50  ? -98.316  -12.063 55.283 1.00 92.02  ? 1449 THR H CG2   1 
ATOM   9757  N N     . GLY H 5 51  ? -99.862  -13.301 57.611 1.00 91.76  ? 1450 GLY H N     1 
ATOM   9758  C CA    . GLY H 5 51  ? -99.689  -14.530 58.367 1.00 88.37  ? 1450 GLY H CA    1 
ATOM   9759  C C     . GLY H 5 51  ? -99.065  -15.637 57.544 1.00 86.33  ? 1450 GLY H C     1 
ATOM   9760  O O     . GLY H 5 51  ? -98.893  -15.490 56.333 1.00 86.74  ? 1450 GLY H O     1 
ATOM   9761  N N     . ILE H 5 52  ? -98.743  -16.755 58.190 1.00 79.87  ? 1451 ILE H N     1 
ATOM   9762  C CA    . ILE H 5 52  ? -98.113  -17.865 57.487 1.00 77.33  ? 1451 ILE H CA    1 
ATOM   9763  C C     . ILE H 5 52  ? -98.783  -19.234 57.738 1.00 76.43  ? 1451 ILE H C     1 
ATOM   9764  O O     . ILE H 5 52  ? -99.051  -19.618 58.876 1.00 78.68  ? 1451 ILE H O     1 
ATOM   9765  C CB    . ILE H 5 52  ? -96.594  -17.898 57.838 1.00 83.94  ? 1451 ILE H CB    1 
ATOM   9766  C CG1   . ILE H 5 52  ? -95.885  -18.982 57.035 1.00 81.62  ? 1451 ILE H CG1   1 
ATOM   9767  C CG2   . ILE H 5 52  ? -96.402  -18.086 59.323 1.00 84.02  ? 1451 ILE H CG2   1 
ATOM   9768  C CD1   . ILE H 5 52  ? -94.424  -19.130 57.400 1.00 80.13  ? 1451 ILE H CD1   1 
ATOM   9769  N N     . SER H 5 53  ? -99.054  -19.960 56.656 1.00 68.23  ? 1452 SER H N     1 
ATOM   9770  C CA    . SER H 5 53  ? -99.704  -21.266 56.730 1.00 66.62  ? 1452 SER H CA    1 
ATOM   9771  C C     . SER H 5 53  ? -98.900  -22.325 57.447 1.00 65.89  ? 1452 SER H C     1 
ATOM   9772  O O     . SER H 5 53  ? -97.708  -22.164 57.702 1.00 66.65  ? 1452 SER H O     1 
ATOM   9773  C CB    . SER H 5 53  ? -100.018 -21.786 55.334 1.00 69.27  ? 1452 SER H CB    1 
ATOM   9774  O OG    . SER H 5 53  ? -98.834  -22.151 54.652 1.00 71.96  ? 1452 SER H OG    1 
ATOM   9775  N N     . SER H 5 54  ? -99.569  -23.430 57.747 1.00 81.02  ? 1453 SER H N     1 
ATOM   9776  C CA    . SER H 5 54  ? -98.952  -24.539 58.444 1.00 80.74  ? 1453 SER H CA    1 
ATOM   9777  C C     . SER H 5 54  ? -97.719  -25.025 57.715 1.00 80.84  ? 1453 SER H C     1 
ATOM   9778  O O     . SER H 5 54  ? -96.600  -24.929 58.228 1.00 77.70  ? 1453 SER H O     1 
ATOM   9779  C CB    . SER H 5 54  ? -99.941  -25.687 58.573 1.00 87.66  ? 1453 SER H CB    1 
ATOM   9780  O OG    . SER H 5 54  ? -99.276  -26.853 59.018 1.00 91.75  ? 1453 SER H OG    1 
ATOM   9781  N N     . LYS H 5 55  ? -97.922  -25.554 56.513 1.00 75.03  ? 1454 LYS H N     1 
ATOM   9782  C CA    . LYS H 5 55  ? -96.807  -26.066 55.728 1.00 75.37  ? 1454 LYS H CA    1 
ATOM   9783  C C     . LYS H 5 55  ? -95.728  -25.008 55.567 1.00 74.68  ? 1454 LYS H C     1 
ATOM   9784  O O     . LYS H 5 55  ? -94.550  -25.275 55.795 1.00 76.06  ? 1454 LYS H O     1 
ATOM   9785  C CB    . LYS H 5 55  ? -97.307  -26.534 54.367 1.00 81.07  ? 1454 LYS H CB    1 
ATOM   9786  C CG    . LYS H 5 55  ? -98.184  -27.755 54.461 1.00 80.77  ? 1454 LYS H CG    1 
ATOM   9787  C CD    . LYS H 5 55  ? -98.964  -27.982 53.189 1.00 84.78  ? 1454 LYS H CD    1 
ATOM   9788  C CE    . LYS H 5 55  ? -99.832  -29.222 53.306 1.00 88.69  ? 1454 LYS H CE    1 
ATOM   9789  N NZ    . LYS H 5 55  ? -100.747 -29.387 52.139 1.00 90.90  ? 1454 LYS H NZ    1 
ATOM   9790  N N     . ALA H 5 56  ? -96.137  -23.803 55.189 1.00 80.61  ? 1455 ALA H N     1 
ATOM   9791  C CA    . ALA H 5 56  ? -95.199  -22.703 55.009 1.00 78.88  ? 1455 ALA H CA    1 
ATOM   9792  C C     . ALA H 5 56  ? -94.283  -22.589 56.224 1.00 78.60  ? 1455 ALA H C     1 
ATOM   9793  O O     . ALA H 5 56  ? -93.067  -22.411 56.089 1.00 77.54  ? 1455 ALA H O     1 
ATOM   9794  C CB    . ALA H 5 56  ? -95.957  -21.398 54.798 1.00 61.03  ? 1455 ALA H CB    1 
ATOM   9795  N N     . MET H 5 57  ? -94.871  -22.698 57.412 1.00 77.22  ? 1456 MET H N     1 
ATOM   9796  C CA    . MET H 5 57  ? -94.100  -22.619 58.643 1.00 77.11  ? 1456 MET H CA    1 
ATOM   9797  C C     . MET H 5 57  ? -93.121  -23.786 58.767 1.00 77.38  ? 1456 MET H C     1 
ATOM   9798  O O     . MET H 5 57  ? -91.989  -23.601 59.226 1.00 77.08  ? 1456 MET H O     1 
ATOM   9799  C CB    . MET H 5 57  ? -95.025  -22.612 59.851 1.00 54.13  ? 1456 MET H CB    1 
ATOM   9800  C CG    . MET H 5 57  ? -94.279  -22.569 61.186 1.00 57.41  ? 1456 MET H CG    1 
ATOM   9801  S SD    . MET H 5 57  ? -93.249  -21.081 61.430 1.00 63.66  ? 1456 MET H SD    1 
ATOM   9802  C CE    . MET H 5 57  ? -94.519  -19.830 61.499 1.00 60.37  ? 1456 MET H CE    1 
ATOM   9803  N N     . SER H 5 58  ? -93.554  -24.982 58.363 1.00 85.62  ? 1457 SER H N     1 
ATOM   9804  C CA    . SER H 5 58  ? -92.696  -26.167 58.433 1.00 84.41  ? 1457 SER H CA    1 
ATOM   9805  C C     . SER H 5 58  ? -91.431  -25.970 57.596 1.00 84.45  ? 1457 SER H C     1 
ATOM   9806  O O     . SER H 5 58  ? -90.348  -26.424 57.968 1.00 86.36  ? 1457 SER H O     1 
ATOM   9807  C CB    . SER H 5 58  ? -93.448  -27.410 57.951 1.00 190.23 ? 1457 SER H CB    1 
ATOM   9808  O OG    . SER H 5 58  ? -92.687  -28.584 58.189 1.00 190.23 ? 1457 SER H OG    1 
ATOM   9809  N N     . ILE H 5 59  ? -91.576  -25.286 56.465 1.00 76.37  ? 1458 ILE H N     1 
ATOM   9810  C CA    . ILE H 5 59  ? -90.455  -25.010 55.586 1.00 74.54  ? 1458 ILE H CA    1 
ATOM   9811  C C     . ILE H 5 59  ? -89.473  -24.098 56.297 1.00 74.64  ? 1458 ILE H C     1 
ATOM   9812  O O     . ILE H 5 59  ? -88.275  -24.377 56.313 1.00 75.68  ? 1458 ILE H O     1 
