data_2FBW
# 
_entry.id   2FBW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FBW         
RCSB  RCSB035694   
WWPDB D_1000035694 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1YQ3 'Another crystal form'                                                  unspecified 
PDB 1YQ4 'OTHER CRYSTAL FORM, WITH 3-NITROPROPIONIC ACID BOUND'                  unspecified 
PDB 1ZOY 'PORCINE HOMOLOG'                                                       unspecified 
PDB 1ZPO 'PORCINE HOMOLOG WITH 3-NPA AND THENOYL TRIFLUOROACETONE BOUND'         unspecified 
PDB 1NEK 'E.COLI HOMOLOG'                                                        unspecified 
PDB 1QJD 'FLAVOCYTOCHROME C3 HAS SIMILAR FAD DOMAIN, DICARBOXYLATE BINDING SITE' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FBW 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, L.S.'    1 
'Sun, G.'        2 
'Cobessi, D.'    3 
'Wang, A.C.'     4 
'Shen, J.T.'     5 
'Tung, E.Y.'     6 
'Anderson, V.E.' 7 
'Berry, E.A.'    8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;3-nitropropionic acid is a suicide inhibitor of mitochondrial respiration that, upon oxidation by complex II, forms a covalent adduct with a catalytic base arginine in the active site of the enzyme.
;
J.Biol.Chem.               281 5965 5972 2006 JBCHA3 US 0021-9258 0071 ? 16371358 10.1074/jbc.M511270200 
1       
'Crystallization of mitochondrial respiratory complex II from chicken heart: a membrane-protein complex diffracting to 2.0 A' 
'Acta Crystallogr.,Sect.D' 61  380  387  2005 ABCRE6 DK 0907-4449 0766 ? ?        ?                      
2       'Crystal structure of mitochondrial respiratory membrane protein complex II.' 'Cell(Cambridge,Mass.)'    121 1043 1057 
2005 CELLB5 US 0092-8674 0998 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huang, L.S.'    1  
primary 'Sun, G.'        2  
primary 'Cobessi, D.'    3  
primary 'Wang, A.C.'     4  
primary 'Shen, J.T.'     5  
primary 'Tung, E.Y.'     6  
primary 'Anderson, V.E.' 7  
primary 'Berry, E.A.'    8  
1       'Huang, L.S.'    9  
1       'Borders, T.M.'  10 
1       'Shen, J.T.'     11 
1       'Wang, C.J.'     12 
1       'Berry, E.A.'    13 
2       'Sun, F.'        14 
2       'Huo, X.'        15 
2       'Zhai, Y.'       16 
2       'Wang, A.'       17 
2       'Xu, J.'         18 
2       'Su, D.'         19 
2       'Bartlam, M.'    20 
2       'Rao, Z.'        21 
# 
_cell.entry_id           2FBW 
_cell.length_a           118.700 
_cell.length_b           200.753 
_cell.length_c           67.631 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.06 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2FBW 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Succinate dehydrogenase flavoprotein subunit'            68256.922 2    1.3.5.1 ? ? ? 
2  polymer     nat 'succinate dehydrogenase Ip subunit'                      28685.221 2    1.3.5.1 ? ? ? 
3  polymer     nat 'Succinate dehydrogenase cytochrome B, large subunit'     15419.120 2    1.3.5.1 ? ? ? 
4  polymer     nat 'Succinate dehydrogenase cytochrome B, small subunit'     10971.604 2    1.3.5.1 ? ? ? 
5  non-polymer syn 'POTASSIUM ION'                                           39.098    4    ?       ? ? ? 
6  non-polymer syn 'AZIDE ION'                                               42.020    1    ?       ? ? ? 
7  non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                             785.550   2    ?       ? ? ? 
8  non-polymer syn 'MALATE LIKE INTERMEDIATE'                                132.072   2    ?       ? ? ? 
9  non-polymer syn 'UNKNOWN LIGAND'                                          ?         95   ?       ? ? ? 
10 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                              175.820   2    ?       ? ? ? 
11 non-polymer syn 'IRON/SULFUR CLUSTER'                                     351.640   2    ?       ? ? ? 
12 non-polymer syn 'FE3-S4 CLUSTER'                                          295.795   2    ?       ? ? ? 
13 non-polymer syn GLYCEROL                                                  92.094    4    ?       ? ? ? 
14 non-polymer syn 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL   264.315   2    ?       ? ? ? 
15 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                         616.487   2    ?       ? ? ? 
16 non-polymer syn 2-METHYL-N-PHENYL-5,6-DIHYDRO-1,4-OXATHIINE-3-CARBOXAMIDE 235.302   2    ?       ? ? ? 
17 non-polymer syn 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine             749.073   2    ?       ? ? ? 
18 water       nat water                                                     18.015    2000 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;STKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHT
LYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRA
GLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDH
VYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEAAS
ASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHA
AVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDE
FDYSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY
;
;STKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHT
LYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRA
GLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDH
VYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEAAS
ASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHA
AVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDE
FDYSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY
;
A,N ? 
2 'polypeptide(L)' no no 
;AQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGG
NTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECIL
CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKK
MMATYKEKAAAA
;
;AQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGG
NTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECIL
CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKK
MMATYKEKAAAA
;
B,O ? 
3 'polypeptide(L)' no no 
;MATTAKEEMARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSVAALLLPEQFPHYVAVVKSLSLS
PALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQSGVVVLILTLLSSAGIAAIS
;
;MATTAKEEMARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSVAALLLPEQFPHYVAVVKSLSLS
PALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQSGVVVLILTLLSSAGIAAIS
;
C,P ? 
4 'polypeptide(L)' no no 
;GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYVHGDTPIKVANTGLYVLSAITF
TGLCYFNYYDVGICKAVAMLWSI
;
;GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYVHGDTPIKVANTGLYVLSAITF
TGLCYFNYYDVGICKAVAMLWSI
;
D,Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   THR n 
1 3   LYS n 
1 4   VAL n 
1 5   SER n 
1 6   ASP n 
1 7   SER n 
1 8   ILE n 
1 9   SER n 
1 10  THR n 
1 11  GLN n 
1 12  TYR n 
1 13  PRO n 
1 14  VAL n 
1 15  VAL n 
1 16  ASP n 
1 17  HIS n 
1 18  GLU n 
1 19  PHE n 
1 20  ASP n 
1 21  ALA n 
1 22  VAL n 
1 23  VAL n 
1 24  VAL n 
1 25  GLY n 
1 26  ALA n 
1 27  GLY n 
1 28  GLY n 
1 29  ALA n 
1 30  GLY n 
1 31  LEU n 
1 32  ARG n 
1 33  ALA n 
1 34  ALA n 
1 35  PHE n 
1 36  GLY n 
1 37  LEU n 
1 38  SER n 
1 39  GLU n 
1 40  ALA n 
1 41  GLY n 
1 42  PHE n 
1 43  ASN n 
1 44  THR n 
1 45  ALA n 
1 46  CYS n 
1 47  VAL n 
1 48  THR n 
1 49  LYS n 
1 50  LEU n 
1 51  PHE n 
1 52  PRO n 
1 53  THR n 
1 54  ARG n 
1 55  SER n 
1 56  HIS n 
1 57  THR n 
1 58  VAL n 
1 59  ALA n 
1 60  ALA n 
1 61  GLN n 
1 62  GLY n 
1 63  GLY n 
1 64  ILE n 
1 65  ASN n 
1 66  ALA n 
1 67  ALA n 
1 68  LEU n 
1 69  GLY n 
1 70  ASN n 
1 71  MET n 
1 72  GLU n 
1 73  ASP n 
1 74  ASP n 
1 75  ASN n 
1 76  TRP n 
1 77  ARG n 
1 78  TRP n 
1 79  HIS n 
1 80  PHE n 
1 81  TYR n 
1 82  ASP n 
1 83  THR n 
1 84  VAL n 
1 85  LYS n 
1 86  GLY n 
1 87  SER n 
1 88  ASP n 
1 89  TRP n 
1 90  LEU n 
1 91  GLY n 
1 92  ASP n 
1 93  GLN n 
1 94  ASP n 
1 95  ALA n 
1 96  ILE n 
1 97  HIS n 
1 98  TYR n 
1 99  MET n 
1 100 THR n 
1 101 GLU n 
1 102 GLN n 
1 103 ALA n 
1 104 PRO n 
1 105 ALA n 
1 106 ALA n 
1 107 VAL n 
1 108 ILE n 
1 109 GLU n 
1 110 LEU n 
1 111 GLU n 
1 112 ASN n 
1 113 TYR n 
1 114 GLY n 
1 115 MET n 
1 116 PRO n 
1 117 PHE n 
1 118 SER n 
1 119 ARG n 
1 120 THR n 
1 121 GLU n 
1 122 GLU n 
1 123 GLY n 
1 124 LYS n 
1 125 ILE n 
1 126 TYR n 
1 127 GLN n 
1 128 ARG n 
1 129 ALA n 
1 130 PHE n 
1 131 GLY n 
1 132 GLY n 
1 133 GLN n 
1 134 SER n 
1 135 LEU n 
1 136 GLN n 
1 137 PHE n 
1 138 GLY n 
1 139 LYS n 
1 140 GLY n 
1 141 GLY n 
1 142 GLN n 
1 143 ALA n 
1 144 HIS n 
1 145 ARG n 
1 146 CYS n 
1 147 CYS n 
1 148 CYS n 
1 149 VAL n 
1 150 ALA n 
1 151 ASP n 
1 152 ARG n 
1 153 THR n 
1 154 GLY n 
1 155 HIS n 
1 156 SER n 
1 157 LEU n 
1 158 LEU n 
1 159 HIS n 
1 160 THR n 
1 161 LEU n 
1 162 TYR n 
1 163 GLY n 
1 164 ARG n 
1 165 SER n 
1 166 LEU n 
1 167 ARG n 
1 168 TYR n 
1 169 ASP n 
1 170 THR n 
1 171 SER n 
1 172 TYR n 
1 173 PHE n 
1 174 VAL n 
1 175 GLU n 
1 176 TYR n 
1 177 PHE n 
1 178 ALA n 
1 179 LEU n 
1 180 ASP n 
1 181 LEU n 
1 182 LEU n 
1 183 MET n 
1 184 GLU n 
1 185 ASN n 
1 186 GLY n 
1 187 GLU n 
1 188 CYS n 
1 189 ARG n 
1 190 GLY n 
1 191 VAL n 
1 192 ILE n 
1 193 ALA n 
1 194 LEU n 
1 195 CYS n 
1 196 ILE n 
1 197 GLU n 
1 198 ASP n 
1 199 GLY n 
1 200 THR n 
1 201 ILE n 
1 202 HIS n 
1 203 ARG n 
1 204 PHE n 
1 205 ARG n 
1 206 ALA n 
1 207 LYS n 
1 208 ASN n 
1 209 THR n 
1 210 VAL n 
1 211 ILE n 
1 212 ALA n 
1 213 THR n 
1 214 GLY n 
1 215 GLY n 
1 216 TYR n 
1 217 GLY n 
1 218 ARG n 
1 219 THR n 
1 220 TYR n 
1 221 PHE n 
1 222 SER n 
1 223 CYS n 
1 224 THR n 
1 225 SER n 
1 226 ALA n 
1 227 HIS n 
1 228 THR n 
1 229 SER n 
1 230 THR n 
1 231 GLY n 
1 232 ASP n 
1 233 GLY n 
1 234 THR n 
1 235 ALA n 
1 236 MET n 
1 237 VAL n 
1 238 THR n 
1 239 ARG n 
1 240 ALA n 
1 241 GLY n 
1 242 LEU n 
1 243 PRO n 
1 244 CYS n 
1 245 GLN n 
1 246 ASP n 
1 247 LEU n 
1 248 GLU n 
1 249 PHE n 
1 250 VAL n 
1 251 GLN n 
1 252 PHE n 
1 253 HIS n 
1 254 PRO n 
1 255 THR n 
1 256 GLY n 
1 257 ILE n 
1 258 TYR n 
1 259 GLY n 
1 260 ALA n 
1 261 GLY n 
1 262 CYS n 
1 263 LEU n 
1 264 ILE n 
1 265 THR n 
1 266 GLU n 
1 267 GLY n 
1 268 CYS n 
1 269 ARG n 
1 270 GLY n 
1 271 GLU n 
1 272 GLY n 
1 273 GLY n 
1 274 ILE n 
1 275 LEU n 
1 276 ILE n 
1 277 ASN n 
1 278 SER n 
1 279 GLN n 
1 280 GLY n 
1 281 GLU n 
1 282 ARG n 
1 283 PHE n 
1 284 MET n 
1 285 GLU n 
1 286 ARG n 
1 287 TYR n 
1 288 ALA n 
1 289 PRO n 
1 290 VAL n 
1 291 ALA n 
1 292 LYS n 
1 293 ASP n 
1 294 LEU n 
1 295 ALA n 
1 296 SER n 
1 297 ARG n 
1 298 ASP n 
1 299 VAL n 
1 300 VAL n 
1 301 SER n 
1 302 ARG n 
1 303 SER n 
1 304 MET n 
1 305 THR n 
1 306 ILE n 
1 307 GLU n 
1 308 ILE n 
1 309 ARG n 
1 310 GLU n 
1 311 GLY n 
1 312 ARG n 
1 313 GLY n 
1 314 CYS n 
1 315 GLY n 
1 316 PRO n 
1 317 GLU n 
1 318 LYS n 
1 319 ASP n 
1 320 HIS n 
1 321 VAL n 
1 322 TYR n 
1 323 LEU n 
1 324 GLN n 
1 325 LEU n 
1 326 HIS n 
1 327 HIS n 
1 328 LEU n 
1 329 PRO n 
1 330 PRO n 
1 331 GLN n 
1 332 GLN n 
1 333 LEU n 
1 334 ALA n 
1 335 THR n 
1 336 ARG n 
1 337 LEU n 
1 338 PRO n 
1 339 GLY n 
1 340 ILE n 
1 341 SER n 
1 342 GLU n 
1 343 THR n 
1 344 ALA n 
1 345 MET n 
1 346 ILE n 
1 347 PHE n 
1 348 ALA n 
1 349 GLY n 
1 350 VAL n 
1 351 ASP n 
1 352 VAL n 
1 353 THR n 
1 354 LYS n 
1 355 GLU n 
1 356 PRO n 
1 357 ILE n 
1 358 PRO n 
1 359 VAL n 
1 360 LEU n 
1 361 PRO n 
1 362 THR n 
1 363 VAL n 
1 364 HIS n 
1 365 TYR n 
1 366 ASN n 
1 367 MET n 
1 368 GLY n 
1 369 GLY n 
1 370 ILE n 
1 371 PRO n 
1 372 THR n 
1 373 ASN n 
1 374 TYR n 
1 375 LYS n 
1 376 GLY n 
1 377 GLN n 
1 378 VAL n 
1 379 ILE n 
1 380 THR n 
1 381 HIS n 
1 382 VAL n 
1 383 ASN n 
1 384 GLY n 
1 385 GLU n 
1 386 ASP n 
1 387 LYS n 
1 388 VAL n 
1 389 VAL n 
1 390 PRO n 
1 391 GLY n 
1 392 LEU n 
1 393 TYR n 
1 394 ALA n 
1 395 CYS n 
1 396 GLY n 
1 397 GLU n 
1 398 ALA n 
1 399 ALA n 
1 400 SER n 
1 401 ALA n 
1 402 SER n 
1 403 VAL n 
1 404 HIS n 
1 405 GLY n 
1 406 ALA n 
1 407 ASN n 
1 408 ARG n 
1 409 LEU n 
1 410 GLY n 
1 411 ALA n 
1 412 ASN n 
1 413 SER n 
1 414 LEU n 
1 415 LEU n 
1 416 ASP n 
1 417 LEU n 
1 418 VAL n 
1 419 VAL n 
1 420 PHE n 
1 421 GLY n 
1 422 ARG n 
1 423 ALA n 
1 424 CYS n 
1 425 ALA n 
1 426 LEU n 
1 427 THR n 
1 428 ILE n 
1 429 ALA n 
1 430 GLU n 
1 431 THR n 
1 432 CYS n 
1 433 LYS n 
1 434 PRO n 
1 435 GLY n 
1 436 GLU n 
1 437 PRO n 
1 438 VAL n 
1 439 PRO n 
1 440 SER n 
1 441 ILE n 
1 442 LYS n 
1 443 PRO n 
1 444 ASN n 
1 445 ALA n 
1 446 GLY n 
1 447 GLU n 
1 448 GLU n 
1 449 SER n 
1 450 VAL n 
1 451 ALA n 
1 452 ASN n 
1 453 LEU n 
1 454 ASP n 
1 455 LYS n 
1 456 LEU n 
1 457 ARG n 
1 458 PHE n 
1 459 ALA n 
1 460 ASP n 
1 461 GLY n 
1 462 THR n 
1 463 ILE n 
1 464 ARG n 
1 465 THR n 
1 466 SER n 
1 467 GLU n 
1 468 ALA n 
1 469 ARG n 
1 470 LEU n 
1 471 ASN n 
1 472 MET n 
1 473 GLN n 
1 474 LYS n 
1 475 THR n 
1 476 MET n 
1 477 GLN n 
1 478 SER n 
1 479 HIS n 
1 480 ALA n 
1 481 ALA n 
1 482 VAL n 
1 483 PHE n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 SER n 
1 488 ILE n 
1 489 LEU n 
1 490 GLN n 
1 491 GLU n 
1 492 GLY n 
1 493 CYS n 
1 494 GLU n 
1 495 LYS n 
1 496 LEU n 
1 497 SER n 
1 498 GLN n 
1 499 ILE n 
1 500 TYR n 
1 501 ARG n 
1 502 ASP n 
1 503 LEU n 
1 504 ALA n 
1 505 HIS n 
1 506 LEU n 
1 507 LYS n 
1 508 THR n 
1 509 PHE n 
1 510 ASP n 
1 511 ARG n 
1 512 GLY n 
1 513 ILE n 
1 514 VAL n 
1 515 TRP n 
1 516 ASN n 
1 517 THR n 
1 518 ASP n 
1 519 LEU n 
1 520 VAL n 
1 521 GLU n 
1 522 THR n 
1 523 LEU n 
1 524 GLU n 
1 525 LEU n 
1 526 GLN n 
1 527 ASN n 
1 528 LEU n 
1 529 MET n 
1 530 LEU n 
1 531 CYS n 
1 532 ALA n 
1 533 LEU n 
1 534 GLN n 
1 535 THR n 
1 536 ILE n 
1 537 TYR n 
1 538 GLY n 
1 539 ALA n 
1 540 GLU n 
1 541 ALA n 
1 542 ARG n 
1 543 LYS n 
1 544 GLU n 
1 545 SER n 
1 546 ARG n 
1 547 GLY n 
1 548 ALA n 
1 549 HIS n 
1 550 ALA n 
1 551 ARG n 
1 552 GLU n 
1 553 ASP n 
1 554 TYR n 
1 555 LYS n 
1 556 LEU n 
1 557 ARG n 
1 558 ILE n 
1 559 ASP n 
1 560 GLU n 
1 561 PHE n 
1 562 ASP n 
1 563 TYR n 
1 564 SER n 
1 565 LYS n 
1 566 PRO n 
1 567 LEU n 
1 568 GLN n 
1 569 GLY n 
1 570 GLN n 
1 571 GLN n 
1 572 LYS n 
1 573 ARG n 
1 574 PRO n 
1 575 PHE n 
1 576 GLU n 
1 577 GLU n 
1 578 HIS n 
1 579 TRP n 
1 580 ARG n 
1 581 LYS n 
1 582 HIS n 
1 583 THR n 
1 584 LEU n 
1 585 SER n 
1 586 TYR n 
1 587 VAL n 
1 588 ASP n 
1 589 VAL n 
1 590 LYS n 
1 591 SER n 
1 592 GLY n 
1 593 LYS n 
1 594 VAL n 
1 595 THR n 
1 596 LEU n 
1 597 LYS n 
1 598 TYR n 
1 599 ARG n 
1 600 PRO n 
1 601 VAL n 
1 602 ILE n 
1 603 ASP n 
1 604 ARG n 
1 605 THR n 
1 606 LEU n 
1 607 ASN n 
1 608 GLU n 
1 609 GLU n 
1 610 ASP n 
1 611 CYS n 
1 612 SER n 
1 613 SER n 
1 614 VAL n 
1 615 PRO n 
1 616 PRO n 
1 617 ALA n 
1 618 ILE n 
1 619 ARG n 
1 620 SER n 
1 621 TYR n 
2 1   ALA n 
2 2   GLN n 
2 3   THR n 
2 4   ALA n 
2 5   ALA n 
2 6   ALA n 
2 7   ALA n 
2 8   THR n 
2 9   SER n 
2 10  ARG n 
2 11  ILE n 
2 12  LYS n 
2 13  LYS n 
2 14  PHE n 
2 15  SER n 
2 16  ILE n 
2 17  TYR n 
2 18  ARG n 
2 19  TRP n 
2 20  ASP n 
2 21  PRO n 
2 22  ASP n 
2 23  LYS n 
2 24  PRO n 
2 25  GLY n 
2 26  ASP n 
2 27  LYS n 
2 28  PRO n 
2 29  ARG n 
2 30  MET n 
2 31  GLN n 
2 32  THR n 
2 33  TYR n 
2 34  GLU n 
2 35  VAL n 
2 36  ASP n 
2 37  LEU n 
2 38  ASN n 
2 39  LYS n 
2 40  CYS n 
2 41  GLY n 
2 42  PRO n 
2 43  MET n 
2 44  VAL n 
2 45  LEU n 
2 46  ASP n 
2 47  ALA n 
2 48  LEU n 
2 49  ILE n 
2 50  LYS n 
2 51  ILE n 
2 52  LYS n 
2 53  ASN n 
2 54  GLU n 
2 55  LEU n 
2 56  ASP n 
2 57  SER n 
2 58  THR n 
2 59  LEU n 
2 60  THR n 
2 61  PHE n 
2 62  ARG n 
2 63  ARG n 
2 64  SER n 
2 65  CYS n 
2 66  ARG n 
2 67  GLU n 
2 68  GLY n 
2 69  ILE n 
2 70  CYS n 
2 71  GLY n 
2 72  SER n 
2 73  CYS n 
2 74  ALA n 
2 75  MET n 
2 76  ASN n 
2 77  ILE n 
2 78  ALA n 
2 79  GLY n 
2 80  GLY n 
2 81  ASN n 
2 82  THR n 
2 83  LEU n 
2 84  ALA n 
2 85  CYS n 
2 86  THR n 
2 87  LYS n 
2 88  LYS n 
2 89  ILE n 
2 90  ASP n 
2 91  PRO n 
2 92  ASP n 
2 93  LEU n 
2 94  SER n 
2 95  LYS n 
2 96  THR n 
2 97  THR n 
2 98  LYS n 
2 99  ILE n 
2 100 TYR n 
2 101 PRO n 
2 102 LEU n 
2 103 PRO n 
2 104 HIS n 
2 105 MET n 
2 106 TYR n 
2 107 VAL n 
2 108 VAL n 
2 109 LYS n 
2 110 ASP n 
2 111 LEU n 
2 112 VAL n 
2 113 PRO n 
2 114 ASP n 
2 115 LEU n 
2 116 SER n 
2 117 ASN n 
2 118 PHE n 
2 119 TYR n 
2 120 ALA n 
2 121 GLN n 
2 122 TYR n 
2 123 LYS n 
2 124 SER n 
2 125 ILE n 
2 126 GLU n 
2 127 PRO n 
2 128 TYR n 
2 129 LEU n 
2 130 LYS n 
2 131 LYS n 
2 132 LYS n 
2 133 ASP n 
2 134 GLU n 
2 135 SER n 
2 136 LYS n 
2 137 GLN n 
2 138 GLY n 
2 139 LYS n 
2 140 GLU n 
2 141 GLN n 
2 142 TYR n 
2 143 LEU n 
2 144 GLN n 
2 145 SER n 
2 146 ILE n 
2 147 GLU n 
2 148 ASP n 
2 149 ARG n 
2 150 GLN n 
2 151 LYS n 
2 152 LEU n 
2 153 ASP n 
2 154 GLY n 
2 155 LEU n 
2 156 TYR n 
2 157 GLU n 
2 158 CYS n 
2 159 ILE n 
2 160 LEU n 
2 161 CYS n 
2 162 ALA n 
2 163 CYS n 
2 164 CYS n 
2 165 SER n 
2 166 THR n 
2 167 SER n 
2 168 CYS n 
2 169 PRO n 
2 170 SER n 
2 171 TYR n 
2 172 TRP n 
2 173 TRP n 
2 174 ASN n 
2 175 GLY n 
2 176 ASP n 
2 177 LYS n 
2 178 TYR n 
2 179 LEU n 
2 180 GLY n 
2 181 PRO n 
2 182 ALA n 
2 183 VAL n 
2 184 LEU n 
2 185 MET n 
2 186 GLN n 
2 187 ALA n 
2 188 TYR n 
2 189 ARG n 
2 190 TRP n 
2 191 MET n 
2 192 ILE n 
2 193 ASP n 
2 194 SER n 
2 195 ARG n 
2 196 ASP n 
2 197 ASP n 
2 198 TYR n 
2 199 THR n 
2 200 GLU n 
2 201 GLU n 
2 202 ARG n 
2 203 LEU n 
2 204 ALA n 
2 205 GLN n 
2 206 LEU n 
2 207 GLN n 
2 208 ASP n 
2 209 PRO n 
2 210 PHE n 
2 211 SER n 
2 212 LEU n 
2 213 TYR n 
2 214 ARG n 
2 215 CYS n 
2 216 HIS n 
2 217 THR n 
2 218 ILE n 
2 219 MET n 
2 220 ASN n 
2 221 CYS n 
2 222 THR n 
2 223 ARG n 
2 224 THR n 
2 225 CYS n 
2 226 PRO n 
2 227 LYS n 
2 228 GLY n 
2 229 LEU n 
2 230 ASN n 
2 231 PRO n 
2 232 GLY n 
2 233 LYS n 
2 234 ALA n 
2 235 ILE n 
2 236 ALA n 
2 237 GLU n 
2 238 ILE n 
2 239 LYS n 
2 240 LYS n 
2 241 MET n 
2 242 MET n 
2 243 ALA n 
2 244 THR n 
2 245 TYR n 
2 246 LYS n 
2 247 GLU n 
2 248 LYS n 
2 249 ALA n 
2 250 ALA n 
2 251 ALA n 
2 252 ALA n 
3 1   MET n 
3 2   ALA n 
3 3   THR n 
3 4   THR n 
3 5   ALA n 
3 6   LYS n 
3 7   GLU n 
3 8   GLU n 
3 9   MET n 
3 10  ALA n 
3 11  ARG n 
3 12  PHE n 
3 13  TRP n 
3 14  GLU n 
3 15  LYS n 
3 16  ASN n 
3 17  THR n 
3 18  LYS n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  PRO n 
3 23  LEU n 
3 24  SER n 
3 25  PRO n 
3 26  HIS n 
3 27  ILE n 
3 28  SER n 
3 29  ILE n 
3 30  TYR n 
3 31  LYS n 
3 32  TRP n 
3 33  SER n 
3 34  LEU n 
3 35  PRO n 
3 36  MET n 
3 37  ALA n 
3 38  MET n 
3 39  SER n 
3 40  ILE n 
3 41  THR n 
3 42  HIS n 
3 43  ARG n 
3 44  GLY n 
3 45  THR n 
3 46  GLY n 
3 47  VAL n 
3 48  ALA n 
3 49  LEU n 
3 50  SER n 
3 51  LEU n 
3 52  GLY n 
3 53  VAL n 
3 54  SER n 
3 55  LEU n 
3 56  PHE n 
3 57  SER n 
3 58  VAL n 
3 59  ALA n 
3 60  ALA n 
3 61  LEU n 
3 62  LEU n 
3 63  LEU n 
3 64  PRO n 
3 65  GLU n 
3 66  GLN n 
3 67  PHE n 
3 68  PRO n 
3 69  HIS n 
3 70  TYR n 
3 71  VAL n 
3 72  ALA n 
3 73  VAL n 
3 74  VAL n 
3 75  LYS n 
3 76  SER n 
3 77  LEU n 
3 78  SER n 
3 79  LEU n 
3 80  SER n 
3 81  PRO n 
3 82  ALA n 
3 83  LEU n 
3 84  ILE n 
3 85  TYR n 
3 86  SER n 
3 87  ALA n 
3 88  LYS n 
3 89  PHE n 
3 90  ALA n 
3 91  LEU n 
3 92  VAL n 
3 93  PHE n 
3 94  PRO n 
3 95  LEU n 
3 96  SER n 
3 97  TYR n 
3 98  HIS n 
3 99  THR n 
3 100 TRP n 
3 101 ASN n 
3 102 GLY n 
3 103 ILE n 
3 104 ARG n 
3 105 HIS n 
3 106 LEU n 
3 107 VAL n 
3 108 TRP n 
3 109 ASP n 
3 110 MET n 
3 111 GLY n 
3 112 LYS n 
3 113 GLY n 
3 114 PHE n 
3 115 LYS n 
3 116 LEU n 
3 117 SER n 
3 118 GLN n 
3 119 VAL n 
3 120 GLU n 
3 121 GLN n 
3 122 SER n 
3 123 GLY n 
3 124 VAL n 
3 125 VAL n 
3 126 VAL n 
3 127 LEU n 
3 128 ILE n 
3 129 LEU n 
3 130 THR n 
3 131 LEU n 
3 132 LEU n 
3 133 SER n 
3 134 SER n 
3 135 ALA n 
3 136 GLY n 
3 137 ILE n 
3 138 ALA n 
3 139 ALA n 
3 140 ILE n 
3 141 SER n 
4 1   GLY n 
4 2   SER n 
4 3   SER n 
4 4   LYS n 
4 5   ALA n 
4 6   ALA n 
4 7   SER n 
4 8   LEU n 
4 9   HIS n 
4 10  TRP n 
4 11  THR n 
4 12  SER n 
4 13  GLU n 
4 14  ARG n 
4 15  ALA n 
4 16  VAL n 
4 17  SER n 
4 18  ALA n 
4 19  LEU n 
4 20  LEU n 
4 21  LEU n 
4 22  GLY n 
4 23  LEU n 
4 24  LEU n 
4 25  PRO n 
4 26  ALA n 
4 27  ALA n 
4 28  TYR n 
4 29  LEU n 
4 30  TYR n 
4 31  PRO n 
4 32  GLY n 
4 33  PRO n 
4 34  ALA n 
4 35  VAL n 
4 36  ASP n 
4 37  TYR n 
4 38  SER n 
4 39  LEU n 
4 40  ALA n 
4 41  ALA n 
4 42  ALA n 
4 43  LEU n 
4 44  THR n 
4 45  LEU n 
4 46  HIS n 
4 47  GLY n 
4 48  HIS n 
4 49  TRP n 
4 50  GLY n 
4 51  LEU n 
4 52  GLY n 
4 53  GLN n 
4 54  VAL n 
4 55  ILE n 
4 56  THR n 
4 57  ASP n 
4 58  TYR n 
4 59  VAL n 
4 60  HIS n 
4 61  GLY n 
4 62  ASP n 
4 63  THR n 
4 64  PRO n 
4 65  ILE n 
4 66  LYS n 
4 67  VAL n 
4 68  ALA n 
4 69  ASN n 
4 70  THR n 
4 71  GLY n 
4 72  LEU n 
4 73  TYR n 
4 74  VAL n 
4 75  LEU n 
4 76  SER n 
4 77  ALA n 
4 78  ILE n 
4 79  THR n 
4 80  PHE n 
4 81  THR n 
4 82  GLY n 
4 83  LEU n 
4 84  CYS n 
4 85  TYR n 
4 86  PHE n 
4 87  ASN n 
4 88  TYR n 
4 89  TYR n 
4 90  ASP n 
4 91  VAL n 
4 92  GLY n 
4 93  ILE n 
4 94  CYS n 
4 95  LYS n 
4 96  ALA n 
4 97  VAL n 
4 98  ALA n 
4 99  MET n 
4 100 LEU n 
4 101 TRP n 
4 102 SER n 
4 103 ILE n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? chicken 'Gallus gallus' 9031 Gallus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? chicken 'Gallus gallus' 9031 Gallus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? chicken 'Gallus gallus' 9031 Gallus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? chicken 'Gallus gallus' 9031 Gallus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 GB  XP_419054 1 
;MEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVA
DRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTST
GDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIRE
GRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVP
GLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARL
NMQKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDYKLRIDEFDYSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY
;
1  50736125 ? 
2 GB  AAC72372  2 
;AQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGG
NTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECIL
CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKK
MMATYKEKAAAA
;
39 3851612  ? 
3 GB  CAG32373  4 
;GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYVHGDTPIKVANTGLYVLSAITF
TGLCYFNYYDVGICKAVAMLWSI
;
55 53134884 ? 
4 PDB 2FBW      3 ? ?  2FBW     ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FBW A 71 ? 621 ? 50736125 1  ? 551 ? 71 621 
2 1 2FBW N 71 ? 621 ? 50736125 1  ? 551 ? 71 621 
3 2 2FBW B 1  ? 252 ? 3851612  39 ? 290 ? 1  252 
4 2 2FBW O 1  ? 252 ? 3851612  39 ? 290 ? 1  252 
5 3 2FBW D 1  ? 103 ? 53134884 55 ? 157 ? 1  103 
6 3 2FBW Q 1  ? 103 ? 53134884 55 ? 157 ? 1  103 
7 4 2FBW C 1  ? 141 ? 2FBW     1  ? 141 ? 1  141 
8 4 2FBW P 1  ? 141 ? 2FBW     1  ? 141 ? 1  141 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                           ? 'C4 H7 N O4'        133.103 
AZI non-polymer         . 'AZIDE ION'                                               ? 'N3 -1'             42.020  
BHG saccharide          . 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL   ? 'C12 H24 O6'        264.315 
CBE non-polymer         . 2-METHYL-N-PHENYL-5,6-DIHYDRO-1,4-OXATHIINE-3-CARBOXAMIDE 
'5,6-DIHYDRO-2-METHYL-1,4-OXATHIIN-3-CARBOXANILID; CARBOXIN; CBX' 'C12 H13 N O2 S'    235.302 
CYS 'L-peptide linking' y CYSTEINE                                                  ? 'C3 H7 N O2 S'      121.158 
F3S non-polymer         . 'FE3-S4 CLUSTER'                                          ? 'Fe3 S4'            295.795 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'                             ? 'C27 H33 N9 O15 P2' 785.550 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                              ? 'Fe2 S2'            175.820 
GLN 'L-peptide linking' y GLUTAMINE                                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                   ? 'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                                  'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 
92.094  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                         HEME 'C34 H32 Fe N4 O4'  616.487 
HIS 'L-peptide linking' y HISTIDINE                                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                ? 'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                                           ? 'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                ? 'C5 H11 N O2 S'     149.211 
PEE non-polymer         . 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine             DOPE 'C41 H83 N O8 P 1'  749.073 
PHE 'L-peptide linking' y PHENYLALANINE                                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                    ? 'C3 H7 N O3'        105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'                                     ? 'Fe4 S4'            351.640 
TEO non-polymer         . 'MALATE LIKE INTERMEDIATE'                                ? 'C4 H4 O5 -2'       132.072 
THR 'L-peptide linking' y THREONINE                                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                  ? 'C9 H11 N O3'       181.189 
UNL non-polymer         . 'UNKNOWN LIGAND'                                          ? ?                   ?       
VAL 'L-peptide linking' y VALINE                                                    ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2FBW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.29 
_exptl_crystal.density_percent_sol   62.3 
_exptl_crystal.description           
;LOW COMPLETENESS IN OUTER SHELLS IS DUE TO DETECTOR GEOMETRY WHICH WAS A COMPROMISE BETWEEN RESOLVING SPOTS AND COLLECTING HIGH RESOLUTION DATA. OPTICAL RESOLUTION FOR THE DATASET: 1.63 A
;
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    
;50 G/L PEG-3350, 25 ML/L ISOPROPANOL, 15 ML/L PEG-400 0.05 M NA-HEPES, 0.01 M TRIS-HCL, 0.0005 M MNCL2, 0.0013 M MGCL2, 0.0015 M NA-AZIDE, 0.00025 M NA-EDTA, CARBOXIN, pH 7.50, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-02-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             0.9800 
_diffrn_source.pdbx_wavelength_list        0.9800 
# 
_reflns.entry_id                     2FBW 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             99 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   166966 
_reflns.number_all                   166966 
_reflns.percent_possible_obs         86.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.192 
_reflns.pdbx_netI_over_sigmaI        7.80 
_reflns.B_iso_Wilson_estimate        12.1 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   49.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.518 
_reflns_shell.meanI_over_sigI_obs    1.16 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FBW 
_refine.ls_number_reflns_obs                     162208 
_refine.ls_number_reflns_all                     162208 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3447934.67 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             64.09 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    88.2 
_refine.ls_R_factor_obs                          0.187 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  8009 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.0 
_refine.aniso_B[1][1]                            -3.06 
_refine.aniso_B[2][2]                            6.84 
_refine.aniso_B[3][3]                            -3.78 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.355794 
_refine.solvent_model_param_bsol                 100.006 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;STRONG NCS RESTRAINTS WERE USED IN POSITIONAL REFINEMENT. THE NCS IS IMPROPER, CORRESPONDING TO A 2-FOLD AXIS PARALLEL TO C WITH A SCREW COMPONENT OF ~3.1 ANGSTROMS. THE COMPLEX WAS DIVIDED INTO 12 TWO-FOLD NCS GROUPS. SPECIFIC RESIDUES NOT OBEYING NCS WERE IDENTIFIED AND RELEASED FROM THE RESTRAINT. NO NCS RESTRAINT ON B-FACTOR WAS USED.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1YQ3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2FBW 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16978 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         516 
_refine_hist.number_atoms_solvent             2000 
_refine_hist.number_atoms_total               19494 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        64.09 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.022 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.15  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.39  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.15  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.08  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   15 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.15 
_refine_ls_shell.number_reflns_R_work             6353 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               54.8 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             332 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 sqrprosth5.par    ? 'X-RAY DIFFRACTION' 
3 fad5.par          ? 'X-RAY DIFFRACTION' 
4 water.param       ? 'X-RAY DIFFRACTION' 
5 more.par          ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FBW 
_struct.title                     'Avian respiratory complex II with carboxin bound' 
_struct.pdbx_descriptor           
;Succinate dehydrogenase flavoprotein subunit (E.C.1.3.5.1), succinate dehydrogenase Ip subunit (E.C.1.3.5.1), Succinate dehydrogenase cytochrome B, large subunit (E.C.1.3.5.1), Succinate dehydrogenase cytochrome B, small subunit (E.C.1.3.5.1)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FBW 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;COMPLEX II, MEMBRANE PROTEIN, HEME PROTEIN, IRON SULFUR PROTEIN, CYTOCHROME B, OXIDOREDUCTASE, REDOX ENZYME, RESPIRATORY CHAIN, OXALOACETATE NITROPROPIONATE UBIQUINONE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 1  ? 
F  N N 2  ? 
G  N N 3  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 8  ? 
M  N N 9  ? 
N  N N 9  ? 
O  N N 9  ? 
P  N N 9  ? 
Q  N N 9  ? 
R  N N 9  ? 
S  N N 9  ? 
T  N N 9  ? 
U  N N 9  ? 
V  N N 9  ? 
W  N N 9  ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 9  ? 
AA N N 9  ? 
BA N N 9  ? 
CA N N 9  ? 
DA N N 9  ? 
EA N N 9  ? 
FA N N 9  ? 
GA N N 9  ? 
HA N N 5  ? 
IA N N 10 ? 
JA N N 11 ? 
KA N N 12 ? 
LA N N 9  ? 
MA N N 9  ? 
NA N N 9  ? 
OA N N 9  ? 
PA N N 9  ? 
QA N N 9  ? 
RA N N 9  ? 
SA N N 9  ? 
TA N N 9  ? 
UA N N 9  ? 
VA N N 13 ? 
WA N N 14 ? 
XA N N 15 ? 
YA N N 16 ? 
ZA N N 9  ? 
AB N N 9  ? 
BB N N 9  ? 
CB N N 9  ? 
DB N N 9  ? 
EB N N 9  ? 
FB N N 9  ? 
GB N N 9  ? 
HB N N 9  ? 
IB N N 9  ? 
JB N N 9  ? 
KB N N 9  ? 
LB N N 9  ? 
MB N N 9  ? 
NB N N 9  ? 
OB N N 13 ? 
PB N N 17 ? 
QB N N 9  ? 
RB N N 9  ? 
SB N N 9  ? 
TB N N 9  ? 
UB N N 9  ? 
VB N N 9  ? 
WB N N 9  ? 
XB N N 9  ? 
YB N N 9  ? 
ZB N N 5  ? 
AC N N 7  ? 
BC N N 8  ? 
CC N N 9  ? 
DC N N 9  ? 
EC N N 9  ? 
FC N N 9  ? 
GC N N 9  ? 
HC N N 9  ? 
IC N N 9  ? 
JC N N 9  ? 
KC N N 9  ? 
LC N N 9  ? 
MC N N 9  ? 
NC N N 9  ? 
OC N N 9  ? 
PC N N 9  ? 
QC N N 9  ? 
RC N N 9  ? 
SC N N 9  ? 
TC N N 9  ? 
UC N N 9  ? 
VC N N 9  ? 
WC N N 9  ? 
XC N N 5  ? 
YC N N 10 ? 
ZC N N 11 ? 
AD N N 12 ? 
BD N N 9  ? 
CD N N 9  ? 
DD N N 9  ? 
ED N N 9  ? 
FD N N 9  ? 
GD N N 9  ? 
HD N N 13 ? 
ID N N 14 ? 
JD N N 15 ? 
KD N N 16 ? 
LD N N 9  ? 
MD N N 9  ? 
ND N N 9  ? 
OD N N 9  ? 
PD N N 9  ? 
QD N N 9  ? 
RD N N 9  ? 
SD N N 13 ? 
TD N N 17 ? 
UD N N 9  ? 
VD N N 9  ? 
WD N N 9  ? 
XD N N 9  ? 
YD N N 9  ? 
ZD N N 9  ? 
AE N N 18 ? 
BE N N 18 ? 
CE N N 18 ? 
DE N N 18 ? 
EE N N 18 ? 
FE N N 18 ? 
GE N N 18 ? 
HE N N 18 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;THE BIOLOGICAL UNIT IS BELIEVED TO BE A SINGLE HETROTETRAMER. THE DEPOSITED COORDINATES CONSTITUTE THE ASYMMETRIC UNIT WHICH CONSISTS OF TWO BIOLOGICAL UNITS, ONE COMPRISING CHAINS A,B,C AND D AND THE OTHER COMPRISING CHAINS N,O,P AND Q. LIGANDS WITH RESIDUE NUMBER 100-199 ARE ASSOCIATED WITH [ABCD] WHILE THOSE WITH RESIDUE NUMBERS 200-299 ARE ASSOCIATED WITH [NOPQ] OR OCCUPY ASYMMETRIC POSITIONS. 
THE OPERATOR TAKING [ABCD] ONTO [NOPQ] IS GIVEN IN THE MTRIX1 ENTRIES. 
 
MTRIX1   1 -0.999997  0.001496 -0.0019022     59.287878    1      
MTRIX1   1 -0.001500 -0.999996  0.0025438      0.332060    1        
MTRIX1   1 -0.001898  0.002547  0.9999950     -3.116521    1
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 27  ? ALA A 40  ? GLY A 27  ALA A 40  1 ? 14 
HELX_P HELX_P2  2  PHE A 51  ? ALA A 60  ? PHE A 51  ALA A 60  5 ? 10 
HELX_P HELX_P3  3  ASN A 75  ? SER A 87  ? ASN A 75  SER A 87  1 ? 13 
HELX_P HELX_P4  4  ASP A 92  ? TYR A 113 ? ASP A 92  TYR A 113 1 ? 22 
HELX_P HELX_P5  5  ARG A 152 ? LEU A 166 ? ARG A 152 LEU A 166 1 ? 15 
HELX_P HELX_P6  6  TYR A 216 ? TYR A 220 ? TYR A 216 TYR A 220 5 ? 5  
HELX_P HELX_P7  7  GLY A 231 ? ALA A 240 ? GLY A 231 ALA A 240 1 ? 10 
HELX_P HELX_P8  8  GLU A 266 ? GLU A 271 ? GLU A 266 GLU A 271 1 ? 6  
HELX_P HELX_P9  9  PHE A 283 ? ALA A 288 ? PHE A 283 ALA A 288 1 ? 6  
HELX_P HELX_P10 10 ALA A 291 ? ALA A 295 ? ALA A 291 ALA A 295 5 ? 5  
HELX_P HELX_P11 11 SER A 296 ? GLU A 310 ? SER A 296 GLU A 310 1 ? 15 
HELX_P HELX_P12 12 PRO A 329 ? LEU A 337 ? PRO A 329 LEU A 337 1 ? 9  
HELX_P HELX_P13 13 LEU A 337 ? GLY A 349 ? LEU A 337 GLY A 349 1 ? 13 
HELX_P HELX_P14 14 ASN A 412 ? GLU A 430 ? ASN A 412 GLU A 430 1 ? 19 
HELX_P HELX_P15 15 GLY A 446 ? PHE A 458 ? GLY A 446 PHE A 458 1 ? 13 
HELX_P HELX_P16 16 THR A 465 ? ALA A 480 ? THR A 465 ALA A 480 1 ? 16 
HELX_P HELX_P17 17 THR A 485 ? LEU A 503 ? THR A 485 LEU A 503 1 ? 19 
HELX_P HELX_P18 18 ASN A 516 ? ARG A 542 ? ASN A 516 ARG A 542 1 ? 27 
HELX_P HELX_P19 19 PRO A 574 ? HIS A 578 ? PRO A 574 HIS A 578 5 ? 5  
HELX_P HELX_P20 20 ASN B 38  ? CYS B 40  ? ASN B 38  CYS B 40  5 ? 3  
HELX_P HELX_P21 21 MET B 43  ? LEU B 55  ? MET B 43  LEU B 55  1 ? 13 
HELX_P HELX_P22 22 CYS B 85  ? LYS B 87  ? CYS B 85  LYS B 87  5 ? 3  
HELX_P HELX_P23 23 LEU B 115 ? ILE B 125 ? LEU B 115 ILE B 125 1 ? 11 
HELX_P HELX_P24 24 SER B 145 ? LYS B 151 ? SER B 145 LYS B 151 1 ? 7  
HELX_P HELX_P25 25 CYS B 164 ? SER B 167 ? CYS B 164 SER B 167 5 ? 4  
HELX_P HELX_P26 26 CYS B 168 ? GLY B 175 ? CYS B 168 GLY B 175 1 ? 8  
HELX_P HELX_P27 27 GLY B 180 ? ILE B 192 ? GLY B 180 ILE B 192 1 ? 13 
HELX_P HELX_P28 28 TYR B 198 ? GLN B 205 ? TYR B 198 GLN B 205 1 ? 8  
HELX_P HELX_P29 29 MET B 219 ? CYS B 225 ? MET B 219 CYS B 225 1 ? 7  
HELX_P HELX_P30 30 ASN B 230 ? TYR B 245 ? ASN B 230 TYR B 245 1 ? 16 
HELX_P HELX_P31 31 THR C 4   ? LYS C 18  ? THR C 4   LYS C 18  1 ? 15 
HELX_P HELX_P32 32 SER C 33  ? LEU C 63  ? SER C 33  LEU C 63  1 ? 31 
HELX_P HELX_P33 33 GLN C 66  ? LEU C 77  ? GLN C 66  LEU C 77  1 ? 12 
HELX_P HELX_P34 34 SER C 80  ? MET C 110 ? SER C 80  MET C 110 1 ? 31 
HELX_P HELX_P35 35 LYS C 115 ? ALA C 139 ? LYS C 115 ALA C 139 1 ? 25 
HELX_P HELX_P36 36 LYS D 4   ? TYR D 30  ? LYS D 4   TYR D 30  1 ? 27 
HELX_P HELX_P37 37 GLY D 32  ? VAL D 59  ? GLY D 32  VAL D 59  1 ? 28 
HELX_P HELX_P38 38 GLY D 61  ? ASP D 90  ? GLY D 61  ASP D 90  1 ? 30 
HELX_P HELX_P39 39 GLY D 92  ? TRP D 101 ? GLY D 92  TRP D 101 1 ? 10 
HELX_P HELX_P40 40 GLY E 27  ? ALA E 40  ? GLY N 27  ALA N 40  1 ? 14 
HELX_P HELX_P41 41 PHE E 51  ? ALA E 60  ? PHE N 51  ALA N 60  5 ? 10 
HELX_P HELX_P42 42 ASN E 75  ? SER E 87  ? ASN N 75  SER N 87  1 ? 13 
HELX_P HELX_P43 43 ASP E 92  ? TYR E 113 ? ASP N 92  TYR N 113 1 ? 22 
HELX_P HELX_P44 44 ARG E 152 ? LEU E 166 ? ARG N 152 LEU N 166 1 ? 15 
HELX_P HELX_P45 45 TYR E 216 ? TYR E 220 ? TYR N 216 TYR N 220 5 ? 5  
HELX_P HELX_P46 46 GLY E 231 ? ALA E 240 ? GLY N 231 ALA N 240 1 ? 10 
HELX_P HELX_P47 47 GLU E 266 ? GLU E 271 ? GLU N 266 GLU N 271 1 ? 6  
HELX_P HELX_P48 48 PHE E 283 ? ALA E 288 ? PHE N 283 ALA N 288 1 ? 6  
HELX_P HELX_P49 49 ALA E 291 ? ALA E 295 ? ALA N 291 ALA N 295 5 ? 5  
HELX_P HELX_P50 50 SER E 296 ? GLU E 310 ? SER N 296 GLU N 310 1 ? 15 
HELX_P HELX_P51 51 PRO E 329 ? LEU E 337 ? PRO N 329 LEU N 337 1 ? 9  
HELX_P HELX_P52 52 LEU E 337 ? GLY E 349 ? LEU N 337 GLY N 349 1 ? 13 
HELX_P HELX_P53 53 ASN E 412 ? GLU E 430 ? ASN N 412 GLU N 430 1 ? 19 
HELX_P HELX_P54 54 GLY E 446 ? PHE E 458 ? GLY N 446 PHE N 458 1 ? 13 
HELX_P HELX_P55 55 THR E 465 ? ALA E 480 ? THR N 465 ALA N 480 1 ? 16 
HELX_P HELX_P56 56 THR E 485 ? LEU E 503 ? THR N 485 LEU N 503 1 ? 19 
HELX_P HELX_P57 57 ASN E 516 ? ARG E 542 ? ASN N 516 ARG N 542 1 ? 27 
HELX_P HELX_P58 58 PRO E 574 ? HIS E 578 ? PRO N 574 HIS N 578 5 ? 5  
HELX_P HELX_P59 59 ASN F 38  ? CYS F 40  ? ASN O 38  CYS O 40  5 ? 3  
HELX_P HELX_P60 60 MET F 43  ? LEU F 55  ? MET O 43  LEU O 55  1 ? 13 
HELX_P HELX_P61 61 CYS F 85  ? LYS F 87  ? CYS O 85  LYS O 87  5 ? 3  
HELX_P HELX_P62 62 LEU F 115 ? ILE F 125 ? LEU O 115 ILE O 125 1 ? 11 
HELX_P HELX_P63 63 SER F 145 ? LYS F 151 ? SER O 145 LYS O 151 1 ? 7  
HELX_P HELX_P64 64 CYS F 164 ? SER F 167 ? CYS O 164 SER O 167 5 ? 4  
HELX_P HELX_P65 65 CYS F 168 ? GLY F 175 ? CYS O 168 GLY O 175 1 ? 8  
HELX_P HELX_P66 66 GLY F 180 ? ILE F 192 ? GLY O 180 ILE O 192 1 ? 13 
HELX_P HELX_P67 67 TYR F 198 ? GLN F 205 ? TYR O 198 GLN O 205 1 ? 8  
HELX_P HELX_P68 68 MET F 219 ? CYS F 225 ? MET O 219 CYS O 225 1 ? 7  
HELX_P HELX_P69 69 ASN F 230 ? TYR F 245 ? ASN O 230 TYR O 245 1 ? 16 
HELX_P HELX_P70 70 THR G 4   ? LYS G 18  ? THR P 4   LYS P 18  1 ? 15 
HELX_P HELX_P71 71 SER G 33  ? LEU G 63  ? SER P 33  LEU P 63  1 ? 31 
HELX_P HELX_P72 72 GLN G 66  ? LEU G 77  ? GLN P 66  LEU P 77  1 ? 12 
HELX_P HELX_P73 73 SER G 80  ? MET G 110 ? SER P 80  MET P 110 1 ? 31 
HELX_P HELX_P74 74 LYS G 115 ? ALA G 139 ? LYS P 115 ALA P 139 1 ? 25 
HELX_P HELX_P75 75 LYS H 4   ? TYR H 30  ? LYS Q 4   TYR Q 30  1 ? 27 
HELX_P HELX_P76 76 GLY H 32  ? VAL H 59  ? GLY Q 32  VAL Q 59  1 ? 28 
HELX_P HELX_P77 77 GLY H 61  ? ASP H 90  ? GLY Q 61  ASP Q 90  1 ? 30 
HELX_P HELX_P78 78 GLY H 92  ? TRP H 101 ? GLY Q 92  TRP Q 101 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? K  FAD .   C8M ? ? ? 1_555 A  HIS 56  NE2 ? ? A FAD 1001 A HIS 56   1_555 ? ? ? ? ? ? ? 1.425 ? 
metalc1  metalc ? ? IA FES .   FE1 ? ? ? 1_555 B  CYS 73  SG  ? ? B FES 1002 B CYS 73   1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc2  metalc ? ? IA FES .   FE1 ? ? ? 1_555 B  CYS 85  SG  ? ? B FES 1002 B CYS 85   1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc3  metalc ? ? IA FES .   FE2 ? ? ? 1_555 B  CYS 65  SG  ? ? B FES 1002 B CYS 65   1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc4  metalc ? ? IA FES .   FE2 ? ? ? 1_555 B  CYS 70  SG  ? ? B FES 1002 B CYS 70   1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc5  metalc ? ? JA SF4 .   FE1 ? ? ? 1_555 B  CYS 164 SG  ? ? B SF4 1003 B CYS 164  1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc6  metalc ? ? JA SF4 .   FE2 ? ? ? 1_555 B  CYS 158 SG  ? ? B SF4 1003 B CYS 158  1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc7  metalc ? ? JA SF4 .   FE3 ? ? ? 1_555 B  CYS 225 SG  ? ? B SF4 1003 B CYS 225  1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc8  metalc ? ? JA SF4 .   FE4 ? ? ? 1_555 B  CYS 161 SG  ? ? B SF4 1003 B CYS 161  1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc9  metalc ? ? KA F3S .   FE1 ? ? ? 1_555 B  CYS 215 SG  ? ? B F3S 1004 B CYS 215  1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc10 metalc ? ? KA F3S .   FE3 ? ? ? 1_555 B  CYS 221 SG  ? ? B F3S 1004 B CYS 221  1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc11 metalc ? ? KA F3S .   FE4 ? ? ? 1_555 B  CYS 168 SG  ? ? B F3S 1004 B CYS 168  1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc12 metalc ? ? XA HEM .   FE  ? ? ? 1_555 C  HIS 98  NE2 ? ? C HEM 143  C HIS 98   1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc13 metalc ? ? XA HEM .   FE  ? ? ? 1_555 D  HIS 46  NE2 ? ? C HEM 143  D HIS 46   1_555 ? ? ? ? ? ? ? 2.007 ? 
covale2  covale ? ? AC FAD .   C8M ? ? ? 1_555 E  HIS 56  NE2 ? ? N FAD 1001 N HIS 56   1_555 ? ? ? ? ? ? ? 1.407 ? 
metalc14 metalc ? ? YC FES .   FE1 ? ? ? 1_555 F  CYS 73  SG  ? ? O FES 1002 O CYS 73   1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc15 metalc ? ? YC FES .   FE1 ? ? ? 1_555 F  CYS 85  SG  ? ? O FES 1002 O CYS 85   1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc16 metalc ? ? YC FES .   FE2 ? ? ? 1_555 F  CYS 65  SG  ? ? O FES 1002 O CYS 65   1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc17 metalc ? ? YC FES .   FE2 ? ? ? 1_555 F  CYS 70  SG  ? ? O FES 1002 O CYS 70   1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc18 metalc ? ? ZC SF4 .   FE1 ? ? ? 1_555 F  CYS 164 SG  ? ? O SF4 1003 O CYS 164  1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc19 metalc ? ? ZC SF4 .   FE2 ? ? ? 1_555 F  CYS 158 SG  ? ? O SF4 1003 O CYS 158  1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc20 metalc ? ? ZC SF4 .   FE3 ? ? ? 1_555 F  CYS 225 SG  ? ? O SF4 1003 O CYS 225  1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc21 metalc ? ? ZC SF4 .   FE4 ? ? ? 1_555 F  CYS 161 SG  ? ? O SF4 1003 O CYS 161  1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc22 metalc ? ? AD F3S .   FE1 ? ? ? 1_555 F  CYS 215 SG  ? ? O F3S 1004 O CYS 215  1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc23 metalc ? ? AD F3S .   FE3 ? ? ? 1_555 F  CYS 221 SG  ? ? O F3S 1004 O CYS 221  1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc24 metalc ? ? AD F3S .   FE4 ? ? ? 1_555 F  CYS 168 SG  ? ? O F3S 1004 O CYS 168  1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc25 metalc ? ? JD HEM .   FE  ? ? ? 1_555 G  HIS 98  NE2 ? ? P HEM 201  P HIS 98   1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc26 metalc ? ? JD HEM .   FE  ? ? ? 1_555 H  HIS 46  NE2 ? ? P HEM 201  Q HIS 46   1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc27 metalc ? ? A  ASN 366 O   ? ? ? 1_555 I  K   .   K   ? ? A ASN 366  A K   622  1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc28 metalc ? ? A  GLY 368 O   ? ? ? 1_555 I  K   .   K   ? ? A GLY 368  A K   622  1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc29 metalc ? ? A  GLU 397 O   ? ? ? 1_555 I  K   .   K   ? ? A GLU 397  A K   622  1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc30 metalc ? ? A  ALA 399 O   ? ? ? 1_555 I  K   .   K   ? ? A ALA 399  A K   622  1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc31 metalc ? ? B  MET 191 O   ? ? ? 1_555 HA K   .   K   ? ? B MET 191  B K   253  1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc32 metalc ? ? B  ASP 193 O   ? ? ? 1_555 HA K   .   K   ? ? B ASP 193  B K   253  1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc33 metalc ? ? B  ASP 196 O   ? ? ? 1_555 HA K   .   K   ? ? B ASP 196  B K   253  1_555 ? ? ? ? ? ? ? 2.943 ? 
metalc34 metalc ? ? B  THR 199 OG1 ? ? ? 1_555 HA K   .   K   ? ? B THR 199  B K   253  1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc35 metalc ? ? E  ASN 366 O   ? ? ? 1_555 ZB K   .   K   ? ? N ASN 366  N K   622  1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc36 metalc ? ? E  GLY 368 O   ? ? ? 1_555 ZB K   .   K   ? ? N GLY 368  N K   622  1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc37 metalc ? ? E  GLU 397 O   ? ? ? 1_555 ZB K   .   K   ? ? N GLU 397  N K   622  1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc38 metalc ? ? E  ALA 399 O   ? ? ? 1_555 ZB K   .   K   ? ? N ALA 399  N K   622  1_555 ? ? ? ? ? ? ? 2.798 ? 
metalc39 metalc ? ? F  MET 191 O   ? ? ? 1_555 XC K   .   K   ? ? O MET 191  O K   253  1_555 ? ? ? ? ? ? ? 2.991 ? 
metalc40 metalc ? ? F  ASP 193 O   ? ? ? 1_555 XC K   .   K   ? ? O ASP 193  O K   253  1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc41 metalc ? ? F  ASP 196 O   ? ? ? 1_555 XC K   .   K   ? ? O ASP 196  O K   253  1_555 ? ? ? ? ? ? ? 2.828 ? 
metalc42 metalc ? ? F  THR 199 OG1 ? ? ? 1_555 XC K   .   K   ? ? O THR 199  O K   253  1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc43 metalc ? ? HA K   .   K   ? ? ? 1_555 BE HOH .   O   ? ? B K   253  B HOH 1900 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc44 metalc ? ? XC K   .   K   ? ? ? 1_555 FE HOH .   O   ? ? O K   253  O HOH 1041 1_555 ? ? ? ? ? ? ? 3.007 ? 
metalc45 metalc ? ? E  MET 367 O   ? ? ? 1_555 ZB K   .   K   ? ? N MET 367  N K   622  1_555 ? ? ? ? ? ? ? 3.050 ? 
metalc46 metalc ? ? A  MET 367 O   ? ? ? 1_555 I  K   .   K   ? ? A MET 367  A K   622  1_555 ? ? ? ? ? ? ? 3.083 ? 
metalc47 metalc ? ? HA K   .   K   ? ? ? 1_555 BE HOH .   O   ? ? B K   253  B HOH 1795 1_555 ? ? ? ? ? ? ? 3.165 ? 
metalc48 metalc ? ? HA K   .   K   ? ? ? 1_555 BE HOH .   O   ? ? B K   253  B HOH 1777 1_555 ? ? ? ? ? ? ? 3.265 ? 
metalc49 metalc ? ? XC K   .   K   ? ? ? 1_555 FE HOH .   O   ? ? O K   253  O HOH 1049 1_555 ? ? ? ? ? ? ? 3.291 ? 
metalc50 metalc ? ? HA K   .   K   ? ? ? 1_555 BE HOH .   O   ? ? B K   253  B HOH 2905 1_555 ? ? ? ? ? ? ? 3.309 ? 
metalc51 metalc ? ? HA K   .   K   ? ? ? 1_555 BE HOH .   O   ? ? B K   253  B HOH 1861 1_555 ? ? ? ? ? ? ? 3.335 ? 
metalc52 metalc ? ? A  TYR 365 OH  ? ? ? 1_555 I  K   .   K   ? ? A TYR 365  A K   622  1_555 ? ? ? ? ? ? ? 3.351 ? 
metalc53 metalc ? ? E  TYR 365 OH  ? ? ? 1_555 ZB K   .   K   ? ? N TYR 365  N K   622  1_555 ? ? ? ? ? ? ? 3.433 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 401 A . ? ALA 401 A SER 402 A ? SER 402 A 1 -2.44 
2 ALA 401 E . ? ALA 401 N SER 402 E ? SER 402 N 1 -2.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 3 ? 
D ? 3 ? 
E ? 4 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
I ? 2 ? 
J ? 4 ? 
K ? 6 ? 
L ? 3 ? 
M ? 3 ? 
N ? 4 ? 
O ? 2 ? 
P ? 2 ? 
Q ? 5 ? 
R ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
P 1 2 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? parallel      
Q 3 4 ? anti-parallel 
Q 4 5 ? anti-parallel 
R 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 171 ? VAL A 174 ? SER A 171 VAL A 174 
A 2 THR A 44  ? THR A 48  ? THR A 44  THR A 48  
A 3 VAL A 14  ? VAL A 24  ? VAL A 14  VAL A 24  
A 4 ILE A 201 ? ILE A 211 ? ILE A 201 ILE A 211 
A 5 GLU A 187 ? CYS A 195 ? GLU A 187 CYS A 195 
A 6 TYR A 176 ? GLU A 184 ? TYR A 176 GLU A 184 
B 1 SER A 171 ? VAL A 174 ? SER A 171 VAL A 174 
B 2 THR A 44  ? THR A 48  ? THR A 44  THR A 48  
B 3 VAL A 14  ? VAL A 24  ? VAL A 14  VAL A 24  
B 4 ILE A 201 ? ILE A 211 ? ILE A 201 ILE A 211 
B 5 GLU A 385 ? ALA A 394 ? GLU A 385 ALA A 394 
B 6 GLN A 377 ? VAL A 382 ? GLN A 377 VAL A 382 
C 1 ILE A 64  ? ASN A 65  ? ILE A 64  ASN A 65  
C 2 GLN A 142 ? CYS A 147 ? GLN A 142 CYS A 147 
C 3 GLN A 127 ? SER A 134 ? GLN A 127 SER A 134 
D 1 CYS A 244 ? GLN A 245 ? CYS A 244 GLN A 245 
D 2 LYS A 581 ? ASP A 588 ? LYS A 581 ASP A 588 
D 3 LYS A 593 ? PRO A 600 ? LYS A 593 PRO A 600 
E 1 VAL A 250 ? ILE A 257 ? VAL A 250 ILE A 257 
E 2 ILE A 357 ? ASN A 366 ? ILE A 357 ASN A 366 
E 3 VAL A 321 ? GLN A 324 ? VAL A 321 GLN A 324 
E 4 ILE A 274 ? ILE A 276 ? ILE A 274 ILE A 276 
F 1 ILE A 370 ? PRO A 371 ? ILE A 370 PRO A 371 
F 2 ALA A 399 ? SER A 400 ? ALA A 399 SER A 400 
G 1 ILE A 463 ? ARG A 464 ? ILE A 463 ARG A 464 
G 2 LEU A 506 ? LYS A 507 ? LEU A 506 LYS A 507 
H 1 ARG B 29  ? ASP B 36  ? ARG B 29  ASP B 36  
H 2 ILE B 11  ? ARG B 18  ? ILE B 11  ARG B 18  
H 3 THR B 97  ? TYR B 100 ? THR B 97  TYR B 100 
H 4 ALA B 74  ? ILE B 77  ? ALA B 74  ILE B 77  
H 5 GLY B 80  ? LEU B 83  ? GLY B 80  LEU B 83  
I 1 VAL B 107 ? LYS B 109 ? VAL B 107 LYS B 109 
I 2 VAL B 112 ? PRO B 113 ? VAL B 112 PRO B 113 
J 1 VAL E 14  ? GLU E 18  ? VAL N 14  GLU N 18  
J 2 ILE E 201 ? ARG E 205 ? ILE N 201 ARG N 205 
J 3 GLU E 187 ? CYS E 195 ? GLU N 187 CYS N 195 
J 4 TYR E 176 ? GLU E 184 ? TYR N 176 GLU N 184 
K 1 SER E 171 ? VAL E 174 ? SER N 171 VAL N 174 
K 2 THR E 44  ? THR E 48  ? THR N 44  THR N 48  
K 3 ALA E 21  ? VAL E 24  ? ALA N 21  VAL N 24  
K 4 ASN E 208 ? ILE E 211 ? ASN N 208 ILE N 211 
K 5 GLU E 385 ? ALA E 394 ? GLU N 385 ALA N 394 
K 6 GLN E 377 ? VAL E 382 ? GLN N 377 VAL N 382 
L 1 ILE E 64  ? ASN E 65  ? ILE N 64  ASN N 65  
L 2 GLN E 142 ? CYS E 147 ? GLN N 142 CYS N 147 
L 3 GLN E 127 ? SER E 134 ? GLN N 127 SER N 134 
M 1 CYS E 244 ? GLN E 245 ? CYS N 244 GLN N 245 
M 2 LYS E 581 ? VAL E 587 ? LYS N 581 VAL N 587 
M 3 VAL E 594 ? PRO E 600 ? VAL N 594 PRO N 600 
N 1 VAL E 250 ? ILE E 257 ? VAL N 250 ILE N 257 
N 2 ILE E 357 ? ASN E 366 ? ILE N 357 ASN N 366 
N 3 VAL E 321 ? GLN E 324 ? VAL N 321 GLN N 324 
N 4 ILE E 274 ? ILE E 276 ? ILE N 274 ILE N 276 
O 1 ILE E 370 ? PRO E 371 ? ILE N 370 PRO N 371 
O 2 ALA E 399 ? SER E 400 ? ALA N 399 SER N 400 
P 1 ILE E 463 ? ARG E 464 ? ILE N 463 ARG N 464 
P 2 LEU E 506 ? LYS E 507 ? LEU N 506 LYS N 507 
Q 1 ARG F 29  ? ASP F 36  ? ARG O 29  ASP O 36  
Q 2 ILE F 11  ? ARG F 18  ? ILE O 11  ARG O 18  
Q 3 THR F 97  ? TYR F 100 ? THR O 97  TYR O 100 
Q 4 ALA F 74  ? ILE F 77  ? ALA O 74  ILE O 77  
Q 5 GLY F 80  ? LEU F 83  ? GLY O 80  LEU O 83  
R 1 VAL F 107 ? LYS F 109 ? VAL O 107 LYS O 109 
R 2 VAL F 112 ? PRO F 113 ? VAL O 112 PRO O 113 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 171 ? O SER A 171 N THR A 44  ? N THR A 44  
A 2 3 O ALA A 45  ? O ALA A 45  N VAL A 23  ? N VAL A 23  
A 3 4 N VAL A 24  ? N VAL A 24  O VAL A 210 ? O VAL A 210 
A 4 5 O PHE A 204 ? O PHE A 204 N VAL A 191 ? N VAL A 191 
A 5 6 O ARG A 189 ? O ARG A 189 N LEU A 182 ? N LEU A 182 
B 1 2 O SER A 171 ? O SER A 171 N THR A 44  ? N THR A 44  
B 2 3 O ALA A 45  ? O ALA A 45  N VAL A 23  ? N VAL A 23  
B 3 4 N VAL A 24  ? N VAL A 24  O VAL A 210 ? O VAL A 210 
B 4 5 N THR A 209 ? N THR A 209 O TYR A 393 ? O TYR A 393 
B 5 6 O LYS A 387 ? O LYS A 387 N THR A 380 ? N THR A 380 
C 1 2 N ILE A 64  ? N ILE A 64  O CYS A 147 ? O CYS A 147 
C 2 3 O CYS A 146 ? O CYS A 146 N ARG A 128 ? N ARG A 128 
D 1 2 N CYS A 244 ? N CYS A 244 O SER A 585 ? O SER A 585 
D 2 3 N LEU A 584 ? N LEU A 584 O LYS A 597 ? O LYS A 597 
E 1 2 N HIS A 253 ? N HIS A 253 O THR A 362 ? O THR A 362 
E 2 3 O ILE A 357 ? O ILE A 357 N LEU A 323 ? N LEU A 323 
E 3 4 O GLN A 324 ? O GLN A 324 N ILE A 274 ? N ILE A 274 
F 1 2 N ILE A 370 ? N ILE A 370 O SER A 400 ? O SER A 400 
G 1 2 N ILE A 463 ? N ILE A 463 O LYS A 507 ? O LYS A 507 
H 1 2 O VAL B 35  ? O VAL B 35  N LYS B 12  ? N LYS B 12  
H 2 3 N SER B 15  ? N SER B 15  O ILE B 99  ? O ILE B 99  
H 3 4 O TYR B 100 ? O TYR B 100 N ASN B 76  ? N ASN B 76  
H 4 5 N MET B 75  ? N MET B 75  O THR B 82  ? O THR B 82  
I 1 2 N LYS B 109 ? N LYS B 109 O VAL B 112 ? O VAL B 112 
J 1 2 N VAL E 15  ? N VAL N 15  O ILE E 201 ? O ILE N 201 
J 2 3 O PHE E 204 ? O PHE N 204 N VAL E 191 ? N VAL N 191 
J 3 4 O ARG E 189 ? O ARG N 189 N LEU E 182 ? N LEU N 182 
K 1 2 O SER E 171 ? O SER N 171 N THR E 44  ? N THR N 44  
K 2 3 O ALA E 45  ? O ALA N 45  N VAL E 23  ? N VAL N 23  
K 3 4 N VAL E 24  ? N VAL N 24  O VAL E 210 ? O VAL N 210 
K 4 5 N THR E 209 ? N THR N 209 O TYR E 393 ? O TYR N 393 
K 5 6 O LYS E 387 ? O LYS N 387 N THR E 380 ? N THR N 380 
L 1 2 N ILE E 64  ? N ILE N 64  O CYS E 147 ? O CYS N 147 
L 2 3 O CYS E 146 ? O CYS N 146 N ARG E 128 ? N ARG N 128 
M 1 2 N CYS E 244 ? N CYS N 244 O SER E 585 ? O SER N 585 
M 2 3 N LEU E 584 ? N LEU N 584 O LYS E 597 ? O LYS N 597 
N 1 2 N HIS E 253 ? N HIS N 253 O THR E 362 ? O THR N 362 
N 2 3 O VAL E 359 ? O VAL N 359 N VAL E 321 ? N VAL N 321 
N 3 4 O GLN E 324 ? O GLN N 324 N ILE E 274 ? N ILE N 274 
O 1 2 N ILE E 370 ? N ILE N 370 O SER E 400 ? O SER N 400 
P 1 2 N ILE E 463 ? N ILE N 463 O LYS E 507 ? O LYS N 507 
Q 1 2 O VAL F 35  ? O VAL O 35  N LYS F 12  ? N LYS O 12  
Q 2 3 N SER F 15  ? N SER O 15  O ILE F 99  ? O ILE O 99  
Q 3 4 O TYR F 100 ? O TYR O 100 N ASN F 76  ? N ASN O 76  
Q 4 5 N MET F 75  ? N MET O 75  O THR F 82  ? O THR O 82  
R 1 2 N VAL F 108 ? N VAL O 108 O VAL F 112 ? O VAL O 112 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BHG C 142'  
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BHG P 204'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K A 622'    
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K B 253'    
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K N 622'    
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K O 253'    
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE AZI A 623'  
AC8 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD A 1001' 
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES B 1002' 
BC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 B 1003' 
BC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE F3S B 1004' 
BC3 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD N 1001' 
BC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES O 1002' 
BC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 O 1003' 
BC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE F3S O 1004' 
BC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM C 143'  
BC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CBE C 144'  
BC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE TEO A 1002' 
CC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PEE D 109'  
CC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 145'  
CC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM P 201'  
CC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CBE P 202'  
CC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE TEO N 1002' 
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PEE Q 210'  
CC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL P 211'  
CC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE UNL N 1003' 
CC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL O 1005' 
DC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNL C 214'  
DC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE UNL B 1005' 
DC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNL A 1003' 
DC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL A 1004' 
DC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL N 1006' 
DC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL P 224'  
DC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL N 1007' 
DC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL N 1011' 
DC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL O 1008' 
EC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 240'  
EC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL D 245'  
EC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 248'  
EC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 251'  
EC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL B 258'  
EC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL A 1009' 
EC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL A 1011' 
EC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL B 268'  
EC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL A 1014' 
FC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNL B 277'  
FC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL A 1017' 
FC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL A 1018' 
FC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL B 280'  
FC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNL A 1019' 
FC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL Q 288'  
FC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 289'  
FC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL N 1017' 
FC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL N 1019' 
GC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL N 1020' 
GC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL N 1021' 
GC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL A 1020' 
GC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNL A 1021' 
GC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL N 1022' 
GC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL A 1023' 
GC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL C 294'  
GC8 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL B 1010' 
GC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL O 1009' 
HC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL P 208'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 10 LYS C  31  ? LYS C 31   . ? 1_555 ? 