ATOM   9813  C CB    . ILE H 5 59  ? -90.945  -24.360 54.300 1.00 66.20  ? 1458 ILE H CB    1 
ATOM   9814  C CG1   . ILE H 5 59  ? -91.653  -25.422 53.463 1.00 65.74  ? 1458 ILE H CG1   1 
ATOM   9815  C CG2   . ILE H 5 59  ? -89.788  -23.714 53.535 1.00 63.90  ? 1458 ILE H CG2   1 
ATOM   9816  C CD1   . ILE H 5 59  ? -92.295  -24.884 52.226 1.00 69.82  ? 1458 ILE H CD1   1 
ATOM   9817  N N     . MET H 5 60  ? -89.974  -23.017 56.894 1.00 63.82  ? 1459 MET H N     1 
ATOM   9818  C CA    . MET H 5 60  ? -89.109  -22.093 57.629 1.00 64.04  ? 1459 MET H CA    1 
ATOM   9819  C C     . MET H 5 60  ? -88.399  -22.864 58.730 1.00 63.80  ? 1459 MET H C     1 
ATOM   9820  O O     . MET H 5 60  ? -87.227  -22.630 59.024 1.00 64.24  ? 1459 MET H O     1 
ATOM   9821  C CB    . MET H 5 60  ? -89.923  -20.970 58.254 1.00 63.38  ? 1459 MET H CB    1 
ATOM   9822  C CG    . MET H 5 60  ? -90.622  -20.096 57.241 1.00 65.09  ? 1459 MET H CG    1 
ATOM   9823  S SD    . MET H 5 60  ? -89.445  -19.423 56.098 1.00 65.30  ? 1459 MET H SD    1 
ATOM   9824  C CE    . MET H 5 60  ? -88.501  -18.364 57.182 1.00 64.06  ? 1459 MET H CE    1 
ATOM   9825  N N     . ASN H 5 61  ? -89.115  -23.799 59.334 1.00 65.23  ? 1460 ASN H N     1 
ATOM   9826  C CA    . ASN H 5 61  ? -88.534  -24.603 60.388 1.00 65.24  ? 1460 ASN H CA    1 
ATOM   9827  C C     . ASN H 5 61  ? -87.365  -25.409 59.817 1.00 64.38  ? 1460 ASN H C     1 
ATOM   9828  O O     . ASN H 5 61  ? -86.272  -25.443 60.387 1.00 65.20  ? 1460 ASN H O     1 
ATOM   9829  C CB    . ASN H 5 61  ? -89.589  -25.534 60.965 1.00 91.60  ? 1460 ASN H CB    1 
ATOM   9830  C CG    . ASN H 5 61  ? -89.361  -25.820 62.421 1.00 92.01  ? 1460 ASN H CG    1 
ATOM   9831  O OD1   . ASN H 5 61  ? -90.240  -25.580 63.245 1.00 94.71  ? 1460 ASN H OD1   1 
ATOM   9832  N ND2   . ASN H 5 61  ? -88.178  -26.331 62.755 1.00 91.70  ? 1460 ASN H ND2   1 
ATOM   9833  N N     . SER H 5 62  ? -87.593  -26.053 58.683 1.00 60.87  ? 1461 SER H N     1 
ATOM   9834  C CA    . SER H 5 62  ? -86.536  -26.824 58.063 1.00 59.76  ? 1461 SER H CA    1 
ATOM   9835  C C     . SER H 5 62  ? -85.359  -25.909 57.800 1.00 57.44  ? 1461 SER H C     1 
ATOM   9836  O O     . SER H 5 62  ? -84.221  -26.238 58.143 1.00 55.54  ? 1461 SER H O     1 
ATOM   9837  C CB    . SER H 5 62  ? -87.022  -27.443 56.762 1.00 50.53  ? 1461 SER H CB    1 
ATOM   9838  O OG    . SER H 5 62  ? -87.891  -28.519 57.048 1.00 55.31  ? 1461 SER H OG    1 
ATOM   9839  N N     . PHE H 5 63  ? -85.633  -24.756 57.193 1.00 50.61  ? 1462 PHE H N     1 
ATOM   9840  C CA    . PHE H 5 63  ? -84.588  -23.791 56.911 1.00 49.78  ? 1462 PHE H CA    1 
ATOM   9841  C C     . PHE H 5 63  ? -83.729  -23.594 58.152 1.00 48.15  ? 1462 PHE H C     1 
ATOM   9842  O O     . PHE H 5 63  ? -82.557  -23.967 58.169 1.00 46.53  ? 1462 PHE H O     1 
ATOM   9843  C CB    . PHE H 5 63  ? -85.183  -22.449 56.512 1.00 51.40  ? 1462 PHE H CB    1 
ATOM   9844  C CG    . PHE H 5 63  ? -84.156  -21.387 56.300 1.00 55.15  ? 1462 PHE H CG    1 
ATOM   9845  C CD1   . PHE H 5 63  ? -83.256  -21.477 55.245 1.00 55.91  ? 1462 PHE H CD1   1 
ATOM   9846  C CD2   . PHE H 5 63  ? -84.060  -20.305 57.177 1.00 56.42  ? 1462 PHE H CD2   1 
ATOM   9847  C CE1   . PHE H 5 63  ? -82.275  -20.502 55.062 1.00 57.10  ? 1462 PHE H CE1   1 
ATOM   9848  C CE2   . PHE H 5 63  ? -83.077  -19.322 56.999 1.00 56.82  ? 1462 PHE H CE2   1 
ATOM   9849  C CZ    . PHE H 5 63  ? -82.182  -19.422 55.941 1.00 56.71  ? 1462 PHE H CZ    1 
ATOM   9850  N N     . VAL H 5 64  ? -84.312  -23.025 59.202 1.00 56.30  ? 1463 VAL H N     1 
ATOM   9851  C CA    . VAL H 5 64  ? -83.541  -22.790 60.412 1.00 56.66  ? 1463 VAL H CA    1 
ATOM   9852  C C     . VAL H 5 64  ? -82.735  -24.005 60.854 1.00 58.21  ? 1463 VAL H C     1 
ATOM   9853  O O     . VAL H 5 64  ? -81.554  -23.872 61.185 1.00 57.88  ? 1463 VAL H O     1 
ATOM   9854  C CB    . VAL H 5 64  ? -84.416  -22.334 61.599 1.00 55.83  ? 1463 VAL H CB    1 
ATOM   9855  C CG1   . VAL H 5 64  ? -83.524  -22.073 62.796 1.00 51.52  ? 1463 VAL H CG1   1 
ATOM   9856  C CG2   . VAL H 5 64  ? -85.182  -21.055 61.246 1.00 51.63  ? 1463 VAL H CG2   1 
ATOM   9857  N N     . ASN H 5 65  ? -83.348  -25.186 60.862 1.00 52.58  ? 1464 ASN H N     1 
ATOM   9858  C CA    . ASN H 5 65  ? -82.609  -26.380 61.277 1.00 55.39  ? 1464 ASN H CA    1 
ATOM   9859  C C     . ASN H 5 65  ? -81.413  -26.695 60.371 1.00 56.01  ? 1464 ASN H C     1 
ATOM   9860  O O     . ASN H 5 65  ? -80.350  -27.108 60.860 1.00 55.01  ? 1464 ASN H O     1 
ATOM   9861  C CB    . ASN H 5 65  ? -83.532  -27.602 61.364 1.00 59.11  ? 1464 ASN H CB    1 
ATOM   9862  C CG    . ASN H 5 65  ? -84.469  -27.551 62.571 1.00 63.49  ? 1464 ASN H CG    1 
ATOM   9863  O OD1   . ASN H 5 65  ? -84.048  -27.252 63.688 1.00 65.86  ? 1464 ASN H OD1   1 
ATOM   9864  N ND2   . ASN H 5 65  ? -85.745  -27.859 62.344 1.00 65.26  ? 1464 ASN H ND2   1 
ATOM   9865  N N     . ASP H 5 66  ? -81.572  -26.487 59.063 1.00 49.52  ? 1465 ASP H N     1 
ATOM   9866  C CA    . ASP H 5 66  ? -80.490  -26.750 58.116 1.00 50.03  ? 1465 ASP H CA    1 
ATOM   9867  C C     . ASP H 5 66  ? -79.315  -25.775 58.285 1.00 49.09  ? 1465 ASP H C     1 
ATOM   9868  O O     . ASP H 5 66  ? -78.187  -26.184 58.596 1.00 45.59  ? 1465 ASP H O     1 
ATOM   9869  C CB    . ASP H 5 66  ? -81.022  -26.689 56.681 1.00 57.40  ? 1465 ASP H CB    1 
ATOM   9870  C CG    . ASP H 5 66  ? -79.960  -27.022 55.647 1.00 60.91  ? 1465 ASP H CG    1 
ATOM   9871  O OD1   . ASP H 5 66  ? -78.969  -27.706 56.003 1.00 64.34  ? 1465 ASP H OD1   1 
ATOM   9872  O OD2   . ASP H 5 66  ? -80.126  -26.616 54.478 1.00 61.71  ? 1465 ASP H OD2   1 
ATOM   9873  N N     . VAL H 5 67  ? -79.572  -24.486 58.087 1.00 49.92  ? 1466 VAL H N     1 
ATOM   9874  C CA    . VAL H 5 67  ? -78.515  -23.495 58.232 1.00 50.58  ? 1466 VAL H CA    1 
ATOM   9875  C C     . VAL H 5 67  ? -77.848  -23.690 59.566 1.00 51.19  ? 1466 VAL H C     1 
ATOM   9876  O O     . VAL H 5 67  ? -76.615  -23.652 59.664 1.00 50.39  ? 1466 VAL H O     1 
ATOM   9877  C CB    . VAL H 5 67  ? -79.035  -22.060 58.228 1.00 51.62  ? 1466 VAL H CB    1 
ATOM   9878  C CG1   . VAL H 5 67  ? -77.847  -21.107 58.349 1.00 50.96  ? 1466 VAL H CG1   1 
ATOM   9879  C CG2   . VAL H 5 67  ? -79.872  -21.795 56.967 1.00 50.79  ? 1466 VAL H CG2   1 
ATOM   9880  N N     . PHE H 5 68  ? -78.671  -23.874 60.598 1.00 48.85  ? 1467 PHE H N     1 
ATOM   9881  C CA    . PHE H 5 68  ? -78.128  -24.075 61.925 1.00 49.75  ? 1467 PHE H CA    1 
ATOM   9882  C C     . PHE H 5 68  ? -77.076  -25.153 61.818 1.00 50.32  ? 1467 PHE H C     1 
ATOM   9883  O O     . PHE H 5 68  ? -75.917  -24.932 62.174 1.00 49.53  ? 1467 PHE H O     1 
ATOM   9884  C CB    . PHE H 5 68  ? -79.187  -24.541 62.919 1.00 55.15  ? 1467 PHE H CB    1 
ATOM   9885  C CG    . PHE H 5 68  ? -78.625  -24.863 64.288 1.00 57.47  ? 1467 PHE H CG    1 
ATOM   9886  C CD1   . PHE H 5 68  ? -78.771  -23.973 65.346 1.00 58.68  ? 1467 PHE H CD1   1 
ATOM   9887  C CD2   . PHE H 5 68  ? -77.903  -26.040 64.506 1.00 58.64  ? 1467 PHE H CD2   1 
ATOM   9888  C CE1   . PHE H 5 68  ? -78.199  -24.253 66.606 1.00 59.76  ? 1467 PHE H CE1   1 
ATOM   9889  C CE2   . PHE H 5 68  ? -77.334  -26.321 65.746 1.00 58.39  ? 1467 PHE H CE2   1 
ATOM   9890  C CZ    . PHE H 5 68  ? -77.481  -25.426 66.798 1.00 58.08  ? 1467 PHE H CZ    1 
ATOM   9891  N N     . GLU H 5 69  ? -77.481  -26.320 61.317 1.00 51.03  ? 1468 GLU H N     1 
ATOM   9892  C CA    . GLU H 5 69  ? -76.563  -27.442 61.188 1.00 52.68  ? 1468 GLU H CA    1 
ATOM   9893  C C     . GLU H 5 69  ? -75.315  -27.137 60.344 1.00 50.96  ? 1468 GLU H C     1 
ATOM   9894  O O     . GLU H 5 69  ? -74.186  -27.452 60.741 1.00 50.97  ? 1468 GLU H O     1 
ATOM   9895  C CB    . GLU H 5 69  ? -77.310  -28.657 60.626 1.00 80.94  ? 1468 GLU H CB    1 
ATOM   9896  C CG    . GLU H 5 69  ? -76.464  -29.918 60.488 1.00 91.21  ? 1468 GLU H CG    1 
ATOM   9897  C CD    . GLU H 5 69  ? -75.611  -30.200 61.715 1.00 97.36  ? 1468 GLU H CD    1 
ATOM   9898  O OE1   . GLU H 5 69  ? -76.109  -30.036 62.851 1.00 101.72 ? 1468 GLU H OE1   1 
ATOM   9899  O OE2   . GLU H 5 69  ? -74.438  -30.597 61.538 1.00 100.85 ? 1468 GLU H OE2   1 
ATOM   9900  N N     . ARG H 5 70  ? -75.507  -26.510 59.192 1.00 59.06  ? 1469 ARG H N     1 
ATOM   9901  C CA    . ARG H 5 70  ? -74.373  -26.212 58.344 1.00 56.93  ? 1469 ARG H CA    1 
ATOM   9902  C C     . ARG H 5 70  ? -73.383  -25.352 59.095 1.00 56.58  ? 1469 ARG H C     1 
ATOM   9903  O O     . ARG H 5 70  ? -72.178  -25.628 59.073 1.00 54.74  ? 1469 ARG H O     1 
ATOM   9904  C CB    . ARG H 5 70  ? -74.808  -25.483 57.089 1.00 46.97  ? 1469 ARG H CB    1 
ATOM   9905  C CG    . ARG H 5 70  ? -76.007  -26.073 56.366 1.00 47.41  ? 1469 ARG H CG    1 
ATOM   9906  C CD    . ARG H 5 70  ? -76.176  -25.313 55.076 1.00 48.78  ? 1469 ARG H CD    1 
ATOM   9907  N NE    . ARG H 5 70  ? -77.378  -25.648 54.337 1.00 52.68  ? 1469 ARG H NE    1 
ATOM   9908  C CZ    . ARG H 5 70  ? -77.674  -25.101 53.166 1.00 56.14  ? 1469 ARG H CZ    1 
ATOM   9909  N NH1   . ARG H 5 70  ? -76.843  -24.213 52.639 1.00 57.45  ? 1469 ARG H NH1   1 
ATOM   9910  N NH2   . ARG H 5 70  ? -78.792  -25.428 52.526 1.00 55.06  ? 1469 ARG H NH2   1 
ATOM   9911  N N     . ILE H 5 71  ? -73.881  -24.313 59.764 1.00 46.83  ? 1470 ILE H N     1 
ATOM   9912  C CA    . ILE H 5 71  ? -72.997  -23.427 60.512 1.00 48.59  ? 1470 ILE H CA    1 
ATOM   9913  C C     . ILE H 5 71  ? -72.307  -24.153 61.669 1.00 48.73  ? 1470 ILE H C     1 
ATOM   9914  O O     . ILE H 5 71  ? -71.107  -23.996 61.893 1.00 49.49  ? 1470 ILE H O     1 
ATOM   9915  C CB    . ILE H 5 71  ? -73.759  -22.208 61.054 1.00 43.55  ? 1470 ILE H CB    1 
ATOM   9916  C CG1   . ILE H 5 71  ? -74.269  -21.368 59.880 1.00 42.24  ? 1470 ILE H CG1   1 
ATOM   9917  C CG2   . ILE H 5 71  ? -72.840  -21.368 61.957 1.00 42.36  ? 1470 ILE H CG2   1 
ATOM   9918  C CD1   . ILE H 5 71  ? -75.155  -20.233 60.294 1.00 40.88  ? 1470 ILE H CD1   1 
ATOM   9919  N N     . ALA H 5 72  ? -73.065  -24.956 62.398 1.00 55.41  ? 1471 ALA H N     1 
ATOM   9920  C CA    . ALA H 5 72  ? -72.513  -25.695 63.518 1.00 55.13  ? 1471 ALA H CA    1 
ATOM   9921  C C     . ALA H 5 72  ? -71.469  -26.688 63.004 1.00 55.38  ? 1471 ALA H C     1 
ATOM   9922  O O     . ALA H 5 72  ? -70.431  -26.892 63.637 1.00 54.83  ? 1471 ALA H O     1 
ATOM   9923  C CB    . ALA H 5 72  ? -73.628  -26.413 64.241 1.00 50.96  ? 1471 ALA H CB    1 
ATOM   9924  N N     . GLY H 5 73  ? -71.748  -27.300 61.853 1.00 48.35  ? 1472 GLY H N     1 
ATOM   9925  C CA    . GLY H 5 73  ? -70.812  -28.243 61.266 1.00 48.77  ? 1472 GLY H CA    1 
ATOM   9926  C C     . GLY H 5 73  ? -69.472  -27.593 60.891 1.00 49.50  ? 1472 GLY H C     1 
ATOM   9927  O O     . GLY H 5 73  ? -68.384  -28.080 61.273 1.00 48.79  ? 1472 GLY H O     1 