2   AC1 10 TRP C  32  ? TRP C 32   . ? 1_555 ? 
3   AC1 10 SER C  33  ? SER C 33   . ? 1_555 ? 
4   AC1 10 LEU C  34  ? LEU C 34   . ? 1_555 ? 
5   AC1 10 PRO C  35  ? PRO C 35   . ? 1_555 ? 
6   AC1 10 GLU C  120 ? GLU C 120  . ? 1_555 ? 
7   AC1 10 UNL LB .   ? UNL C 289  . ? 1_555 ? 
8   AC1 10 HOH CE .   ? HOH C 1750 . ? 1_555 ? 
9   AC1 10 HOH CE .   ? HOH C 2605 . ? 1_555 ? 
10  AC1 10 TYR G  85  ? TYR P 85   . ? 1_555 ? 
11  AC2 8  ALA C  139 ? ALA C 139  . ? 1_555 ? 
12  AC2 8  TRP G  32  ? TRP P 32   . ? 1_555 ? 
13  AC2 8  LEU G  34  ? LEU P 34   . ? 1_555 ? 
14  AC2 8  PRO G  35  ? PRO P 35   . ? 1_555 ? 
15  AC2 8  GLU G  120 ? GLU P 120  . ? 1_555 ? 
16  AC2 8  HOH GE .   ? HOH P 1172 . ? 1_555 ? 
17  AC2 8  HOH GE .   ? HOH P 2485 . ? 1_555 ? 
18  AC2 8  HOH GE .   ? HOH P 2548 . ? 1_555 ? 
19  AC3 6  TYR A  365 ? TYR A 365  . ? 1_555 ? 
20  AC3 6  ASN A  366 ? ASN A 366  . ? 1_555 ? 
21  AC3 6  MET A  367 ? MET A 367  . ? 1_555 ? 
22  AC3 6  GLY A  368 ? GLY A 368  . ? 1_555 ? 
23  AC3 6  GLU A  397 ? GLU A 397  . ? 1_555 ? 
24  AC3 6  ALA A  399 ? ALA A 399  . ? 1_555 ? 
25  AC4 5  MET B  191 ? MET B 191  . ? 1_555 ? 
26  AC4 5  ASP B  193 ? ASP B 193  . ? 1_555 ? 
27  AC4 5  ASP B  196 ? ASP B 196  . ? 1_555 ? 
28  AC4 5  THR B  199 ? THR B 199  . ? 1_555 ? 
29  AC4 5  HOH BE .   ? HOH B 1900 . ? 1_555 ? 
30  AC5 6  TYR E  365 ? TYR N 365  . ? 1_555 ? 
31  AC5 6  ASN E  366 ? ASN N 366  . ? 1_555 ? 
32  AC5 6  MET E  367 ? MET N 367  . ? 1_555 ? 
33  AC5 6  GLY E  368 ? GLY N 368  . ? 1_555 ? 
34  AC5 6  GLU E  397 ? GLU N 397  . ? 1_555 ? 
35  AC5 6  ALA E  399 ? ALA N 399  . ? 1_555 ? 
36  AC6 5  MET F  191 ? MET O 191  . ? 1_555 ? 
37  AC6 5  ASP F  193 ? ASP O 193  . ? 1_555 ? 
38  AC6 5  ASP F  196 ? ASP O 196  . ? 1_555 ? 
39  AC6 5  THR F  199 ? THR O 199  . ? 1_555 ? 
40  AC6 5  HOH FE .   ? HOH O 1041 . ? 1_555 ? 
41  AC7 3  TYR A  172 ? TYR A 172  . ? 1_555 ? 
42  AC7 3  VAL A  174 ? VAL A 174  . ? 1_555 ? 
43  AC7 3  HOH AE .   ? HOH A 1854 . ? 1_555 ? 
44  AC8 40 VAL A  24  ? VAL A 24   . ? 1_555 ? 
45  AC8 40 GLY A  25  ? GLY A 25   . ? 1_555 ? 
46  AC8 40 ALA A  26  ? ALA A 26   . ? 1_555 ? 
47  AC8 40 GLY A  27  ? GLY A 27   . ? 1_555 ? 
48  AC8 40 GLY A  28  ? GLY A 28   . ? 1_555 ? 
49  AC8 40 ALA A  29  ? ALA A 29   . ? 1_555 ? 
50  AC8 40 THR A  48  ? THR A 48   . ? 1_555 ? 
51  AC8 40 LYS A  49  ? LYS A 49   . ? 1_555 ? 
52  AC8 40 LEU A  50  ? LEU A 50   . ? 1_555 ? 
53  AC8 40 SER A  55  ? SER A 55   . ? 1_555 ? 
54  AC8 40 HIS A  56  ? HIS A 56   . ? 1_555 ? 
55  AC8 40 THR A  57  ? THR A 57   . ? 1_555 ? 
56  AC8 40 ALA A  59  ? ALA A 59   . ? 1_555 ? 
57  AC8 40 ALA A  60  ? ALA A 60   . ? 1_555 ? 
58  AC8 40 GLN A  61  ? GLN A 61   . ? 1_555 ? 
59  AC8 40 GLY A  62  ? GLY A 62   . ? 1_555 ? 
60  AC8 40 GLY A  63  ? GLY A 63   . ? 1_555 ? 
61  AC8 40 TYR A  176 ? TYR A 176  . ? 1_555 ? 
62  AC8 40 PHE A  177 ? PHE A 177  . ? 1_555 ? 
63  AC8 40 ALA A  178 ? ALA A 178  . ? 1_555 ? 
64  AC8 40 ALA A  212 ? ALA A 212  . ? 1_555 ? 
65  AC8 40 THR A  213 ? THR A 213  . ? 1_555 ? 
66  AC8 40 THR A  224 ? THR A 224  . ? 1_555 ? 
67  AC8 40 ASP A  232 ? ASP A 232  . ? 1_555 ? 
68  AC8 40 LEU A  263 ? LEU A 263  . ? 1_555 ? 
69  AC8 40 HIS A  364 ? HIS A 364  . ? 1_555 ? 
70  AC8 40 TYR A  365 ? TYR A 365  . ? 1_555 ? 
71  AC8 40 GLY A  396 ? GLY A 396  . ? 1_555 ? 
72  AC8 40 GLU A  397 ? GLU A 397  . ? 1_555 ? 
73  AC8 40 ARG A  408 ? ARG A 408  . ? 1_555 ? 
74  AC8 40 ALA A  411 ? ALA A 411  . ? 1_555 ? 
75  AC8 40 ASN A  412 ? ASN A 412  . ? 1_555 ? 
76  AC8 40 SER A  413 ? SER A 413  . ? 1_555 ? 
77  AC8 40 LEU A  414 ? LEU A 414  . ? 1_555 ? 
78  AC8 40 LEU A  417 ? LEU A 417  . ? 1_555 ? 
79  AC8 40 TEO L  .   ? TEO A 1002 . ? 1_555 ? 
80  AC8 40 HOH AE .   ? HOH A 1692 . ? 1_555 ? 
81  AC8 40 HOH AE .   ? HOH A 1708 . ? 1_555 ? 
82  AC8 40 HOH AE .   ? HOH A 1735 . ? 1_555 ? 
83  AC8 40 HOH AE .   ? HOH A 1880 . ? 1_555 ? 
84  AC9 8  SER B  64  ? SER B 64   . ? 1_555 ? 
85  AC9 8  CYS B  65  ? CYS B 65   . ? 1_555 ? 
86  AC9 8  ARG B  66  ? ARG B 66   . ? 1_555 ? 
87  AC9 8  GLY B  68  ? GLY B 68   . ? 1_555 ? 
88  AC9 8  CYS B  70  ? CYS B 70   . ? 1_555 ? 
89  AC9 8  GLY B  71  ? GLY B 71   . ? 1_555 ? 
90  AC9 8  CYS B  73  ? CYS B 73   . ? 1_555 ? 
91  AC9 8  CYS B  85  ? CYS B 85   . ? 1_555 ? 
92  BC1 8  CYS B  158 ? CYS B 158  . ? 1_555 ? 
93  BC1 8  ILE B  159 ? ILE B 159  . ? 1_555 ? 
94  BC1 8  CYS B  161 ? CYS B 161  . ? 1_555 ? 
95  BC1 8  ALA B  162 ? ALA B 162  . ? 1_555 ? 
96  BC1 8  CYS B  164 ? CYS B 164  . ? 1_555 ? 
97  BC1 8  CYS B  225 ? CYS B 225  . ? 1_555 ? 
98  BC1 8  PRO B  226 ? PRO B 226  . ? 1_555 ? 
99  BC1 8  LYS B  227 ? LYS B 227  . ? 1_555 ? 
100 BC2 10 CYS B  168 ? CYS B 168  . ? 1_555 ? 
101 BC2 10 TYR B  178 ? TYR B 178  . ? 1_555 ? 
102 BC2 10 CYS B  215 ? CYS B 215  . ? 1_555 ? 
103 BC2 10 HIS B  216 ? HIS B 216  . ? 1_555 ? 
104 BC2 10 THR B  217 ? THR B 217  . ? 1_555 ? 
105 BC2 10 ILE B  218 ? ILE B 218  . ? 1_555 ? 
106 BC2 10 MET B  219 ? MET B 219  . ? 1_555 ? 
107 BC2 10 ASN B  220 ? ASN B 220  . ? 1_555 ? 
108 BC2 10 CYS B  221 ? CYS B 221  . ? 1_555 ? 
109 BC2 10 ILE B  235 ? ILE B 235  . ? 1_555 ? 
110 BC3 40 GLY E  25  ? GLY N 25   . ? 1_555 ? 
111 BC3 40 ALA E  26  ? ALA N 26   . ? 1_555 ? 
112 BC3 40 GLY E  27  ? GLY N 27   . ? 1_555 ? 
113 BC3 40 GLY E  28  ? GLY N 28   . ? 1_555 ? 
114 BC3 40 ALA E  29  ? ALA N 29   . ? 1_555 ? 
115 BC3 40 THR E  48  ? THR N 48   . ? 1_555 ? 
116 BC3 40 LYS E  49  ? LYS N 49   . ? 1_555 ? 
117 BC3 40 LEU E  50  ? LEU N 50   . ? 1_555 ? 
118 BC3 40 SER E  55  ? SER N 55   . ? 1_555 ? 
119 BC3 40 HIS E  56  ? HIS N 56   . ? 1_555 ? 
120 BC3 40 THR E  57  ? THR N 57   . ? 1_555 ? 
121 BC3 40 ALA E  59  ? ALA N 59   . ? 1_555 ? 
122 BC3 40 ALA E  60  ? ALA N 60   . ? 1_555 ? 
123 BC3 40 GLN E  61  ? GLN N 61   . ? 1_555 ? 
124 BC3 40 GLY E  62  ? GLY N 62   . ? 1_555 ? 
125 BC3 40 GLY E  63  ? GLY N 63   . ? 1_555 ? 
126 BC3 40 TYR E  176 ? TYR N 176  . ? 1_555 ? 
127 BC3 40 PHE E  177 ? PHE N 177  . ? 1_555 ? 
128 BC3 40 ALA E  178 ? ALA N 178  . ? 1_555 ? 
129 BC3 40 ALA E  212 ? ALA N 212  . ? 1_555 ? 
130 BC3 40 THR E  213 ? THR N 213  . ? 1_555 ? 
131 BC3 40 THR E  224 ? THR N 224  . ? 1_555 ? 
132 BC3 40 ASP E  232 ? ASP N 232  . ? 1_555 ? 
133 BC3 40 LEU E  263 ? LEU N 263  . ? 1_555 ? 
134 BC3 40 HIS E  364 ? HIS N 364  . ? 1_555 ? 
135 BC3 40 TYR E  365 ? TYR N 365  . ? 1_555 ? 
136 BC3 40 GLY E  396 ? GLY N 396  . ? 1_555 ? 
137 BC3 40 GLU E  397 ? GLU N 397  . ? 1_555 ? 
138 BC3 40 ARG E  408 ? ARG N 408  . ? 1_555 ? 
139 BC3 40 ALA E  411 ? ALA N 411  . ? 1_555 ? 
140 BC3 40 ASN E  412 ? ASN N 412  . ? 1_555 ? 
141 BC3 40 SER E  413 ? SER N 413  . ? 1_555 ? 
142 BC3 40 LEU E  414 ? LEU N 414  . ? 1_555 ? 
143 BC3 40 LEU E  417 ? LEU N 417  . ? 1_555 ? 
144 BC3 40 TEO BC .   ? TEO N 1002 . ? 1_555 ? 
145 BC3 40 HOH EE .   ? HOH N 1026 . ? 1_555 ? 
146 BC3 40 HOH EE .   ? HOH N 1038 . ? 1_555 ? 
147 BC3 40 HOH EE .   ? HOH N 1051 . ? 1_555 ? 
148 BC3 40 HOH EE .   ? HOH N 1054 . ? 1_555 ? 
149 BC3 40 HOH EE .   ? HOH N 1133 . ? 1_555 ? 
150 BC4 8  SER F  64  ? SER O 64   . ? 1_555 ? 
151 BC4 8  CYS F  65  ? CYS O 65   . ? 1_555 ? 
152 BC4 8  ARG F  66  ? ARG O 66   . ? 1_555 ? 
153 BC4 8  GLY F  68  ? GLY O 68   . ? 1_555 ? 
154 BC4 8  CYS F  70  ? CYS O 70   . ? 1_555 ? 
155 BC4 8  GLY F  71  ? GLY O 71   . ? 1_555 ? 
156 BC4 8  CYS F  73  ? CYS O 73   . ? 1_555 ? 
157 BC4 8  CYS F  85  ? CYS O 85   . ? 1_555 ? 
158 BC5 8  CYS F  158 ? CYS O 158  . ? 1_555 ? 
159 BC5 8  ILE F  159 ? ILE O 159  . ? 1_555 ? 
160 BC5 8  CYS F  161 ? CYS O 161  . ? 1_555 ? 
161 BC5 8  ALA F  162 ? ALA O 162  . ? 1_555 ? 
162 BC5 8  CYS F  164 ? CYS O 164  . ? 1_555 ? 
163 BC5 8  ALA F  182 ? ALA O 182  . ? 1_555 ? 
164 BC5 8  CYS F  225 ? CYS O 225  . ? 1_555 ? 
165 BC5 8  PRO F  226 ? PRO O 226  . ? 1_555 ? 
166 BC6 10 CYS F  168 ? CYS O 168  . ? 1_555 ? 
167 BC6 10 TYR F  178 ? TYR O 178  . ? 1_555 ? 
168 BC6 10 CYS F  215 ? CYS O 215  . ? 1_555 ? 
169 BC6 10 HIS F  216 ? HIS O 216  . ? 1_555 ? 
170 BC6 10 THR F  217 ? THR O 217  . ? 1_555 ? 
171 BC6 10 ILE F  218 ? ILE O 218  . ? 1_555 ? 
172 BC6 10 MET F  219 ? MET O 219  . ? 1_555 ? 
173 BC6 10 ASN F  220 ? ASN O 220  . ? 1_555 ? 
174 BC6 10 CYS F  221 ? CYS O 221  . ? 1_555 ? 
175 BC6 10 ILE F  235 ? ILE O 235  . ? 1_555 ? 
176 BC7 16 HIS C  42  ? HIS C 42   . ? 1_555 ? 
177 BC7 16 ARG C  43  ? ARG C 43   . ? 1_555 ? 
178 BC7 16 GLY C  46  ? GLY C 46   . ? 1_555 ? 
179 BC7 16 LEU C  49  ? LEU C 49   . ? 1_555 ? 
180 BC7 16 SER C  50  ? SER C 50   . ? 1_555 ? 
181 BC7 16 HIS C  98  ? HIS C 98   . ? 1_555 ? 
182 BC7 16 GLY C  102 ? GLY C 102  . ? 1_555 ? 
183 BC7 16 HIS C  105 ? HIS C 105  . ? 1_555 ? 
184 BC7 16 HOH CE .   ? HOH C 1879 . ? 1_555 ? 
185 BC7 16 HOH CE .   ? HOH C 1903 . ? 1_555 ? 
186 BC7 16 HOH CE .   ? HOH C 2103 . ? 1_555 ? 
187 BC7 16 ARG D  14  ? ARG D 14   . ? 1_555 ? 
188 BC7 16 LEU D  20  ? LEU D 20   . ? 1_555 ? 
189 BC7 16 LEU D  43  ? LEU D 43   . ? 1_555 ? 
190 BC7 16 HIS D  46  ? HIS D 46   . ? 1_555 ? 
191 BC7 16 GLY D  50  ? GLY D 50   . ? 1_555 ? 
192 BC8 11 PRO B  169 ? PRO B 169  . ? 1_555 ? 
193 BC8 11 TRP B  173 ? TRP B 173  . ? 1_555 ? 
194 BC8 11 HIS B  216 ? HIS B 216  . ? 1_555 ? 
195 BC8 11 ILE C  27  ? ILE C 27   . ? 1_555 ? 
196 BC8 11 TRP C  32  ? TRP C 32   . ? 1_555 ? 
197 BC8 11 MET C  36  ? MET C 36   . ? 1_555 ? 
198 BC8 11 SER C  39  ? SER C 39   . ? 1_555 ? 
199 BC8 11 ILE C  40  ? ILE C 40   . ? 1_555 ? 
200 BC8 11 ARG C  43  ? ARG C 43   . ? 1_555 ? 
201 BC8 11 HOH CE .   ? HOH C 1687 . ? 1_555 ? 
202 BC8 11 TYR D  58  ? TYR D 58   . ? 1_555 ? 
203 BC9 11 GLY A  62  ? GLY A 62   . ? 1_555 ? 
204 BC9 11 HIS A  253 ? HIS A 253  . ? 1_555 ? 
205 BC9 11 LEU A  263 ? LEU A 263  . ? 1_555 ? 
206 BC9 11 THR A  265 ? THR A 265  . ? 1_555 ? 
207 BC9 11 GLU A  266 ? GLU A 266  . ? 1_555 ? 
208 BC9 11 ARG A  297 ? ARG A 297  . ? 1_555 ? 
209 BC9 11 HIS A  364 ? HIS A 364  . ? 1_555 ? 
210 BC9 11 ARG A  408 ? ARG A 408  . ? 1_555 ? 
211 BC9 11 GLY A  410 ? GLY A 410  . ? 1_555 ? 
212 BC9 11 ALA A  411 ? ALA A 411  . ? 1_555 ? 
213 BC9 11 FAD K  .   ? FAD A 1001 . ? 1_555 ? 
214 CC1 4  GOL OB .   ? GOL C 294  . ? 1_555 ? 
215 CC1 4  ALA D  27  ? ALA D 27   . ? 1_555 ? 
216 CC1 4  TYR D  28  ? TYR D 28   . ? 1_555 ? 
217 CC1 4  TRP D  101 ? TRP D 101  . ? 1_555 ? 
218 CC2 1  HOH CE .   ? HOH C 2865 . ? 1_555 ? 
219 CC3 17 HOH FE .   ? HOH O 1079 . ? 1_555 ? 
220 CC3 17 HIS G  42  ? HIS P 42   . ? 1_555 ? 
221 CC3 17 ARG G  43  ? ARG P 43   . ? 1_555 ? 
222 CC3 17 GLY G  46  ? GLY P 46   . ? 1_555 ? 
223 CC3 17 LEU G  49  ? LEU P 49   . ? 1_555 ? 
224 CC3 17 SER G  50  ? SER P 50   . ? 1_555 ? 
225 CC3 17 HIS G  98  ? HIS P 98   . ? 1_555 ? 
226 CC3 17 THR G  99  ? THR P 99   . ? 1_555 ? 
227 CC3 17 GLY G  102 ? GLY P 102  . ? 1_555 ? 
228 CC3 17 HIS G  105 ? HIS P 105  . ? 1_555 ? 
229 CC3 17 HOH GE .   ? HOH P 1002 . ? 1_555 ? 
230 CC3 17 HOH GE .   ? HOH P 1199 . ? 1_555 ? 
231 CC3 17 ARG H  14  ? ARG Q 14   . ? 1_555 ? 
232 CC3 17 LEU H  20  ? LEU Q 20   . ? 1_555 ? 
233 CC3 17 LEU H  43  ? LEU Q 43   . ? 1_555 ? 
234 CC3 17 HIS H  46  ? HIS Q 46   . ? 1_555 ? 
235 CC3 17 GLY H  50  ? GLY Q 50   . ? 1_555 ? 
236 CC4 12 PRO F  169 ? PRO O 169  . ? 1_555 ? 
237 CC4 12 TRP F  173 ? TRP O 173  . ? 1_555 ? 
238 CC4 12 HIS F  216 ? HIS O 216  . ? 1_555 ? 
239 CC4 12 ILE F  218 ? ILE O 218  . ? 1_555 ? 
240 CC4 12 ILE G  27  ? ILE P 27   . ? 1_555 ? 
241 CC4 12 TRP G  32  ? TRP P 32   . ? 1_555 ? 
242 CC4 12 MET G  36  ? MET P 36   . ? 1_555 ? 
243 CC4 12 SER G  39  ? SER P 39   . ? 1_555 ? 
244 CC4 12 ILE G  40  ? ILE P 40   . ? 1_555 ? 
245 CC4 12 ARG G  43  ? ARG P 43   . ? 1_555 ? 
246 CC4 12 HOH GE .   ? HOH P 1004 . ? 1_555 ? 
247 CC4 12 TYR H  58  ? TYR Q 58   . ? 1_555 ? 
248 CC5 11 GLY E  62  ? GLY N 62   . ? 1_555 ? 
249 CC5 11 HIS E  253 ? HIS N 253  . ? 1_555 ? 
250 CC5 11 LEU E  263 ? LEU N 263  . ? 1_555 ? 
251 CC5 11 THR E  265 ? THR N 265  . ? 1_555 ? 
252 CC5 11 GLU E  266 ? GLU N 266  . ? 1_555 ? 
253 CC5 11 ARG E  297 ? ARG N 297  . ? 1_555 ? 
254 CC5 11 HIS E  364 ? HIS N 364  . ? 1_555 ? 
255 CC5 11 ARG E  408 ? ARG N 408  . ? 1_555 ? 
256 CC5 11 GLY E  410 ? GLY N 410  . ? 1_555 ? 
257 CC5 11 ALA E  411 ? ALA N 411  . ? 1_555 ? 
258 CC5 11 FAD AC .   ? FAD N 1001 . ? 1_555 ? 
259 CC6 6  SER G  141 ? SER P 141  . ? 1_555 ? 
260 CC6 6  GOL SD .   ? GOL P 208  . ? 1_555 ? 
261 CC6 6  UNL LD .   ? UNL P 211  . ? 1_555 ? 
262 CC6 6  ALA H  27  ? ALA Q 27   . ? 1_555 ? 
263 CC6 6  VAL H  97  ? VAL Q 97   . ? 1_555 ? 
264 CC6 6  TRP H  101 ? TRP Q 101  . ? 1_555 ? 
265 CC7 2  GOL SD .   ? GOL P 208  . ? 1_555 ? 
266 CC7 2  PEE TD .   ? PEE Q 210  . ? 1_555 ? 
267 CC8 4  GLN E  11  ? GLN N 11   . ? 1_555 ? 
268 CC8 4  TYR E  12  ? TYR N 12   . ? 1_555 ? 
269 CC8 4  GLN E  136 ? GLN N 136  . ? 1_554 ? 
270 CC8 4  ARG E  457 ? ARG N 457  . ? 1_555 ? 
271 CC9 2  ASP F  176 ? ASP O 176  . ? 1_555 ? 
272 CC9 2  TRP G  13  ? TRP P 13   . ? 1_555 ? 
273 DC1 3  TYR C  85  ? TYR C 85   . ? 1_555 ? 
274 DC1 3  HOH CE .   ? HOH C 2876 . ? 1_555 ? 
275 DC1 3  LEU G  127 ? LEU P 127  . ? 1_555 ? 
276 DC2 4  ALA B  78  ? ALA B 78   . ? 1_555 ? 
277 DC2 4  HOH BE .   ? HOH B 1906 . ? 1_555 ? 
278 DC2 4  HOH BE .   ? HOH B 2343 . ? 1_555 ? 
279 DC2 4  LYS C  31  ? LYS C 31   . ? 1_555 ? 
280 DC3 3  PHE A  137 ? PHE A 137  . ? 1_555 ? 
281 DC3 3  SER A  612 ? SER A 612  . ? 1_555 ? 
282 DC3 3  HOH AE .   ? HOH A 2231 . ? 1_556 ? 
283 DC4 2  GLY A  272 ? GLY A 272  . ? 1_555 ? 
284 DC4 2  HOH AE .   ? HOH A 2942 . ? 1_555 ? 
285 DC5 1  GLN E  11  ? GLN N 11   . ? 1_556 ? 
286 DC6 1  GLN G  118 ? GLN P 118  . ? 1_555 ? 
287 DC7 1  GLU E  608 ? GLU N 608  . ? 1_555 ? 
288 DC8 1  TYR E  258 ? TYR N 258  . ? 1_555 ? 
289 DC9 1  PHE F  210 ? PHE O 210  . ? 1_555 ? 
290 EC1 1  THR C  41  ? THR C 41   . ? 1_555 ? 
291 EC2 1  TYR D  73  ? TYR D 73   . ? 1_555 ? 
292 EC3 1  UNL FB .   ? UNL C 251  . ? 1_555 ? 
293 EC4 1  UNL EB .   ? UNL C 248  . ? 1_555 ? 
294 EC5 1  ASP B  46  ? ASP B 46   . ? 1_555 ? 
295 EC6 2  LYS A  442 ? LYS A 442  . ? 1_555 ? 
296 EC6 2  ASN A  444 ? ASN A 444  . ? 1_555 ? 
297 EC7 1  HOH AE .   ? HOH A 2810 . ? 1_555 ? 
298 EC8 1  PRO B  209 ? PRO B 209  . ? 1_555 ? 
299 EC9 2  LYS A  354 ? LYS A 354  . ? 1_555 ? 
300 EC9 2  GLU A  355 ? GLU A 355  . ? 1_555 ? 
301 FC1 3  HOH AE .   ? HOH A 2544 . ? 1_554 ? 
302 FC1 3  HOH AE .   ? HOH A 2640 . ? 1_554 ? 
303 FC1 3  HOH AE .   ? HOH A 2892 . ? 1_554 ? 
304 FC2 1  LYS A  593 ? LYS A 593  . ? 1_555 ? 
305 FC3 1  TYR A  500 ? TYR A 500  . ? 1_555 ? 
306 FC4 1  ARG B  10  ? ARG B 10   . ? 1_555 ? 
307 FC5 3  ALA A  451 ? ALA A 451  . ? 1_556 ? 
308 FC5 3  ASP A  454 ? ASP A 454  . ? 1_556 ? 
309 FC5 3  LYS A  455 ? LYS A 455  . ? 1_556 ? 
310 FC6 1  TYR H  73  ? TYR Q 73   . ? 1_555 ? 
311 FC7 1  BHG WA .   ? BHG C 142  . ? 1_555 ? 
312 FC8 2  PHE E  137 ? PHE N 137  . ? 1_554 ? 
313 FC8 2  SER E  612 ? SER N 612  . ? 1_554 ? 
314 FC9 1  GLU E  491 ? GLU N 491  . ? 1_555 ? 
315 GC1 2  GLU E  18  ? GLU N 18   . ? 1_555 ? 
316 GC1 2  HOH EE .   ? HOH N 1566 . ? 1_555 ? 
317 GC2 1  LYS E  474 ? LYS N 474  . ? 1_555 ? 
318 GC3 2  PRO A  13  ? PRO A 13   . ? 1_556 ? 
319 GC3 2  GLY A  199 ? GLY A 199  . ? 1_556 ? 
320 GC4 3  HIS A  326 ? HIS A 326  . ? 1_555 ? 
321 GC4 3  HIS A  327 ? HIS A 327  . ? 1_555 ? 
322 GC4 3  HOH AE .   ? HOH A 2959 . ? 1_555 ? 
323 GC5 1  LYS E  474 ? LYS N 474  . ? 1_555 ? 
324 GC6 2  LEU A  567 ? LEU A 567  . ? 1_555 ? 
325 GC6 2  PRO A  615 ? PRO A 615  . ? 1_555 ? 
326 GC7 3  PHE C  56  ? PHE C 56   . ? 1_555 ? 
327 GC7 3  ILE D  93  ? ILE D 93   . ? 1_555 ? 
328 GC7 3  PEE PB .   ? PEE D 109  . ? 1_555 ? 
329 GC8 9  HIS B  104 ? HIS B 104  . ? 1_555 ? 
330 GC8 9  MET B  105 ? MET B 105  . ? 1_555 ? 
331 GC8 9  TYR B  171 ? TYR B 171  . ? 1_555 ? 
332 GC8 9  HOH BE .   ? HOH B 1772 . ? 1_555 ? 
333 GC8 9  HOH BE .   ? HOH B 1792 . ? 1_555 ? 
334 GC8 9  HOH BE .   ? HOH B 1821 . ? 1_555 ? 
335 GC8 9  HOH BE .   ? HOH B 1952 . ? 1_555 ? 
336 GC8 9  HOH BE .   ? HOH B 2154 . ? 1_555 ? 
337 GC8 9  TRP C  13  ? TRP C 13   . ? 1_555 ? 
338 GC9 10 HIS F  104 ? HIS O 104  . ? 1_555 ? 
339 GC9 10 MET F  105 ? MET O 105  . ? 1_555 ? 
340 GC9 10 GLY F  175 ? GLY O 175  . ? 1_555 ? 
341 GC9 10 HOH FE .   ? HOH O 1039 . ? 1_555 ? 
342 GC9 10 HOH FE .   ? HOH O 1047 . ? 1_555 ? 
343 GC9 10 HOH FE .   ? HOH O 1055 . ? 1_555 ? 
344 GC9 10 HOH FE .   ? HOH O 1099 . ? 1_555 ? 
345 GC9 10 HOH FE .   ? HOH O 1156 . ? 1_555 ? 
346 GC9 10 PHE G  12  ? PHE P 12   . ? 1_555 ? 
347 GC9 10 TRP G  13  ? TRP P 13   . ? 1_555 ? 
348 HC1 3  LEU G  91  ? LEU P 91   . ? 1_555 ? 
349 HC1 3  UNL LD .   ? UNL P 211  . ? 1_555 ? 
350 HC1 3  PEE TD .   ? PEE Q 210  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FBW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FBW 
_atom_sites.fract_transf_matrix[1][1]   0.008425 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000009 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004981 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014786 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
K  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  9   ? 8.874   67.315  -2.704  1.00 87.74  ? 9    SER A N     1 
ATOM   2     C  CA    . SER A  1  9   ? 9.420   66.846  -4.020  1.00 86.53  ? 9    SER A CA    1 
ATOM   3     C  C     . SER A  1  9   ? 8.320   66.349  -4.952  1.00 85.62  ? 9    SER A C     1 
ATOM   4     O  O     . SER A  1  9   ? 7.189   66.846  -4.950  1.00 85.20  ? 9    SER A O     1 
ATOM   5     C  CB    . SER A  1  9   ? 10.428  65.702  -3.817  1.00 85.45  ? 9    SER A CB    1 
ATOM   6     O  OG    . SER A  1  9   ? 9.784   64.508  -3.394  1.00 81.68  ? 9    SER A OG    1 
ATOM   7     N  N     . THR A  1  10  ? 8.682   65.347  -5.742  1.00 84.31  ? 10   THR A N     1 
ATOM   8     C  CA    . THR A  1  10  ? 7.780   64.732  -6.696  1.00 81.85  ? 10   THR A CA    1 
ATOM   9     C  C     . THR A  1  10  ? 8.389   63.371  -6.982  1.00 79.20  ? 10   THR A C     1 
ATOM   10    O  O     . THR A  1  10  ? 7.703   62.430  -7.400  1.00 77.94  ? 10   THR A O     1 
ATOM   11    C  CB    . THR A  1  10  ? 7.722   65.537  -8.017  1.00 82.90  ? 10   THR A CB    1 
ATOM   12    O  OG1   . THR A  1  10  ? 7.485   66.923  -7.729  1.00 83.45  ? 10   THR A OG1   1 
ATOM   13    C  CG2   . THR A  1  10  ? 6.603   65.011  -8.912  1.00 83.41  ? 10   THR A CG2   1 
ATOM   14    N  N     . GLN A  1  11  ? 9.687   63.264  -6.727  1.00 75.42  ? 11   GLN A N     1 
ATOM   15    C  CA    . GLN A  1  11  ? 10.359  62.014  -7.004  1.00 72.87  ? 11   GLN A CA    1 
ATOM   16    C  C     . GLN A  1  11  ? 10.221  60.985  -5.896  1.00 67.92  ? 11   GLN A C     1 
ATOM   17    O  O     . GLN A  1  11  ? 10.446  59.794  -6.119  1.00 69.27  ? 11   GLN A O     1 
ATOM   18    C  CB    . GLN A  1  11  ? 11.831  62.259  -7.331  1.00 77.49  ? 11   GLN A CB    1 
ATOM   19    C  CG    . GLN A  1  11  ? 12.484  63.379  -6.561  1.00 83.00  ? 11   GLN A CG    1 
ATOM   20    C  CD    . GLN A  1  11  ? 13.917  63.610  -7.019  1.00 87.63  ? 11   GLN A CD    1 
ATOM   21    O  OE1   . GLN A  1  11  ? 14.209  63.582  -8.221  1.00 86.57  ? 11   GLN A OE1   1 
ATOM   22    N  NE2   . GLN A  1  11  ? 14.816  63.853  -6.064  1.00 90.23  ? 11   GLN A NE2   1 
ATOM   23    N  N     . TYR A  1  12  ? 9.866   61.426  -4.697  1.00 58.92  ? 12   TYR A N     1 
ATOM   24    C  CA    . TYR A  1  12  ? 9.678   60.469  -3.625  1.00 50.93  ? 12   TYR A CA    1 
ATOM   25    C  C     . TYR A  1  12  ? 8.201   60.327  -3.321  1.00 48.23  ? 12   TYR A C     1 
ATOM   26    O  O     . TYR A  1  12  ? 7.488   61.306  -3.159  1.00 46.37  ? 12   TYR A O     1 
ATOM   27    C  CB    . TYR A  1  12  ? 10.429  60.885  -2.359  1.00 47.30  ? 12   TYR A CB    1 
ATOM   28    C  CG    . TYR A  1  12  ? 11.922  60.698  -2.448  1.00 40.79  ? 12   TYR A CG    1 
ATOM   29    C  CD1   . TYR A  1  12  ? 12.739  61.690  -3.007  1.00 37.47  ? 12   TYR A CD1   1 
ATOM   30    C  CD2   . TYR A  1  12  ? 12.523  59.512  -2.006  1.00 37.32  ? 12   TYR A CD2   1 
ATOM   31    C  CE1   . TYR A  1  12  ? 14.119  61.504  -3.120  1.00 34.32  ? 12   TYR A CE1   1 
ATOM   32    C  CE2   . TYR A  1  12  ? 13.893  59.316  -2.124  1.00 36.24  ? 12   TYR A CE2   1 
ATOM   33    C  CZ    . TYR A  1  12  ? 14.686  60.313  -2.681  1.00 34.78  ? 12   TYR A CZ    1 
ATOM   34    O  OH    . TYR A  1  12  ? 16.039  60.104  -2.825  1.00 37.49  ? 12   TYR A OH    1 
ATOM   35    N  N     . PRO A  1  13  ? 7.710   59.091  -3.293  1.00 47.88  ? 13   PRO A N     1 
ATOM   36    C  CA    . PRO A  1  13  ? 6.281   58.927  -2.988  1.00 43.28  ? 13   PRO A CA    1 
ATOM   37    C  C     . PRO A  1  13  ? 6.074   59.314  -1.516  1.00 39.06  ? 13   PRO A C     1 
ATOM   38    O  O     . PRO A  1  13  ? 6.855   58.889  -0.651  1.00 36.58  ? 13   PRO A O     1 
ATOM   39    C  CB    . PRO A  1  13  ? 6.038   57.438  -3.253  1.00 46.12  ? 13   PRO A CB    1 
ATOM   40    C  CG    . PRO A  1  13  ? 7.420   56.802  -3.026  1.00 45.29  ? 13   PRO A CG    1 
ATOM   41    C  CD    . PRO A  1  13  ? 8.366   57.808  -3.619  1.00 44.64  ? 13   PRO A CD    1 
ATOM   42    N  N     . VAL A  1  14  ? 5.049   60.120  -1.243  1.00 32.96  ? 14   VAL A N     1 
ATOM   43    C  CA    . VAL A  1  14  ? 4.742   60.570  0.103   1.00 28.24  ? 14   VAL A CA    1 
ATOM   44    C  C     . VAL A  1  14  ? 3.427   60.029  0.637   1.00 32.83  ? 14   VAL A C     1 
ATOM   45    O  O     . VAL A  1  14  ? 2.390   60.196  0.006   1.00 34.14  ? 14   VAL A O     1 
ATOM   46    C  CB    . VAL A  1  14  ? 4.637   62.079  0.162   1.00 27.53  ? 14   VAL A CB    1 
ATOM   47    C  CG1   . VAL A  1  14  ? 4.357   62.542  1.618   1.00 27.00  ? 14   VAL A CG1   1 
ATOM   48    C  CG2   . VAL A  1  14  ? 5.907   62.696  -0.327  1.00 29.65  ? 14   VAL A CG2   1 
ATOM   49    N  N     . VAL A  1  15  ? 3.468   59.417  1.824   1.00 31.33  ? 15   VAL A N     1 
ATOM   50    C  CA    . VAL A  1  15  ? 2.280   58.879  2.468   1.00 27.99  ? 15   VAL A CA    1 
ATOM   51    C  C     . VAL A  1  15  ? 1.942   59.691  3.722   1.00 30.33  ? 15   VAL A C     1 
ATOM   52    O  O     . VAL A  1  15  ? 2.806   59.951  4.572   1.00 32.65  ? 15   VAL A O     1 
ATOM   53    C  CB    . VAL A  1  15  ? 2.475   57.404  2.855   1.00 28.24  ? 15   VAL A CB    1 
ATOM   54    C  CG1   . VAL A  1  15  ? 1.254   56.880  3.578   1.00 33.26  ? 15   VAL A CG1   1 
ATOM   55    C  CG2   . VAL A  1  15  ? 2.719   56.574  1.614   1.00 26.14  ? 15   VAL A CG2   1 
ATOM   56    N  N     . ASP A  1  16  ? 0.684   60.098  3.837   1.00 28.72  ? 16   ASP A N     1 
ATOM   57    C  CA    . ASP A  1  16  ? 0.257   60.892  4.970   1.00 31.30  ? 16   ASP A CA    1 
ATOM   58    C  C     . ASP A  1  16  ? -0.614  60.090  5.916   1.00 31.07  ? 16   ASP A C     1 
ATOM   59    O  O     . ASP A  1  16  ? -1.457  59.299  5.481   1.00 32.78  ? 16   ASP A O     1 
ATOM   60    C  CB    . ASP A  1  16  ? -0.484  62.144  4.490   1.00 33.69  ? 16   ASP A CB    1 
ATOM   61    C  CG    . ASP A  1  16  ? 0.470   63.289  4.145   1.00 39.20  ? 16   ASP A CG    1 
ATOM   62    O  OD1   . ASP A  1  16  ? 1.698   63.089  4.182   1.00 41.60  ? 16   ASP A OD1   1 
ATOM   63    O  OD2   . ASP A  1  16  ? -0.004  64.399  3.841   1.00 44.42  ? 16   ASP A OD2   1 
ATOM   64    N  N     . HIS A  1  17  ? -0.372  60.273  7.212   1.00 28.62  ? 17   HIS A N     1 
ATOM   65    C  CA    . HIS A  1  17  ? -1.119  59.587  8.268   1.00 28.90  ? 17   HIS A CA    1 
ATOM   66    C  C     . HIS A  1  17  ? -1.648  60.659  9.229   1.00 28.54  ? 17   HIS A C     1 
ATOM   67    O  O     . HIS A  1  17  ? -1.031  61.719  9.390   1.00 31.28  ? 17   HIS A O     1 
ATOM   68    C  CB    . HIS A  1  17  ? -0.184  58.645  9.051   1.00 29.98  ? 17   HIS A CB    1 
ATOM   69    C  CG    . HIS A  1  17  ? 0.614   57.711  8.187   1.00 29.53  ? 17   HIS A CG    1 
ATOM   70    N  ND1   . HIS A  1  17  ? 0.249   56.402  7.974   1.00 27.86  ? 17   HIS A ND1   1 
ATOM   71    C  CD2   . HIS A  1  17  ? 1.777   57.887  7.515   1.00 29.66  ? 17   HIS A CD2   1 
ATOM   72    C  CE1   . HIS A  1  17  ? 1.154   55.806  7.218   1.00 27.44  ? 17   HIS A CE1   1 
ATOM   73    N  NE2   . HIS A  1  17  ? 2.090   56.688  6.925   1.00 27.06  ? 17   HIS A NE2   1 
ATOM   74    N  N     . GLU A  1  18  ? -2.792  60.398  9.848   1.00 26.46  ? 18   GLU A N     1 
ATOM   75    C  CA    . GLU A  1  18  ? -3.374  61.314  10.809  1.00 30.14  ? 18   GLU A CA    1 
ATOM   76    C  C     . GLU A  1  18  ? -3.582  60.503  12.071  1.00 28.57  ? 18   GLU A C     1 
ATOM   77    O  O     . GLU A  1  18  ? -4.221  59.460  12.029  1.00 29.05  ? 18   GLU A O     1 
ATOM   78    C  CB    . GLU A  1  18  ? -4.724  61.844  10.313  1.00 35.31  ? 18   GLU A CB    1 
ATOM   79    C  CG    . GLU A  1  18  ? -4.648  62.644  9.013   1.00 47.63  ? 18   GLU A CG    1 
ATOM   80    C  CD    . GLU A  1  18  ? -6.009  63.207  8.575   1.00 55.10  ? 18   GLU A CD    1 
ATOM   81    O  OE1   . GLU A  1  18  ? -6.556  64.077  9.290   1.00 58.09  ? 18   GLU A OE1   1 
ATOM   82    O  OE2   . GLU A  1  18  ? -6.532  62.776  7.519   1.00 59.25  ? 18   GLU A OE2   1 
ATOM   83    N  N     . PHE A  1  19  ? -3.031  60.961  13.186  1.00 25.22  ? 19   PHE A N     1 
ATOM   84    C  CA    . PHE A  1  19  ? -3.191  60.246  14.456  1.00 24.58  ? 19   PHE A CA    1 
ATOM   85    C  C     . PHE A  1  19  ? -3.489  61.282  15.535  1.00 22.03  ? 19   PHE A C     1 
ATOM   86    O  O     . PHE A  1  19  ? -3.380  62.471  15.265  1.00 25.67  ? 19   PHE A O     1 
ATOM   87    C  CB    . PHE A  1  19  ? -1.902  59.469  14.812  1.00 22.66  ? 19   PHE A CB    1 
ATOM   88    C  CG    . PHE A  1  19  ? -1.706  58.202  14.010  1.00 17.83  ? 19   PHE A CG    1 
ATOM   89    C  CD1   . PHE A  1  19  ? -0.940  58.198  12.849  1.00 24.12  ? 19   PHE A CD1   1 
ATOM   90    C  CD2   . PHE A  1  19  ? -2.311  57.019  14.407  1.00 18.32  ? 19   PHE A CD2   1 
ATOM   91    C  CE1   . PHE A  1  19  ? -0.783  57.021  12.094  1.00 21.60  ? 19   PHE A CE1   1 
ATOM   92    C  CE2   . PHE A  1  19  ? -2.165  55.830  13.664  1.00 14.21  ? 19   PHE A CE2   1 
ATOM   93    C  CZ    . PHE A  1  19  ? -1.401  55.835  12.508  1.00 19.17  ? 19   PHE A CZ    1 
ATOM   94    N  N     . ASP A  1  20  ? -3.905  60.862  16.729  1.00 19.60  ? 20   ASP A N     1 
ATOM   95    C  CA    . ASP A  1  20  ? -4.115  61.834  17.792  1.00 19.45  ? 20   ASP A CA    1 
ATOM   96    C  C     . ASP A  1  20  ? -2.740  62.201  18.322  1.00 20.95  ? 20   ASP A C     1 
ATOM   97    O  O     . ASP A  1  20  ? -2.486  63.358  18.734  1.00 19.29  ? 20   ASP A O     1 
ATOM   98    C  CB    . ASP A  1  20  ? -4.880  61.255  18.980  1.00 19.45  ? 20   ASP A CB    1 
ATOM   99    C  CG    . ASP A  1  20  ? -6.364  61.108  18.713  1.00 22.28  ? 20   ASP A CG    1 
ATOM   100   O  OD1   . ASP A  1  20  ? -6.976  62.085  18.232  1.00 28.98  ? 20   ASP A OD1   1 
ATOM   101   O  OD2   . ASP A  1  20  ? -6.907  60.012  18.990  1.00 19.37  ? 20   ASP A OD2   1 
ATOM   102   N  N     . ALA A  1  21  ? -1.874  61.181  18.343  1.00 16.90  ? 21   ALA A N     1 
ATOM   103   C  CA    . ALA A  1  21  ? -0.527  61.331  18.872  1.00 19.42  ? 21   ALA A CA    1 
ATOM   104   C  C     . ALA A  1  21  ? 0.510   60.473  18.181  1.00 19.38  ? 21   ALA A C     1 
ATOM   105   O  O     . ALA A  1  21  ? 0.216   59.377  17.703  1.00 20.13  ? 21   ALA A O     1 
ATOM   106   C  CB    . ALA A  1  21  ? -0.532  61.025  20.386  1.00 17.11  ? 21   ALA A CB    1 
ATOM   107   N  N     . VAL A  1  22  ? 1.737   60.991  18.138  1.00 19.27  ? 22   VAL A N     1 
ATOM   108   C  CA    . VAL A  1  22  ? 2.847   60.279  17.530  1.00 21.64  ? 22   VAL A CA    1 
ATOM   109   C  C     . VAL A  1  22  ? 3.981   60.165  18.525  1.00 19.01  ? 22   VAL A C     1 
ATOM   110   O  O     . VAL A  1  22  ? 4.408   61.174  19.080  1.00 20.92  ? 22   VAL A O     1 
ATOM   111   C  CB    . VAL A  1  22  ? 3.429   61.047  16.362  1.00 26.52  ? 22   VAL A CB    1 
ATOM   112   C  CG1   . VAL A  1  22  ? 4.640   60.291  15.814  1.00 25.45  ? 22   VAL A CG1   1 
ATOM   113   C  CG2   . VAL A  1  22  ? 2.380   61.217  15.327  1.00 27.79  ? 22   VAL A CG2   1 
ATOM   114   N  N     . VAL A  1  23  ? 4.483   58.958  18.748  1.00 14.68  ? 23   VAL A N     1 
ATOM   115   C  CA    . VAL A  1  23  ? 5.602   58.790  19.672  1.00 14.49  ? 23   VAL A CA    1 
ATOM   116   C  C     . VAL A  1  23  ? 6.820   58.376  18.848  1.00 14.41  ? 23   VAL A C     1 
ATOM   117   O  O     . VAL A  1  23  ? 6.733   57.431  18.114  1.00 14.81  ? 23   VAL A O     1 
ATOM   118   C  CB    . VAL A  1  23  ? 5.325   57.694  20.739  1.00 13.12  ? 23   VAL A CB    1 
ATOM   119   C  CG1   . VAL A  1  23  ? 6.572   57.488  21.629  1.00 15.12  ? 23   VAL A CG1   1 
ATOM   120   C  CG2   . VAL A  1  23  ? 4.145   58.100  21.608  1.00 12.30  ? 23   VAL A CG2   1 
ATOM   121   N  N     . VAL A  1  24  ? 7.944   59.092  18.925  1.00 15.83  ? 24   VAL A N     1 
ATOM   122   C  CA    . VAL A  1  24  ? 9.137   58.656  18.155  1.00 13.63  ? 24   VAL A CA    1 
ATOM   123   C  C     . VAL A  1  24  ? 10.066  57.983  19.164  1.00 15.64  ? 24   VAL A C     1 
ATOM   124   O  O     . VAL A  1  24  ? 10.631  58.644  20.036  1.00 14.29  ? 24   VAL A O     1 
ATOM   125   C  CB    . VAL A  1  24  ? 9.859   59.853  17.478  1.00 17.34  ? 24   VAL A CB    1 
ATOM   126   C  CG1   . VAL A  1  24  ? 10.994  59.357  16.561  1.00 14.79  ? 24   VAL A CG1   1 
ATOM   127   C  CG2   . VAL A  1  24  ? 8.849   60.662  16.674  1.00 16.37  ? 24   VAL A CG2   1 
ATOM   128   N  N     . GLY A  1  25  ? 10.168  56.658  19.067  1.00 16.80  ? 25   GLY A N     1 
ATOM   129   C  CA    . GLY A  1  25  ? 10.981  55.884  19.975  1.00 13.78  ? 25   GLY A CA    1 
ATOM   130   C  C     . GLY A  1  25  ? 10.183  54.731  20.585  1.00 14.41  ? 25   GLY A C     1 
ATOM   131   O  O     . GLY A  1  25  ? 9.019   54.917  20.956  1.00 15.56  ? 25   GLY A O     1 
ATOM   132   N  N     . ALA A  1  26  ? 10.803  53.548  20.667  1.00 14.48  ? 26   ALA A N     1 
ATOM   133   C  CA    . ALA A  1  26  ? 10.183  52.362  21.242  1.00 15.51  ? 26   ALA A CA    1 
ATOM   134   C  C     . ALA A  1  26  ? 11.095  51.694  22.280  1.00 19.22  ? 26   ALA A C     1 
ATOM   135   O  O     . ALA A  1  26  ? 11.199  50.456  22.347  1.00 20.93  ? 26   ALA A O     1 
ATOM   136   C  CB    . ALA A  1  26  ? 9.836   51.372  20.142  1.00 20.68  ? 26   ALA A CB    1 
ATOM   137   N  N     . GLY A  1  27  ? 11.757  52.522  23.073  1.00 15.50  ? 27   GLY A N     1 
ATOM   138   C  CA    . GLY A  1  27  ? 12.627  52.037  24.131  1.00 17.19  ? 27   GLY A CA    1 
ATOM   139   C  C     . GLY A  1  27  ? 11.712  51.987  25.324  1.00 12.20  ? 27   GLY A C     1 
ATOM   140   O  O     . GLY A  1  27  ? 10.500  51.942  25.153  1.00 18.83  ? 27   GLY A O     1 
ATOM   141   N  N     . GLY A  1  28  ? 12.249  52.028  26.538  1.00 16.36  ? 28   GLY A N     1 
ATOM   142   C  CA    . GLY A  1  28  ? 11.361  51.964  27.690  1.00 10.27  ? 28   GLY A CA    1 
ATOM   143   C  C     . GLY A  1  28  ? 10.429  53.156  27.747  1.00 13.05  ? 28   GLY A C     1 
ATOM   144   O  O     . GLY A  1  28  ? 9.210   53.024  28.054  1.00 15.07  ? 28   GLY A O     1 
ATOM   145   N  N     . ALA A  1  29  ? 10.968  54.333  27.464  1.00 9.63   ? 29   ALA A N     1 
ATOM   146   C  CA    . ALA A  1  29  ? 10.129  55.532  27.513  1.00 12.56  ? 29   ALA A CA    1 
ATOM   147   C  C     . ALA A  1  29  ? 9.087   55.564  26.409  1.00 14.81  ? 29   ALA A C     1 
ATOM   148   O  O     . ALA A  1  29  ? 7.893   55.701  26.692  1.00 19.47  ? 29   ALA A O     1 
ATOM   149   C  CB    . ALA A  1  29  ? 10.994  56.791  27.447  1.00 8.98   ? 29   ALA A CB    1 
ATOM   150   N  N     . GLY A  1  30  ? 9.532   55.464  25.159  1.00 10.30  ? 30   GLY A N     1 
ATOM   151   C  CA    . GLY A  1  30  ? 8.605   55.476  24.028  1.00 12.95  ? 30   GLY A CA    1 
ATOM   152   C  C     . GLY A  1  30  ? 7.455   54.483  24.148  1.00 15.64  ? 30   GLY A C     1 
ATOM   153   O  O     . GLY A  1  30  ? 6.287   54.823  23.929  1.00 15.27  ? 30   GLY A O     1 
ATOM   154   N  N     . LEU A  1  31  ? 7.780   53.237  24.494  1.00 18.01  ? 31   LEU A N     1 
ATOM   155   C  CA    . LEU A  1  31  ? 6.742   52.225  24.675  1.00 17.71  ? 31   LEU A CA    1 
ATOM   156   C  C     . LEU A  1  31  ? 5.801   52.596  25.807  1.00 18.83  ? 31   LEU A C     1 
ATOM   157   O  O     . LEU A  1  31  ? 4.584   52.501  25.648  1.00 18.32  ? 31   LEU A O     1 
ATOM   158   C  CB    . LEU A  1  31  ? 7.351   50.826  24.956  1.00 19.15  ? 31   LEU A CB    1 
ATOM   159   C  CG    . LEU A  1  31  ? 7.985   50.066  23.768  1.00 22.88  ? 31   LEU A CG    1 
ATOM   160   C  CD1   . LEU A  1  31  ? 8.575   48.752  24.252  1.00 22.31  ? 31   LEU A CD1   1 
ATOM   161   C  CD2   . LEU A  1  31  ? 6.919   49.794  22.682  1.00 19.72  ? 31   LEU A CD2   1 
ATOM   162   N  N     . ARG A  1  32  ? 6.337   53.028  26.957  1.00 15.73  ? 32   ARG A N     1 
ATOM   163   C  CA    . ARG A  1  32  ? 5.441   53.371  28.052  1.00 14.89  ? 32   ARG A CA    1 
ATOM   164   C  C     . ARG A  1  32  ? 4.509   54.532  27.697  1.00 17.11  ? 32   ARG A C     1 
ATOM   165   O  O     . ARG A  1  32  ? 3.352   54.517  28.105  1.00 11.81  ? 32   ARG A O     1 
ATOM   166   C  CB    . ARG A  1  32  ? 6.196   53.761  29.332  1.00 14.32  ? 32   ARG A CB    1 
ATOM   167   C  CG    . ARG A  1  32  ? 5.230   54.047  30.483  1.00 13.63  ? 32   ARG A CG    1 
ATOM   168   C  CD    . ARG A  1  32  ? 4.546   52.746  30.900  1.00 17.10  ? 32   ARG A CD    1 
ATOM   169   N  NE    . ARG A  1  32  ? 3.501   52.894  31.921  1.00 20.16  ? 32   ARG A NE    1 
ATOM   170   C  CZ    . ARG A  1  32  ? 2.278   53.340  31.667  1.00 22.04  ? 32   ARG A CZ    1 
ATOM   171   N  NH1   . ARG A  1  32  ? 1.952   53.689  30.440  1.00 23.00  ? 32   ARG A NH1   1 
ATOM   172   N  NH2   . ARG A  1  32  ? 1.365   53.402  32.628  1.00 21.80  ? 32   ARG A NH2   1 
ATOM   173   N  N     . ALA A  1  33  ? 5.037   55.546  26.989  1.00 18.65  ? 33   ALA A N     1 
ATOM   174   C  CA    . ALA A  1  33  ? 4.235   56.705  26.561  1.00 19.96  ? 33   ALA A CA    1 
ATOM   175   C  C     . ALA A  1  33  ? 3.222   56.240  25.521  1.00 18.23  ? 33   ALA A C     1 
ATOM   176   O  O     . ALA A  1  33  ? 2.049   56.589  25.592  1.00 16.38  ? 33   ALA A O     1 
ATOM   177   C  CB    . ALA A  1  33  ? 5.115   57.758  25.924  1.00 13.83  ? 33   ALA A CB    1 
ATOM   178   N  N     . ALA A  1  34  ? 3.697   55.452  24.556  1.00 17.40  ? 34   ALA A N     1 
ATOM   179   C  CA    . ALA A  1  34  ? 2.839   54.976  23.470  1.00 16.48  ? 34   ALA A CA    1 
ATOM   180   C  C     . ALA A  1  34  ? 1.625   54.171  23.954  1.00 19.13  ? 34   ALA A C     1 
ATOM   181   O  O     . ALA A  1  34  ? 0.488   54.519  23.627  1.00 20.26  ? 34   ALA A O     1 
ATOM   182   C  CB    . ALA A  1  34  ? 3.657   54.148  22.480  1.00 14.53  ? 34   ALA A CB    1 
ATOM   183   N  N     . PHE A  1  35  ? 1.822   53.100  24.734  1.00 20.41  ? 35   PHE A N     1 
ATOM   184   C  CA    . PHE A  1  35  ? 0.622   52.397  25.144  1.00 23.64  ? 35   PHE A CA    1 
ATOM   185   C  C     . PHE A  1  35  ? -0.125  53.155  26.238  1.00 21.09  ? 35   PHE A C     1 
ATOM   186   O  O     . PHE A  1  35  ? -1.312  52.934  26.460  1.00 20.54  ? 35   PHE A O     1 
ATOM   187   C  CB    . PHE A  1  35  ? 0.882   50.900  25.470  1.00 21.35  ? 35   PHE A CB    1 
ATOM   188   C  CG    . PHE A  1  35  ? 1.574   50.639  26.768  1.00 23.49  ? 35   PHE A CG    1 
ATOM   189   C  CD1   . PHE A  1  35  ? 0.898   50.745  27.966  1.00 21.77  ? 35   PHE A CD1   1 
ATOM   190   C  CD2   . PHE A  1  35  ? 2.885   50.176  26.774  1.00 24.64  ? 35   PHE A CD2   1 
ATOM   191   C  CE1   . PHE A  1  35  ? 1.514   50.385  29.177  1.00 27.70  ? 35   PHE A CE1   1 
ATOM   192   C  CE2   . PHE A  1  35  ? 3.513   49.813  27.962  1.00 23.03  ? 35   PHE A CE2   1 
ATOM   193   C  CZ    . PHE A  1  35  ? 2.821   49.918  29.172  1.00 27.00  ? 35   PHE A CZ    1 
ATOM   194   N  N     . GLY A  1  36  ? 0.553   54.086  26.888  1.00 21.29  ? 36   GLY A N     1 
ATOM   195   C  CA    . GLY A  1  36  ? -0.129  54.896  27.890  1.00 21.20  ? 36   GLY A CA    1 
ATOM   196   C  C     . GLY A  1  36  ? -1.141  55.783  27.167  1.00 22.19  ? 36   GLY A C     1 
ATOM   197   O  O     . GLY A  1  36  ? -2.248  56.004  27.647  1.00 22.79  ? 36   GLY A O     1 
ATOM   198   N  N     . LEU A  1  37  ? -0.752  56.320  26.015  1.00 20.36  ? 37   LEU A N     1 
ATOM   199   C  CA    . LEU A  1  37  ? -1.667  57.142  25.223  1.00 22.81  ? 37   LEU A CA    1 
ATOM   200   C  C     . LEU A  1  37  ? -2.807  56.252  24.748  1.00 21.71  ? 37   LEU A C     1 
ATOM   201   O  O     . LEU A  1  37  ? -3.955  56.615  24.913  1.00 24.26  ? 37   LEU A O     1 
ATOM   202   C  CB    . LEU A  1  37  ? -0.944  57.793  24.034  1.00 20.09  ? 37   LEU A CB    1 
ATOM   203   C  CG    . LEU A  1  37  ? -0.109  59.031  24.435  1.00 23.84  ? 37   LEU A CG    1 
ATOM   204   C  CD1   . LEU A  1  37  ? 0.976   59.338  23.402  1.00 23.77  ? 37   LEU A CD1   1 
ATOM   205   C  CD2   . LEU A  1  37  ? -1.049  60.228  24.610  1.00 21.16  ? 37   LEU A CD2   1 
ATOM   206   N  N     . SER A  1  38  ? -2.495  55.075  24.192  1.00 24.51  ? 38   SER A N     1 
ATOM   207   C  CA    . SER A  1  38  ? -3.537  54.152  23.724  1.00 24.45  ? 38   SER A CA    1 
ATOM   208   C  C     . SER A  1  38  ? -4.484  53.720  24.842  1.00 27.76  ? 38   SER A C     1 
ATOM   209   O  O     . SER A  1  38  ? -5.687  53.598  24.609  1.00 27.33  ? 38   SER A O     1 
ATOM   210   C  CB    . SER A  1  38  ? -2.955  52.874  23.103  1.00 28.59  ? 38   SER A CB    1 
ATOM   211   O  OG    . SER A  1  38  ? -2.240  53.126  21.912  1.00 26.84  ? 38   SER A OG    1 
ATOM   212   N  N     . GLU A  1  39  ? -3.968  53.475  26.041  1.00 28.18  ? 39   GLU A N     1 
ATOM   213   C  CA    . GLU A  1  39  ? -4.853  53.060  27.117  1.00 34.81  ? 39   GLU A CA    1 
ATOM   214   C  C     . GLU A  1  39  ? -5.755  54.212  27.569  1.00 34.06  ? 39   GLU A C     1 
ATOM   215   O  O     . GLU A  1  39  ? -6.772  53.982  28.230  1.00 32.05  ? 39   GLU A O     1 
ATOM   216   C  CB    . GLU A  1  39  ? -4.078  52.471  28.313  1.00 36.45  ? 39   GLU A CB    1 
ATOM   217   C  CG    . GLU A  1  39  ? -3.244  53.446  29.125  1.00 47.96  ? 39   GLU A CG    1 
ATOM   218   C  CD    . GLU A  1  39  ? -2.628  52.796  30.378  1.00 53.87  ? 39   GLU A CD    1 
ATOM   219   O  OE1   . GLU A  1  39  ? -1.495  53.193  30.777  1.00 52.71  ? 39   GLU A OE1   1 
ATOM   220   O  OE2   . GLU A  1  39  ? -3.292  51.905  30.969  1.00 56.13  ? 39   GLU A OE2   1 
ATOM   221   N  N     . ALA A  1  40  ? -5.395  55.447  27.213  1.00 33.60  ? 40   ALA A N     1 
ATOM   222   C  CA    . ALA A  1  40  ? -6.225  56.606  27.567  1.00 29.97  ? 40   ALA A CA    1 
ATOM   223   C  C     . ALA A  1  40  ? -7.232  56.908  26.436  1.00 30.14  ? 40   ALA A C     1 
ATOM   224   O  O     . ALA A  1  40  ? -7.956  57.914  26.467  1.00 28.65  ? 40   ALA A O     1 
ATOM   225   C  CB    . ALA A  1  40  ? -5.354  57.819  27.806  1.00 29.58  ? 40   ALA A CB    1 
ATOM   226   N  N     . GLY A  1  41  ? -7.274  56.059  25.425  1.00 26.51  ? 41   GLY A N     1 
ATOM   227   C  CA    . GLY A  1  41  ? -8.203  56.319  24.345  1.00 26.90  ? 41   GLY A CA    1 
ATOM   228   C  C     . GLY A  1  41  ? -7.668  57.048  23.118  1.00 27.50  ? 41   GLY A C     1 
ATOM   229   O  O     . GLY A  1  41  ? -8.420  57.265  22.170  1.00 26.18  ? 41   GLY A O     1 
ATOM   230   N  N     . PHE A  1  42  ? -6.390  57.419  23.104  1.00 26.91  ? 42   PHE A N     1 
ATOM   231   C  CA    . PHE A  1  42  ? -5.849  58.133  21.944  1.00 25.08  ? 42   PHE A CA    1 
ATOM   232   C  C     . PHE A  1  42  ? -5.397  57.206  20.825  1.00 27.02  ? 42   PHE A C     1 
ATOM   233   O  O     . PHE A  1  42  ? -4.801  56.171  21.091  1.00 26.79  ? 42   PHE A O     1 
ATOM   234   C  CB    . PHE A  1  42  ? -4.675  59.022  22.365  1.00 23.60  ? 42   PHE A CB    1 
ATOM   235   C  CG    . PHE A  1  42  ? -5.068  60.162  23.270  1.00 27.28  ? 42   PHE A CG    1 
ATOM   236   C  CD1   . PHE A  1  42  ? -5.389  59.938  24.596  1.00 28.10  ? 42   PHE A CD1   1 
ATOM   237   C  CD2   . PHE A  1  42  ? -5.157  61.456  22.774  1.00 31.58  ? 42   PHE A CD2   1 
ATOM   238   C  CE1   . PHE A  1  42  ? -5.798  60.990  25.426  1.00 34.53  ? 42   PHE A CE1   1 
ATOM   239   C  CE2   . PHE A  1  42  ? -5.566  62.525  23.594  1.00 30.82  ? 42   PHE A CE2   1 
ATOM   240   C  CZ    . PHE A  1  42  ? -5.885  62.292  24.913  1.00 36.05  ? 42   PHE A CZ    1 
ATOM   241   N  N     . ASN A  1  43  ? -5.698  57.579  19.572  1.00 29.51  ? 43   ASN A N     1 
ATOM   242   C  CA    . ASN A  1  43  ? -5.280  56.821  18.373  1.00 27.43  ? 43   ASN A CA    1 
ATOM   243   C  C     . ASN A  1  43  ? -3.807  57.222  18.238  1.00 24.71  ? 43   ASN A C     1 
ATOM   244   O  O     . ASN A  1  43  ? -3.499  58.324  17.758  1.00 24.02  ? 43   ASN A O     1 
ATOM   245   C  CB    . ASN A  1  43  ? -6.041  57.309  17.131  1.00 28.16  ? 43   ASN A CB    1 
ATOM   246   C  CG    . ASN A  1  43  ? -5.643  56.552  15.873  1.00 32.71  ? 43   ASN A CG    1 
ATOM   247   O  OD1   . ASN A  1  43  ? -5.820  57.041  14.755  1.00 33.40  ? 43   ASN A OD1   1 
ATOM   248   N  ND2   . ASN A  1  43  ? -5.107  55.346  16.053  1.00 29.01  ? 43   ASN A ND2   1 
ATOM   249   N  N     . THR A  1  44  ? -2.925  56.306  18.622  1.00 20.99  ? 44   THR A N     1 
ATOM   250   C  CA    . THR A  1  44  ? -1.480  56.573  18.671  1.00 23.54  ? 44   THR A CA    1 
ATOM   251   C  C     . THR A  1  44  ? -0.540  55.809  17.713  1.00 21.72  ? 44   THR A C     1 
ATOM   252   O  O     . THR A  1  44  ? -0.726  54.619  17.419  1.00 19.40  ? 44   THR A O     1 
ATOM   253   C  CB    . THR A  1  44  ? -1.010  56.313  20.138  1.00 25.32  ? 44   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  44  ? -1.888  57.020  21.021  1.00 25.42  ? 44   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  44  ? 0.422   56.745  20.375  1.00 19.22  ? 44   THR A CG2   1 
ATOM   256   N  N     . ALA A  1  45  ? 0.480   56.511  17.232  1.00 19.78  ? 45   ALA A N     1 
ATOM   257   C  CA    . ALA A  1  45  ? 1.471   55.901  16.357  1.00 21.02  ? 45   ALA A CA    1 
ATOM   258   C  C     . ALA A  1  45  ? 2.820   55.862  17.066  1.00 17.80  ? 45   ALA A C     1 
ATOM   259   O  O     . ALA A  1  45  ? 3.202   56.812  17.716  1.00 23.46  ? 45   ALA A O     1 
ATOM   260   C  CB    . ALA A  1  45  ? 1.591   56.695  15.061  1.00 17.95  ? 45   ALA A CB    1 
ATOM   261   N  N     . CYS A  1  46  ? 3.526   54.753  16.957  1.00 16.80  ? 46   CYS A N     1 
ATOM   262   C  CA    . CYS A  1  46  ? 4.870   54.649  17.550  1.00 20.92  ? 46   CYS A CA    1 
ATOM   263   C  C     . CYS A  1  46  ? 5.798   54.331  16.400  1.00 19.30  ? 46   CYS A C     1 
ATOM   264   O  O     . CYS A  1  46  ? 5.727   53.256  15.826  1.00 21.95  ? 46   CYS A O     1 
ATOM   265   C  CB    . CYS A  1  46  ? 4.941   53.539  18.624  1.00 25.30  ? 46   CYS A CB    1 
ATOM   266   S  SG    . CYS A  1  46  ? 6.564   53.441  19.336  1.00 26.45  ? 46   CYS A SG    1 
ATOM   267   N  N     . VAL A  1  47  ? 6.633   55.305  16.055  1.00 18.44  ? 47   VAL A N     1 
ATOM   268   C  CA    . VAL A  1  47  ? 7.567   55.242  14.942  1.00 17.04  ? 47   VAL A CA    1 
ATOM   269   C  C     . VAL A  1  47  ? 8.946   54.932  15.515  1.00 17.30  ? 47   VAL A C     1 
ATOM   270   O  O     . VAL A  1  47  ? 9.458   55.699  16.325  1.00 19.21  ? 47   VAL A O     1 
ATOM   271   C  CB    . VAL A  1  47  ? 7.566   56.656  14.219  1.00 18.67  ? 47   VAL A CB    1 
ATOM   272   C  CG1   . VAL A  1  47  ? 8.594   56.720  13.109  1.00 21.36  ? 47   VAL A CG1   1 
ATOM   273   C  CG2   . VAL A  1  47  ? 6.171   56.969  13.687  1.00 17.86  ? 47   VAL A CG2   1 
ATOM   274   N  N     . THR A  1  48  ? 9.570   53.851  15.074  1.00 17.77  ? 48   THR A N     1 
ATOM   275   C  CA    . THR A  1  48  ? 10.869  53.481  15.599  1.00 14.55  ? 48   THR A CA    1 
ATOM   276   C  C     . THR A  1  48  ? 11.807  52.946  14.524  1.00 15.65  ? 48   THR A C     1 
ATOM   277   O  O     . THR A  1  48  ? 11.389  52.177  13.646  1.00 12.89  ? 48   THR A O     1 
ATOM   278   C  CB    . THR A  1  48  ? 10.698  52.427  16.738  1.00 16.73  ? 48   THR A CB    1 
ATOM   279   O  OG1   . THR A  1  48  ? 11.981  51.870  17.085  1.00 17.91  ? 48   THR A OG1   1 
ATOM   280   C  CG2   . THR A  1  48  ? 9.725   51.289  16.290  1.00 13.36  ? 48   THR A CG2   1 
ATOM   281   N  N     . LYS A  1  49  ? 13.084  53.330  14.588  1.00 13.21  ? 49   LYS A N     1 
ATOM   282   C  CA    . LYS A  1  49  ? 14.000  52.829  13.574  1.00 13.35  ? 49   LYS A CA    1 
ATOM   283   C  C     . LYS A  1  49  ? 14.411  51.384  13.804  1.00 16.40  ? 49   LYS A C     1 
ATOM   284   O  O     . LYS A  1  49  ? 14.945  50.745  12.917  1.00 13.59  ? 49   LYS A O     1 
ATOM   285   C  CB    . LYS A  1  49  ? 15.237  53.738  13.423  1.00 15.52  ? 49   LYS A CB    1 
ATOM   286   C  CG    . LYS A  1  49  ? 16.173  53.834  14.616  1.00 18.89  ? 49   LYS A CG    1 
ATOM   287   C  CD    . LYS A  1  49  ? 17.417  54.710  14.290  1.00 14.58  ? 49   LYS A CD    1 
ATOM   288   C  CE    . LYS A  1  49  ? 18.354  54.848  15.483  1.00 19.45  ? 49   LYS A CE    1 
ATOM   289   N  NZ    . LYS A  1  49  ? 19.584  55.688  15.174  1.00 17.96  ? 49   LYS A NZ    1 
ATOM   290   N  N     . LEU A  1  50  ? 14.130  50.847  14.991  1.00 19.18  ? 50   LEU A N     1 
ATOM   291   C  CA    . LEU A  1  50  ? 14.464  49.464  15.304  1.00 19.78  ? 50   LEU A CA    1 
ATOM   292   C  C     . LEU A  1  50  ? 13.234  48.707  15.773  1.00 17.66  ? 50   LEU A C     1 
ATOM   293   O  O     . LEU A  1  50  ? 12.257  49.317  16.198  1.00 21.55  ? 50   LEU A O     1 
ATOM   294   C  CB    . LEU A  1  50  ? 15.464  49.424  16.466  1.00 22.31  ? 50   LEU A CB    1 
ATOM   295   C  CG    . LEU A  1  50  ? 16.836  50.091  16.425  1.00 22.71  ? 50   LEU A CG    1 
ATOM   296   C  CD1   . LEU A  1  50  ? 17.437  50.217  17.863  1.00 19.34  ? 50   LEU A CD1   1 
ATOM   297   C  CD2   . LEU A  1  50  ? 17.718  49.223  15.590  1.00 24.37  ? 50   LEU A CD2   1 
ATOM   298   N  N     . PHE A  1  51  ? 13.281  47.379  15.683  1.00 17.50  ? 51   PHE A N     1 
ATOM   299   C  CA    . PHE A  1  51  ? 12.221  46.542  16.248  1.00 16.96  ? 51   PHE A CA    1 
ATOM   300   C  C     . PHE A  1  51  ? 12.389  46.919  17.750  1.00 17.63  ? 51   PHE A C     1 
ATOM   301   O  O     . PHE A  1  51  ? 13.514  46.974  18.264  1.00 16.24  ? 51   PHE A O     1 
ATOM   302   C  CB    . PHE A  1  51  ? 12.520  45.053  16.006  1.00 15.36  ? 51   PHE A CB    1 
ATOM   303   C  CG    . PHE A  1  51  ? 11.493  44.165  16.602  1.00 18.61  ? 51   PHE A CG    1 
ATOM   304   C  CD1   . PHE A  1  51  ? 10.224  44.091  16.053  1.00 12.55  ? 51   PHE A CD1   1 
ATOM   305   C  CD2   . PHE A  1  51  ? 11.750  43.510  17.824  1.00 16.78  ? 51   PHE A CD2   1 
ATOM   306   C  CE1   . PHE A  1  51  ? 9.208   43.389  16.706  1.00 14.21  ? 51   PHE A CE1   1 
ATOM   307   C  CE2   . PHE A  1  51  ? 10.744  42.809  18.484  1.00 16.02  ? 51   PHE A CE2   1 
ATOM   308   C  CZ    . PHE A  1  51  ? 9.473   42.748  17.933  1.00 16.03  ? 51   PHE A CZ    1 
ATOM   309   N  N     . PRO A  1  52  ? 11.296  47.170  18.463  1.00 15.64  ? 52   PRO A N     1 
ATOM   310   C  CA    . PRO A  1  52  ? 11.386  47.574  19.869  1.00 18.99  ? 52   PRO A CA    1 
ATOM   311   C  C     . PRO A  1  52  ? 12.356  46.948  20.840  1.00 19.13  ? 52   PRO A C     1 
ATOM   312   O  O     . PRO A  1  52  ? 13.096  47.688  21.510  1.00 18.26  ? 52   PRO A O     1 
ATOM   313   C  CB    . PRO A  1  52  ? 9.928   47.471  20.368  1.00 14.65  ? 52   PRO A CB    1 
ATOM   314   C  CG    . PRO A  1  52  ? 9.139   47.796  19.128  1.00 12.83  ? 52   PRO A CG    1 
ATOM   315   C  CD    . PRO A  1  52  ? 9.886   46.952  18.088  1.00 16.66  ? 52   PRO A CD    1 
ATOM   316   N  N     . THR A  1  53  ? 12.373  45.612  20.901  1.00 14.72  ? 53   THR A N     1 
ATOM   317   C  CA    . THR A  1  53  ? 13.205  44.934  21.872  1.00 17.56  ? 53   THR A CA    1 
ATOM   318   C  C     . THR A  1  53  ? 14.691  44.996  21.567  1.00 17.33  ? 53   THR A C     1 
ATOM   319   O  O     . THR A  1  53  ? 15.496  44.420  22.302  1.00 19.22  ? 53   THR A O     1 
ATOM   320   C  CB    . THR A  1  53  ? 12.742  43.453  22.073  1.00 16.41  ? 53   THR A CB    1 
ATOM   321   O  OG1   . THR A  1  53  ? 13.001  42.696  20.894  1.00 16.35  ? 53   THR A OG1   1 
ATOM   322   C  CG2   . THR A  1  53  ? 11.200  43.402  22.386  1.00 17.66  ? 53   THR A CG2   1 
ATOM   323   N  N     . ARG A  1  54  ? 15.057  45.682  20.482  1.00 17.63  ? 54   ARG A N     1 
ATOM   324   C  CA    . ARG A  1  54  ? 16.465  45.839  20.107  1.00 11.75  ? 54   ARG A CA    1 
ATOM   325   C  C     . ARG A  1  54  ? 17.015  47.175  20.664  1.00 16.99  ? 54   ARG A C     1 
ATOM   326   O  O     . ARG A  1  54  ? 18.228  47.431  20.556  1.00 15.39  ? 54   ARG A O     1 
ATOM   327   C  CB    . ARG A  1  54  ? 16.633  45.889  18.583  1.00 18.83  ? 54   ARG A CB    1 
ATOM   328   C  CG    . ARG A  1  54  ? 16.008  44.795  17.783  1.00 11.51  ? 54   ARG A CG    1 
ATOM   329   C  CD    . ARG A  1  54  ? 16.377  43.398  18.231  1.00 14.56  ? 54   ARG A CD    1 
ATOM   330   N  NE    . ARG A  1  54  ? 15.700  42.440  17.355  1.00 12.26  ? 54   ARG A NE    1 
ATOM   331   C  CZ    . ARG A  1  54  ? 15.483  41.151  17.628  1.00 10.31  ? 54   ARG A CZ    1 
ATOM   332   N  NH1   . ARG A  1  54  ? 15.894  40.568  18.766  1.00 12.74  ? 54   ARG A NH1   1 
ATOM   333   N  NH2   . ARG A  1  54  ? 14.712  40.458  16.816  1.00 11.33  ? 54   ARG A NH2   1 
ATOM   334   N  N     . SER A  1  55  ? 16.140  48.024  21.224  1.00 13.92  ? 55   SER A N     1 
ATOM   335   C  CA    . SER A  1  55  ? 16.538  49.342  21.757  1.00 16.09  ? 55   SER A CA    1 
ATOM   336   C  C     . SER A  1  55  ? 17.562  49.209  22.900  1.00 17.49  ? 55   SER A C     1 
ATOM   337   O  O     . SER A  1  55  ? 17.592  48.213  23.627  1.00 18.76  ? 55   SER A O     1 
ATOM   338   C  CB    . SER A  1  55  ? 15.310  50.110  22.293  1.00 17.07  ? 55   SER A CB    1 
ATOM   339   O  OG    . SER A  1  55  ? 14.253  50.155  21.353  1.00 19.41  ? 55   SER A OG    1 
ATOM   340   N  N     . HIS A  1  56  ? 18.383  50.232  23.066  1.00 16.11  ? 56   HIS A N     1 
ATOM   341   C  CA    . HIS A  1  56  ? 19.424  50.214  24.078  1.00 16.38  ? 56   HIS A CA    1 
ATOM   342   C  C     . HIS A  1  56  ? 18.948  49.821  25.482  1.00 15.74  ? 56   HIS A C     1 
ATOM   343   O  O     . HIS A  1  56  ? 19.726  49.257  26.250  1.00 13.69  ? 56   HIS A O     1 
ATOM   344   C  CB    . HIS A  1  56  ? 20.138  51.584  24.147  1.00 10.98  ? 56   HIS A CB    1 
ATOM   345   C  CG    . HIS A  1  56  ? 21.407  51.543  24.950  1.00 19.04  ? 56   HIS A CG    1 
ATOM   346   N  ND1   . HIS A  1  56  ? 22.463  50.716  24.618  1.00 15.47  ? 56   HIS A ND1   1 
ATOM   347   C  CD2   . HIS A  1  56  ? 21.739  52.128  26.126  1.00 18.20  ? 56   HIS A CD2   1 
ATOM   348   C  CE1   . HIS A  1  56  ? 23.384  50.791  25.561  1.00 19.21  ? 56   HIS A CE1   1 
ATOM   349   N  NE2   . HIS A  1  56  ? 22.971  51.645  26.484  1.00 15.55  ? 56   HIS A NE2   1 
ATOM   350   N  N     . THR A  1  57  ? 17.678  50.125  25.805  1.00 11.32  ? 57   THR A N     1 
ATOM   351   C  CA    . THR A  1  57  ? 17.088  49.824  27.093  1.00 10.65  ? 57   THR A CA    1 
ATOM   352   C  C     . THR A  1  57  ? 17.262  48.318  27.406  1.00 14.24  ? 57   THR A C     1 
ATOM   353   O  O     . THR A  1  57  ? 17.403  47.903  28.564  1.00 13.07  ? 57   THR A O     1 
ATOM   354   C  CB    . THR A  1  57  ? 15.544  50.144  27.084  1.00 11.74  ? 57   THR A CB    1 
ATOM   355   O  OG1   . THR A  1  57  ? 15.351  51.570  27.002  1.00 10.81  ? 57   THR A OG1   1 
ATOM   356   C  CG2   . THR A  1  57  ? 14.859  49.588  28.383  1.00 8.29   ? 57   THR A CG2   1 
ATOM   357   N  N     . VAL A  1  58  ? 17.270  47.531  26.344  1.00 9.63   ? 58   VAL A N     1 
ATOM   358   C  CA    . VAL A  1  58  ? 17.346  46.058  26.417  1.00 11.76  ? 58   VAL A CA    1 
ATOM   359   C  C     . VAL A  1  58  ? 18.722  45.700  27.007  1.00 15.38  ? 58   VAL A C     1 
ATOM   360   O  O     . VAL A  1  58  ? 18.926  44.613  27.522  1.00 16.46  ? 58   VAL A O     1 
ATOM   361   C  CB    . VAL A  1  58  ? 17.224  45.430  24.962  1.00 8.26   ? 58   VAL A CB    1 
ATOM   362   C  CG1   . VAL A  1  58  ? 18.614  45.435  24.266  1.00 10.21  ? 58   VAL A CG1   1 
ATOM   363   C  CG2   . VAL A  1  58  ? 16.752  43.907  25.045  1.00 14.60  ? 58   VAL A CG2   1 
ATOM   364   N  N     . ALA A  1  59  ? 19.670  46.618  26.908  1.00 11.58  ? 59   ALA A N     1 
ATOM   365   C  CA    . ALA A  1  59  ? 20.973  46.299  27.430  1.00 14.07  ? 59   ALA A CA    1 
ATOM   366   C  C     . ALA A  1  59  ? 21.163  46.743  28.901  1.00 12.85  ? 59   ALA A C     1 
ATOM   367   O  O     . ALA A  1  59  ? 22.188  46.470  29.489  1.00 13.02  ? 59   ALA A O     1 
ATOM   368   C  CB    . ALA A  1  59  ? 22.057  46.911  26.540  1.00 10.54  ? 59   ALA A CB    1 
ATOM   369   N  N     . ALA A  1  60  ? 20.175  47.404  29.494  1.00 14.37  ? 60   ALA A N     1 
ATOM   370   C  CA    . ALA A  1  60  ? 20.348  47.837  30.874  1.00 16.18  ? 60   ALA A CA    1 
ATOM   371   C  C     . ALA A  1  60  ? 20.475  46.632  31.846  1.00 20.29  ? 60   ALA A C     1 
ATOM   372   O  O     . ALA A  1  60  ? 19.833  45.588  31.653  1.00 21.72  ? 60   ALA A O     1 
ATOM   373   C  CB    . ALA A  1  60  ? 19.241  48.759  31.257  1.00 10.54  ? 60   ALA A CB    1 
ATOM   374   N  N     . GLN A  1  61  ? 21.297  46.791  32.888  1.00 17.40  ? 61   GLN A N     1 
ATOM   375   C  CA    . GLN A  1  61  ? 21.598  45.691  33.801  1.00 18.94  ? 61   GLN A CA    1 
ATOM   376   C  C     . GLN A  1  61  ? 21.238  45.770  35.273  1.00 20.07  ? 61   GLN A C     1 
ATOM   377   O  O     . GLN A  1  61  ? 20.467  44.955  35.801  1.00 22.95  ? 61   GLN A O     1 
ATOM   378   C  CB    . GLN A  1  61  ? 23.102  45.412  33.741  1.00 20.45  ? 61   GLN A CB    1 
ATOM   379   C  CG    . GLN A  1  61  ? 23.685  45.022  32.380  1.00 18.62  ? 61   GLN A CG    1 
ATOM   380   C  CD    . GLN A  1  61  ? 25.207  44.924  32.455  1.00 25.39  ? 61   GLN A CD    1 
ATOM   381   O  OE1   . GLN A  1  61  ? 25.778  44.949  33.555  1.00 18.95  ? 61   GLN A OE1   1 
ATOM   382   N  NE2   . GLN A  1  61  ? 25.873  44.832  31.295  1.00 22.27  ? 61   GLN A NE2   1 
ATOM   383   N  N     . GLY A  1  62  ? 21.866  46.741  35.923  1.00 18.40  ? 62   GLY A N     1 
ATOM   384   C  CA    . GLY A  1  62  ? 21.762  46.951  37.345  1.00 17.71  ? 62   GLY A CA    1 
ATOM   385   C  C     . GLY A  1  62  ? 20.408  46.973  37.997  1.00 18.23  ? 62   GLY A C     1 
ATOM   386   O  O     . GLY A  1  62  ? 20.191  46.272  38.994  1.00 17.79  ? 62   GLY A O     1 
ATOM   387   N  N     . GLY A  1  63  ? 19.512  47.810  37.498  1.00 14.64  ? 63   GLY A N     1 
ATOM   388   C  CA    . GLY A  1  63  ? 18.192  47.862  38.092  1.00 15.63  ? 63   GLY A CA    1 
ATOM   389   C  C     . GLY A  1  63  ? 17.474  49.170  37.996  1.00 14.25  ? 63   GLY A C     1 
ATOM   390   O  O     . GLY A  1  63  ? 17.891  50.056  37.269  1.00 19.87  ? 63   GLY A O     1 
ATOM   391   N  N     . ILE A  1  64  ? 16.366  49.282  38.724  1.00 15.31  ? 64   ILE A N     1 
ATOM   392   C  CA    . ILE A  1  64  ? 15.580  50.495  38.717  1.00 11.24  ? 64   ILE A CA    1 
ATOM   393   C  C     . ILE A  1  64  ? 15.265  50.852  40.175  1.00 12.39  ? 64   ILE A C     1 
ATOM   394   O  O     . ILE A  1  64  ? 14.822  50.001  40.915  1.00 12.15  ? 64   ILE A O     1 
ATOM   395   C  CB    . ILE A  1  64  ? 14.313  50.256  37.837  1.00 16.09  ? 64   ILE A CB    1 
ATOM   396   C  CG1   . ILE A  1  64  ? 13.338  51.402  37.971  1.00 15.48  ? 64   ILE A CG1   1 
ATOM   397   C  CG2   . ILE A  1  64  ? 13.636  48.897  38.145  1.00 8.58   ? 64   ILE A CG2   1 
ATOM   398   C  CD1   . ILE A  1  64  ? 12.313  51.356  36.862  1.00 14.19  ? 64   ILE A CD1   1 
ATOM   399   N  N     . ASN A  1  65  ? 15.509  52.107  40.564  1.00 13.28  ? 65   ASN A N     1 
ATOM   400   C  CA    . ASN A  1  65  ? 15.288  52.614  41.923  1.00 14.53  ? 65   ASN A CA    1 
ATOM   401   C  C     . ASN A  1  65  ? 13.862  52.926  42.373  1.00 18.64  ? 65   ASN A C     1 
ATOM   402   O  O     . ASN A  1  65  ? 13.063  53.573  41.660  1.00 16.54  ? 65   ASN A O     1 
ATOM   403   C  CB    . ASN A  1  65  ? 16.117  53.890  42.183  1.00 15.55  ? 65   ASN A CB    1 
ATOM   404   C  CG    . ASN A  1  65  ? 17.647  53.632  42.141  1.00 20.02  ? 65   ASN A CG    1 
ATOM   405   O  OD1   . ASN A  1  65  ? 18.128  52.560  42.537  1.00 14.24  ? 65   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A  1  65  ? 18.402  54.631  41.663  1.00 14.35  ? 65   ASN A ND2   1 
ATOM   407   N  N     . ALA A  1  66  ? 13.557  52.493  43.590  1.00 13.86  ? 66   ALA A N     1 
ATOM   408   C  CA    . ALA A  1  66  ? 12.243  52.760  44.180  1.00 21.15  ? 66   ALA A CA    1 
ATOM   409   C  C     . ALA A  1  66  ? 12.316  52.479  45.680  1.00 20.68  ? 66   ALA A C     1 
ATOM   410   O  O     . ALA A  1  66  ? 12.863  51.443  46.112  1.00 20.01  ? 66   ALA A O     1 
ATOM   411   C  CB    . ALA A  1  66  ? 11.175  51.856  43.513  1.00 18.57  ? 66   ALA A CB    1 
ATOM   412   N  N     . ALA A  1  67  ? 11.815  53.410  46.481  1.00 22.28  ? 67   ALA A N     1 
ATOM   413   C  CA    . ALA A  1  67  ? 11.824  53.207  47.913  1.00 22.03  ? 67   ALA A CA    1 
ATOM   414   C  C     . ALA A  1  67  ? 10.679  52.272  48.309  1.00 23.13  ? 67   ALA A C     1 
ATOM   415   O  O     . ALA A  1  67  ? 9.776   52.703  48.982  1.00 25.78  ? 67   ALA A O     1 
ATOM   416   C  CB    . ALA A  1  67  ? 11.661  54.542  48.636  1.00 23.71  ? 67   ALA A CB    1 
ATOM   417   N  N     . LEU A  1  68  ? 10.702  51.004  47.895  1.00 19.26  ? 68   LEU A N     1 
ATOM   418   C  CA    . LEU A  1  68  ? 9.644   50.061  48.264  1.00 17.39  ? 68   LEU A CA    1 
ATOM   419   C  C     . LEU A  1  68  ? 9.831   49.624  49.729  1.00 19.33  ? 68   LEU A C     1 
ATOM   420   O  O     . LEU A  1  68  ? 8.865   49.292  50.392  1.00 17.80  ? 68   LEU A O     1 
ATOM   421   C  CB    . LEU A  1  68  ? 9.687   48.794  47.411  1.00 18.34  ? 68   LEU A CB    1 
ATOM   422   C  CG    . LEU A  1  68  ? 9.358   48.966  45.923  1.00 22.96  ? 68   LEU A CG    1 
ATOM   423   C  CD1   . LEU A  1  68  ? 9.722   47.701  45.180  1.00 19.85  ? 68   LEU A CD1   1 
ATOM   424   C  CD2   . LEU A  1  68  ? 7.876   49.307  45.787  1.00 20.37  ? 68   LEU A CD2   1 
ATOM   425   N  N     . GLY A  1  69  ? 11.074  49.634  50.219  1.00 17.85  ? 69   GLY A N     1 
ATOM   426   C  CA    . GLY A  1  69  ? 11.316  49.227  51.596  1.00 17.49  ? 69   GLY A CA    1 
ATOM   427   C  C     . GLY A  1  69  ? 11.275  47.716  51.756  1.00 18.38  ? 69   GLY A C     1 
ATOM   428   O  O     . GLY A  1  69  ? 10.964  47.217  52.811  1.00 22.94  ? 69   GLY A O     1 
ATOM   429   N  N     . ASN A  1  70  ? 11.582  46.968  50.712  1.00 23.47  ? 70   ASN A N     1 
ATOM   430   C  CA    . ASN A  1  70  ? 11.582  45.509  50.825  1.00 21.29  ? 70   ASN A CA    1 
ATOM   431   C  C     . ASN A  1  70  ? 12.760  44.879  51.604  1.00 21.64  ? 70   ASN A C     1 
ATOM   432   O  O     . ASN A  1  70  ? 12.674  43.718  52.023  1.00 19.43  ? 70   ASN A O     1 
ATOM   433   C  CB    . ASN A  1  70  ? 11.609  44.871  49.438  1.00 15.58  ? 70   ASN A CB    1 
ATOM   434   C  CG    . ASN A  1  70  ? 10.301  45.019  48.683  1.00 20.74  ? 70   ASN A CG    1 
ATOM   435   O  OD1   . ASN A  1  70  ? 9.260   45.275  49.279  1.00 18.53  ? 70   ASN A OD1   1 
ATOM   436   N  ND2   . ASN A  1  70  ? 10.343  44.812  47.361  1.00 22.69  ? 70   ASN A ND2   1 
ATOM   437   N  N     . MET A  1  71  ? 13.869  45.605  51.724  1.00 21.01  ? 71   MET A N     1 
ATOM   438   C  CA    . MET A  1  71  ? 15.083  45.074  52.339  1.00 21.26  ? 71   MET A CA    1 
ATOM   439   C  C     . MET A  1  71  ? 15.314  45.637  53.738  1.00 24.16  ? 71   MET A C     1 
ATOM   440   O  O     . MET A  1  71  ? 15.814  44.944  54.608  1.00 26.62  ? 71   MET A O     1 
ATOM   441   C  CB    . MET A  1  71  ? 16.307  45.391  51.466  1.00 20.65  ? 71   MET A CB    1 
ATOM   442   C  CG    . MET A  1  71  ? 16.188  45.047  49.991  1.00 24.39  ? 71   MET A CG    1 
ATOM   443   S  SD    . MET A  1  71  ? 15.586  43.392  49.670  1.00 25.26  ? 71   MET A SD    1 
ATOM   444   C  CE    . MET A  1  71  ? 16.982  42.413  50.067  1.00 29.82  ? 71   MET A CE    1 
ATOM   445   N  N     . GLU A  1  72  ? 14.962  46.906  53.914  1.00 23.29  ? 72   GLU A N     1 
ATOM   446   C  CA    . GLU A  1  72  ? 15.057  47.615  55.189  1.00 27.99  ? 72   GLU A CA    1 
ATOM   447   C  C     . GLU A  1  72  ? 14.049  48.761  55.012  1.00 31.25  ? 72   GLU A C     1 
ATOM   448   O  O     . GLU A  1  72  ? 13.547  48.993  53.891  1.00 31.05  ? 72   GLU A O     1 
ATOM   449   C  CB    . GLU A  1  72  ? 16.455  48.192  55.384  1.00 28.42  ? 72   GLU A CB    1 
ATOM   450   C  CG    . GLU A  1  72  ? 16.681  49.537  54.696  1.00 35.84  ? 72   GLU A CG    1 
ATOM   451   C  CD    . GLU A  1  72  ? 17.389  49.432  53.342  1.00 39.41  ? 72   GLU A CD    1 
ATOM   452   O  OE1   . GLU A  1  72  ? 18.547  48.976  53.320  1.00 38.10  ? 72   GLU A OE1   1 
ATOM   453   O  OE2   . GLU A  1  72  ? 16.801  49.825  52.304  1.00 42.98  ? 72   GLU A OE2   1 
ATOM   454   N  N     . ASP A  1  73  ? 13.738  49.479  56.081  1.00 28.45  ? 73   ASP A N     1 
ATOM   455   C  CA    . ASP A  1  73  ? 12.798  50.588  55.932  1.00 31.43  ? 73   ASP A CA    1 
ATOM   456   C  C     . ASP A  1  73  ? 13.322  51.729  55.064  1.00 28.96  ? 73   ASP A C     1 
ATOM   457   O  O     . ASP A  1  73  ? 14.495  52.090  55.136  1.00 26.81  ? 73   ASP A O     1 
ATOM   458   C  CB    . ASP A  1  73  ? 12.389  51.111  57.279  1.00 37.95  ? 73   ASP A CB    1 
ATOM   459   C  CG    . ASP A  1  73  ? 11.019  50.614  57.669  1.00 49.90  ? 73   ASP A CG    1 
ATOM   460   O  OD1   . ASP A  1  73  ? 10.842  49.373  57.842  1.00 47.41  ? 73   ASP A OD1   1 
ATOM   461   O  OD2   . ASP A  1  73  ? 10.111  51.479  57.771  1.00 59.86  ? 73   ASP A OD2   1 
ATOM   462   N  N     . ASP A  1  74  ? 12.446  52.316  54.257  1.00 26.23  ? 74   ASP A N     1 
ATOM   463   C  CA    . ASP A  1  74  ? 12.890  53.368  53.350  1.00 23.89  ? 74   ASP A CA    1 
ATOM   464   C  C     . ASP A  1  74  ? 11.926  54.510  53.319  1.00 22.17  ? 74   ASP A C     1 
ATOM   465   O  O     . ASP A  1  74  ? 10.877  54.458  53.940  1.00 22.53  ? 74   ASP A O     1 
ATOM   466   C  CB    . ASP A  1  74  ? 13.029  52.815  51.942  1.00 18.53  ? 74   ASP A CB    1 
ATOM   467   C  CG    . ASP A  1  74  ? 14.165  53.471  51.149  1.00 21.49  ? 74   ASP A CG    1 
ATOM   468   O  OD1   . ASP A  1  74  ? 14.606  54.601  51.475  1.00 20.33  ? 74   ASP A OD1   1 
ATOM   469   O  OD2   . ASP A  1  74  ? 14.585  52.848  50.161  1.00 19.49  ? 74   ASP A OD2   1 
ATOM   470   N  N     . ASN A  1  75  ? 12.286  55.533  52.557  1.00 19.16  ? 75   ASN A N     1 
ATOM   471   C  CA    . ASN A  1  75  ? 11.463  56.704  52.416  1.00 22.00  ? 75   ASN A CA    1 
ATOM   472   C  C     . ASN A  1  75  ? 11.801  57.347  51.074  1.00 23.32  ? 75   ASN A C     1 
ATOM   473   O  O     . ASN A  1  75  ? 12.962  57.629  50.796  1.00 25.12  ? 75   ASN A O     1 
ATOM   474   C  CB    . ASN A  1  75  ? 11.768  57.670  53.540  1.00 17.99  ? 75   ASN A CB    1 
ATOM   475   C  CG    . ASN A  1  75  ? 10.766  58.814  53.611  1.00 25.48  ? 75   ASN A CG    1 
ATOM   476   O  OD1   . ASN A  1  75  ? 10.387  59.356  52.593  1.00 26.71  ? 75   ASN A OD1   1 
ATOM   477   N  ND2   . ASN A  1  75  ? 10.349  59.188  54.823  1.00 23.47  ? 75   ASN A ND2   1 
ATOM   478   N  N     . TRP A  1  76  ? 10.788  57.608  50.258  1.00 21.87  ? 76   TRP A N     1 
ATOM   479   C  CA    . TRP A  1  76  ? 11.058  58.191  48.947  1.00 21.87  ? 76   TRP A CA    1 
ATOM   480   C  C     . TRP A  1  76  ? 11.729  59.561  49.057  1.00 20.44  ? 76   TRP A C     1 
ATOM   481   O  O     . TRP A  1  76  ? 12.470  59.950  48.133  1.00 19.51  ? 76   TRP A O     1 
ATOM   482   C  CB    . TRP A  1  76  ? 9.772   58.284  48.091  1.00 16.11  ? 76   TRP A CB    1 
ATOM   483   C  CG    . TRP A  1  76  ? 8.743   59.296  48.556  1.00 17.13  ? 76   TRP A CG    1 
ATOM   484   C  CD1   . TRP A  1  76  ? 7.628   59.050  49.313  1.00 14.52  ? 76   TRP A CD1   1 
ATOM   485   C  CD2   . TRP A  1  76  ? 8.729   60.700  48.263  1.00 15.30  ? 76   TRP A CD2   1 
ATOM   486   N  NE1   . TRP A  1  76  ? 6.921   60.215  49.501  1.00 16.15  ? 76   TRP A NE1   1 
ATOM   487   C  CE2   . TRP A  1  76  ? 7.569   61.242  48.869  1.00 13.10  ? 76   TRP A CE2   1 
ATOM   488   C  CE3   . TRP A  1  76  ? 9.583   61.552  47.540  1.00 18.34  ? 76   TRP A CE3   1 
ATOM   489   C  CZ2   . TRP A  1  76  ? 7.229   62.600  48.775  1.00 13.95  ? 76   TRP A CZ2   1 
ATOM   490   C  CZ3   . TRP A  1  76  ? 9.246   62.923  47.435  1.00 16.09  ? 76   TRP A CZ3   1 
ATOM   491   C  CH2   . TRP A  1  76  ? 8.076   63.423  48.047  1.00 17.09  ? 76   TRP A CH2   1 
ATOM   492   N  N     . ARG A  1  77  ? 11.505  60.281  50.169  1.00 11.65  ? 77   ARG A N     1 
ATOM   493   C  CA    . ARG A  1  77  ? 12.131  61.591  50.285  1.00 14.20  ? 77   ARG A CA    1 
ATOM   494   C  C     . ARG A  1  77  ? 13.652  61.442  50.455  1.00 14.95  ? 77   ARG A C     1 
ATOM   495   O  O     . ARG A  1  77  ? 14.404  62.390  50.177  1.00 15.75  ? 77   ARG A O     1 
ATOM   496   C  CB    . ARG A  1  77  ? 11.516  62.397  51.454  1.00 15.87  ? 77   ARG A CB    1 
ATOM   497   C  CG    . ARG A  1  77  ? 9.989   62.635  51.305  1.00 22.53  ? 77   ARG A CG    1 
ATOM   498   C  CD    . ARG A  1  77  ? 9.317   63.101  52.620  1.00 26.36  ? 77   ARG A CD    1 
ATOM   499   N  NE    . ARG A  1  77  ? 7.852   63.058  52.541  1.00 22.75  ? 77   ARG A NE    1 
ATOM   500   C  CZ    . ARG A  1  77  ? 7.133   61.933  52.544  1.00 26.63  ? 77   ARG A CZ    1 
ATOM   501   N  NH1   . ARG A  1  77  ? 7.749   60.759  52.634  1.00 25.21  ? 77   ARG A NH1   1 
ATOM   502   N  NH2   . ARG A  1  77  ? 5.792   61.975  52.425  1.00 19.84  ? 77   ARG A NH2   1 
ATOM   503   N  N     . TRP A  1  78  ? 14.113  60.262  50.902  1.00 17.61  ? 78   TRP A N     1 
ATOM   504   C  CA    . TRP A  1  78  ? 15.556  60.035  51.040  1.00 16.37  ? 78   TRP A CA    1 
ATOM   505   C  C     . TRP A  1  78  ? 16.144  59.847  49.613  1.00 18.66  ? 78   TRP A C     1 
ATOM   506   O  O     . TRP A  1  78  ? 17.277  60.235  49.330  1.00 20.38  ? 78   TRP A O     1 
ATOM   507   C  CB    . TRP A  1  78  ? 15.825  58.766  51.883  1.00 19.96  ? 78   TRP A CB    1 
ATOM   508   C  CG    . TRP A  1  78  ? 15.363  58.886  53.347  1.00 19.43  ? 78   TRP A CG    1 
ATOM   509   C  CD1   . TRP A  1  78  ? 15.051  60.048  54.029  1.00 19.77  ? 78   TRP A CD1   1 
ATOM   510   C  CD2   . TRP A  1  78  ? 15.169  57.812  54.277  1.00 16.42  ? 78   TRP A CD2   1 
ATOM   511   N  NE1   . TRP A  1  78  ? 14.680  59.752  55.321  1.00 22.04  ? 78   TRP A NE1   1 
ATOM   512   C  CE2   . TRP A  1  78  ? 14.734  58.387  55.496  1.00 20.16  ? 78   TRP A CE2   1 
ATOM   513   C  CE3   . TRP A  1  78  ? 15.315  56.410  54.195  1.00 15.65  ? 78   TRP A CE3   1 
ATOM   514   C  CZ2   . TRP A  1  78  ? 14.430  57.608  56.628  1.00 18.71  ? 78   TRP A CZ2   1 
ATOM   515   C  CZ3   . TRP A  1  78  ? 15.012  55.633  55.326  1.00 21.33  ? 78   TRP A CZ3   1 
ATOM   516   C  CH2   . TRP A  1  78  ? 14.573  56.239  56.522  1.00 20.01  ? 78   TRP A CH2   1 
ATOM   517   N  N     . HIS A  1  79  ? 15.365  59.195  48.754  1.00 13.91  ? 79   HIS A N     1 
ATOM   518   C  CA    . HIS A  1  79  ? 15.749  58.966  47.353  1.00 17.38  ? 79   HIS A CA    1 
ATOM   519   C  C     . HIS A  1  79  ? 15.741  60.324  46.639  1.00 17.18  ? 79   HIS A C     1 
ATOM   520   O  O     . HIS A  1  79  ? 16.598  60.605  45.800  1.00 21.99  ? 79   HIS A O     1 
ATOM   521   C  CB    . HIS A  1  79  ? 14.737  58.020  46.751  1.00 17.21  ? 79   HIS A CB    1 
ATOM   522   C  CG    . HIS A  1  79  ? 15.025  57.625  45.339  1.00 21.18  ? 79   HIS A CG    1 
ATOM   523   N  ND1   . HIS A  1  79  ? 14.067  57.053  44.537  1.00 16.32  ? 79   HIS A ND1   1 
ATOM   524   C  CD2   . HIS A  1  79  ? 16.141  57.747  44.577  1.00 16.98  ? 79   HIS A CD2   1 
ATOM   525   C  CE1   . HIS A  1  79  ? 14.573  56.851  43.330  1.00 18.86  ? 79   HIS A CE1   1 
ATOM   526   N  NE2   . HIS A  1  79  ? 15.830  57.259  43.331  1.00 16.75  ? 79   HIS A NE2   1 
ATOM   527   N  N     . PHE A  1  80  ? 14.756  61.164  46.978  1.00 18.24  ? 80   PHE A N     1 
ATOM   528   C  CA    . PHE A  1  80  ? 14.658  62.553  46.464  1.00 15.77  ? 80   PHE A CA    1 
ATOM   529   C  C     . PHE A  1  80  ? 15.971  63.265  46.802  1.00 17.05  ? 80   PHE A C     1 
ATOM   530   O  O     . PHE A  1  80  ? 16.604  63.866  45.955  1.00 15.32  ? 80   PHE A O     1 
ATOM   531   C  CB    . PHE A  1  80  ? 13.515  63.303  47.170  1.00 15.53  ? 80   PHE A CB    1 
ATOM   532   C  CG    . PHE A  1  80  ? 13.521  64.813  46.946  1.00 19.65  ? 80   PHE A CG    1 
ATOM   533   C  CD1   . PHE A  1  80  ? 13.056  65.361  45.744  1.00 15.20  ? 80   PHE A CD1   1 
ATOM   534   C  CD2   . PHE A  1  80  ? 13.997  65.683  47.943  1.00 17.78  ? 80   PHE A CD2   1 
ATOM   535   C  CE1   . PHE A  1  80  ? 13.065  66.731  45.526  1.00 15.75  ? 80   PHE A CE1   1 
ATOM   536   C  CE2   . PHE A  1  80  ? 14.005  67.074  47.724  1.00 22.05  ? 80   PHE A CE2   1 
ATOM   537   C  CZ    . PHE A  1  80  ? 13.536  67.594  46.507  1.00 16.49  ? 80   PHE A CZ    1 
ATOM   538   N  N     . TYR A  1  81  ? 16.346  63.226  48.080  1.00 15.41  ? 81   TYR A N     1 
ATOM   539   C  CA    . TYR A  1  81  ? 17.560  63.854  48.525  1.00 16.21  ? 81   TYR A CA    1 
ATOM   540   C  C     . TYR A  1  81  ? 18.816  63.324  47.826  1.00 16.36  ? 81   TYR A C     1 
ATOM   541   O  O     . TYR A  1  81  ? 19.670  64.104  47.449  1.00 12.65  ? 81   TYR A O     1 
ATOM   542   C  CB    . TYR A  1  81  ? 17.709  63.657  50.041  1.00 20.83  ? 81   TYR A CB    1 
ATOM   543   C  CG    . TYR A  1  81  ? 18.995  64.207  50.608  1.00 24.07  ? 81   TYR A CG    1 
ATOM   544   C  CD1   . TYR A  1  81  ? 19.126  65.569  50.933  1.00 24.99  ? 81   TYR A CD1   1 
ATOM   545   C  CD2   . TYR A  1  81  ? 20.110  63.387  50.757  1.00 22.30  ? 81   TYR A CD2   1 
ATOM   546   C  CE1   . TYR A  1  81  ? 20.363  66.088  51.381  1.00 25.59  ? 81   TYR A CE1   1 
ATOM   547   C  CE2   . TYR A  1  81  ? 21.328  63.894  51.200  1.00 20.51  ? 81   TYR A CE2   1 
ATOM   548   C  CZ    . TYR A  1  81  ? 21.452  65.246  51.502  1.00 24.31  ? 81   TYR A CZ    1 
ATOM   549   O  OH    . TYR A  1  81  ? 22.699  65.737  51.859  1.00 24.60  ? 81   TYR A OH    1 
ATOM   550   N  N     . ASP A  1  82  ? 18.949  62.002  47.685  1.00 16.24  ? 82   ASP A N     1 
ATOM   551   C  CA    . ASP A  1  82  ? 20.142  61.429  47.041  1.00 15.17  ? 82   ASP A CA    1 
ATOM   552   C  C     . ASP A  1  82  ? 20.254  61.904  45.587  1.00 16.99  ? 82   ASP A C     1 
ATOM   553   O  O     . ASP A  1  82  ? 21.347  62.137  45.082  1.00 13.74  ? 82   ASP A O     1 
ATOM   554   C  CB    . ASP A  1  82  ? 20.113  59.867  47.051  1.00 17.94  ? 82   ASP A CB    1 
ATOM   555   C  CG    . ASP A  1  82  ? 20.220  59.253  48.484  1.00 26.88  ? 82   ASP A CG    1 
ATOM   556   O  OD1   . ASP A  1  82  ? 20.839  59.901  49.367  1.00 17.59  ? 82   ASP A OD1   1 
ATOM   557   O  OD2   . ASP A  1  82  ? 19.702  58.123  48.729  1.00 21.33  ? 82   ASP A OD2   1 
ATOM   558   N  N     . THR A  1  83  ? 19.113  62.087  44.936  1.00 14.46  ? 83   THR A N     1 
ATOM   559   C  CA    . THR A  1  83  ? 19.098  62.472  43.520  1.00 16.60  ? 83   THR A CA    1 
ATOM   560   C  C     . THR A  1  83  ? 19.426  63.960  43.368  1.00 15.40  ? 83   THR A C     1 
ATOM   561   O  O     . THR A  1  83  ? 20.159  64.351  42.459  1.00 18.22  ? 83   THR A O     1 
ATOM   562   C  CB    . THR A  1  83  ? 17.723  62.123  42.889  1.00 13.78  ? 83   THR A CB    1 
ATOM   563   O  OG1   . THR A  1  83  ? 17.430  60.736  43.130  1.00 14.61  ? 83   THR A OG1   1 
ATOM   564   C  CG2   . THR A  1  83  ? 17.750  62.364  41.370  1.00 15.94  ? 83   THR A CG2   1 
ATOM   565   N  N     . VAL A  1  84  ? 18.923  64.778  44.291  1.00 17.17  ? 84   VAL A N     1 
ATOM   566   C  CA    . VAL A  1  84  ? 19.207  66.201  44.274  1.00 14.65  ? 84   VAL A CA    1 
ATOM   567   C  C     . VAL A  1  84  ? 20.722  66.416  44.493  1.00 17.56  ? 84   VAL A C     1 
ATOM   568   O  O     . VAL A  1  84  ? 21.399  67.102  43.739  1.00 20.91  ? 84   VAL A O     1 
ATOM   569   C  CB    . VAL A  1  84  ? 18.382  66.925  45.366  1.00 15.74  ? 84   VAL A CB    1 
ATOM   570   C  CG1   . VAL A  1  84  ? 18.764  68.417  45.444  1.00 18.07  ? 84   VAL A CG1   1 
ATOM   571   C  CG2   . VAL A  1  84  ? 16.890  66.830  45.034  1.00 19.73  ? 84   VAL A CG2   1 
ATOM   572   N  N     . LYS A  1  85  ? 21.269  65.775  45.502  1.00 18.58  ? 85   LYS A N     1 
ATOM   573   C  CA    . LYS A  1  85  ? 22.685  65.912  45.781  1.00 19.41  ? 85   LYS A CA    1 
ATOM   574   C  C     . LYS A  1  85  ? 23.498  65.298  44.661  1.00 15.64  ? 85   LYS A C     1 
ATOM   575   O  O     . LYS A  1  85  ? 24.526  65.829  44.235  1.00 16.17  ? 85   LYS A O     1 
ATOM   576   C  CB    . LYS A  1  85  ? 23.041  65.215  47.115  1.00 19.69  ? 85   LYS A CB    1 
ATOM   577   C  CG    . LYS A  1  85  ? 24.545  65.148  47.367  1.00 21.77  ? 85   LYS A CG    1 
ATOM   578   C  CD    . LYS A  1  85  ? 24.880  64.352  48.626  1.00 27.44  ? 85   LYS A CD    1 
ATOM   579   C  CE    . LYS A  1  85  ? 26.388  64.151  48.780  1.00 24.89  ? 85   LYS A CE    1 
ATOM   580   N  NZ    . LYS A  1  85  ? 26.712  63.449  50.051  1.00 29.08  ? 85   LYS A NZ    1 
ATOM   581   N  N     . GLY A  1  86  ? 23.067  64.135  44.204  1.00 15.79  ? 86   GLY A N     1 
ATOM   582   C  CA    . GLY A  1  86  ? 23.818  63.521  43.142  1.00 15.94  ? 86   GLY A CA    1 
ATOM   583   C  C     . GLY A  1  86  ? 23.930  64.418  41.919  1.00 17.56  ? 86   GLY A C     1 
ATOM   584   O  O     . GLY A  1  86  ? 24.955  64.400  41.247  1.00 18.23  ? 86   GLY A O     1 
ATOM   585   N  N     . SER A  1  87  ? 22.890  65.196  41.630  1.00 18.43  ? 87   SER A N     1 
ATOM   586   C  CA    . SER A  1  87  ? 22.896  66.067  40.448  1.00 18.46  ? 87   SER A CA    1 
ATOM   587   C  C     . SER A  1  87  ? 23.740  67.314  40.630  1.00 22.43  ? 87   SER A C     1 
ATOM   588   O  O     . SER A  1  87  ? 23.887  68.107  39.686  1.00 19.31  ? 87   SER A O     1 
ATOM   589   C  CB    . SER A  1  87  ? 21.460  66.497  40.090  1.00 21.88  ? 87   SER A CB    1 
ATOM   590   O  OG    . SER A  1  87  ? 20.941  67.423  41.032  1.00 25.41  ? 87   SER A OG    1 
ATOM   591   N  N     . ASP A  1  88  ? 24.288  67.488  41.843  1.00 20.01  ? 88   ASP A N     1 
ATOM   592   C  CA    . ASP A  1  88  ? 25.141  68.632  42.167  1.00 20.35  ? 88   ASP A CA    1 
ATOM   593   C  C     . ASP A  1  88  ? 24.442  69.959  41.970  1.00 19.89  ? 88   ASP A C     1 
ATOM   594   O  O     . ASP A  1  88  ? 25.053  70.933  41.505  1.00 18.97  ? 88   ASP A O     1 
ATOM   595   C  CB    . ASP A  1  88  ? 26.445  68.591  41.340  1.00 21.67  ? 88   ASP A CB    1 
ATOM   596   C  CG    . ASP A  1  88  ? 27.665  69.155  42.104  1.00 26.66  ? 88   ASP A CG    1 
ATOM   597   O  OD1   . ASP A  1  88  ? 27.533  69.527  43.299  1.00 27.47  ? 88   ASP A OD1   1 
ATOM   598   O  OD2   . ASP A  1  88  ? 28.771  69.197  41.511  1.00 23.64  ? 88   ASP A OD2   1 
ATOM   599   N  N     . TRP A  1  89  ? 23.165  69.974  42.362  1.00 18.96  ? 89   TRP A N     1 
ATOM   600   C  CA    . TRP A  1  89  ? 22.256  71.116  42.313  1.00 21.74  ? 89   TRP A CA    1 
ATOM   601   C  C     . TRP A  1  89  ? 21.987  71.754  40.964  1.00 21.83  ? 89   TRP A C     1 
ATOM   602   O  O     . TRP A  1  89  ? 21.677  72.944  40.861  1.00 23.18  ? 89   TRP A O     1 
ATOM   603   C  CB    . TRP A  1  89  ? 22.631  72.178  43.387  1.00 19.59  ? 89   TRP A CB    1 
ATOM   604   C  CG    . TRP A  1  89  ? 22.308  71.660  44.776  1.00 16.88  ? 89   TRP A CG    1 
ATOM   605   C  CD1   . TRP A  1  89  ? 21.119  71.764  45.420  1.00 15.36  ? 89   TRP A CD1   1 
ATOM   606   C  CD2   . TRP A  1  89  ? 23.125  70.781  45.578  1.00 15.06  ? 89   TRP A CD2   1 
ATOM   607   N  NE1   . TRP A  1  89  ? 21.127  70.986  46.561  1.00 23.36  ? 89   TRP A NE1   1 
ATOM   608   C  CE2   . TRP A  1  89  ? 22.350  70.376  46.677  1.00 16.74  ? 89   TRP A CE2   1 
ATOM   609   C  CE3   . TRP A  1  89  ? 24.438  70.303  45.464  1.00 19.08  ? 89   TRP A CE3   1 
ATOM   610   C  CZ2   . TRP A  1  89  ? 22.834  69.509  47.666  1.00 19.93  ? 89   TRP A CZ2   1 
ATOM   611   C  CZ3   . TRP A  1  89  ? 24.931  69.432  46.449  1.00 12.46  ? 89   TRP A CZ3   1 
ATOM   612   C  CH2   . TRP A  1  89  ? 24.123  69.046  47.537  1.00 22.66  ? 89   TRP A CH2   1 
ATOM   613   N  N     . LEU A  1  90  ? 22.075  70.949  39.921  1.00 22.89  ? 90   LEU A N     1 
ATOM   614   C  CA    . LEU A  1  90  ? 21.732  71.462  38.619  1.00 21.45  ? 90   LEU A CA    1 
ATOM   615   C  C     . LEU A  1  90  ? 20.407  70.825  38.263  1.00 22.54  ? 90   LEU A C     1 
ATOM   616   O  O     . LEU A  1  90  ? 19.818  71.142  37.216  1.00 24.20  ? 90   LEU A O     1 
ATOM   617   C  CB    . LEU A  1  90  ? 22.750  71.052  37.584  1.00 23.32  ? 90   LEU A CB    1 
ATOM   618   C  CG    . LEU A  1  90  ? 22.617  71.942  36.369  1.00 22.70  ? 90   LEU A CG    1 
ATOM   619   C  CD1   . LEU A  1  90  ? 22.990  73.380  36.759  1.00 23.39  ? 90   LEU A CD1   1 
ATOM   620   C  CD2   . LEU A  1  90  ? 23.531  71.422  35.280  1.00 26.43  ? 90   LEU A CD2   1 
ATOM   621   N  N     . GLY A  1  91  ? 19.952  69.903  39.112  1.00 20.27  ? 91   GLY A N     1 
ATOM   622   C  CA    . GLY A  1  91  ? 18.687  69.207  38.877  1.00 19.43  ? 91   GLY A CA    1 
ATOM   623   C  C     . GLY A  1  91  ? 17.469  70.020  39.300  1.00 26.92  ? 91   GLY A C     1 
ATOM   624   O  O     . GLY A  1  91  ? 17.518  70.753  40.301  1.00 26.79  ? 91   GLY A O     1 
ATOM   625   N  N     . ASP A  1  92  ? 16.378  69.915  38.546  1.00 27.66  ? 92   ASP A N     1 
ATOM   626   C  CA    . ASP A  1  92  ? 15.172  70.659  38.887  1.00 23.40  ? 92   ASP A CA    1 
ATOM   627   C  C     . ASP A  1  92  ? 14.419  69.839  39.916  1.00 24.04  ? 92   ASP A C     1 
ATOM   628   O  O     . ASP A  1  92  ? 13.947  68.706  39.650  1.00 18.97  ? 92   ASP A O     1 
ATOM   629   C  CB    . ASP A  1  92  ? 14.308  70.925  37.646  1.00 25.13  ? 92   ASP A CB    1 
ATOM   630   C  CG    . ASP A  1  92  ? 15.085  71.688  36.522  1.00 35.22  ? 92   ASP A CG    1 
ATOM   631   O  OD1   . ASP A  1  92  ? 15.787  72.688  36.810  1.00 35.63  ? 92   ASP A OD1   1 
ATOM   632   O  OD2   . ASP A  1  92  ? 14.996  71.282  35.341  1.00 39.11  ? 92   ASP A OD2   1 
ATOM   633   N  N     . GLN A  1  93  ? 14.314  70.424  41.104  1.00 19.68  ? 93   GLN A N     1 
ATOM   634   C  CA    . GLN A  1  93  ? 13.704  69.743  42.233  1.00 19.72  ? 93   GLN A CA    1 
ATOM   635   C  C     . GLN A  1  93  ? 12.225  69.440  42.086  1.00 20.83  ? 93   GLN A C     1 
ATOM   636   O  O     . GLN A  1  93  ? 11.721  68.512  42.725  1.00 20.37  ? 93   GLN A O     1 
ATOM   637   C  CB    . GLN A  1  93  ? 14.025  70.529  43.504  1.00 23.87  ? 93   GLN A CB    1 
ATOM   638   C  CG    . GLN A  1  93  ? 15.530  70.573  43.697  1.00 20.66  ? 93   GLN A CG    1 
ATOM   639   C  CD    . GLN A  1  93  ? 15.961  71.013  45.071  1.00 21.90  ? 93   GLN A CD    1 
ATOM   640   O  OE1   . GLN A  1  93  ? 15.311  70.711  46.056  1.00 23.40  ? 93   GLN A OE1   1 
ATOM   641   N  NE2   . GLN A  1  93  ? 17.091  71.698  45.145  1.00 21.80  ? 93   GLN A NE2   1 
ATOM   642   N  N     . ASP A  1  94  ? 11.521  70.172  41.224  1.00 16.75  ? 94   ASP A N     1 
ATOM   643   C  CA    . ASP A  1  94  ? 10.127  69.828  41.057  1.00 19.12  ? 94   ASP A CA    1 
ATOM   644   C  C     . ASP A  1  94  ? 10.037  68.480  40.300  1.00 19.98  ? 94   ASP A C     1 
ATOM   645   O  O     . ASP A  1  94  ? 9.190   67.620  40.609  1.00 20.94  ? 94   ASP A O     1 
ATOM   646   C  CB    . ASP A  1  94  ? 9.371   70.945  40.315  1.00 19.46  ? 94   ASP A CB    1 
ATOM   647   C  CG    . ASP A  1  94  ? 9.995   71.323  38.966  1.00 27.18  ? 94   ASP A CG    1 
ATOM   648   O  OD1   . ASP A  1  94  ? 11.158  70.944  38.625  1.00 26.64  ? 94   ASP A OD1   1 
ATOM   649   O  OD2   . ASP A  1  94  ? 9.291   72.046  38.242  1.00 25.42  ? 94   ASP A OD2   1 
ATOM   650   N  N     . ALA A  1  95  ? 10.910  68.270  39.323  1.00 17.39  ? 95   ALA A N     1 
ATOM   651   C  CA    . ALA A  1  95  ? 10.858  67.006  38.579  1.00 18.46  ? 95   ALA A CA    1 
ATOM   652   C  C     . ALA A  1  95  ? 11.403  65.846  39.399  1.00 16.51  ? 95   ALA A C     1 
ATOM   653   O  O     . ALA A  1  95  ? 10.894  64.717  39.336  1.00 20.80  ? 95   ALA A O     1 
ATOM   654   C  CB    . ALA A  1  95  ? 11.630  67.140  37.247  1.00 16.70  ? 95   ALA A CB    1 
ATOM   655   N  N     . ILE A  1  96  ? 12.457  66.103  40.162  1.00 17.24  ? 96   ILE A N     1 
ATOM   656   C  CA    . ILE A  1  96  ? 13.030  65.046  40.988  1.00 15.58  ? 96   ILE A CA    1 
ATOM   657   C  C     . ILE A  1  96  ? 11.982  64.587  42.010  1.00 12.65  ? 96   ILE A C     1 
ATOM   658   O  O     . ILE A  1  96  ? 11.822  63.385  42.336  1.00 12.24  ? 96   ILE A O     1 
ATOM   659   C  CB    . ILE A  1  96  ? 14.301  65.545  41.714  1.00 15.80  ? 96   ILE A CB    1 
ATOM   660   C  CG1   . ILE A  1  96  ? 15.435  65.733  40.689  1.00 15.53  ? 96   ILE A CG1   1 
ATOM   661   C  CG2   . ILE A  1  96  ? 14.702  64.498  42.796  1.00 18.53  ? 96   ILE A CG2   1 
ATOM   662   C  CD1   . ILE A  1  96  ? 16.617  66.572  41.160  1.00 10.64  ? 96   ILE A CD1   1 
ATOM   663   N  N     . HIS A  1  97  ? 11.231  65.556  42.493  1.00 14.21  ? 97   HIS A N     1 
ATOM   664   C  CA    . HIS A  1  97  ? 10.181  65.274  43.464  1.00 15.54  ? 97   HIS A CA    1 
ATOM   665   C  C     . HIS A  1  97  ? 9.165   64.338  42.811  1.00 18.99  ? 97   HIS A C     1 
ATOM   666   O  O     . HIS A  1  97  ? 8.819   63.262  43.353  1.00 19.14  ? 97   HIS A O     1 
ATOM   667   C  CB    . HIS A  1  97  ? 9.566   66.617  43.898  1.00 18.77  ? 97   HIS A CB    1 
ATOM   668   C  CG    . HIS A  1  97  ? 8.376   66.500  44.803  1.00 21.45  ? 97   HIS A CG    1 
ATOM   669   N  ND1   . HIS A  1  97  ? 7.904   67.562  45.540  1.00 23.70  ? 97   HIS A ND1   1 
ATOM   670   C  CD2   . HIS A  1  97  ? 7.566   65.455  45.090  1.00 22.79  ? 97   HIS A CD2   1 
ATOM   671   C  CE1   . HIS A  1  97  ? 6.863   67.172  46.252  1.00 24.18  ? 97   HIS A CE1   1 
ATOM   672   N  NE2   . HIS A  1  97  ? 6.638   65.897  45.997  1.00 21.53  ? 97   HIS A NE2   1 
ATOM   673   N  N     . TYR A  1  98  ? 8.697   64.719  41.631  1.00 19.89  ? 98   TYR A N     1 
ATOM   674   C  CA    . TYR A  1  98  ? 7.704   63.878  40.947  1.00 19.91  ? 98   TYR A CA    1 
ATOM   675   C  C     . TYR A  1  98  ? 8.269   62.453  40.719  1.00 17.76  ? 98   TYR A C     1 
ATOM   676   O  O     . TYR A  1  98  ? 7.603   61.447  41.010  1.00 18.31  ? 98   TYR A O     1 
ATOM   677   C  CB    . TYR A  1  98  ? 7.306   64.532  39.594  1.00 17.56  ? 98   TYR A CB    1 
ATOM   678   C  CG    . TYR A  1  98  ? 6.211   63.794  38.862  1.00 21.33  ? 98   TYR A CG    1 
ATOM   679   C  CD1   . TYR A  1  98  ? 6.520   62.913  37.826  1.00 21.17  ? 98   TYR A CD1   1 
ATOM   680   C  CD2   . TYR A  1  98  ? 4.851   63.908  39.267  1.00 18.19  ? 98   TYR A CD2   1 
ATOM   681   C  CE1   . TYR A  1  98  ? 5.543   62.161  37.211  1.00 17.60  ? 98   TYR A CE1   1 
ATOM   682   C  CE2   . TYR A  1  98  ? 3.861   63.148  38.659  1.00 16.37  ? 98   TYR A CE2   1 
ATOM   683   C  CZ    . TYR A  1  98  ? 4.211   62.275  37.641  1.00 22.12  ? 98   TYR A CZ    1 
ATOM   684   O  OH    . TYR A  1  98  ? 3.273   61.424  37.102  1.00 20.53  ? 98   TYR A OH    1 
ATOM   685   N  N     . MET A  1  99  ? 9.506   62.371  40.221  1.00 18.15  ? 99   MET A N     1 
ATOM   686   C  CA    . MET A  1  99  ? 10.095  61.064  39.916  1.00 18.19  ? 99   MET A CA    1 
ATOM   687   C  C     . MET A  1  99  ? 10.302  60.134  41.106  1.00 16.24  ? 99   MET A C     1 
ATOM   688   O  O     . MET A  1  99  ? 9.929   58.949  41.048  1.00 17.78  ? 99   MET A O     1 
ATOM   689   C  CB    . MET A  1  99  ? 11.424  61.201  39.161  1.00 11.33  ? 99   MET A CB    1 
ATOM   690   C  CG    . MET A  1  99  ? 11.892  59.865  38.563  1.00 12.19  ? 99   MET A CG    1 
ATOM   691   S  SD    . MET A  1  99  ? 13.605  59.923  37.920  1.00 23.61  ? 99   MET A SD    1 
ATOM   692   C  CE    . MET A  1  99  ? 14.590  60.313  39.290  1.00 18.33  ? 99   MET A CE    1 
ATOM   693   N  N     . THR A  1  100 ? 10.897  60.639  42.185  1.00 19.54  ? 100  THR A N     1 
ATOM   694   C  CA    . THR A  1  100 ? 11.118  59.759  43.328  1.00 16.43  ? 100  THR A CA    1 
ATOM   695   C  C     . THR A  1  100 ? 9.809   59.399  44.008  1.00 20.57  ? 100  THR A C     1 
ATOM   696   O  O     . THR A  1  100 ? 9.614   58.250  44.379  1.00 20.64  ? 100  THR A O     1 
ATOM   697   C  CB    . THR A  1  100 ? 12.142  60.366  44.315  1.00 19.64  ? 100  THR A CB    1 
ATOM   698   O  OG1   . THR A  1  100 ? 11.752  61.696  44.708  1.00 15.58  ? 100  THR A OG1   1 
ATOM   699   C  CG2   . THR A  1  100 ? 13.543  60.461  43.598  1.00 17.13  ? 100  THR A CG2   1 
ATOM   700   N  N     . GLU A  1  101 ? 8.891   60.348  44.145  1.00 19.02  ? 101  GLU A N     1 
ATOM   701   C  CA    . GLU A  1  101 ? 7.620   60.016  44.789  1.00 18.86  ? 101  GLU A CA    1 
ATOM   702   C  C     . GLU A  1  101 ? 6.804   59.000  44.001  1.00 19.22  ? 101  GLU A C     1 
ATOM   703   O  O     . GLU A  1  101 ? 6.137   58.141  44.574  1.00 19.30  ? 101  GLU A O     1 
ATOM   704   C  CB    . GLU A  1  101 ? 6.775   61.273  45.036  1.00 19.10  ? 101  GLU A CB    1 
ATOM   705   C  CG    . GLU A  1  101 ? 5.555   61.004  45.905  1.00 24.77  ? 101  GLU A CG    1 
ATOM   706   C  CD    . GLU A  1  101 ? 4.699   62.267  46.165  1.00 29.50  ? 101  GLU A CD    1 
ATOM   707   O  OE1   . GLU A  1  101 ? 4.653   63.193  45.315  1.00 33.26  ? 101  GLU A OE1   1 
ATOM   708   O  OE2   . GLU A  1  101 ? 4.051   62.320  47.228  1.00 36.04  ? 101  GLU A OE2   1 
ATOM   709   N  N     . GLN A  1  102 ? 6.861   59.085  42.682  1.00 18.55  ? 102  GLN A N     1 
ATOM   710   C  CA    . GLN A  1  102 ? 6.120   58.151  41.836  1.00 19.71  ? 102  GLN A CA    1 
ATOM   711   C  C     . GLN A  1  102 ? 6.822   56.794  41.686  1.00 16.99  ? 102  GLN A C     1 
ATOM   712   O  O     . GLN A  1  102 ? 6.222   55.842  41.214  1.00 20.32  ? 102  GLN A O     1 
ATOM   713   C  CB    . GLN A  1  102 ? 5.927   58.768  40.434  1.00 18.51  ? 102  GLN A CB    1 
ATOM   714   C  CG    . GLN A  1  102 ? 5.038   60.000  40.420  1.00 23.38  ? 102  GLN A CG    1 
ATOM   715   C  CD    . GLN A  1  102 ? 3.682   59.689  41.048  1.00 26.16  ? 102  GLN A CD    1 
ATOM   716   O  OE1   . GLN A  1  102 ? 3.006   58.728  40.659  1.00 24.42  ? 102  GLN A OE1   1 
ATOM   717   N  NE2   . GLN A  1  102 ? 3.297   60.479  42.037  1.00 31.49  ? 102  GLN A NE2   1 
ATOM   718   N  N     . ALA A  1  103 ? 8.081   56.700  42.091  1.00 19.02  ? 103  ALA A N     1 
ATOM   719   C  CA    . ALA A  1  103 ? 8.849   55.460  41.919  1.00 18.04  ? 103  ALA A CA    1 
ATOM   720   C  C     . ALA A  1  103 ? 8.267   54.174  42.460  1.00 19.25  ? 103  ALA A C     1 
ATOM   721   O  O     . ALA A  1  103 ? 8.281   53.153  41.751  1.00 20.74  ? 103  ALA A O     1 
ATOM   722   C  CB    . ALA A  1  103 ? 10.295  55.620  42.460  1.00 16.59  ? 103  ALA A CB    1 
ATOM   723   N  N     . PRO A  1  104 ? 7.794   54.170  43.724  1.00 17.58  ? 104  PRO A N     1 
ATOM   724   C  CA    . PRO A  1  104 ? 7.254   52.891  44.162  1.00 20.79  ? 104  PRO A CA    1 
ATOM   725   C  C     . PRO A  1  104 ? 6.117   52.423  43.245  1.00 17.63  ? 104  PRO A C     1 
ATOM   726   O  O     . PRO A  1  104 ? 6.081   51.256  42.855  1.00 16.59  ? 104  PRO A O     1 
ATOM   727   C  CB    . PRO A  1  104 ? 6.788   53.187  45.591  1.00 21.41  ? 104  PRO A CB    1 
ATOM   728   C  CG    . PRO A  1  104 ? 7.776   54.228  46.043  1.00 21.67  ? 104  PRO A CG    1 
ATOM   729   C  CD    . PRO A  1  104 ? 7.857   55.130  44.842  1.00 18.51  ? 104  PRO A CD    1 
ATOM   730   N  N     . ALA A  1  105 ? 5.191   53.331  42.931  1.00 18.59  ? 105  ALA A N     1 
ATOM   731   C  CA    . ALA A  1  105 ? 4.040   52.998  42.075  1.00 20.87  ? 105  ALA A CA    1 
ATOM   732   C  C     . ALA A  1  105 ? 4.495   52.473  40.723  1.00 17.76  ? 105  ALA A C     1 
ATOM   733   O  O     . ALA A  1  105 ? 3.949   51.516  40.196  1.00 22.74  ? 105  ALA A O     1 
ATOM   734   C  CB    . ALA A  1  105 ? 3.137   54.250  41.848  1.00 20.95  ? 105  ALA A CB    1 
ATOM   735   N  N     . ALA A  1  106 ? 5.514   53.114  40.166  1.00 19.61  ? 106  ALA A N     1 
ATOM   736   C  CA    . ALA A  1  106 ? 6.020   52.725  38.850  1.00 16.74  ? 106  ALA A CA    1 
ATOM   737   C  C     . ALA A  1  106 ? 6.611   51.311  38.814  1.00 16.48  ? 106  ALA A C     1 
ATOM   738   O  O     . ALA A  1  106 ? 6.426   50.580  37.842  1.00 18.88  ? 106  ALA A O     1 
ATOM   739   C  CB    . ALA A  1  106 ? 7.050   53.734  38.405  1.00 11.37  ? 106  ALA A CB    1 
ATOM   740   N  N     . VAL A  1  107 ? 7.322   50.918  39.868  1.00 19.98  ? 107  VAL A N     1 
ATOM   741   C  CA    . VAL A  1  107 ? 7.937   49.584  39.875  1.00 19.10  ? 107  VAL A CA    1 
ATOM   742   C  C     . VAL A  1  107 ? 6.850   48.540  40.097  1.00 15.22  ? 107  VAL A C     1 
ATOM   743   O  O     . VAL A  1  107 ? 6.831   47.498  39.446  1.00 19.87  ? 107  VAL A O     1 
ATOM   744   C  CB    . VAL A  1  107 ? 9.058   49.482  40.938  1.00 13.44  ? 107  VAL A CB    1 
ATOM   745   C  CG1   . VAL A  1  107 ? 9.664   48.073  40.963  1.00 12.01  ? 107  VAL A CG1   1 
ATOM   746   C  CG2   . VAL A  1  107 ? 10.145  50.421  40.580  1.00 10.24  ? 107  VAL A CG2   1 
ATOM   747   N  N     . ILE A  1  108 ? 5.931   48.818  41.004  1.00 19.31  ? 108  ILE A N     1 
ATOM   748   C  CA    . ILE A  1  108 ? 4.829   47.879  41.223  1.00 17.91  ? 108  ILE A CA    1 
ATOM   749   C  C     . ILE A  1  108 ? 4.080   47.642  39.898  1.00 15.37  ? 108  ILE A C     1 
ATOM   750   O  O     . ILE A  1  108 ? 3.729   46.496  39.550  1.00 18.82  ? 108  ILE A O     1 
ATOM   751   C  CB    . ILE A  1  108 ? 3.879   48.440  42.281  1.00 18.89  ? 108  ILE A CB    1 
ATOM   752   C  CG1   . ILE A  1  108 ? 4.521   48.264  43.661  1.00 22.86  ? 108  ILE A CG1   1 
ATOM   753   C  CG2   . ILE A  1  108 ? 2.510   47.728  42.203  1.00 22.49  ? 108  ILE A CG2   1 
ATOM   754   C  CD1   . ILE A  1  108 ? 3.882   49.108  44.764  1.00 19.87  ? 108  ILE A CD1   1 
ATOM   755   N  N     . GLU A  1  109 ? 3.825   48.717  39.149  1.00 12.55  ? 109  GLU A N     1 
ATOM   756   C  CA    . GLU A  1  109 ? 3.149   48.542  37.836  1.00 13.47  ? 109  GLU A CA    1 
ATOM   757   C  C     . GLU A  1  109 ? 3.891   47.543  36.951  1.00 13.20  ? 109  GLU A C     1 
ATOM   758   O  O     . GLU A  1  109 ? 3.285   46.637  36.398  1.00 15.36  ? 109  GLU A O     1 
ATOM   759   C  CB    . GLU A  1  109 ? 3.031   49.889  37.122  1.00 18.97  ? 109  GLU A CB    1 
ATOM   760   C  CG    . GLU A  1  109 ? 2.452   49.875  35.674  1.00 20.30  ? 109  GLU A CG    1 
ATOM   761   C  CD    . GLU A  1  109 ? 2.393   51.302  35.107  1.00 25.03  ? 109  GLU A CD    1 
ATOM   762   O  OE1   . GLU A  1  109 ? 3.438   51.811  34.634  1.00 24.44  ? 109  GLU A OE1   1 
ATOM   763   O  OE2   . GLU A  1  109 ? 1.317   51.943  35.171  1.00 28.89  ? 109  GLU A OE2   1 
ATOM   764   N  N     . LEU A  1  110 ? 5.214   47.691  36.821  1.00 17.29  ? 110  LEU A N     1 
ATOM   765   C  CA    . LEU A  1  110 ? 5.998   46.800  35.970  1.00 12.81  ? 110  LEU A CA    1 
ATOM   766   C  C     . LEU A  1  110 ? 5.960   45.372  36.443  1.00 12.83  ? 110  LEU A C     1 
ATOM   767   O  O     . LEU A  1  110 ? 5.896   44.444  35.652  1.00 18.85  ? 110  LEU A O     1 
ATOM   768   C  CB    . LEU A  1  110 ? 7.467   47.262  35.919  1.00 20.07  ? 110  LEU A CB    1 
ATOM   769   C  CG    . LEU A  1  110 ? 7.806   48.549  35.169  1.00 19.15  ? 110  LEU A CG    1 
ATOM   770   C  CD1   . LEU A  1  110 ? 9.253   48.936  35.484  1.00 22.28  ? 110  LEU A CD1   1 
ATOM   771   C  CD2   . LEU A  1  110 ? 7.624   48.315  33.658  1.00 20.13  ? 110  LEU A CD2   1 
ATOM   772   N  N     . GLU A  1  111 ? 6.042   45.171  37.757  1.00 13.87  ? 111  GLU A N     1 
ATOM   773   C  CA    . GLU A  1  111 ? 5.986   43.803  38.262  1.00 11.32  ? 111  GLU A CA    1 
ATOM   774   C  C     . GLU A  1  111 ? 4.574   43.251  37.995  1.00 10.84  ? 111  GLU A C     1 
ATOM   775   O  O     . GLU A  1  111 ? 4.403   42.089  37.626  1.00 11.92  ? 111  GLU A O     1 
ATOM   776   C  CB    . GLU A  1  111 ? 6.289   43.790  39.779  1.00 14.69  ? 111  GLU A CB    1 
ATOM   777   C  CG    . GLU A  1  111 ? 6.440   42.371  40.383  1.00 22.00  ? 111  GLU A CG    1 
ATOM   778   C  CD    . GLU A  1  111 ? 5.084   41.671  40.623  1.00 21.90  ? 111  GLU A CD    1 
ATOM   779   O  OE1   . GLU A  1  111 ? 4.121   42.401  40.910  1.00 23.15  ? 111  GLU A OE1   1 
ATOM   780   O  OE2   . GLU A  1  111 ? 4.998   40.412  40.561  1.00 19.81  ? 111  GLU A OE2   1 
ATOM   781   N  N     . ASN A  1  112 ? 3.553   44.060  38.201  1.00 10.10  ? 112  ASN A N     1 
ATOM   782   C  CA    . ASN A  1  112 ? 2.208   43.545  37.919  1.00 12.99  ? 112  ASN A CA    1 
ATOM   783   C  C     . ASN A  1  112 ? 2.027   43.271  36.396  1.00 18.93  ? 112  ASN A C     1 
ATOM   784   O  O     . ASN A  1  112 ? 1.060   42.636  36.006  1.00 20.27  ? 112  ASN A O     1 
ATOM   785   C  CB    . ASN A  1  112 ? 1.146   44.522  38.396  1.00 13.71  ? 112  ASN A CB    1 
ATOM   786   C  CG    . ASN A  1  112 ? 0.960   44.514  39.934  1.00 20.98  ? 112  ASN A CG    1 
ATOM   787   O  OD1   . ASN A  1  112 ? 1.733   43.894  40.683  1.00 23.84  ? 112  ASN A OD1   1 
ATOM   788   N  ND2   . ASN A  1  112 ? -0.087  45.201  40.397  1.00 14.46  ? 112  ASN A ND2   1 
ATOM   789   N  N     . TYR A  1  113 ? 2.938   43.765  35.550  1.00 18.00  ? 113  TYR A N     1 
ATOM   790   C  CA    . TYR A  1  113 ? 2.873   43.480  34.109  1.00 19.44  ? 113  TYR A CA    1 
ATOM   791   C  C     . TYR A  1  113 ? 3.570   42.112  33.928  1.00 18.95  ? 113  TYR A C     1 
ATOM   792   O  O     . TYR A  1  113 ? 3.549   41.520  32.856  1.00 19.42  ? 113  TYR A O     1 
ATOM   793   C  CB    . TYR A  1  113 ? 3.657   44.519  33.269  1.00 19.78  ? 113  TYR A CB    1 
ATOM   794   C  CG    . TYR A  1  113 ? 3.055   45.932  33.142  1.00 18.72  ? 113  TYR A CG    1 
ATOM   795   C  CD1   . TYR A  1  113 ? 3.855   46.993  32.748  1.00 18.37  ? 113  TYR A CD1   1 
ATOM   796   C  CD2   . TYR A  1  113 ? 1.689   46.180  33.338  1.00 19.49  ? 113  TYR A CD2   1 
ATOM   797   C  CE1   . TYR A  1  113 ? 3.336   48.276  32.547  1.00 20.56  ? 113  TYR A CE1   1 
ATOM   798   C  CE2   . TYR A  1  113 ? 1.147   47.466  33.129  1.00 20.94  ? 113  TYR A CE2   1 
ATOM   799   C  CZ    . TYR A  1  113 ? 1.978   48.499  32.738  1.00 22.65  ? 113  TYR A CZ    1 
ATOM   800   O  OH    . TYR A  1  113 ? 1.491   49.768  32.551  1.00 22.97  ? 113  TYR A OH    1 
ATOM   801   N  N     . GLY A  1  114 ? 4.211   41.607  34.971  1.00 17.18  ? 114  GLY A N     1 
ATOM   802   C  CA    . GLY A  1  114 ? 4.884   40.322  34.796  1.00 16.18  ? 114  GLY A CA    1 
ATOM   803   C  C     . GLY A  1  114 ? 6.421   40.395  34.757  1.00 14.88  ? 114  GLY A C     1 
ATOM   804   O  O     . GLY A  1  114 ? 7.078   39.383  34.566  1.00 18.43  ? 114  GLY A O     1 
ATOM   805   N  N     . MET A  1  115 ? 6.996   41.576  34.918  1.00 9.50   ? 115  MET A N     1 
ATOM   806   C  CA    . MET A  1  115 ? 8.473   41.666  34.935  1.00 17.10  ? 115  MET A CA    1 
ATOM   807   C  C     . MET A  1  115 ? 8.956   40.687  36.013  1.00 17.45  ? 115  MET A C     1 
ATOM   808   O  O     . MET A  1  115 ? 8.594   40.817  37.190  1.00 16.83  ? 115  MET A O     1 
ATOM   809   C  CB    . MET A  1  115 ? 8.928   43.079  35.290  1.00 16.44  ? 115  MET A CB    1 
ATOM   810   C  CG    . MET A  1  115 ? 10.321  43.402  34.758  1.00 20.96  ? 115  MET A CG    1 
ATOM   811   S  SD    . MET A  1  115 ? 10.652  45.169  34.982  1.00 24.85  ? 115  MET A SD    1 
ATOM   812   C  CE    . MET A  1  115 ? 12.486  45.132  35.406  1.00 24.22  ? 115  MET A CE    1 
ATOM   813   N  N     . PRO A  1  116 ? 9.796   39.711  35.627  1.00 18.15  ? 116  PRO A N     1 
ATOM   814   C  CA    . PRO A  1  116 ? 10.331  38.682  36.527  1.00 14.41  ? 116  PRO A CA    1 
ATOM   815   C  C     . PRO A  1  116 ? 11.404  39.092  37.523  1.00 17.47  ? 116  PRO A C     1 
ATOM   816   O  O     . PRO A  1  116 ? 12.504  38.542  37.541  1.00 18.46  ? 116  PRO A O     1 
ATOM   817   C  CB    . PRO A  1  116 ? 10.812  37.610  35.566  1.00 14.59  ? 116  PRO A CB    1 
ATOM   818   C  CG    . PRO A  1  116 ? 11.322  38.411  34.414  1.00 6.90   ? 116  PRO A CG    1 
ATOM   819   C  CD    . PRO A  1  116 ? 10.322  39.535  34.256  1.00 18.30  ? 116  PRO A CD    1 
ATOM   820   N  N     . PHE A  1  117 ? 11.091  40.094  38.326  1.00 12.00  ? 117  PHE A N     1 
ATOM   821   C  CA    . PHE A  1  117 ? 12.009  40.523  39.356  1.00 20.38  ? 117  PHE A CA    1 
ATOM   822   C  C     . PHE A  1  117 ? 12.539  39.341  40.205  1.00 17.17  ? 117  PHE A C     1 
ATOM   823   O  O     . PHE A  1  117 ? 11.863  38.318  40.376  1.00 18.40  ? 117  PHE A O     1 
ATOM   824   C  CB    . PHE A  1  117 ? 11.319  41.538  40.257  1.00 17.08  ? 117  PHE A CB    1 
ATOM   825   C  CG    . PHE A  1  117 ? 11.167  42.909  39.629  1.00 17.57  ? 117  PHE A CG    1 
ATOM   826   C  CD1   . PHE A  1  117 ? 12.254  43.755  39.507  1.00 14.80  ? 117  PHE A CD1   1 
ATOM   827   C  CD2   . PHE A  1  117 ? 9.906   43.367  39.219  1.00 17.18  ? 117  PHE A CD2   1 
ATOM   828   C  CE1   . PHE A  1  117 ? 12.110  45.060  38.988  1.00 12.96  ? 117  PHE A CE1   1 
ATOM   829   C  CE2   . PHE A  1  117 ? 9.742   44.681  38.690  1.00 18.35  ? 117  PHE A CE2   1 
ATOM   830   C  CZ    . PHE A  1  117 ? 10.853  45.524  38.582  1.00 15.85  ? 117  PHE A CZ    1 
ATOM   831   N  N     . SER A  1  118 ? 13.786  39.470  40.658  1.00 16.68  ? 118  SER A N     1 
ATOM   832   C  CA    . SER A  1  118 ? 14.395  38.462  41.545  1.00 18.45  ? 118  SER A CA    1 
ATOM   833   C  C     . SER A  1  118 ? 13.639  38.638  42.833  1.00 15.58  ? 118  SER A C     1 
ATOM   834   O  O     . SER A  1  118 ? 13.097  39.733  43.084  1.00 15.98  ? 118  SER A O     1 
ATOM   835   C  CB    . SER A  1  118 ? 15.868  38.772  41.788  1.00 22.97  ? 118  SER A CB    1 
ATOM   836   O  OG    . SER A  1  118 ? 16.570  38.660  40.574  1.00 23.52  ? 118  SER A OG    1 
ATOM   837   N  N     . ARG A  1  119 ? 13.610  37.603  43.662  1.00 17.35  ? 119  ARG A N     1 
ATOM   838   C  CA    . ARG A  1  119 ? 12.806  37.654  44.897  1.00 17.67  ? 119  ARG A CA    1 
ATOM   839   C  C     . ARG A  1  119 ? 13.498  37.506  46.249  1.00 19.36  ? 119  ARG A C     1 
ATOM   840   O  O     . ARG A  1  119 ? 14.578  36.934  46.349  1.00 22.03  ? 119  ARG A O     1 
ATOM   841   C  CB    . ARG A  1  119 ? 11.717  36.588  44.794  1.00 16.73  ? 119  ARG A CB    1 
ATOM   842   C  CG    . ARG A  1  119 ? 10.830  36.783  43.569  1.00 20.74  ? 119  ARG A CG    1 
ATOM   843   C  CD    . ARG A  1  119 ? 9.897   37.974  43.769  1.00 19.74  ? 119  ARG A CD    1 
ATOM   844   N  NE    . ARG A  1  119 ? 9.167   38.265  42.542  1.00 22.05  ? 119  ARG A NE    1 
ATOM   845   C  CZ    . ARG A  1  119 ? 8.008   38.910  42.467  1.00 19.61  ? 119  ARG A CZ    1 
ATOM   846   N  NH1   . ARG A  1  119 ? 7.398   39.364  43.565  1.00 14.98  ? 119  ARG A NH1   1 
ATOM   847   N  NH2   . ARG A  1  119 ? 7.451   39.093  41.276  1.00 17.07  ? 119  ARG A NH2   1 
ATOM   848   N  N     . THR A  1  120 ? 12.866  38.036  47.285  1.00 19.29  ? 120  THR A N     1 
ATOM   849   C  CA    . THR A  1  120 ? 13.369  37.903  48.646  1.00 21.71  ? 120  THR A CA    1 
ATOM   850   C  C     . THR A  1  120 ? 12.658  36.680  49.272  1.00 25.65  ? 120  THR A C     1 
ATOM   851   O  O     . THR A  1  120 ? 11.793  36.039  48.644  1.00 24.45  ? 120  THR A O     1 
ATOM   852   C  CB    . THR A  1  120 ? 13.011  39.109  49.519  1.00 19.43  ? 120  THR A CB    1 
ATOM   853   O  OG1   . THR A  1  120 ? 11.596  39.148  49.675  1.00 22.29  ? 120  THR A OG1   1 
ATOM   854   C  CG2   . THR A  1  120 ? 13.478  40.410  48.899  1.00 17.19  ? 120  THR A CG2   1 
ATOM   855   N  N     . GLU A  1  121 ? 13.028  36.377  50.513  1.00 25.71  ? 121  GLU A N     1 
ATOM   856   C  CA    . GLU A  1  121 ? 12.457  35.267  51.266  1.00 27.46  ? 121  GLU A CA    1 
ATOM   857   C  C     . GLU A  1  121 ? 10.976  35.485  51.526  1.00 26.72  ? 121  GLU A C     1 
ATOM   858   O  O     . GLU A  1  121 ? 10.264  34.527  51.783  1.00 26.42  ? 121  GLU A O     1 
ATOM   859   C  CB    . GLU A  1  121 ? 13.161  35.111  52.612  1.00 32.41  ? 121  GLU A CB    1 
ATOM   860   C  CG    . GLU A  1  121 ? 14.661  35.004  52.515  1.00 46.55  ? 121  GLU A CG    1 
ATOM   861   C  CD    . GLU A  1  121 ? 15.122  33.594  52.294  1.00 53.08  ? 121  GLU A CD    1 
ATOM   862   O  OE1   . GLU A  1  121 ? 14.698  32.989  51.282  1.00 58.48  ? 121  GLU A OE1   1 
ATOM   863   O  OE2   . GLU A  1  121 ? 15.904  33.094  53.140  1.00 57.21  ? 121  GLU A OE2   1 
ATOM   864   N  N     . GLU A  1  122 ? 10.519  36.733  51.501  1.00 24.75  ? 122  GLU A N     1 
ATOM   865   C  CA    . GLU A  1  122 ? 9.083   37.017  51.697  1.00 26.38  ? 122  GLU A CA    1 
ATOM   866   C  C     . GLU A  1  122 ? 8.326   36.989  50.373  1.00 24.08  ? 122  GLU A C     1 
ATOM   867   O  O     . GLU A  1  122 ? 7.129   37.177  50.342  1.00 19.11  ? 122  GLU A O     1 
ATOM   868   C  CB    . GLU A  1  122 ? 8.864   38.393  52.335  1.00 30.89  ? 122  GLU A CB    1 
ATOM   869   C  CG    . GLU A  1  122 ? 9.367   38.479  53.776  1.00 41.33  ? 122  GLU A CG    1 
ATOM   870   C  CD    . GLU A  1  122 ? 9.224   39.878  54.375  1.00 49.03  ? 122  GLU A CD    1 
ATOM   871   O  OE1   . GLU A  1  122 ? 9.250   39.993  55.635  1.00 52.46  ? 122  GLU A OE1   1 
ATOM   872   O  OE2   . GLU A  1  122 ? 9.099   40.857  53.594  1.00 48.92  ? 122  GLU A OE2   1 
ATOM   873   N  N     . GLY A  1  123 ? 9.036   36.793  49.269  1.00 23.73  ? 123  GLY A N     1 
ATOM   874   C  CA    . GLY A  1  123 ? 8.356   36.747  47.991  1.00 24.50  ? 123  GLY A CA    1 
ATOM   875   C  C     . GLY A  1  123 ? 8.200   38.114  47.330  1.00 25.44  ? 123  GLY A C     1 
ATOM   876   O  O     . GLY A  1  123 ? 7.515   38.244  46.300  1.00 20.73  ? 123  GLY A O     1 
ATOM   877   N  N     . LYS A  1  124 ? 8.832   39.123  47.917  1.00 21.67  ? 124  LYS A N     1 
ATOM   878   C  CA    . LYS A  1  124 ? 8.782   40.485  47.380  1.00 23.30  ? 124  LYS A CA    1 
ATOM   879   C  C     . LYS A  1  124 ? 9.962   40.740  46.453  1.00 20.79  ? 124  LYS A C     1 
ATOM   880   O  O     . LYS A  1  124 ? 10.845  39.889  46.309  1.00 19.92  ? 124  LYS A O     1 
ATOM   881   C  CB    . LYS A  1  124 ? 8.806   41.507  48.515  1.00 25.19  ? 124  LYS A CB    1 
ATOM   882   C  CG    . LYS A  1  124 ? 7.609   41.370  49.419  1.00 25.59  ? 124  LYS A CG    1 
ATOM   883   C  CD    . LYS A  1  124 ? 7.672   42.295  50.648  1.00 27.84  ? 124  LYS A CD    1 
ATOM   884   C  CE    . LYS A  1  124 ? 6.277   42.376  51.317  1.00 26.65  ? 124  LYS A CE    1 
ATOM   885   N  NZ    . LYS A  1  124 ? 6.060   43.642  52.123  1.00 29.80  ? 124  LYS A NZ    1 
ATOM   886   N  N     . ILE A  1  125 ? 9.990   41.927  45.857  1.00 20.34  ? 125  ILE A N     1 
ATOM   887   C  CA    . ILE A  1  125 ? 11.044  42.307  44.927  1.00 19.06  ? 125  ILE A CA    1 
ATOM   888   C  C     . ILE A  1  125 ? 12.397  42.543  45.623  1.00 16.90  ? 125  ILE A C     1 
ATOM   889   O  O     . ILE A  1  125 ? 12.505  43.324  46.559  1.00 19.49  ? 125  ILE A O     1 
ATOM   890   C  CB    . ILE A  1  125 ? 10.616  43.584  44.155  1.00 19.49  ? 125  ILE A CB    1 
ATOM   891   C  CG1   . ILE A  1  125 ? 9.439   43.258  43.242  1.00 17.53  ? 125  ILE A CG1   1 
ATOM   892   C  CG2   . ILE A  1  125 ? 11.753  44.146  43.336  1.00 13.77  ? 125  ILE A CG2   1 
ATOM   893   C  CD1   . ILE A  1  125 ? 8.744   44.536  42.728  1.00 16.01  ? 125  ILE A CD1   1 
ATOM   894   N  N     . TYR A  1  126 ? 13.408  41.819  45.168  1.00 15.27  ? 126  TYR A N     1 
ATOM   895   C  CA    . TYR A  1  126 ? 14.759  41.930  45.674  1.00 15.23  ? 126  TYR A CA    1 
ATOM   896   C  C     . TYR A  1  126 ? 15.352  43.287  45.249  1.00 17.28  ? 126  TYR A C     1 
ATOM   897   O  O     . TYR A  1  126 ? 15.275  43.632  44.080  1.00 14.98  ? 126  TYR A O     1 
ATOM   898   C  CB    . TYR A  1  126 ? 15.617  40.811  45.076  1.00 14.82  ? 126  TYR A CB    1 
ATOM   899   C  CG    . TYR A  1  126 ? 17.107  40.934  45.400  1.00 19.78  ? 126  TYR A CG    1 
ATOM   900   C  CD1   . TYR A  1  126 ? 17.592  40.755  46.713  1.00 17.56  ? 126  TYR A CD1   1 
ATOM   901   C  CD2   . TYR A  1  126 ? 18.014  41.288  44.405  1.00 17.08  ? 126  TYR A CD2   1 
ATOM   902   C  CE1   . TYR A  1  126 ? 18.992  40.946  47.009  1.00 22.73  ? 126  TYR A CE1   1 
ATOM   903   C  CE2   . TYR A  1  126 ? 19.372  41.477  44.679  1.00 19.26  ? 126  TYR A CE2   1 
ATOM   904   C  CZ    . TYR A  1  126 ? 19.862  41.312  45.980  1.00 20.56  ? 126  TYR A CZ    1 
ATOM   905   O  OH    . TYR A  1  126 ? 21.221  41.570  46.215  1.00 26.35  ? 126  TYR A OH    1 
ATOM   906   N  N     . GLN A  1  127 ? 15.933  44.024  46.198  1.00 17.63  ? 127  GLN A N     1 
ATOM   907   C  CA    . GLN A  1  127 ? 16.570  45.307  45.928  1.00 18.83  ? 127  GLN A CA    1 
ATOM   908   C  C     . GLN A  1  127 ? 18.058  45.254  46.338  1.00 18.44  ? 127  GLN A C     1 
ATOM   909   O  O     . GLN A  1  127 ? 18.377  44.699  47.389  1.00 19.93  ? 127  GLN A O     1 
ATOM   910   C  CB    . GLN A  1  127 ? 15.889  46.421  46.723  1.00 17.27  ? 127  GLN A CB    1 
ATOM   911   C  CG    . GLN A  1  127 ? 14.407  46.632  46.411  1.00 21.12  ? 127  GLN A CG    1 
ATOM   912   C  CD    . GLN A  1  127 ? 13.749  47.583  47.396  1.00 16.19  ? 127  GLN A CD    1 