ATOM   9928  N N     . GLU H 5 74  ? -69.526  -26.488 60.143 1.00 61.09  ? 1473 GLU H N     1 
ATOM   9929  C CA    . GLU H 5 74  ? -68.292  -25.816 59.745 1.00 60.27  ? 1473 GLU H CA    1 
ATOM   9930  C C     . GLU H 5 74  ? -67.513  -25.366 60.990 1.00 59.08  ? 1473 GLU H C     1 
ATOM   9931  O O     . GLU H 5 74  ? -66.284  -25.533 61.069 1.00 58.14  ? 1473 GLU H O     1 
ATOM   9932  C CB    . GLU H 5 74  ? -68.594  -24.607 58.852 1.00 64.63  ? 1473 GLU H CB    1 
ATOM   9933  C CG    . GLU H 5 74  ? -67.948  -24.646 57.458 1.00 64.71  ? 1473 GLU H CG    1 
ATOM   9934  C CD    . GLU H 5 74  ? -66.457  -25.025 57.453 1.00 65.86  ? 1473 GLU H CD    1 
ATOM   9935  O OE1   . GLU H 5 74  ? -65.651  -24.385 58.155 1.00 66.49  ? 1473 GLU H OE1   1 
ATOM   9936  O OE2   . GLU H 5 74  ? -66.081  -25.967 56.727 1.00 66.67  ? 1473 GLU H OE2   1 
ATOM   9937  N N     . ALA H 5 75  ? -68.243  -24.814 61.961 1.00 48.03  ? 1474 ALA H N     1 
ATOM   9938  C CA    . ALA H 5 75  ? -67.650  -24.320 63.204 1.00 47.54  ? 1474 ALA H CA    1 
ATOM   9939  C C     . ALA H 5 75  ? -66.779  -25.344 63.918 1.00 47.08  ? 1474 ALA H C     1 
ATOM   9940  O O     . ALA H 5 75  ? -65.564  -25.154 64.049 1.00 47.58  ? 1474 ALA H O     1 
ATOM   9941  C CB    . ALA H 5 75  ? -68.737  -23.831 64.139 1.00 79.40  ? 1474 ALA H CB    1 
ATOM   9942  N N     . SER H 5 76  ? -67.390  -26.429 64.383 1.00 53.44  ? 1475 SER H N     1 
ATOM   9943  C CA    . SER H 5 76  ? -66.624  -27.463 65.077 1.00 55.30  ? 1475 SER H CA    1 
ATOM   9944  C C     . SER H 5 76  ? -65.459  -27.923 64.214 1.00 57.18  ? 1475 SER H C     1 
ATOM   9945  O O     . SER H 5 76  ? -64.384  -28.232 64.718 1.00 57.05  ? 1475 SER H O     1 
ATOM   9946  C CB    . SER H 5 76  ? -67.510  -28.655 65.405 1.00 64.07  ? 1475 SER H CB    1 
ATOM   9947  O OG    . SER H 5 76  ? -68.194  -29.089 64.251 1.00 63.91  ? 1475 SER H OG    1 
ATOM   9948  N N     . ARG H 5 77  ? -65.679  -27.953 62.905 1.00 53.24  ? 1476 ARG H N     1 
ATOM   9949  C CA    . ARG H 5 77  ? -64.638  -28.367 61.987 1.00 55.90  ? 1476 ARG H CA    1 
ATOM   9950  C C     . ARG H 5 77  ? -63.445  -27.389 62.006 1.00 55.87  ? 1476 ARG H C     1 
ATOM   9951  O O     . ARG H 5 77  ? -62.293  -27.820 61.992 1.00 54.45  ? 1476 ARG H O     1 
ATOM   9952  C CB    . ARG H 5 77  ? -65.221  -28.511 60.580 1.00 57.83  ? 1476 ARG H CB    1 
ATOM   9953  C CG    . ARG H 5 77  ? -64.738  -29.768 59.876 1.00 64.17  ? 1476 ARG H CG    1 
ATOM   9954  C CD    . ARG H 5 77  ? -65.267  -29.916 58.444 1.00 69.28  ? 1476 ARG H CD    1 
ATOM   9955  N NE    . ARG H 5 77  ? -66.693  -30.237 58.374 1.00 72.67  ? 1476 ARG H NE    1 
ATOM   9956  C CZ    . ARG H 5 77  ? -67.645  -29.376 58.015 1.00 74.73  ? 1476 ARG H CZ    1 
ATOM   9957  N NH1   . ARG H 5 77  ? -67.330  -28.128 57.695 1.00 73.15  ? 1476 ARG H NH1   1 
ATOM   9958  N NH2   . ARG H 5 77  ? -68.916  -29.763 57.960 1.00 77.61  ? 1476 ARG H NH2   1 
ATOM   9959  N N     . LEU H 5 78  ? -63.710  -26.082 62.049 1.00 65.99  ? 1477 LEU H N     1 
ATOM   9960  C CA    . LEU H 5 78  ? -62.625  -25.094 62.090 1.00 67.63  ? 1477 LEU H CA    1 
ATOM   9961  C C     . LEU H 5 78  ? -61.836  -25.325 63.358 1.00 69.08  ? 1477 LEU H C     1 
ATOM   9962  O O     . LEU H 5 78  ? -60.600  -25.349 63.359 1.00 70.29  ? 1477 LEU H O     1 
ATOM   9963  C CB    . LEU H 5 78  ? -63.175  -23.666 62.133 1.00 52.19  ? 1477 LEU H CB    1 
ATOM   9964  C CG    . LEU H 5 78  ? -63.690  -23.124 60.810 1.00 50.83  ? 1477 LEU H CG    1 
ATOM   9965  C CD1   . LEU H 5 78  ? -64.639  -21.993 61.068 1.00 52.54  ? 1477 LEU H CD1   1 
ATOM   9966  C CD2   . LEU H 5 78  ? -62.534  -22.677 59.950 1.00 45.83  ? 1477 LEU H CD2   1 
ATOM   9967  N N     . ALA H 5 79  ? -62.583  -25.479 64.445 1.00 72.68  ? 1478 ALA H N     1 
ATOM   9968  C CA    . ALA H 5 79  ? -62.005  -25.704 65.749 1.00 73.82  ? 1478 ALA H CA    1 
ATOM   9969  C C     . ALA H 5 79  ? -61.123  -26.935 65.676 1.00 74.57  ? 1478 ALA H C     1 
ATOM   9970  O O     . ALA H 5 79  ? -59.974  -26.906 66.115 1.00 75.87  ? 1478 ALA H O     1 
ATOM   9971  C CB    . ALA H 5 79  ? -63.095  -25.896 66.750 1.00 49.36  ? 1478 ALA H CB    1 
ATOM   9972  N N     . HIS H 5 80  ? -61.652  -28.019 65.119 1.00 52.47  ? 1479 HIS H N     1 
ATOM   9973  C CA    . HIS H 5 80  ? -60.857  -29.229 64.990 1.00 54.39  ? 1479 HIS H CA    1 
ATOM   9974  C C     . HIS H 5 80  ? -59.537  -28.941 64.255 1.00 54.91  ? 1479 HIS H C     1 
ATOM   9975  O O     . HIS H 5 80  ? -58.467  -29.104 64.842 1.00 54.06  ? 1479 HIS H O     1 
ATOM   9976  C CB    . HIS H 5 80  ? -61.626  -30.316 64.248 1.00 95.54  ? 1479 HIS H CB    1 
ATOM   9977  C CG    . HIS H 5 80  ? -60.899  -31.622 64.180 1.00 97.79  ? 1479 HIS H CG    1 
ATOM   9978  N ND1   . HIS H 5 80  ? -60.578  -32.354 65.304 1.00 98.69  ? 1479 HIS H ND1   1 
ATOM   9979  C CD2   . HIS H 5 80  ? -60.436  -32.334 63.124 1.00 97.45  ? 1479 HIS H CD2   1 
ATOM   9980  C CE1   . HIS H 5 80  ? -59.951  -33.461 64.943 1.00 98.76  ? 1479 HIS H CE1   1 
ATOM   9981  N NE2   . HIS H 5 80  ? -59.852  -33.474 63.626 1.00 98.73  ? 1479 HIS H NE2   1 
ATOM   9982  N N     . TYR H 5 81  ? -59.606  -28.498 62.995 1.00 67.93  ? 1480 TYR H N     1 
ATOM   9983  C CA    . TYR H 5 81  ? -58.389  -28.223 62.218 1.00 71.14  ? 1480 TYR H CA    1 
ATOM   9984  C C     . TYR H 5 81  ? -57.373  -27.432 63.020 1.00 70.14  ? 1480 TYR H C     1 