ATOM   913   O  OE1   . GLN A  1  127 ? 13.454  47.206  48.538  1.00 21.08  ? 127  GLN A OE1   1 
ATOM   914   N  NE2   . GLN A  1  127 ? 13.537  48.838  46.975  1.00 17.97  ? 127  GLN A NE2   1 
ATOM   915   N  N     . ARG A  1  128 ? 18.958  45.821  45.523  1.00 13.77  ? 128  ARG A N     1 
ATOM   916   C  CA    . ARG A  1  128 ? 20.385  45.842  45.853  1.00 17.48  ? 128  ARG A CA    1 
ATOM   917   C  C     . ARG A  1  128 ? 20.915  47.256  46.154  1.00 17.95  ? 128  ARG A C     1 
ATOM   918   O  O     . ARG A  1  128 ? 20.228  48.267  45.943  1.00 14.51  ? 128  ARG A O     1 
ATOM   919   C  CB    . ARG A  1  128 ? 21.215  45.200  44.730  1.00 12.20  ? 128  ARG A CB    1 
ATOM   920   C  CG    . ARG A  1  128 ? 21.046  45.862  43.354  1.00 22.10  ? 128  ARG A CG    1 
ATOM   921   C  CD    . ARG A  1  128 ? 22.061  45.411  42.305  1.00 13.32  ? 128  ARG A CD    1 
ATOM   922   N  NE    . ARG A  1  128 ? 22.208  43.959  42.215  1.00 19.70  ? 128  ARG A NE    1 
ATOM   923   C  CZ    . ARG A  1  128 ? 22.023  43.250  41.106  1.00 18.78  ? 128  ARG A CZ    1 
ATOM   924   N  NH1   . ARG A  1  128 ? 21.676  43.869  39.982  1.00 16.41  ? 128  ARG A NH1   1 
ATOM   925   N  NH2   . ARG A  1  128 ? 22.176  41.932  41.123  1.00 19.23  ? 128  ARG A NH2   1 
ATOM   926   N  N     . ALA A  1  129 ? 22.131  47.315  46.695  1.00 20.11  ? 129  ALA A N     1 
ATOM   927   C  CA    . ALA A  1  129 ? 22.782  48.591  46.968  1.00 18.93  ? 129  ALA A CA    1 
ATOM   928   C  C     . ALA A  1  129 ? 23.229  49.081  45.616  1.00 20.47  ? 129  ALA A C     1 
ATOM   929   O  O     . ALA A  1  129 ? 23.430  48.279  44.717  1.00 18.29  ? 129  ALA A O     1 
ATOM   930   C  CB    . ALA A  1  129 ? 23.991  48.394  47.833  1.00 18.89  ? 129  ALA A CB    1 
ATOM   931   N  N     . PHE A  1  130 ? 23.403  50.392  45.481  1.00 24.18  ? 130  PHE A N     1 
ATOM   932   C  CA    . PHE A  1  130 ? 23.865  50.992  44.238  1.00 22.66  ? 130  PHE A CA    1 
ATOM   933   C  C     . PHE A  1  130 ? 24.590  52.286  44.605  1.00 20.27  ? 130  PHE A C     1 
ATOM   934   O  O     . PHE A  1  130 ? 24.438  52.794  45.720  1.00 19.38  ? 130  PHE A O     1 
ATOM   935   C  CB    . PHE A  1  130 ? 22.688  51.281  43.305  1.00 20.40  ? 130  PHE A CB    1 
ATOM   936   C  CG    . PHE A  1  130 ? 22.896  50.788  41.914  1.00 22.31  ? 130  PHE A CG    1 
ATOM   937   C  CD1   . PHE A  1  130 ? 22.876  49.410  41.636  1.00 18.57  ? 130  PHE A CD1   1 
ATOM   938   C  CD2   . PHE A  1  130 ? 23.121  51.687  40.870  1.00 21.36  ? 130  PHE A CD2   1 
ATOM   939   C  CE1   . PHE A  1  130 ? 23.080  48.947  40.341  1.00 19.96  ? 130  PHE A CE1   1 
ATOM   940   C  CE2   . PHE A  1  130 ? 23.324  51.233  39.570  1.00 14.52  ? 130  PHE A CE2   1 
ATOM   941   C  CZ    . PHE A  1  130 ? 23.306  49.873  39.300  1.00 20.95  ? 130  PHE A CZ    1 
ATOM   942   N  N     . GLY A  1  131 ? 25.382  52.795  43.671  1.00 15.59  ? 131  GLY A N     1 
ATOM   943   C  CA    . GLY A  1  131 ? 26.156  53.990  43.929  1.00 19.73  ? 131  GLY A CA    1 
ATOM   944   C  C     . GLY A  1  131 ? 25.461  55.301  44.240  1.00 22.85  ? 131  GLY A C     1 
ATOM   945   O  O     . GLY A  1  131 ? 24.608  55.752  43.497  1.00 18.60  ? 131  GLY A O     1 
ATOM   946   N  N     . GLY A  1  132 ? 25.878  55.930  45.341  1.00 24.03  ? 132  GLY A N     1 
ATOM   947   C  CA    . GLY A  1  132 ? 25.344  57.220  45.736  1.00 23.88  ? 132  GLY A CA    1 
ATOM   948   C  C     . GLY A  1  132 ? 23.977  57.271  46.418  1.00 24.18  ? 132  GLY A C     1 
ATOM   949   O  O     . GLY A  1  132 ? 23.376  58.327  46.436  1.00 18.44  ? 132  GLY A O     1 
ATOM   950   N  N     . GLN A  1  133 ? 23.486  56.152  46.951  1.00 24.28  ? 133  GLN A N     1 
ATOM   951   C  CA    . GLN A  1  133 ? 22.191  56.134  47.639  1.00 23.57  ? 133  GLN A CA    1 
ATOM   952   C  C     . GLN A  1  133 ? 22.340  55.787  49.117  1.00 21.45  ? 133  GLN A C     1 
ATOM   953   O  O     . GLN A  1  133 ? 23.033  54.826  49.472  1.00 21.17  ? 133  GLN A O     1 
ATOM   954   C  CB    . GLN A  1  133 ? 21.280  55.135  46.974  1.00 23.00  ? 133  GLN A CB    1 
ATOM   955   C  CG    . GLN A  1  133 ? 20.927  55.518  45.561  1.00 27.17  ? 133  GLN A CG    1 
ATOM   956   C  CD    . GLN A  1  133 ? 19.805  54.696  45.096  1.00 31.91  ? 133  GLN A CD    1 
ATOM   957   O  OE1   . GLN A  1  133 ? 18.637  55.061  45.305  1.00 30.85  ? 133  GLN A OE1   1 
ATOM   958   N  NE2   . GLN A  1  133 ? 20.121  53.534  44.505  1.00 28.33  ? 133  GLN A NE2   1 
ATOM   959   N  N     . SER A  1  134 ? 21.666  56.572  49.950  1.00 19.61  ? 134  SER A N     1 
ATOM   960   C  CA    . SER A  1  134 ? 21.718  56.469  51.403  1.00 18.25  ? 134  SER A CA    1 
ATOM   961   C  C     . SER A  1  134 ? 20.348  56.554  52.054  1.00 22.17  ? 134  SER A C     1 
ATOM   962   O  O     . SER A  1  134 ? 19.348  56.916  51.413  1.00 22.99  ? 134  SER A O     1 
ATOM   963   C  CB    . SER A  1  134 ? 22.481  57.635  51.954  1.00 17.66  ? 134  SER A CB    1 
ATOM   964   O  OG    . SER A  1  134 ? 21.703  58.812  51.749  1.00 20.94  ? 134  SER A OG    1 
ATOM   965   N  N     . LEU A  1  135 ? 20.335  56.265  53.352  1.00 22.69  ? 135  LEU A N     1 
ATOM   966   C  CA    . LEU A  1  135 ? 19.127  56.346  54.170  1.00 23.77  ? 135  LEU A CA    1 
ATOM   967   C  C     . LEU A  1  135 ? 19.268  57.606  55.043  1.00 26.16  ? 135  LEU A C     1 
ATOM   968   O  O     . LEU A  1  135 ? 20.378  58.133  55.250  1.00 24.40  ? 135  LEU A O     1 
ATOM   969   C  CB    . LEU A  1  135 ? 19.017  55.113  55.064  1.00 21.55  ? 135  LEU A CB    1 
ATOM   970   C  CG    . LEU A  1  135 ? 19.121  53.742  54.366  1.00 23.62  ? 135  LEU A CG    1 
ATOM   971   C  CD1   . LEU A  1  135 ? 19.304  52.670  55.426  1.00 24.60  ? 135  LEU A CD1   1 
ATOM   972   C  CD2   . LEU A  1  135 ? 17.847  53.444  53.557  1.00 24.20  ? 135  LEU A CD2   1 
ATOM   973   N  N     . GLN A  1  136 ? 18.149  58.112  55.530  1.00 27.19  ? 136  GLN A N     1 
ATOM   974   C  CA    . GLN A  1  136 ? 18.157  59.265  56.413  1.00 26.29  ? 136  GLN A CA    1 
ATOM   975   C  C     . GLN A  1  136 ? 18.819  60.500  55.883  1.00 26.28  ? 136  GLN A C     1 
ATOM   976   O  O     . GLN A  1  136 ? 19.635  61.095  56.581  1.00 24.13  ? 136  GLN A O     1 
ATOM   977   C  CB    . GLN A  1  136 ? 18.821  58.883  57.734  1.00 26.45  ? 136  GLN A CB    1 
ATOM   978   C  CG    . GLN A  1  136 ? 18.134  57.722  58.390  1.00 25.81  ? 136  GLN A CG    1 
ATOM   979   C  CD    . GLN A  1  136 ? 16.846  58.132  59.117  1.00 28.92  ? 136  GLN A CD    1 
ATOM   980   O  OE1   . GLN A  1  136 ? 16.472  59.314  59.160  1.00 31.67  ? 136  GLN A OE1   1 
ATOM   981   N  NE2   . GLN A  1  136 ? 16.172  57.152  59.702  1.00 29.73  ? 136  GLN A NE2   1 
ATOM   982   N  N     . PHE A  1  137 ? 18.473  60.895  54.652  1.00 25.49  ? 137  PHE A N     1 
ATOM   983   C  CA    . PHE A  1  137 ? 19.019  62.120  54.049  1.00 23.29  ? 137  PHE A CA    1 
ATOM   984   C  C     . PHE A  1  137 ? 20.529  62.210  54.069  1.00 21.85  ? 137  PHE A C     1 
ATOM   985   O  O     . PHE A  1  137 ? 21.114  63.254  54.384  1.00 22.64  ? 137  PHE A O     1 
ATOM   986   C  CB    . PHE A  1  137 ? 18.427  63.366  54.718  1.00 18.21  ? 137  PHE A CB    1 
ATOM   987   C  CG    . PHE A  1  137 ? 16.925  63.484  54.562  1.00 22.26  ? 137  PHE A CG    1 
ATOM   988   C  CD1   . PHE A  1  137 ? 16.065  63.115  55.595  1.00 24.80  ? 137  PHE A CD1   1 
ATOM   989   C  CD2   . PHE A  1  137 ? 16.368  63.961  53.370  1.00 25.26  ? 137  PHE A CD2   1 
ATOM   990   C  CE1   . PHE A  1  137 ? 14.665  63.215  55.451  1.00 19.91  ? 137  PHE A CE1   1 
ATOM   991   C  CE2   . PHE A  1  137 ? 14.973  64.071  53.208  1.00 19.69  ? 137  PHE A CE2   1 
ATOM   992   C  CZ    . PHE A  1  137 ? 14.127  63.703  54.235  1.00 25.75  ? 137  PHE A CZ    1 
ATOM   993   N  N     . GLY A  1  138 ? 21.155  61.095  53.721  1.00 24.42  ? 138  GLY A N     1 
ATOM   994   C  CA    . GLY A  1  138 ? 22.603  61.030  53.674  1.00 24.24  ? 138  GLY A CA    1 
ATOM   995   C  C     . GLY A  1  138 ? 23.310  60.770  54.992  1.00 26.72  ? 138  GLY A C     1 
ATOM   996   O  O     . GLY A  1  138 ? 24.537  60.675  55.015  1.00 26.98  ? 138  GLY A O     1 
ATOM   997   N  N     . LYS A  1  139 ? 22.562  60.600  56.078  1.00 23.58  ? 139  LYS A N     1 
ATOM   998   C  CA    . LYS A  1  139 ? 23.204  60.408  57.359  1.00 25.48  ? 139  LYS A CA    1 
ATOM   999   C  C     . LYS A  1  139 ? 23.181  58.961  57.838  1.00 28.45  ? 139  LYS A C     1 
ATOM   1000  O  O     . LYS A  1  139 ? 23.953  58.590  58.730  1.00 31.37  ? 139  LYS A O     1 
ATOM   1001  C  CB    . LYS A  1  139 ? 22.515  61.291  58.414  1.00 26.36  ? 139  LYS A CB    1 
ATOM   1002  C  CG    . LYS A  1  139 ? 22.422  62.783  58.084  1.00 23.55  ? 139  LYS A CG    1 
ATOM   1003  C  CD    . LYS A  1  139 ? 21.580  63.557  59.117  1.00 28.95  ? 139  LYS A CD    1 
ATOM   1004  C  CE    . LYS A  1  139 ? 20.069  63.355  58.925  1.00 33.17  ? 139  LYS A CE    1 
ATOM   1005  N  NZ    . LYS A  1  139 ? 19.234  63.994  59.995  1.00 34.59  ? 139  LYS A NZ    1 
ATOM   1006  N  N     . GLY A  1  140 ? 22.336  58.127  57.230  1.00 25.87  ? 140  GLY A N     1 
ATOM   1007  C  CA    . GLY A  1  140 ? 22.200  56.771  57.723  1.00 26.81  ? 140  GLY A CA    1 
ATOM   1008  C  C     . GLY A  1  140 ? 22.737  55.531  57.062  1.00 28.11  ? 140  GLY A C     1 
ATOM   1009  O  O     . GLY A  1  140 ? 22.203  54.450  57.284  1.00 33.84  ? 140  GLY A O     1 
ATOM   1010  N  N     . GLY A  1  141 ? 23.788  55.642  56.275  1.00 28.48  ? 141  GLY A N     1 
ATOM   1011  C  CA    . GLY A  1  141 ? 24.311  54.441  55.653  1.00 27.54  ? 141  GLY A CA    1 
ATOM   1012  C  C     . GLY A  1  141 ? 23.653  54.116  54.314  1.00 23.62  ? 141  GLY A C     1 
ATOM   1013  O  O     . GLY A  1  141 ? 22.682  54.758  53.908  1.00 21.06  ? 141  GLY A O     1 
ATOM   1014  N  N     . GLN A  1  142 ? 24.169  53.072  53.687  1.00 23.17  ? 142  GLN A N     1 
ATOM   1015  C  CA    . GLN A  1  142 ? 23.757  52.590  52.368  1.00 24.37  ? 142  GLN A CA    1 
ATOM   1016  C  C     . GLN A  1  142 ? 22.314  52.105  52.201  1.00 22.40  ? 142  GLN A C     1 
ATOM   1017  O  O     . GLN A  1  142 ? 21.846  51.241  52.936  1.00 23.85  ? 142  GLN A O     1 
ATOM   1018  C  CB    . GLN A  1  142 ? 24.704  51.447  51.964  1.00 25.57  ? 142  GLN A CB    1 
ATOM   1019  C  CG    . GLN A  1  142 ? 24.455  50.831  50.594  1.00 25.41  ? 142  GLN A CG    1 
ATOM   1020  C  CD    . GLN A  1  142 ? 24.677  51.840  49.473  1.00 28.53  ? 142  GLN A CD    1 
ATOM   1021  O  OE1   . GLN A  1  142 ? 25.760  52.400  49.350  1.00 23.12  ? 142  GLN A OE1   1 
ATOM   1022  N  NE2   . GLN A  1  142 ? 23.639  52.088  48.664  1.00 25.44  ? 142  GLN A NE2   1 
ATOM   1023  N  N     . ALA A  1  143 ? 21.618  52.640  51.216  1.00 18.61  ? 143  ALA A N     1 
ATOM   1024  C  CA    . ALA A  1  143 ? 20.269  52.171  50.939  1.00 20.50  ? 143  ALA A CA    1 
ATOM   1025  C  C     . ALA A  1  143 ? 20.371  50.959  49.989  1.00 21.47  ? 143  ALA A C     1 
ATOM   1026  O  O     . ALA A  1  143 ? 21.399  50.750  49.305  1.00 22.92  ? 143  ALA A O     1 
ATOM   1027  C  CB    . ALA A  1  143 ? 19.459  53.279  50.300  1.00 19.59  ? 143  ALA A CB    1 
ATOM   1028  N  N     . HIS A  1  144 ? 19.331  50.139  49.990  1.00 19.16  ? 144  HIS A N     1 
ATOM   1029  C  CA    . HIS A  1  144 ? 19.241  48.962  49.119  1.00 19.81  ? 144  HIS A CA    1 
ATOM   1030  C  C     . HIS A  1  144 ? 17.873  49.135  48.452  1.00 21.07  ? 144  HIS A C     1 
ATOM   1031  O  O     . HIS A  1  144 ? 16.876  48.557  48.895  1.00 17.17  ? 144  HIS A O     1 
ATOM   1032  C  CB    . HIS A  1  144 ? 19.263  47.695  49.968  1.00 20.95  ? 144  HIS A CB    1 
ATOM   1033  C  CG    . HIS A  1  144 ? 20.468  47.598  50.845  1.00 23.86  ? 144  HIS A CG    1 
ATOM   1034  N  ND1   . HIS A  1  144 ? 21.632  46.979  50.443  1.00 27.18  ? 144  HIS A ND1   1 
ATOM   1035  C  CD2   . HIS A  1  144 ? 20.749  48.190  52.029  1.00 24.22  ? 144  HIS A CD2   1 
ATOM   1036  C  CE1   . HIS A  1  144 ? 22.579  47.207  51.334  1.00 23.22  ? 144  HIS A CE1   1 
ATOM   1037  N  NE2   . HIS A  1  144 ? 22.069  47.939  52.305  1.00 23.98  ? 144  HIS A NE2   1 
ATOM   1038  N  N     . ARG A  1  145 ? 17.817  49.967  47.412  1.00 18.83  ? 145  ARG A N     1 
ATOM   1039  C  CA    . ARG A  1  145 ? 16.539  50.229  46.771  1.00 19.74  ? 145  ARG A CA    1 
ATOM   1040  C  C     . ARG A  1  145 ? 16.540  50.050  45.238  1.00 20.48  ? 145  ARG A C     1 
ATOM   1041  O  O     . ARG A  1  145 ? 15.576  50.403  44.546  1.00 14.77  ? 145  ARG A O     1 
ATOM   1042  C  CB    . ARG A  1  145 ? 16.037  51.631  47.178  1.00 19.01  ? 145  ARG A CB    1 
ATOM   1043  C  CG    . ARG A  1  145 ? 16.766  52.784  46.550  1.00 12.81  ? 145  ARG A CG    1 
ATOM   1044  C  CD    . ARG A  1  145 ? 16.049  54.141  46.818  1.00 16.41  ? 145  ARG A CD    1 
ATOM   1045  N  NE    . ARG A  1  145 ? 16.142  54.624  48.204  1.00 22.08  ? 145  ARG A NE    1 
ATOM   1046  C  CZ    . ARG A  1  145 ? 17.048  55.485  48.665  1.00 14.62  ? 145  ARG A CZ    1 
ATOM   1047  N  NH1   . ARG A  1  145 ? 17.988  55.998  47.874  1.00 16.76  ? 145  ARG A NH1   1 
ATOM   1048  N  NH2   . ARG A  1  145 ? 17.005  55.839  49.932  1.00 16.98  ? 145  ARG A NH2   1 
ATOM   1049  N  N     . CYS A  1  146 ? 17.625  49.480  44.716  1.00 15.02  ? 146  CYS A N     1 
ATOM   1050  C  CA    . CYS A  1  146 ? 17.745  49.192  43.292  1.00 15.78  ? 146  CYS A CA    1 
ATOM   1051  C  C     . CYS A  1  146 ? 17.085  47.851  42.975  1.00 17.42  ? 146  CYS A C     1 
ATOM   1052  O  O     . CYS A  1  146 ? 17.723  46.791  43.156  1.00 15.62  ? 146  CYS A O     1 
ATOM   1053  C  CB    . CYS A  1  146 ? 19.230  49.104  42.901  1.00 15.37  ? 146  CYS A CB    1 
ATOM   1054  S  SG    . CYS A  1  146 ? 19.460  48.735  41.156  1.00 23.46  ? 146  CYS A SG    1 
ATOM   1055  N  N     . CYS A  1  147 ? 15.836  47.873  42.501  1.00 16.82  ? 147  CYS A N     1 
ATOM   1056  C  CA    . CYS A  1  147 ? 15.113  46.628  42.152  1.00 18.39  ? 147  CYS A CA    1 
ATOM   1057  C  C     . CYS A  1  147 ? 15.684  46.002  40.894  1.00 18.13  ? 147  CYS A C     1 
ATOM   1058  O  O     . CYS A  1  147 ? 15.953  46.697  39.897  1.00 19.47  ? 147  CYS A O     1 
ATOM   1059  C  CB    . CYS A  1  147 ? 13.618  46.913  41.924  1.00 19.97  ? 147  CYS A CB    1 
ATOM   1060  S  SG    . CYS A  1  147 ? 12.902  47.976  43.143  1.00 23.17  ? 147  CYS A SG    1 
ATOM   1061  N  N     . CYS A  1  148 ? 15.805  44.687  40.870  1.00 19.51  ? 148  CYS A N     1 
ATOM   1062  C  CA    . CYS A  1  148 ? 16.417  44.107  39.698  1.00 16.57  ? 148  CYS A CA    1 
ATOM   1063  C  C     . CYS A  1  148 ? 15.967  42.729  39.298  1.00 17.16  ? 148  CYS A C     1 
ATOM   1064  O  O     . CYS A  1  148 ? 15.318  42.012  40.064  1.00 16.50  ? 148  CYS A O     1 
ATOM   1065  C  CB    . CYS A  1  148 ? 17.938  44.077  39.926  1.00 22.17  ? 148  CYS A CB    1 
ATOM   1066  S  SG    . CYS A  1  148 ? 18.428  43.181  41.460  1.00 26.15  ? 148  CYS A SG    1 
ATOM   1067  N  N     . VAL A  1  149 ? 16.326  42.367  38.069  1.00 14.20  ? 149  VAL A N     1 
ATOM   1068  C  CA    . VAL A  1  149 ? 16.095  41.020  37.528  1.00 15.06  ? 149  VAL A CA    1 
ATOM   1069  C  C     . VAL A  1  149 ? 17.541  40.552  37.327  1.00 19.03  ? 149  VAL A C     1 
ATOM   1070  O  O     . VAL A  1  149 ? 18.096  40.679  36.217  1.00 16.56  ? 149  VAL A O     1 
ATOM   1071  C  CB    . VAL A  1  149 ? 15.455  41.018  36.125  1.00 12.97  ? 149  VAL A CB    1 
ATOM   1072  C  CG1   . VAL A  1  149 ? 15.378  39.580  35.647  1.00 7.71   ? 149  VAL A CG1   1 
ATOM   1073  C  CG2   . VAL A  1  149 ? 14.036  41.703  36.149  1.00 11.88  ? 149  VAL A CG2   1 
ATOM   1074  N  N     . ALA A  1  150 ? 18.142  40.042  38.398  1.00 18.37  ? 150  ALA A N     1 
ATOM   1075  C  CA    . ALA A  1  150 ? 19.556  39.628  38.384  1.00 22.57  ? 150  ALA A CA    1 
ATOM   1076  C  C     . ALA A  1  150 ? 20.294  40.818  37.785  1.00 20.68  ? 150  ALA A C     1 
ATOM   1077  O  O     . ALA A  1  150 ? 20.140  41.924  38.297  1.00 21.76  ? 150  ALA A O     1 
ATOM   1078  C  CB    . ALA A  1  150 ? 19.754  38.333  37.536  1.00 19.36  ? 150  ALA A CB    1 
ATOM   1079  N  N     . ASP A  1  151 ? 21.103  40.612  36.745  1.00 20.51  ? 151  ASP A N     1 
ATOM   1080  C  CA    . ASP A  1  151 ? 21.791  41.734  36.089  1.00 20.75  ? 151  ASP A CA    1 
ATOM   1081  C  C     . ASP A  1  151 ? 21.336  41.929  34.624  1.00 22.07  ? 151  ASP A C     1 
ATOM   1082  O  O     . ASP A  1  151 ? 22.101  42.346  33.761  1.00 18.13  ? 151  ASP A O     1 
ATOM   1083  C  CB    . ASP A  1  151 ? 23.305  41.573  36.152  1.00 23.38  ? 151  ASP A CB    1 
ATOM   1084  C  CG    . ASP A  1  151 ? 23.786  40.242  35.609  1.00 27.95  ? 151  ASP A CG    1 
ATOM   1085  O  OD1   . ASP A  1  151 ? 22.952  39.304  35.477  1.00 29.87  ? 151  ASP A OD1   1 
ATOM   1086  O  OD2   . ASP A  1  151 ? 25.017  40.143  35.335  1.00 26.56  ? 151  ASP A OD2   1 
ATOM   1087  N  N     . ARG A  1  152 ? 20.064  41.635  34.370  1.00 19.45  ? 152  ARG A N     1 
ATOM   1088  C  CA    . ARG A  1  152 ? 19.456  41.811  33.050  1.00 20.36  ? 152  ARG A CA    1 
ATOM   1089  C  C     . ARG A  1  152 ? 18.136  42.572  33.236  1.00 17.54  ? 152  ARG A C     1 
ATOM   1090  O  O     . ARG A  1  152 ? 17.145  42.233  32.602  1.00 15.86  ? 152  ARG A O     1 
ATOM   1091  C  CB    . ARG A  1  152 ? 19.068  40.468  32.440  1.00 22.91  ? 152  ARG A CB    1 
ATOM   1092  C  CG    . ARG A  1  152 ? 20.005  39.358  32.653  1.00 27.62  ? 152  ARG A CG    1 
ATOM   1093  C  CD    . ARG A  1  152 ? 19.519  38.161  31.887  1.00 21.67  ? 152  ARG A CD    1 
ATOM   1094  N  NE    . ARG A  1  152 ? 20.638  37.277  31.645  1.00 27.96  ? 152  ARG A NE    1 
ATOM   1095  C  CZ    . ARG A  1  152 ? 20.966  36.251  32.422  1.00 29.92  ? 152  ARG A CZ    1 
ATOM   1096  N  NH1   . ARG A  1  152 ? 20.233  35.984  33.503  1.00 25.51  ? 152  ARG A NH1   1 
ATOM   1097  N  NH2   . ARG A  1  152 ? 22.037  35.515  32.112  1.00 26.86  ? 152  ARG A NH2   1 
ATOM   1098  N  N     . THR A  1  153 ? 18.108  43.562  34.121  1.00 14.99  ? 153  THR A N     1 
ATOM   1099  C  CA    . THR A  1  153 ? 16.897  44.304  34.377  1.00 14.05  ? 153  THR A CA    1 
ATOM   1100  C  C     . THR A  1  153 ? 16.337  45.015  33.126  1.00 16.77  ? 153  THR A C     1 
ATOM   1101  O  O     . THR A  1  153 ? 15.120  45.020  32.897  1.00 16.40  ? 153  THR A O     1 
ATOM   1102  C  CB    . THR A  1  153 ? 17.139  45.310  35.491  1.00 14.26  ? 153  THR A CB    1 
ATOM   1103  O  OG1   . THR A  1  153 ? 17.704  44.621  36.622  1.00 18.55  ? 153  THR A OG1   1 
ATOM   1104  C  CG2   . THR A  1  153 ? 15.801  45.953  35.951  1.00 13.60  ? 153  THR A CG2   1 
ATOM   1105  N  N     . GLY A  1  154 ? 17.222  45.590  32.316  1.00 12.64  ? 154  GLY A N     1 
ATOM   1106  C  CA    . GLY A  1  154 ? 16.802  46.296  31.121  1.00 14.03  ? 154  GLY A CA    1 
ATOM   1107  C  C     . GLY A  1  154 ? 16.130  45.343  30.174  1.00 16.13  ? 154  GLY A C     1 
ATOM   1108  O  O     . GLY A  1  154 ? 15.020  45.606  29.668  1.00 18.05  ? 154  GLY A O     1 
ATOM   1109  N  N     . HIS A  1  155 ? 16.795  44.227  29.915  1.00 16.23  ? 155  HIS A N     1 
ATOM   1110  C  CA    . HIS A  1  155 ? 16.227  43.200  29.049  1.00 14.45  ? 155  HIS A CA    1 
ATOM   1111  C  C     . HIS A  1  155 ? 14.820  42.831  29.533  1.00 16.84  ? 155  HIS A C     1 
ATOM   1112  O  O     . HIS A  1  155 ? 13.888  42.743  28.737  1.00 14.82  ? 155  HIS A O     1 
ATOM   1113  C  CB    . HIS A  1  155 ? 17.124  41.950  29.070  1.00 17.06  ? 155  HIS A CB    1 
ATOM   1114  C  CG    . HIS A  1  155 ? 16.522  40.732  28.424  1.00 11.71  ? 155  HIS A CG    1 
ATOM   1115  N  ND1   . HIS A  1  155 ? 15.821  39.781  29.144  1.00 17.67  ? 155  HIS A ND1   1 
ATOM   1116  C  CD2   . HIS A  1  155 ? 16.570  40.275  27.145  1.00 13.06  ? 155  HIS A CD2   1 
ATOM   1117  C  CE1   . HIS A  1  155 ? 15.467  38.793  28.341  1.00 14.35  ? 155  HIS A CE1   1 
ATOM   1118  N  NE2   . HIS A  1  155 ? 15.908  39.066  27.120  1.00 18.57  ? 155  HIS A NE2   1 
ATOM   1119  N  N     . SER A  1  156 ? 14.640  42.609  30.839  1.00 14.11  ? 156  SER A N     1 
ATOM   1120  C  CA    . SER A  1  156 ? 13.304  42.229  31.293  1.00 14.00  ? 156  SER A CA    1 
ATOM   1121  C  C     . SER A  1  156 ? 12.302  43.364  31.249  1.00 16.93  ? 156  SER A C     1 
ATOM   1122  O  O     . SER A  1  156 ? 11.131  43.150  30.926  1.00 15.15  ? 156  SER A O     1 
ATOM   1123  C  CB    . SER A  1  156 ? 13.332  41.631  32.695  1.00 17.99  ? 156  SER A CB    1 
ATOM   1124  O  OG    . SER A  1  156 ? 13.768  40.292  32.592  1.00 19.52  ? 156  SER A OG    1 
ATOM   1125  N  N     . LEU A  1  157 ? 12.752  44.572  31.582  1.00 15.14  ? 157  LEU A N     1 
ATOM   1126  C  CA    . LEU A  1  157 ? 11.859  45.721  31.540  1.00 13.05  ? 157  LEU A CA    1 
ATOM   1127  C  C     . LEU A  1  157 ? 11.349  45.921  30.104  1.00 11.27  ? 157  LEU A C     1 
ATOM   1128  O  O     . LEU A  1  157 ? 10.137  46.026  29.877  1.00 12.58  ? 157  LEU A O     1 
ATOM   1129  C  CB    . LEU A  1  157 ? 12.599  46.982  32.019  1.00 19.33  ? 157  LEU A CB    1 
ATOM   1130  C  CG    . LEU A  1  157 ? 11.789  48.297  32.082  1.00 23.73  ? 157  LEU A CG    1 
ATOM   1131  C  CD1   . LEU A  1  157 ? 12.249  49.131  33.276  1.00 22.74  ? 157  LEU A CD1   1 
ATOM   1132  C  CD2   . LEU A  1  157 ? 11.993  49.086  30.806  1.00 18.51  ? 157  LEU A CD2   1 
ATOM   1133  N  N     . LEU A  1  158 ? 12.250  45.917  29.128  1.00 9.38   ? 158  LEU A N     1 
ATOM   1134  C  CA    . LEU A  1  158 ? 11.836  46.122  27.741  1.00 11.94  ? 158  LEU A CA    1 
ATOM   1135  C  C     . LEU A  1  158 ? 10.958  45.010  27.192  1.00 16.34  ? 158  LEU A C     1 
ATOM   1136  O  O     . LEU A  1  158 ? 9.982   45.278  26.549  1.00 15.08  ? 158  LEU A O     1 
ATOM   1137  C  CB    . LEU A  1  158 ? 13.042  46.304  26.824  1.00 11.96  ? 158  LEU A CB    1 
ATOM   1138  C  CG    . LEU A  1  158 ? 12.779  46.904  25.434  1.00 15.93  ? 158  LEU A CG    1 
ATOM   1139  C  CD1   . LEU A  1  158 ? 12.141  48.318  25.511  1.00 8.67   ? 158  LEU A CD1   1 
ATOM   1140  C  CD2   . LEU A  1  158 ? 14.131  46.978  24.718  1.00 16.79  ? 158  LEU A CD2   1 
ATOM   1141  N  N     . HIS A  1  159 ? 11.313  43.752  27.417  1.00 18.35  ? 159  HIS A N     1 
ATOM   1142  C  CA    . HIS A  1  159 ? 10.498  42.684  26.912  1.00 13.19  ? 159  HIS A CA    1 
ATOM   1143  C  C     . HIS A  1  159 ? 9.124   42.680  27.600  1.00 16.99  ? 159  HIS A C     1 
ATOM   1144  O  O     . HIS A  1  159 ? 8.112   42.358  26.987  1.00 17.51  ? 159  HIS A O     1 
ATOM   1145  C  CB    . HIS A  1  159 ? 11.215  41.352  27.091  1.00 16.09  ? 159  HIS A CB    1 
ATOM   1146  C  CG    . HIS A  1  159 ? 12.238  41.081  26.033  1.00 20.64  ? 159  HIS A CG    1 
ATOM   1147  N  ND1   . HIS A  1  159 ? 11.898  40.658  24.771  1.00 18.81  ? 159  HIS A ND1   1 
ATOM   1148  C  CD2   . HIS A  1  159 ? 13.585  41.255  26.023  1.00 16.92  ? 159  HIS A CD2   1 
ATOM   1149  C  CE1   . HIS A  1  159 ? 12.985  40.587  24.022  1.00 23.83  ? 159  HIS A CE1   1 
ATOM   1150  N  NE2   . HIS A  1  159 ? 14.021  40.947  24.757  1.00 13.23  ? 159  HIS A NE2   1 
ATOM   1151  N  N     . THR A  1  160 ? 9.076   43.086  28.856  1.00 13.07  ? 160  THR A N     1 
ATOM   1152  C  CA    . THR A  1  160 ? 7.807   43.127  29.551  1.00 15.57  ? 160  THR A CA    1 
ATOM   1153  C  C     . THR A  1  160 ? 6.900   44.232  28.982  1.00 20.39  ? 160  THR A C     1 
ATOM   1154  O  O     . THR A  1  160 ? 5.697   44.032  28.774  1.00 19.77  ? 160  THR A O     1 
ATOM   1155  C  CB    . THR A  1  160 ? 8.049   43.372  31.077  1.00 19.85  ? 160  THR A CB    1 
ATOM   1156  O  OG1   . THR A  1  160 ? 8.818   42.276  31.603  1.00 17.16  ? 160  THR A OG1   1 
ATOM   1157  C  CG2   . THR A  1  160 ? 6.709   43.488  31.846  1.00 17.35  ? 160  THR A CG2   1 
ATOM   1158  N  N     . LEU A  1  161 ? 7.482   45.412  28.774  1.00 15.76  ? 161  LEU A N     1 
ATOM   1159  C  CA    . LEU A  1  161 ? 6.749   46.552  28.241  1.00 18.30  ? 161  LEU A CA    1 
ATOM   1160  C  C     . LEU A  1  161 ? 6.321   46.257  26.801  1.00 16.94  ? 161  LEU A C     1 
ATOM   1161  O  O     . LEU A  1  161 ? 5.235   46.627  26.404  1.00 15.26  ? 161  LEU A O     1 
ATOM   1162  C  CB    . LEU A  1  161 ? 7.610   47.855  28.262  1.00 11.11  ? 161  LEU A CB    1 
ATOM   1163  C  CG    . LEU A  1  161 ? 7.822   48.601  29.591  1.00 16.63  ? 161  LEU A CG    1 
ATOM   1164  C  CD1   . LEU A  1  161 ? 8.642   49.847  29.275  1.00 12.91  ? 161  LEU A CD1   1 
ATOM   1165  C  CD2   . LEU A  1  161 ? 6.486   49.023  30.228  1.00 13.10  ? 161  LEU A CD2   1 
ATOM   1166  N  N     . TYR A  1  162 ? 7.175   45.600  26.027  1.00 12.20  ? 162  TYR A N     1 
ATOM   1167  C  CA    . TYR A  1  162 ? 6.795   45.284  24.635  1.00 16.11  ? 162  TYR A CA    1 
ATOM   1168  C  C     . TYR A  1  162 ? 5.603   44.310  24.608  1.00 17.35  ? 162  TYR A C     1 
ATOM   1169  O  O     . TYR A  1  162 ? 4.674   44.464  23.804  1.00 20.12  ? 162  TYR A O     1 
ATOM   1170  C  CB    . TYR A  1  162 ? 7.964   44.673  23.895  1.00 8.14   ? 162  TYR A CB    1 
ATOM   1171  C  CG    . TYR A  1  162 ? 7.604   44.239  22.489  1.00 18.72  ? 162  TYR A CG    1 
ATOM   1172  C  CD1   . TYR A  1  162 ? 7.265   45.181  21.533  1.00 17.04  ? 162  TYR A CD1   1 
ATOM   1173  C  CD2   . TYR A  1  162 ? 7.521   42.893  22.147  1.00 16.49  ? 162  TYR A CD2   1 
ATOM   1174  C  CE1   . TYR A  1  162 ? 6.836   44.803  20.260  1.00 24.73  ? 162  TYR A CE1   1 
ATOM   1175  C  CE2   . TYR A  1  162 ? 7.096   42.498  20.864  1.00 22.69  ? 162  TYR A CE2   1 
ATOM   1176  C  CZ    . TYR A  1  162 ? 6.748   43.461  19.930  1.00 23.82  ? 162  TYR A CZ    1 
ATOM   1177  O  OH    . TYR A  1  162 ? 6.227   43.124  18.692  1.00 23.21  ? 162  TYR A OH    1 
ATOM   1178  N  N     . GLY A  1  163 ? 5.631   43.296  25.477  1.00 17.29  ? 163  GLY A N     1 
ATOM   1179  C  CA    . GLY A  1  163 ? 4.517   42.359  25.543  1.00 12.89  ? 163  GLY A CA    1 
ATOM   1180  C  C     . GLY A  1  163 ? 3.242   43.084  25.955  1.00 15.57  ? 163  GLY A C     1 
ATOM   1181  O  O     . GLY A  1  163 ? 2.191   42.852  25.397  1.00 18.42  ? 163  GLY A O     1 
ATOM   1182  N  N     . ARG A  1  164 ? 3.327   43.989  26.926  1.00 15.99  ? 164  ARG A N     1 
ATOM   1183  C  CA    . ARG A  1  164 ? 2.177   44.735  27.358  1.00 16.64  ? 164  ARG A CA    1 
ATOM   1184  C  C     . ARG A  1  164 ? 1.569   45.583  26.202  1.00 23.53  ? 164  ARG A C     1 
ATOM   1185  O  O     . ARG A  1  164 ? 0.347   45.609  26.002  1.00 23.46  ? 164  ARG A O     1 
ATOM   1186  C  CB    . ARG A  1  164 ? 2.566   45.638  28.521  1.00 20.64  ? 164  ARG A CB    1 
ATOM   1187  C  CG    . ARG A  1  164 ? 1.397   46.375  29.165  1.00 22.68  ? 164  ARG A CG    1 
ATOM   1188  C  CD    . ARG A  1  164 ? 0.459   45.450  29.916  1.00 28.71  ? 164  ARG A CD    1 
ATOM   1189  N  NE    . ARG A  1  164 ? -0.660  46.232  30.431  1.00 31.18  ? 164  ARG A NE    1 
ATOM   1190  C  CZ    . ARG A  1  164 ? -1.492  45.835  31.389  1.00 37.66  ? 164  ARG A CZ    1 
ATOM   1191  N  NH1   . ARG A  1  164 ? -1.367  44.639  31.961  1.00 34.53  ? 164  ARG A NH1   1 
ATOM   1192  N  NH2   . ARG A  1  164 ? -2.425  46.675  31.818  1.00 41.73  ? 164  ARG A NH2   1 
ATOM   1193  N  N     . SER A  1  165 ? 2.430   46.260  25.447  1.00 17.61  ? 165  SER A N     1 
ATOM   1194  C  CA    . SER A  1  165 ? 1.996   47.107  24.338  1.00 19.31  ? 165  SER A CA    1 
ATOM   1195  C  C     . SER A  1  165 ? 1.186   46.278  23.324  1.00 17.05  ? 165  SER A C     1 
ATOM   1196  O  O     . SER A  1  165 ? 0.349   46.802  22.598  1.00 19.04  ? 165  SER A O     1 
ATOM   1197  C  CB    . SER A  1  165 ? 3.229   47.696  23.659  1.00 16.58  ? 165  SER A CB    1 
ATOM   1198  O  OG    . SER A  1  165 ? 3.807   46.692  22.849  1.00 17.51  ? 165  SER A OG    1 
ATOM   1199  N  N     . LEU A  1  166 ? 1.422   44.973  23.302  1.00 17.92  ? 166  LEU A N     1 
ATOM   1200  C  CA    . LEU A  1  166 ? 0.707   44.113  22.388  1.00 22.60  ? 166  LEU A CA    1 
ATOM   1201  C  C     . LEU A  1  166 ? -0.786  44.021  22.739  1.00 25.87  ? 166  LEU A C     1 
ATOM   1202  O  O     . LEU A  1  166 ? -1.560  43.490  21.956  1.00 27.79  ? 166  LEU A O     1 
ATOM   1203  C  CB    . LEU A  1  166 ? 1.307   42.720  22.390  1.00 20.97  ? 166  LEU A CB    1 
ATOM   1204  C  CG    . LEU A  1  166 ? 2.734   42.626  21.842  1.00 27.21  ? 166  LEU A CG    1 
ATOM   1205  C  CD1   . LEU A  1  166 ? 3.189   41.142  21.903  1.00 25.97  ? 166  LEU A CD1   1 
ATOM   1206  C  CD2   . LEU A  1  166 ? 2.802   43.173  20.439  1.00 14.79  ? 166  LEU A CD2   1 
ATOM   1207  N  N     . ARG A  1  167 ? -1.185  44.538  23.896  1.00 28.19  ? 167  ARG A N     1 
ATOM   1208  C  CA    . ARG A  1  167 ? -2.584  44.480  24.324  1.00 27.55  ? 167  ARG A CA    1 
ATOM   1209  C  C     . ARG A  1  167 ? -3.422  45.681  23.869  1.00 26.39  ? 167  ARG A C     1 
ATOM   1210  O  O     . ARG A  1  167 ? -4.643  45.710  24.061  1.00 29.70  ? 167  ARG A O     1 
ATOM   1211  C  CB    . ARG A  1  167 ? -2.668  44.404  25.853  1.00 26.67  ? 167  ARG A CB    1 
ATOM   1212  C  CG    . ARG A  1  167 ? -1.874  43.277  26.485  1.00 32.77  ? 167  ARG A CG    1 
ATOM   1213  C  CD    . ARG A  1  167 ? -2.171  43.124  27.971  1.00 30.12  ? 167  ARG A CD    1 
ATOM   1214  N  NE    . ARG A  1  167 ? -3.460  42.482  28.215  1.00 33.03  ? 167  ARG A NE    1 
ATOM   1215  C  CZ    . ARG A  1  167 ? -3.781  41.869  29.356  1.00 39.26  ? 167  ARG A CZ    1 
ATOM   1216  N  NH1   . ARG A  1  167 ? -2.895  41.830  30.347  1.00 40.70  ? 167  ARG A NH1   1 
ATOM   1217  N  NH2   . ARG A  1  167 ? -4.966  41.271  29.511  1.00 33.68  ? 167  ARG A NH2   1 
ATOM   1218  N  N     . TYR A  1  168 ? -2.774  46.674  23.293  1.00 24.80  ? 168  TYR A N     1 
ATOM   1219  C  CA    . TYR A  1  168 ? -3.450  47.884  22.857  1.00 24.07  ? 168  TYR A CA    1 
ATOM   1220  C  C     . TYR A  1  168 ? -3.433  48.038  21.345  1.00 25.77  ? 168  TYR A C     1 
ATOM   1221  O  O     . TYR A  1  168 ? -2.711  47.329  20.670  1.00 23.56  ? 168  TYR A O     1 
ATOM   1222  C  CB    . TYR A  1  168 ? -2.792  49.091  23.500  1.00 23.58  ? 168  TYR A CB    1 
ATOM   1223  C  CG    . TYR A  1  168 ? -2.790  49.021  25.014  1.00 32.00  ? 168  TYR A CG    1 
ATOM   1224  C  CD1   . TYR A  1  168 ? -1.736  48.398  25.712  1.00 27.38  ? 168  TYR A CD1   1 
ATOM   1225  C  CD2   . TYR A  1  168 ? -3.880  49.528  25.756  1.00 31.57  ? 168  TYR A CD2   1 
ATOM   1226  C  CE1   . TYR A  1  168 ? -1.781  48.286  27.131  1.00 37.37  ? 168  TYR A CE1   1 
ATOM   1227  C  CE2   . TYR A  1  168 ? -3.928  49.411  27.149  1.00 36.51  ? 168  TYR A CE2   1 
ATOM   1228  C  CZ    . TYR A  1  168 ? -2.879  48.793  27.831  1.00 37.98  ? 168  TYR A CZ    1 
ATOM   1229  O  OH    . TYR A  1  168 ? -2.942  48.699  29.206  1.00 43.45  ? 168  TYR A OH    1 
ATOM   1230  N  N     . ASP A  1  169 ? -4.223  48.971  20.820  1.00 26.78  ? 169  ASP A N     1 
ATOM   1231  C  CA    . ASP A  1  169 ? -4.280  49.170  19.383  1.00 34.07  ? 169  ASP A CA    1 
ATOM   1232  C  C     . ASP A  1  169 ? -3.285  50.210  18.867  1.00 32.38  ? 169  ASP A C     1 
ATOM   1233  O  O     . ASP A  1  169 ? -3.494  50.823  17.832  1.00 33.53  ? 169  ASP A O     1 
ATOM   1234  C  CB    . ASP A  1  169 ? -5.700  49.553  18.951  1.00 41.77  ? 169  ASP A CB    1 
ATOM   1235  C  CG    . ASP A  1  169 ? -6.108  50.935  19.430  1.00 49.76  ? 169  ASP A CG    1 
ATOM   1236  O  OD1   . ASP A  1  169 ? -5.865  51.261  20.609  1.00 56.33  ? 169  ASP A OD1   1 
ATOM   1237  O  OD2   . ASP A  1  169 ? -6.691  51.702  18.630  1.00 59.41  ? 169  ASP A OD2   1 
ATOM   1238  N  N     . THR A  1  170 ? -2.198  50.405  19.592  1.00 32.94  ? 170  THR A N     1 
ATOM   1239  C  CA    . THR A  1  170 ? -1.182  51.350  19.140  1.00 29.05  ? 170  THR A CA    1 
ATOM   1240  C  C     . THR A  1  170 ? -0.733  50.902  17.759  1.00 28.21  ? 170  THR A C     1 
ATOM   1241  O  O     . THR A  1  170 ? -0.563  49.697  17.522  1.00 25.49  ? 170  THR A O     1 
ATOM   1242  C  CB    . THR A  1  170 ? 0.022   51.320  20.062  1.00 30.64  ? 170  THR A CB    1 
ATOM   1243  O  OG1   . THR A  1  170 ? -0.428  51.413  21.418  1.00 29.68  ? 170  THR A OG1   1 
ATOM   1244  C  CG2   . THR A  1  170 ? 0.960   52.499  19.758  1.00 32.10  ? 170  THR A CG2   1 
ATOM   1245  N  N     . SER A  1  171 ? -0.569  51.846  16.828  1.00 26.96  ? 171  SER A N     1 
ATOM   1246  C  CA    . SER A  1  171 ? -0.096  51.467  15.496  1.00 21.44  ? 171  SER A CA    1 
ATOM   1247  C  C     . SER A  1  171 ? 1.436   51.624  15.452  1.00 20.30  ? 171  SER A C     1 
ATOM   1248  O  O     . SER A  1  171 ? 1.935   52.737  15.597  1.00 17.97  ? 171  SER A O     1 
ATOM   1249  C  CB    . SER A  1  171 ? -0.735  52.367  14.442  1.00 20.65  ? 171  SER A CB    1 
ATOM   1250  O  OG    . SER A  1  171 ? -2.151  52.246  14.467  1.00 27.11  ? 171  SER A OG    1 
ATOM   1251  N  N     . TYR A  1  172 ? 2.177   50.531  15.235  1.00 17.95  ? 172  TYR A N     1 
ATOM   1252  C  CA    . TYR A  1  172 ? 3.640   50.593  15.168  1.00 19.48  ? 172  TYR A CA    1 
ATOM   1253  C  C     . TYR A  1  172 ? 4.197   50.670  13.751  1.00 21.52  ? 172  TYR A C     1 
ATOM   1254  O  O     . TYR A  1  172 ? 3.783   49.931  12.881  1.00 24.64  ? 172  TYR A O     1 
ATOM   1255  C  CB    . TYR A  1  172 ? 4.292   49.383  15.882  1.00 23.37  ? 172  TYR A CB    1 
ATOM   1256  C  CG    . TYR A  1  172 ? 4.189   49.499  17.381  1.00 30.25  ? 172  TYR A CG    1 
ATOM   1257  C  CD1   . TYR A  1  172 ? 2.984   49.201  18.031  1.00 34.95  ? 172  TYR A CD1   1 
ATOM   1258  C  CD2   . TYR A  1  172 ? 5.231   50.044  18.138  1.00 30.69  ? 172  TYR A CD2   1 
ATOM   1259  C  CE1   . TYR A  1  172 ? 2.807   49.453  19.400  1.00 37.86  ? 172  TYR A CE1   1 
ATOM   1260  C  CE2   . TYR A  1  172 ? 5.066   50.310  19.522  1.00 37.08  ? 172  TYR A CE2   1 
ATOM   1261  C  CZ    . TYR A  1  172 ? 3.843   50.013  20.142  1.00 38.52  ? 172  TYR A CZ    1 
ATOM   1262  O  OH    . TYR A  1  172 ? 3.615   50.296  21.473  1.00 36.32  ? 172  TYR A OH    1 
ATOM   1263  N  N     . PHE A  1  173 ? 5.157   51.565  13.544  1.00 18.48  ? 173  PHE A N     1 
ATOM   1264  C  CA    . PHE A  1  173 ? 5.793   51.744  12.266  1.00 18.64  ? 173  PHE A CA    1 
ATOM   1265  C  C     . PHE A  1  173 ? 7.250   51.421  12.559  1.00 17.25  ? 173  PHE A C     1 
ATOM   1266  O  O     . PHE A  1  173 ? 8.053   52.295  12.921  1.00 17.85  ? 173  PHE A O     1 
ATOM   1267  C  CB    . PHE A  1  173 ? 5.589   53.187  11.802  1.00 14.81  ? 173  PHE A CB    1 
ATOM   1268  C  CG    . PHE A  1  173 ? 4.172   53.499  11.477  1.00 14.96  ? 173  PHE A CG    1 
ATOM   1269  C  CD1   . PHE A  1  173 ? 3.268   53.825  12.487  1.00 15.24  ? 173  PHE A CD1   1 
ATOM   1270  C  CD2   . PHE A  1  173 ? 3.692   53.315  10.156  1.00 14.00  ? 173  PHE A CD2   1 
ATOM   1271  C  CE1   . PHE A  1  173 ? 1.873   53.950  12.220  1.00 17.95  ? 173  PHE A CE1   1 
ATOM   1272  C  CE2   . PHE A  1  173 ? 2.344   53.428  9.863   1.00 16.02  ? 173  PHE A CE2   1 
ATOM   1273  C  CZ    . PHE A  1  173 ? 1.406   53.746  10.893  1.00 15.71  ? 173  PHE A CZ    1 
ATOM   1274  N  N     . VAL A  1  174 ? 7.571   50.148  12.391  1.00 17.36  ? 174  VAL A N     1 
ATOM   1275  C  CA    . VAL A  1  174 ? 8.880   49.584  12.720  1.00 14.91  ? 174  VAL A CA    1 
ATOM   1276  C  C     . VAL A  1  174 ? 9.867   49.714  11.616  1.00 18.16  ? 174  VAL A C     1 
ATOM   1277  O  O     . VAL A  1  174 ? 9.582   49.430  10.466  1.00 17.87  ? 174  VAL A O     1 
ATOM   1278  C  CB    . VAL A  1  174 ? 8.727   48.084  13.162  1.00 18.14  ? 174  VAL A CB    1 
ATOM   1279  C  CG1   . VAL A  1  174 ? 10.094  47.430  13.421  1.00 17.97  ? 174  VAL A CG1   1 
ATOM   1280  C  CG2   . VAL A  1  174 ? 7.895   48.026  14.438  1.00 18.49  ? 174  VAL A CG2   1 
ATOM   1281  N  N     . GLU A  1  175 ? 11.064  50.154  11.980  1.00 22.05  ? 175  GLU A N     1 
ATOM   1282  C  CA    . GLU A  1  175 ? 12.108  50.381  11.019  1.00 18.06  ? 175  GLU A CA    1 
ATOM   1283  C  C     . GLU A  1  175 ? 11.723  51.547  10.097  1.00 19.64  ? 175  GLU A C     1 
ATOM   1284  O  O     . GLU A  1  175 ? 11.753  51.470  8.864   1.00 17.78  ? 175  GLU A O     1 
ATOM   1285  C  CB    . GLU A  1  175 ? 12.469  49.064  10.312  1.00 22.44  ? 175  GLU A CB    1 
ATOM   1286  C  CG    . GLU A  1  175 ? 13.157  48.131  11.375  1.00 29.68  ? 175  GLU A CG    1 
ATOM   1287  C  CD    . GLU A  1  175 ? 13.789  46.824  10.860  1.00 35.19  ? 175  GLU A CD    1 
ATOM   1288  O  OE1   . GLU A  1  175 ? 13.165  46.141  10.011  1.00 36.97  ? 175  GLU A OE1   1 
ATOM   1289  O  OE2   . GLU A  1  175 ? 14.906  46.464  11.343  1.00 33.49  ? 175  GLU A OE2   1 
ATOM   1290  N  N     . TYR A  1  176 ? 11.331  52.642  10.758  1.00 17.91  ? 176  TYR A N     1 
ATOM   1291  C  CA    . TYR A  1  176 ? 11.022  53.926  10.096  1.00 17.45  ? 176  TYR A CA    1 
ATOM   1292  C  C     . TYR A  1  176 ? 11.972  54.911  10.791  1.00 18.73  ? 176  TYR A C     1 
ATOM   1293  O  O     . TYR A  1  176 ? 12.025  54.956  12.020  1.00 16.91  ? 176  TYR A O     1 
ATOM   1294  C  CB    . TYR A  1  176 ? 9.577   54.392  10.346  1.00 14.35  ? 176  TYR A CB    1 
ATOM   1295  C  CG    . TYR A  1  176 ? 8.549   53.789  9.425   1.00 13.63  ? 176  TYR A CG    1 
ATOM   1296  C  CD1   . TYR A  1  176 ? 8.373   52.404  9.361   1.00 13.30  ? 176  TYR A CD1   1 
ATOM   1297  C  CD2   . TYR A  1  176 ? 7.716   54.602  8.652   1.00 16.59  ? 176  TYR A CD2   1 
ATOM   1298  C  CE1   . TYR A  1  176 ? 7.403   51.836  8.559   1.00 17.55  ? 176  TYR A CE1   1 
ATOM   1299  C  CE2   . TYR A  1  176 ? 6.707   54.042  7.825   1.00 10.52  ? 176  TYR A CE2   1 
ATOM   1300  C  CZ    . TYR A  1  176 ? 6.562   52.667  7.790   1.00 21.24  ? 176  TYR A CZ    1 
ATOM   1301  O  OH    . TYR A  1  176 ? 5.568   52.100  7.027   1.00 23.78  ? 176  TYR A OH    1 
ATOM   1302  N  N     . PHE A  1  177 ? 12.701  55.699  10.006  1.00 17.95  ? 177  PHE A N     1 
ATOM   1303  C  CA    . PHE A  1  177 ? 13.660  56.650  10.531  1.00 16.26  ? 177  PHE A CA    1 
ATOM   1304  C  C     . PHE A  1  177 ? 13.103  58.081  10.540  1.00 19.06  ? 177  PHE A C     1 
ATOM   1305  O  O     . PHE A  1  177 ? 12.851  58.659  9.485   1.00 13.49  ? 177  PHE A O     1 
ATOM   1306  C  CB    . PHE A  1  177 ? 14.913  56.570  9.677   1.00 16.29  ? 177  PHE A CB    1 
ATOM   1307  C  CG    . PHE A  1  177 ? 16.089  57.301  10.234  1.00 13.14  ? 177  PHE A CG    1 
ATOM   1308  C  CD1   . PHE A  1  177 ? 17.063  56.632  10.943  1.00 17.66  ? 177  PHE A CD1   1 
ATOM   1309  C  CD2   . PHE A  1  177 ? 16.245  58.667  10.017  1.00 19.65  ? 177  PHE A CD2   1 
ATOM   1310  C  CE1   . PHE A  1  177 ? 18.185  57.305  11.435  1.00 20.45  ? 177  PHE A CE1   1 
ATOM   1311  C  CE2   . PHE A  1  177 ? 17.359  59.351  10.503  1.00 18.82  ? 177  PHE A CE2   1 
ATOM   1312  C  CZ    . PHE A  1  177 ? 18.334  58.667  11.217  1.00 17.98  ? 177  PHE A CZ    1 
ATOM   1313  N  N     . ALA A  1  178 ? 12.894  58.654  11.728  1.00 19.16  ? 178  ALA A N     1 
ATOM   1314  C  CA    . ALA A  1  178 ? 12.366  60.017  11.804  1.00 20.97  ? 178  ALA A CA    1 
ATOM   1315  C  C     . ALA A  1  178 ? 13.428  61.021  11.366  1.00 21.86  ? 178  ALA A C     1 
ATOM   1316  O  O     . ALA A  1  178 ? 14.569  60.960  11.817  1.00 20.52  ? 178  ALA A O     1 
ATOM   1317  C  CB    . ALA A  1  178 ? 11.890  60.342  13.204  1.00 25.09  ? 178  ALA A CB    1 
ATOM   1318  N  N     . LEU A  1  179 ? 13.039  61.944  10.486  1.00 23.68  ? 179  LEU A N     1 
ATOM   1319  C  CA    . LEU A  1  179 ? 13.956  62.953  9.932   1.00 24.67  ? 179  LEU A CA    1 
ATOM   1320  C  C     . LEU A  1  179 ? 13.844  64.360  10.515  1.00 23.77  ? 179  LEU A C     1 
ATOM   1321  O  O     . LEU A  1  179 ? 14.852  65.054  10.680  1.00 21.37  ? 179  LEU A O     1 
ATOM   1322  C  CB    . LEU A  1  179 ? 13.756  63.035  8.399   1.00 23.61  ? 179  LEU A CB    1 
ATOM   1323  C  CG    . LEU A  1  179 ? 13.821  61.684  7.641   1.00 20.90  ? 179  LEU A CG    1 
ATOM   1324  C  CD1   . LEU A  1  179 ? 13.044  61.789  6.310   1.00 20.93  ? 179  LEU A CD1   1 
ATOM   1325  C  CD2   . LEU A  1  179 ? 15.268  61.301  7.398   1.00 18.49  ? 179  LEU A CD2   1 
ATOM   1326  N  N     . ASP A  1  180 ? 12.624  64.799  10.805  1.00 20.33  ? 180  ASP A N     1 
ATOM   1327  C  CA    . ASP A  1  180 ? 12.410  66.136  11.330  1.00 19.94  ? 180  ASP A CA    1 
ATOM   1328  C  C     . ASP A  1  180 ? 11.006  66.288  11.870  1.00 19.99  ? 180  ASP A C     1 
ATOM   1329  O  O     . ASP A  1  180 ? 10.113  65.474  11.572  1.00 23.30  ? 180  ASP A O     1 
ATOM   1330  C  CB    . ASP A  1  180 ? 12.608  67.206  10.219  1.00 20.47  ? 180  ASP A CB    1 
ATOM   1331  C  CG    . ASP A  1  180 ? 14.091  67.583  9.985   1.00 25.35  ? 180  ASP A CG    1 
ATOM   1332  O  OD1   . ASP A  1  180 ? 14.787  67.965  10.959  1.00 18.36  ? 180  ASP A OD1   1 
ATOM   1333  O  OD2   . ASP A  1  180 ? 14.564  67.499  8.824   1.00 26.74  ? 180  ASP A OD2   1 
ATOM   1334  N  N     . LEU A  1  181 ? 10.821  67.344  12.663  1.00 20.64  ? 181  LEU A N     1 
ATOM   1335  C  CA    . LEU A  1  181 ? 9.524   67.709  13.220  1.00 21.64  ? 181  LEU A CA    1 
ATOM   1336  C  C     . LEU A  1  181 ? 8.831   68.569  12.147  1.00 21.73  ? 181  LEU A C     1 
ATOM   1337  O  O     . LEU A  1  181 ? 9.509   69.241  11.382  1.00 21.56  ? 181  LEU A O     1 
ATOM   1338  C  CB    . LEU A  1  181 ? 9.698   68.596  14.461  1.00 21.95  ? 181  LEU A CB    1 
ATOM   1339  C  CG    . LEU A  1  181 ? 10.445  68.018  15.662  1.00 23.95  ? 181  LEU A CG    1 
ATOM   1340  C  CD1   . LEU A  1  181 ? 10.461  69.047  16.789  1.00 21.00  ? 181  LEU A CD1   1 
ATOM   1341  C  CD2   . LEU A  1  181 ? 9.781   66.709  16.121  1.00 21.73  ? 181  LEU A CD2   1 
ATOM   1342  N  N     . LEU A  1  182 ? 7.505   68.531  12.107  1.00 23.69  ? 182  LEU A N     1 
ATOM   1343  C  CA    . LEU A  1  182 ? 6.697   69.358  11.201  1.00 27.84  ? 182  LEU A CA    1 
ATOM   1344  C  C     . LEU A  1  182 ? 6.244   70.521  12.085  1.00 29.64  ? 182  LEU A C     1 
ATOM   1345  O  O     . LEU A  1  182 ? 5.271   70.411  12.833  1.00 30.91  ? 182  LEU A O     1 
ATOM   1346  C  CB    . LEU A  1  182 ? 5.470   68.581  10.702  1.00 18.17  ? 182  LEU A CB    1 
ATOM   1347  C  CG    . LEU A  1  182 ? 5.908   67.440  9.784   1.00 27.24  ? 182  LEU A CG    1 
ATOM   1348  C  CD1   . LEU A  1  182 ? 4.720   66.623  9.316   1.00 27.24  ? 182  LEU A CD1   1 
ATOM   1349  C  CD2   . LEU A  1  182 ? 6.663   68.020  8.599   1.00 27.93  ? 182  LEU A CD2   1 
ATOM   1350  N  N     . MET A  1  183 ? 6.976   71.620  12.027  1.00 32.76  ? 183  MET A N     1 
ATOM   1351  C  CA    . MET A  1  183 ? 6.667   72.795  12.848  1.00 33.11  ? 183  MET A CA    1 
ATOM   1352  C  C     . MET A  1  183 ? 5.872   73.832  12.077  1.00 35.23  ? 183  MET A C     1 
ATOM   1353  O  O     . MET A  1  183 ? 6.053   74.001  10.867  1.00 30.68  ? 183  MET A O     1 
ATOM   1354  C  CB    . MET A  1  183 ? 7.963   73.435  13.353  1.00 30.01  ? 183  MET A CB    1 
ATOM   1355  C  CG    . MET A  1  183 ? 8.825   72.504  14.186  1.00 31.33  ? 183  MET A CG    1 
ATOM   1356  S  SD    . MET A  1  183 ? 8.119   72.163  15.802  1.00 35.07  ? 183  MET A SD    1 
ATOM   1357  C  CE    . MET A  1  183 ? 8.306   73.827  16.582  1.00 24.86  ? 183  MET A CE    1 
ATOM   1358  N  N     . GLU A  1  184 ? 4.999   74.533  12.795  1.00 38.44  ? 184  GLU A N     1 
ATOM   1359  C  CA    . GLU A  1  184 ? 4.184   75.570  12.193  1.00 43.37  ? 184  GLU A CA    1 
ATOM   1360  C  C     . GLU A  1  184 ? 3.787   76.536  13.307  1.00 42.95  ? 184  GLU A C     1 
ATOM   1361  O  O     . GLU A  1  184 ? 3.157   76.130  14.281  1.00 43.62  ? 184  GLU A O     1 
ATOM   1362  C  CB    . GLU A  1  184 ? 2.947   74.930  11.568  1.00 47.71  ? 184  GLU A CB    1 
ATOM   1363  C  CG    . GLU A  1  184 ? 2.352   75.694  10.413  1.00 59.60  ? 184  GLU A CG    1 
ATOM   1364  C  CD    . GLU A  1  184 ? 3.215   75.636  9.158   1.00 64.47  ? 184  GLU A CD    1 
ATOM   1365  O  OE1   . GLU A  1  184 ? 3.513   74.510  8.675   1.00 68.49  ? 184  GLU A OE1   1 
ATOM   1366  O  OE2   . GLU A  1  184 ? 3.586   76.720  8.654   1.00 67.05  ? 184  GLU A OE2   1 
ATOM   1367  N  N     . ASN A  1  185 ? 4.174   77.802  13.173  1.00 43.12  ? 185  ASN A N     1 
ATOM   1368  C  CA    . ASN A  1  185 ? 3.848   78.835  14.162  1.00 44.00  ? 185  ASN A CA    1 
ATOM   1369  C  C     . ASN A  1  185 ? 4.457   78.542  15.517  1.00 41.37  ? 185  ASN A C     1 
ATOM   1370  O  O     . ASN A  1  185 ? 3.877   78.938  16.516  1.00 39.83  ? 185  ASN A O     1 
ATOM   1371  C  CB    . ASN A  1  185 ? 2.337   78.937  14.400  1.00 51.61  ? 185  ASN A CB    1 
ATOM   1372  C  CG    . ASN A  1  185 ? 1.532   79.097  13.127  1.00 59.23  ? 185  ASN A CG    1 
ATOM   1373  O  OD1   . ASN A  1  185 ? 0.296   78.992  13.150  1.00 63.56  ? 185  ASN A OD1   1 
ATOM   1374  N  ND2   . ASN A  1  185 ? 2.215   79.366  12.011  1.00 63.11  ? 185  ASN A ND2   1 
ATOM   1375  N  N     . GLY A  1  186 ? 5.606   77.868  15.569  1.00 39.05  ? 186  GLY A N     1 
ATOM   1376  C  CA    . GLY A  1  186 ? 6.198   77.532  16.858  1.00 36.97  ? 186  GLY A CA    1 
ATOM   1377  C  C     . GLY A  1  186 ? 5.498   76.350  17.547  1.00 33.92  ? 186  GLY A C     1 
ATOM   1378  O  O     . GLY A  1  186 ? 5.720   76.058  18.733  1.00 37.69  ? 186  GLY A O     1 
ATOM   1379  N  N     . GLU A  1  187 ? 4.629   75.679  16.806  1.00 31.01  ? 187  GLU A N     1 
ATOM   1380  C  CA    . GLU A  1  187 ? 3.903   74.527  17.311  1.00 33.18  ? 187  GLU A CA    1 
ATOM   1381  C  C     . GLU A  1  187 ? 4.343   73.296  16.556  1.00 30.21  ? 187  GLU A C     1 
ATOM   1382  O  O     . GLU A  1  187 ? 4.618   73.375  15.362  1.00 28.53  ? 187  GLU A O     1 
ATOM   1383  C  CB    . GLU A  1  187 ? 2.409   74.691  17.073  1.00 34.75  ? 187  GLU A CB    1 
ATOM   1384  C  CG    . GLU A  1  187 ? 1.817   75.986  17.610  1.00 44.82  ? 187  GLU A CG    1 
ATOM   1385  C  CD    . GLU A  1  187 ? 0.286   75.993  17.505  1.00 49.09  ? 187  GLU A CD    1 
ATOM   1386  O  OE1   . GLU A  1  187 ? -0.238  75.598  16.437  1.00 48.13  ? 187  GLU A OE1   1 
ATOM   1387  O  OE2   . GLU A  1  187 ? -0.391  76.384  18.486  1.00 50.44  ? 187  GLU A OE2   1 
ATOM   1388  N  N     . CYS A  1  188 ? 4.412   72.148  17.222  1.00 29.82  ? 188  CYS A N     1 
ATOM   1389  C  CA    . CYS A  1  188 ? 4.780   70.939  16.476  1.00 29.36  ? 188  CYS A CA    1 
ATOM   1390  C  C     . CYS A  1  188 ? 3.496   70.246  16.009  1.00 28.47  ? 188  CYS A C     1 
ATOM   1391  O  O     . CYS A  1  188 ? 2.541   70.122  16.772  1.00 26.81  ? 188  CYS A O     1 
ATOM   1392  C  CB    . CYS A  1  188 ? 5.609   69.977  17.336  1.00 33.89  ? 188  CYS A CB    1 
ATOM   1393  S  SG    . CYS A  1  188 ? 5.976   68.444  16.479  1.00 28.33  ? 188  CYS A SG    1 
ATOM   1394  N  N     . ARG A  1  189 ? 3.471   69.801  14.760  1.00 27.06  ? 189  ARG A N     1 
ATOM   1395  C  CA    . ARG A  1  189 ? 2.279   69.156  14.230  1.00 28.73  ? 189  ARG A CA    1 
ATOM   1396  C  C     . ARG A  1  189 ? 2.535   67.729  13.704  1.00 25.41  ? 189  ARG A C     1 
ATOM   1397  O  O     . ARG A  1  189 ? 1.715   67.160  13.003  1.00 24.89  ? 189  ARG A O     1 
ATOM   1398  C  CB    . ARG A  1  189 ? 1.700   70.012  13.118  1.00 30.73  ? 189  ARG A CB    1 
ATOM   1399  C  CG    . ARG A  1  189 ? 1.350   71.455  13.529  1.00 35.16  ? 189  ARG A CG    1 
ATOM   1400  C  CD    . ARG A  1  189 ? 0.259   71.963  12.589  1.00 43.62  ? 189  ARG A CD    1 
ATOM   1401  N  NE    . ARG A  1  189 ? -0.012  73.391  12.683  1.00 47.88  ? 189  ARG A NE    1 
ATOM   1402  C  CZ    . ARG A  1  189 ? -0.408  74.009  13.784  1.00 49.63  ? 189  ARG A CZ    1 
ATOM   1403  N  NH1   . ARG A  1  189 ? -0.571  73.314  14.907  1.00 53.28  ? 189  ARG A NH1   1 
ATOM   1404  N  NH2   . ARG A  1  189 ? -0.669  75.315  13.755  1.00 49.22  ? 189  ARG A NH2   1 
ATOM   1405  N  N     . GLY A  1  190 ? 3.681   67.161  14.040  1.00 23.51  ? 190  GLY A N     1 
ATOM   1406  C  CA    . GLY A  1  190 ? 3.963   65.801  13.606  1.00 19.29  ? 190  GLY A CA    1 
ATOM   1407  C  C     . GLY A  1  190 ? 5.415   65.635  13.245  1.00 20.03  ? 190  GLY A C     1 
ATOM   1408  O  O     . GLY A  1  190 ? 6.263   66.478  13.600  1.00 17.91  ? 190  GLY A O     1 
ATOM   1409  N  N     . VAL A  1  191 ? 5.702   64.558  12.520  1.00 20.29  ? 191  VAL A N     1 
ATOM   1410  C  CA    . VAL A  1  191 ? 7.065   64.270  12.111  1.00 19.13  ? 191  VAL A CA    1 
ATOM   1411  C  C     . VAL A  1  191 ? 7.053   63.671  10.738  1.00 17.87  ? 191  VAL A C     1 
ATOM   1412  O  O     . VAL A  1  191 ? 6.068   63.067  10.359  1.00 15.60  ? 191  VAL A O     1 
ATOM   1413  C  CB    . VAL A  1  191 ? 7.737   63.224  13.051  1.00 18.69  ? 191  VAL A CB    1 
ATOM   1414  C  CG1   . VAL A  1  191 ? 7.451   63.564  14.518  1.00 23.01  ? 191  VAL A CG1   1 
ATOM   1415  C  CG2   . VAL A  1  191 ? 7.234   61.832  12.740  1.00 19.35  ? 191  VAL A CG2   1 
ATOM   1416  N  N     . ILE A  1  192 ? 8.160   63.806  10.010  1.00 19.66  ? 192  ILE A N     1 
ATOM   1417  C  CA    . ILE A  1  192 ? 8.286   63.208  8.696   1.00 17.95  ? 192  ILE A CA    1 
ATOM   1418  C  C     . ILE A  1  192 ? 9.367   62.124  8.835   1.00 19.46  ? 192  ILE A C     1 
ATOM   1419  O  O     . ILE A  1  192 ? 10.354  62.294  9.560   1.00 15.88  ? 192  ILE A O     1 
ATOM   1420  C  CB    . ILE A  1  192 ? 8.644   64.260  7.615   1.00 22.15  ? 192  ILE A CB    1 
ATOM   1421  C  CG1   . ILE A  1  192 ? 8.782   63.580  6.244   1.00 22.59  ? 192  ILE A CG1   1 
ATOM   1422  C  CG2   . ILE A  1  192 ? 9.904   65.007  7.989   1.00 21.11  ? 192  ILE A CG2   1 
ATOM   1423  C  CD1   . ILE A  1  192 ? 8.960   64.574  5.032   1.00 20.21  ? 192  ILE A CD1   1 
ATOM   1424  N  N     . ALA A  1  193 ? 9.167   60.992  8.174   1.00 17.00  ? 193  ALA A N     1 
ATOM   1425  C  CA    . ALA A  1  193 ? 10.122  59.903  8.293   1.00 22.31  ? 193  ALA A CA    1 
ATOM   1426  C  C     . ALA A  1  193 ? 10.278  59.068  7.042   1.00 22.60  ? 193  ALA A C     1 
ATOM   1427  O  O     . ALA A  1  193 ? 9.469   59.117  6.128   1.00 26.10  ? 193  ALA A O     1 
ATOM   1428  C  CB    . ALA A  1  193 ? 9.720   58.996  9.460   1.00 18.73  ? 193  ALA A CB    1 
ATOM   1429  N  N     . LEU A  1  194 ? 11.352  58.296  7.010   1.00 22.75  ? 194  LEU A N     1 
ATOM   1430  C  CA    . LEU A  1  194 ? 11.638  57.405  5.897   1.00 20.93  ? 194  LEU A CA    1 
ATOM   1431  C  C     . LEU A  1  194 ? 11.337  55.931  6.313   1.00 25.38  ? 194  LEU A C     1 
ATOM   1432  O  O     . LEU A  1  194 ? 11.748  55.493  7.408   1.00 23.83  ? 194  LEU A O     1 
ATOM   1433  C  CB    . LEU A  1  194 ? 13.111  57.538  5.517   1.00 19.46  ? 194  LEU A CB    1 
ATOM   1434  C  CG    . LEU A  1  194 ? 13.643  56.435  4.588   1.00 24.65  ? 194  LEU A CG    1 
ATOM   1435  C  CD1   . LEU A  1  194 ? 13.126  56.644  3.153   1.00 21.47  ? 194  LEU A CD1   1 
ATOM   1436  C  CD2   . LEU A  1  194 ? 15.156  56.487  4.588   1.00 25.73  ? 194  LEU A CD2   1 
ATOM   1437  N  N     . CYS A  1  195 ? 10.595  55.199  5.471   1.00 24.52  ? 195  CYS A N     1 
ATOM   1438  C  CA    . CYS A  1  195 ? 10.296  53.774  5.704   1.00 26.79  ? 195  CYS A CA    1 
ATOM   1439  C  C     . CYS A  1  195 ? 11.471  53.021  5.072   1.00 25.74  ? 195  CYS A C     1 
ATOM   1440  O  O     . CYS A  1  195 ? 11.554  52.925  3.852   1.00 28.50  ? 195  CYS A O     1 
ATOM   1441  C  CB    . CYS A  1  195 ? 9.011   53.299  4.990   1.00 20.47  ? 195  CYS A CB    1 
ATOM   1442  S  SG    . CYS A  1  195 ? 8.762   51.481  5.118   1.00 25.83  ? 195  CYS A SG    1 
ATOM   1443  N  N     . ILE A  1  196 ? 12.362  52.503  5.909   1.00 24.52  ? 196  ILE A N     1 
ATOM   1444  C  CA    . ILE A  1  196 ? 13.545  51.795  5.475   1.00 25.26  ? 196  ILE A CA    1 
ATOM   1445  C  C     . ILE A  1  196 ? 13.255  50.535  4.652   1.00 25.64  ? 196  ILE A C     1 
ATOM   1446  O  O     . ILE A  1  196 ? 14.032  50.216  3.754   1.00 20.68  ? 196  ILE A O     1 
ATOM   1447  C  CB    . ILE A  1  196 ? 14.442  51.454  6.730   1.00 28.89  ? 196  ILE A CB    1 
ATOM   1448  C  CG1   . ILE A  1  196 ? 14.917  52.763  7.386   1.00 27.82  ? 196  ILE A CG1   1 
ATOM   1449  C  CG2   . ILE A  1  196 ? 15.660  50.626  6.332   1.00 16.64  ? 196  ILE A CG2   1 
ATOM   1450  C  CD1   . ILE A  1  196 ? 15.488  52.553  8.783   1.00 29.02  ? 196  ILE A CD1   1 
ATOM   1451  N  N     . GLU A  1  197 ? 12.131  49.850  4.901   1.00 20.70  ? 197  GLU A N     1 
ATOM   1452  C  CA    . GLU A  1  197 ? 11.847  48.631  4.139   1.00 24.17  ? 197  GLU A CA    1 
ATOM   1453  C  C     . GLU A  1  197 ? 11.480  48.850  2.675   1.00 26.71  ? 197  GLU A C     1 
ATOM   1454  O  O     . GLU A  1  197 ? 11.712  47.972  1.839   1.00 30.45  ? 197  GLU A O     1 
ATOM   1455  C  CB    . GLU A  1  197 ? 10.713  47.798  4.775   1.00 27.13  ? 197  GLU A CB    1 
ATOM   1456  C  CG    . GLU A  1  197 ? 10.333  46.580  3.906   1.00 33.11  ? 197  GLU A CG    1 
ATOM   1457  C  CD    . GLU A  1  197 ? 9.148   45.757  4.414   1.00 41.97  ? 197  GLU A CD    1 
ATOM   1458  O  OE1   . GLU A  1  197 ? 8.121   46.341  4.823   1.00 42.02  ? 197  GLU A OE1   1 
ATOM   1459  O  OE2   . GLU A  1  197 ? 9.247   44.504  4.378   1.00 44.52  ? 197  GLU A OE2   1 
ATOM   1460  N  N     . ASP A  1  198 ? 10.898  49.992  2.348   1.00 27.60  ? 198  ASP A N     1 
ATOM   1461  C  CA    . ASP A  1  198 ? 10.481  50.204  0.967   1.00 31.25  ? 198  ASP A CA    1 
ATOM   1462  C  C     . ASP A  1  198 ? 10.842  51.551  0.360   1.00 29.80  ? 198  ASP A C     1 
ATOM   1463  O  O     . ASP A  1  198 ? 10.445  51.864  -0.766  1.00 32.99  ? 198  ASP A O     1 
ATOM   1464  C  CB    . ASP A  1  198 ? 8.979   49.979  0.860   1.00 35.76  ? 198  ASP A CB    1 
ATOM   1465  C  CG    . ASP A  1  198 ? 8.178   51.020  1.604   1.00 43.80  ? 198  ASP A CG    1 
ATOM   1466  O  OD1   . ASP A  1  198 ? 6.940   50.837  1.687   1.00 48.91  ? 198  ASP A OD1   1 
ATOM   1467  O  OD2   . ASP A  1  198 ? 8.767   52.016  2.103   1.00 46.99  ? 198  ASP A OD2   1 
ATOM   1468  N  N     . GLY A  1  199 ? 11.555  52.363  1.124   1.00 27.26  ? 199  GLY A N     1 
ATOM   1469  C  CA    . GLY A  1  199 ? 12.002  53.640  0.618   1.00 22.41  ? 199  GLY A CA    1 
ATOM   1470  C  C     . GLY A  1  199 ? 11.053  54.788  0.515   1.00 20.25  ? 199  GLY A C     1 
ATOM   1471  O  O     . GLY A  1  199 ? 11.424  55.834  0.004   1.00 23.03  ? 199  GLY A O     1 
ATOM   1472  N  N     . THR A  1  200 ? 9.827   54.631  0.997   1.00 23.58  ? 200  THR A N     1 
ATOM   1473  C  CA    . THR A  1  200 ? 8.854   55.715  0.916   1.00 21.54  ? 200  THR A CA    1 
ATOM   1474  C  C     . THR A  1  200 ? 8.964   56.737  2.063   1.00 24.39  ? 200  THR A C     1 
ATOM   1475  O  O     . THR A  1  200 ? 9.505   56.445  3.158   1.00 21.88  ? 200  THR A O     1 
ATOM   1476  C  CB    . THR A  1  200 ? 7.421   55.115  0.867   1.00 24.69  ? 200  THR A CB    1 
ATOM   1477  O  OG1   . THR A  1  200 ? 7.211   54.281  2.009   1.00 28.66  ? 200  THR A OG1   1 
ATOM   1478  C  CG2   . THR A  1  200 ? 7.255   54.223  -0.371  1.00 22.99  ? 200  THR A CG2   1 
ATOM   1479  N  N     . ILE A  1  201 ? 8.449   57.936  1.812   1.00 21.76  ? 201  ILE A N     1 
ATOM   1480  C  CA    . ILE A  1  201 ? 8.445   59.020  2.790   1.00 23.85  ? 201  ILE A CA    1 
ATOM   1481  C  C     . ILE A  1  201 ? 7.028   59.111  3.417   1.00 26.08  ? 201  ILE A C     1 
ATOM   1482  O  O     . ILE A  1  201 ? 6.005   59.039  2.708   1.00 25.69  ? 201  ILE A O     1 
ATOM   1483  C  CB    . ILE A  1  201 ? 8.803   60.361  2.095   1.00 18.33  ? 201  ILE A CB    1 
ATOM   1484  C  CG1   . ILE A  1  201 ? 10.172  60.245  1.449   1.00 18.79  ? 201  ILE A CG1   1 
ATOM   1485  C  CG2   . ILE A  1  201 ? 8.746   61.510  3.059   1.00 16.02  ? 201  ILE A CG2   1 
ATOM   1486  C  CD1   . ILE A  1  201 ? 11.307  60.051  2.393   1.00 25.53  ? 201  ILE A CD1   1 
ATOM   1487  N  N     . HIS A  1  202 ? 6.971   59.227  4.742   1.00 24.81  ? 202  HIS A N     1 
ATOM   1488  C  CA    . HIS A  1  202 ? 5.695   59.328  5.441   1.00 24.95  ? 202  HIS A CA    1 
ATOM   1489  C  C     . HIS A  1  202 ? 5.653   60.521  6.358   1.00 24.86  ? 202  HIS A C     1 
ATOM   1490  O  O     . HIS A  1  202 ? 6.645   60.866  6.998   1.00 22.04  ? 202  HIS A O     1 
ATOM   1491  C  CB    . HIS A  1  202 ? 5.431   58.087  6.292   1.00 27.65  ? 202  HIS A CB    1 
ATOM   1492  C  CG    . HIS A  1  202 ? 5.448   56.808  5.519   1.00 24.60  ? 202  HIS A CG    1 
ATOM   1493  N  ND1   . HIS A  1  202 ? 4.337   56.006  5.392   1.00 22.74  ? 202  HIS A ND1   1 
ATOM   1494  C  CD2   . HIS A  1  202 ? 6.443   56.184  4.844   1.00 22.84  ? 202  HIS A CD2   1 
ATOM   1495  C  CE1   . HIS A  1  202 ? 4.643   54.937  4.677   1.00 21.29  ? 202  HIS A CE1   1 
ATOM   1496  N  NE2   . HIS A  1  202 ? 5.918   55.020  4.331   1.00 21.86  ? 202  HIS A NE2   1 
ATOM   1497  N  N     . ARG A  1  203 ? 4.486   61.147  6.411   1.00 25.06  ? 203  ARG A N     1 
ATOM   1498  C  CA    . ARG A  1  203 ? 4.265   62.279  7.275   1.00 26.59  ? 203  ARG A CA    1 
ATOM   1499  C  C     . ARG A  1  203 ? 3.215   61.889  8.288   1.00 25.48  ? 203  ARG A C     1 
ATOM   1500  O  O     . ARG A  1  203 ? 2.112   61.509  7.937   1.00 28.66  ? 203  ARG A O     1 
ATOM   1501  C  CB    . ARG A  1  203 ? 3.809   63.504  6.478   1.00 27.88  ? 203  ARG A CB    1 
ATOM   1502  C  CG    . ARG A  1  203 ? 4.880   63.990  5.522   1.00 36.27  ? 203  ARG A CG    1 
ATOM   1503  C  CD    . ARG A  1  203 ? 4.598   65.386  4.999   1.00 37.50  ? 203  ARG A CD    1 
ATOM   1504  N  NE    . ARG A  1  203 ? 3.452   65.408  4.103   1.00 41.88  ? 203  ARG A NE    1 
ATOM   1505  C  CZ    . ARG A  1  203 ? 3.092   66.480  3.406   1.00 45.11  ? 203  ARG A CZ    1 
ATOM   1506  N  NH1   . ARG A  1  203 ? 3.790   67.607  3.513   1.00 45.38  ? 203  ARG A NH1   1 
ATOM   1507  N  NH2   . ARG A  1  203 ? 2.048   66.419  2.593   1.00 46.15  ? 203  ARG A NH2   1 
ATOM   1508  N  N     . PHE A  1  204 ? 3.573   61.963  9.558   1.00 22.48  ? 204  PHE A N     1 
ATOM   1509  C  CA    . PHE A  1  204 ? 2.662   61.614  10.597  1.00 21.89  ? 204  PHE A CA    1 
ATOM   1510  C  C     . PHE A  1  204 ? 2.189   62.926  11.193  1.00 24.14  ? 204  PHE A C     1 
ATOM   1511  O  O     . PHE A  1  204 ? 2.977   63.620  11.840  1.00 28.04  ? 204  PHE A O     1 
ATOM   1512  C  CB    . PHE A  1  204 ? 3.378   60.748  11.644  1.00 19.64  ? 204  PHE A CB    1 
ATOM   1513  C  CG    . PHE A  1  204 ? 3.830   59.413  11.120  1.00 19.10  ? 204  PHE A CG    1 
ATOM   1514  C  CD1   . PHE A  1  204 ? 5.069   59.266  10.511  1.00 22.15  ? 204  PHE A CD1   1 
ATOM   1515  C  CD2   . PHE A  1  204 ? 3.007   58.299  11.228  1.00 21.62  ? 204  PHE A CD2   1 
ATOM   1516  C  CE1   . PHE A  1  204 ? 5.485   58.026  10.011  1.00 22.08  ? 204  PHE A CE1   1 
ATOM   1517  C  CE2   . PHE A  1  204 ? 3.401   57.068  10.741  1.00 19.37  ? 204  PHE A CE2   1 
ATOM   1518  C  CZ    . PHE A  1  204 ? 4.657   56.929  10.122  1.00 21.23  ? 204  PHE A CZ    1 
ATOM   1519  N  N     . ARG A  1  205 ? 0.925   63.280  10.942  1.00 22.20  ? 205  ARG A N     1 
ATOM   1520  C  CA    . ARG A  1  205 ? 0.360   64.507  11.486  1.00 25.38  ? 205  ARG A CA    1 
ATOM   1521  C  C     . ARG A  1  205 ? -0.349  64.168  12.807  1.00 25.78  ? 205  ARG A C     1 
ATOM   1522  O  O     . ARG A  1  205 ? -1.014  63.128  12.909  1.00 23.65  ? 205  ARG A O     1 
ATOM   1523  C  CB    . ARG A  1  205 ? -0.649  65.089  10.509  1.00 33.52  ? 205  ARG A CB    1 
ATOM   1524  C  CG    . ARG A  1  205 ? -0.049  65.528  9.187   1.00 38.00  ? 205  ARG A CG    1 
ATOM   1525  C  CD    . ARG A  1  205 ? -1.148  65.835  8.190   1.00 46.40  ? 205  ARG A CD    1 
ATOM   1526  N  NE    . ARG A  1  205 ? -2.200  66.651  8.795   1.00 52.48  ? 205  ARG A NE    1 
ATOM   1527  C  CZ    . ARG A  1  205 ? -3.489  66.572  8.469   1.00 54.73  ? 205  ARG A CZ    1 
ATOM   1528  N  NH1   . ARG A  1  205 ? -3.892  65.715  7.538   1.00 53.10  ? 205  ARG A NH1   1 
ATOM   1529  N  NH2   . ARG A  1  205 ? -4.385  67.332  9.093   1.00 57.97  ? 205  ARG A NH2   1 
ATOM   1530  N  N     . ALA A  1  206 ? -0.214  65.029  13.809  1.00 22.30  ? 206  ALA A N     1 
ATOM   1531  C  CA    . ALA A  1  206 ? -0.851  64.766  15.102  1.00 22.34  ? 206  ALA A CA    1 
ATOM   1532  C  C     . ALA A  1  206 ? -0.846  66.004  15.944  1.00 18.43  ? 206  ALA A C     1 
ATOM   1533  O  O     . ALA A  1  206 ? 0.012   66.836  15.825  1.00 20.45  ? 206  ALA A O     1 
ATOM   1534  C  CB    . ALA A  1  206 ? -0.121  63.655  15.847  1.00 18.00  ? 206  ALA A CB    1 
ATOM   1535  N  N     . LYS A  1  207 ? -1.823  66.114  16.809  1.00 22.71  ? 207  LYS A N     1 
ATOM   1536  C  CA    . LYS A  1  207 ? -1.894  67.255  17.671  1.00 24.85  ? 207  LYS A CA    1 
ATOM   1537  C  C     . LYS A  1  207 ? -0.754  67.222  18.695  1.00 22.89  ? 207  LYS A C     1 
ATOM   1538  O  O     . LYS A  1  207 ? -0.356  68.270  19.199  1.00 21.74  ? 207  LYS A O     1 
ATOM   1539  C  CB    . LYS A  1  207 ? -3.248  67.281  18.379  1.00 26.87  ? 207  LYS A CB    1 
ATOM   1540  C  CG    . LYS A  1  207 ? -3.710  68.690  18.665  1.00 39.86  ? 207  LYS A CG    1 
ATOM   1541  C  CD    . LYS A  1  207 ? -4.749  68.714  19.764  1.00 47.72  ? 207  LYS A CD    1 
ATOM   1542  C  CE    . LYS A  1  207 ? -5.899  67.803  19.422  1.00 51.83  ? 207  LYS A CE    1 
ATOM   1543  N  NZ    . LYS A  1  207 ? -6.838  67.781  20.561  1.00 57.45  ? 207  LYS A NZ    1 
ATOM   1544  N  N     . ASN A  1  208 ? -0.231  66.027  19.003  1.00 19.99  ? 208  ASN A N     1 
ATOM   1545  C  CA    . ASN A  1  208 ? 0.847   65.910  19.990  1.00 18.30  ? 208  ASN A CA    1 
ATOM   1546  C  C     . ASN A  1  208 ? 1.923   64.917  19.581  1.00 16.20  ? 208  ASN A C     1 
ATOM   1547  O  O     . ASN A  1  208 ? 1.639   63.789  19.170  1.00 16.26  ? 208  ASN A O     1 
ATOM   1548  C  CB    . ASN A  1  208 ? 0.281   65.508  21.349  1.00 18.39  ? 208  ASN A CB    1 
ATOM   1549  C  CG    . ASN A  1  208 ? -0.504  66.619  22.017  1.00 25.66  ? 208  ASN A CG    1 
ATOM   1550  O  OD1   . ASN A  1  208 ? 0.052   67.638  22.388  1.00 23.80  ? 208  ASN A OD1   1 
ATOM   1551  N  ND2   . ASN A  1  208 ? -1.810  66.417  22.179  1.00 27.08  ? 208  ASN A ND2   1 
ATOM   1552  N  N     . THR A  1  209 ? 3.166   65.332  19.749  1.00 19.82  ? 209  THR A N     1 
ATOM   1553  C  CA    . THR A  1  209 ? 4.309   64.516  19.385  1.00 17.53  ? 209  THR A CA    1 
ATOM   1554  C  C     . THR A  1  209 ? 5.211   64.326  20.582  1.00 20.88  ? 209  THR A C     1 
ATOM   1555  O  O     . THR A  1  209 ? 5.526   65.288  21.283  1.00 18.18  ? 209  THR A O     1 
ATOM   1556  C  CB    . THR A  1  209 ? 5.075   65.189  18.242  1.00 20.91  ? 209  THR A CB    1 
ATOM   1557  O  OG1   . THR A  1  209 ? 4.252   65.156  17.073  1.00 19.80  ? 209  THR A OG1   1 
ATOM   1558  C  CG2   . THR A  1  209 ? 6.401   64.454  17.931  1.00 22.41  ? 209  THR A CG2   1 
ATOM   1559  N  N     . VAL A  1  210 ? 5.599   63.070  20.821  1.00 19.72  ? 210  VAL A N     1 
ATOM   1560  C  CA    . VAL A  1  210 ? 6.466   62.719  21.935  1.00 13.33  ? 210  VAL A CA    1 
ATOM   1561  C  C     . VAL A  1  210 ? 7.825   62.208  21.392  1.00 15.85  ? 210  VAL A C     1 
ATOM   1562  O  O     . VAL A  1  210 ? 7.888   61.251  20.607  1.00 14.60  ? 210  VAL A O     1 
ATOM   1563  C  CB    . VAL A  1  210 ? 5.801   61.629  22.799  1.00 14.38  ? 210  VAL A CB    1 
ATOM   1564  C  CG1   . VAL A  1  210 ? 6.666   61.335  24.033  1.00 16.06  ? 210  VAL A CG1   1 
ATOM   1565  C  CG2   . VAL A  1  210 ? 4.398   62.088  23.211  1.00 14.52  ? 210  VAL A CG2   1 
ATOM   1566  N  N     . ILE A  1  211 ? 8.903   62.871  21.782  1.00 14.21  ? 211  ILE A N     1 
ATOM   1567  C  CA    . ILE A  1  211 ? 10.237  62.461  21.356  1.00 13.20  ? 211  ILE A CA    1 
ATOM   1568  C  C     . ILE A  1  211 ? 10.865  61.591  22.475  1.00 19.15  ? 211  ILE A C     1 
ATOM   1569  O  O     . ILE A  1  211 ? 11.025  62.044  23.618  1.00 14.20  ? 211  ILE A O     1 
ATOM   1570  C  CB    . ILE A  1  211 ? 11.062  63.705  21.015  1.00 14.70  ? 211  ILE A CB    1 
ATOM   1571  C  CG1   . ILE A  1  211 ? 10.434  64.317  19.746  1.00 24.13  ? 211  ILE A CG1   1 
ATOM   1572  C  CG2   . ILE A  1  211 ? 12.529  63.314  20.661  1.00 10.81  ? 211  ILE A CG2   1 
ATOM   1573  C  CD1   . ILE A  1  211 ? 11.208  65.455  19.164  1.00 30.13  ? 211  ILE A CD1   1 
ATOM   1574  N  N     . ALA A  1  212 ? 11.162  60.328  22.142  1.00 14.72  ? 212  ALA A N     1 
ATOM   1575  C  CA    . ALA A  1  212 ? 11.721  59.371  23.100  1.00 14.61  ? 212  ALA A CA    1 
ATOM   1576  C  C     . ALA A  1  212 ? 12.847  58.596  22.384  1.00 15.85  ? 212  ALA A C     1 
ATOM   1577  O  O     . ALA A  1  212 ? 12.928  57.375  22.448  1.00 16.39  ? 212  ALA A O     1 
ATOM   1578  C  CB    . ALA A  1  212 ? 10.602  58.374  23.549  1.00 15.60  ? 212  ALA A CB    1 
ATOM   1579  N  N     . THR A  1  213 ? 13.718  59.329  21.723  1.00 12.91  ? 213  THR A N     1 
ATOM   1580  C  CA    . THR A  1  213 ? 14.756  58.752  20.922  1.00 14.43  ? 213  THR A CA    1 
ATOM   1581  C  C     . THR A  1  213 ? 16.076  58.348  21.572  1.00 14.05  ? 213  THR A C     1 
ATOM   1582  O  O     . THR A  1  213 ? 17.027  57.960  20.862  1.00 10.24  ? 213  THR A O     1 
ATOM   1583  C  CB    . THR A  1  213 ? 15.023  59.734  19.754  1.00 13.65  ? 213  THR A CB    1 
ATOM   1584  O  OG1   . THR A  1  213 ? 15.204  61.043  20.301  1.00 15.51  ? 213  THR A OG1   1 
ATOM   1585  C  CG2   . THR A  1  213 ? 13.835  59.772  18.825  1.00 16.14  ? 213  THR A CG2   1 
ATOM   1586  N  N     . GLY A  1  214 ? 16.200  58.451  22.901  1.00 12.84  ? 214  GLY A N     1 
ATOM   1587  C  CA    . GLY A  1  214 ? 17.467  58.026  23.461  1.00 11.07  ? 214  GLY A CA    1 
ATOM   1588  C  C     . GLY A  1  214 ? 18.583  59.039  23.433  1.00 14.85  ? 214  GLY A C     1 
ATOM   1589  O  O     . GLY A  1  214 ? 18.357  60.228  23.145  1.00 15.37  ? 214  GLY A O     1 
ATOM   1590  N  N     . GLY A  1  215 ? 19.784  58.572  23.775  1.00 16.08  ? 215  GLY A N     1 
ATOM   1591  C  CA    . GLY A  1  215 ? 20.936  59.451  23.821  1.00 12.62  ? 215  GLY A CA    1 
ATOM   1592  C  C     . GLY A  1  215 ? 21.822  59.451  22.599  1.00 12.43  ? 215  GLY A C     1 
ATOM   1593  O  O     . GLY A  1  215 ? 21.431  58.990  21.528  1.00 13.89  ? 215  GLY A O     1 
ATOM   1594  N  N     . TYR A  1  216 ? 23.032  59.997  22.764  1.00 14.29  ? 216  TYR A N     1 
ATOM   1595  C  CA    . TYR A  1  216 ? 23.982  60.121  21.684  1.00 16.12  ? 216  TYR A CA    1 
ATOM   1596  C  C     . TYR A  1  216 ? 25.402  59.748  22.081  1.00 18.52  ? 216  TYR A C     1 
ATOM   1597  O  O     . TYR A  1  216 ? 26.356  60.382  21.652  1.00 18.54  ? 216  TYR A O     1 
ATOM   1598  C  CB    . TYR A  1  216 ? 23.923  61.546  21.096  1.00 15.99  ? 216  TYR A CB    1 
ATOM   1599  C  CG    . TYR A  1  216 ? 24.232  62.689  22.064  1.00 22.85  ? 216  TYR A CG    1 
ATOM   1600  C  CD1   . TYR A  1  216 ? 25.529  63.196  22.178  1.00 19.44  ? 216  TYR A CD1   1 
ATOM   1601  C  CD2   . TYR A  1  216 ? 23.235  63.230  22.901  1.00 19.24  ? 216  TYR A CD2   1 
ATOM   1602  C  CE1   . TYR A  1  216 ? 25.843  64.199  23.106  1.00 22.95  ? 216  TYR A CE1   1 
ATOM   1603  C  CE2   . TYR A  1  216 ? 23.540  64.245  23.836  1.00 21.70  ? 216  TYR A CE2   1 
ATOM   1604  C  CZ    . TYR A  1  216 ? 24.862  64.717  23.932  1.00 18.39  ? 216  TYR A CZ    1 
ATOM   1605  O  OH    . TYR A  1  216 ? 25.221  65.659  24.876  1.00 20.06  ? 216  TYR A OH    1 
ATOM   1606  N  N     . GLY A  1  217 ? 25.539  58.660  22.836  1.00 18.91  ? 217  GLY A N     1 
ATOM   1607  C  CA    . GLY A  1  217 ? 26.856  58.220  23.270  1.00 19.08  ? 217  GLY A CA    1 
ATOM   1608  C  C     . GLY A  1  217 ? 27.815  57.885  22.148  1.00 21.96  ? 217  GLY A C     1 
ATOM   1609  O  O     . GLY A  1  217 ? 29.044  57.888  22.314  1.00 20.17  ? 217  GLY A O     1 
ATOM   1610  N  N     . ARG A  1  218 ? 27.254  57.574  20.982  1.00 26.90  ? 218  ARG A N     1 
ATOM   1611  C  CA    . ARG A  1  218 ? 28.063  57.227  19.838  1.00 23.34  ? 218  ARG A CA    1 
ATOM   1612  C  C     . ARG A  1  218 ? 28.891  58.346  19.258  1.00 23.97  ? 218  ARG A C     1 
ATOM   1613  O  O     . ARG A  1  218 ? 29.646  58.115  18.299  1.00 25.57  ? 218  ARG A O     1 
ATOM   1614  C  CB    . ARG A  1  218 ? 27.212  56.618  18.739  1.00 25.83  ? 218  ARG A CB    1 
ATOM   1615  C  CG    . ARG A  1  218 ? 27.098  55.158  18.889  1.00 25.73  ? 218  ARG A CG    1 
ATOM   1616  C  CD    . ARG A  1  218 ? 28.429  54.440  18.670  1.00 28.26  ? 218  ARG A CD    1 
ATOM   1617  N  NE    . ARG A  1  218 ? 28.280  53.096  19.213  1.00 34.25  ? 218  ARG A NE    1 
ATOM   1618  C  CZ    . ARG A  1  218 ? 29.265  52.216  19.418  1.00 35.54  ? 218  ARG A CZ    1 
ATOM   1619  N  NH1   . ARG A  1  218 ? 30.528  52.525  19.120  1.00 27.43  ? 218  ARG A NH1   1 
ATOM   1620  N  NH2   . ARG A  1  218 ? 28.968  51.015  19.936  1.00 30.32  ? 218  ARG A NH2   1 
ATOM   1621  N  N     . THR A  1  219 ? 28.740  59.554  19.788  1.00 20.56  ? 219  THR A N     1 
ATOM   1622  C  CA    . THR A  1  219 ? 29.567  60.654  19.315  1.00 21.75  ? 219  THR A CA    1 
ATOM   1623  C  C     . THR A  1  219 ? 31.023  60.415  19.766  1.00 22.27  ? 219  THR A C     1 
ATOM   1624  O  O     . THR A  1  219 ? 31.945  61.020  19.220  1.00 23.74  ? 219  THR A O     1 
ATOM   1625  C  CB    . THR A  1  219 ? 29.112  62.049  19.851  1.00 22.78  ? 219  THR A CB    1 
ATOM   1626  O  OG1   . THR A  1  219 ? 28.968  62.009  21.272  1.00 21.84  ? 219  THR A OG1   1 
ATOM   1627  C  CG2   . THR A  1  219 ? 27.757  62.456  19.250  1.00 31.66  ? 219  THR A CG2   1 
ATOM   1628  N  N     . TYR A  1  220 ? 31.217  59.527  20.756  1.00 23.25  ? 220  TYR A N     1 
ATOM   1629  C  CA    . TYR A  1  220 ? 32.543  59.202  21.289  1.00 16.46  ? 220  TYR A CA    1 
ATOM   1630  C  C     . TYR A  1  220 ? 33.159  57.966  20.636  1.00 19.67  ? 220  TYR A C     1 
ATOM   1631  O  O     . TYR A  1  220 ? 32.460  57.202  19.948  1.00 21.12  ? 220  TYR A O     1 
ATOM   1632  C  CB    . TYR A  1  220 ? 32.459  59.011  22.820  1.00 15.89  ? 220  TYR A CB    1 
ATOM   1633  C  CG    . TYR A  1  220 ? 32.403  60.328  23.574  1.00 17.76  ? 220  TYR A CG    1 
ATOM   1634  C  CD1   . TYR A  1  220 ? 31.209  61.032  23.693  1.00 15.45  ? 220  TYR A CD1   1 
ATOM   1635  C  CD2   . TYR A  1  220 ? 33.551  60.883  24.131  1.00 15.43  ? 220  TYR A CD2   1 
ATOM   1636  C  CE1   . TYR A  1  220 ? 31.158  62.245  24.357  1.00 15.98  ? 220  TYR A CE1   1 
ATOM   1637  C  CE2   . TYR A  1  220 ? 33.522  62.099  24.771  1.00 12.23  ? 220  TYR A CE2   1 
ATOM   1638  C  CZ    . TYR A  1  220 ? 32.313  62.779  24.888  1.00 16.82  ? 220  TYR A CZ    1 
ATOM   1639  O  OH    . TYR A  1  220 ? 32.260  64.004  25.516  1.00 17.97  ? 220  TYR A OH    1 
ATOM   1640  N  N     . PHE A  1  221 ? 34.464  57.758  20.857  1.00 15.74  ? 221  PHE A N     1 
ATOM   1641  C  CA    . PHE A  1  221 ? 35.171  56.649  20.231  1.00 15.76  ? 221  PHE A CA    1 
ATOM   1642  C  C     . PHE A  1  221 ? 34.937  55.386  21.023  1.00 19.35  ? 221  PHE A C     1 
ATOM   1643  O  O     . PHE A  1  221 ? 34.828  54.281  20.481  1.00 17.17  ? 221  PHE A O     1 
ATOM   1644  C  CB    . PHE A  1  221 ? 36.699  56.979  20.137  1.00 20.80  ? 221  PHE A CB    1 
ATOM   1645  C  CG    . PHE A  1  221 ? 37.512  55.885  19.479  1.00 23.60  ? 221  PHE A CG    1 
ATOM   1646  C  CD1   . PHE A  1  221 ? 37.421  55.664  18.094  1.00 22.89  ? 221  PHE A CD1   1 
ATOM   1647  C  CD2   . PHE A  1  221 ? 38.325  55.052  20.239  1.00 23.07  ? 221  PHE A CD2   1 
ATOM   1648  C  CE1   . PHE A  1  221 ? 38.137  54.615  17.474  1.00 28.62  ? 221  PHE A CE1   1 
ATOM   1649  C  CE2   . PHE A  1  221 ? 39.049  53.996  19.642  1.00 28.98  ? 221  PHE A CE2   1 
ATOM   1650  C  CZ    . PHE A  1  221 ? 38.956  53.772  18.241  1.00 28.70  ? 221  PHE A CZ    1 
ATOM   1651  N  N     . SER A  1  222 ? 34.867  55.538  22.331  1.00 16.19  ? 222  SER A N     1 
ATOM   1652  C  CA    . SER A  1  222 ? 34.605  54.389  23.178  1.00 22.92  ? 222  SER A CA    1 
ATOM   1653  C  C     . SER A  1  222 ? 33.355  54.683  24.018  1.00 20.05  ? 222  SER A C     1 
ATOM   1654  O  O     . SER A  1  222 ? 33.297  55.710  24.684  1.00 22.07  ? 222  SER A O     1 
ATOM   1655  C  CB    . SER A  1  222 ? 35.809  54.147  24.079  1.00 22.86  ? 222  SER A CB    1 
ATOM   1656  O  OG    . SER A  1  222 ? 35.567  53.051  24.945  1.00 37.56  ? 222  SER A OG    1 
ATOM   1657  N  N     . CYS A  1  223 ? 32.379  53.784  23.998  1.00 19.49  ? 223  CYS A N     1 
ATOM   1658  C  CA    . CYS A  1  223 ? 31.111  53.974  24.743  1.00 18.16  ? 223  CYS A CA    1 
ATOM   1659  C  C     . CYS A  1  223 ? 30.402  52.648  25.011  1.00 19.50  ? 223  CYS A C     1 
ATOM   1660  O  O     . CYS A  1  223 ? 30.610  51.688  24.289  1.00 22.94  ? 223  CYS A O     1 
ATOM   1661  C  CB    . CYS A  1  223 ? 30.159  54.865  23.958  1.00 16.88  ? 223  CYS A CB    1 
ATOM   1662  S  SG    . CYS A  1  223 ? 29.732  54.232  22.263  1.00 22.20  ? 223  CYS A SG    1 
ATOM   1663  N  N     . THR A  1  224 ? 29.578  52.590  26.055  1.00 20.55  ? 224  THR A N     1 
ATOM   1664  C  CA    . THR A  1  224 ? 28.826  51.366  26.366  1.00 18.16  ? 224  THR A CA    1 
ATOM   1665  C  C     . THR A  1  224 ? 27.590  51.364  25.442  1.00 20.79  ? 224  THR A C     1 
ATOM   1666  O  O     . THR A  1  224 ? 26.919  50.347  25.246  1.00 11.95  ? 224  THR A O     1 
ATOM   1667  C  CB    . THR A  1  224 ? 28.364  51.377  27.865  1.00 18.06  ? 224  THR A CB    1 
ATOM   1668  O  OG1   . THR A  1  224 ? 27.443  52.451  28.090  1.00 15.09  ? 224  THR A OG1   1 
ATOM   1669  C  CG2   . THR A  1  224 ? 29.555  51.601  28.782  1.00 19.39  ? 224  THR A CG2   1 
ATOM   1670  N  N     . SER A  1  225 ? 27.332  52.529  24.858  1.00 17.21  ? 225  SER A N     1 
ATOM   1671  C  CA    . SER A  1  225 ? 26.173  52.739  24.007  1.00 21.28  ? 225  SER A CA    1 
ATOM   1672  C  C     . SER A  1  225 ? 26.073  51.879  22.732  1.00 21.52  ? 225  SER A C     1 
ATOM   1673  O  O     . SER A  1  225 ? 27.073  51.469  22.155  1.00 17.54  ? 225  SER A O     1 
ATOM   1674  C  CB    . SER A  1  225 ? 26.120  54.222  23.617  1.00 25.04  ? 225  SER A CB    1 
ATOM   1675  O  OG    . SER A  1  225 ? 26.450  55.060  24.723  1.00 21.13  ? 225  SER A OG    1 
ATOM   1676  N  N     . ALA A  1  226 ? 24.838  51.621  22.303  1.00 17.50  ? 226  ALA A N     1 
ATOM   1677  C  CA    . ALA A  1  226 ? 24.569  50.866  21.066  1.00 15.98  ? 226  ALA A CA    1 
ATOM   1678  C  C     . ALA A  1  226 ? 25.011  51.686  19.890  1.00 15.51  ? 226  ALA A C     1 
ATOM   1679  O  O     . ALA A  1  226 ? 25.090  52.928  19.971  1.00 12.90  ? 226  ALA A O     1 
ATOM   1680  C  CB    . ALA A  1  226 ? 23.045  50.618  20.885  1.00 13.73  ? 226  ALA A CB    1 
ATOM   1681  N  N     . HIS A  1  227 ? 25.223  51.005  18.764  1.00 18.55  ? 227  HIS A N     1 
ATOM   1682  C  CA    . HIS A  1  227 ? 25.597  51.680  17.528  1.00 16.15  ? 227  HIS A CA    1 
ATOM   1683  C  C     . HIS A  1  227 ? 24.465  52.584  17.129  1.00 18.77  ? 227  HIS A C     1 
ATOM   1684  O  O     . HIS A  1  227 ? 24.655  53.510  16.363  1.00 20.19  ? 227  HIS A O     1 
ATOM   1685  C  CB    . HIS A  1  227 ? 25.808  50.667  16.415  1.00 20.97  ? 227  HIS A CB    1 
ATOM   1686  C  CG    . HIS A  1  227 ? 27.076  49.890  16.551  1.00 23.05  ? 227  HIS A CG    1 
ATOM   1687  N  ND1   . HIS A  1  227 ? 28.307  50.439  16.286  1.00 26.21  ? 227  HIS A ND1   1 
ATOM   1688  C  CD2   . HIS A  1  227 ? 27.313  48.641  17.022  1.00 26.36  ? 227  HIS A CD2   1 
ATOM   1689  C  CE1   . HIS A  1  227 ? 29.251  49.571  16.597  1.00 26.94  ? 227  HIS A CE1   1 
ATOM   1690  N  NE2   . HIS A  1  227 ? 28.674  48.469  17.046  1.00 26.65  ? 227  HIS A NE2   1 
ATOM   1691  N  N     . THR A  1  228 ? 23.266  52.302  17.642  1.00 15.27  ? 228  THR A N     1 
ATOM   1692  C  CA    . THR A  1  228 ? 22.089  53.085  17.316  1.00 16.71  ? 228  THR A CA    1 
ATOM   1693  C  C     . THR A  1  228 ? 21.774  54.319  18.189  1.00 19.66  ? 228  THR A C     1 
ATOM   1694  O  O     . THR A  1  228 ? 20.754  54.961  17.967  1.00 16.68  ? 228  THR A O     1 
ATOM   1695  C  CB    . THR A  1  228 ? 20.830  52.176  17.294  1.00 13.77  ? 228  THR A CB    1 
ATOM   1696  O  OG1   . THR A  1  228 ? 20.719  51.492  18.548  1.00 23.20  ? 228  THR A OG1   1 
ATOM   1697  C  CG2   . THR A  1  228 ? 20.950  51.102  16.147  1.00 15.17  ? 228  THR A CG2   1 
ATOM   1698  N  N     . SER A  1  229 ? 22.607  54.632  19.190  1.00 18.47  ? 229  SER A N     1 
ATOM   1699  C  CA    . SER A  1  229 ? 22.383  55.795  20.065  1.00 18.91  ? 229  SER A CA    1 
ATOM   1700  C  C     . SER A  1  229 ? 23.048  56.983  19.409  1.00 16.76  ? 229  SER A C     1 
ATOM   1701  O  O     . SER A  1  229 ? 24.179  57.351  19.752  1.00 19.17  ? 229  SER A O     1 
ATOM   1702  C  CB    . SER A  1  229 ? 22.964  55.547  21.468  1.00 16.31  ? 229  SER A CB    1 
ATOM   1703  O  OG    . SER A  1  229 ? 22.414  54.360  22.052  1.00 13.59  ? 229  SER A OG    1 
ATOM   1704  N  N     . THR A  1  230 ? 22.334  57.593  18.456  1.00 19.43  ? 230  THR A N     1 
ATOM   1705  C  CA    . THR A  1  230 ? 22.895  58.667  17.660  1.00 16.10  ? 230  THR A CA    1 
ATOM   1706  C  C     . THR A  1  230 ? 22.256  60.041  17.806  1.00 19.84  ? 230  THR A C     1 
ATOM   1707  O  O     . THR A  1  230 ? 22.435  60.911  16.960  1.00 17.12  ? 230  THR A O     1 
ATOM   1708  C  CB    . THR A  1  230 ? 22.907  58.227  16.176  1.00 24.98  ? 230  THR A CB    1 
ATOM   1709  O  OG1   . THR A  1  230 ? 21.593  57.835  15.773  1.00 20.57  ? 230  THR A OG1   1 
ATOM   1710  C  CG2   . THR A  1  230 ? 23.833  57.015  15.984  1.00 21.65  ? 230  THR A CG2   1 
ATOM   1711  N  N     . GLY A  1  231 ? 21.525  60.234  18.896  1.00 21.12  ? 231  GLY A N     1 
ATOM   1712  C  CA    . GLY A  1  231 ? 20.876  61.509  19.157  1.00 23.74  ? 231  GLY A CA    1 
ATOM   1713  C  C     . GLY A  1  231 ? 19.956  62.075  18.074  1.00 22.04  ? 231  GLY A C     1 
ATOM   1714  O  O     . GLY A  1  231 ? 19.865  63.292  17.936  1.00 17.64  ? 231  GLY A O     1 
ATOM   1715  N  N     . ASP A  1  232 ? 19.258  61.209  17.337  1.00 23.60  ? 232  ASP A N     1 
ATOM   1716  C  CA    . ASP A  1  232 ? 18.371  61.655  16.259  1.00 22.03  ? 232  ASP A CA    1 
ATOM   1717  C  C     . ASP A  1  232 ? 17.251  62.618  16.671  1.00 24.65  ? 232  ASP A C     1 
ATOM   1718  O  O     . ASP A  1  232 ? 16.884  63.522  15.897  1.00 24.43  ? 232  ASP A O     1 
ATOM   1719  C  CB    . ASP A  1  232 ? 17.758  60.451  15.529  1.00 23.90  ? 232  ASP A CB    1 
ATOM   1720  C  CG    . ASP A  1  232 ? 18.809  59.519  14.929  1.00 24.74  ? 232  ASP A CG    1 
ATOM   1721  O  OD1   . ASP A  1  232 ? 19.982  59.933  14.818  1.00 22.98  ? 232  ASP A OD1   1 
ATOM   1722  O  OD2   . ASP A  1  232 ? 18.459  58.365  14.572  1.00 26.71  ? 232  ASP A OD2   1 
ATOM   1723  N  N     . GLY A  1  233 ? 16.705  62.436  17.870  1.00 26.84  ? 233  GLY A N     1 
ATOM   1724  C  CA    . GLY A  1  233 ? 15.625  63.297  18.349  1.00 23.23  ? 233  GLY A CA    1 
ATOM   1725  C  C     . GLY A  1  233 ? 16.112  64.673  18.791  1.00 24.63  ? 233  GLY A C     1 
ATOM   1726  O  O     . GLY A  1  233 ? 15.445  65.688  18.579  1.00 25.13  ? 233  GLY A O     1 
ATOM   1727  N  N     . THR A  1  234 ? 17.280  64.695  19.419  1.00 24.73  ? 234  THR A N     1 
ATOM   1728  C  CA    . THR A  1  234 ? 17.919  65.926  19.883  1.00 26.17  ? 234  THR A CA    1 
ATOM   1729  C  C     . THR A  1  234 ? 18.232  66.807  18.659  1.00 25.29  ? 234  THR A C     1 
ATOM   1730  O  O     . THR A  1  234 ? 18.076  68.030  18.709  1.00 27.38  ? 234  THR A O     1 
ATOM   1731  C  CB    . THR A  1  234 ? 19.234  65.585  20.581  1.00 26.47  ? 234  THR A CB    1 
ATOM   1732  O  OG1   . THR A  1  234 ? 19.032  64.435  21.400  1.00 37.93  ? 234  THR A OG1   1 
ATOM   1733  C  CG2   . THR A  1  234 ? 19.702  66.721  21.446  1.00 33.04  ? 234  THR A CG2   1 
ATOM   1734  N  N     . ALA A  1  235 ? 18.694  66.171  17.579  1.00 20.90  ? 235  ALA A N     1 
ATOM   1735  C  CA    . ALA A  1  235 ? 19.035  66.848  16.327  1.00 19.03  ? 235  ALA A CA    1 
ATOM   1736  C  C     . ALA A  1  235 ? 17.777  67.420  15.631  1.00 18.38  ? 235  ALA A C     1 
ATOM   1737  O  O     . ALA A  1  235 ? 17.822  68.513  15.045  1.00 20.76  ? 235  ALA A O     1 
ATOM   1738  C  CB    . ALA A  1  235 ? 19.773  65.881  15.411  1.00 13.35  ? 235  ALA A CB    1 
ATOM   1739  N  N     . MET A  1  236 ? 16.655  66.710  15.707  1.00 20.17  ? 236  MET A N     1 
ATOM   1740  C  CA    . MET A  1  236 ? 15.414  67.211  15.118  1.00 18.35  ? 236  MET A CA    1 
ATOM   1741  C  C     . MET A  1  236 ? 15.007  68.485  15.854  1.00 20.68  ? 236  MET A C     1 
ATOM   1742  O  O     . MET A  1  236 ? 14.602  69.443  15.222  1.00 23.60  ? 236  MET A O     1 
ATOM   1743  C  CB    . MET A  1  236 ? 14.280  66.192  15.209  1.00 20.69  ? 236  MET A CB    1 
ATOM   1744  C  CG    . MET A  1  236 ? 14.468  64.961  14.319  1.00 27.54  ? 236  MET A CG    1 
ATOM   1745  S  SD    . MET A  1  236 ? 12.923  63.971  14.097  1.00 30.57  ? 236  MET A SD    1 
ATOM   1746  C  CE    . MET A  1  236 ? 12.562  63.431  15.835  1.00 26.09  ? 236  MET A CE    1 
ATOM   1747  N  N     . VAL A  1  237 ? 15.138  68.504  17.182  1.00 17.61  ? 237  VAL A N     1 
ATOM   1748  C  CA    . VAL A  1  237 ? 14.799  69.681  17.969  1.00 14.39  ? 237  VAL A CA    1 
ATOM   1749  C  C     . VAL A  1  237 ? 15.739  70.803  17.575  1.00 17.94  ? 237  VAL A C     1 
ATOM   1750  O  O     . VAL A  1  237 ? 15.310  71.945  17.318  1.00 19.84  ? 237  VAL A O     1 
ATOM   1751  C  CB    . VAL A  1  237 ? 14.874  69.363  19.529  1.00 15.69  ? 237  VAL A CB    1 
ATOM   1752  C  CG1   . VAL A  1  237 ? 14.895  70.622  20.364  1.00 17.08  ? 237  VAL A CG1   1 
ATOM   1753  C  CG2   . VAL A  1  237 ? 13.662  68.545  19.935  1.00 12.74  ? 237  VAL A CG2   1 
ATOM   1754  N  N     . THR A  1  238 ? 17.034  70.502  17.491  1.00 18.12  ? 238  THR A N     1 
ATOM   1755  C  CA    . THR A  1  238 ? 17.983  71.537  17.084  1.00 16.26  ? 238  THR A CA    1 
ATOM   1756  C  C     . THR A  1  238 ? 17.653  72.112  15.675  1.00 17.76  ? 238  THR A C     1 
ATOM   1757  O  O     . THR A  1  238 ? 17.744  73.321  15.430  1.00 20.66  ? 238  THR A O     1 
ATOM   1758  C  CB    . THR A  1  238 ? 19.411  70.971  17.088  1.00 13.70  ? 238  THR A CB    1 
ATOM   1759  O  OG1   . THR A  1  238 ? 19.767  70.662  18.432  1.00 18.28  ? 238  THR A OG1   1 
ATOM   1760  C  CG2   . THR A  1  238 ? 20.427  72.003  16.541  1.00 15.98  ? 238  THR A CG2   1 
ATOM   1761  N  N     . ARG A  1  239 ? 17.289  71.246  14.746  1.00 17.38  ? 239  ARG A N     1 
ATOM   1762  C  CA    . ARG A  1  239 ? 16.992  71.722  13.405  1.00 21.83  ? 239  ARG A CA    1 
ATOM   1763  C  C     . ARG A  1  239 ? 15.742  72.584  13.363  1.00 19.63  ? 239  ARG A C     1 
ATOM   1764  O  O     . ARG A  1  239 ? 15.595  73.401  12.479  1.00 23.25  ? 239  ARG A O     1 
ATOM   1765  C  CB    . ARG A  1  239 ? 16.864  70.548  12.415  1.00 19.24  ? 239  ARG A CB    1 
ATOM   1766  C  CG    . ARG A  1  239 ? 18.200  70.109  11.862  1.00 15.35  ? 239  ARG A CG    1 
ATOM   1767  C  CD    . ARG A  1  239 ? 18.041  69.061  10.751  1.00 22.05  ? 239  ARG A CD    1 
ATOM   1768  N  NE    . ARG A  1  239 ? 17.447  67.783  11.193  1.00 20.40  ? 239  ARG A NE    1 
ATOM   1769  C  CZ    . ARG A  1  239 ? 18.132  66.728  11.639  1.00 18.07  ? 239  ARG A CZ    1 
ATOM   1770  N  NH1   . ARG A  1  239 ? 19.470  66.750  11.730  1.00 16.25  ? 239  ARG A NH1   1 
ATOM   1771  N  NH2   . ARG A  1  239 ? 17.464  65.627  11.970  1.00 19.43  ? 239  ARG A NH2   1 
ATOM   1772  N  N     . ALA A  1  240 ? 14.853  72.412  14.322  1.00 18.76  ? 240  ALA A N     1 
ATOM   1773  C  CA    . ALA A  1  240 ? 13.632  73.194  14.328  1.00 20.67  ? 240  ALA A CA    1 
ATOM   1774  C  C     . ALA A  1  240 ? 13.922  74.553  14.969  1.00 23.77  ? 240  ALA A C     1 
ATOM   1775  O  O     . ALA A  1  240 ? 13.019  75.353  15.173  1.00 22.34  ? 240  ALA A O     1 
ATOM   1776  C  CB    . ALA A  1  240 ? 12.572  72.479  15.105  1.00 20.10  ? 240  ALA A CB    1 
ATOM   1777  N  N     . GLY A  1  241 ? 15.183  74.798  15.306  1.00 21.70  ? 241  GLY A N     1 
ATOM   1778  C  CA    . GLY A  1  241 ? 15.536  76.073  15.925  1.00 23.64  ? 241  GLY A CA    1 
ATOM   1779  C  C     . GLY A  1  241 ? 15.258  76.143  17.413  1.00 23.37  ? 241  GLY A C     1 
ATOM   1780  O  O     . GLY A  1  241 ? 15.295  77.218  18.011  1.00 23.70  ? 241  GLY A O     1 
ATOM   1781  N  N     . LEU A  1  242 ? 14.971  75.006  18.028  1.00 18.81  ? 242  LEU A N     1 
ATOM   1782  C  CA    . LEU A  1  242 ? 14.707  74.986  19.457  1.00 21.44  ? 242  LEU A CA    1 
ATOM   1783  C  C     . LEU A  1  242 ? 15.992  74.713  20.281  1.00 21.67  ? 242  LEU A C     1 
ATOM   1784  O  O     . LEU A  1  242 ? 16.974  74.199  19.756  1.00 23.69  ? 242  LEU A O     1 
ATOM   1785  C  CB    . LEU A  1  242 ? 13.662  73.916  19.749  1.00 18.43  ? 242  LEU A CB    1 
ATOM   1786  C  CG    . LEU A  1  242 ? 12.279  74.212  19.201  1.00 22.69  ? 242  LEU A CG    1 
ATOM   1787  C  CD1   . LEU A  1  242 ? 11.362  73.000  19.434  1.00 26.95  ? 242  LEU A CD1   1 
ATOM   1788  C  CD2   . LEU A  1  242 ? 11.736  75.455  19.895  1.00 24.86  ? 242  LEU A CD2   1 
ATOM   1789  N  N     . PRO A  1  243 ? 15.999  75.063  21.580  1.00 20.93  ? 243  PRO A N     1 
ATOM   1790  C  CA    . PRO A  1  243 ? 17.251  74.771  22.302  1.00 20.54  ? 243  PRO A CA    1 
ATOM   1791  C  C     . PRO A  1  243 ? 17.343  73.356  22.908  1.00 19.37  ? 243  PRO A C     1 
ATOM   1792  O  O     . PRO A  1  243 ? 16.333  72.722  23.177  1.00 19.26  ? 243  PRO A O     1 
ATOM   1793  C  CB    . PRO A  1  243 ? 17.256  75.807  23.425  1.00 17.99  ? 243  PRO A CB    1 
ATOM   1794  C  CG    . PRO A  1  243 ? 15.760  75.880  23.813  1.00 15.13  ? 243  PRO A CG    1 
ATOM   1795  C  CD    . PRO A  1  243 ? 15.130  75.969  22.369  1.00 17.98  ? 243  PRO A CD    1 
ATOM   1796  N  N     . CYS A  1  244 ? 18.571  72.864  23.042  1.00 18.62  ? 244  CYS A N     1 
ATOM   1797  C  CA    . CYS A  1  244 ? 18.833  71.634  23.774  1.00 18.44  ? 244  CYS A CA    1 
ATOM   1798  C  C     . CYS A  1  244 ? 19.416  72.176  25.082  1.00 19.38  ? 244  CYS A C     1 
ATOM   1799  O  O     . CYS A  1  244 ? 19.766  73.362  25.179  1.00 19.73  ? 244  CYS A O     1 
ATOM   1800  C  CB    . CYS A  1  244 ? 19.840  70.763  23.067  1.00 21.47  ? 244  CYS A CB    1 
ATOM   1801  S  SG    . CYS A  1  244 ? 19.030  70.011  21.639  1.00 25.45  ? 244  CYS A SG    1 
ATOM   1802  N  N     . GLN A  1  245 ? 19.529  71.330  26.086  1.00 20.27  ? 245  GLN A N     1 
ATOM   1803  C  CA    . GLN A  1  245 ? 20.007  71.778  27.396  1.00 17.73  ? 245  GLN A CA    1 
ATOM   1804  C  C     . GLN A  1  245 ? 21.054  70.886  28.063  1.00 20.09  ? 245  GLN A C     1 
ATOM   1805  O  O     . GLN A  1  245 ? 20.936  69.667  28.022  1.00 20.16  ? 245  GLN A O     1 
ATOM   1806  C  CB    . GLN A  1  245 ? 18.799  71.894  28.303  1.00 19.82  ? 245  GLN A CB    1 
ATOM   1807  C  CG    . GLN A  1  245 ? 19.068  72.123  29.791  1.00 18.87  ? 245  GLN A CG    1 
ATOM   1808  C  CD    . GLN A  1  245 ? 17.776  72.471  30.502  1.00 24.33  ? 245  GLN A CD    1 
ATOM   1809  O  OE1   . GLN A  1  245 ? 17.313  73.603  30.443  1.00 26.28  ? 245  GLN A OE1   1 
ATOM   1810  N  NE2   . GLN A  1  245 ? 17.175  71.496  31.157  1.00 28.42  ? 245  GLN A NE2   1 
ATOM   1811  N  N     . ASP A  1  246 ? 22.076  71.505  28.650  1.00 19.85  ? 246  ASP A N     1 
ATOM   1812  C  CA    . ASP A  1  246 ? 23.110  70.797  29.424  1.00 20.36  ? 246  ASP A CA    1 
ATOM   1813  C  C     . ASP A  1  246 ? 23.823  69.661  28.719  1.00 19.72  ? 246  ASP A C     1 
ATOM   1814  O  O     . ASP A  1  246 ? 24.246  68.687  29.360  1.00 17.01  ? 246  ASP A O     1 
ATOM   1815  C  CB    . ASP A  1  246 ? 22.482  70.245  30.725  1.00 18.79  ? 246  ASP A CB    1 
ATOM   1816  C  CG    . ASP A  1  246 ? 21.957  71.340  31.637  1.00 23.54  ? 246  ASP A CG    1 
ATOM   1817  O  OD1   . ASP A  1  246 ? 22.440  72.504  31.531  1.00 18.71  ? 246  ASP A OD1   1 
ATOM   1818  O  OD2   . ASP A  1  246 ? 21.065  71.037  32.481  1.00 25.01  ? 246  ASP A OD2   1 
ATOM   1819  N  N     . LEU A  1  247 ? 23.950  69.777  27.406  1.00 16.90  ? 247  LEU A N     1 
ATOM   1820  C  CA    . LEU A  1  247 ? 24.603  68.762  26.623  1.00 18.81  ? 247  LEU A CA    1 
ATOM   1821  C  C     . LEU A  1  247 ? 26.041  68.542  27.026  1.00 17.64  ? 247  LEU A C     1 
ATOM   1822  O  O     . LEU A  1  247 ? 26.551  67.466  26.769  1.00 19.04  ? 247  LEU A O     1 
ATOM   1823  C  CB    . LEU A  1  247 ? 24.529  69.091  25.109  1.00 17.77  ? 247  LEU A CB    1 
ATOM   1824  C  CG    . LEU A  1  247 ? 23.110  69.075  24.529  1.00 20.54  ? 247  LEU A CG    1 
ATOM   1825  C  CD1   . LEU A  1  247 ? 23.154  69.126  23.000  1.00 13.45  ? 247  LEU A CD1   1 
ATOM   1826  C  CD2   . LEU A  1  247 ? 22.394  67.791  24.941  1.00 20.59  ? 247  LEU A CD2   1 
ATOM   1827  N  N     . GLU A  1  248 ? 26.706  69.523  27.640  1.00 16.77  ? 248  GLU A N     1 
ATOM   1828  C  CA    . GLU A  1  248 ? 28.102  69.288  28.042  1.00 20.78  ? 248  GLU A CA    1 
ATOM   1829  C  C     . GLU A  1  248 ? 28.239  68.295  29.211  1.00 19.42  ? 248  GLU A C     1 
ATOM   1830  O  O     . GLU A  1  248 ? 29.350  67.908  29.574  1.00 15.84  ? 248  GLU A O     1 
ATOM   1831  C  CB    . GLU A  1  248 ? 28.823  70.580  28.449  1.00 22.15  ? 248  GLU A CB    1 
ATOM   1832  C  CG    . GLU A  1  248 ? 28.313  71.228  29.753  1.00 26.04  ? 248  GLU A CG    1 
ATOM   1833  C  CD    . GLU A  1  248 ? 27.196  72.218  29.497  1.00 27.08  ? 248  GLU A CD    1 
ATOM   1834  O  OE1   . GLU A  1  248 ? 26.493  72.041  28.471  1.00 19.75  ? 248  GLU A OE1   1 
ATOM   1835  O  OE2   . GLU A  1  248 ? 27.032  73.159  30.312  1.00 27.19  ? 248  GLU A OE2   1 
ATOM   1836  N  N     . PHE A  1  249 ? 27.127  67.910  29.817  1.00 14.80  ? 249  PHE A N     1 
ATOM   1837  C  CA    . PHE A  1  249 ? 27.187  66.959  30.918  1.00 16.25  ? 249  PHE A CA    1 
ATOM   1838  C  C     . PHE A  1  249 ? 27.069  65.518  30.454  1.00 13.87  ? 249  PHE A C     1 
ATOM   1839  O  O     . PHE A  1  249 ? 25.968  64.972  30.279  1.00 12.90  ? 249  PHE A O     1 
ATOM   1840  C  CB    . PHE A  1  249 ? 26.129  67.289  31.949  1.00 16.49  ? 249  PHE A CB    1 
ATOM   1841  C  CG    . PHE A  1  249 ? 26.406  68.562  32.679  1.00 22.13  ? 249  PHE A CG    1 
ATOM   1842  C  CD1   . PHE A  1  249 ? 25.869  69.762  32.233  1.00 17.47  ? 249  PHE A CD1   1 
ATOM   1843  C  CD2   . PHE A  1  249 ? 27.260  68.568  33.789  1.00 12.31  ? 249  PHE A CD2   1 
ATOM   1844  C  CE1   . PHE A  1  249 ? 26.194  70.983  32.883  1.00 24.21  ? 249  PHE A CE1   1 
ATOM   1845  C  CE2   . PHE A  1  249 ? 27.586  69.769  34.432  1.00 20.77  ? 249  PHE A CE2   1 
ATOM   1846  C  CZ    . PHE A  1  249 ? 27.060  70.981  33.981  1.00 16.86  ? 249  PHE A CZ    1 
ATOM   1847  N  N     . VAL A  1  250 ? 28.236  64.916  30.247  1.00 16.13  ? 250  VAL A N     1 
ATOM   1848  C  CA    . VAL A  1  250 ? 28.320  63.540  29.776  1.00 16.73  ? 250  VAL A CA    1 
ATOM   1849  C  C     . VAL A  1  250 ? 28.769  62.554  30.857  1.00 17.93  ? 250  VAL A C     1 
ATOM   1850  O  O     . VAL A  1  250 ? 29.814  62.696  31.443  1.00 15.79  ? 250  VAL A O     1 
ATOM   1851  C  CB    . VAL A  1  250 ? 29.295  63.441  28.575  1.00 20.29  ? 250  VAL A CB    1 
ATOM   1852  C  CG1   . VAL A  1  250 ? 29.413  61.978  28.130  1.00 21.18  ? 250  VAL A CG1   1 
ATOM   1853  C  CG2   . VAL A  1  250 ? 28.799  64.360  27.403  1.00 12.88  ? 250  VAL A CG2   1 
ATOM   1854  N  N     . GLN A  1  251 ? 27.979  61.534  31.107  1.00 16.49  ? 251  GLN A N     1 
ATOM   1855  C  CA    . GLN A  1  251 ? 28.365  60.567  32.101  1.00 18.18  ? 251  GLN A CA    1 
ATOM   1856  C  C     . GLN A  1  251 ? 29.306  59.460  31.653  1.00 19.92  ? 251  GLN A C     1 
ATOM   1857  O  O     . GLN A  1  251 ? 28.991  58.696  30.722  1.00 18.47  ? 251  GLN A O     1 
ATOM   1858  C  CB    . GLN A  1  251 ? 27.137  59.883  32.692  1.00 19.75  ? 251  GLN A CB    1 
ATOM   1859  C  CG    . GLN A  1  251 ? 27.504  58.724  33.661  1.00 16.16  ? 251  GLN A CG    1 
ATOM   1860  C  CD    . GLN A  1  251 ? 26.390  58.433  34.639  1.00 15.79  ? 251  GLN A CD    1 
ATOM   1861  O  OE1   . GLN A  1  251 ? 25.650  57.458  34.474  1.00 21.58  ? 251  GLN A OE1   1 
ATOM   1862  N  NE2   . GLN A  1  251 ? 26.248  59.288  35.661  1.00 11.10  ? 251  GLN A NE2   1 
ATOM   1863  N  N     . PHE A  1  252 ? 30.435  59.340  32.363  1.00 17.93  ? 252  PHE A N     1 
ATOM   1864  C  CA    . PHE A  1  252 ? 31.375  58.270  32.115  1.00 13.49  ? 252  PHE A CA    1 
ATOM   1865  C  C     . PHE A  1  252 ? 31.069  57.240  33.190  1.00 18.59  ? 252  PHE A C     1 
ATOM   1866  O  O     . PHE A  1  252 ? 31.112  57.552  34.409  1.00 18.13  ? 252  PHE A O     1 
ATOM   1867  C  CB    . PHE A  1  252 ? 32.821  58.749  32.249  1.00 20.65  ? 252  PHE A CB    1 
ATOM   1868  C  CG    . PHE A  1  252 ? 33.183  59.858  31.285  1.00 23.97  ? 252  PHE A CG    1 
ATOM   1869  C  CD1   . PHE A  1  252 ? 32.824  61.176  31.553  1.00 27.43  ? 252  PHE A CD1   1 
ATOM   1870  C  CD2   . PHE A  1  252 ? 33.827  59.570  30.094  1.00 22.61  ? 252  PHE A CD2   1 
ATOM   1871  C  CE1   . PHE A  1  252 ? 33.101  62.180  30.637  1.00 27.69  ? 252  PHE A CE1   1 
ATOM   1872  C  CE2   . PHE A  1  252 ? 34.102  60.557  29.191  1.00 23.85  ? 252  PHE A CE2   1 
ATOM   1873  C  CZ    . PHE A  1  252 ? 33.742  61.857  29.451  1.00 21.80  ? 252  PHE A CZ    1 
ATOM   1874  N  N     . HIS A  1  253 ? 30.711  56.032  32.762  1.00 12.80  ? 253  HIS A N     1 
ATOM   1875  C  CA    . HIS A  1  253 ? 30.420  54.950  33.713  1.00 19.58  ? 253  HIS A CA    1 
ATOM   1876  C  C     . HIS A  1  253 ? 31.800  54.406  34.123  1.00 19.16  ? 253  HIS A C     1 
ATOM   1877  O  O     . HIS A  1  253 ? 32.687  54.225  33.285  1.00 17.91  ? 253  HIS A O     1 
ATOM   1878  C  CB    . HIS A  1  253 ? 29.571  53.850  33.066  1.00 14.79  ? 253  HIS A CB    1 
ATOM   1879  C  CG    . HIS A  1  253 ? 29.064  52.817  34.038  1.00 16.42  ? 253  HIS A CG    1 
ATOM   1880  N  ND1   . HIS A  1  253 ? 29.891  51.899  34.661  1.00 13.37  ? 253  HIS A ND1   1 
ATOM   1881  C  CD2   . HIS A  1  253 ? 27.809  52.529  34.448  1.00 14.53  ? 253  HIS A CD2   1 
ATOM   1882  C  CE1   . HIS A  1  253 ? 29.164  51.088  35.411  1.00 18.25  ? 253  HIS A CE1   1 
ATOM   1883  N  NE2   . HIS A  1  253 ? 27.895  51.447  35.300  1.00 19.00  ? 253  HIS A NE2   1 
ATOM   1884  N  N     . PRO A  1  254 ? 32.001  54.177  35.422  1.00 19.03  ? 254  PRO A N     1 
ATOM   1885  C  CA    . PRO A  1  254 ? 33.281  53.677  35.947  1.00 20.11  ? 254  PRO A CA    1 
ATOM   1886  C  C     . PRO A  1  254 ? 33.752  52.369  35.337  1.00 21.32  ? 254  PRO A C     1 
ATOM   1887  O  O     . PRO A  1  254 ? 34.956  52.185  35.127  1.00 17.17  ? 254  PRO A O     1 
ATOM   1888  C  CB    . PRO A  1  254 ? 33.009  53.504  37.463  1.00 19.34  ? 254  PRO A CB    1 
ATOM   1889  C  CG    . PRO A  1  254 ? 31.942  54.521  37.739  1.00 22.50  ? 254  PRO A CG    1 
ATOM   1890  C  CD    . PRO A  1  254 ? 31.047  54.486  36.507  1.00 17.66  ? 254  PRO A CD    1 
ATOM   1891  N  N     . THR A  1  255 ? 32.822  51.451  35.055  1.00 17.15  ? 255  THR A N     1 
ATOM   1892  C  CA    . THR A  1  255 ? 33.267  50.164  34.562  1.00 15.91  ? 255  THR A CA    1 
ATOM   1893  C  C     . THR A  1  255 ? 32.815  49.606  33.202  1.00 19.10  ? 255  THR A C     1 
ATOM   1894  O  O     . THR A  1  255 ? 31.953  48.743  33.130  1.00 21.78  ? 255  THR A O     1 
ATOM   1895  C  CB    . THR A  1  255 ? 33.034  49.067  35.657  1.00 14.85  ? 255  THR A CB    1 
ATOM   1896  O  OG1   . THR A  1  255 ? 31.650  48.978  36.016  1.00 17.63  ? 255  THR A OG1   1 
ATOM   1897  C  CG2   . THR A  1  255 ? 33.790  49.446  36.917  1.00 20.28  ? 255  THR A CG2   1 
ATOM   1898  N  N     . GLY A  1  256 ? 33.391  50.105  32.120  1.00 14.38  ? 256  GLY A N     1 
ATOM   1899  C  CA    . GLY A  1  256 ? 33.077  49.522  30.836  1.00 18.01  ? 256  GLY A CA    1 
ATOM   1900  C  C     . GLY A  1  256 ? 34.223  48.529  30.730  1.00 19.55  ? 256  GLY A C     1 
ATOM   1901  O  O     . GLY A  1  256 ? 35.316  48.829  31.195  1.00 22.56  ? 256  GLY A O     1 
ATOM   1902  N  N     . ILE A  1  257 ? 34.011  47.359  30.153  1.00 20.08  ? 257  ILE A N     1 
ATOM   1903  C  CA    . ILE A  1  257 ? 35.087  46.397  30.061  1.00 23.23  ? 257  ILE A CA    1 
ATOM   1904  C  C     . ILE A  1  257 ? 36.218  46.888  29.103  1.00 23.15  ? 257  ILE A C     1 
ATOM   1905  O  O     . ILE A  1  257 ? 35.961  47.426  28.030  1.00 21.44  ? 257  ILE A O     1 
ATOM   1906  C  CB    . ILE A  1  257 ? 34.530  45.043  29.619  1.00 25.04  ? 257  ILE A CB    1 
ATOM   1907  C  CG1   . ILE A  1  257 ? 35.410  43.929  30.149  1.00 28.08  ? 257  ILE A CG1   1 
ATOM   1908  C  CG2   . ILE A  1  257 ? 34.464  44.958  28.088  1.00 26.37  ? 257  ILE A CG2   1 
ATOM   1909  C  CD1   . ILE A  1  257 ? 34.771  42.554  29.973  1.00 36.01  ? 257  ILE A CD1   1 
ATOM   1910  N  N     . TYR A  1  258 ? 37.463  46.712  29.519  1.00 24.87  ? 258  TYR A N     1 
ATOM   1911  C  CA    . TYR A  1  258 ? 38.621  47.128  28.716  1.00 22.90  ? 258  TYR A CA    1 
ATOM   1912  C  C     . TYR A  1  258 ? 38.613  46.519  27.306  1.00 24.06  ? 258  TYR A C     1 
ATOM   1913  O  O     . TYR A  1  258 ? 38.467  45.319  27.132  1.00 23.64  ? 258  TYR A O     1 
ATOM   1914  C  CB    . TYR A  1  258 ? 39.897  46.730  29.453  1.00 24.97  ? 258  TYR A CB    1 
ATOM   1915  C  CG    . TYR A  1  258 ? 41.144  47.152  28.727  1.00 28.36  ? 258  TYR A CG    1 
ATOM   1916  C  CD1   . TYR A  1  258 ? 41.455  48.500  28.592  1.00 29.08  ? 258  TYR A CD1   1 
ATOM   1917  C  CD2   . TYR A  1  258 ? 41.977  46.208  28.109  1.00 28.27  ? 258  TYR A CD2   1 
ATOM   1918  C  CE1   . TYR A  1  258 ? 42.550  48.916  27.869  1.00 30.26  ? 258  TYR A CE1   1 
ATOM   1919  C  CE2   . TYR A  1  258 ? 43.094  46.617  27.364  1.00 27.05  ? 258  TYR A CE2   1 
ATOM   1920  C  CZ    . TYR A  1  258 ? 43.371  47.979  27.260  1.00 30.68  ? 258  TYR A CZ    1 
ATOM   1921  O  OH    . TYR A  1  258 ? 44.507  48.421  26.616  1.00 32.93  ? 258  TYR A OH    1 
ATOM   1922  N  N     . GLY A  1  259 ? 38.771  47.350  26.289  1.00 26.81  ? 259  GLY A N     1 
ATOM   1923  C  CA    . GLY A  1  259 ? 38.759  46.816  24.940  1.00 28.94  ? 259  GLY A CA    1 
ATOM   1924  C  C     . GLY A  1  259 ? 37.396  46.989  24.296  1.00 29.94  ? 259  GLY A C     1 
ATOM   1925  O  O     . GLY A  1  259 ? 37.111  48.013  23.689  1.00 31.21  ? 259  GLY A O     1 
ATOM   1926  N  N     . ALA A  1  260 ? 36.554  45.978  24.444  1.00 29.71  ? 260  ALA A N     1 
ATOM   1927  C  CA    . ALA A  1  260 ? 35.208  45.980  23.908  1.00 26.21  ? 260  ALA A CA    1 
ATOM   1928  C  C     . ALA A  1  260 ? 34.373  47.182  24.342  1.00 24.66  ? 260  ALA A C     1 
ATOM   1929  O  O     . ALA A  1  260 ? 33.602  47.704  23.552  1.00 24.63  ? 260  ALA A O     1 
ATOM   1930  C  CB    . ALA A  1  260 ? 34.504  44.682  24.333  1.00 29.71  ? 260  ALA A CB    1 
ATOM   1931  N  N     . GLY A  1  261 ? 34.499  47.627  25.595  1.00 23.10  ? 261  GLY A N     1 
ATOM   1932  C  CA    . GLY A  1  261 ? 33.685  48.753  26.018  1.00 21.58  ? 261  GLY A CA    1 
ATOM   1933  C  C     . GLY A  1  261 ? 32.337  48.370  26.659  1.00 25.09  ? 261  GLY A C     1 
ATOM   1934  O  O     . GLY A  1  261 ? 31.657  49.205  27.252  1.00 22.34  ? 261  GLY A O     1 
ATOM   1935  N  N     . CYS A  1  262 ? 31.956  47.099  26.560  1.00 23.43  ? 262  CYS A N     1 
ATOM   1936  C  CA    . CYS A  1  262 ? 30.695  46.591  27.118  1.00 24.25  ? 262  CYS A CA    1 
ATOM   1937  C  C     . CYS A  1  262 ? 30.571  46.908  28.605  1.00 23.76  ? 262  CYS A C     1 
ATOM   1938  O  O     . CYS A  1  262 ? 31.521  46.758  29.350  1.00 19.92  ? 262  CYS A O     1 
ATOM   1939  C  CB    . CYS A  1  262 ? 30.633  45.068  26.954  1.00 27.53  ? 262  CYS A CB    1 
ATOM   1940  S  SG    . CYS A  1  262 ? 30.890  44.543  25.258  1.00 40.27  ? 262  CYS A SG    1 
ATOM   1941  N  N     . LEU A  1  263 ? 29.382  47.308  29.033  1.00 19.37  ? 263  LEU A N     1 
ATOM   1942  C  CA    . LEU A  1  263 ? 29.172  47.641  30.420  1.00 22.58  ? 263  LEU A CA    1 
ATOM   1943  C  C     . LEU A  1  263 ? 29.244  46.449  31.387  1.00 21.16  ? 263  LEU A C     1 
ATOM   1944  O  O     . LEU A  1  263 ? 28.732  45.371  31.106  1.00 20.69  ? 263  LEU A O     1 
ATOM   1945  C  CB    . LEU A  1  263 ? 27.797  48.308  30.601  1.00 22.21  ? 263  LEU A CB    1 
ATOM   1946  C  CG    . LEU A  1  263 ? 27.544  48.585  32.089  1.00 25.31  ? 263  LEU A CG    1 
ATOM   1947  C  CD1   . LEU A  1  263 ? 27.932  50.012  32.432  1.00 25.51  ? 263  LEU A CD1   1 
ATOM   1948  C  CD2   . LEU A  1  263 ? 26.106  48.336  32.422  1.00 24.65  ? 263  LEU A CD2   1 
ATOM   1949  N  N     . ILE A  1  264 ? 29.872  46.669  32.535  1.00 21.79  ? 264  ILE A N     1 
ATOM   1950  C  CA    . ILE A  1  264 ? 29.933  45.663  33.596  1.00 18.89  ? 264  ILE A CA    1 
ATOM   1951  C  C     . ILE A  1  264 ? 29.154  46.386  34.698  1.00 18.15  ? 264  ILE A C     1 
ATOM   1952  O  O     . ILE A  1  264 ? 29.575  47.415  35.224  1.00 17.53  ? 264  ILE A O     1 
ATOM   1953  C  CB    . ILE A  1  264 ? 31.360  45.365  34.057  1.00 19.51  ? 264  ILE A CB    1 
ATOM   1954  C  CG1   . ILE A  1  264 ? 32.133  44.682  32.935  1.00 18.92  ? 264  ILE A CG1   1 
ATOM   1955  C  CG2   . ILE A  1  264 ? 31.311  44.450  35.270  1.00 19.49  ? 264  ILE A CG2   1 
ATOM   1956  C  CD1   . ILE A  1  264 ? 31.587  43.279  32.553  1.00 22.53  ? 264  ILE A CD1   1 
ATOM   1957  N  N     . THR A  1  265 ? 28.009  45.849  35.061  1.00 17.76  ? 265  THR A N     1 
ATOM   1958  C  CA    . THR A  1  265 ? 27.187  46.595  35.990  1.00 20.36  ? 265  THR A CA    1 
ATOM   1959  C  C     . THR A  1  265 ? 27.759  47.030  37.321  1.00 19.29  ? 265  THR A C     1 
ATOM   1960  O  O     . THR A  1  265 ? 28.557  46.341  37.921  1.00 13.42  ? 265  THR A O     1 
ATOM   1961  C  CB    . THR A  1  265 ? 25.872  45.881  36.305  1.00 20.79  ? 265  THR A CB    1 
ATOM   1962  O  OG1   . THR A  1  265 ? 25.159  46.670  37.261  1.00 18.46  ? 265  THR A OG1   1 
ATOM   1963  C  CG2   . THR A  1  265 ? 26.137  44.519  36.925  1.00 19.53  ? 265  THR A CG2   1 
ATOM   1964  N  N     . GLU A  1  266 ? 27.293  48.201  37.740  1.00 14.38  ? 266  GLU A N     1 
ATOM   1965  C  CA    . GLU A  1  266 ? 27.613  48.804  39.000  1.00 19.89  ? 266  GLU A CA    1 
ATOM   1966  C  C     . GLU A  1  266 ? 26.966  47.885  40.078  1.00 18.82  ? 266  GLU A C     1 
ATOM   1967  O  O     . GLU A  1  266 ? 27.277  47.977  41.271  1.00 22.30  ? 266  GLU A O     1 
ATOM   1968  C  CB    . GLU A  1  266 ? 27.041  50.244  39.013  1.00 17.68  ? 266  GLU A CB    1 
ATOM   1969  C  CG    . GLU A  1  266 ? 26.917  50.907  40.403  1.00 20.26  ? 266  GLU A CG    1 
ATOM   1970  C  CD    . GLU A  1  266 ? 27.009  52.447  40.296  1.00 25.74  ? 266  GLU A CD    1 
ATOM   1971  O  OE1   . GLU A  1  266 ? 26.300  53.158  41.069  1.00 22.49  ? 266  GLU A OE1   1 
ATOM   1972  O  OE2   . GLU A  1  266 ? 27.798  52.938  39.444  1.00 18.41  ? 266  GLU A OE2   1 
ATOM   1973  N  N     . GLY A  1  267 ? 26.069  46.994  39.642  1.00 20.91  ? 267  GLY A N     1 
ATOM   1974  C  CA    . GLY A  1  267 ? 25.469  46.025  40.562  1.00 17.16  ? 267  GLY A CA    1 
ATOM   1975  C  C     . GLY A  1  267 ? 26.594  45.150  41.124  1.00 18.80  ? 267  GLY A C     1 
ATOM   1976  O  O     . GLY A  1  267 ? 26.485  44.608  42.237  1.00 19.61  ? 267  GLY A O     1 
ATOM   1977  N  N     . CYS A  1  268 ? 27.686  45.006  40.362  1.00 17.10  ? 268  CYS A N     1 
ATOM   1978  C  CA    . CYS A  1  268 ? 28.844  44.221  40.848  1.00 20.32  ? 268  CYS A CA    1 
ATOM   1979  C  C     . CYS A  1  268 ? 29.348  44.816  42.164  1.00 18.97  ? 268  CYS A C     1 
ATOM   1980  O  O     . CYS A  1  268 ? 29.565  44.093  43.135  1.00 25.37  ? 268  CYS A O     1 
ATOM   1981  C  CB    . CYS A  1  268 ? 29.980  44.219  39.850  1.00 19.40  ? 268  CYS A CB    1 
ATOM   1982  S  SG    . CYS A  1  268 ? 29.694  43.239  38.360  1.00 25.16  ? 268  CYS A SG    1 
ATOM   1983  N  N     . ARG A  1  269 ? 29.531  46.131  42.192  1.00 20.26  ? 269  ARG A N     1 
ATOM   1984  C  CA    . ARG A  1  269 ? 29.964  46.813  43.406  1.00 17.45  ? 269  ARG A CA    1 
ATOM   1985  C  C     . ARG A  1  269 ? 28.831  46.815  44.427  1.00 20.92  ? 269  ARG A C     1 
ATOM   1986  O  O     . ARG A  1  269 ? 29.086  46.696  45.631  1.00 20.65  ? 269  ARG A O     1 
ATOM   1987  C  CB    . ARG A  1  269 ? 30.440  48.245  43.080  1.00 18.10  ? 269  ARG A CB    1 
ATOM   1988  C  CG    . ARG A  1  269 ? 31.759  48.253  42.294  1.00 22.98  ? 269  ARG A CG    1 
ATOM   1989  C  CD    . ARG A  1  269 ? 32.148  49.647  41.794  1.00 23.28  ? 269  ARG A CD    1 
ATOM   1990  N  NE    . ARG A  1  269 ? 31.431  50.021  40.591  1.00 21.00  ? 269  ARG A NE    1 
ATOM   1991  C  CZ    . ARG A  1  269 ? 30.890  51.215  40.360  1.00 23.27  ? 269  ARG A CZ    1 
ATOM   1992  N  NH1   . ARG A  1  269 ? 30.964  52.190  41.273  1.00 23.05  ? 269  ARG A NH1   1 
ATOM   1993  N  NH2   . ARG A  1  269 ? 30.289  51.441  39.199  1.00 20.81  ? 269  ARG A NH2   1 
ATOM   1994  N  N     . GLY A  1  270 ? 27.574  46.901  43.970  1.00 19.20  ? 270  GLY A N     1 
ATOM   1995  C  CA    . GLY A  1  270 ? 26.472  46.874  44.922  1.00 16.85  ? 270  GLY A CA    1 
ATOM   1996  C  C     . GLY A  1  270 ? 26.450  45.551  45.707  1.00 22.73  ? 270  GLY A C     1 
ATOM   1997  O  O     . GLY A  1  270 ? 26.118  45.514  46.889  1.00 14.43  ? 270  GLY A O     1 
ATOM   1998  N  N     . GLU A  1  271 ? 26.823  44.456  45.044  1.00 19.86  ? 271  GLU A N     1 
ATOM   1999  C  CA    . GLU A  1  271 ? 26.847  43.144  45.685  1.00 22.95  ? 271  GLU A CA    1 
ATOM   2000  C  C     . GLU A  1  271 ? 28.158  42.851  46.460  1.00 24.81  ? 271  GLU A C     1 