ATOM   9985  O O     . TYR H 5 81  ? -56.175  -27.712 62.983 1.00 69.76  ? 1480 TYR H O     1 
ATOM   9986  C CB    . TYR H 5 81  ? -58.682  -27.436 60.934 1.00 71.70  ? 1480 TYR H CB    1 
ATOM   9987  C CG    . TYR H 5 81  ? -59.617  -28.107 59.948 1.00 77.71  ? 1480 TYR H CG    1 
ATOM   9988  C CD1   . TYR H 5 81  ? -59.916  -29.468 60.037 1.00 79.38  ? 1480 TYR H CD1   1 
ATOM   9989  C CD2   . TYR H 5 81  ? -60.226  -27.367 58.926 1.00 80.91  ? 1480 TYR H CD2   1 
ATOM   9990  C CE1   . TYR H 5 81  ? -60.808  -30.070 59.137 1.00 82.07  ? 1480 TYR H CE1   1 
ATOM   9991  C CE2   . TYR H 5 81  ? -61.117  -27.964 58.021 1.00 82.25  ? 1480 TYR H CE2   1 
ATOM   9992  C CZ    . TYR H 5 81  ? -61.402  -29.309 58.133 1.00 82.47  ? 1480 TYR H CZ    1 
ATOM   9993  O OH    . TYR H 5 81  ? -62.275  -29.893 57.243 1.00 84.20  ? 1480 TYR H OH    1 
ATOM   9994  N N     . ASN H 5 82  ? -57.850  -26.443 63.757 1.00 69.64  ? 1481 ASN H N     1 
ATOM   9995  C CA    . ASN H 5 82  ? -56.946  -25.626 64.534 1.00 71.21  ? 1481 ASN H CA    1 
ATOM   9996  C C     . ASN H 5 82  ? -56.639  -26.158 65.935 1.00 71.17  ? 1481 ASN H C     1 
ATOM   9997  O O     . ASN H 5 82  ? -56.181  -25.423 66.808 1.00 71.51  ? 1481 ASN H O     1 
ATOM   9998  C CB    . ASN H 5 82  ? -57.491  -24.205 64.559 1.00 60.54  ? 1481 ASN H CB    1 
ATOM   9999  C CG    . ASN H 5 82  ? -57.495  -23.585 63.176 1.00 61.62  ? 1481 ASN H CG    1 
ATOM   10000 O OD1   . ASN H 5 82  ? -56.433  -23.328 62.600 1.00 61.72  ? 1481 ASN H OD1   1 
ATOM   10001 N ND2   . ASN H 5 82  ? -58.688  -23.368 62.618 1.00 62.67  ? 1481 ASN H ND2   1 
ATOM   10002 N N     . LYS H 5 83  ? -56.868  -27.451 66.136 1.00 69.16  ? 1482 LYS H N     1 
ATOM   10003 C CA    . LYS H 5 83  ? -56.599  -28.089 67.419 1.00 68.29  ? 1482 LYS H CA    1 
ATOM   10004 C C     . LYS H 5 83  ? -57.193  -27.352 68.622 1.00 68.48  ? 1482 LYS H C     1 
ATOM   10005 O O     . LYS H 5 83  ? -56.648  -27.427 69.725 1.00 68.60  ? 1482 LYS H O     1 
ATOM   10006 C CB    . LYS H 5 83  ? -55.086  -28.259 67.613 1.00 93.46  ? 1482 LYS H CB    1 
ATOM   10007 C CG    . LYS H 5 83  ? -54.439  -29.257 66.661 1.00 94.52  ? 1482 LYS H CG    1 
ATOM   10008 C CD    . LYS H 5 83  ? -54.458  -28.752 65.221 1.00 97.09  ? 1482 LYS H CD    1 
ATOM   10009 C CE    . LYS H 5 83  ? -54.019  -29.824 64.217 1.00 99.60  ? 1482 LYS H CE    1 
ATOM   10010 N NZ    . LYS H 5 83  ? -52.615  -30.295 64.417 1.00 99.77  ? 1482 LYS H NZ    1 
ATOM   10011 N N     . ARG H 5 84  ? -58.299  -26.637 68.404 1.00 65.31  ? 1483 ARG H N     1 
ATOM   10012 C CA    . ARG H 5 84  ? -58.975  -25.913 69.475 1.00 65.87  ? 1483 ARG H CA    1 
ATOM   10013 C C     . ARG H 5 84  ? -60.052  -26.836 70.016 1.00 66.28  ? 1483 ARG H C     1 
ATOM   10014 O O     . ARG H 5 84  ? -60.511  -27.735 69.314 1.00 65.26  ? 1483 ARG H O     1 
ATOM   10015 C CB    . ARG H 5 84  ? -59.628  -24.633 68.959 1.00 118.99 ? 1483 ARG H CB    1 
ATOM   10016 C CG    . ARG H 5 84  ? -58.673  -23.538 68.520 1.00 123.82 ? 1483 ARG H CG    1 
ATOM   10017 C CD    . ARG H 5 84  ? -59.388  -22.200 68.602 1.00 127.41 ? 1483 ARG H CD    1 
ATOM   10018 N NE    . ARG H 5 84  ? -59.016  -21.274 67.539 1.00 130.68 ? 1483 ARG H NE    1 
ATOM   10019 C CZ    . ARG H 5 84  ? -59.593  -20.090 67.359 1.00 132.95 ? 1483 ARG H CZ    1 
ATOM   10020 N NH1   . ARG H 5 84  ? -60.563  -19.698 68.174 1.00 132.96 ? 1483 ARG H NH1   1 
ATOM   10021 N NH2   . ARG H 5 84  ? -59.210  -19.300 66.367 1.00 133.82 ? 1483 ARG H NH2   1 
ATOM   10022 N N     . SER H 5 85  ? -60.462  -26.619 71.260 1.00 79.29  ? 1484 SER H N     1 
ATOM   10023 C CA    . SER H 5 85  ? -61.484  -27.458 71.883 1.00 78.70  ? 1484 SER H CA    1 
ATOM   10024 C C     . SER H 5 85  ? -62.730  -26.655 72.217 1.00 77.16  ? 1484 SER H C     1 
ATOM   10025 O O     . SER H 5 85  ? -63.628  -27.144 72.898 1.00 78.08  ? 1484 SER H O     1 
ATOM   10026 C CB    . SER H 5 85  ? -60.937  -28.081 73.163 1.00 83.85  ? 1484 SER H CB    1 
ATOM   10027 O OG    . SER H 5 85  ? -60.567  -27.071 74.085 1.00 87.15  ? 1484 SER H OG    1 
ATOM   10028 N N     . THR H 5 86  ? -62.783  -25.418 71.738 1.00 75.87  ? 1485 THR H N     1 
ATOM   10029 C CA    . THR H 5 86  ? -63.930  -24.575 72.013 1.00 74.23  ? 1485 THR H CA    1 
ATOM   10030 C C     . THR H 5 86  ? -64.524  -23.942 70.764 1.00 72.51  ? 1485 THR H C     1 
ATOM   10031 O O     . THR H 5 86  ? -63.818  -23.315 69.987 1.00 73.31  ? 1485 THR H O     1 
ATOM   10032 C CB    . THR H 5 86  ? -63.562  -23.415 72.935 1.00 76.00  ? 1485 THR H CB    1 
ATOM   10033 O OG1   . THR H 5 86  ? -62.717  -23.884 73.991 1.00 77.58  ? 1485 THR H OG1   1 
ATOM   10034 C CG2   . THR H 5 86  ? -64.827  -22.803 73.518 1.00 75.84  ? 1485 THR H CG2   1 
ATOM   10035 N N     . ILE H 5 87  ? -65.823  -24.115 70.573 1.00 59.09  ? 1486 ILE H N     1 
ATOM   10036 C CA    . ILE H 5 87  ? -66.478  -23.484 69.451 1.00 56.28  ? 1486 ILE H CA    1 
ATOM   10037 C C     . ILE H 5 87  ? -66.843  -22.141 70.033 1.00 56.01  ? 1486 ILE H C     1 
ATOM   10038 O O     . ILE H 5 87  ? -67.491  -22.064 71.073 1.00 56.38  ? 1486 ILE H O     1 
ATOM   10039 C CB    . ILE H 5 87  ? -67.759  -24.228 69.034 1.00 54.03  ? 1486 ILE H CB    1 
ATOM   10040 C CG1   . ILE H 5 87  ? -67.403  -25.578 68.414 1.00 51.11  ? 1486 ILE H CG1   1 
ATOM   10041 C CG2   . ILE H 5 87  ? -68.570  -23.366 68.086 1.00 52.24  ? 1486 ILE H CG2   1 