ATOM   2001  O  O     . GLU A  1  271 ? 28.320  41.755  46.989  1.00 21.26  ? 271  GLU A O     1 
ATOM   2002  C  CB    . GLU A  1  271 ? 26.642  42.050  44.636  1.00 20.96  ? 271  GLU A CB    1 
ATOM   2003  C  CG    . GLU A  1  271 ? 25.354  42.164  43.820  1.00 26.53  ? 271  GLU A CG    1 
ATOM   2004  C  CD    . GLU A  1  271 ? 24.114  41.673  44.569  1.00 30.00  ? 271  GLU A CD    1 
ATOM   2005  O  OE1   . GLU A  1  271 ? 24.274  41.086  45.668  1.00 31.05  ? 271  GLU A OE1   1 
ATOM   2006  O  OE2   . GLU A  1  271 ? 22.975  41.848  44.041  1.00 32.50  ? 271  GLU A OE2   1 
ATOM   2007  N  N     . GLY A  1  272 ? 29.094  43.806  46.509  1.00 23.55  ? 272  GLY A N     1 
ATOM   2008  C  CA    . GLY A  1  272 ? 30.329  43.562  47.252  1.00 18.74  ? 272  GLY A CA    1 
ATOM   2009  C  C     . GLY A  1  272 ? 31.634  43.575  46.488  1.00 22.91  ? 272  GLY A C     1 
ATOM   2010  O  O     . GLY A  1  272 ? 32.711  43.455  47.095  1.00 20.49  ? 272  GLY A O     1 
ATOM   2011  N  N     . GLY A  1  273 ? 31.568  43.718  45.159  1.00 19.92  ? 273  GLY A N     1 
ATOM   2012  C  CA    . GLY A  1  273 ? 32.800  43.734  44.401  1.00 21.52  ? 273  GLY A CA    1 
ATOM   2013  C  C     . GLY A  1  273 ? 33.576  44.993  44.705  1.00 19.84  ? 273  GLY A C     1 
ATOM   2014  O  O     . GLY A  1  273 ? 32.989  45.962  45.158  1.00 17.04  ? 273  GLY A O     1 
ATOM   2015  N  N     . ILE A  1  274 ? 34.876  44.996  44.419  1.00 19.28  ? 274  ILE A N     1 
ATOM   2016  C  CA    . ILE A  1  274 ? 35.691  46.178  44.678  1.00 21.32  ? 274  ILE A CA    1 
ATOM   2017  C  C     . ILE A  1  274 ? 36.646  46.526  43.538  1.00 19.14  ? 274  ILE A C     1 
ATOM   2018  O  O     . ILE A  1  274 ? 37.006  45.663  42.735  1.00 14.70  ? 274  ILE A O     1 
ATOM   2019  C  CB    . ILE A  1  274 ? 36.541  45.976  45.934  1.00 24.70  ? 274  ILE A CB    1 
ATOM   2020  C  CG1   . ILE A  1  274 ? 37.453  44.770  45.740  1.00 19.24  ? 274  ILE A CG1   1 
ATOM   2021  C  CG2   . ILE A  1  274 ? 35.624  45.771  47.149  1.00 22.23  ? 274  ILE A CG2   1 
ATOM   2022  C  CD1   . ILE A  1  274 ? 38.507  44.647  46.823  1.00 24.06  ? 274  ILE A CD1   1 
ATOM   2023  N  N     . LEU A  1  275 ? 37.029  47.801  43.450  1.00 14.21  ? 275  LEU A N     1 
ATOM   2024  C  CA    . LEU A  1  275 ? 37.988  48.201  42.428  1.00 20.11  ? 275  LEU A CA    1 
ATOM   2025  C  C     . LEU A  1  275 ? 39.422  48.169  43.007  1.00 18.82  ? 275  LEU A C     1 
ATOM   2026  O  O     . LEU A  1  275 ? 39.671  48.660  44.117  1.00 18.18  ? 275  LEU A O     1 
ATOM   2027  C  CB    . LEU A  1  275 ? 37.704  49.629  41.973  1.00 22.27  ? 275  LEU A CB    1 
ATOM   2028  C  CG    . LEU A  1  275 ? 36.363  49.881  41.286  1.00 24.26  ? 275  LEU A CG    1 
ATOM   2029  C  CD1   . LEU A  1  275 ? 36.132  51.406  41.204  1.00 22.41  ? 275  LEU A CD1   1 
ATOM   2030  C  CD2   . LEU A  1  275 ? 36.375  49.257  39.917  1.00 16.93  ? 275  LEU A CD2   1 
ATOM   2031  N  N     . ILE A  1  276 ? 40.362  47.594  42.284  1.00 22.52  ? 276  ILE A N     1 
ATOM   2032  C  CA    . ILE A  1  276 ? 41.739  47.618  42.776  1.00 21.69  ? 276  ILE A CA    1 
ATOM   2033  C  C     . ILE A  1  276 ? 42.671  48.092  41.667  1.00 20.63  ? 276  ILE A C     1 
ATOM   2034  O  O     . ILE A  1  276 ? 42.345  47.982  40.478  1.00 20.20  ? 276  ILE A O     1 
ATOM   2035  C  CB    . ILE A  1  276 ? 42.230  46.241  43.306  1.00 20.78  ? 276  ILE A CB    1 
ATOM   2036  C  CG1   . ILE A  1  276 ? 42.158  45.221  42.203  1.00 20.24  ? 276  ILE A CG1   1 
ATOM   2037  C  CG2   . ILE A  1  276 ? 41.426  45.807  44.575  1.00 19.35  ? 276  ILE A CG2   1 
ATOM   2038  C  CD1   . ILE A  1  276 ? 42.761  43.867  42.543  1.00 22.36  ? 276  ILE A CD1   1 
ATOM   2039  N  N     . ASN A  1  277 ? 43.817  48.654  42.050  1.00 20.22  ? 277  ASN A N     1 
ATOM   2040  C  CA    . ASN A  1  277 ? 44.802  49.115  41.068  1.00 15.34  ? 277  ASN A CA    1 
ATOM   2041  C  C     . ASN A  1  277 ? 45.893  48.078  40.928  1.00 18.42  ? 277  ASN A C     1 
ATOM   2042  O  O     . ASN A  1  277 ? 45.733  46.954  41.387  1.00 17.70  ? 277  ASN A O     1 
ATOM   2043  C  CB    . ASN A  1  277 ? 45.398  50.471  41.454  1.00 18.14  ? 277  ASN A CB    1 
ATOM   2044  C  CG    . ASN A  1  277 ? 46.023  50.478  42.849  1.00 21.36  ? 277  ASN A CG    1 
ATOM   2045  O  OD1   . ASN A  1  277 ? 46.469  49.440  43.372  1.00 18.64  ? 277  ASN A OD1   1 
ATOM   2046  N  ND2   . ASN A  1  277 ? 46.076  51.654  43.443  1.00 19.08  ? 277  ASN A ND2   1 
ATOM   2047  N  N     . SER A  1  278 ? 47.006  48.440  40.299  1.00 20.81  ? 278  SER A N     1 
ATOM   2048  C  CA    . SER A  1  278 ? 48.065  47.461  40.071  1.00 21.39  ? 278  SER A CA    1 
ATOM   2049  C  C     . SER A  1  278 ? 48.825  47.060  41.310  1.00 25.23  ? 278  SER A C     1 
ATOM   2050  O  O     . SER A  1  278 ? 49.552  46.092  41.280  1.00 29.32  ? 278  SER A O     1 
ATOM   2051  C  CB    . SER A  1  278 ? 49.038  47.954  39.000  1.00 18.75  ? 278  SER A CB    1 
ATOM   2052  O  OG    . SER A  1  278 ? 49.528  49.234  39.337  1.00 22.73  ? 278  SER A OG    1 
ATOM   2053  N  N     . GLN A  1  279 ? 48.656  47.791  42.402  1.00 26.86  ? 279  GLN A N     1 
ATOM   2054  C  CA    . GLN A  1  279 ? 49.326  47.444  43.634  1.00 27.10  ? 279  GLN A CA    1 
ATOM   2055  C  C     . GLN A  1  279 ? 48.348  46.640  44.510  1.00 32.40  ? 279  GLN A C     1 
ATOM   2056  O  O     . GLN A  1  279 ? 48.630  46.337  45.662  1.00 30.20  ? 279  GLN A O     1 
ATOM   2057  C  CB    . GLN A  1  279 ? 49.753  48.717  44.355  1.00 26.48  ? 279  GLN A CB    1 
ATOM   2058  C  CG    . GLN A  1  279 ? 50.926  49.430  43.718  1.00 31.36  ? 279  GLN A CG    1 
ATOM   2059  C  CD    . GLN A  1  279 ? 51.241  50.745  44.389  1.00 35.06  ? 279  GLN A CD    1 
ATOM   2060  O  OE1   . GLN A  1  279 ? 50.962  50.931  45.567  1.00 46.49  ? 279  GLN A OE1   1 
ATOM   2061  N  NE2   . GLN A  1  279 ? 51.836  51.666  43.644  1.00 41.09  ? 279  GLN A NE2   1 
ATOM   2062  N  N     . GLY A  1  280 ? 47.186  46.301  43.962  1.00 31.21  ? 280  GLY A N     1 
ATOM   2063  C  CA    . GLY A  1  280 ? 46.232  45.555  44.746  1.00 27.12  ? 280  GLY A CA    1 
ATOM   2064  C  C     . GLY A  1  280 ? 45.478  46.426  45.733  1.00 29.47  ? 280  GLY A C     1 
ATOM   2065  O  O     . GLY A  1  280 ? 44.674  45.917  46.510  1.00 30.34  ? 280  GLY A O     1 
ATOM   2066  N  N     . GLU A  1  281 ? 45.705  47.733  45.709  1.00 26.53  ? 281  GLU A N     1 
ATOM   2067  C  CA    . GLU A  1  281 ? 45.021  48.607  46.645  1.00 26.68  ? 281  GLU A CA    1 
ATOM   2068  C  C     . GLU A  1  281 ? 43.565  48.909  46.262  1.00 24.94  ? 281  GLU A C     1 
ATOM   2069  O  O     . GLU A  1  281 ? 43.240  49.166  45.087  1.00 22.48  ? 281  GLU A O     1 
ATOM   2070  C  CB    . GLU A  1  281 ? 45.770  49.939  46.794  1.00 26.42  ? 281  GLU A CB    1 
ATOM   2071  C  CG    . GLU A  1  281 ? 44.988  50.999  47.604  1.00 34.56  ? 281  GLU A CG    1 
ATOM   2072  C  CD    . GLU A  1  281 ? 45.440  52.456  47.346  1.00 38.21  ? 281  GLU A CD    1 
ATOM   2073  O  OE1   . GLU A  1  281 ? 46.130  52.724  46.336  1.00 41.03  ? 281  GLU A OE1   1 
ATOM   2074  O  OE2   . GLU A  1  281 ? 45.079  53.342  48.151  1.00 40.23  ? 281  GLU A OE2   1 
ATOM   2075  N  N     . ARG A  1  282 ? 42.695  48.850  47.266  1.00 25.56  ? 282  ARG A N     1 
ATOM   2076  C  CA    . ARG A  1  282 ? 41.283  49.189  47.107  1.00 20.36  ? 282  ARG A CA    1 
ATOM   2077  C  C     . ARG A  1  282 ? 41.302  50.713  47.250  1.00 22.72  ? 282  ARG A C     1 
ATOM   2078  O  O     . ARG A  1  282 ? 40.975  51.259  48.296  1.00 24.64  ? 282  ARG A O     1 
ATOM   2079  C  CB    . ARG A  1  282 ? 40.466  48.565  48.228  1.00 25.08  ? 282  ARG A CB    1 
ATOM   2080  C  CG    . ARG A  1  282 ? 38.973  48.769  48.040  1.00 28.63  ? 282  ARG A CG    1 
ATOM   2081  C  CD    . ARG A  1  282 ? 38.160  48.166  49.153  1.00 28.45  ? 282  ARG A CD    1 
ATOM   2082  N  NE    . ARG A  1  282 ? 36.757  48.514  48.943  1.00 32.11  ? 282  ARG A NE    1 
ATOM   2083  C  CZ    . ARG A  1  282 ? 35.774  48.252  49.797  1.00 30.16  ? 282  ARG A CZ    1 
ATOM   2084  N  NH1   . ARG A  1  282 ? 36.032  47.638  50.938  1.00 30.35  ? 282  ARG A NH1   1 
ATOM   2085  N  NH2   . ARG A  1  282 ? 34.531  48.596  49.498  1.00 27.92  ? 282  ARG A NH2   1 
ATOM   2086  N  N     . PHE A  1  283 ? 41.711  51.398  46.185  1.00 22.88  ? 283  PHE A N     1 
ATOM   2087  C  CA    . PHE A  1  283 ? 41.875  52.851  46.193  1.00 20.56  ? 283  PHE A CA    1 
ATOM   2088  C  C     . PHE A  1  283 ? 40.699  53.774  46.462  1.00 22.58  ? 283  PHE A C     1 
ATOM   2089  O  O     . PHE A  1  283 ? 40.920  54.922  46.841  1.00 21.86  ? 283  PHE A O     1 
ATOM   2090  C  CB    . PHE A  1  283 ? 42.575  53.285  44.896  1.00 23.80  ? 283  PHE A CB    1 
ATOM   2091  C  CG    . PHE A  1  283 ? 41.824  52.915  43.656  1.00 19.23  ? 283  PHE A CG    1 
ATOM   2092  C  CD1   . PHE A  1  283 ? 40.870  53.787  43.108  1.00 24.36  ? 283  PHE A CD1   1 
ATOM   2093  C  CD2   . PHE A  1  283 ? 42.050  51.698  43.049  1.00 19.57  ? 283  PHE A CD2   1 
ATOM   2094  C  CE1   . PHE A  1  283 ? 40.140  53.439  41.943  1.00 23.56  ? 283  PHE A CE1   1 
ATOM   2095  C  CE2   . PHE A  1  283 ? 41.333  51.328  41.882  1.00 21.94  ? 283  PHE A CE2   1 
ATOM   2096  C  CZ    . PHE A  1  283 ? 40.378  52.205  41.336  1.00 21.12  ? 283  PHE A CZ    1 
ATOM   2097  N  N     . MET A  1  284 ? 39.461  53.317  46.273  1.00 22.71  ? 284  MET A N     1 
ATOM   2098  C  CA    . MET A  1  284 ? 38.345  54.202  46.559  1.00 23.82  ? 284  MET A CA    1 
ATOM   2099  C  C     . MET A  1  284 ? 38.279  54.473  48.068  1.00 28.50  ? 284  MET A C     1 
ATOM   2100  O  O     . MET A  1  284 ? 37.602  55.421  48.509  1.00 23.35  ? 284  MET A O     1 
ATOM   2101  C  CB    . MET A  1  284 ? 37.010  53.597  46.083  1.00 21.43  ? 284  MET A CB    1 
ATOM   2102  C  CG    . MET A  1  284 ? 36.792  53.681  44.553  1.00 19.99  ? 284  MET A CG    1 
ATOM   2103  S  SD    . MET A  1  284 ? 37.168  55.351  43.875  1.00 21.43  ? 284  MET A SD    1 
ATOM   2104  C  CE    . MET A  1  284 ? 35.948  56.410  44.598  1.00 8.98   ? 284  MET A CE    1 
ATOM   2105  N  N     . GLU A  1  285 ? 38.950  53.643  48.871  1.00 30.15  ? 285  GLU A N     1 
ATOM   2106  C  CA    . GLU A  1  285 ? 38.905  53.893  50.317  1.00 36.38  ? 285  GLU A CA    1 
ATOM   2107  C  C     . GLU A  1  285 ? 39.582  55.221  50.607  1.00 36.97  ? 285  GLU A C     1 
ATOM   2108  O  O     . GLU A  1  285 ? 39.274  55.898  51.586  1.00 40.52  ? 285  GLU A O     1 
ATOM   2109  C  CB    . GLU A  1  285 ? 39.588  52.772  51.089  1.00 38.18  ? 285  GLU A CB    1 
ATOM   2110  C  CG    . GLU A  1  285 ? 38.759  51.509  51.091  1.00 45.58  ? 285  GLU A CG    1 
ATOM   2111  C  CD    . GLU A  1  285 ? 39.333  50.411  51.982  1.00 50.70  ? 285  GLU A CD    1 
ATOM   2112  O  OE1   . GLU A  1  285 ? 40.523  50.055  51.801  1.00 55.06  ? 285  GLU A OE1   1 
ATOM   2113  O  OE2   . GLU A  1  285 ? 38.589  49.895  52.851  1.00 49.87  ? 285  GLU A OE2   1 
ATOM   2114  N  N     . ARG A  1  286 ? 40.461  55.606  49.691  1.00 34.63  ? 286  ARG A N     1 
ATOM   2115  C  CA    . ARG A  1  286 ? 41.241  56.835  49.778  1.00 35.15  ? 286  ARG A CA    1 
ATOM   2116  C  C     . ARG A  1  286 ? 40.523  58.035  49.139  1.00 34.71  ? 286  ARG A C     1 
ATOM   2117  O  O     . ARG A  1  286 ? 40.596  59.150  49.655  1.00 35.38  ? 286  ARG A O     1 
ATOM   2118  C  CB    . ARG A  1  286 ? 42.617  56.529  49.134  1.00 33.51  ? 286  ARG A CB    1 
ATOM   2119  C  CG    . ARG A  1  286 ? 43.636  57.603  49.035  1.00 31.97  ? 286  ARG A CG    1 
ATOM   2120  C  CD    . ARG A  1  286 ? 45.039  56.977  48.860  1.00 22.47  ? 286  ARG A CD    1 
ATOM   2121  N  NE    . ARG A  1  286 ? 45.201  56.052  47.724  1.00 24.83  ? 286  ARG A NE    1 
ATOM   2122  C  CZ    . ARG A  1  286 ? 45.323  56.428  46.445  1.00 24.50  ? 286  ARG A CZ    1 
ATOM   2123  N  NH1   . ARG A  1  286 ? 45.290  57.730  46.119  1.00 23.76  ? 286  ARG A NH1   1 
ATOM   2124  N  NH2   . ARG A  1  286 ? 45.505  55.512  45.494  1.00 18.93  ? 286  ARG A NH2   1 
ATOM   2125  N  N     . TYR A  1  287 ? 39.809  57.817  48.033  1.00 31.62  ? 287  TYR A N     1 
ATOM   2126  C  CA    . TYR A  1  287 ? 39.097  58.922  47.387  1.00 28.24  ? 287  TYR A CA    1 
ATOM   2127  C  C     . TYR A  1  287 ? 37.738  59.212  47.998  1.00 29.48  ? 287  TYR A C     1 
ATOM   2128  O  O     . TYR A  1  287 ? 37.288  60.361  47.980  1.00 29.94  ? 287  TYR A O     1 
ATOM   2129  C  CB    . TYR A  1  287 ? 38.922  58.675  45.887  1.00 23.42  ? 287  TYR A CB    1 
ATOM   2130  C  CG    . TYR A  1  287 ? 40.231  58.641  45.151  1.00 21.98  ? 287  TYR A CG    1 
ATOM   2131  C  CD1   . TYR A  1  287 ? 40.959  57.462  45.063  1.00 16.87  ? 287  TYR A CD1   1 
ATOM   2132  C  CD2   . TYR A  1  287 ? 40.735  59.795  44.534  1.00 18.19  ? 287  TYR A CD2   1 
ATOM   2133  C  CE1   . TYR A  1  287 ? 42.170  57.417  44.368  1.00 19.66  ? 287  TYR A CE1   1 
ATOM   2134  C  CE2   . TYR A  1  287 ? 41.950  59.770  43.828  1.00 21.41  ? 287  TYR A CE2   1 
ATOM   2135  C  CZ    . TYR A  1  287 ? 42.648  58.568  43.750  1.00 20.61  ? 287  TYR A CZ    1 
ATOM   2136  O  OH    . TYR A  1  287 ? 43.770  58.493  42.981  1.00 24.59  ? 287  TYR A OH    1 
ATOM   2137  N  N     . ALA A  1  288 ? 37.071  58.177  48.507  1.00 27.58  ? 288  ALA A N     1 
ATOM   2138  C  CA    . ALA A  1  288 ? 35.770  58.352  49.153  1.00 26.95  ? 288  ALA A CA    1 
ATOM   2139  C  C     . ALA A  1  288 ? 35.772  57.465  50.417  1.00 30.21  ? 288  ALA A C     1 
ATOM   2140  O  O     . ALA A  1  288 ? 35.230  56.361  50.430  1.00 30.50  ? 288  ALA A O     1 
ATOM   2141  C  CB    . ALA A  1  288 ? 34.636  57.958  48.209  1.00 21.91  ? 288  ALA A CB    1 
ATOM   2142  N  N     . PRO A  1  289 ? 36.399  57.952  51.497  1.00 30.12  ? 289  PRO A N     1 
ATOM   2143  C  CA    . PRO A  1  289 ? 36.475  57.190  52.752  1.00 30.20  ? 289  PRO A CA    1 
ATOM   2144  C  C     . PRO A  1  289 ? 35.164  56.480  53.134  1.00 29.21  ? 289  PRO A C     1 
ATOM   2145  O  O     . PRO A  1  289 ? 35.164  55.282  53.439  1.00 28.51  ? 289  PRO A O     1 
ATOM   2146  C  CB    . PRO A  1  289 ? 36.911  58.248  53.766  1.00 30.39  ? 289  PRO A CB    1 
ATOM   2147  C  CG    . PRO A  1  289 ? 37.799  59.138  52.957  1.00 31.29  ? 289  PRO A CG    1 
ATOM   2148  C  CD    . PRO A  1  289 ? 36.956  59.304  51.669  1.00 30.22  ? 289  PRO A CD    1 
ATOM   2149  N  N     . VAL A  1  290 ? 34.045  57.198  53.068  1.00 27.83  ? 290  VAL A N     1 
ATOM   2150  C  CA    . VAL A  1  290 ? 32.764  56.592  53.424  1.00 26.87  ? 290  VAL A CA    1 
ATOM   2151  C  C     . VAL A  1  290 ? 32.102  55.737  52.323  1.00 26.61  ? 290  VAL A C     1 
ATOM   2152  O  O     . VAL A  1  290 ? 31.924  54.531  52.493  1.00 20.35  ? 290  VAL A O     1 
ATOM   2153  C  CB    . VAL A  1  290 ? 31.772  57.664  53.897  1.00 31.31  ? 290  VAL A CB    1 
ATOM   2154  C  CG1   . VAL A  1  290 ? 30.425  57.008  54.340  1.00 28.13  ? 290  VAL A CG1   1 
ATOM   2155  C  CG2   . VAL A  1  290 ? 32.391  58.457  55.069  1.00 30.37  ? 290  VAL A CG2   1 
ATOM   2156  N  N     . ALA A  1  291 ? 31.750  56.342  51.193  1.00 26.53  ? 291  ALA A N     1 
ATOM   2157  C  CA    . ALA A  1  291 ? 31.093  55.579  50.124  1.00 25.08  ? 291  ALA A CA    1 
ATOM   2158  C  C     . ALA A  1  291 ? 31.951  54.525  49.440  1.00 23.42  ? 291  ALA A C     1 
ATOM   2159  O  O     . ALA A  1  291 ? 31.422  53.513  48.969  1.00 24.87  ? 291  ALA A O     1 
ATOM   2160  C  CB    . ALA A  1  291 ? 30.516  56.538  49.071  1.00 27.83  ? 291  ALA A CB    1 
ATOM   2161  N  N     . LYS A  1  292 ? 33.263  54.764  49.365  1.00 18.55  ? 292  LYS A N     1 
ATOM   2162  C  CA    . LYS A  1  292 ? 34.196  53.843  48.727  1.00 16.22  ? 292  LYS A CA    1 
ATOM   2163  C  C     . LYS A  1  292 ? 33.837  53.581  47.251  1.00 17.60  ? 292  LYS A C     1 
ATOM   2164  O  O     . LYS A  1  292 ? 33.717  54.528  46.489  1.00 17.99  ? 292  LYS A O     1 
ATOM   2165  C  CB    . LYS A  1  292 ? 34.268  52.531  49.516  1.00 16.31  ? 292  LYS A CB    1 
ATOM   2166  C  CG    . LYS A  1  292 ? 34.904  52.781  50.894  1.00 26.14  ? 292  LYS A CG    1 
ATOM   2167  C  CD    . LYS A  1  292 ? 34.977  51.559  51.771  1.00 29.11  ? 292  LYS A CD    1 
ATOM   2168  C  CE    . LYS A  1  292 ? 35.337  52.012  53.176  1.00 28.69  ? 292  LYS A CE    1 
ATOM   2169  N  NZ    . LYS A  1  292 ? 35.428  50.826  54.052  1.00 39.43  ? 292  LYS A NZ    1 
ATOM   2170  N  N     . ASP A  1  293 ? 33.690  52.316  46.854  1.00 16.17  ? 293  ASP A N     1 
ATOM   2171  C  CA    . ASP A  1  293 ? 33.345  51.994  45.472  1.00 21.92  ? 293  ASP A CA    1 
ATOM   2172  C  C     . ASP A  1  293 ? 31.863  52.268  45.137  1.00 23.65  ? 293  ASP A C     1 
ATOM   2173  O  O     . ASP A  1  293 ? 31.435  51.984  44.006  1.00 20.71  ? 293  ASP A O     1 
ATOM   2174  C  CB    . ASP A  1  293 ? 33.651  50.515  45.141  1.00 24.57  ? 293  ASP A CB    1 
ATOM   2175  C  CG    . ASP A  1  293 ? 35.003  50.048  45.689  1.00 30.96  ? 293  ASP A CG    1 
ATOM   2176  O  OD1   . ASP A  1  293 ? 35.099  49.733  46.910  1.00 33.06  ? 293  ASP A OD1   1 
ATOM   2177  O  OD2   . ASP A  1  293 ? 35.967  50.016  44.904  1.00 30.05  ? 293  ASP A OD2   1 
ATOM   2178  N  N     . LEU A  1  294 ? 31.086  52.778  46.100  1.00 22.01  ? 294  LEU A N     1 
ATOM   2179  C  CA    . LEU A  1  294 ? 29.681  53.135  45.834  1.00 23.75  ? 294  LEU A CA    1 
ATOM   2180  C  C     . LEU A  1  294 ? 29.474  54.653  45.927  1.00 20.75  ? 294  LEU A C     1 
ATOM   2181  O  O     . LEU A  1  294 ? 28.389  55.154  46.255  1.00 19.43  ? 294  LEU A O     1 
ATOM   2182  C  CB    . LEU A  1  294 ? 28.698  52.382  46.753  1.00 24.90  ? 294  LEU A CB    1 
ATOM   2183  C  CG    . LEU A  1  294 ? 28.613  50.874  46.437  1.00 27.61  ? 294  LEU A CG    1 
ATOM   2184  C  CD1   . LEU A  1  294 ? 27.857  50.113  47.515  1.00 28.26  ? 294  LEU A CD1   1 
ATOM   2185  C  CD2   . LEU A  1  294 ? 27.950  50.682  45.086  1.00 22.81  ? 294  LEU A CD2   1 
ATOM   2186  N  N     . ALA A  1  295 ? 30.533  55.383  45.628  1.00 17.59  ? 295  ALA A N     1 
ATOM   2187  C  CA    . ALA A  1  295 ? 30.444  56.831  45.575  1.00 19.20  ? 295  ALA A CA    1 
ATOM   2188  C  C     . ALA A  1  295 ? 29.735  57.112  44.224  1.00 20.96  ? 295  ALA A C     1 
ATOM   2189  O  O     . ALA A  1  295 ? 29.483  56.168  43.451  1.00 16.83  ? 295  ALA A O     1 
ATOM   2190  C  CB    . ALA A  1  295 ? 31.859  57.439  45.562  1.00 16.91  ? 295  ALA A CB    1 
ATOM   2191  N  N     . SER A  1  296 ? 29.420  58.385  43.936  1.00 22.00  ? 296  SER A N     1 
ATOM   2192  C  CA    . SER A  1  296 ? 28.752  58.737  42.673  1.00 23.16  ? 296  SER A CA    1 
ATOM   2193  C  C     . SER A  1  296 ? 29.650  58.468  41.482  1.00 23.38  ? 296  SER A C     1 
ATOM   2194  O  O     . SER A  1  296 ? 30.891  58.499  41.582  1.00 24.33  ? 296  SER A O     1 
ATOM   2195  C  CB    . SER A  1  296 ? 28.319  60.217  42.667  1.00 26.59  ? 296  SER A CB    1 
ATOM   2196  O  OG    . SER A  1  296 ? 29.429  61.074  42.841  1.00 24.50  ? 296  SER A OG    1 
ATOM   2197  N  N     . ARG A  1  297 ? 29.038  58.244  40.323  1.00 21.87  ? 297  ARG A N     1 
ATOM   2198  C  CA    . ARG A  1  297 ? 29.814  57.912  39.146  1.00 16.24  ? 297  ARG A CA    1 
ATOM   2199  C  C     . ARG A  1  297 ? 30.838  58.945  38.743  1.00 19.08  ? 297  ARG A C     1 
ATOM   2200  O  O     . ARG A  1  297 ? 31.955  58.588  38.335  1.00 17.55  ? 297  ARG A O     1 
ATOM   2201  C  CB    . ARG A  1  297 ? 28.872  57.595  37.991  1.00 16.70  ? 297  ARG A CB    1 
ATOM   2202  C  CG    . ARG A  1  297 ? 28.085  56.329  38.259  1.00 17.03  ? 297  ARG A CG    1 
ATOM   2203  C  CD    . ARG A  1  297 ? 27.213  55.971  37.132  1.00 19.91  ? 297  ARG A CD    1 
ATOM   2204  N  NE    . ARG A  1  297 ? 26.690  54.627  37.303  1.00 23.33  ? 297  ARG A NE    1 
ATOM   2205  C  CZ    . ARG A  1  297 ? 25.646  54.168  36.628  1.00 15.61  ? 297  ARG A CZ    1 
ATOM   2206  N  NH1   . ARG A  1  297 ? 25.060  54.970  35.761  1.00 20.50  ? 297  ARG A NH1   1 
ATOM   2207  N  NH2   . ARG A  1  297 ? 25.188  52.935  36.830  1.00 19.22  ? 297  ARG A NH2   1 
ATOM   2208  N  N     . ASP A  1  298 ? 30.496  60.223  38.854  1.00 19.00  ? 298  ASP A N     1 
ATOM   2209  C  CA    . ASP A  1  298 ? 31.465  61.239  38.462  1.00 20.71  ? 298  ASP A CA    1 
ATOM   2210  C  C     . ASP A  1  298 ? 32.736  61.127  39.308  1.00 21.24  ? 298  ASP A C     1 
ATOM   2211  O  O     . ASP A  1  298 ? 33.857  61.262  38.783  1.00 23.80  ? 298  ASP A O     1 
ATOM   2212  C  CB    . ASP A  1  298 ? 30.831  62.665  38.525  1.00 22.21  ? 298  ASP A CB    1 
ATOM   2213  C  CG    . ASP A  1  298 ? 30.327  63.059  39.931  1.00 28.39  ? 298  ASP A CG    1 
ATOM   2214  O  OD1   . ASP A  1  298 ? 29.547  62.275  40.541  1.00 21.25  ? 298  ASP A OD1   1 
ATOM   2215  O  OD2   . ASP A  1  298 ? 30.712  64.174  40.415  1.00 21.44  ? 298  ASP A OD2   1 
ATOM   2216  N  N     . VAL A  1  299 ? 32.580  60.837  40.602  1.00 20.55  ? 299  VAL A N     1 
ATOM   2217  C  CA    . VAL A  1  299 ? 33.725  60.707  41.500  1.00 18.68  ? 299  VAL A CA    1 
ATOM   2218  C  C     . VAL A  1  299 ? 34.541  59.428  41.280  1.00 17.13  ? 299  VAL A C     1 
ATOM   2219  O  O     . VAL A  1  299 ? 35.785  59.455  41.257  1.00 20.58  ? 299  VAL A O     1 
ATOM   2220  C  CB    . VAL A  1  299 ? 33.248  60.796  42.980  1.00 19.03  ? 299  VAL A CB    1 
ATOM   2221  C  CG1   . VAL A  1  299 ? 34.406  60.527  43.916  1.00 24.63  ? 299  VAL A CG1   1 
ATOM   2222  C  CG2   . VAL A  1  299 ? 32.656  62.221  43.249  1.00 19.96  ? 299  VAL A CG2   1 
ATOM   2223  N  N     . VAL A  1  300 ? 33.871  58.300  41.113  1.00 15.35  ? 300  VAL A N     1 
ATOM   2224  C  CA    . VAL A  1  300 ? 34.599  57.045  40.887  1.00 14.26  ? 300  VAL A CA    1 
ATOM   2225  C  C     . VAL A  1  300 ? 35.366  57.126  39.563  1.00 16.91  ? 300  VAL A C     1 
ATOM   2226  O  O     . VAL A  1  300 ? 36.542  56.761  39.495  1.00 16.02  ? 300  VAL A O     1 
ATOM   2227  C  CB    . VAL A  1  300 ? 33.643  55.817  40.872  1.00 15.85  ? 300  VAL A CB    1 
ATOM   2228  C  CG1   . VAL A  1  300 ? 34.450  54.474  40.586  1.00 9.86   ? 300  VAL A CG1   1 
ATOM   2229  C  CG2   . VAL A  1  300 ? 32.938  55.689  42.246  1.00 20.84  ? 300  VAL A CG2   1 
ATOM   2230  N  N     . SER A  1  301 ? 34.712  57.620  38.506  1.00 17.54  ? 301  SER A N     1 
ATOM   2231  C  CA    . SER A  1  301 ? 35.393  57.727  37.209  1.00 19.11  ? 301  SER A CA    1 
ATOM   2232  C  C     . SER A  1  301 ? 36.642  58.620  37.292  1.00 16.88  ? 301  SER A C     1 
ATOM   2233  O  O     . SER A  1  301 ? 37.698  58.229  36.829  1.00 17.31  ? 301  SER A O     1 
ATOM   2234  C  CB    . SER A  1  301 ? 34.419  58.224  36.123  1.00 20.34  ? 301  SER A CB    1 
ATOM   2235  O  OG    . SER A  1  301 ? 33.667  57.111  35.643  1.00 24.63  ? 301  SER A OG    1 
ATOM   2236  N  N     . ARG A  1  302 ? 36.523  59.798  37.907  1.00 14.55  ? 302  ARG A N     1 
ATOM   2237  C  CA    . ARG A  1  302 ? 37.671  60.685  38.058  1.00 15.25  ? 302  ARG A CA    1 
ATOM   2238  C  C     . ARG A  1  302 ? 38.783  59.999  38.886  1.00 17.79  ? 302  ARG A C     1 
ATOM   2239  O  O     . ARG A  1  302 ? 39.954  60.071  38.521  1.00 19.38  ? 302  ARG A O     1 
ATOM   2240  C  CB    . ARG A  1  302 ? 37.271  62.001  38.728  1.00 15.29  ? 302  ARG A CB    1 
ATOM   2241  C  CG    . ARG A  1  302 ? 36.751  63.061  37.784  1.00 17.66  ? 302  ARG A CG    1 
ATOM   2242  C  CD    . ARG A  1  302 ? 36.613  64.436  38.510  1.00 15.61  ? 302  ARG A CD    1 
ATOM   2243  N  NE    . ARG A  1  302 ? 35.582  64.505  39.551  1.00 19.80  ? 302  ARG A NE    1 
ATOM   2244  C  CZ    . ARG A  1  302 ? 34.288  64.765  39.331  1.00 21.95  ? 302  ARG A CZ    1 
ATOM   2245  N  NH1   . ARG A  1  302 ? 33.814  64.977  38.093  1.00 20.41  ? 302  ARG A NH1   1 
ATOM   2246  N  NH2   . ARG A  1  302 ? 33.468  64.856  40.352  1.00 16.48  ? 302  ARG A NH2   1 
ATOM   2247  N  N     . SER A  1  303 ? 38.412  59.346  39.993  1.00 19.42  ? 303  SER A N     1 
ATOM   2248  C  CA    . SER A  1  303 ? 39.368  58.624  40.842  1.00 19.76  ? 303  SER A CA    1 
ATOM   2249  C  C     . SER A  1  303 ? 40.078  57.559  40.018  1.00 20.88  ? 303  SER A C     1 
ATOM   2250  O  O     . SER A  1  303 ? 41.313  57.468  40.033  1.00 23.01  ? 303  SER A O     1 
ATOM   2251  C  CB    . SER A  1  303 ? 38.656  57.958  42.017  1.00 20.12  ? 303  SER A CB    1 
ATOM   2252  O  OG    . SER A  1  303 ? 37.876  58.906  42.722  1.00 23.88  ? 303  SER A OG    1 
ATOM   2253  N  N     . MET A  1  304 ? 39.328  56.729  39.298  1.00 22.41  ? 304  MET A N     1 
ATOM   2254  C  CA    . MET A  1  304 ? 39.995  55.720  38.454  1.00 22.66  ? 304  MET A CA    1 
ATOM   2255  C  C     . MET A  1  304 ? 40.949  56.356  37.431  1.00 22.98  ? 304  MET A C     1 
ATOM   2256  O  O     . MET A  1  304 ? 42.029  55.817  37.139  1.00 21.01  ? 304  MET A O     1 
ATOM   2257  C  CB    . MET A  1  304 ? 38.978  54.874  37.673  1.00 24.32  ? 304  MET A CB    1 
ATOM   2258  C  CG    . MET A  1  304 ? 38.144  53.953  38.544  1.00 25.93  ? 304  MET A CG    1 
ATOM   2259  S  SD    . MET A  1  304 ? 36.699  53.364  37.640  1.00 21.48  ? 304  MET A SD    1 
ATOM   2260  C  CE    . MET A  1  304 ? 37.328  51.927  36.762  1.00 17.84  ? 304  MET A CE    1 
ATOM   2261  N  N     . THR A  1  305 ? 40.533  57.486  36.876  1.00 18.13  ? 305  THR A N     1 
ATOM   2262  C  CA    . THR A  1  305 ? 41.345  58.171  35.869  1.00 21.86  ? 305  THR A CA    1 
ATOM   2263  C  C     . THR A  1  305 ? 42.647  58.698  36.503  1.00 21.90  ? 305  THR A C     1 
ATOM   2264  O  O     . THR A  1  305 ? 43.690  58.676  35.856  1.00 21.45  ? 305  THR A O     1 
ATOM   2265  C  CB    . THR A  1  305 ? 40.541  59.317  35.256  1.00 19.75  ? 305  THR A CB    1 
ATOM   2266  O  OG1   . THR A  1  305 ? 39.340  58.770  34.721  1.00 27.27  ? 305  THR A OG1   1 
ATOM   2267  C  CG2   . THR A  1  305 ? 41.301  60.047  34.157  1.00 17.45  ? 305  THR A CG2   1 
ATOM   2268  N  N     . ILE A  1  306 ? 42.576  59.175  37.756  1.00 23.19  ? 306  ILE A N     1 
ATOM   2269  C  CA    . ILE A  1  306 ? 43.768  59.671  38.442  1.00 22.11  ? 306  ILE A CA    1 
ATOM   2270  C  C     . ILE A  1  306 ? 44.694  58.480  38.703  1.00 25.97  ? 306  ILE A C     1 
ATOM   2271  O  O     . ILE A  1  306 ? 45.887  58.574  38.437  1.00 25.31  ? 306  ILE A O     1 
ATOM   2272  C  CB    . ILE A  1  306 ? 43.404  60.386  39.770  1.00 24.02  ? 306  ILE A CB    1 
ATOM   2273  C  CG1   . ILE A  1  306 ? 42.726  61.715  39.468  1.00 21.50  ? 306  ILE A CG1   1 
ATOM   2274  C  CG2   . ILE A  1  306 ? 44.655  60.700  40.600  1.00 24.31  ? 306  ILE A CG2   1 
ATOM   2275  C  CD1   . ILE A  1  306 ? 42.003  62.309  40.719  1.00 17.49  ? 306  ILE A CD1   1 
ATOM   2276  N  N     . GLU A  1  307 ? 44.153  57.348  39.186  1.00 21.90  ? 307  GLU A N     1 
ATOM   2277  C  CA    . GLU A  1  307 ? 44.987  56.177  39.431  1.00 18.56  ? 307  GLU A CA    1 
ATOM   2278  C  C     . GLU A  1  307 ? 45.785  55.802  38.198  1.00 21.09  ? 307  GLU A C     1 
ATOM   2279  O  O     . GLU A  1  307 ? 46.986  55.451  38.284  1.00 22.40  ? 307  GLU A O     1 
ATOM   2280  C  CB    . GLU A  1  307 ? 44.144  54.981  39.868  1.00 18.50  ? 307  GLU A CB    1 
ATOM   2281  C  CG    . GLU A  1  307 ? 43.642  55.136  41.295  1.00 19.16  ? 307  GLU A CG    1 
ATOM   2282  C  CD    . GLU A  1  307 ? 44.812  55.290  42.263  1.00 24.41  ? 307  GLU A CD    1 
ATOM   2283  O  OE1   . GLU A  1  307 ? 45.527  54.276  42.483  1.00 20.07  ? 307  GLU A OE1   1 
ATOM   2284  O  OE2   . GLU A  1  307 ? 45.027  56.414  42.778  1.00 24.85  ? 307  GLU A OE2   1 
ATOM   2285  N  N     . ILE A  1  308 ? 45.122  55.847  37.045  1.00 18.98  ? 308  ILE A N     1 
ATOM   2286  C  CA    . ILE A  1  308 ? 45.783  55.506  35.790  1.00 18.57  ? 308  ILE A CA    1 
ATOM   2287  C  C     . ILE A  1  308 ? 46.848  56.566  35.418  1.00 23.22  ? 308  ILE A C     1 
ATOM   2288  O  O     . ILE A  1  308 ? 47.981  56.193  35.074  1.00 20.46  ? 308  ILE A O     1 
ATOM   2289  C  CB    . ILE A  1  308 ? 44.737  55.332  34.680  1.00 21.70  ? 308  ILE A CB    1 
ATOM   2290  C  CG1   . ILE A  1  308 ? 43.845  54.139  35.040  1.00 23.41  ? 308  ILE A CG1   1 
ATOM   2291  C  CG2   . ILE A  1  308 ? 45.414  55.125  33.302  1.00 19.72  ? 308  ILE A CG2   1 
ATOM   2292  C  CD1   . ILE A  1  308 ? 42.638  53.954  34.134  1.00 22.76  ? 308  ILE A CD1   1 
ATOM   2293  N  N     . ARG A  1  309 ? 46.492  57.860  35.529  1.00 21.98  ? 309  ARG A N     1 
ATOM   2294  C  CA    . ARG A  1  309 ? 47.407  58.993  35.234  1.00 26.69  ? 309  ARG A CA    1 
ATOM   2295  C  C     . ARG A  1  309 ? 48.666  58.937  36.096  1.00 26.57  ? 309  ARG A C     1 
ATOM   2296  O  O     . ARG A  1  309 ? 49.750  59.306  35.642  1.00 24.89  ? 309  ARG A O     1 
ATOM   2297  C  CB    . ARG A  1  309 ? 46.783  60.371  35.544  1.00 26.64  ? 309  ARG A CB    1 
ATOM   2298  C  CG    . ARG A  1  309 ? 45.636  60.821  34.656  1.00 36.83  ? 309  ARG A CG    1 
ATOM   2299  C  CD    . ARG A  1  309 ? 45.411  62.353  34.691  1.00 39.15  ? 309  ARG A CD    1 
ATOM   2300  N  NE    . ARG A  1  309 ? 45.232  62.910  36.038  1.00 43.42  ? 309  ARG A NE    1 
ATOM   2301  C  CZ    . ARG A  1  309 ? 44.664  64.097  36.300  1.00 44.42  ? 309  ARG A CZ    1 
ATOM   2302  N  NH1   . ARG A  1  309 ? 44.206  64.858  35.310  1.00 38.53  ? 309  ARG A NH1   1 
ATOM   2303  N  NH2   . ARG A  1  309 ? 44.565  64.542  37.554  1.00 41.35  ? 309  ARG A NH2   1 
ATOM   2304  N  N     . GLU A  1  310 ? 48.484  58.516  37.350  1.00 26.90  ? 310  GLU A N     1 
ATOM   2305  C  CA    . GLU A  1  310 ? 49.566  58.432  38.324  1.00 28.30  ? 310  GLU A CA    1 
ATOM   2306  C  C     . GLU A  1  310 ? 50.342  57.114  38.313  1.00 26.77  ? 310  GLU A C     1 
ATOM   2307  O  O     . GLU A  1  310 ? 51.030  56.784  39.278  1.00 28.24  ? 310  GLU A O     1 
ATOM   2308  C  CB    . GLU A  1  310 ? 49.017  58.730  39.722  1.00 28.44  ? 310  GLU A CB    1 
ATOM   2309  C  CG    . GLU A  1  310 ? 48.481  60.155  39.848  1.00 31.67  ? 310  GLU A CG    1 
ATOM   2310  C  CD    . GLU A  1  310 ? 48.124  60.555  41.270  1.00 38.43  ? 310  GLU A CD    1 
ATOM   2311  O  OE1   . GLU A  1  310 ? 48.072  59.669  42.154  1.00 43.00  ? 310  GLU A OE1   1 
ATOM   2312  O  OE2   . GLU A  1  310 ? 47.879  61.767  41.508  1.00 41.37  ? 310  GLU A OE2   1 
ATOM   2313  N  N     . GLY A  1  311 ? 50.198  56.356  37.229  1.00 25.48  ? 311  GLY A N     1 
ATOM   2314  C  CA    . GLY A  1  311 ? 50.933  55.118  37.039  1.00 23.09  ? 311  GLY A CA    1 
ATOM   2315  C  C     . GLY A  1  311 ? 50.500  53.816  37.677  1.00 27.13  ? 311  GLY A C     1 
ATOM   2316  O  O     . GLY A  1  311 ? 51.252  52.827  37.621  1.00 23.98  ? 311  GLY A O     1 
ATOM   2317  N  N     . ARG A  1  312 ? 49.302  53.770  38.250  1.00 25.32  ? 312  ARG A N     1 
ATOM   2318  C  CA    . ARG A  1  312 ? 48.884  52.558  38.936  1.00 24.25  ? 312  ARG A CA    1 
ATOM   2319  C  C     . ARG A  1  312 ? 47.872  51.737  38.151  1.00 26.89  ? 312  ARG A C     1 
ATOM   2320  O  O     . ARG A  1  312 ? 47.132  50.932  38.714  1.00 22.73  ? 312  ARG A O     1 
ATOM   2321  C  CB    . ARG A  1  312 ? 48.366  52.918  40.351  1.00 25.90  ? 312  ARG A CB    1 
ATOM   2322  C  CG    . ARG A  1  312 ? 49.480  53.421  41.283  1.00 24.62  ? 312  ARG A CG    1 
ATOM   2323  C  CD    . ARG A  1  312 ? 49.038  53.701  42.746  1.00 22.03  ? 312  ARG A CD    1 
ATOM   2324  N  NE    . ARG A  1  312 ? 48.189  54.878  42.826  1.00 21.68  ? 312  ARG A NE    1 
ATOM   2325  C  CZ    . ARG A  1  312 ? 48.631  56.127  42.783  1.00 25.48  ? 312  ARG A CZ    1 
ATOM   2326  N  NH1   . ARG A  1  312 ? 49.935  56.384  42.690  1.00 26.71  ? 312  ARG A NH1   1 
ATOM   2327  N  NH2   . ARG A  1  312 ? 47.761  57.114  42.732  1.00 14.64  ? 312  ARG A NH2   1 
ATOM   2328  N  N     . GLY A  1  313 ? 47.864  51.955  36.838  1.00 28.33  ? 313  GLY A N     1 
ATOM   2329  C  CA    . GLY A  1  313 ? 46.987  51.223  35.949  1.00 26.15  ? 313  GLY A CA    1 
ATOM   2330  C  C     . GLY A  1  313 ? 47.520  49.814  35.771  1.00 27.41  ? 313  GLY A C     1 
ATOM   2331  O  O     . GLY A  1  313 ? 48.716  49.564  36.008  1.00 26.47  ? 313  GLY A O     1 
ATOM   2332  N  N     . CYS A  1  314 ? 46.645  48.901  35.345  1.00 26.07  ? 314  CYS A N     1 
ATOM   2333  C  CA    . CYS A  1  314 ? 46.977  47.497  35.175  1.00 23.70  ? 314  CYS A CA    1 
ATOM   2334  C  C     . CYS A  1  314 ? 47.104  47.148  33.692  1.00 24.64  ? 314  CYS A C     1 
ATOM   2335  O  O     . CYS A  1  314 ? 46.814  47.982  32.836  1.00 24.86  ? 314  CYS A O     1 
ATOM   2336  C  CB    . CYS A  1  314 ? 45.873  46.642  35.809  1.00 24.33  ? 314  CYS A CB    1 
ATOM   2337  S  SG    . CYS A  1  314 ? 45.436  47.083  37.531  1.00 37.02  ? 314  CYS A SG    1 
ATOM   2338  N  N     . GLY A  1  315 ? 47.519  45.909  33.415  1.00 24.36  ? 315  GLY A N     1 
ATOM   2339  C  CA    . GLY A  1  315 ? 47.691  45.429  32.053  1.00 27.82  ? 315  GLY A CA    1 
ATOM   2340  C  C     . GLY A  1  315 ? 49.019  45.825  31.418  1.00 31.34  ? 315  GLY A C     1 
ATOM   2341  O  O     . GLY A  1  315 ? 49.741  46.644  31.975  1.00 29.69  ? 315  GLY A O     1 
ATOM   2342  N  N     . PRO A  1  316 ? 49.383  45.255  30.259  1.00 34.10  ? 316  PRO A N     1 
ATOM   2343  C  CA    . PRO A  1  316 ? 50.654  45.628  29.621  1.00 36.81  ? 316  PRO A CA    1 
ATOM   2344  C  C     . PRO A  1  316 ? 50.775  47.128  29.295  1.00 37.88  ? 316  PRO A C     1 
ATOM   2345  O  O     . PRO A  1  316 ? 51.885  47.650  29.169  1.00 37.09  ? 316  PRO A O     1 
ATOM   2346  C  CB    . PRO A  1  316 ? 50.686  44.759  28.354  1.00 38.01  ? 316  PRO A CB    1 
ATOM   2347  C  CG    . PRO A  1  316 ? 49.230  44.456  28.091  1.00 37.47  ? 316  PRO A CG    1 
ATOM   2348  C  CD    . PRO A  1  316 ? 48.696  44.205  29.485  1.00 39.16  ? 316  PRO A CD    1 
ATOM   2349  N  N     . GLU A  1  317 ? 49.647  47.822  29.158  1.00 34.01  ? 317  GLU A N     1 
ATOM   2350  C  CA    . GLU A  1  317 ? 49.690  49.247  28.850  1.00 32.06  ? 317  GLU A CA    1 
ATOM   2351  C  C     . GLU A  1  317 ? 49.337  50.115  30.045  1.00 29.30  ? 317  GLU A C     1 
ATOM   2352  O  O     . GLU A  1  317 ? 49.218  51.340  29.916  1.00 27.26  ? 317  GLU A O     1 
ATOM   2353  C  CB    . GLU A  1  317 ? 48.742  49.574  27.704  1.00 37.46  ? 317  GLU A CB    1 
ATOM   2354  C  CG    . GLU A  1  317 ? 49.049  48.838  26.416  1.00 44.31  ? 317  GLU A CG    1 
ATOM   2355  C  CD    . GLU A  1  317 ? 50.496  49.014  25.974  1.00 51.27  ? 317  GLU A CD    1 
ATOM   2356  O  OE1   . GLU A  1  317 ? 50.953  50.178  25.845  1.00 54.72  ? 317  GLU A OE1   1 
ATOM   2357  O  OE2   . GLU A  1  317 ? 51.181  47.988  25.755  1.00 56.04  ? 317  GLU A OE2   1 
ATOM   2358  N  N     . LYS A  1  318 ? 49.160  49.486  31.202  1.00 26.50  ? 318  LYS A N     1 
ATOM   2359  C  CA    . LYS A  1  318 ? 48.825  50.220  32.427  1.00 26.90  ? 318  LYS A CA    1 
ATOM   2360  C  C     . LYS A  1  318 ? 47.764  51.286  32.145  1.00 25.70  ? 318  LYS A C     1 
ATOM   2361  O  O     . LYS A  1  318 ? 47.861  52.414  32.617  1.00 24.07  ? 318  LYS A O     1 
ATOM   2362  C  CB    . LYS A  1  318 ? 50.071  50.879  33.006  1.00 28.96  ? 318  LYS A CB    1 
ATOM   2363  C  CG    . LYS A  1  318 ? 51.137  49.871  33.413  1.00 35.28  ? 318  LYS A CG    1 
ATOM   2364  C  CD    . LYS A  1  318 ? 52.331  50.531  34.139  1.00 40.76  ? 318  LYS A CD    1 
ATOM   2365  C  CE    . LYS A  1  318 ? 51.914  51.237  35.432  1.00 42.03  ? 318  LYS A CE    1 
ATOM   2366  N  NZ    . LYS A  1  318 ? 51.242  50.375  36.469  1.00 41.20  ? 318  LYS A NZ    1 
ATOM   2367  N  N     . ASP A  1  319 ? 46.737  50.890  31.404  1.00 21.86  ? 319  ASP A N     1 
ATOM   2368  C  CA    . ASP A  1  319 ? 45.685  51.798  31.001  1.00 22.40  ? 319  ASP A CA    1 
ATOM   2369  C  C     . ASP A  1  319 ? 44.272  51.505  31.529  1.00 21.45  ? 319  ASP A C     1 
ATOM   2370  O  O     . ASP A  1  319 ? 43.305  52.122  31.088  1.00 26.49  ? 319  ASP A O     1 
ATOM   2371  C  CB    . ASP A  1  319 ? 45.681  51.904  29.445  1.00 21.19  ? 319  ASP A CB    1 
ATOM   2372  C  CG    . ASP A  1  319 ? 45.477  50.566  28.746  1.00 22.16  ? 319  ASP A CG    1 
ATOM   2373  O  OD1   . ASP A  1  319 ? 45.508  49.480  29.381  1.00 27.44  ? 319  ASP A OD1   1 
ATOM   2374  O  OD2   . ASP A  1  319 ? 45.279  50.598  27.515  1.00 31.55  ? 319  ASP A OD2   1 
ATOM   2375  N  N     . HIS A  1  320 ? 44.138  50.570  32.459  1.00 21.30  ? 320  HIS A N     1 
ATOM   2376  C  CA    . HIS A  1  320 ? 42.824  50.268  33.011  1.00 20.98  ? 320  HIS A CA    1 
ATOM   2377  C  C     . HIS A  1  320 ? 43.039  49.791  34.450  1.00 20.44  ? 320  HIS A C     1 
ATOM   2378  O  O     . HIS A  1  320 ? 44.171  49.793  34.920  1.00 20.90  ? 320  HIS A O     1 
ATOM   2379  C  CB    . HIS A  1  320 ? 42.134  49.182  32.183  1.00 17.05  ? 320  HIS A CB    1 
ATOM   2380  C  CG    . HIS A  1  320 ? 42.890  47.889  32.124  1.00 20.97  ? 320  HIS A CG    1 
ATOM   2381  N  ND1   . HIS A  1  320 ? 43.669  47.527  31.042  1.00 26.03  ? 320  HIS A ND1   1 
ATOM   2382  C  CD2   . HIS A  1  320 ? 42.978  46.866  33.010  1.00 17.83  ? 320  HIS A CD2   1 
ATOM   2383  C  CE1   . HIS A  1  320 ? 44.199  46.333  31.264  1.00 24.59  ? 320  HIS A CE1   1 
ATOM   2384  N  NE2   . HIS A  1  320 ? 43.795  45.911  32.452  1.00 18.63  ? 320  HIS A NE2   1 
ATOM   2385  N  N     . VAL A  1  321 ? 41.968  49.434  35.159  1.00 17.61  ? 321  VAL A N     1 
ATOM   2386  C  CA    . VAL A  1  321 ? 42.111  48.919  36.511  1.00 20.09  ? 321  VAL A CA    1 
ATOM   2387  C  C     . VAL A  1  321 ? 41.308  47.630  36.613  1.00 21.73  ? 321  VAL A C     1 
ATOM   2388  O  O     . VAL A  1  321 ? 40.796  47.138  35.603  1.00 20.99  ? 321  VAL A O     1 
ATOM   2389  C  CB    . VAL A  1  321 ? 41.672  49.931  37.633  1.00 20.88  ? 321  VAL A CB    1 
ATOM   2390  C  CG1   . VAL A  1  321 ? 42.581  51.145  37.631  1.00 23.31  ? 321  VAL A CG1   1 
ATOM   2391  C  CG2   . VAL A  1  321 ? 40.230  50.357  37.465  1.00 18.52  ? 321  VAL A CG2   1 
ATOM   2392  N  N     . TYR A  1  322 ? 41.210  47.075  37.818  1.00 18.14  ? 322  TYR A N     1 
ATOM   2393  C  CA    . TYR A  1  322 ? 40.492  45.826  38.002  1.00 19.44  ? 322  TYR A CA    1 
ATOM   2394  C  C     . TYR A  1  322 ? 39.283  45.897  38.887  1.00 19.08  ? 322  TYR A C     1 
ATOM   2395  O  O     . TYR A  1  322 ? 39.280  46.567  39.936  1.00 16.28  ? 322  TYR A O     1 
ATOM   2396  C  CB    . TYR A  1  322 ? 41.400  44.744  38.607  1.00 19.66  ? 322  TYR A CB    1 
ATOM   2397  C  CG    . TYR A  1  322 ? 42.472  44.228  37.707  1.00 27.74  ? 322  TYR A CG    1 
ATOM   2398  C  CD1   . TYR A  1  322 ? 43.768  44.076  38.169  1.00 28.47  ? 322  TYR A CD1   1 
ATOM   2399  C  CD2   . TYR A  1  322 ? 42.184  43.847  36.399  1.00 28.00  ? 322  TYR A CD2   1 
ATOM   2400  C  CE1   . TYR A  1  322 ? 44.759  43.549  37.352  1.00 35.07  ? 322  TYR A CE1   1 
ATOM   2401  C  CE2   . TYR A  1  322 ? 43.148  43.337  35.584  1.00 30.62  ? 322  TYR A CE2   1 
ATOM   2402  C  CZ    . TYR A  1  322 ? 44.441  43.185  36.058  1.00 35.56  ? 322  TYR A CZ    1 
ATOM   2403  O  OH    . TYR A  1  322 ? 45.412  42.686  35.220  1.00 39.21  ? 322  TYR A OH    1 
ATOM   2404  N  N     . LEU A  1  323 ? 38.292  45.120  38.480  1.00 20.37  ? 323  LEU A N     1 
ATOM   2405  C  CA    . LEU A  1  323 ? 37.047  44.964  39.216  1.00 20.37  ? 323  LEU A CA    1 
ATOM   2406  C  C     . LEU A  1  323 ? 37.126  43.544  39.788  1.00 20.19  ? 323  LEU A C     1 
ATOM   2407  O  O     . LEU A  1  323 ? 37.102  42.570  39.046  1.00 19.34  ? 323  LEU A O     1 
ATOM   2408  C  CB    . LEU A  1  323 ? 35.869  45.081  38.264  1.00 16.04  ? 323  LEU A CB    1 
ATOM   2409  C  CG    . LEU A  1  323 ? 34.505  44.777  38.893  1.00 19.81  ? 323  LEU A CG    1 
ATOM   2410  C  CD1   . LEU A  1  323 ? 34.294  45.557  40.155  1.00 21.17  ? 323  LEU A CD1   1 
ATOM   2411  C  CD2   . LEU A  1  323 ? 33.430  45.113  37.892  1.00 19.99  ? 323  LEU A CD2   1 
ATOM   2412  N  N     . GLN A  1  324 ? 37.190  43.425  41.109  1.00 21.07  ? 324  GLN A N     1 
ATOM   2413  C  CA    . GLN A  1  324 ? 37.326  42.108  41.729  1.00 21.96  ? 324  GLN A CA    1 
ATOM   2414  C  C     . GLN A  1  324 ? 36.046  41.546  42.345  1.00 21.49  ? 324  GLN A C     1 
ATOM   2415  O  O     . GLN A  1  324 ? 35.479  42.147  43.260  1.00 19.00  ? 324  GLN A O     1 
ATOM   2416  C  CB    . GLN A  1  324 ? 38.411  42.159  42.824  1.00 19.75  ? 324  GLN A CB    1 
ATOM   2417  C  CG    . GLN A  1  324 ? 38.500  40.887  43.644  1.00 16.57  ? 324  GLN A CG    1 
ATOM   2418  C  CD    . GLN A  1  324 ? 39.545  40.959  44.770  1.00 21.55  ? 324  GLN A CD    1 
ATOM   2419  O  OE1   . GLN A  1  324 ? 40.723  41.258  44.537  1.00 23.33  ? 324  GLN A OE1   1 
ATOM   2420  N  NE2   . GLN A  1  324 ? 39.118  40.660  45.988  1.00 20.59  ? 324  GLN A NE2   1 
ATOM   2421  N  N     . LEU A  1  325 ? 35.646  40.363  41.878  1.00 21.41  ? 325  LEU A N     1 
ATOM   2422  C  CA    . LEU A  1  325 ? 34.461  39.682  42.387  1.00 23.37  ? 325  LEU A CA    1 
ATOM   2423  C  C     . LEU A  1  325 ? 34.775  38.297  42.952  1.00 24.61  ? 325  LEU A C     1 
ATOM   2424  O  O     . LEU A  1  325 ? 33.885  37.654  43.538  1.00 28.37  ? 325  LEU A O     1 
ATOM   2425  C  CB    . LEU A  1  325 ? 33.430  39.472  41.262  1.00 20.15  ? 325  LEU A CB    1 
ATOM   2426  C  CG    . LEU A  1  325 ? 33.027  40.663  40.390  1.00 23.95  ? 325  LEU A CG    1 
ATOM   2427  C  CD1   . LEU A  1  325 ? 32.082  40.216  39.292  1.00 21.84  ? 325  LEU A CD1   1 
ATOM   2428  C  CD2   . LEU A  1  325 ? 32.358  41.691  41.242  1.00 27.41  ? 325  LEU A CD2   1 
ATOM   2429  N  N     . HIS A  1  326 ? 35.998  37.804  42.792  1.00 26.35  ? 326  HIS A N     1 
ATOM   2430  C  CA    . HIS A  1  326 ? 36.228  36.419  43.234  1.00 25.75  ? 326  HIS A CA    1 
ATOM   2431  C  C     . HIS A  1  326 ? 36.170  36.142  44.709  1.00 25.74  ? 326  HIS A C     1 
ATOM   2432  O  O     . HIS A  1  326 ? 36.086  34.987  45.086  1.00 28.99  ? 326  HIS A O     1 
ATOM   2433  C  CB    . HIS A  1  326 ? 37.521  35.824  42.640  1.00 24.19  ? 326  HIS A CB    1 
ATOM   2434  C  CG    . HIS A  1  326 ? 38.753  36.595  42.967  1.00 30.30  ? 326  HIS A CG    1 
ATOM   2435  N  ND1   . HIS A  1  326 ? 39.408  37.386  42.040  1.00 31.68  ? 326  HIS A ND1   1 
ATOM   2436  C  CD2   . HIS A  1  326 ? 39.430  36.734  44.133  1.00 26.10  ? 326  HIS A CD2   1 
ATOM   2437  C  CE1   . HIS A  1  326 ? 40.434  37.981  42.623  1.00 31.69  ? 326  HIS A CE1   1 
ATOM   2438  N  NE2   . HIS A  1  326 ? 40.470  37.602  43.893  1.00 29.95  ? 326  HIS A NE2   1 
ATOM   2439  N  N     . HIS A  1  327 ? 36.198  37.169  45.554  1.00 23.84  ? 327  HIS A N     1 
ATOM   2440  C  CA    . HIS A  1  327 ? 36.103  36.918  46.989  1.00 23.64  ? 327  HIS A CA    1 
ATOM   2441  C  C     . HIS A  1  327 ? 34.636  36.643  47.357  1.00 27.07  ? 327  HIS A C     1 
ATOM   2442  O  O     . HIS A  1  327 ? 34.334  36.349  48.522  1.00 28.08  ? 327  HIS A O     1 
ATOM   2443  C  CB    . HIS A  1  327 ? 36.603  38.125  47.797  1.00 21.60  ? 327  HIS A CB    1 
ATOM   2444  C  CG    . HIS A  1  327 ? 35.890  39.403  47.481  1.00 27.08  ? 327  HIS A CG    1 
ATOM   2445  N  ND1   . HIS A  1  327 ? 36.052  40.063  46.280  1.00 31.13  ? 327  HIS A ND1   1 
ATOM   2446  C  CD2   . HIS A  1  327 ? 35.000  40.134  48.193  1.00 26.75  ? 327  HIS A CD2   1 
ATOM   2447  C  CE1   . HIS A  1  327 ? 35.298  41.148  46.269  1.00 27.29  ? 327  HIS A CE1   1 
ATOM   2448  N  NE2   . HIS A  1  327 ? 34.651  41.216  47.418  1.00 29.72  ? 327  HIS A NE2   1 
ATOM   2449  N  N     . LEU A  1  328 ? 33.713  36.744  46.383  1.00 24.56  ? 328  LEU A N     1 
ATOM   2450  C  CA    . LEU A  1  328 ? 32.301  36.513  46.688  1.00 22.12  ? 328  LEU A CA    1 
ATOM   2451  C  C     . LEU A  1  328 ? 31.941  35.050  46.448  1.00 22.25  ? 328  LEU A C     1 
ATOM   2452  O  O     . LEU A  1  328 ? 32.546  34.399  45.615  1.00 24.89  ? 328  LEU A O     1 
ATOM   2453  C  CB    . LEU A  1  328 ? 31.386  37.451  45.850  1.00 23.55  ? 328  LEU A CB    1 
ATOM   2454  C  CG    . LEU A  1  328 ? 31.597  38.988  45.970  1.00 26.86  ? 328  LEU A CG    1 
ATOM   2455  C  CD1   . LEU A  1  328 ? 30.719  39.749  44.974  1.00 23.96  ? 328  LEU A CD1   1 
ATOM   2456  C  CD2   . LEU A  1  328 ? 31.292  39.476  47.402  1.00 24.86  ? 328  LEU A CD2   1 
ATOM   2457  N  N     . PRO A  1  329 ? 30.924  34.525  47.157  1.00 23.09  ? 329  PRO A N     1 
ATOM   2458  C  CA    . PRO A  1  329 ? 30.526  33.124  46.979  1.00 24.40  ? 329  PRO A CA    1 
ATOM   2459  C  C     . PRO A  1  329 ? 30.048  32.885  45.551  1.00 29.56  ? 329  PRO A C     1 
ATOM   2460  O  O     . PRO A  1  329 ? 29.229  33.648  45.032  1.00 33.47  ? 329  PRO A O     1 
ATOM   2461  C  CB    . PRO A  1  329 ? 29.406  32.944  47.997  1.00 21.27  ? 329  PRO A CB    1 
ATOM   2462  C  CG    . PRO A  1  329 ? 29.709  33.976  49.056  1.00 26.60  ? 329  PRO A CG    1 
ATOM   2463  C  CD    . PRO A  1  329 ? 30.151  35.169  48.236  1.00 22.95  ? 329  PRO A CD    1 
ATOM   2464  N  N     . PRO A  1  330 ? 30.547  31.822  44.889  1.00 29.34  ? 330  PRO A N     1 
ATOM   2465  C  CA    . PRO A  1  330 ? 30.093  31.600  43.520  1.00 28.42  ? 330  PRO A CA    1 
ATOM   2466  C  C     . PRO A  1  330 ? 28.591  31.483  43.336  1.00 31.80  ? 330  PRO A C     1 
ATOM   2467  O  O     . PRO A  1  330 ? 28.089  31.774  42.237  1.00 29.01  ? 330  PRO A O     1 
ATOM   2468  C  CB    . PRO A  1  330 ? 30.869  30.353  43.072  1.00 32.24  ? 330  PRO A CB    1 
ATOM   2469  C  CG    . PRO A  1  330 ? 31.388  29.752  44.334  1.00 30.52  ? 330  PRO A CG    1 
ATOM   2470  C  CD    . PRO A  1  330 ? 31.642  30.908  45.247  1.00 30.87  ? 330  PRO A CD    1 
ATOM   2471  N  N     . GLN A  1  331 ? 27.857  31.095  44.383  1.00 29.54  ? 331  GLN A N     1 
ATOM   2472  C  CA    . GLN A  1  331 ? 26.400  31.000  44.219  1.00 33.33  ? 331  GLN A CA    1 
ATOM   2473  C  C     . GLN A  1  331 ? 25.769  32.405  44.054  1.00 31.73  ? 331  GLN A C     1 
ATOM   2474  O  O     . GLN A  1  331 ? 24.790  32.575  43.322  1.00 33.60  ? 331  GLN A O     1 
ATOM   2475  C  CB    . GLN A  1  331 ? 25.745  30.269  45.392  1.00 34.48  ? 331  GLN A CB    1 
ATOM   2476  C  CG    . GLN A  1  331 ? 24.268  29.958  45.131  1.00 41.43  ? 331  GLN A CG    1 
ATOM   2477  C  CD    . GLN A  1  331 ? 24.022  29.397  43.712  1.00 49.57  ? 331  GLN A CD    1 
ATOM   2478  O  OE1   . GLN A  1  331 ? 24.448  28.284  43.378  1.00 52.07  ? 331  GLN A OE1   1 
ATOM   2479  N  NE2   . GLN A  1  331 ? 23.345  30.183  42.871  1.00 48.32  ? 331  GLN A NE2   1 
ATOM   2480  N  N     . GLN A  1  332 ? 26.346  33.402  44.729  1.00 28.52  ? 332  GLN A N     1 
ATOM   2481  C  CA    . GLN A  1  332 ? 25.893  34.792  44.642  1.00 26.40  ? 332  GLN A CA    1 
ATOM   2482  C  C     . GLN A  1  332 ? 26.229  35.368  43.258  1.00 25.88  ? 332  GLN A C     1 
ATOM   2483  O  O     . GLN A  1  332 ? 25.499  36.183  42.718  1.00 32.32  ? 332  GLN A O     1 
ATOM   2484  C  CB    . GLN A  1  332 ? 26.563  35.635  45.740  1.00 26.22  ? 332  GLN A CB    1 
ATOM   2485  C  CG    . GLN A  1  332 ? 26.487  37.161  45.534  1.00 29.62  ? 332  GLN A CG    1 
ATOM   2486  C  CD    . GLN A  1  332 ? 26.967  37.986  46.742  1.00 32.59  ? 332  GLN A CD    1 
ATOM   2487  O  OE1   . GLN A  1  332 ? 27.903  37.600  47.453  1.00 32.88  ? 332  GLN A OE1   1 
ATOM   2488  N  NE2   . GLN A  1  332 ? 26.331  39.143  46.961  1.00 30.22  ? 332  GLN A NE2   1 
ATOM   2489  N  N     . LEU A  1  333 ? 27.350  34.969  42.682  1.00 26.80  ? 333  LEU A N     1 
ATOM   2490  C  CA    . LEU A  1  333 ? 27.721  35.478  41.367  1.00 24.20  ? 333  LEU A CA    1 
ATOM   2491  C  C     . LEU A  1  333 ? 26.729  34.932  40.327  1.00 23.73  ? 333  LEU A C     1 
ATOM   2492  O  O     . LEU A  1  333 ? 26.232  35.672  39.448  1.00 23.13  ? 333  LEU A O     1 
ATOM   2493  C  CB    . LEU A  1  333 ? 29.158  35.046  41.021  1.00 22.10  ? 333  LEU A CB    1 
ATOM   2494  C  CG    . LEU A  1  333 ? 30.260  35.600  41.925  1.00 20.23  ? 333  LEU A CG    1 
ATOM   2495  C  CD1   . LEU A  1  333 ? 31.613  35.160  41.435  1.00 22.54  ? 333  LEU A CD1   1 
ATOM   2496  C  CD2   . LEU A  1  333 ? 30.208  37.135  41.939  1.00 26.20  ? 333  LEU A CD2   1 
ATOM   2497  N  N     . ALA A  1  334 ? 26.428  33.641  40.456  1.00 22.38  ? 334  ALA A N     1 
ATOM   2498  C  CA    . ALA A  1  334 ? 25.505  32.966  39.553  1.00 21.45  ? 334  ALA A CA    1 
ATOM   2499  C  C     . ALA A  1  334 ? 24.066  33.416  39.714  1.00 22.51  ? 334  ALA A C     1 
ATOM   2500  O  O     . ALA A  1  334 ? 23.313  33.442  38.743  1.00 29.09  ? 334  ALA A O     1 
ATOM   2501  C  CB    . ALA A  1  334 ? 25.592  31.444  39.729  1.00 18.60  ? 334  ALA A CB    1 
ATOM   2502  N  N     . THR A  1  335 ? 23.672  33.781  40.929  1.00 24.82  ? 335  THR A N     1 
ATOM   2503  C  CA    . THR A  1  335 ? 22.314  34.205  41.173  1.00 20.23  ? 335  THR A CA    1 
ATOM   2504  C  C     . THR A  1  335 ? 22.104  35.708  40.954  1.00 24.14  ? 335  THR A C     1 
ATOM   2505  O  O     . THR A  1  335 ? 21.071  36.116  40.418  1.00 20.78  ? 335  THR A O     1 
ATOM   2506  C  CB    . THR A  1  335 ? 21.879  33.845  42.597  1.00 22.54  ? 335  THR A CB    1 
ATOM   2507  O  OG1   . THR A  1  335 ? 21.935  32.425  42.767  1.00 30.68  ? 335  THR A OG1   1 
ATOM   2508  C  CG2   . THR A  1  335 ? 20.456  34.292  42.846  1.00 20.04  ? 335  THR A CG2   1 
ATOM   2509  N  N     . ARG A  1  336 ? 23.073  36.531  41.340  1.00 18.55  ? 336  ARG A N     1 
ATOM   2510  C  CA    . ARG A  1  336 ? 22.910  37.986  41.183  1.00 21.98  ? 336  ARG A CA    1 
ATOM   2511  C  C     . ARG A  1  336 ? 23.545  38.627  39.949  1.00 22.38  ? 336  ARG A C     1 
ATOM   2512  O  O     . ARG A  1  336 ? 23.057  39.667  39.469  1.00 22.40  ? 336  ARG A O     1 
ATOM   2513  C  CB    . ARG A  1  336 ? 23.468  38.729  42.403  1.00 14.54  ? 336  ARG A CB    1 
ATOM   2514  C  CG    . ARG A  1  336 ? 22.991  38.226  43.726  1.00 19.26  ? 336  ARG A CG    1 
ATOM   2515  C  CD    . ARG A  1  336 ? 21.484  38.382  43.809  1.00 21.21  ? 336  ARG A CD    1 
ATOM   2516  N  NE    . ARG A  1  336 ? 20.994  38.110  45.154  1.00 22.02  ? 336  ARG A NE    1 
ATOM   2517  C  CZ    . ARG A  1  336 ? 19.759  37.692  45.427  1.00 24.43  ? 336  ARG A CZ    1 
ATOM   2518  N  NH1   . ARG A  1  336 ? 18.894  37.503  44.446  1.00 17.20  ? 336  ARG A NH1   1 
ATOM   2519  N  NH2   . ARG A  1  336 ? 19.398  37.449  46.683  1.00 25.33  ? 336  ARG A NH2   1 
ATOM   2520  N  N     . LEU A  1  337 ? 24.635  38.035  39.463  1.00 24.32  ? 337  LEU A N     1 
ATOM   2521  C  CA    . LEU A  1  337 ? 25.381  38.575  38.319  1.00 22.08  ? 337  LEU A CA    1 
ATOM   2522  C  C     . LEU A  1  337 ? 25.687  37.569  37.213  1.00 21.27  ? 337  LEU A C     1 
ATOM   2523  O  O     . LEU A  1  337 ? 26.774  37.559  36.661  1.00 19.81  ? 337  LEU A O     1 
ATOM   2524  C  CB    . LEU A  1  337 ? 26.703  39.151  38.807  1.00 21.64  ? 337  LEU A CB    1 
ATOM   2525  C  CG    . LEU A  1  337 ? 26.634  40.197  39.931  1.00 26.83  ? 337  LEU A CG    1 
ATOM   2526  C  CD1   . LEU A  1  337 ? 28.012  40.411  40.492  1.00 21.86  ? 337  LEU A CD1   1 
ATOM   2527  C  CD2   . LEU A  1  337 ? 26.101  41.506  39.406  1.00 24.17  ? 337  LEU A CD2   1 
ATOM   2528  N  N     . PRO A  1  338 ? 24.725  36.717  36.866  1.00 22.44  ? 338  PRO A N     1 
ATOM   2529  C  CA    . PRO A  1  338 ? 24.982  35.737  35.804  1.00 20.23  ? 338  PRO A CA    1 
ATOM   2530  C  C     . PRO A  1  338 ? 25.310  36.378  34.451  1.00 21.35  ? 338  PRO A C     1 
ATOM   2531  O  O     . PRO A  1  338 ? 26.145  35.862  33.695  1.00 18.87  ? 338  PRO A O     1 
ATOM   2532  C  CB    . PRO A  1  338 ? 23.684  34.941  35.745  1.00 22.09  ? 338  PRO A CB    1 
ATOM   2533  C  CG    . PRO A  1  338 ? 22.628  36.035  36.121  1.00 18.28  ? 338  PRO A CG    1 
ATOM   2534  C  CD    . PRO A  1  338 ? 23.312  36.722  37.293  1.00 16.63  ? 338  PRO A CD    1 
ATOM   2535  N  N     . GLY A  1  339 ? 24.663  37.505  34.152  1.00 20.01  ? 339  GLY A N     1 
ATOM   2536  C  CA    . GLY A  1  339 ? 24.897  38.171  32.868  1.00 15.83  ? 339  GLY A CA    1 
ATOM   2537  C  C     . GLY A  1  339 ? 26.315  38.638  32.646  1.00 15.35  ? 339  GLY A C     1 
ATOM   2538  O  O     . GLY A  1  339 ? 26.915  38.344  31.606  1.00 16.98  ? 339  GLY A O     1 
ATOM   2539  N  N     . ILE A  1  340 ? 26.881  39.364  33.611  1.00 17.68  ? 340  ILE A N     1 
ATOM   2540  C  CA    . ILE A  1  340 ? 28.235  39.835  33.411  1.00 17.45  ? 340  ILE A CA    1 
ATOM   2541  C  C     . ILE A  1  340 ? 29.211  38.663  33.547  1.00 21.56  ? 340  ILE A C     1 
ATOM   2542  O  O     . ILE A  1  340 ? 30.303  38.702  32.987  1.00 23.04  ? 340  ILE A O     1 
ATOM   2543  C  CB    . ILE A  1  340 ? 28.575  41.016  34.351  1.00 18.94  ? 340  ILE A CB    1 
ATOM   2544  C  CG1   . ILE A  1  340 ? 28.388  40.626  35.811  1.00 19.69  ? 340  ILE A CG1   1 