ATOM   10042 C CD1   . ILE H 5 87  ? -68.631  -26.367 67.970 1.00 46.84  ? 1486 ILE H CD1   1 
ATOM   10043 N N     . THR H 5 88  ? -66.392  -21.083 69.381 1.00 58.43  ? 1487 THR H N     1 
ATOM   10044 C CA    . THR H 5 88  ? -66.664  -19.740 69.861 1.00 57.95  ? 1487 THR H CA    1 
ATOM   10045 C C     . THR H 5 88  ? -67.263  -18.914 68.748 1.00 57.09  ? 1487 THR H C     1 
ATOM   10046 O O     . THR H 5 88  ? -67.353  -19.366 67.607 1.00 56.74  ? 1487 THR H O     1 
ATOM   10047 C CB    . THR H 5 88  ? -65.375  -19.049 70.311 1.00 51.06  ? 1487 THR H CB    1 
ATOM   10048 O OG1   . THR H 5 88  ? -64.609  -18.686 69.154 1.00 45.94  ? 1487 THR H OG1   1 
ATOM   10049 C CG2   . THR H 5 88  ? -64.551  -19.988 71.200 1.00 51.39  ? 1487 THR H CG2   1 
ATOM   10050 N N     . SER H 5 89  ? -67.653  -17.691 69.078 1.00 57.28  ? 1488 SER H N     1 
ATOM   10051 C CA    . SER H 5 89  ? -68.243  -16.806 68.092 1.00 58.37  ? 1488 SER H CA    1 
ATOM   10052 C C     . SER H 5 89  ? -67.287  -16.595 66.926 1.00 57.37  ? 1488 SER H C     1 
ATOM   10053 O O     . SER H 5 89  ? -67.712  -16.328 65.815 1.00 56.89  ? 1488 SER H O     1 
ATOM   10054 C CB    . SER H 5 89  ? -68.619  -15.473 68.741 1.00 100.64 ? 1488 SER H CB    1 
ATOM   10055 O OG    . SER H 5 89  ? -67.638  -15.076 69.678 1.00 105.28 ? 1488 SER H OG    1 
ATOM   10056 N N     . ARG H 5 90  ? -65.994  -16.737 67.170 1.00 61.43  ? 1489 ARG H N     1 
ATOM   10057 C CA    . ARG H 5 90  ? -65.017  -16.558 66.102 1.00 61.47  ? 1489 ARG H CA    1 
ATOM   10058 C C     . ARG H 5 90  ? -65.247  -17.624 65.029 1.00 61.80  ? 1489 ARG H C     1 
ATOM   10059 O O     . ARG H 5 90  ? -65.249  -17.323 63.827 1.00 63.06  ? 1489 ARG H O     1 
ATOM   10060 C CB    . ARG H 5 90  ? -63.590  -16.669 66.664 1.00 62.25  ? 1489 ARG H CB    1 
ATOM   10061 C CG    . ARG H 5 90  ? -62.490  -16.430 65.653 1.00 62.02  ? 1489 ARG H CG    1 
ATOM   10062 C CD    . ARG H 5 90  ? -61.611  -15.273 66.050 1.00 62.53  ? 1489 ARG H CD    1 
ATOM   10063 N NE    . ARG H 5 90  ? -60.651  -14.969 64.994 1.00 64.61  ? 1489 ARG H NE    1 
ATOM   10064 C CZ    . ARG H 5 90  ? -59.743  -15.831 64.542 1.00 66.36  ? 1489 ARG H CZ    1 
ATOM   10065 N NH1   . ARG H 5 90  ? -59.670  -17.056 65.063 1.00 67.33  ? 1489 ARG H NH1   1 
ATOM   10066 N NH2   . ARG H 5 90  ? -58.915  -15.472 63.561 1.00 65.71  ? 1489 ARG H NH2   1 
ATOM   10067 N N     . GLU H 5 91  ? -65.437  -18.869 65.467 1.00 60.33  ? 1490 GLU H N     1 
ATOM   10068 C CA    . GLU H 5 91  ? -65.688  -19.962 64.544 1.00 59.34  ? 1490 GLU H CA    1 
ATOM   10069 C C     . GLU H 5 91  ? -67.015  -19.729 63.833 1.00 57.97  ? 1490 GLU H C     1 
ATOM   10070 O O     . GLU H 5 91  ? -67.083  -19.752 62.599 1.00 60.22  ? 1490 GLU H O     1 
ATOM   10071 C CB    . GLU H 5 91  ? -65.732  -21.291 65.284 1.00 69.36  ? 1490 GLU H CB    1 
ATOM   10072 C CG    . GLU H 5 91  ? -64.366  -21.853 65.638 1.00 76.04  ? 1490 GLU H CG    1 
ATOM   10073 C CD    . GLU H 5 91  ? -63.585  -20.976 66.595 1.00 80.82  ? 1490 GLU H CD    1 
ATOM   10074 O OE1   . GLU H 5 91  ? -64.019  -20.798 67.756 1.00 82.75  ? 1490 GLU H OE1   1 
ATOM   10075 O OE2   . GLU H 5 91  ? -62.524  -20.466 66.184 1.00 83.91  ? 1490 GLU H OE2   1 
ATOM   10076 N N     . ILE H 5 92  ? -68.073  -19.484 64.598 1.00 55.92  ? 1491 ILE H N     1 
ATOM   10077 C CA    . ILE H 5 92  ? -69.364  -19.252 63.976 1.00 53.96  ? 1491 ILE H CA    1 
ATOM   10078 C C     . ILE H 5 92  ? -69.222  -18.236 62.858 1.00 55.20  ? 1491 ILE H C     1 
ATOM   10079 O O     . ILE H 5 92  ? -69.780  -18.417 61.768 1.00 56.07  ? 1491 ILE H O     1 
ATOM   10080 C CB    . ILE H 5 92  ? -70.424  -18.739 64.979 1.00 54.61  ? 1491 ILE H CB    1 
ATOM   10081 C CG1   . ILE H 5 92  ? -71.099  -19.911 65.677 1.00 51.27  ? 1491 ILE H CG1   1 
ATOM   10082 C CG2   . ILE H 5 92  ? -71.509  -17.985 64.260 1.00 52.16  ? 1491 ILE H CG2   1 
ATOM   10083 C CD1   . ILE H 5 92  ? -70.253  -20.575 66.706 1.00 39.40  ? 1491 ILE H CD1   1 
ATOM   10084 N N     . GLN H 5 93  ? -68.460  -17.176 63.115 1.00 55.05  ? 1492 GLN H N     1 
ATOM   10085 C CA    . GLN H 5 93  ? -68.288  -16.125 62.116 1.00 55.30  ? 1492 GLN H CA    1 
ATOM   10086 C C     . GLN H 5 93  ? -67.647  -16.650 60.847 1.00 54.51  ? 1492 GLN H C     1 
ATOM   10087 O O     . GLN H 5 93  ? -68.214  -16.539 59.754 1.00 54.96  ? 1492 GLN H O     1 
ATOM   10088 C CB    . GLN H 5 93  ? -67.441  -14.983 62.660 1.00 48.16  ? 1492 GLN H CB    1 
ATOM   10089 C CG    . GLN H 5 93  ? -67.637  -13.715 61.858 1.00 50.31  ? 1492 GLN H CG    1 
ATOM   10090 C CD    . GLN H 5 93  ? -66.867  -12.566 62.403 1.00 48.85  ? 1492 GLN H CD    1 
ATOM   10091 O OE1   . GLN H 5 93  ? -65.643  -12.534 62.303 1.00 51.95  ? 1492 GLN H OE1   1 
ATOM   10092 N NE2   . GLN H 5 93  ? -67.570  -11.612 63.001 1.00 50.40  ? 1492 GLN H NE2   1 
ATOM   10093 N N     . THR H 5 94  ? -66.451  -17.203 61.004 1.00 60.04  ? 1493 THR H N     1 
ATOM   10094 C CA    . THR H 5 94  ? -65.740  -17.772 59.888 1.00 59.45  ? 1493 THR H CA    1 
ATOM   10095 C C     . THR H 5 94  ? -66.728  -18.712 59.215 1.00 59.80  ? 1493 THR H C     1 
ATOM   10096 O O     . THR H 5 94  ? -66.937  -18.643 58.000 1.00 60.65  ? 1493 THR H O     1 
ATOM   10097 C CB    . THR H 5 94  ? -64.515  -18.560 60.377 1.00 51.52  ? 1493 THR H CB    1 
ATOM   10098 O OG1   . THR H 5 94  ? -63.606  -17.661 61.006 1.00 53.91  ? 1493 THR H OG1   1 
ATOM   10099 C CG2   . THR H 5 94  ? -63.802  -19.253 59.221 1.00 51.58  ? 1493 THR H CG2   1 
ATOM   10100 N N     . ALA H 5 95  ? -67.357  -19.576 60.008 1.00 41.36  ? 1494 ALA H N     1 
ATOM   10101 C CA    . ALA H 5 95  ? -68.318  -20.514 59.443 1.00 41.77  ? 1494 ALA H CA    1 
ATOM   10102 C C     . ALA H 5 95  ? -69.282  -19.758 58.530 1.00 41.88  ? 1494 ALA H C     1 
ATOM   10103 O O     . ALA H 5 95  ? -69.482  -20.108 57.353 1.00 40.88  ? 1494 ALA H O     1 
ATOM   10104 C CB    . ALA H 5 95  ? -69.087  -21.216 60.544 1.00 54.55  ? 1494 ALA H CB    1 
ATOM   10105 N N     . VAL H 5 96  ? -69.859  -18.699 59.077 1.00 52.35  ? 1495 VAL H N     1 
ATOM   10106 C CA    . VAL H 5 96  ? -70.802  -17.901 58.324 1.00 52.46  ? 1495 VAL H CA    1 
ATOM   10107 C C     . VAL H 5 96  ? -70.208  -17.399 57.007 1.00 54.84  ? 1495 VAL H C     1 
ATOM   10108 O O     . VAL H 5 96  ? -70.841  -17.505 55.957 1.00 55.73  ? 1495 VAL H O     1 
ATOM   10109 C CB    . VAL H 5 96  ? -71.312  -16.743 59.193 1.00 49.80  ? 1495 VAL H CB    1 
ATOM   10110 C CG1   . VAL H 5 96  ? -71.965  -15.678 58.330 1.00 48.36  ? 1495 VAL H CG1   1 
ATOM   10111 C CG2   . VAL H 5 96  ? -72.323  -17.290 60.196 1.00 48.93  ? 1495 VAL H CG2   1 
ATOM   10112 N N     . ARG H 5 97  ? -68.989  -16.874 57.065 1.00 54.16  ? 1496 ARG H N     1 
ATOM   10113 C CA    . ARG H 5 97  ? -68.316  -16.368 55.877 1.00 54.14  ? 1496 ARG H CA    1 
ATOM   10114 C C     . ARG H 5 97  ? -68.133  -17.460 54.845 1.00 54.34  ? 1496 ARG H C     1 
ATOM   10115 O O     . ARG H 5 97  ? -68.286  -17.212 53.648 1.00 55.47  ? 1496 ARG H O     1 
ATOM   10116 C CB    . ARG H 5 97  ? -66.944  -15.791 56.223 1.00 58.70  ? 1496 ARG H CB    1 
ATOM   10117 C CG    . ARG H 5 97  ? -66.991  -14.437 56.844 1.00 62.34  ? 1496 ARG H CG    1 
ATOM   10118 C CD    . ARG H 5 97  ? -65.674  -13.720 56.695 1.00 66.79  ? 1496 ARG H CD    1 
ATOM   10119 N NE    . ARG H 5 97  ? -65.883  -12.274 56.760 1.00 70.06  ? 1496 ARG H NE    1 
ATOM   10120 C CZ    . ARG H 5 97  ? -66.193  -11.595 57.864 1.00 72.91  ? 1496 ARG H CZ    1 
ATOM   10121 N NH1   . ARG H 5 97  ? -66.331  -12.221 59.031 1.00 72.44  ? 1496 ARG H NH1   1 
ATOM   10122 N NH2   . ARG H 5 97  ? -66.372  -10.278 57.800 1.00 73.53  ? 1496 ARG H NH2   1 
ATOM   10123 N N     . LEU H 5 98  ? -67.794  -18.663 55.306 1.00 48.44  ? 1497 LEU H N     1 
ATOM   10124 C CA    . LEU H 5 98  ? -67.588  -19.789 54.402 1.00 49.03  ? 1497 LEU H CA    1 
ATOM   10125 C C     . LEU H 5 98  ? -68.860  -20.338 53.753 1.00 50.35  ? 1497 LEU H C     1 
ATOM   10126 O O     . LEU H 5 98  ? -68.806  -20.874 52.647 1.00 50.90  ? 1497 LEU H O     1 
ATOM   10127 C CB    . LEU H 5 98  ? -66.885  -20.933 55.129 1.00 44.86  ? 1497 LEU H CB    1 
ATOM   10128 C CG    . LEU H 5 98  ? -65.375  -20.776 55.280 1.00 44.01  ? 1497 LEU H CG    1 
ATOM   10129 C CD1   . LEU H 5 98  ? -64.805  -21.931 56.101 1.00 43.16  ? 1497 LEU H CD1   1 
ATOM   10130 C CD2   . LEU H 5 98  ? -64.732  -20.720 53.901 1.00 43.32  ? 1497 LEU H CD2   1 
ATOM   10131 N N     . LEU H 5 99  ? -69.995  -20.186 54.434 1.00 52.72  ? 1498 LEU H N     1 
ATOM   10132 C CA    . LEU H 5 99  ? -71.267  -20.718 53.956 1.00 50.95  ? 1498 LEU H CA    1 
ATOM   10133 C C     . LEU H 5 99  ? -72.235  -19.805 53.220 1.00 50.84  ? 1498 LEU H C     1 
ATOM   10134 O O     . LEU H 5 99  ? -73.072  -20.295 52.464 1.00 50.89  ? 1498 LEU H O     1 
ATOM   10135 C CB    . LEU H 5 99  ? -72.019  -21.341 55.132 1.00 62.35  ? 1498 LEU H CB    1 
ATOM   10136 C CG    . LEU H 5 99  ? -71.285  -22.407 55.950 1.00 63.98  ? 1498 LEU H CG    1 
ATOM   10137 C CD1   . LEU H 5 99  ? -72.097  -22.732 57.206 1.00 66.31  ? 1498 LEU H CD1   1 
ATOM   10138 C CD2   . LEU H 5 99  ? -71.054  -23.655 55.102 1.00 62.59  ? 1498 LEU H CD2   1 
ATOM   10139 N N     . LEU H 5 100 ? -72.145  -18.496 53.434 1.00 51.06  ? 1499 LEU H N     1 
ATOM   10140 C CA    . LEU H 5 100 ? -73.094  -17.589 52.806 1.00 52.34  ? 1499 LEU H CA    1 
ATOM   10141 C C     . LEU H 5 100 ? -72.580  -16.715 51.690 1.00 54.89  ? 1499 LEU H C     1 
ATOM   10142 O O     . LEU H 5 100 ? -71.452  -16.222 51.735 1.00 56.75  ? 1499 LEU H O     1 
ATOM   10143 C CB    . LEU H 5 100 ? -73.721  -16.683 53.859 1.00 43.07  ? 1499 LEU H CB    1 
ATOM   10144 C CG    . LEU H 5 100 ? -74.316  -17.376 55.083 1.00 42.32  ? 1499 LEU H CG    1 
ATOM   10145 C CD1   . LEU H 5 100 ? -75.111  -16.361 55.897 1.00 40.90  ? 1499 LEU H CD1   1 
ATOM   10146 C CD2   . LEU H 5 100 ? -75.205  -18.550 54.646 1.00 41.24  ? 1499 LEU H CD2   1 
ATOM   10147 N N     . PRO H 5 101 ? -73.418  -16.494 50.669 1.00 62.74  ? 1500 PRO H N     1 
ATOM   10148 C CA    . PRO H 5 101 ? -73.051  -15.659 49.526 1.00 62.25  ? 1500 PRO H CA    1 
ATOM   10149 C C     . PRO H 5 101 ? -72.717  -14.272 50.064 1.00 61.59  ? 1500 PRO H C     1 
ATOM   10150 O O     . PRO H 5 101 ? -73.298  -13.819 51.059 1.00 62.79  ? 1500 PRO H O     1 
ATOM   10151 C CB    . PRO H 5 101 ? -74.313  -15.657 48.679 1.00 71.44  ? 1500 PRO H CB    1 
ATOM   10152 C CG    . PRO H 5 101 ? -74.925  -16.966 48.989 1.00 72.57  ? 1500 PRO H CG    1 
ATOM   10153 C CD    . PRO H 5 101 ? -74.756  -17.074 50.482 1.00 73.17  ? 1500 PRO H CD    1 
ATOM   10154 N N     . GLY H 5 102 ? -71.776  -13.617 49.394 1.00 70.07  ? 1501 GLY H N     1 
ATOM   10155 C CA    . GLY H 5 102 ? -71.309  -12.299 49.786 1.00 69.83  ? 1501 GLY H CA    1 