ATOM   2545  C  CG2   . ILE A  1  340 ? 27.765  42.225  33.960  1.00 22.19  ? 340  ILE A CG2   1 
ATOM   2546  C  CD1   . ILE A  1  340 ? 29.684  40.126  36.451  1.00 20.16  ? 340  ILE A CD1   1 
ATOM   2547  N  N     . SER A  1  341 ? 28.819  37.599  34.247  1.00 22.96  ? 341  SER A N     1 
ATOM   2548  C  CA    . SER A  1  341 ? 29.708  36.433  34.346  1.00 25.28  ? 341  SER A CA    1 
ATOM   2549  C  C     . SER A  1  341 ? 30.039  35.891  32.949  1.00 26.26  ? 341  SER A C     1 
ATOM   2550  O  O     . SER A  1  341 ? 31.198  35.572  32.642  1.00 24.75  ? 341  SER A O     1 
ATOM   2551  C  CB    . SER A  1  341 ? 29.068  35.327  35.186  1.00 26.50  ? 341  SER A CB    1 
ATOM   2552  O  OG    . SER A  1  341 ? 28.951  35.752  36.538  1.00 24.04  ? 341  SER A OG    1 
ATOM   2553  N  N     . GLU A  1  342 ? 29.017  35.826  32.100  1.00 26.12  ? 342  GLU A N     1 
ATOM   2554  C  CA    . GLU A  1  342 ? 29.147  35.349  30.733  1.00 26.08  ? 342  GLU A CA    1 
ATOM   2555  C  C     . GLU A  1  342 ? 29.916  36.328  29.850  1.00 27.66  ? 342  GLU A C     1 
ATOM   2556  O  O     . GLU A  1  342 ? 30.765  35.927  29.025  1.00 23.61  ? 342  GLU A O     1 
ATOM   2557  C  CB    . GLU A  1  342 ? 27.750  35.125  30.147  1.00 32.96  ? 342  GLU A CB    1 
ATOM   2558  C  CG    . GLU A  1  342 ? 27.724  34.317  28.863  1.00 43.69  ? 342  GLU A CG    1 
ATOM   2559  C  CD    . GLU A  1  342 ? 28.270  32.892  29.052  1.00 54.65  ? 342  GLU A CD    1 
ATOM   2560  O  OE1   . GLU A  1  342 ? 27.866  32.222  30.046  1.00 58.74  ? 342  GLU A OE1   1 
ATOM   2561  O  OE2   . GLU A  1  342 ? 29.095  32.444  28.209  1.00 58.55  ? 342  GLU A OE2   1 
ATOM   2562  N  N     . THR A  1  343 ? 29.593  37.612  30.021  1.00 26.87  ? 343  THR A N     1 
ATOM   2563  C  CA    . THR A  1  343 ? 30.196  38.688  29.250  1.00 23.17  ? 343  THR A CA    1 
ATOM   2564  C  C     . THR A  1  343 ? 31.697  38.776  29.542  1.00 21.77  ? 343  THR A C     1 
ATOM   2565  O  O     . THR A  1  343 ? 32.512  38.903  28.620  1.00 20.18  ? 343  THR A O     1 
ATOM   2566  C  CB    . THR A  1  343 ? 29.501  40.028  29.586  1.00 27.57  ? 343  THR A CB    1 
ATOM   2567  O  OG1   . THR A  1  343 ? 28.172  39.996  29.062  1.00 23.35  ? 343  THR A OG1   1 
ATOM   2568  C  CG2   . THR A  1  343 ? 30.247  41.220  28.955  1.00 24.60  ? 343  THR A CG2   1 
ATOM   2569  N  N     . ALA A  1  344 ? 32.059  38.696  30.816  1.00 19.51  ? 344  ALA A N     1 
ATOM   2570  C  CA    . ALA A  1  344 ? 33.462  38.740  31.194  1.00 24.09  ? 344  ALA A CA    1 
ATOM   2571  C  C     . ALA A  1  344 ? 34.217  37.612  30.493  1.00 23.85  ? 344  ALA A C     1 
ATOM   2572  O  O     . ALA A  1  344 ? 35.342  37.806  30.019  1.00 24.50  ? 344  ALA A O     1 
ATOM   2573  C  CB    . ALA A  1  344 ? 33.616  38.609  32.707  1.00 21.51  ? 344  ALA A CB    1 
ATOM   2574  N  N     . MET A  1  345 ? 33.599  36.435  30.428  1.00 19.31  ? 345  MET A N     1 
ATOM   2575  C  CA    . MET A  1  345 ? 34.245  35.291  29.780  1.00 20.05  ? 345  MET A CA    1 
ATOM   2576  C  C     . MET A  1  345 ? 34.322  35.512  28.265  1.00 22.92  ? 345  MET A C     1 
ATOM   2577  O  O     . MET A  1  345 ? 35.373  35.336  27.638  1.00 21.93  ? 345  MET A O     1 
ATOM   2578  C  CB    . MET A  1  345 ? 33.465  34.008  30.078  1.00 20.20  ? 345  MET A CB    1 
ATOM   2579  C  CG    . MET A  1  345 ? 34.023  32.744  29.424  1.00 26.44  ? 345  MET A CG    1 
ATOM   2580  S  SD    . MET A  1  345 ? 35.843  32.445  29.768  1.00 35.89  ? 345  MET A SD    1 
ATOM   2581  C  CE    . MET A  1  345 ? 35.784  32.066  31.501  1.00 28.22  ? 345  MET A CE    1 
ATOM   2582  N  N     . ILE A  1  346 ? 33.218  35.928  27.664  1.00 22.08  ? 346  ILE A N     1 
ATOM   2583  C  CA    . ILE A  1  346 ? 33.239  36.150  26.226  1.00 20.69  ? 346  ILE A CA    1 
ATOM   2584  C  C     . ILE A  1  346 ? 34.186  37.273  25.760  1.00 20.51  ? 346  ILE A C     1 
ATOM   2585  O  O     . ILE A  1  346 ? 34.913  37.105  24.776  1.00 20.12  ? 346  ILE A O     1 
ATOM   2586  C  CB    . ILE A  1  346 ? 31.848  36.487  25.706  1.00 23.72  ? 346  ILE A CB    1 
ATOM   2587  C  CG1   . ILE A  1  346 ? 30.888  35.333  25.995  1.00 21.59  ? 346  ILE A CG1   1 
ATOM   2588  C  CG2   . ILE A  1  346 ? 31.922  36.797  24.200  1.00 22.70  ? 346  ILE A CG2   1 
ATOM   2589  C  CD1   . ILE A  1  346 ? 29.469  35.655  25.622  1.00 20.78  ? 346  ILE A CD1   1 
ATOM   2590  N  N     . PHE A  1  347 ? 34.191  38.414  26.447  1.00 17.86  ? 347  PHE A N     1 
ATOM   2591  C  CA    . PHE A  1  347 ? 35.009  39.522  25.980  1.00 19.62  ? 347  PHE A CA    1 
ATOM   2592  C  C     . PHE A  1  347 ? 36.371  39.783  26.597  1.00 24.00  ? 347  PHE A C     1 
ATOM   2593  O  O     . PHE A  1  347 ? 37.105  40.646  26.103  1.00 28.31  ? 347  PHE A O     1 
ATOM   2594  C  CB    . PHE A  1  347 ? 34.200  40.825  26.021  1.00 23.72  ? 347  PHE A CB    1 
ATOM   2595  C  CG    . PHE A  1  347 ? 33.064  40.860  25.028  1.00 19.38  ? 347  PHE A CG    1 
ATOM   2596  C  CD1   . PHE A  1  347 ? 31.778  40.468  25.409  1.00 19.96  ? 347  PHE A CD1   1 
ATOM   2597  C  CD2   . PHE A  1  347 ? 33.299  41.216  23.705  1.00 19.38  ? 347  PHE A CD2   1 
ATOM   2598  C  CE1   . PHE A  1  347 ? 30.710  40.416  24.474  1.00 20.39  ? 347  PHE A CE1   1 
ATOM   2599  C  CE2   . PHE A  1  347 ? 32.247  41.176  22.749  1.00 24.70  ? 347  PHE A CE2   1 
ATOM   2600  C  CZ    . PHE A  1  347 ? 30.941  40.767  23.148  1.00 18.28  ? 347  PHE A CZ    1 
ATOM   2601  N  N     . ALA A  1  348 ? 36.707  39.083  27.677  1.00 24.65  ? 348  ALA A N     1 
ATOM   2602  C  CA    . ALA A  1  348 ? 38.000  39.284  28.312  1.00 26.74  ? 348  ALA A CA    1 
ATOM   2603  C  C     . ALA A  1  348 ? 38.620  37.942  28.702  1.00 25.16  ? 348  ALA A C     1 
ATOM   2604  O  O     . ALA A  1  348 ? 39.709  37.906  29.245  1.00 29.61  ? 348  ALA A O     1 
ATOM   2605  C  CB    . ALA A  1  348 ? 37.858  40.188  29.539  1.00 23.39  ? 348  ALA A CB    1 
ATOM   2606  N  N     . GLY A  1  349 ? 37.927  36.849  28.419  1.00 25.28  ? 349  GLY A N     1 
ATOM   2607  C  CA    . GLY A  1  349 ? 38.442  35.541  28.759  1.00 26.56  ? 349  GLY A CA    1 
ATOM   2608  C  C     . GLY A  1  349 ? 38.598  35.365  30.254  1.00 28.50  ? 349  GLY A C     1 
ATOM   2609  O  O     . GLY A  1  349 ? 39.394  34.561  30.703  1.00 32.69  ? 349  GLY A O     1 
ATOM   2610  N  N     . VAL A  1  350 ? 37.815  36.098  31.033  1.00 28.75  ? 350  VAL A N     1 
ATOM   2611  C  CA    . VAL A  1  350 ? 37.899  36.044  32.486  1.00 27.46  ? 350  VAL A CA    1 
ATOM   2612  C  C     . VAL A  1  350 ? 36.823  35.182  33.137  1.00 29.34  ? 350  VAL A C     1 
ATOM   2613  O  O     . VAL A  1  350 ? 35.656  35.256  32.749  1.00 25.45  ? 350  VAL A O     1 
ATOM   2614  C  CB    . VAL A  1  350 ? 37.748  37.474  33.078  1.00 31.95  ? 350  VAL A CB    1 
ATOM   2615  C  CG1   . VAL A  1  350 ? 37.576  37.408  34.579  1.00 31.56  ? 350  VAL A CG1   1 
ATOM   2616  C  CG2   . VAL A  1  350 ? 38.955  38.338  32.711  1.00 32.14  ? 350  VAL A CG2   1 
ATOM   2617  N  N     . ASP A  1  351 ? 37.227  34.400  34.144  1.00 27.70  ? 351  ASP A N     1 
ATOM   2618  C  CA    . ASP A  1  351 ? 36.329  33.557  34.938  1.00 27.88  ? 351  ASP A CA    1 
ATOM   2619  C  C     . ASP A  1  351 ? 36.209  34.362  36.244  1.00 26.97  ? 351  ASP A C     1 
ATOM   2620  O  O     . ASP A  1  351 ? 37.129  34.382  37.060  1.00 24.34  ? 351  ASP A O     1 
ATOM   2621  C  CB    . ASP A  1  351 ? 36.983  32.188  35.216  1.00 31.57  ? 351  ASP A CB    1 
ATOM   2622  C  CG    . ASP A  1  351 ? 36.162  31.318  36.169  1.00 34.93  ? 351  ASP A CG    1 
ATOM   2623  O  OD1   . ASP A  1  351 ? 35.284  31.854  36.881  1.00 36.01  ? 351  ASP A OD1   1 
ATOM   2624  O  OD2   . ASP A  1  351 ? 36.399  30.085  36.218  1.00 41.19  ? 351  ASP A OD2   1 
ATOM   2625  N  N     . VAL A  1  352 ? 35.070  35.017  36.456  1.00 25.70  ? 352  VAL A N     1 
ATOM   2626  C  CA    . VAL A  1  352 ? 34.931  35.870  37.642  1.00 24.71  ? 352  VAL A CA    1 
ATOM   2627  C  C     . VAL A  1  352 ? 35.091  35.207  39.000  1.00 20.61  ? 352  VAL A C     1 
ATOM   2628  O  O     . VAL A  1  352 ? 35.307  35.904  39.981  1.00 18.13  ? 352  VAL A O     1 
ATOM   2629  C  CB    . VAL A  1  352 ? 33.583  36.708  37.628  1.00 25.35  ? 352  VAL A CB    1 
ATOM   2630  C  CG1   . VAL A  1  352 ? 33.488  37.533  36.332  1.00 24.70  ? 352  VAL A CG1   1 
ATOM   2631  C  CG2   . VAL A  1  352 ? 32.365  35.773  37.769  1.00 25.35  ? 352  VAL A CG2   1 
ATOM   2632  N  N     . THR A  1  353 ? 34.995  33.884  39.080  1.00 22.85  ? 353  THR A N     1 
ATOM   2633  C  CA    . THR A  1  353 ? 35.180  33.235  40.379  1.00 24.91  ? 353  THR A CA    1 
ATOM   2634  C  C     . THR A  1  353 ? 36.664  33.093  40.670  1.00 26.64  ? 353  THR A C     1 
ATOM   2635  O  O     . THR A  1  353 ? 37.034  32.749  41.771  1.00 29.02  ? 353  THR A O     1 
ATOM   2636  C  CB    . THR A  1  353 ? 34.572  31.801  40.462  1.00 25.37  ? 353  THR A CB    1 
ATOM   2637  O  OG1   . THR A  1  353 ? 35.112  30.990  39.413  1.00 31.34  ? 353  THR A OG1   1 
ATOM   2638  C  CG2   . THR A  1  353 ? 33.054  31.849  40.379  1.00 24.00  ? 353  THR A CG2   1 
ATOM   2639  N  N     . LYS A  1  354 ? 37.513  33.383  39.695  1.00 27.16  ? 354  LYS A N     1 
ATOM   2640  C  CA    . LYS A  1  354 ? 38.958  33.236  39.885  1.00 28.95  ? 354  LYS A CA    1 
ATOM   2641  C  C     . LYS A  1  354 ? 39.827  34.473  39.650  1.00 28.70  ? 354  LYS A C     1 
ATOM   2642  O  O     . LYS A  1  354 ? 40.843  34.639  40.312  1.00 26.11  ? 354  LYS A O     1 
ATOM   2643  C  CB    . LYS A  1  354 ? 39.489  32.117  38.982  1.00 28.95  ? 354  LYS A CB    1 
ATOM   2644  C  CG    . LYS A  1  354 ? 38.838  30.748  39.194  1.00 36.32  ? 354  LYS A CG    1 
ATOM   2645  C  CD    . LYS A  1  354 ? 39.271  29.755  38.105  1.00 38.96  ? 354  LYS A CD    1 
ATOM   2646  C  CE    . LYS A  1  354 ? 38.981  28.307  38.517  1.00 40.05  ? 354  LYS A CE    1 
ATOM   2647  N  NZ    . LYS A  1  354 ? 37.542  28.092  38.833  1.00 44.82  ? 354  LYS A NZ    1 
ATOM   2648  N  N     . GLU A  1  355 ? 39.442  35.335  38.713  1.00 30.48  ? 355  GLU A N     1 
ATOM   2649  C  CA    . GLU A  1  355 ? 40.250  36.512  38.388  1.00 32.51  ? 355  GLU A CA    1 
ATOM   2650  C  C     . GLU A  1  355 ? 39.426  37.779  38.209  1.00 29.15  ? 355  GLU A C     1 
ATOM   2651  O  O     . GLU A  1  355 ? 38.237  37.705  37.951  1.00 28.72  ? 355  GLU A O     1 
ATOM   2652  C  CB    . GLU A  1  355 ? 41.045  36.243  37.101  1.00 36.51  ? 355  GLU A CB    1 
ATOM   2653  C  CG    . GLU A  1  355 ? 41.988  35.024  37.156  1.00 44.88  ? 355  GLU A CG    1 
ATOM   2654  C  CD    . GLU A  1  355 ? 43.200  35.240  38.074  1.00 55.14  ? 355  GLU A CD    1 
ATOM   2655  O  OE1   . GLU A  1  355 ? 43.846  36.316  37.974  1.00 55.56  ? 355  GLU A OE1   1 
ATOM   2656  O  OE2   . GLU A  1  355 ? 43.511  34.329  38.892  1.00 59.21  ? 355  GLU A OE2   1 
ATOM   2657  N  N     . PRO A  1  356 ? 40.066  38.961  38.311  1.00 25.95  ? 356  PRO A N     1 
ATOM   2658  C  CA    . PRO A  1  356 ? 39.305  40.201  38.153  1.00 22.15  ? 356  PRO A CA    1 
ATOM   2659  C  C     . PRO A  1  356 ? 39.035  40.583  36.705  1.00 24.24  ? 356  PRO A C     1 
ATOM   2660  O  O     . PRO A  1  356 ? 39.699  40.113  35.782  1.00 19.98  ? 356  PRO A O     1 
ATOM   2661  C  CB    . PRO A  1  356 ? 40.171  41.236  38.879  1.00 20.84  ? 356  PRO A CB    1 
ATOM   2662  C  CG    . PRO A  1  356 ? 41.579  40.746  38.574  1.00 24.45  ? 356  PRO A CG    1 
ATOM   2663  C  CD    . PRO A  1  356 ? 41.474  39.232  38.671  1.00 22.29  ? 356  PRO A CD    1 
ATOM   2664  N  N     . ILE A  1  357 ? 38.045  41.455  36.526  1.00 24.36  ? 357  ILE A N     1 
ATOM   2665  C  CA    . ILE A  1  357 ? 37.669  41.963  35.218  1.00 17.80  ? 357  ILE A CA    1 
ATOM   2666  C  C     . ILE A  1  357 ? 38.427  43.265  34.950  1.00 19.58  ? 357  ILE A C     1 
ATOM   2667  O  O     . ILE A  1  357 ? 38.532  44.118  35.844  1.00 17.59  ? 357  ILE A O     1 
ATOM   2668  C  CB    . ILE A  1  357 ? 36.158  42.283  35.184  1.00 18.19  ? 357  ILE A CB    1 
ATOM   2669  C  CG1   . ILE A  1  357 ? 35.359  41.063  35.652  1.00 15.20  ? 357  ILE A CG1   1 
ATOM   2670  C  CG2   . ILE A  1  357 ? 35.743  42.693  33.779  1.00 20.14  ? 357  ILE A CG2   1 
ATOM   2671  C  CD1   . ILE A  1  357 ? 33.840  41.263  35.734  1.00 18.41  ? 357  ILE A CD1   1 
ATOM   2672  N  N     . PRO A  1  358 ? 38.989  43.436  33.726  1.00 19.97  ? 358  PRO A N     1 
ATOM   2673  C  CA    . PRO A  1  358 ? 39.714  44.672  33.398  1.00 19.10  ? 358  PRO A CA    1 
ATOM   2674  C  C     . PRO A  1  358 ? 38.686  45.697  32.987  1.00 18.34  ? 358  PRO A C     1 
ATOM   2675  O  O     . PRO A  1  358 ? 37.943  45.458  32.047  1.00 18.81  ? 358  PRO A O     1 
ATOM   2676  C  CB    . PRO A  1  358 ? 40.594  44.274  32.231  1.00 18.14  ? 358  PRO A CB    1 
ATOM   2677  C  CG    . PRO A  1  358 ? 39.718  43.187  31.529  1.00 20.46  ? 358  PRO A CG    1 
ATOM   2678  C  CD    . PRO A  1  358 ? 39.220  42.393  32.702  1.00 18.20  ? 358  PRO A CD    1 
ATOM   2679  N  N     . VAL A  1  359 ? 38.681  46.844  33.669  1.00 15.57  ? 359  VAL A N     1 
ATOM   2680  C  CA    . VAL A  1  359 ? 37.692  47.904  33.432  1.00 17.49  ? 359  VAL A CA    1 
ATOM   2681  C  C     . VAL A  1  359 ? 38.290  49.329  33.332  1.00 17.00  ? 359  VAL A C     1 
ATOM   2682  O  O     . VAL A  1  359 ? 39.415  49.577  33.746  1.00 22.05  ? 359  VAL A O     1 
ATOM   2683  C  CB    . VAL A  1  359 ? 36.591  47.885  34.550  1.00 16.08  ? 359  VAL A CB    1 
ATOM   2684  C  CG1   . VAL A  1  359 ? 35.817  46.554  34.552  1.00 14.83  ? 359  VAL A CG1   1 
ATOM   2685  C  CG2   . VAL A  1  359 ? 37.247  48.070  35.904  1.00 14.19  ? 359  VAL A CG2   1 
ATOM   2686  N  N     . LEU A  1  360 ? 37.498  50.269  32.830  1.00 17.93  ? 360  LEU A N     1 
ATOM   2687  C  CA    . LEU A  1  360 ? 37.943  51.644  32.603  1.00 22.44  ? 360  LEU A CA    1 
ATOM   2688  C  C     . LEU A  1  360 ? 36.694  52.553  32.407  1.00 22.73  ? 360  LEU A C     1 
ATOM   2689  O  O     . LEU A  1  360 ? 35.690  52.110  31.850  1.00 21.37  ? 360  LEU A O     1 
ATOM   2690  C  CB    . LEU A  1  360 ? 38.804  51.622  31.317  1.00 26.97  ? 360  LEU A CB    1 
ATOM   2691  C  CG    . LEU A  1  360 ? 39.241  52.800  30.452  1.00 33.92  ? 360  LEU A CG    1 
ATOM   2692  C  CD1   . LEU A  1  360 ? 40.414  53.450  31.100  1.00 41.68  ? 360  LEU A CD1   1 
ATOM   2693  C  CD2   . LEU A  1  360 ? 39.687  52.316  29.074  1.00 35.59  ? 360  LEU A CD2   1 
ATOM   2694  N  N     . PRO A  1  361 ? 36.751  53.824  32.869  1.00 19.20  ? 361  PRO A N     1 
ATOM   2695  C  CA    . PRO A  1  361 ? 35.636  54.770  32.728  1.00 19.39  ? 361  PRO A CA    1 
ATOM   2696  C  C     . PRO A  1  361 ? 35.281  54.847  31.247  1.00 15.70  ? 361  PRO A C     1 
ATOM   2697  O  O     . PRO A  1  361 ? 36.157  54.976  30.423  1.00 18.67  ? 361  PRO A O     1 
ATOM   2698  C  CB    . PRO A  1  361 ? 36.227  56.088  33.275  1.00 16.11  ? 361  PRO A CB    1 
ATOM   2699  C  CG    . PRO A  1  361 ? 37.137  55.549  34.386  1.00 15.12  ? 361  PRO A CG    1 
ATOM   2700  C  CD    . PRO A  1  361 ? 37.865  54.450  33.606  1.00 18.01  ? 361  PRO A CD    1 
ATOM   2701  N  N     . THR A  1  362 ? 33.990  54.793  30.920  1.00 16.74  ? 362  THR A N     1 
ATOM   2702  C  CA    . THR A  1  362 ? 33.563  54.753  29.503  1.00 18.08  ? 362  THR A CA    1 
ATOM   2703  C  C     . THR A  1  362 ? 32.290  55.575  29.337  1.00 16.61  ? 362  THR A C     1 
ATOM   2704  O  O     . THR A  1  362 ? 31.395  55.478  30.190  1.00 18.26  ? 362  THR A O     1 
ATOM   2705  C  CB    . THR A  1  362 ? 33.236  53.261  29.122  1.00 19.62  ? 362  THR A CB    1 
ATOM   2706  O  OG1   . THR A  1  362 ? 34.368  52.443  29.409  1.00 17.73  ? 362  THR A OG1   1 
ATOM   2707  C  CG2   . THR A  1  362 ? 32.840  53.112  27.646  1.00 19.96  ? 362  THR A CG2   1 
ATOM   2708  N  N     . VAL A  1  363 ? 32.215  56.372  28.264  1.00 15.72  ? 363  VAL A N     1 
ATOM   2709  C  CA    . VAL A  1  363 ? 31.053  57.204  27.951  1.00 12.86  ? 363  VAL A CA    1 
ATOM   2710  C  C     . VAL A  1  363 ? 29.862  56.262  27.985  1.00 12.34  ? 363  VAL A C     1 
ATOM   2711  O  O     . VAL A  1  363 ? 29.897  55.173  27.422  1.00 11.89  ? 363  VAL A O     1 
ATOM   2712  C  CB    . VAL A  1  363 ? 31.223  57.943  26.586  1.00 18.25  ? 363  VAL A CB    1 
ATOM   2713  C  CG1   . VAL A  1  363 ? 29.873  58.483  26.092  1.00 11.63  ? 363  VAL A CG1   1 
ATOM   2714  C  CG2   . VAL A  1  363 ? 32.209  59.118  26.777  1.00 15.00  ? 363  VAL A CG2   1 
ATOM   2715  N  N     . HIS A  1  364 ? 28.811  56.699  28.679  1.00 15.65  ? 364  HIS A N     1 
ATOM   2716  C  CA    . HIS A  1  364 ? 27.677  55.850  28.930  1.00 12.09  ? 364  HIS A CA    1 
ATOM   2717  C  C     . HIS A  1  364 ? 26.270  56.454  28.830  1.00 14.68  ? 364  HIS A C     1 
ATOM   2718  O  O     . HIS A  1  364 ? 25.342  55.756  28.423  1.00 13.12  ? 364  HIS A O     1 
ATOM   2719  C  CB    . HIS A  1  364 ? 27.867  55.331  30.358  1.00 16.33  ? 364  HIS A CB    1 
ATOM   2720  C  CG    . HIS A  1  364 ? 26.761  54.464  30.863  1.00 14.76  ? 364  HIS A CG    1 
ATOM   2721  N  ND1   . HIS A  1  364 ? 26.623  53.143  30.484  1.00 22.46  ? 364  HIS A ND1   1 
ATOM   2722  C  CD2   . HIS A  1  364 ? 25.816  54.684  31.808  1.00 6.69   ? 364  HIS A CD2   1 
ATOM   2723  C  CE1   . HIS A  1  364 ? 25.653  52.582  31.188  1.00 14.21  ? 364  HIS A CE1   1 
ATOM   2724  N  NE2   . HIS A  1  364 ? 25.150  53.495  31.998  1.00 14.28  ? 364  HIS A NE2   1 
ATOM   2725  N  N     . TYR A  1  365 ? 26.106  57.722  29.204  1.00 9.03   ? 365  TYR A N     1 
ATOM   2726  C  CA    . TYR A  1  365 ? 24.771  58.280  29.254  1.00 14.33  ? 365  TYR A CA    1 
ATOM   2727  C  C     . TYR A  1  365 ? 24.817  59.794  29.165  1.00 17.05  ? 365  TYR A C     1 
ATOM   2728  O  O     . TYR A  1  365 ? 25.795  60.409  29.611  1.00 17.68  ? 365  TYR A O     1 
ATOM   2729  C  CB    . TYR A  1  365 ? 24.144  57.843  30.573  1.00 15.24  ? 365  TYR A CB    1 
ATOM   2730  C  CG    . TYR A  1  365 ? 22.818  58.469  30.887  1.00 17.46  ? 365  TYR A CG    1 
ATOM   2731  C  CD1   . TYR A  1  365 ? 21.626  57.880  30.453  1.00 10.74  ? 365  TYR A CD1   1 
ATOM   2732  C  CD2   . TYR A  1  365 ? 22.754  59.698  31.537  1.00 13.53  ? 365  TYR A CD2   1 
ATOM   2733  C  CE1   . TYR A  1  365 ? 20.411  58.515  30.647  1.00 14.59  ? 365  TYR A CE1   1 
ATOM   2734  C  CE2   . TYR A  1  365 ? 21.554  60.339  31.732  1.00 11.72  ? 365  TYR A CE2   1 
ATOM   2735  C  CZ    . TYR A  1  365 ? 20.383  59.741  31.280  1.00 17.74  ? 365  TYR A CZ    1 
ATOM   2736  O  OH    . TYR A  1  365 ? 19.193  60.391  31.451  1.00 16.07  ? 365  TYR A OH    1 
ATOM   2737  N  N     . ASN A  1  366 ? 23.779  60.396  28.595  1.00 15.49  ? 366  ASN A N     1 
ATOM   2738  C  CA    . ASN A  1  366 ? 23.745  61.863  28.448  1.00 15.71  ? 366  ASN A CA    1 
ATOM   2739  C  C     . ASN A  1  366 ? 22.779  62.542  29.396  1.00 15.74  ? 366  ASN A C     1 
ATOM   2740  O  O     . ASN A  1  366 ? 21.579  62.336  29.274  1.00 13.58  ? 366  ASN A O     1 
ATOM   2741  C  CB    . ASN A  1  366 ? 23.353  62.241  27.026  1.00 16.58  ? 366  ASN A CB    1 
ATOM   2742  C  CG    . ASN A  1  366 ? 24.366  61.806  26.034  1.00 22.33  ? 366  ASN A CG    1 
ATOM   2743  O  OD1   . ASN A  1  366 ? 25.476  62.360  25.976  1.00 20.62  ? 366  ASN A OD1   1 
ATOM   2744  N  ND2   . ASN A  1  366 ? 24.020  60.794  25.246  1.00 17.03  ? 366  ASN A ND2   1 
ATOM   2745  N  N     . MET A  1  367 ? 23.289  63.352  30.334  1.00 20.46  ? 367  MET A N     1 
ATOM   2746  C  CA    . MET A  1  367 ? 22.413  64.062  31.288  1.00 19.10  ? 367  MET A CA    1 
ATOM   2747  C  C     . MET A  1  367 ? 21.554  65.127  30.570  1.00 21.36  ? 367  MET A C     1 
ATOM   2748  O  O     . MET A  1  367 ? 20.403  65.356  30.915  1.00 20.22  ? 367  MET A O     1 
ATOM   2749  C  CB    . MET A  1  367 ? 23.247  64.751  32.388  1.00 23.72  ? 367  MET A CB    1 
ATOM   2750  C  CG    . MET A  1  367 ? 23.485  63.908  33.658  1.00 19.81  ? 367  MET A CG    1 
ATOM   2751  S  SD    . MET A  1  367 ? 24.642  62.494  33.488  1.00 17.86  ? 367  MET A SD    1 
ATOM   2752  C  CE    . MET A  1  367 ? 26.197  63.345  33.333  1.00 14.86  ? 367  MET A CE    1 
ATOM   2753  N  N     . GLY A  1  368 ? 22.138  65.797  29.584  1.00 22.00  ? 368  GLY A N     1 
ATOM   2754  C  CA    . GLY A  1  368 ? 21.399  66.792  28.837  1.00 23.17  ? 368  GLY A CA    1 
ATOM   2755  C  C     . GLY A  1  368 ? 20.454  66.181  27.800  1.00 25.61  ? 368  GLY A C     1 
ATOM   2756  O  O     . GLY A  1  368 ? 20.366  64.958  27.626  1.00 24.58  ? 368  GLY A O     1 
ATOM   2757  N  N     . GLY A  1  369 ? 19.724  67.036  27.109  1.00 22.38  ? 369  GLY A N     1 
ATOM   2758  C  CA    . GLY A  1  369 ? 18.805  66.570  26.092  1.00 21.42  ? 369  GLY A CA    1 
ATOM   2759  C  C     . GLY A  1  369 ? 17.864  67.712  25.752  1.00 20.99  ? 369  GLY A C     1 
ATOM   2760  O  O     . GLY A  1  369 ? 18.251  68.874  25.839  1.00 21.83  ? 369  GLY A O     1 
ATOM   2761  N  N     . ILE A  1  370 ? 16.637  67.385  25.372  1.00 17.78  ? 370  ILE A N     1 
ATOM   2762  C  CA    . ILE A  1  370 ? 15.641  68.389  25.059  1.00 15.67  ? 370  ILE A CA    1 
ATOM   2763  C  C     . ILE A  1  370 ? 15.041  68.872  26.388  1.00 16.35  ? 370  ILE A C     1 
ATOM   2764  O  O     . ILE A  1  370 ? 14.515  68.066  27.149  1.00 17.06  ? 370  ILE A O     1 
ATOM   2765  C  CB    . ILE A  1  370 ? 14.545  67.754  24.182  1.00 15.37  ? 370  ILE A CB    1 
ATOM   2766  C  CG1   . ILE A  1  370 ? 15.194  67.178  22.898  1.00 15.93  ? 370  ILE A CG1   1 
ATOM   2767  C  CG2   . ILE A  1  370 ? 13.483  68.803  23.833  1.00 15.65  ? 370  ILE A CG2   1 
ATOM   2768  C  CD1   . ILE A  1  370 ? 14.462  65.976  22.317  1.00 10.65  ? 370  ILE A CD1   1 
ATOM   2769  N  N     . PRO A  1  371 ? 15.088  70.199  26.679  1.00 15.06  ? 371  PRO A N     1 
ATOM   2770  C  CA    . PRO A  1  371 ? 14.517  70.705  27.946  1.00 13.42  ? 371  PRO A CA    1 
ATOM   2771  C  C     . PRO A  1  371 ? 13.006  70.543  28.029  1.00 16.83  ? 371  PRO A C     1 
ATOM   2772  O  O     . PRO A  1  371 ? 12.273  70.819  27.055  1.00 18.29  ? 371  PRO A O     1 
ATOM   2773  C  CB    . PRO A  1  371 ? 14.941  72.175  27.962  1.00 16.58  ? 371  PRO A CB    1 
ATOM   2774  C  CG    . PRO A  1  371 ? 15.004  72.550  26.471  1.00 15.86  ? 371  PRO A CG    1 
ATOM   2775  C  CD    . PRO A  1  371 ? 15.564  71.300  25.817  1.00 13.75  ? 371  PRO A CD    1 
ATOM   2776  N  N     . THR A  1  372 ? 12.528  70.073  29.176  1.00 17.67  ? 372  THR A N     1 
ATOM   2777  C  CA    . THR A  1  372 ? 11.092  69.881  29.372  1.00 16.29  ? 372  THR A CA    1 
ATOM   2778  C  C     . THR A  1  372 ? 10.728  70.360  30.775  1.00 20.33  ? 372  THR A C     1 
ATOM   2779  O  O     . THR A  1  372 ? 11.625  70.663  31.561  1.00 20.34  ? 372  THR A O     1 
ATOM   2780  C  CB    . THR A  1  372 ? 10.699  68.348  29.189  1.00 20.39  ? 372  THR A CB    1 
ATOM   2781  O  OG1   . THR A  1  372 ? 11.098  67.570  30.326  1.00 24.81  ? 372  THR A OG1   1 
ATOM   2782  C  CG2   . THR A  1  372 ? 11.393  67.748  27.952  1.00 22.68  ? 372  THR A CG2   1 
ATOM   2783  N  N     . ASN A  1  373 ? 9.432   70.495  31.092  1.00 20.28  ? 373  ASN A N     1 
ATOM   2784  C  CA    . ASN A  1  373 ? 9.087   70.849  32.463  1.00 20.42  ? 373  ASN A CA    1 
ATOM   2785  C  C     . ASN A  1  373 ? 8.837   69.475  33.122  1.00 23.91  ? 373  ASN A C     1 
ATOM   2786  O  O     . ASN A  1  373 ? 9.042   68.451  32.462  1.00 25.24  ? 373  ASN A O     1 
ATOM   2787  C  CB    . ASN A  1  373 ? 7.837   71.722  32.539  1.00 23.75  ? 373  ASN A CB    1 
ATOM   2788  C  CG    . ASN A  1  373 ? 6.665   71.164  31.743  1.00 26.47  ? 373  ASN A CG    1 
ATOM   2789  O  OD1   . ASN A  1  373 ? 6.543   69.952  31.515  1.00 24.71  ? 373  ASN A OD1   1 
ATOM   2790  N  ND2   . ASN A  1  373 ? 5.772   72.066  31.326  1.00 18.65  ? 373  ASN A ND2   1 
ATOM   2791  N  N     . TYR A  1  374 ? 8.391   69.434  34.379  1.00 24.01  ? 374  TYR A N     1 
ATOM   2792  C  CA    . TYR A  1  374 ? 8.188   68.144  35.039  1.00 23.59  ? 374  TYR A CA    1 
ATOM   2793  C  C     . TYR A  1  374 ? 7.001   67.383  34.506  1.00 22.91  ? 374  TYR A C     1 
ATOM   2794  O  O     . TYR A  1  374 ? 6.776   66.242  34.904  1.00 23.40  ? 374  TYR A O     1 
ATOM   2795  C  CB    . TYR A  1  374 ? 8.071   68.301  36.569  1.00 24.97  ? 374  TYR A CB    1 
ATOM   2796  C  CG    . TYR A  1  374 ? 6.739   68.811  37.063  1.00 24.32  ? 374  TYR A CG    1 
ATOM   2797  C  CD1   . TYR A  1  374 ? 5.690   67.940  37.304  1.00 24.15  ? 374  TYR A CD1   1 
ATOM   2798  C  CD2   . TYR A  1  374 ? 6.505   70.170  37.198  1.00 29.04  ? 374  TYR A CD2   1 
ATOM   2799  C  CE1   . TYR A  1  374 ? 4.433   68.409  37.656  1.00 23.74  ? 374  TYR A CE1   1 
ATOM   2800  C  CE2   . TYR A  1  374 ? 5.240   70.658  37.547  1.00 25.88  ? 374  TYR A CE2   1 
ATOM   2801  C  CZ    . TYR A  1  374 ? 4.220   69.771  37.765  1.00 27.87  ? 374  TYR A CZ    1 
ATOM   2802  O  OH    . TYR A  1  374 ? 2.955   70.244  38.035  1.00 33.09  ? 374  TYR A OH    1 
ATOM   2803  N  N     . LYS A  1  375 ? 6.247   67.989  33.594  1.00 20.92  ? 375  LYS A N     1 
ATOM   2804  C  CA    . LYS A  1  375 ? 5.100   67.284  33.008  1.00 20.80  ? 375  LYS A CA    1 
ATOM   2805  C  C     . LYS A  1  375 ? 5.482   66.609  31.704  1.00 20.70  ? 375  LYS A C     1 
ATOM   2806  O  O     . LYS A  1  375 ? 4.671   65.930  31.092  1.00 18.79  ? 375  LYS A O     1 
ATOM   2807  C  CB    . LYS A  1  375 ? 3.959   68.254  32.729  1.00 24.37  ? 375  LYS A CB    1 
ATOM   2808  C  CG    . LYS A  1  375 ? 3.493   69.017  33.939  1.00 24.25  ? 375  LYS A CG    1 
ATOM   2809  C  CD    . LYS A  1  375 ? 2.061   69.478  33.758  1.00 34.38  ? 375  LYS A CD    1 
ATOM   2810  C  CE    . LYS A  1  375 ? 1.518   70.127  35.031  1.00 37.55  ? 375  LYS A CE    1 
ATOM   2811  N  NZ    . LYS A  1  375 ? 1.875   71.580  35.091  1.00 48.31  ? 375  LYS A NZ    1 
ATOM   2812  N  N     . GLY A  1  376 ? 6.720   66.823  31.269  1.00 18.55  ? 376  GLY A N     1 
ATOM   2813  C  CA    . GLY A  1  376 ? 7.191   66.227  30.036  1.00 21.85  ? 376  GLY A CA    1 
ATOM   2814  C  C     . GLY A  1  376 ? 7.082   67.155  28.841  1.00 22.00  ? 376  GLY A C     1 
ATOM   2815  O  O     . GLY A  1  376 ? 7.511   66.826  27.754  1.00 20.87  ? 376  GLY A O     1 
ATOM   2816  N  N     . GLN A  1  377 ? 6.517   68.338  29.035  1.00 23.31  ? 377  GLN A N     1 
ATOM   2817  C  CA    . GLN A  1  377 ? 6.350   69.254  27.917  1.00 22.28  ? 377  GLN A CA    1 
ATOM   2818  C  C     . GLN A  1  377 ? 7.648   69.930  27.585  1.00 19.48  ? 377  GLN A C     1 
ATOM   2819  O  O     . GLN A  1  377 ? 8.329   70.419  28.459  1.00 19.45  ? 377  GLN A O     1 
ATOM   2820  C  CB    . GLN A  1  377 ? 5.304   70.331  28.247  1.00 22.30  ? 377  GLN A CB    1 
ATOM   2821  C  CG    . GLN A  1  377 ? 3.950   69.784  28.701  1.00 22.46  ? 377  GLN A CG    1 
ATOM   2822  C  CD    . GLN A  1  377 ? 3.042   70.888  29.251  1.00 22.89  ? 377  GLN A CD    1 
ATOM   2823  O  OE1   . GLN A  1  377 ? 3.424   71.643  30.148  1.00 24.97  ? 377  GLN A OE1   1 
ATOM   2824  N  NE2   . GLN A  1  377 ? 1.839   70.972  28.718  1.00 22.31  ? 377  GLN A NE2   1 
ATOM   2825  N  N     . VAL A  1  378 ? 7.964   69.978  26.300  1.00 18.81  ? 378  VAL A N     1 
ATOM   2826  C  CA    . VAL A  1  378 ? 9.166   70.629  25.849  1.00 18.43  ? 378  VAL A CA    1 
ATOM   2827  C  C     . VAL A  1  378 ? 9.021   72.144  26.015  1.00 23.67  ? 378  VAL A C     1 
ATOM   2828  O  O     . VAL A  1  378 ? 7.955   72.699  25.753  1.00 22.20  ? 378  VAL A O     1 
ATOM   2829  C  CB    . VAL A  1  378 ? 9.451   70.277  24.379  1.00 17.04  ? 378  VAL A CB    1 
ATOM   2830  C  CG1   . VAL A  1  378 ? 10.591  71.132  23.845  1.00 21.42  ? 378  VAL A CG1   1 
ATOM   2831  C  CG2   . VAL A  1  378 ? 9.824   68.776  24.271  1.00 17.08  ? 378  VAL A CG2   1 
ATOM   2832  N  N     . ILE A  1  379 ? 10.090  72.807  26.466  1.00 21.48  ? 379  ILE A N     1 
ATOM   2833  C  CA    . ILE A  1  379 ? 10.055  74.240  26.656  1.00 21.50  ? 379  ILE A CA    1 
ATOM   2834  C  C     . ILE A  1  379 ? 11.164  74.976  25.931  1.00 26.13  ? 379  ILE A C     1 
ATOM   2835  O  O     . ILE A  1  379 ? 12.202  74.410  25.545  1.00 27.51  ? 379  ILE A O     1 
ATOM   2836  C  CB    . ILE A  1  379 ? 10.197  74.641  28.157  1.00 22.75  ? 379  ILE A CB    1 
ATOM   2837  C  CG1   . ILE A  1  379 ? 11.412  73.935  28.737  1.00 25.68  ? 379  ILE A CG1   1 
ATOM   2838  C  CG2   . ILE A  1  379 ? 8.880   74.312  28.968  1.00 20.88  ? 379  ILE A CG2   1 
ATOM   2839  C  CD1   . ILE A  1  379 ? 11.996  74.607  29.965  1.00 26.96  ? 379  ILE A CD1   1 
ATOM   2840  N  N     . THR A  1  380 ? 10.920  76.255  25.716  1.00 29.84  ? 380  THR A N     1 
ATOM   2841  C  CA    . THR A  1  380 ? 11.943  77.115  25.149  1.00 30.61  ? 380  THR A CA    1 
ATOM   2842  C  C     . THR A  1  380 ? 12.072  78.211  26.213  1.00 30.89  ? 380  THR A C     1 
ATOM   2843  O  O     . THR A  1  380 ? 11.319  78.193  27.189  1.00 28.29  ? 380  THR A O     1 
ATOM   2844  C  CB    . THR A  1  380 ? 11.568  77.693  23.786  1.00 33.54  ? 380  THR A CB    1 
ATOM   2845  O  OG1   . THR A  1  380 ? 12.701  78.409  23.297  1.00 41.71  ? 380  THR A OG1   1 
ATOM   2846  C  CG2   . THR A  1  380 ? 10.356  78.612  23.875  1.00 31.52  ? 380  THR A CG2   1 
ATOM   2847  N  N     . HIS A  1  381 ? 13.030  79.127  26.062  1.00 31.58  ? 381  HIS A N     1 
ATOM   2848  C  CA    . HIS A  1  381 ? 13.244  80.183  27.060  1.00 33.31  ? 381  HIS A CA    1 
ATOM   2849  C  C     . HIS A  1  381 ? 13.381  81.516  26.344  1.00 35.66  ? 381  HIS A C     1 
ATOM   2850  O  O     . HIS A  1  381 ? 14.396  81.755  25.681  1.00 36.99  ? 381  HIS A O     1 
ATOM   2851  C  CB    . HIS A  1  381 ? 14.524  79.907  27.853  1.00 31.21  ? 381  HIS A CB    1 
ATOM   2852  C  CG    . HIS A  1  381 ? 14.650  80.710  29.105  1.00 34.46  ? 381  HIS A CG    1 
ATOM   2853  N  ND1   . HIS A  1  381 ? 13.885  80.462  30.229  1.00 37.70  ? 381  HIS A ND1   1 
ATOM   2854  C  CD2   . HIS A  1  381 ? 15.476  81.732  29.433  1.00 32.96  ? 381  HIS A CD2   1 
ATOM   2855  C  CE1   . HIS A  1  381 ? 14.237  81.291  31.197  1.00 30.34  ? 381  HIS A CE1   1 
ATOM   2856  N  NE2   . HIS A  1  381 ? 15.200  82.073  30.740  1.00 34.43  ? 381  HIS A NE2   1 
ATOM   2857  N  N     . VAL A  1  382 ? 12.376  82.381  26.493  1.00 40.13  ? 382  VAL A N     1 
ATOM   2858  C  CA    . VAL A  1  382 ? 12.362  83.691  25.820  1.00 45.67  ? 382  VAL A CA    1 
ATOM   2859  C  C     . VAL A  1  382 ? 12.190  84.874  26.760  1.00 45.35  ? 382  VAL A C     1 
ATOM   2860  O  O     . VAL A  1  382 ? 11.264  84.892  27.561  1.00 46.62  ? 382  VAL A O     1 
ATOM   2861  C  CB    . VAL A  1  382 ? 11.208  83.796  24.795  1.00 46.64  ? 382  VAL A CB    1 
ATOM   2862  C  CG1   . VAL A  1  382 ? 11.389  85.040  23.965  1.00 45.11  ? 382  VAL A CG1   1 
ATOM   2863  C  CG2   . VAL A  1  382 ? 11.148  82.562  23.932  1.00 47.73  ? 382  VAL A CG2   1 
ATOM   2864  N  N     . ASN A  1  383 ? 13.058  85.871  26.633  1.00 48.26  ? 383  ASN A N     1 
ATOM   2865  C  CA    . ASN A  1  383 ? 12.976  87.058  27.485  1.00 51.15  ? 383  ASN A CA    1 
ATOM   2866  C  C     . ASN A  1  383 ? 12.877  86.640  28.940  1.00 50.18  ? 383  ASN A C     1 
ATOM   2867  O  O     . ASN A  1  383 ? 11.900  86.952  29.631  1.00 50.17  ? 383  ASN A O     1 
ATOM   2868  C  CB    . ASN A  1  383 ? 11.756  87.899  27.099  1.00 54.91  ? 383  ASN A CB    1 
ATOM   2869  C  CG    . ASN A  1  383 ? 11.885  88.503  25.708  1.00 60.51  ? 383  ASN A CG    1 
ATOM   2870  O  OD1   . ASN A  1  383 ? 10.881  88.723  25.016  1.00 61.87  ? 383  ASN A OD1   1 
ATOM   2871  N  ND2   . ASN A  1  383 ? 13.128  88.789  25.293  1.00 61.11  ? 383  ASN A ND2   1 
ATOM   2872  N  N     . GLY A  1  384 ? 13.881  85.891  29.384  1.00 49.24  ? 384  GLY A N     1 
ATOM   2873  C  CA    . GLY A  1  384 ? 13.917  85.435  30.761  1.00 47.85  ? 384  GLY A CA    1 
ATOM   2874  C  C     . GLY A  1  384 ? 12.774  84.566  31.240  1.00 45.51  ? 384  GLY A C     1 
ATOM   2875  O  O     . GLY A  1  384 ? 12.598  84.386  32.439  1.00 46.80  ? 384  GLY A O     1 
ATOM   2876  N  N     . GLU A  1  385 ? 11.978  84.015  30.343  1.00 45.00  ? 385  GLU A N     1 
ATOM   2877  C  CA    . GLU A  1  385 ? 10.900  83.167  30.829  1.00 44.55  ? 385  GLU A CA    1 
ATOM   2878  C  C     . GLU A  1  385 ? 10.762  81.856  30.051  1.00 39.52  ? 385  GLU A C     1 
ATOM   2879  O  O     . GLU A  1  385 ? 10.881  81.835  28.823  1.00 35.02  ? 385  GLU A O     1 
ATOM   2880  C  CB    . GLU A  1  385 ? 9.586   83.929  30.786  1.00 50.22  ? 385  GLU A CB    1 
ATOM   2881  C  CG    . GLU A  1  385 ? 9.292   84.506  29.415  1.00 62.51  ? 385  GLU A CG    1 
ATOM   2882  C  CD    . GLU A  1  385 ? 7.799   84.682  29.146  1.00 68.52  ? 385  GLU A CD    1 
ATOM   2883  O  OE1   . GLU A  1  385 ? 7.089   83.647  29.032  1.00 70.62  ? 385  GLU A OE1   1 
ATOM   2884  O  OE2   . GLU A  1  385 ? 7.346   85.854  29.054  1.00 69.95  ? 385  GLU A OE2   1 
ATOM   2885  N  N     . ASP A  1  386 ? 10.519  80.766  30.779  1.00 35.87  ? 386  ASP A N     1 
ATOM   2886  C  CA    . ASP A  1  386 ? 10.332  79.453  30.149  1.00 35.57  ? 386  ASP A CA    1 
ATOM   2887  C  C     . ASP A  1  386 ? 8.961   79.463  29.480  1.00 34.99  ? 386  ASP A C     1 
ATOM   2888  O  O     . ASP A  1  386 ? 7.995   79.969  30.034  1.00 31.02  ? 386  ASP A O     1 
ATOM   2889  C  CB    . ASP A  1  386 ? 10.356  78.321  31.174  1.00 30.94  ? 386  ASP A CB    1 
ATOM   2890  C  CG    . ASP A  1  386 ? 11.680  78.222  31.912  1.00 33.72  ? 386  ASP A CG    1 
ATOM   2891  O  OD1   . ASP A  1  386 ? 12.721  78.609  31.348  1.00 28.42  ? 386  ASP A OD1   1 
ATOM   2892  O  OD2   . ASP A  1  386 ? 11.674  77.740  33.061  1.00 36.60  ? 386  ASP A OD2   1 
ATOM   2893  N  N     . LYS A  1  387 ? 8.883   78.895  28.290  1.00 36.68  ? 387  LYS A N     1 
ATOM   2894  C  CA    . LYS A  1  387 ? 7.630   78.872  27.566  1.00 36.80  ? 387  LYS A CA    1 
ATOM   2895  C  C     . LYS A  1  387 ? 7.434   77.484  26.934  1.00 34.12  ? 387  LYS A C     1 
ATOM   2896  O  O     . LYS A  1  387 ? 8.349   76.929  26.322  1.00 31.11  ? 387  LYS A O     1 
ATOM   2897  C  CB    . LYS A  1  387 ? 7.670   79.978  26.499  1.00 38.80  ? 387  LYS A CB    1 
ATOM   2898  C  CG    . LYS A  1  387 ? 6.338   80.312  25.884  1.00 46.49  ? 387  LYS A CG    1 
ATOM   2899  C  CD    . LYS A  1  387 ? 6.505   81.347  24.773  1.00 51.82  ? 387  LYS A CD    1 
ATOM   2900  C  CE    . LYS A  1  387 ? 5.173   81.629  24.059  1.00 55.96  ? 387  LYS A CE    1 
ATOM   2901  N  NZ    . LYS A  1  387 ? 5.353   82.369  22.756  1.00 57.98  ? 387  LYS A NZ    1 
ATOM   2902  N  N     . VAL A  1  388 ? 6.240   76.933  27.088  1.00 29.61  ? 388  VAL A N     1 
ATOM   2903  C  CA    . VAL A  1  388 ? 5.929   75.626  26.535  1.00 28.24  ? 388  VAL A CA    1 
ATOM   2904  C  C     . VAL A  1  388 ? 5.846   75.682  25.006  1.00 26.97  ? 388  VAL A C     1 
ATOM   2905  O  O     . VAL A  1  388 ? 5.446   76.707  24.457  1.00 27.62  ? 388  VAL A O     1 
ATOM   2906  C  CB    . VAL A  1  388 ? 4.599   75.110  27.141  1.00 27.17  ? 388  VAL A CB    1 
ATOM   2907  C  CG1   . VAL A  1  388 ? 4.009   73.971  26.293  1.00 26.21  ? 388  VAL A CG1   1 
ATOM   2908  C  CG2   . VAL A  1  388 ? 4.866   74.618  28.546  1.00 20.18  ? 388  VAL A CG2   1 
ATOM   2909  N  N     . VAL A  1  389 ? 6.274   74.611  24.333  1.00 22.97  ? 389  VAL A N     1 
ATOM   2910  C  CA    . VAL A  1  389 ? 6.216   74.513  22.866  1.00 22.23  ? 389  VAL A CA    1 
ATOM   2911  C  C     . VAL A  1  389 ? 4.971   73.691  22.664  1.00 23.23  ? 389  VAL A C     1 
ATOM   2912  O  O     . VAL A  1  389 ? 4.919   72.505  23.014  1.00 24.08  ? 389  VAL A O     1 
ATOM   2913  C  CB    . VAL A  1  389 ? 7.406   73.743  22.231  1.00 20.98  ? 389  VAL A CB    1 
ATOM   2914  C  CG1   . VAL A  1  389 ? 7.266   73.743  20.696  1.00 19.81  ? 389  VAL A CG1   1 
ATOM   2915  C  CG2   . VAL A  1  389 ? 8.713   74.354  22.646  1.00 15.31  ? 389  VAL A CG2   1 
ATOM   2916  N  N     . PRO A  1  390 ? 3.923   74.320  22.113  1.00 25.41  ? 390  PRO A N     1 
ATOM   2917  C  CA    . PRO A  1  390 ? 2.665   73.616  21.887  1.00 25.35  ? 390  PRO A CA    1 
ATOM   2918  C  C     . PRO A  1  390 ? 2.802   72.310  21.122  1.00 27.11  ? 390  PRO A C     1 
ATOM   2919  O  O     . PRO A  1  390 ? 3.422   72.283  20.059  1.00 27.77  ? 390  PRO A O     1 
ATOM   2920  C  CB    . PRO A  1  390 ? 1.825   74.651  21.136  1.00 29.04  ? 390  PRO A CB    1 
ATOM   2921  C  CG    . PRO A  1  390 ? 2.331   75.963  21.704  1.00 27.73  ? 390  PRO A CG    1 
ATOM   2922  C  CD    . PRO A  1  390 ? 3.829   75.738  21.719  1.00 20.75  ? 390  PRO A CD    1 
ATOM   2923  N  N     . GLY A  1  391 ? 2.219   71.237  21.678  1.00 24.93  ? 391  GLY A N     1 
ATOM   2924  C  CA    . GLY A  1  391 ? 2.227   69.928  21.029  1.00 23.18  ? 391  GLY A CA    1 
ATOM   2925  C  C     . GLY A  1  391 ? 3.503   69.082  20.997  1.00 24.05  ? 391  GLY A C     1 
ATOM   2926  O  O     . GLY A  1  391 ? 3.547   68.049  20.306  1.00 26.05  ? 391  GLY A O     1 
ATOM   2927  N  N     . LEU A  1  392 ? 4.533   69.484  21.736  1.00 22.25  ? 392  LEU A N     1 
ATOM   2928  C  CA    . LEU A  1  392 ? 5.779   68.736  21.739  1.00 18.53  ? 392  LEU A CA    1 
ATOM   2929  C  C     . LEU A  1  392 ? 6.166   68.263  23.131  1.00 19.50  ? 392  LEU A C     1 
ATOM   2930  O  O     . LEU A  1  392 ? 6.255   69.080  24.062  1.00 16.66  ? 392  LEU A O     1 
ATOM   2931  C  CB    . LEU A  1  392 ? 6.901   69.603  21.196  1.00 14.23  ? 392  LEU A CB    1 
ATOM   2932  C  CG    . LEU A  1  392 ? 8.227   68.917  20.876  1.00 17.25  ? 392  LEU A CG    1 
ATOM   2933  C  CD1   . LEU A  1  392 ? 8.077   67.779  19.838  1.00 13.14  ? 392  LEU A CD1   1 
ATOM   2934  C  CD2   . LEU A  1  392 ? 9.145   69.980  20.331  1.00 14.57  ? 392  LEU A CD2   1 
ATOM   2935  N  N     . TYR A  1  393 ? 6.428   66.957  23.250  1.00 15.86  ? 393  TYR A N     1 
ATOM   2936  C  CA    . TYR A  1  393 ? 6.838   66.330  24.510  1.00 16.27  ? 393  TYR A CA    1 
ATOM   2937  C  C     . TYR A  1  393 ? 8.150   65.545  24.299  1.00 16.39  ? 393  TYR A C     1 
ATOM   2938  O  O     . TYR A  1  393 ? 8.517   65.205  23.159  1.00 12.40  ? 393  TYR A O     1 
ATOM   2939  C  CB    . TYR A  1  393 ? 5.772   65.352  24.976  1.00 15.86  ? 393  TYR A CB    1 
ATOM   2940  C  CG    . TYR A  1  393 ? 4.492   65.988  25.419  1.00 17.66  ? 393  TYR A CG    1 
ATOM   2941  C  CD1   . TYR A  1  393 ? 4.177   66.068  26.759  1.00 16.26  ? 393  TYR A CD1   1 
ATOM   2942  C  CD2   . TYR A  1  393 ? 3.613   66.564  24.497  1.00 16.64  ? 393  TYR A CD2   1 
ATOM   2943  C  CE1   . TYR A  1  393 ? 3.031   66.708  27.193  1.00 19.33  ? 393  TYR A CE1   1 
ATOM   2944  C  CE2   . TYR A  1  393 ? 2.458   67.211  24.917  1.00 18.72  ? 393  TYR A CE2   1 
ATOM   2945  C  CZ    . TYR A  1  393 ? 2.177   67.282  26.287  1.00 21.97  ? 393  TYR A CZ    1 
ATOM   2946  O  OH    . TYR A  1  393 ? 1.090   67.980  26.775  1.00 18.39  ? 393  TYR A OH    1 
ATOM   2947  N  N     . ALA A  1  394 ? 8.850   65.247  25.392  1.00 14.45  ? 394  ALA A N     1 
ATOM   2948  C  CA    . ALA A  1  394 ? 10.099  64.481  25.335  1.00 14.64  ? 394  ALA A CA    1 
ATOM   2949  C  C     . ALA A  1  394 ? 10.245  63.748  26.666  1.00 20.18  ? 394  ALA A C     1 
ATOM   2950  O  O     . ALA A  1  394 ? 9.890   64.287  27.724  1.00 13.52  ? 394  ALA A O     1 
ATOM   2951  C  CB    . ALA A  1  394 ? 11.316  65.418  25.125  1.00 13.32  ? 394  ALA A CB    1 
ATOM   2952  N  N     . CYS A  1  395 ? 10.748  62.518  26.608  1.00 21.76  ? 395  CYS A N     1 
ATOM   2953  C  CA    . CYS A  1  395 ? 10.963  61.727  27.821  1.00 17.34  ? 395  CYS A CA    1 
ATOM   2954  C  C     . CYS A  1  395 ? 12.094  60.731  27.549  1.00 16.31  ? 395  CYS A C     1 
ATOM   2955  O  O     . CYS A  1  395 ? 12.433  60.450  26.395  1.00 13.52  ? 395  CYS A O     1 
ATOM   2956  C  CB    . CYS A  1  395 ? 9.675   61.014  28.256  1.00 12.72  ? 395  CYS A CB    1 
ATOM   2957  S  SG    . CYS A  1  395 ? 8.891   60.000  27.036  1.00 22.15  ? 395  CYS A SG    1 
ATOM   2958  N  N     . GLY A  1  396 ? 12.710  60.233  28.612  1.00 14.59  ? 396  GLY A N     1 
ATOM   2959  C  CA    . GLY A  1  396 ? 13.785  59.285  28.445  1.00 12.24  ? 396  GLY A CA    1 
ATOM   2960  C  C     . GLY A  1  396 ? 15.111  59.989  28.377  1.00 13.44  ? 396  GLY A C     1 
ATOM   2961  O  O     . GLY A  1  396 ? 15.221  61.185  28.688  1.00 18.79  ? 396  GLY A O     1 
ATOM   2962  N  N     . GLU A  1  397 ? 16.128  59.266  27.964  1.00 10.91  ? 397  GLU A N     1 
ATOM   2963  C  CA    . GLU A  1  397 ? 17.455  59.850  27.882  1.00 11.80  ? 397  GLU A CA    1 
ATOM   2964  C  C     . GLU A  1  397 ? 17.507  61.041  26.935  1.00 15.00  ? 397  GLU A C     1 
ATOM   2965  O  O     . GLU A  1  397 ? 18.394  61.888  27.037  1.00 16.90  ? 397  GLU A O     1 
ATOM   2966  C  CB    . GLU A  1  397 ? 18.489  58.773  27.472  1.00 8.13   ? 397  GLU A CB    1 
ATOM   2967  C  CG    . GLU A  1  397 ? 19.956  59.251  27.451  1.00 10.87  ? 397  GLU A CG    1 
ATOM   2968  C  CD    . GLU A  1  397 ? 20.980  58.122  27.349  1.00 18.61  ? 397  GLU A CD    1 
ATOM   2969  O  OE1   . GLU A  1  397 ? 20.604  56.940  27.539  1.00 18.99  ? 397  GLU A OE1   1 
ATOM   2970  O  OE2   . GLU A  1  397 ? 22.180  58.406  27.105  1.00 22.37  ? 397  GLU A OE2   1 
ATOM   2971  N  N     . ALA A  1  398 ? 16.568  61.128  26.014  1.00 18.41  ? 398  ALA A N     1 
ATOM   2972  C  CA    . ALA A  1  398 ? 16.577  62.246  25.061  1.00 19.92  ? 398  ALA A CA    1 
ATOM   2973  C  C     . ALA A  1  398 ? 16.154  63.577  25.709  1.00 19.68  ? 398  ALA A C     1 
ATOM   2974  O  O     . ALA A  1  398 ? 16.456  64.644  25.184  1.00 20.43  ? 398  ALA A O     1 
ATOM   2975  C  CB    . ALA A  1  398 ? 15.648  61.934  23.829  1.00 20.40  ? 398  ALA A CB    1 
ATOM   2976  N  N     . ALA A  1  399 ? 15.472  63.512  26.849  1.00 21.04  ? 399  ALA A N     1 
ATOM   2977  C  CA    . ALA A  1  399 ? 14.994  64.728  27.512  1.00 19.66  ? 399  ALA A CA    1 
ATOM   2978  C  C     . ALA A  1  399 ? 15.858  65.200  28.660  1.00 20.24  ? 399  ALA A C     1 
ATOM   2979  O  O     . ALA A  1  399 ? 16.657  64.441  29.185  1.00 20.43  ? 399  ALA A O     1 
ATOM   2980  C  CB    . ALA A  1  399 ? 13.560  64.514  28.041  1.00 17.20  ? 399  ALA A CB    1 
ATOM   2981  N  N     . SER A  1  400 ? 15.691  66.468  29.035  1.00 19.66  ? 400  SER A N     1 
ATOM   2982  C  CA    . SER A  1  400 ? 16.382  67.019  30.211  1.00 19.62  ? 400  SER A CA    1 
ATOM   2983  C  C     . SER A  1  400 ? 15.268  67.620  31.051  1.00 20.46  ? 400  SER A C     1 
ATOM   2984  O  O     . SER A  1  400 ? 14.903  68.803  30.882  1.00 19.36  ? 400  SER A O     1 
ATOM   2985  C  CB    . SER A  1  400 ? 17.387  68.112  29.819  1.00 16.46  ? 400  SER A CB    1 
ATOM   2986  O  OG    . SER A  1  400 ? 18.053  68.573  30.982  1.00 22.79  ? 400  SER A OG    1 
ATOM   2987  N  N     . ALA A  1  401 ? 14.712  66.818  31.950  1.00 23.73  ? 401  ALA A N     1 
ATOM   2988  C  CA    . ALA A  1  401 ? 13.583  67.263  32.787  1.00 26.46  ? 401  ALA A CA    1 
ATOM   2989  C  C     . ALA A  1  401 ? 13.763  68.433  33.793  1.00 25.85  ? 401  ALA A C     1 
ATOM   2990  O  O     . ALA A  1  401 ? 12.805  69.161  34.036  1.00 25.48  ? 401  ALA A O     1 
ATOM   2991  C  CB    . ALA A  1  401 ? 12.962  66.042  33.507  1.00 27.56  ? 401  ALA A CB    1 
ATOM   2992  N  N     . SER A  1  402 ? 14.921  68.599  34.451  1.00 29.38  ? 402  SER A N     1 
ATOM   2993  C  CA    . SER A  1  402 ? 16.101  67.743  34.379  1.00 21.34  ? 402  SER A CA    1 
ATOM   2994  C  C     . SER A  1  402 ? 16.169  67.011  35.727  1.00 20.93  ? 402  SER A C     1 
ATOM   2995  O  O     . SER A  1  402 ? 16.365  67.642  36.751  1.00 19.04  ? 402  SER A O     1 
ATOM   2996  C  CB    . SER A  1  402 ? 17.341  68.617  34.207  1.00 28.06  ? 402  SER A CB    1 
ATOM   2997  O  OG    . SER A  1  402 ? 18.528  67.878  34.424  1.00 28.08  ? 402  SER A OG    1 
ATOM   2998  N  N     . VAL A  1  403 ? 15.987  65.696  35.757  1.00 18.73  ? 403  VAL A N     1 
ATOM   2999  C  CA    . VAL A  1  403 ? 16.079  65.004  37.047  1.00 20.70  ? 403  VAL A CA    1 
ATOM   3000  C  C     . VAL A  1  403 ? 17.495  64.623  37.406  1.00 23.93  ? 403  VAL A C     1 
ATOM   3001  O  O     . VAL A  1  403 ? 17.757  64.277  38.557  1.00 26.01  ? 403  VAL A O     1 
ATOM   3002  C  CB    . VAL A  1  403 ? 15.262  63.692  37.084  1.00 16.59  ? 403  VAL A CB    1 
ATOM   3003  C  CG1   . VAL A  1  403 ? 13.747  64.006  37.264  1.00 18.24  ? 403  VAL A CG1   1 
ATOM   3004  C  CG2   . VAL A  1  403 ? 15.473  62.912  35.771  1.00 15.70  ? 403  VAL A CG2   1 
ATOM   3005  N  N     . HIS A  1  404 ? 18.414  64.670  36.439  1.00 20.16  ? 404  HIS A N     1 
ATOM   3006  C  CA    . HIS A  1  404 ? 19.773  64.220  36.722  1.00 18.25  ? 404  HIS A CA    1 
ATOM   3007  C  C     . HIS A  1  404 ? 20.826  65.313  36.851  1.00 19.48  ? 404  HIS A C     1 
ATOM   3008  O  O     . HIS A  1  404 ? 21.959  65.054  37.273  1.00 21.58  ? 404  HIS A O     1 
ATOM   3009  C  CB    . HIS A  1  404 ? 20.184  63.211  35.655  1.00 18.33  ? 404  HIS A CB    1 
ATOM   3010  C  CG    . HIS A  1  404 ? 19.126  62.188  35.352  1.00 22.90  ? 404  HIS A CG    1 
ATOM   3011  N  ND1   . HIS A  1  404 ? 18.626  61.328  36.311  1.00 22.24  ? 404  HIS A ND1   1 
ATOM   3012  C  CD2   . HIS A  1  404 ? 18.535  61.832  34.183  1.00 14.60  ? 404  HIS A CD2   1 
ATOM   3013  C  CE1   . HIS A  1  404 ? 17.788  60.480  35.744  1.00 22.09  ? 404  HIS A CE1   1 
ATOM   3014  N  NE2   . HIS A  1  404 ? 17.716  60.762  34.455  1.00 15.53  ? 404  HIS A NE2   1 
ATOM   3015  N  N     . GLY A  1  405 ? 20.462  66.540  36.481  1.00 21.14  ? 405  GLY A N     1 
ATOM   3016  C  CA    . GLY A  1  405 ? 21.403  67.632  36.586  1.00 17.53  ? 405  GLY A CA    1 
ATOM   3017  C  C     . GLY A  1  405 ? 22.777  67.377  36.006  1.00 20.71  ? 405  GLY A C     1 
ATOM   3018  O  O     . GLY A  1  405 ? 22.889  67.049  34.834  1.00 19.77  ? 405  GLY A O     1 
ATOM   3019  N  N     . ALA A  1  406 ? 23.827  67.533  36.820  1.00 20.24  ? 406  ALA A N     1 
ATOM   3020  C  CA    . ALA A  1  406 ? 25.177  67.347  36.333  1.00 17.23  ? 406  ALA A CA    1 
ATOM   3021  C  C     . ALA A  1  406 ? 25.726  65.945  36.541  1.00 19.94  ? 406  ALA A C     1 
ATOM   3022  O  O     . ALA A  1  406 ? 26.869  65.680  36.188  1.00 20.25  ? 406  ALA A O     1 
ATOM   3023  C  CB    . ALA A  1  406 ? 26.117  68.394  36.943  1.00 18.90  ? 406  ALA A CB    1 
ATOM   3024  N  N     . ASN A  1  407 ? 24.915  65.044  37.096  1.00 22.74  ? 407  ASN A N     1 
ATOM   3025  C  CA    . ASN A  1  407 ? 25.343  63.651  37.305  1.00 22.74  ? 407  ASN A CA    1 
ATOM   3026  C  C     . ASN A  1  407 ? 24.191  62.717  37.709  1.00 21.17  ? 407  ASN A C     1 
ATOM   3027  O  O     . ASN A  1  407 ? 23.601  62.837  38.773  1.00 26.70  ? 407  ASN A O     1 
ATOM   3028  C  CB    . ASN A  1  407 ? 26.466  63.573  38.360  1.00 19.69  ? 407  ASN A CB    1 
ATOM   3029  C  CG    . ASN A  1  407 ? 26.647  62.156  38.934  1.00 20.97  ? 407  ASN A CG    1 
ATOM   3030  O  OD1   . ASN A  1  407 ? 25.903  61.721  39.819  1.00 24.89  ? 407  ASN A OD1   1 
ATOM   3031  N  ND2   . ASN A  1  407 ? 27.624  61.438  38.428  1.00 15.36  ? 407  ASN A ND2   1 
ATOM   3032  N  N     . ARG A  1  408 ? 23.878  61.766  36.850  1.00 21.34  ? 408  ARG A N     1 
ATOM   3033  C  CA    . ARG A  1  408 ? 22.812  60.809  37.134  1.00 17.37  ? 408  ARG A CA    1 
ATOM   3034  C  C     . ARG A  1  408 ? 23.238  59.673  38.062  1.00 12.48  ? 408  ARG A C     1 
ATOM   3035  O  O     . ARG A  1  408 ? 24.341  59.127  37.927  1.00 16.29  ? 408  ARG A O     1 
ATOM   3036  C  CB    . ARG A  1  408 ? 22.293  60.187  35.830  1.00 11.21  ? 408  ARG A CB    1 
ATOM   3037  C  CG    . ARG A  1  408 ? 21.217  59.153  36.041  1.00 13.38  ? 408  ARG A CG    1 
ATOM   3038  C  CD    . ARG A  1  408 ? 20.667  58.653  34.713  1.00 13.72  ? 408  ARG A CD    1 
ATOM   3039  N  NE    . ARG A  1  408 ? 21.516  57.754  33.950  1.00 12.79  ? 408  ARG A NE    1 
ATOM   3040  C  CZ    . ARG A  1  408 ? 21.779  56.488  34.260  1.00 16.26  ? 408  ARG A CZ    1 
ATOM   3041  N  NH1   . ARG A  1  408 ? 21.279  55.916  35.369  1.00 8.40   ? 408  ARG A NH1   1 
ATOM   3042  N  NH2   . ARG A  1  408 ? 22.508  55.767  33.428  1.00 11.49  ? 408  ARG A NH2   1 
ATOM   3043  N  N     . LEU A  1  409 ? 22.348  59.294  38.969  1.00 17.71  ? 409  LEU A N     1 
ATOM   3044  C  CA    . LEU A  1  409 ? 22.595  58.194  39.895  1.00 14.43  ? 409  LEU A CA    1 
ATOM   3045  C  C     . LEU A  1  409 ? 22.252  56.904  39.181  1.00 17.34  ? 409  LEU A C     1 
ATOM   3046  O  O     . LEU A  1  409 ? 21.226  56.794  38.501  1.00 20.93  ? 409  LEU A O     1 
ATOM   3047  C  CB    . LEU A  1  409 ? 21.703  58.281  41.139  1.00 15.83  ? 409  LEU A CB    1 
ATOM   3048  C  CG    . LEU A  1  409 ? 21.948  59.420  42.130  1.00 19.43  ? 409  LEU A CG    1 
ATOM   3049  C  CD1   . LEU A  1  409 ? 21.072  59.186  43.331  1.00 23.96  ? 409  LEU A CD1   1 
ATOM   3050  C  CD2   . LEU A  1  409 ? 23.435  59.473  42.521  1.00 19.28  ? 409  LEU A CD2   1 
ATOM   3051  N  N     . GLY A  1  410 ? 23.101  55.900  39.347  1.00 17.92  ? 410  GLY A N     1 
ATOM   3052  C  CA    . GLY A  1  410 ? 22.787  54.616  38.742  1.00 15.25  ? 410  GLY A CA    1 
ATOM   3053  C  C     . GLY A  1  410 ? 21.383  54.187  39.159  1.00 14.92  ? 410  GLY A C     1 
ATOM   3054  O  O     . GLY A  1  410 ? 20.918  54.479  40.288  1.00 10.42  ? 410  GLY A O     1 
ATOM   3055  N  N     . ALA A  1  411 ? 20.705  53.527  38.223  1.00 11.05  ? 411  ALA A N     1 
ATOM   3056  C  CA    . ALA A  1  411 ? 19.361  53.008  38.388  1.00 10.82  ? 411  ALA A CA    1 
ATOM   3057  C  C     . ALA A  1  411 ? 18.255  54.050  38.403  1.00 11.67  ? 411  ALA A C     1 
ATOM   3058  O  O     . ALA A  1  411 ? 17.051  53.707  38.600  1.00 14.59  ? 411  ALA A O     1 
ATOM   3059  C  CB    . ALA A  1  411 ? 19.287  52.078  39.649  1.00 15.16  ? 411  ALA A CB    1 
ATOM   3060  N  N     . ASN A  1  412 ? 18.605  55.317  38.196  1.00 12.65  ? 412  ASN A N     1 
ATOM   3061  C  CA    . ASN A  1  412 ? 17.543  56.345  38.116  1.00 15.06  ? 412  ASN A CA    1 
ATOM   3062  C  C     . ASN A  1  412 ? 17.092  56.560  36.639  1.00 19.14  ? 412  ASN A C     1 
ATOM   3063  O  O     . ASN A  1  412 ? 16.114  57.257  36.360  1.00 16.39  ? 412  ASN A O     1 
ATOM   3064  C  CB    . ASN A  1  412 ? 18.009  57.681  38.682  1.00 15.01  ? 412  ASN A CB    1 
ATOM   3065  C  CG    . ASN A  1  412 ? 17.601  57.881  40.165  1.00 17.16  ? 412  ASN A CG    1 
ATOM   3066  O  OD1   . ASN A  1  412 ? 17.010  57.003  40.774  1.00 18.92  ? 412  ASN A OD1   1 
ATOM   3067  N  ND2   . ASN A  1  412 ? 17.907  59.045  40.713  1.00 13.52  ? 412  ASN A ND2   1 
ATOM   3068  N  N     . SER A  1  413 ? 17.789  55.977  35.675  1.00 16.54  ? 413  SER A N     1 
ATOM   3069  C  CA    . SER A  1  413 ? 17.337  56.222  34.283  1.00 17.46  ? 413  SER A CA    1 
ATOM   3070  C  C     . SER A  1  413 ? 16.120  55.375  33.855  1.00 18.26  ? 413  SER A C     1 
ATOM   3071  O  O     . SER A  1  413 ? 15.198  55.882  33.240  1.00 15.46  ? 413  SER A O     1 
ATOM   3072  C  CB    . SER A  1  413 ? 18.457  55.992  33.297  1.00 14.52  ? 413  SER A CB    1 
ATOM   3073  O  OG    . SER A  1  413 ? 17.933  56.054  31.990  1.00 17.70  ? 413  SER A OG    1 
ATOM   3074  N  N     . LEU A  1  414 ? 16.150  54.081  34.177  1.00 18.79  ? 414  LEU A N     1 
ATOM   3075  C  CA    . LEU A  1  414 ? 15.049  53.179  33.870  1.00 17.20  ? 414  LEU A CA    1 
ATOM   3076  C  C     . LEU A  1  414 ? 13.805  53.707  34.607  1.00 17.72  ? 414  LEU A C     1 
ATOM   3077  O  O     . LEU A  1  414 ? 12.681  53.568  34.147  1.00 15.40  ? 414  LEU A O     1 
ATOM   3078  C  CB    . LEU A  1  414 ? 15.367  51.755  34.354  1.00 16.65  ? 414  LEU A CB    1 
ATOM   3079  C  CG    . LEU A  1  414 ? 16.327  50.901  33.501  1.00 20.98  ? 414  LEU A CG    1 
ATOM   3080  C  CD1   . LEU A  1  414 ? 16.330  49.473  34.028  1.00 17.15  ? 414  LEU A CD1   1 
ATOM   3081  C  CD2   . LEU A  1  414 ? 15.902  50.934  32.033  1.00 19.22  ? 414  LEU A CD2   1 
ATOM   3082  N  N     . LEU A  1  415 ? 14.028  54.304  35.770  1.00 16.89  ? 415  LEU A N     1 
ATOM   3083  C  CA    . LEU A  1  415 ? 12.952  54.872  36.557  1.00 15.83  ? 415  LEU A CA    1 
ATOM   3084  C  C     . LEU A  1  415 ? 12.379  56.084  35.801  1.00 20.55  ? 415  LEU A C     1 
ATOM   3085  O  O     . LEU A  1  415 ? 11.166  56.260  35.652  1.00 16.31  ? 415  LEU A O     1 
ATOM   3086  C  CB    . LEU A  1  415 ? 13.496  55.322  37.898  1.00 16.39  ? 415  LEU A CB    1 
ATOM   3087  C  CG    . LEU A  1  415 ? 12.509  56.137  38.734  1.00 16.42  ? 415  LEU A CG    1 
ATOM   3088  C  CD1   . LEU A  1  415 ? 11.225  55.280  38.998  1.00 9.17   ? 415  LEU A CD1   1 