ATOM   10156 C C     . GLY H 5 102 ? -72.206  -11.380 50.582 1.00 69.95  ? 1501 GLY H C     1 
ATOM   10157 O O     . GLY H 5 102 ? -72.087  -11.278 51.802 1.00 72.92  ? 1501 GLY H O     1 
ATOM   10158 N N     . GLU H 5 103 ? -73.115  -10.704 49.896 1.00 54.98  ? 1502 GLU H N     1 
ATOM   10159 C CA    . GLU H 5 103 ? -73.985  -9.744  50.559 1.00 56.06  ? 1502 GLU H CA    1 
ATOM   10160 C C     . GLU H 5 103 ? -74.686  -10.330 51.788 1.00 54.29  ? 1502 GLU H C     1 
ATOM   10161 O O     . GLU H 5 103 ? -74.645  -9.754  52.878 1.00 53.70  ? 1502 GLU H O     1 
ATOM   10162 C CB    . GLU H 5 103 ? -75.006  -9.186  49.556 1.00 81.81  ? 1502 GLU H CB    1 
ATOM   10163 C CG    . GLU H 5 103 ? -75.518  -7.799  49.902 1.00 89.62  ? 1502 GLU H CG    1 
ATOM   10164 C CD    . GLU H 5 103 ? -74.397  -6.778  50.016 1.00 94.19  ? 1502 GLU H CD    1 
ATOM   10165 O OE1   . GLU H 5 103 ? -74.659  -5.652  50.499 1.00 96.14  ? 1502 GLU H OE1   1 
ATOM   10166 O OE2   . GLU H 5 103 ? -73.255  -7.104  49.619 1.00 95.38  ? 1502 GLU H OE2   1 
ATOM   10167 N N     . LEU H 5 104 ? -75.314  -11.484 51.603 1.00 53.01  ? 1503 LEU H N     1 
ATOM   10168 C CA    . LEU H 5 104 ? -76.025  -12.147 52.679 1.00 50.35  ? 1503 LEU H CA    1 
ATOM   10169 C C     . LEU H 5 104 ? -75.052  -12.388 53.819 1.00 50.83  ? 1503 LEU H C     1 
ATOM   10170 O O     . LEU H 5 104 ? -75.384  -12.195 54.987 1.00 49.83  ? 1503 LEU H O     1 
ATOM   10171 C CB    . LEU H 5 104 ? -76.607  -13.459 52.160 1.00 64.60  ? 1503 LEU H CB    1 
ATOM   10172 C CG    . LEU H 5 104 ? -77.976  -13.895 52.689 1.00 65.71  ? 1503 LEU H CG    1 
ATOM   10173 C CD1   . LEU H 5 104 ? -78.863  -12.687 52.904 1.00 63.82  ? 1503 LEU H CD1   1 
ATOM   10174 C CD2   . LEU H 5 104 ? -78.620  -14.866 51.690 1.00 63.44  ? 1503 LEU H CD2   1 
ATOM   10175 N N     . ALA H 5 105 ? -73.832  -12.785 53.478 1.00 49.77  ? 1504 ALA H N     1 
ATOM   10176 C CA    . ALA H 5 105 ? -72.831  -13.041 54.502 1.00 49.56  ? 1504 ALA H CA    1 
ATOM   10177 C C     . ALA H 5 105 ? -72.479  -11.769 55.243 1.00 51.71  ? 1504 ALA H C     1 
ATOM   10178 O O     . ALA H 5 105 ? -72.357  -11.774 56.453 1.00 51.42  ? 1504 ALA H O     1 
ATOM   10179 C CB    . ALA H 5 105 ? -71.581  -13.653 53.888 1.00 41.81  ? 1504 ALA H CB    1 
ATOM   10180 N N     . LYS H 5 106 ? -72.332  -10.677 54.508 1.00 56.60  ? 1505 LYS H N     1 
ATOM   10181 C CA    . LYS H 5 106 ? -71.989  -9.379  55.095 1.00 59.19  ? 1505 LYS H CA    1 
ATOM   10182 C C     . LYS H 5 106 ? -72.863  -9.066  56.318 1.00 59.96  ? 1505 LYS H C     1 
ATOM   10183 O O     . LYS H 5 106 ? -72.366  -8.952  57.443 1.00 60.75  ? 1505 LYS H O     1 
ATOM   10184 C CB    . LYS H 5 106 ? -72.170  -8.296  54.034 1.00 99.92  ? 1505 LYS H CB    1 
ATOM   10185 C CG    . LYS H 5 106 ? -71.508  -6.967  54.337 1.00 104.96 ? 1505 LYS H CG    1 
ATOM   10186 C CD    . LYS H 5 106 ? -71.842  -5.948  53.247 1.00 108.39 ? 1505 LYS H CD    1 
ATOM   10187 C CE    . LYS H 5 106 ? -71.433  -6.455  51.869 1.00 111.71 ? 1505 LYS H CE    1 
ATOM   10188 N NZ    . LYS H 5 106 ? -71.800  -5.495  50.800 1.00 113.21 ? 1505 LYS H NZ    1 
ATOM   10189 N N     . HIS H 5 107 ? -74.170  -8.956  56.080 1.00 61.05  ? 1506 HIS H N     1 
ATOM   10190 C CA    . HIS H 5 107 ? -75.163  -8.651  57.108 1.00 63.41  ? 1506 HIS H CA    1 
ATOM   10191 C C     . HIS H 5 107 ? -75.239  -9.638  58.276 1.00 63.50  ? 1506 HIS H C     1 
ATOM   10192 O O     . HIS H 5 107 ? -75.505  -9.259  59.417 1.00 63.01  ? 1506 HIS H O     1 
ATOM   10193 C CB    . HIS H 5 107 ? -76.519  -8.521  56.434 1.00 77.93  ? 1506 HIS H CB    1 
ATOM   10194 C CG    . HIS H 5 107 ? -76.569  -7.423  55.422 1.00 82.40  ? 1506 HIS H CG    1 
ATOM   10195 N ND1   . HIS H 5 107 ? -77.604  -7.279  54.524 1.00 83.83  ? 1506 HIS H ND1   1 
ATOM   10196 C CD2   . HIS H 5 107 ? -75.704  -6.414  55.163 1.00 83.15  ? 1506 HIS H CD2   1 
ATOM   10197 C CE1   . HIS H 5 107 ? -77.372  -6.231  53.753 1.00 85.09  ? 1506 HIS H CE1   1 
ATOM   10198 N NE2   . HIS H 5 107 ? -76.225  -5.691  54.120 1.00 84.09  ? 1506 HIS H NE2   1 
ATOM   10199 N N     . ALA H 5 108 ? -75.004  -10.910 57.997 1.00 64.69  ? 1507 ALA H N     1 
ATOM   10200 C CA    . ALA H 5 108 ? -75.043  -11.898 59.052 1.00 62.50  ? 1507 ALA H CA    1 
ATOM   10201 C C     . ALA H 5 108 ? -73.838  -11.680 59.963 1.00 61.67  ? 1507 ALA H C     1 
ATOM   10202 O O     . ALA H 5 108 ? -73.939  -11.818 61.172 1.00 62.77  ? 1507 ALA H O     1 
ATOM   10203 C CB    . ALA H 5 108 ? -75.022  -13.287 58.455 1.00 57.39  ? 1507 ALA H CB    1 
ATOM   10204 N N     . VAL H 5 109 ? -72.695  -11.326 59.391 1.00 57.56  ? 1508 VAL H N     1 
ATOM   10205 C CA    . VAL H 5 109 ? -71.521  -11.107 60.221 1.00 55.76  ? 1508 VAL H CA    1 
ATOM   10206 C C     . VAL H 5 109 ? -71.824  -9.933  61.143 1.00 57.68  ? 1508 VAL H C     1 
ATOM   10207 O O     . VAL H 5 109 ? -71.519  -9.964  62.341 1.00 57.30  ? 1508 VAL H O     1 
ATOM   10208 C CB    . VAL H 5 109 ? -70.263  -10.774 59.385 1.00 63.16  ? 1508 VAL H CB    1 
ATOM   10209 C CG1   . VAL H 5 109 ? -69.042  -10.679 60.302 1.00 60.22  ? 1508 VAL H CG1   1 
ATOM   10210 C CG2   . VAL H 5 109 ? -70.035  -11.851 58.334 1.00 60.70  ? 1508 VAL H CG2   1 
ATOM   10211 N N     . SER H 5 110 ? -72.436  -8.905  60.563 1.00 59.65  ? 1509 SER H N     1 
ATOM   10212 C CA    . SER H 5 110 ? -72.809  -7.701  61.292 1.00 63.21  ? 1509 SER