ATOM   3089  C  CD2   . LEU A  1  415 ? 13.204  56.575  40.008  1.00 9.70   ? 415  LEU A CD2   1 
ATOM   3090  N  N     . ASP A  1  416 ? 13.294  56.926  35.364  1.00 18.83  ? 416  ASP A N     1 
ATOM   3091  C  CA    . ASP A  1  416 ? 12.994  58.102  34.589  1.00 21.94  ? 416  ASP A CA    1 
ATOM   3092  C  C     . ASP A  1  416 ? 12.138  57.719  33.347  1.00 21.05  ? 416  ASP A C     1 
ATOM   3093  O  O     . ASP A  1  416 ? 11.151  58.406  33.047  1.00 14.59  ? 416  ASP A O     1 
ATOM   3094  C  CB    . ASP A  1  416 ? 14.334  58.718  34.210  1.00 24.06  ? 416  ASP A CB    1 
ATOM   3095  C  CG    . ASP A  1  416 ? 14.249  59.794  33.158  1.00 31.47  ? 416  ASP A CG    1 
ATOM   3096  O  OD1   . ASP A  1  416 ? 15.345  60.264  32.763  1.00 30.10  ? 416  ASP A OD1   1 
ATOM   3097  O  OD2   . ASP A  1  416 ? 13.144  60.159  32.724  1.00 31.91  ? 416  ASP A OD2   1 
ATOM   3098  N  N     . LEU A  1  417 ? 12.474  56.614  32.678  1.00 15.40  ? 417  LEU A N     1 
ATOM   3099  C  CA    . LEU A  1  417 ? 11.738  56.221  31.480  1.00 21.00  ? 417  LEU A CA    1 
ATOM   3100  C  C     . LEU A  1  417 ? 10.272  55.908  31.711  1.00 21.45  ? 417  LEU A C     1 
ATOM   3101  O  O     . LEU A  1  417 ? 9.402   56.352  30.959  1.00 18.01  ? 417  LEU A O     1 
ATOM   3102  C  CB    . LEU A  1  417 ? 12.347  54.974  30.816  1.00 17.32  ? 417  LEU A CB    1 
ATOM   3103  C  CG    . LEU A  1  417 ? 13.859  54.884  30.617  1.00 12.75  ? 417  LEU A CG    1 
ATOM   3104  C  CD1   . LEU A  1  417 ? 14.142  53.586  29.841  1.00 8.91   ? 417  LEU A CD1   1 
ATOM   3105  C  CD2   . LEU A  1  417 ? 14.388  56.086  29.876  1.00 8.74   ? 417  LEU A CD2   1 
ATOM   3106  N  N     . VAL A  1  418 ? 9.989   55.106  32.727  1.00 21.03  ? 418  VAL A N     1 
ATOM   3107  C  CA    . VAL A  1  418 ? 8.607   54.748  32.924  1.00 19.65  ? 418  VAL A CA    1 
ATOM   3108  C  C     . VAL A  1  418 ? 7.839   55.854  33.593  1.00 19.66  ? 418  VAL A C     1 
ATOM   3109  O  O     . VAL A  1  418 ? 6.675   56.047  33.305  1.00 22.98  ? 418  VAL A O     1 
ATOM   3110  C  CB    . VAL A  1  418 ? 8.466   53.414  33.681  1.00 20.05  ? 418  VAL A CB    1 
ATOM   3111  C  CG1   . VAL A  1  418 ? 8.999   52.280  32.798  1.00 25.51  ? 418  VAL A CG1   1 
ATOM   3112  C  CG2   . VAL A  1  418 ? 9.229   53.452  34.980  1.00 22.55  ? 418  VAL A CG2   1 
ATOM   3113  N  N     . VAL A  1  419 ? 8.479   56.605  34.465  1.00 18.88  ? 419  VAL A N     1 
ATOM   3114  C  CA    . VAL A  1  419 ? 7.771   57.691  35.122  1.00 15.92  ? 419  VAL A CA    1 
ATOM   3115  C  C     . VAL A  1  419 ? 7.375   58.811  34.184  1.00 18.22  ? 419  VAL A C     1 
ATOM   3116  O  O     . VAL A  1  419 ? 6.210   59.248  34.192  1.00 20.39  ? 419  VAL A O     1 
ATOM   3117  C  CB    . VAL A  1  419 ? 8.587   58.290  36.281  1.00 14.88  ? 419  VAL A CB    1 
ATOM   3118  C  CG1   . VAL A  1  419 ? 7.989   59.679  36.713  1.00 14.96  ? 419  VAL A CG1   1 
ATOM   3119  C  CG2   . VAL A  1  419 ? 8.546   57.306  37.469  1.00 11.59  ? 419  VAL A CG2   1 
ATOM   3120  N  N     . PHE A  1  420 ? 8.317   59.292  33.382  1.00 17.12  ? 420  PHE A N     1 
ATOM   3121  C  CA    . PHE A  1  420 ? 8.013   60.400  32.465  1.00 18.94  ? 420  PHE A CA    1 
ATOM   3122  C  C     . PHE A  1  420 ? 7.376   59.965  31.160  1.00 18.89  ? 420  PHE A C     1 
ATOM   3123  O  O     . PHE A  1  420 ? 6.730   60.774  30.488  1.00 24.06  ? 420  PHE A O     1 
ATOM   3124  C  CB    . PHE A  1  420 ? 9.267   61.234  32.225  1.00 18.21  ? 420  PHE A CB    1 
ATOM   3125  C  CG    . PHE A  1  420 ? 9.688   61.975  33.437  1.00 18.48  ? 420  PHE A CG    1 
ATOM   3126  C  CD1   . PHE A  1  420 ? 9.004   63.110  33.836  1.00 18.00  ? 420  PHE A CD1   1 
ATOM   3127  C  CD2   . PHE A  1  420 ? 10.715  61.496  34.238  1.00 19.11  ? 420  PHE A CD2   1 
ATOM   3128  C  CE1   . PHE A  1  420 ? 9.329   63.758  35.018  1.00 21.70  ? 420  PHE A CE1   1 
ATOM   3129  C  CE2   . PHE A  1  420 ? 11.049  62.135  35.428  1.00 16.78  ? 420  PHE A CE2   1 
ATOM   3130  C  CZ    . PHE A  1  420 ? 10.359  63.269  35.823  1.00 22.14  ? 420  PHE A CZ    1 
ATOM   3131  N  N     . GLY A  1  421 ? 7.559   58.695  30.796  1.00 20.35  ? 421  GLY A N     1 
ATOM   3132  C  CA    . GLY A  1  421 ? 6.885   58.172  29.612  1.00 18.89  ? 421  GLY A CA    1 
ATOM   3133  C  C     . GLY A  1  421 ? 5.406   58.239  30.004  1.00 20.76  ? 421  GLY A C     1 
ATOM   3134  O  O     . GLY A  1  421 ? 4.544   58.724  29.274  1.00 20.35  ? 421  GLY A O     1 
ATOM   3135  N  N     . ARG A  1  422 ? 5.113   57.777  31.206  1.00 21.94  ? 422  ARG A N     1 
ATOM   3136  C  CA    . ARG A  1  422 ? 3.760   57.811  31.702  1.00 20.90  ? 422  ARG A CA    1 
ATOM   3137  C  C     . ARG A  1  422 ? 3.257   59.273  31.876  1.00 22.73  ? 422  ARG A C     1 
ATOM   3138  O  O     . ARG A  1  422 ? 2.121   59.593  31.513  1.00 19.06  ? 422  ARG A O     1 
ATOM   3139  C  CB    . ARG A  1  422 ? 3.667   57.076  33.038  1.00 22.31  ? 422  ARG A CB    1 
ATOM   3140  C  CG    . ARG A  1  422 ? 2.216   57.034  33.583  1.00 22.27  ? 422  ARG A CG    1 
ATOM   3141  C  CD    . ARG A  1  422 ? 2.144   56.146  34.808  1.00 31.41  ? 422  ARG A CD    1 
ATOM   3142  N  NE    . ARG A  1  422 ? 0.767   55.963  35.250  1.00 33.52  ? 422  ARG A NE    1 
ATOM   3143  C  CZ    . ARG A  1  422 ? 0.210   56.613  36.260  1.00 31.84  ? 422  ARG A CZ    1 
ATOM   3144  N  NH1   . ARG A  1  422 ? 0.916   57.494  36.953  1.00 35.82  ? 422  ARG A NH1   1 
ATOM   3145  N  NH2   . ARG A  1  422 ? -1.067  56.387  36.566  1.00 35.19  ? 422  ARG A NH2   1 
ATOM   3146  N  N     . ALA A  1  423 ? 4.091   60.155  32.415  1.00 20.60  ? 423  ALA A N     1 
ATOM   3147  C  CA    . ALA A  1  423 ? 3.660   61.544  32.617  1.00 23.05  ? 423  ALA A CA    1 
ATOM   3148  C  C     . ALA A  1  423 ? 3.296   62.246  31.319  1.00 21.82  ? 423  ALA A C     1 
ATOM   3149  O  O     . ALA A  1  423 ? 2.322   63.000  31.277  1.00 22.90  ? 423  ALA A O     1 
ATOM   3150  C  CB    . ALA A  1  423 ? 4.717   62.355  33.366  1.00 20.95  ? 423  ALA A CB    1 
ATOM   3151  N  N     . CYS A  1  424 ? 4.071   62.034  30.268  1.00 23.21  ? 424  CYS A N     1 
ATOM   3152  C  CA    . CYS A  1  424 ? 3.721   62.653  28.979  1.00 18.94  ? 424  CYS A CA    1 
ATOM   3153  C  C     . CYS A  1  424 ? 2.294   62.226  28.616  1.00 19.09  ? 424  CYS A C     1 
ATOM   3154  O  O     . CYS A  1  424 ? 1.462   63.068  28.288  1.00 19.56  ? 424  CYS A O     1 
ATOM   3155  C  CB    . CYS A  1  424 ? 4.660   62.204  27.886  1.00 14.04  ? 424  CYS A CB    1 
ATOM   3156  S  SG    . CYS A  1  424 ? 6.318   62.912  28.020  1.00 25.60  ? 424  CYS A SG    1 
ATOM   3157  N  N     . ALA A  1  425 ? 2.010   60.931  28.717  1.00 20.42  ? 425  ALA A N     1 
ATOM   3158  C  CA    . ALA A  1  425 ? 0.694   60.411  28.384  1.00 21.90  ? 425  ALA A CA    1 
ATOM   3159  C  C     . ALA A  1  425 ? -0.392  61.059  29.236  1.00 27.46  ? 425  ALA A C     1 
ATOM   3160  O  O     . ALA A  1  425 ? -1.387  61.548  28.710  1.00 25.84  ? 425  ALA A O     1 
ATOM   3161  C  CB    . ALA A  1  425 ? 0.674   58.930  28.565  1.00 21.04  ? 425  ALA A CB    1 
ATOM   3162  N  N     . LEU A  1  426 ? -0.191  61.070  30.550  1.00 26.69  ? 426  LEU A N     1 
ATOM   3163  C  CA    . LEU A  1  426 ? -1.137  61.671  31.464  1.00 26.86  ? 426  LEU A CA    1 
ATOM   3164  C  C     . LEU A  1  426 ? -1.426  63.122  31.137  1.00 29.32  ? 426  LEU A C     1 
ATOM   3165  O  O     . LEU A  1  426 ? -2.594  63.535  31.082  1.00 30.29  ? 426  LEU A O     1 
ATOM   3166  C  CB    . LEU A  1  426 ? -0.627  61.575  32.901  1.00 24.66  ? 426  LEU A CB    1 
ATOM   3167  C  CG    . LEU A  1  426 ? -0.685  60.165  33.497  1.00 25.90  ? 426  LEU A CG    1 
ATOM   3168  C  CD1   . LEU A  1  426 ? -0.062  60.183  34.932  1.00 24.25  ? 426  LEU A CD1   1 
ATOM   3169  C  CD2   . LEU A  1  426 ? -2.144  59.712  33.523  1.00 18.02  ? 426  LEU A CD2   1 
ATOM   3170  N  N     . THR A  1  427 ? -0.356  63.885  30.942  1.00 26.80  ? 427  THR A N     1 
ATOM   3171  C  CA    . THR A  1  427 ? -0.429  65.305  30.617  1.00 27.49  ? 427  THR A CA    1 
ATOM   3172  C  C     . THR A  1  427 ? -1.224  65.572  29.332  1.00 28.18  ? 427  THR A C     1 
ATOM   3173  O  O     . THR A  1  427 ? -2.001  66.512  29.267  1.00 26.58  ? 427  THR A O     1 
ATOM   3174  C  CB    . THR A  1  427 ? 0.985   65.874  30.439  1.00 25.72  ? 427  THR A CB    1 
ATOM   3175  O  OG1   . THR A  1  427 ? 1.701   65.722  31.663  1.00 28.99  ? 427  THR A OG1   1 
ATOM   3176  C  CG2   . THR A  1  427 ? 0.952   67.345  30.051  1.00 25.17  ? 427  THR A CG2   1 
ATOM   3177  N  N     . ILE A  1  428 ? -0.998  64.759  28.306  1.00 25.06  ? 428  ILE A N     1 
ATOM   3178  C  CA    . ILE A  1  428 ? -1.717  64.913  27.048  1.00 25.09  ? 428  ILE A CA    1 
ATOM   3179  C  C     . ILE A  1  428 ? -3.212  64.594  27.271  1.00 28.30  ? 428  ILE A C     1 
ATOM   3180  O  O     . ILE A  1  428 ? -4.086  65.342  26.820  1.00 28.85  ? 428  ILE A O     1 
ATOM   3181  C  CB    . ILE A  1  428 ? -1.076  64.009  25.956  1.00 21.46  ? 428  ILE A CB    1 
ATOM   3182  C  CG1   . ILE A  1  428 ? 0.286   64.600  25.588  1.00 21.10  ? 428  ILE A CG1   1 
ATOM   3183  C  CG2   . ILE A  1  428 ? -1.996  63.844  24.728  1.00 21.32  ? 428  ILE A CG2   1 
ATOM   3184  C  CD1   . ILE A  1  428 ? 1.100   63.767  24.572  1.00 20.42  ? 428  ILE A CD1   1 
ATOM   3185  N  N     . ALA A  1  429 ? -3.498  63.524  28.011  1.00 27.61  ? 429  ALA A N     1 
ATOM   3186  C  CA    . ALA A  1  429 ? -4.868  63.133  28.320  1.00 30.66  ? 429  ALA A CA    1 
ATOM   3187  C  C     . ALA A  1  429 ? -5.592  64.136  29.225  1.00 35.93  ? 429  ALA A C     1 
ATOM   3188  O  O     . ALA A  1  429 ? -6.817  64.191  29.220  1.00 36.19  ? 429  ALA A O     1 
ATOM   3189  C  CB    . ALA A  1  429 ? -4.896  61.758  28.973  1.00 29.30  ? 429  ALA A CB    1 
ATOM   3190  N  N     . GLU A  1  430 ? -4.873  64.921  30.018  1.00 40.69  ? 430  GLU A N     1 
ATOM   3191  C  CA    . GLU A  1  430 ? -5.571  65.884  30.869  1.00 47.32  ? 430  GLU A CA    1 
ATOM   3192  C  C     . GLU A  1  430 ? -5.550  67.247  30.189  1.00 47.04  ? 430  GLU A C     1 
ATOM   3193  O  O     . GLU A  1  430 ? -5.964  68.247  30.755  1.00 50.84  ? 430  GLU A O     1 
ATOM   3194  C  CB    . GLU A  1  430 ? -4.914  65.971  32.262  1.00 52.30  ? 430  GLU A CB    1 
ATOM   3195  C  CG    . GLU A  1  430 ? -3.515  66.588  32.264  1.00 64.29  ? 430  GLU A CG    1 
ATOM   3196  C  CD    . GLU A  1  430 ? -2.720  66.339  33.559  1.00 69.28  ? 430  GLU A CD    1 
ATOM   3197  O  OE1   . GLU A  1  430 ? -2.772  65.203  34.087  1.00 71.82  ? 430  GLU A OE1   1 
ATOM   3198  O  OE2   . GLU A  1  430 ? -2.020  67.273  34.030  1.00 70.01  ? 430  GLU A OE2   1 
ATOM   3199  N  N     . THR A  1  431 ? -5.106  67.260  28.942  1.00 47.05  ? 431  THR A N     1 
ATOM   3200  C  CA    . THR A  1  431 ? -4.964  68.484  28.163  1.00 44.75  ? 431  THR A CA    1 
ATOM   3201  C  C     . THR A  1  431 ? -5.767  68.484  26.866  1.00 41.67  ? 431  THR A C     1 
ATOM   3202  O  O     . THR A  1  431 ? -6.214  69.529  26.409  1.00 41.23  ? 431  THR A O     1 
ATOM   3203  C  CB    . THR A  1  431 ? -3.458  68.678  27.798  1.00 47.65  ? 431  THR A CB    1 
ATOM   3204  O  OG1   . THR A  1  431 ? -2.758  69.178  28.939  1.00 50.39  ? 431  THR A OG1   1 
ATOM   3205  C  CG2   . THR A  1  431 ? -3.275  69.615  26.610  1.00 45.63  ? 431  THR A CG2   1 
ATOM   3206  N  N     . CYS A  1  432 ? -5.905  67.308  26.261  1.00 39.06  ? 432  CYS A N     1 
ATOM   3207  C  CA    . CYS A  1  432 ? -6.609  67.151  24.996  1.00 38.48  ? 432  CYS A CA    1 
ATOM   3208  C  C     . CYS A  1  432 ? -7.583  65.991  25.063  1.00 36.31  ? 432  CYS A C     1 
ATOM   3209  O  O     . CYS A  1  432 ? -7.628  65.239  26.040  1.00 35.87  ? 432  CYS A O     1 
ATOM   3210  C  CB    . CYS A  1  432 ? -5.607  66.869  23.865  1.00 41.50  ? 432  CYS A CB    1 
ATOM   3211  S  SG    . CYS A  1  432 ? -4.321  68.138  23.631  1.00 49.14  ? 432  CYS A SG    1 
ATOM   3212  N  N     . LYS A  1  433 ? -8.325  65.817  23.979  1.00 34.97  ? 433  LYS A N     1 
ATOM   3213  C  CA    . LYS A  1  433 ? -9.294  64.743  23.888  1.00 34.60  ? 433  LYS A CA    1 
ATOM   3214  C  C     . LYS A  1  433 ? -9.058  63.933  22.633  1.00 30.72  ? 433  LYS A C     1 
ATOM   3215  O  O     . LYS A  1  433 ? -8.727  64.474  21.591  1.00 33.64  ? 433  LYS A O     1 
ATOM   3216  C  CB    . LYS A  1  433 ? -10.712 65.325  23.856  1.00 39.34  ? 433  LYS A CB    1 
ATOM   3217  C  CG    . LYS A  1  433 ? -11.071 66.174  25.075  1.00 41.65  ? 433  LYS A CG    1 
ATOM   3218  C  CD    . LYS A  1  433 ? -11.529 65.284  26.219  1.00 51.35  ? 433  LYS A CD    1 
ATOM   3219  C  CE    . LYS A  1  433 ? -12.119 66.105  27.390  1.00 58.09  ? 433  LYS A CE    1 
ATOM   3220  N  NZ    . LYS A  1  433 ? -12.543 65.263  28.564  1.00 57.03  ? 433  LYS A NZ    1 
ATOM   3221  N  N     . PRO A  1  434 ? -9.217  62.612  22.710  1.00 29.83  ? 434  PRO A N     1 
ATOM   3222  C  CA    . PRO A  1  434 ? -8.993  61.862  21.483  1.00 26.25  ? 434  PRO A CA    1 
ATOM   3223  C  C     . PRO A  1  434 ? -9.985  62.344  20.440  1.00 32.01  ? 434  PRO A C     1 
ATOM   3224  O  O     . PRO A  1  434 ? -11.076 62.785  20.786  1.00 26.75  ? 434  PRO A O     1 
ATOM   3225  C  CB    . PRO A  1  434 ? -9.312  60.434  21.890  1.00 24.02  ? 434  PRO A CB    1 
ATOM   3226  C  CG    . PRO A  1  434 ? -8.936  60.404  23.344  1.00 27.74  ? 434  PRO A CG    1 
ATOM   3227  C  CD    . PRO A  1  434 ? -9.482  61.708  23.844  1.00 28.45  ? 434  PRO A CD    1 
ATOM   3228  N  N     . GLY A  1  435 ? -9.617  62.247  19.167  1.00 34.36  ? 435  GLY A N     1 
ATOM   3229  C  CA    . GLY A  1  435 ? -10.535 62.637  18.124  1.00 36.23  ? 435  GLY A CA    1 
ATOM   3230  C  C     . GLY A  1  435 ? -10.601 64.106  17.762  1.00 38.52  ? 435  GLY A C     1 
ATOM   3231  O  O     . GLY A  1  435 ? -11.192 64.449  16.745  1.00 39.31  ? 435  GLY A O     1 
ATOM   3232  N  N     . GLU A  1  436 ? -10.024 64.983  18.566  1.00 40.01  ? 436  GLU A N     1 
ATOM   3233  C  CA    . GLU A  1  436 ? -10.064 66.383  18.205  1.00 42.44  ? 436  GLU A CA    1 
ATOM   3234  C  C     . GLU A  1  436 ? -9.418  66.507  16.832  1.00 43.64  ? 436  GLU A C     1 
ATOM   3235  O  O     . GLU A  1  436 ? -8.622  65.655  16.436  1.00 44.37  ? 436  GLU A O     1 
ATOM   3236  C  CB    . GLU A  1  436 ? -9.343  67.225  19.258  1.00 45.31  ? 436  GLU A CB    1 
ATOM   3237  C  CG    . GLU A  1  436 ? -10.159 67.327  20.542  1.00 53.92  ? 436  GLU A CG    1 
ATOM   3238  C  CD    . GLU A  1  436 ? -9.517  68.210  21.603  1.00 58.64  ? 436  GLU A CD    1 
ATOM   3239  O  OE1   . GLU A  1  436 ? -9.088  69.333  21.260  1.00 61.90  ? 436  GLU A OE1   1 
ATOM   3240  O  OE2   . GLU A  1  436 ? -9.452  67.790  22.782  1.00 61.14  ? 436  GLU A OE2   1 
ATOM   3241  N  N     . PRO A  1  437 ? -9.771  67.552  16.071  1.00 43.30  ? 437  PRO A N     1 
ATOM   3242  C  CA    . PRO A  1  437 ? -9.196  67.727  14.734  1.00 45.71  ? 437  PRO A CA    1 
ATOM   3243  C  C     . PRO A  1  437 ? -7.675  67.785  14.652  1.00 46.46  ? 437  PRO A C     1 
ATOM   3244  O  O     . PRO A  1  437 ? -7.007  68.354  15.518  1.00 46.18  ? 437  PRO A O     1 
ATOM   3245  C  CB    . PRO A  1  437 ? -9.884  69.003  14.231  1.00 45.71  ? 437  PRO A CB    1 
ATOM   3246  C  CG    . PRO A  1  437 ? -10.260 69.730  15.512  1.00 43.32  ? 437  PRO A CG    1 
ATOM   3247  C  CD    . PRO A  1  437 ? -10.734 68.625  16.379  1.00 42.89  ? 437  PRO A CD    1 
ATOM   3248  N  N     . VAL A  1  438 ? -7.136  67.182  13.601  1.00 47.65  ? 438  VAL A N     1 
ATOM   3249  C  CA    . VAL A  1  438 ? -5.698  67.159  13.406  1.00 52.21  ? 438  VAL A CA    1 
ATOM   3250  C  C     . VAL A  1  438 ? -5.218  68.468  12.800  1.00 50.89  ? 438  VAL A C     1 
ATOM   3251  O  O     . VAL A  1  438 ? -5.780  68.949  11.824  1.00 49.93  ? 438  VAL A O     1 
ATOM   3252  C  CB    . VAL A  1  438 ? -5.288  65.995  12.491  1.00 56.67  ? 438  VAL A CB    1 
ATOM   3253  C  CG1   . VAL A  1  438 ? -6.082  66.052  11.195  1.00 61.28  ? 438  VAL A CG1   1 
ATOM   3254  C  CG2   . VAL A  1  438 ? -3.805  66.070  12.195  1.00 58.06  ? 438  VAL A CG2   1 
ATOM   3255  N  N     . PRO A  1  439 ? -4.163  69.062  13.378  1.00 51.96  ? 439  PRO A N     1 
ATOM   3256  C  CA    . PRO A  1  439 ? -3.621  70.327  12.882  1.00 50.90  ? 439  PRO A CA    1 
ATOM   3257  C  C     . PRO A  1  439 ? -3.143  70.229  11.449  1.00 50.37  ? 439  PRO A C     1 
ATOM   3258  O  O     . PRO A  1  439 ? -2.714  69.174  10.996  1.00 52.26  ? 439  PRO A O     1 
ATOM   3259  C  CB    . PRO A  1  439 ? -2.498  70.631  13.867  1.00 50.80  ? 439  PRO A CB    1 
ATOM   3260  C  CG    . PRO A  1  439 ? -2.057  69.284  14.305  1.00 51.29  ? 439  PRO A CG    1 
ATOM   3261  C  CD    . PRO A  1  439 ? -3.364  68.566  14.511  1.00 52.37  ? 439  PRO A CD    1 
ATOM   3262  N  N     . SER A  1  440 ? -3.234  71.339  10.735  1.00 50.18  ? 440  SER A N     1 
ATOM   3263  C  CA    . SER A  1  440 ? -2.819  71.386  9.340   1.00 48.39  ? 440  SER A CA    1 
ATOM   3264  C  C     . SER A  1  440 ? -1.358  71.753  9.139   1.00 44.02  ? 440  SER A C     1 
ATOM   3265  O  O     . SER A  1  440 ? -0.746  72.423  9.970   1.00 43.74  ? 440  SER A O     1 
ATOM   3266  C  CB    . SER A  1  440 ? -3.679  72.399  8.581   1.00 52.78  ? 440  SER A CB    1 
ATOM   3267  O  OG    . SER A  1  440 ? -5.020  71.950  8.495   1.00 62.43  ? 440  SER A OG    1 
ATOM   3268  N  N     . ILE A  1  441 ? -0.822  71.309  8.010   1.00 40.43  ? 441  ILE A N     1 
ATOM   3269  C  CA    . ILE A  1  441 ? 0.548   71.589  7.613   1.00 37.11  ? 441  ILE A CA    1 
ATOM   3270  C  C     . ILE A  1  441 ? 0.522   71.969  6.131   1.00 38.80  ? 441  ILE A C     1 
ATOM   3271  O  O     . ILE A  1  441 ? -0.312  71.462  5.378   1.00 35.04  ? 441  ILE A O     1 
ATOM   3272  C  CB    . ILE A  1  441 ? 1.441   70.333  7.774   1.00 36.14  ? 441  ILE A CB    1 
ATOM   3273  C  CG1   . ILE A  1  441 ? 0.858   69.180  6.960   1.00 31.78  ? 441  ILE A CG1   1 
ATOM   3274  C  CG2   . ILE A  1  441 ? 1.572   69.968  9.262   1.00 34.61  ? 441  ILE A CG2   1 
ATOM   3275  C  CD1   . ILE A  1  441 ? 1.572   67.849  7.090   1.00 30.78  ? 441  ILE A CD1   1 
ATOM   3276  N  N     . LYS A  1  442 ? 1.422   72.858  5.714   1.00 41.54  ? 442  LYS A N     1 
ATOM   3277  C  CA    . LYS A  1  442 ? 1.505   73.242  4.306   1.00 42.36  ? 442  LYS A CA    1 
ATOM   3278  C  C     . LYS A  1  442 ? 1.744   71.962  3.486   1.00 43.57  ? 442  LYS A C     1 
ATOM   3279  O  O     . LYS A  1  442 ? 2.368   71.018  3.948   1.00 41.61  ? 442  LYS A O     1 
ATOM   3280  C  CB    . LYS A  1  442 ? 2.627   74.256  4.123   1.00 43.25  ? 442  LYS A CB    1 
ATOM   3281  C  CG    . LYS A  1  442 ? 2.294   75.551  4.829   1.00 49.45  ? 442  LYS A CG    1 
ATOM   3282  C  CD    . LYS A  1  442 ? 3.486   76.471  5.004   1.00 55.15  ? 442  LYS A CD    1 
ATOM   3283  C  CE    . LYS A  1  442 ? 3.106   77.638  5.919   1.00 60.94  ? 442  LYS A CE    1 
ATOM   3284  N  NZ    . LYS A  1  442 ? 4.262   78.499  6.335   1.00 66.31  ? 442  LYS A NZ    1 
ATOM   3285  N  N     . PRO A  1  443 ? 1.225   71.909  2.260   1.00 44.05  ? 443  PRO A N     1 
ATOM   3286  C  CA    . PRO A  1  443 ? 1.357   70.745  1.361   1.00 42.30  ? 443  PRO A CA    1 
ATOM   3287  C  C     . PRO A  1  443 ? 2.773   70.250  1.077   1.00 39.04  ? 443  PRO A C     1 
ATOM   3288  O  O     . PRO A  1  443 ? 2.978   69.083  0.742   1.00 37.79  ? 443  PRO A O     1 
ATOM   3289  C  CB    . PRO A  1  443 ? 0.658   71.213  0.088   1.00 43.84  ? 443  PRO A CB    1 
ATOM   3290  C  CG    . PRO A  1  443 ? -0.377  72.183  0.611   1.00 47.22  ? 443  PRO A CG    1 
ATOM   3291  C  CD    . PRO A  1  443 ? 0.414   72.968  1.642   1.00 46.57  ? 443  PRO A CD    1 
ATOM   3292  N  N     . ASN A  1  444 ? 3.739   71.145  1.206   1.00 35.92  ? 444  ASN A N     1 
ATOM   3293  C  CA    . ASN A  1  444 ? 5.137   70.826  0.956   1.00 36.40  ? 444  ASN A CA    1 
ATOM   3294  C  C     . ASN A  1  444 ? 5.906   70.726  2.286   1.00 35.81  ? 444  ASN A C     1 
ATOM   3295  O  O     . ASN A  1  444 ? 7.143   70.758  2.301   1.00 35.69  ? 444  ASN A O     1 
ATOM   3296  C  CB    . ASN A  1  444 ? 5.744   71.938  0.112   1.00 38.92  ? 444  ASN A CB    1 
ATOM   3297  C  CG    . ASN A  1  444 ? 5.537   73.307  0.753   1.00 45.63  ? 444  ASN A CG    1 
ATOM   3298  O  OD1   . ASN A  1  444 ? 4.397   73.689  1.082   1.00 47.25  ? 444  ASN A OD1   1 
ATOM   3299  N  ND2   . ASN A  1  444 ? 6.628   74.045  0.952   1.00 45.94  ? 444  ASN A ND2   1 
ATOM   3300  N  N     . ALA A  1  445 ? 5.184   70.622  3.398   1.00 31.31  ? 445  ALA A N     1 
ATOM   3301  C  CA    . ALA A  1  445 ? 5.849   70.526  4.694   1.00 29.18  ? 445  ALA A CA    1 
ATOM   3302  C  C     . ALA A  1  445 ? 6.753   69.323  4.675   1.00 26.77  ? 445  ALA A C     1 
ATOM   3303  O  O     . ALA A  1  445 ? 6.366   68.255  4.213   1.00 27.93  ? 445  ALA A O     1 
ATOM   3304  C  CB    . ALA A  1  445 ? 4.833   70.403  5.822   1.00 23.31  ? 445  ALA A CB    1 
ATOM   3305  N  N     . GLY A  1  446 ? 7.974   69.525  5.142   1.00 28.15  ? 446  GLY A N     1 
ATOM   3306  C  CA    . GLY A  1  446 ? 8.947   68.461  5.204   1.00 29.00  ? 446  GLY A CA    1 
ATOM   3307  C  C     . GLY A  1  446 ? 9.817   68.311  3.978   1.00 30.48  ? 446  GLY A C     1 
ATOM   3308  O  O     . GLY A  1  446 ? 10.721  67.466  3.957   1.00 26.89  ? 446  GLY A O     1 
ATOM   3309  N  N     . GLU A  1  447 ? 9.588   69.148  2.968   1.00 30.98  ? 447  GLU A N     1 
ATOM   3310  C  CA    . GLU A  1  447 ? 10.347  69.023  1.736   1.00 31.27  ? 447  GLU A CA    1 
ATOM   3311  C  C     . GLU A  1  447 ? 11.848  69.188  1.913   1.00 28.57  ? 447  GLU A C     1 
ATOM   3312  O  O     . GLU A  1  447 ? 12.621  68.537  1.230   1.00 28.45  ? 447  GLU A O     1 
ATOM   3313  C  CB    . GLU A  1  447 ? 9.828   69.996  0.665   1.00 37.01  ? 447  GLU A CB    1 
ATOM   3314  C  CG    . GLU A  1  447 ? 10.154  71.469  0.882   1.00 43.57  ? 447  GLU A CG    1 
ATOM   3315  C  CD    . GLU A  1  447 ? 9.622   72.360  -0.267  1.00 50.67  ? 447  GLU A CD    1 
ATOM   3316  O  OE1   . GLU A  1  447 ? 9.881   72.034  -1.447  1.00 51.37  ? 447  GLU A OE1   1 
ATOM   3317  O  OE2   . GLU A  1  447 ? 8.952   73.387  0.006   1.00 54.04  ? 447  GLU A OE2   1 
ATOM   3318  N  N     . GLU A  1  448 ? 12.270  70.048  2.818   1.00 27.69  ? 448  GLU A N     1 
ATOM   3319  C  CA    . GLU A  1  448 ? 13.694  70.221  3.021   1.00 30.84  ? 448  GLU A CA    1 
ATOM   3320  C  C     . GLU A  1  448 ? 14.329  68.969  3.684   1.00 28.61  ? 448  GLU A C     1 
ATOM   3321  O  O     . GLU A  1  448 ? 15.528  68.761  3.579   1.00 28.04  ? 448  GLU A O     1 
ATOM   3322  C  CB    . GLU A  1  448 ? 13.963  71.484  3.839   1.00 35.56  ? 448  GLU A CB    1 
ATOM   3323  C  CG    . GLU A  1  448 ? 15.465  71.735  4.114   1.00 53.09  ? 448  GLU A CG    1 
ATOM   3324  C  CD    . GLU A  1  448 ? 16.387  71.623  2.859   1.00 58.14  ? 448  GLU A CD    1 
ATOM   3325  O  OE1   . GLU A  1  448 ? 16.108  72.313  1.841   1.00 60.65  ? 448  GLU A OE1   1 
ATOM   3326  O  OE2   . GLU A  1  448 ? 17.398  70.858  2.905   1.00 56.11  ? 448  GLU A OE2   1 
ATOM   3327  N  N     . SER A  1  449 ? 13.536  68.139  4.353   1.00 26.81  ? 449  SER A N     1 
ATOM   3328  C  CA    . SER A  1  449 ? 14.082  66.919  4.954   1.00 28.49  ? 449  SER A CA    1 
ATOM   3329  C  C     . SER A  1  449 ? 14.336  65.949  3.806   1.00 27.66  ? 449  SER A C     1 
ATOM   3330  O  O     . SER A  1  449 ? 15.336  65.243  3.768   1.00 27.59  ? 449  SER A O     1 
ATOM   3331  C  CB    . SER A  1  449 ? 13.074  66.289  5.921   1.00 24.04  ? 449  SER A CB    1 
ATOM   3332  O  OG    . SER A  1  449 ? 12.817  67.150  7.022   1.00 29.17  ? 449  SER A OG    1 
ATOM   3333  N  N     . VAL A  1  450 ? 13.408  65.916  2.860   1.00 27.31  ? 450  VAL A N     1 
ATOM   3334  C  CA    . VAL A  1  450 ? 13.543  65.025  1.714   1.00 26.19  ? 450  VAL A CA    1 
ATOM   3335  C  C     . VAL A  1  450 ? 14.669  65.458  0.797   1.00 23.56  ? 450  VAL A C     1 
ATOM   3336  O  O     . VAL A  1  450 ? 15.364  64.627  0.205   1.00 21.61  ? 450  VAL A O     1 
ATOM   3337  C  CB    . VAL A  1  450 ? 12.215  64.952  0.905   1.00 27.96  ? 450  VAL A CB    1 
ATOM   3338  C  CG1   . VAL A  1  450 ? 12.371  64.003  -0.290  1.00 26.97  ? 450  VAL A CG1   1 
ATOM   3339  C  CG2   . VAL A  1  450 ? 11.094  64.468  1.807   1.00 23.54  ? 450  VAL A CG2   1 
ATOM   3340  N  N     . ALA A  1  451 ? 14.857  66.761  0.669   1.00 21.56  ? 451  ALA A N     1 
ATOM   3341  C  CA    . ALA A  1  451 ? 15.932  67.236  -0.197  1.00 22.47  ? 451  ALA A CA    1 
ATOM   3342  C  C     . ALA A  1  451 ? 17.297  66.908  0.431   1.00 18.68  ? 451  ALA A C     1 
ATOM   3343  O  O     . ALA A  1  451 ? 18.251  66.519  -0.280  1.00 22.01  ? 451  ALA A O     1 
ATOM   3344  C  CB    . ALA A  1  451 ? 15.796  68.767  -0.443  1.00 22.80  ? 451  ALA A CB    1 
ATOM   3345  N  N     . ASN A  1  452 ? 17.406  67.050  1.757   1.00 17.12  ? 452  ASN A N     1 
ATOM   3346  C  CA    . ASN A  1  452 ? 18.683  66.749  2.429   1.00 15.53  ? 452  ASN A CA    1 
ATOM   3347  C  C     . ASN A  1  452 ? 18.915  65.245  2.283   1.00 16.65  ? 452  ASN A C     1 
ATOM   3348  O  O     . ASN A  1  452 ? 20.031  64.769  2.038   1.00 15.71  ? 452  ASN A O     1 
ATOM   3349  C  CB    . ASN A  1  452 ? 18.592  67.129  3.914   1.00 23.80  ? 452  ASN A CB    1 
ATOM   3350  C  CG    . ASN A  1  452 ? 19.745  66.552  4.742   1.00 24.03  ? 452  ASN A CG    1 
ATOM   3351  O  OD1   . ASN A  1  452 ? 20.869  67.043  4.692   1.00 23.06  ? 452  ASN A OD1   1 
ATOM   3352  N  ND2   . ASN A  1  452 ? 19.468  65.478  5.471   1.00 26.23  ? 452  ASN A ND2   1 
ATOM   3353  N  N     . LEU A  1  453 ? 17.836  64.483  2.407   1.00 14.63  ? 453  LEU A N     1 
ATOM   3354  C  CA    . LEU A  1  453 ? 17.964  63.031  2.282   1.00 20.36  ? 453  LEU A CA    1 
ATOM   3355  C  C     . LEU A  1  453 ? 18.447  62.688  0.865   1.00 23.27  ? 453  LEU A C     1 
ATOM   3356  O  O     . LEU A  1  453 ? 19.258  61.780  0.662   1.00 19.19  ? 453  LEU A O     1 
ATOM   3357  C  CB    . LEU A  1  453 ? 16.606  62.358  2.539   1.00 17.57  ? 453  LEU A CB    1 
ATOM   3358  C  CG    . LEU A  1  453 ? 16.616  60.829  2.483   1.00 22.65  ? 453  LEU A CG    1 
ATOM   3359  C  CD1   . LEU A  1  453 ? 15.433  60.298  3.234   1.00 30.25  ? 453  LEU A CD1   1 
ATOM   3360  C  CD2   . LEU A  1  453 ? 16.509  60.350  1.070   1.00 29.35  ? 453  LEU A CD2   1 
ATOM   3361  N  N     . ASP A  1  454 ? 17.948  63.422  -0.124  1.00 27.95  ? 454  ASP A N     1 
ATOM   3362  C  CA    . ASP A  1  454 ? 18.345  63.126  -1.503  1.00 29.23  ? 454  ASP A CA    1 
ATOM   3363  C  C     . ASP A  1  454 ? 19.769  63.567  -1.754  1.00 28.29  ? 454  ASP A C     1 
ATOM   3364  O  O     . ASP A  1  454 ? 20.516  62.923  -2.474  1.00 30.11  ? 454  ASP A O     1 
ATOM   3365  C  CB    . ASP A  1  454 ? 17.378  63.770  -2.486  1.00 33.78  ? 454  ASP A CB    1 
ATOM   3366  C  CG    . ASP A  1  454 ? 17.538  63.206  -3.869  1.00 41.64  ? 454  ASP A CG    1 
ATOM   3367  O  OD1   . ASP A  1  454 ? 18.206  63.877  -4.692  1.00 47.09  ? 454  ASP A OD1   1 
ATOM   3368  O  OD2   . ASP A  1  454 ? 17.024  62.081  -4.115  1.00 39.47  ? 454  ASP A OD2   1 
ATOM   3369  N  N     . LYS A  1  455 ? 20.162  64.658  -1.118  1.00 29.62  ? 455  LYS A N     1 
ATOM   3370  C  CA    . LYS A  1  455 ? 21.527  65.141  -1.219  1.00 29.69  ? 455  LYS A CA    1 
ATOM   3371  C  C     . LYS A  1  455 ? 22.525  64.058  -0.693  1.00 27.07  ? 455  LYS A C     1 
ATOM   3372  O  O     . LYS A  1  455 ? 23.518  63.766  -1.337  1.00 24.42  ? 455  LYS A O     1 
ATOM   3373  C  CB    . LYS A  1  455 ? 21.619  66.417  -0.399  1.00 33.92  ? 455  LYS A CB    1 
ATOM   3374  C  CG    . LYS A  1  455 ? 22.773  67.342  -0.719  1.00 44.43  ? 455  LYS A CG    1 
ATOM   3375  C  CD    . LYS A  1  455 ? 22.759  68.560  0.219   1.00 48.05  ? 455  LYS A CD    1 
ATOM   3376  C  CE    . LYS A  1  455 ? 22.969  68.149  1.690   1.00 46.48  ? 455  LYS A CE    1 
ATOM   3377  N  NZ    . LYS A  1  455 ? 22.494  69.182  2.678   1.00 51.77  ? 455  LYS A NZ    1 
ATOM   3378  N  N     . LEU A  1  456 ? 22.264  63.435  0.458   1.00 26.65  ? 456  LEU A N     1 
ATOM   3379  C  CA    . LEU A  1  456 ? 23.197  62.414  0.968   1.00 26.29  ? 456  LEU A CA    1 
ATOM   3380  C  C     . LEU A  1  456 ? 23.181  61.116  0.169   1.00 23.65  ? 456  LEU A C     1 
ATOM   3381  O  O     . LEU A  1  456 ? 24.205  60.437  0.035   1.00 20.48  ? 456  LEU A O     1 
ATOM   3382  C  CB    . LEU A  1  456 ? 22.921  62.091  2.446   1.00 21.71  ? 456  LEU A CB    1 
ATOM   3383  C  CG    . LEU A  1  456 ? 22.790  63.313  3.383   1.00 23.10  ? 456  LEU A CG    1 
ATOM   3384  C  CD1   . LEU A  1  456 ? 22.586  62.826  4.807   1.00 20.71  ? 456  LEU A CD1   1 
ATOM   3385  C  CD2   . LEU A  1  456 ? 24.003  64.199  3.318   1.00 20.48  ? 456  LEU A CD2   1 
ATOM   3386  N  N     . ARG A  1  457 ? 22.016  60.774  -0.369  1.00 23.79  ? 457  ARG A N     1 
ATOM   3387  C  CA    . ARG A  1  457 ? 21.869  59.548  -1.141  1.00 24.05  ? 457  ARG A CA    1 
ATOM   3388  C  C     . ARG A  1  457 ? 22.824  59.475  -2.342  1.00 27.36  ? 457  ARG A C     1 
ATOM   3389  O  O     . ARG A  1  457 ? 23.404  58.400  -2.630  1.00 26.76  ? 457  ARG A O     1 
ATOM   3390  C  CB    . ARG A  1  457 ? 20.412  59.422  -1.623  1.00 20.13  ? 457  ARG A CB    1 
ATOM   3391  C  CG    . ARG A  1  457 ? 20.142  58.150  -2.380  1.00 18.37  ? 457  ARG A CG    1 
ATOM   3392  C  CD    . ARG A  1  457 ? 18.652  58.030  -2.728  1.00 17.81  ? 457  ARG A CD    1 
ATOM   3393  N  NE    . ARG A  1  457 ? 18.443  56.880  -3.603  1.00 18.16  ? 457  ARG A NE    1 
ATOM   3394  C  CZ    . ARG A  1  457 ? 17.312  56.626  -4.255  1.00 21.68  ? 457  ARG A CZ    1 
ATOM   3395  N  NH1   . ARG A  1  457 ? 16.273  57.444  -4.141  1.00 24.24  ? 457  ARG A NH1   1 
ATOM   3396  N  NH2   . ARG A  1  457 ? 17.218  55.532  -5.000  1.00 20.61  ? 457  ARG A NH2   1 
ATOM   3397  N  N     . PHE A  1  458 ? 22.986  60.623  -3.018  1.00 25.54  ? 458  PHE A N     1 
ATOM   3398  C  CA    . PHE A  1  458 ? 23.835  60.741  -4.205  1.00 29.06  ? 458  PHE A CA    1 
ATOM   3399  C  C     . PHE A  1  458 ? 25.161  61.473  -3.976  1.00 30.85  ? 458  PHE A C     1 
ATOM   3400  O  O     . PHE A  1  458 ? 25.858  61.762  -4.944  1.00 31.55  ? 458  PHE A O     1 
ATOM   3401  C  CB    . PHE A  1  458 ? 23.038  61.439  -5.320  1.00 21.81  ? 458  PHE A CB    1 
ATOM   3402  C  CG    . PHE A  1  458 ? 21.802  60.682  -5.720  1.00 21.62  ? 458  PHE A CG    1 
ATOM   3403  C  CD1   . PHE A  1  458 ? 21.903  59.453  -6.383  1.00 18.98  ? 458  PHE A CD1   1 
ATOM   3404  C  CD2   . PHE A  1  458 ? 20.553  61.118  -5.322  1.00 17.81  ? 458  PHE A CD2   1 
ATOM   3405  C  CE1   . PHE A  1  458 ? 20.773  58.675  -6.619  1.00 23.16  ? 458  PHE A CE1   1 
ATOM   3406  C  CE2   . PHE A  1  458 ? 19.419  60.343  -5.555  1.00 18.24  ? 458  PHE A CE2   1 
ATOM   3407  C  CZ    . PHE A  1  458 ? 19.520  59.120  -6.194  1.00 17.59  ? 458  PHE A CZ    1 
ATOM   3408  N  N     . ALA A  1  459 ? 25.519  61.741  -2.708  1.00 29.55  ? 459  ALA A N     1 
ATOM   3409  C  CA    . ALA A  1  459 ? 26.762  62.471  -2.387  1.00 30.02  ? 459  ALA A CA    1 
ATOM   3410  C  C     . ALA A  1  459 ? 27.973  61.826  -3.034  1.00 27.72  ? 459  ALA A C     1 
ATOM   3411  O  O     . ALA A  1  459 ? 28.214  60.614  -2.906  1.00 24.17  ? 459  ALA A O     1 
ATOM   3412  C  CB    . ALA A  1  459 ? 26.970  62.571  -0.845  1.00 33.25  ? 459  ALA A CB    1 
ATOM   3413  N  N     . ASP A  1  460 ? 28.751  62.647  -3.716  1.00 29.30  ? 460  ASP A N     1 
ATOM   3414  C  CA    . ASP A  1  460 ? 29.915  62.131  -4.428  1.00 34.48  ? 460  ASP A CA    1 
ATOM   3415  C  C     . ASP A  1  460 ? 31.140  62.966  -4.144  1.00 35.21  ? 460  ASP A C     1 
ATOM   3416  O  O     . ASP A  1  460 ? 31.960  63.236  -5.028  1.00 34.62  ? 460  ASP A O     1 
ATOM   3417  C  CB    . ASP A  1  460 ? 29.620  62.091  -5.939  1.00 36.02  ? 460  ASP A CB    1 
ATOM   3418  C  CG    . ASP A  1  460 ? 30.484  61.061  -6.687  1.00 41.04  ? 460  ASP A CG    1 
ATOM   3419  O  OD1   . ASP A  1  460 ? 31.152  60.227  -6.026  1.00 36.52  ? 460  ASP A OD1   1 
ATOM   3420  O  OD2   . ASP A  1  460 ? 30.478  61.080  -7.947  1.00 48.81  ? 460  ASP A OD2   1 
ATOM   3421  N  N     . GLY A  1  461 ? 31.258  63.365  -2.887  1.00 33.76  ? 461  GLY A N     1 
ATOM   3422  C  CA    . GLY A  1  461 ? 32.383  64.166  -2.470  1.00 33.15  ? 461  GLY A CA    1 
ATOM   3423  C  C     . GLY A  1  461 ? 33.685  63.404  -2.336  1.00 29.94  ? 461  GLY A C     1 
ATOM   3424  O  O     . GLY A  1  461 ? 33.955  62.431  -3.041  1.00 34.64  ? 461  GLY A O     1 
ATOM   3425  N  N     . THR A  1  462 ? 34.465  63.838  -1.362  1.00 28.28  ? 462  THR A N     1 
ATOM   3426  C  CA    . THR A  1  462 ? 35.797  63.320  -1.108  1.00 30.14  ? 462  THR A CA    1 
ATOM   3427  C  C     . THR A  1  462 ? 36.028  62.690  0.276   1.00 29.65  ? 462  THR A C     1 
ATOM   3428  O  O     . THR A  1  462 ? 37.044  62.022  0.505   1.00 31.56  ? 462  THR A O     1 
ATOM   3429  C  CB    . THR A  1  462 ? 36.756  64.491  -1.324  1.00 30.60  ? 462  THR A CB    1 
ATOM   3430  O  OG1   . THR A  1  462 ? 37.095  64.545  -2.717  1.00 37.23  ? 462  THR A OG1   1 
ATOM   3431  C  CG2   . THR A  1  462 ? 37.963  64.381  -0.473  1.00 37.64  ? 462  THR A CG2   1 
ATOM   3432  N  N     . ILE A  1  463 ? 35.097  62.915  1.198   1.00 26.04  ? 463  ILE A N     1 
ATOM   3433  C  CA    . ILE A  1  463 ? 35.231  62.382  2.563   1.00 23.83  ? 463  ILE A CA    1 
ATOM   3434  C  C     . ILE A  1  463 ? 34.066  61.459  2.816   1.00 20.23  ? 463  ILE A C     1 
ATOM   3435  O  O     . ILE A  1  463 ? 32.930  61.902  2.883   1.00 19.06  ? 463  ILE A O     1 
ATOM   3436  C  CB    . ILE A  1  463 ? 35.202  63.510  3.592   1.00 22.91  ? 463  ILE A CB    1 
ATOM   3437  C  CG1   . ILE A  1  463 ? 36.159  64.621  3.152   1.00 25.99  ? 463  ILE A CG1   1 
ATOM   3438  C  CG2   . ILE A  1  463 ? 35.534  62.985  4.955   1.00 19.56  ? 463  ILE A CG2   1 
ATOM   3439  C  CD1   . ILE A  1  463 ? 36.342  65.737  4.192   1.00 27.64  ? 463  ILE A CD1   1 
ATOM   3440  N  N     . ARG A  1  464 ? 34.329  60.163  2.882   1.00 21.26  ? 464  ARG A N     1 
ATOM   3441  C  CA    . ARG A  1  464 ? 33.252  59.230  3.143   1.00 20.34  ? 464  ARG A CA    1 
ATOM   3442  C  C     . ARG A  1  464 ? 32.793  59.322  4.617   1.00 21.45  ? 464  ARG A C     1 
ATOM   3443  O  O     . ARG A  1  464 ? 33.540  59.707  5.518   1.00 15.68  ? 464  ARG A O     1 
ATOM   3444  C  CB    . ARG A  1  464 ? 33.681  57.799  2.805   1.00 19.85  ? 464  ARG A CB    1 
ATOM   3445  C  CG    . ARG A  1  464 ? 34.741  57.238  3.710   1.00 25.55  ? 464  ARG A CG    1 
ATOM   3446  C  CD    . ARG A  1  464 ? 35.265  55.929  3.157   1.00 26.18  ? 464  ARG A CD    1 
ATOM   3447  N  NE    . ARG A  1  464 ? 34.262  54.871  3.181   1.00 29.58  ? 464  ARG A NE    1 
ATOM   3448  C  CZ    . ARG A  1  464 ? 34.331  53.771  2.435   1.00 33.76  ? 464  ARG A CZ    1 
ATOM   3449  N  NH1   . ARG A  1  464 ? 35.365  53.601  1.607   1.00 30.89  ? 464  ARG A NH1   1 
ATOM   3450  N  NH2   . ARG A  1  464 ? 33.372  52.840  2.516   1.00 34.44  ? 464  ARG A NH2   1 
ATOM   3451  N  N     . THR A  1  465 ? 31.531  58.985  4.818   1.00 19.15  ? 465  THR A N     1 
ATOM   3452  C  CA    . THR A  1  465 ? 30.904  59.022  6.102   1.00 19.53  ? 465  THR A CA    1 
ATOM   3453  C  C     . THR A  1  465 ? 31.717  58.415  7.245   1.00 17.87  ? 465  THR A C     1 
ATOM   3454  O  O     . THR A  1  465 ? 31.890  59.040  8.275   1.00 21.33  ? 465  THR A O     1 
ATOM   3455  C  CB    . THR A  1  465 ? 29.549  58.302  6.024   1.00 21.66  ? 465  THR A CB    1 
ATOM   3456  O  OG1   . THR A  1  465 ? 28.740  58.919  5.007   1.00 20.48  ? 465  THR A OG1   1 
ATOM   3457  C  CG2   . THR A  1  465 ? 28.837  58.386  7.377   1.00 15.50  ? 465  THR A CG2   1 
ATOM   3458  N  N     . SER A  1  466 ? 32.216  57.205  7.074   1.00 18.09  ? 466  SER A N     1 
ATOM   3459  C  CA    . SER A  1  466 ? 32.973  56.569  8.154   1.00 21.76  ? 466  SER A CA    1 
ATOM   3460  C  C     . SER A  1  466 ? 34.233  57.340  8.508   1.00 22.74  ? 466  SER A C     1 
ATOM   3461  O  O     . SER A  1  466 ? 34.702  57.285  9.647   1.00 25.12  ? 466  SER A O     1 
ATOM   3462  C  CB    . SER A  1  466 ? 33.326  55.129  7.770   1.00 14.42  ? 466  SER A CB    1 
ATOM   3463  O  OG    . SER A  1  466 ? 34.187  55.127  6.654   1.00 21.46  ? 466  SER A OG    1 
ATOM   3464  N  N     . GLU A  1  467 ? 34.784  58.062  7.541   1.00 22.92  ? 467  GLU A N     1 
ATOM   3465  C  CA    . GLU A  1  467 ? 35.985  58.842  7.798   1.00 25.67  ? 467  GLU A CA    1 
ATOM   3466  C  C     . GLU A  1  467 ? 35.660  60.050  8.663   1.00 22.72  ? 467  GLU A C     1 
ATOM   3467  O  O     . GLU A  1  467 ? 36.352  60.342  9.654   1.00 20.39  ? 467  GLU A O     1 
ATOM   3468  C  CB    . GLU A  1  467 ? 36.587  59.320  6.496   1.00 33.11  ? 467  GLU A CB    1 
ATOM   3469  C  CG    . GLU A  1  467 ? 37.795  60.226  6.682   1.00 45.84  ? 467  GLU A CG    1 
ATOM   3470  C  CD    . GLU A  1  467 ? 38.536  60.482  5.358   1.00 54.05  ? 467  GLU A CD    1 
ATOM   3471  O  OE1   . GLU A  1  467 ? 38.939  59.485  4.707   1.00 56.34  ? 467  GLU A OE1   1 
ATOM   3472  O  OE2   . GLU A  1  467 ? 38.713  61.665  4.970   1.00 56.53  ? 467  GLU A OE2   1 
ATOM   3473  N  N     . ALA A  1  468 ? 34.595  60.754  8.305   1.00 20.58  ? 468  ALA A N     1 
ATOM   3474  C  CA    . ALA A  1  468 ? 34.231  61.936  9.080   1.00 22.34  ? 468  ALA A CA    1 
ATOM   3475  C  C     . ALA A  1  468 ? 33.711  61.525  10.470  1.00 19.94  ? 468  ALA A C     1 
ATOM   3476  O  O     . ALA A  1  468 ? 33.948  62.236  11.449  1.00 19.68  ? 468  ALA A O     1 
ATOM   3477  C  CB    . ALA A  1  468 ? 33.182  62.745  8.350   1.00 23.54  ? 468  ALA A CB    1 
ATOM   3478  N  N     . ARG A  1  469 ? 33.006  60.393  10.565  1.00 19.03  ? 469  ARG A N     1 
ATOM   3479  C  CA    . ARG A  1  469 ? 32.496  59.969  11.882  1.00 22.35  ? 469  ARG A CA    1 
ATOM   3480  C  C     . ARG A  1  469 ? 33.678  59.617  12.783  1.00 20.81  ? 469  ARG A C     1 
ATOM   3481  O  O     . ARG A  1  469 ? 33.737  60.002  13.946  1.00 24.58  ? 469  ARG A O     1 
ATOM   3482  C  CB    . ARG A  1  469 ? 31.554  58.762  11.779  1.00 19.69  ? 469  ARG A CB    1 
ATOM   3483  C  CG    . ARG A  1  469 ? 31.153  58.231  13.158  1.00 22.99  ? 469  ARG A CG    1 
ATOM   3484  C  CD    . ARG A  1  469 ? 30.885  56.741  13.098  1.00 31.50  ? 469  ARG A CD    1 
ATOM   3485  N  NE    . ARG A  1  469 ? 29.891  56.528  12.085  1.00 31.36  ? 469  ARG A NE    1 
ATOM   3486  C  CZ    . ARG A  1  469 ? 29.993  55.696  11.054  1.00 21.36  ? 469  ARG A CZ    1 
ATOM   3487  N  NH1   . ARG A  1  469 ? 31.057  54.934  10.853  1.00 19.80  ? 469  ARG A NH1   1 
ATOM   3488  N  NH2   . ARG A  1  469 ? 28.995  55.688  10.193  1.00 26.78  ? 469  ARG A NH2   1 
ATOM   3489  N  N     . LEU A  1  470 ? 34.630  58.873  12.256  1.00 23.69  ? 470  LEU A N     1 
ATOM   3490  C  CA    . LEU A  1  470 ? 35.788  58.535  13.075  1.00 23.87  ? 470  LEU A CA    1 
ATOM   3491  C  C     . LEU A  1  470 ? 36.485  59.822  13.559  1.00 22.51  ? 470  LEU A C     1 
ATOM   3492  O  O     . LEU A  1  470 ? 36.870  59.923  14.739  1.00 23.16  ? 470  LEU A O     1 
ATOM   3493  C  CB    . LEU A  1  470 ? 36.758  57.647  12.305  1.00 22.90  ? 470  LEU A CB    1 
ATOM   3494  C  CG    . LEU A  1  470 ? 37.939  57.150  13.154  1.00 29.58  ? 470  LEU A CG    1 
ATOM   3495  C  CD1   . LEU A  1  470 ? 37.435  56.236  14.307  1.00 23.36  ? 470  LEU A CD1   1 
ATOM   3496  C  CD2   . LEU A  1  470 ? 38.913  56.407  12.253  1.00 25.66  ? 470  LEU A CD2   1 
ATOM   3497  N  N     . ASN A  1  471 ? 36.638  60.799  12.674  1.00 20.52  ? 471  ASN A N     1 
ATOM   3498  C  CA    . ASN A  1  471 ? 37.244  62.097  13.056  1.00 21.92  ? 471  ASN A CA    1 
ATOM   3499  C  C     . ASN A  1  471 ? 36.499  62.729  14.220  1.00 22.58  ? 471  ASN A C     1 
ATOM   3500  O  O     . ASN A  1  471 ? 37.104  63.230  15.195  1.00 20.33  ? 471  ASN A O     1 
ATOM   3501  C  CB    . ASN A  1  471 ? 37.209  63.120  11.894  1.00 25.71  ? 471  ASN A CB    1 
ATOM   3502  C  CG    . ASN A  1  471 ? 38.218  62.797  10.802  1.00 37.77  ? 471  ASN A CG    1 
ATOM   3503  O  OD1   . ASN A  1  471 ? 39.270  62.194  11.074  1.00 37.78  ? 471  ASN A OD1   1 
ATOM   3504  N  ND2   . ASN A  1  471 ? 37.917  63.202  9.559   1.00 38.80  ? 471  ASN A ND2   1 
ATOM   3505  N  N     . MET A  1  472 ? 35.170  62.745  14.106  1.00 20.01  ? 472  MET A N     1 
ATOM   3506  C  CA    . MET A  1  472 ? 34.360  63.314  15.165  1.00 18.05  ? 472  MET A CA    1 
ATOM   3507  C  C     . MET A  1  472 ? 34.562  62.549  16.485  1.00 16.43  ? 472  MET A C     1 
ATOM   3508  O  O     . MET A  1  472 ? 34.788  63.154  17.532  1.00 18.84  ? 472  MET A O     1 
ATOM   3509  C  CB    . MET A  1  472 ? 32.897  63.273  14.769  1.00 15.77  ? 472  MET A CB    1 
ATOM   3510  C  CG    . MET A  1  472 ? 31.945  63.541  15.948  1.00 23.74  ? 472  MET A CG    1 
ATOM   3511  S  SD    . MET A  1  472 ? 30.235  63.166  15.520  1.00 22.79  ? 472  MET A SD    1 
ATOM   3512  C  CE    . MET A  1  472 ? 30.308  61.287  15.377  1.00 20.20  ? 472  MET A CE    1 
ATOM   3513  N  N     . GLN A  1  473 ? 34.495  61.221  16.429  1.00 15.95  ? 473  GLN A N     1 
ATOM   3514  C  CA    . GLN A  1  473 ? 34.628  60.414  17.640  1.00 18.99  ? 473  GLN A CA    1 
ATOM   3515  C  C     . GLN A  1  473 ? 35.979  60.553  18.311  1.00 22.09  ? 473  GLN A C     1 
ATOM   3516  O  O     . GLN A  1  473 ? 36.063  60.579  19.532  1.00 23.04  ? 473  GLN A O     1 
ATOM   3517  C  CB    . GLN A  1  473 ? 34.332  58.941  17.330  1.00 21.30  ? 473  GLN A CB    1 
ATOM   3518  C  CG    . GLN A  1  473 ? 32.860  58.729  16.845  1.00 17.64  ? 473  GLN A CG    1 
ATOM   3519  C  CD    . GLN A  1  473 ? 32.619  57.299  16.385  1.00 21.02  ? 473  GLN A CD    1 
ATOM   3520  O  OE1   . GLN A  1  473 ? 33.513  56.660  15.816  1.00 19.11  ? 473  GLN A OE1   1 
ATOM   3521  N  NE2   . GLN A  1  473 ? 31.405  56.792  16.609  1.00 23.50  ? 473  GLN A NE2   1 
ATOM   3522  N  N     . LYS A  1  474 ? 37.044  60.647  17.525  1.00 23.06  ? 474  LYS A N     1 
ATOM   3523  C  CA    . LYS A  1  474 ? 38.369  60.806  18.119  1.00 24.17  ? 474  LYS A CA    1 
ATOM   3524  C  C     . LYS A  1  474 ? 38.549  62.192  18.713  1.00 21.75  ? 474  LYS A C     1 
ATOM   3525  O  O     . LYS A  1  474 ? 39.164  62.342  19.749  1.00 24.20  ? 474  LYS A O     1 
ATOM   3526  C  CB    . LYS A  1  474 ? 39.454  60.518  17.073  1.00 26.60  ? 474  LYS A CB    1 
ATOM   3527  C  CG    . LYS A  1  474 ? 39.560  59.029  16.776  1.00 29.78  ? 474  LYS A CG    1 
ATOM   3528  C  CD    . LYS A  1  474 ? 40.754  58.705  15.902  1.00 35.09  ? 474  LYS A CD    1 
ATOM   3529  C  CE    . LYS A  1  474 ? 40.841  57.210  15.672  1.00 35.49  ? 474  LYS A CE    1 
ATOM   3530  N  NZ    . LYS A  1  474 ? 41.962  56.904  14.756  1.00 42.22  ? 474  LYS A NZ    1 
ATOM   3531  N  N     . THR A  1  475 ? 37.989  63.209  18.083  1.00 20.59  ? 475  THR A N     1 
ATOM   3532  C  CA    . THR A  1  475 ? 38.101  64.566  18.618  1.00 20.73  ? 475  THR A CA    1 
ATOM   3533  C  C     . THR A  1  475 ? 37.438  64.628  19.990  1.00 21.55  ? 475  THR A C     1 
ATOM   3534  O  O     . THR A  1  475 ? 38.032  65.086  20.951  1.00 21.23  ? 475  THR A O     1 
ATOM   3535  C  CB    . THR A  1  475 ? 37.407  65.565  17.679  1.00 23.77  ? 475  THR A CB    1 
ATOM   3536  O  OG1   . THR A  1  475 ? 38.046  65.499  16.409  1.00 23.72  ? 475  THR A OG1   1 
ATOM   3537  C  CG2   . THR A  1  475 ? 37.492  67.005  18.213  1.00 24.50  ? 475  THR A CG2   1 
ATOM   3538  N  N     . MET A  1  476 ? 36.186  64.171  20.072  1.00 21.90  ? 476  MET A N     1 
ATOM   3539  C  CA    . MET A  1  476 ? 35.462  64.158  21.340  1.00 18.12  ? 476  MET A CA    1 
ATOM   3540  C  C     . MET A  1  476 ? 36.175  63.322  22.400  1.00 17.23  ? 476  MET A C     1 
ATOM   3541  O  O     . MET A  1  476 ? 36.216  63.680  23.573  1.00 17.90  ? 476  MET A O     1 
ATOM   3542  C  CB    . MET A  1  476 ? 34.052  63.552  21.160  1.00 17.21  ? 476  MET A CB    1 
ATOM   3543  C  CG    . MET A  1  476 ? 33.106  64.314  20.247  1.00 12.27  ? 476  MET A CG    1 
ATOM   3544  S  SD    . MET A  1  476 ? 32.880  65.977  20.781  1.00 21.45  ? 476  MET A SD    1 
ATOM   3545  C  CE    . MET A  1  476 ? 31.825  65.754  22.274  1.00 15.28  ? 476  MET A CE    1 
ATOM   3546  N  N     . GLN A  1  477 ? 36.711  62.180  22.000  1.00 18.56  ? 477  GLN A N     1 
ATOM   3547  C  CA    . GLN A  1  477 ? 37.359  61.331  22.981  1.00 21.88  ? 477  GLN A CA    1 
ATOM   3548  C  C     . GLN A  1  477 ? 38.568  62.016  23.568  1.00 19.99  ? 477  GLN A C     1 
ATOM   3549  O  O     . GLN A  1  477 ? 38.806  61.958  24.759  1.00 24.89  ? 477  GLN A O     1 
ATOM   3550  C  CB    . GLN A  1  477 ? 37.797  59.997  22.375  1.00 20.09  ? 477  GLN A CB    1 
ATOM   3551  C  CG    . GLN A  1  477 ? 38.108  58.950  23.443  1.00 21.45  ? 477  GLN A CG    1 
ATOM   3552  C  CD    . GLN A  1  477 ? 36.829  58.413  24.092  1.00 20.98  ? 477  GLN A CD    1 
ATOM   3553  O  OE1   . GLN A  1  477 ? 35.878  58.085  23.397  1.00 24.93  ? 477  GLN A OE1   1 
ATOM   3554  N  NE2   . GLN A  1  477 ? 36.804  58.324  25.421  1.00 18.86  ? 477  GLN A NE2   1 
ATOM   3555  N  N     . SER A  1  478 ? 39.327  62.693  22.740  1.00 22.49  ? 478  SER A N     1 
ATOM   3556  C  CA    . SER A  1  478 ? 40.516  63.321  23.271  1.00 26.27  ? 478  SER A CA    1 
ATOM   3557  C  C     . SER A  1  478 ? 40.418  64.798  23.642  1.00 26.56  ? 478  SER A C     1 
ATOM   3558  O  O     . SER A  1  478 ? 41.381  65.359  24.169  1.00 33.10  ? 478  SER A O     1 
ATOM   3559  C  CB    . SER A  1  478 ? 41.687  63.063  22.330  1.00 26.03  ? 478  SER A CB    1 
ATOM   3560  O  OG    . SER A  1  478 ? 41.434  63.612  21.073  1.00 36.46  ? 478  SER A OG    1 
ATOM   3561  N  N     . HIS A  1  479 ? 39.280  65.433  23.404  1.00 21.96  ? 479  HIS A N     1 
ATOM   3562  C  CA    . HIS A  1  479 ? 39.142  66.845  23.786  1.00 23.59  ? 479  HIS A CA    1 
ATOM   3563  C  C     . HIS A  1  479 ? 38.003  67.144  24.772  1.00 24.53  ? 479  HIS A C     1 
ATOM   3564  O  O     . HIS A  1  479 ? 37.875  68.274  25.220  1.00 22.21  ? 479  HIS A O     1 
ATOM   3565  C  CB    . HIS A  1  479 ? 38.971  67.724  22.545  1.00 24.73  ? 479  HIS A CB    1 
ATOM   3566  C  CG    . HIS A  1  479 ? 40.208  67.802  21.695  1.00 28.57  ? 479  HIS A CG    1 
ATOM   3567  N  ND1   . HIS A  1  479 ? 41.184  68.752  21.894  1.00 32.00  ? 479  HIS A ND1   1 
ATOM   3568  C  CD2   . HIS A  1  479 ? 40.659  67.005  20.691  1.00 23.98  ? 479  HIS A CD2   1 
ATOM   3569  C  CE1   . HIS A  1  479 ? 42.183  68.542  21.051  1.00 31.58  ? 479  HIS A CE1   1 
ATOM   3570  N  NE2   . HIS A  1  479 ? 41.889  67.487  20.311  1.00 29.51  ? 479  HIS A NE2   1 
ATOM   3571  N  N     . ALA A  1  480 ? 37.181  66.143  25.108  1.00 21.43  ? 480  ALA A N     1 
ATOM   3572  C  CA    . ALA A  1  480 ? 36.071  66.358  26.044  1.00 21.36  ? 480  ALA A CA    1 
ATOM   3573  C  C     . ALA A  1  480 ? 35.831  65.119  26.895  1.00 22.12  ? 480  ALA A C     1 
ATOM   3574  O  O     . ALA A  1  480 ? 34.697  64.632  27.000  1.00 22.27  ? 480  ALA A O     1 
ATOM   3575  C  CB    . ALA A  1  480 ? 34.806  66.707  25.284  1.00 15.52  ? 480  ALA A CB    1 
ATOM   3576  N  N     . ALA A  1  481 ? 36.900  64.634  27.509  1.00 21.78  ? 481  ALA A N     1 
ATOM   3577  C  CA    . ALA A  1  481 ? 36.865  63.422  28.346  1.00 22.23  ? 481  ALA A CA    1 
ATOM   3578  C  C     . ALA A  1  481 ? 36.621  63.704  29.841  1.00 20.28  ? 481  ALA A C     1 
ATOM   3579  O  O     . ALA A  1  481 ? 36.077  64.740  30.209  1.00 21.14  ? 481  ALA A O     1 
ATOM   3580  C  CB    . ALA A  1  481 ? 38.174  62.655  28.172  1.00 23.82  ? 481  ALA A CB    1 
ATOM   3581  N  N     . VAL A  1  482 ? 37.031  62.777  30.700  1.00 16.03  ? 482  VAL A N     1 
ATOM   3582  C  CA    . VAL A  1  482 ? 36.787  62.930  32.136  1.00 17.66  ? 482  VAL A CA    1 
ATOM   3583  C  C     . VAL A  1  482 ? 37.296  64.236  32.745  1.00 17.46  ? 482  VAL A C     1 
ATOM   3584  O  O     . VAL A  1  482 ? 36.574  64.861  33.524  1.00 16.86  ? 482  VAL A O     1 
ATOM   3585  C  CB    . VAL A  1  482 ? 37.321  61.696  32.912  1.00 18.26  ? 482  VAL A CB    1 
ATOM   3586  C  CG1   . VAL A  1  482 ? 37.116  61.885  34.418  1.00 20.46  ? 482  VAL A CG1   1 
ATOM   3587  C  CG2   . VAL A  1  482 ? 36.552  60.419  32.432  1.00 19.07  ? 482  VAL A CG2   1 
ATOM   3588  N  N     . PHE A  1  483 ? 38.532  64.633  32.417  1.00 22.60  ? 483  PHE A N     1 
ATOM   3589  C  CA    . PHE A  1  483 ? 39.104  65.906  32.897  1.00 22.38  ? 483  PHE A CA    1 
ATOM   3590  C  C     . PHE A  1  483 ? 39.220  66.775  31.659  1.00 20.32  ? 483  PHE A C     1 
ATOM   3591  O  O     . PHE A  1  483 ? 39.587  66.289  30.591  1.00 22.66  ? 483  PHE A O     1 
ATOM   3592  C  CB    . PHE A  1  483 ? 40.478  65.689  33.564  1.00 20.21  ? 483  PHE A CB    1 
ATOM   3593  C  CG    . PHE A  1  483 ? 40.382  65.155  34.964  1.00 17.58  ? 483  PHE A CG    1 
ATOM   3594  C  CD1   . PHE A  1  483 ? 39.968  65.972  36.003  1.00 18.81  ? 483  PHE A CD1   1 
ATOM   3595  C  CD2   . PHE A  1  483 ? 40.706  63.831  35.242  1.00 18.38  ? 483  PHE A CD2   1 
ATOM   3596  C  CE1   . PHE A  1  483 ? 39.877  65.489  37.302  1.00 15.66  ? 483  PHE A CE1   1 
ATOM   3597  C  CE2   . PHE A  1  483 ? 40.623  63.334  36.530  1.00 19.06  ? 483  PHE A CE2   1 
ATOM   3598  C  CZ    . PHE A  1  483 ? 40.208  64.162  37.564  1.00 17.15  ? 483  PHE A CZ    1 
ATOM   3599  N  N     . ARG A  1  484 ? 38.891  68.051  31.793  1.00 20.21  ? 484  ARG A N     1 
ATOM   3600  C  CA    . ARG A  1  484 ? 38.907  68.965  30.661  1.00 20.83  ? 484  ARG A CA    1 
ATOM   3601  C  C     . ARG A  1  484 ? 39.629  70.260  30.999  1.00 24.26  ? 484  ARG A C     1 
ATOM   3602  O  O     . ARG A  1  484 ? 39.788  70.605  32.159  1.00 20.70  ? 484  ARG A O     1 
ATOM   3603  C  CB    . ARG A  1  484 ? 37.457  69.321  30.272  1.00 24.20  ? 484  ARG A CB    1 
ATOM   3604  C  CG    . ARG A  1  484 ? 36.637  68.167  29.658  1.00 23.10  ? 484  ARG A CG    1 
ATOM   3605  C  CD    . ARG A  1  484 ? 35.110  68.378  29.817  1.00 19.34  ? 484  ARG A CD    1 
ATOM   3606  N  NE    . ARG A  1  484 ? 34.412  67.167  29.375  1.00 21.63  ? 484  ARG A NE    1 
ATOM   3607  C  CZ    . ARG A  1  484 ? 33.086  67.025  29.322  1.00 25.51  ? 484  ARG A CZ    1 
ATOM   3608  N  NH1   . ARG A  1  484 ? 32.275  68.026  29.698  1.00 18.55  ? 484  ARG A NH1   1 
ATOM   3609  N  NH2   . ARG A  1  484 ? 32.573  65.889  28.858  1.00 20.30  ? 484  ARG A NH2   1 
ATOM   3610  N  N     . THR A  1  485 ? 40.064  70.982  29.975  1.00 23.08  ? 485  THR A N     1 
ATOM   3611  C  CA    . THR A  1  485 ? 40.716  72.253  30.193  1.00 22.77  ? 485  THR A CA    1 
ATOM   3612  C  C     . THR A  1  485 ? 40.431  73.178  29.023  1.00 22.79  ? 485  THR A C     1 
ATOM   3613  O  O     . THR A  1  485 ? 40.212  72.733  27.894  1.00 22.45  ? 485  THR A O     1 
ATOM   3614  C  CB    . THR A  1  485 ? 42.227  72.115  30.353  1.00 25.64  ? 485  THR A CB    1 
ATOM   3615  O  OG1   . THR A  1  485 ? 42.686  73.241  31.097  1.00 34.31  ? 485  THR A OG1   1 
ATOM   3616  C  CG2   . THR A  1  485 ? 42.937  72.140  29.004  1.00 25.88  ? 485  THR A CG2   1 
ATOM   3617  N  N     . GLY A  1  486 ? 40.454  74.467  29.316  1.00 25.09  ? 486  GLY A N     1 
ATOM   3618  C  CA    . GLY A  1  486 ? 40.149  75.484  28.339  1.00 24.54  ? 486  GLY A CA    1 
ATOM   3619  C  C     . GLY A  1  486 ? 40.801  75.411  26.985  1.00 24.78  ? 486  GLY A C     1 
ATOM   3620  O  O     . GLY A  1  486 ? 40.113  75.508  25.971  1.00 25.19  ? 486  GLY A O     1 
ATOM   3621  N  N     . SER A  1  487 ? 42.107  75.226  26.943  1.00 24.54  ? 487  SER A N     1 
ATOM   3622  C  CA    . SER A  1  487 ? 42.765  75.185  25.659  1.00 28.34  ? 487  SER A CA    1 
ATOM   3623  C  C     . SER A  1  487 ? 42.486  73.900  24.872  1.00 28.85  ? 487  SER A C     1 
ATOM   3624  O  O     . SER A  1  487 ? 42.438  73.918  23.640  1.00 28.32  ? 487  SER A O     1 
ATOM   3625  C  CB    . SER A  1  487 ? 44.277  75.402  25.839  1.00 31.75  ? 487  SER A CB    1 
ATOM   3626  O  OG    . SER A  1  487 ? 44.863  74.372  26.622  1.00 38.99  ? 487  SER A OG    1 
ATOM   3627  N  N     . ILE A  1  488 ? 42.309  72.780  25.561  1.00 28.74  ? 488  ILE A N     1 
ATOM   3628  C  CA    . ILE A  1  488 ? 42.020  71.542  24.841  1.00 27.41  ? 488  ILE A CA    1 
ATOM   3629  C  C     . ILE A  1  488 ? 40.583  71.595  24.313  1.00 26.11  ? 488  ILE A C     1 
ATOM   3630  O  O     . ILE A  1  488 ? 40.313  71.202  23.159  1.00 28.80  ? 488  ILE A O     1 
ATOM   3631  C  CB    . ILE A  1  488 ? 42.256  70.312  25.753  1.00 31.06  ? 488  ILE A CB    1 
ATOM   3632  C  CG1   . ILE A  1  488 ? 43.749  70.243  26.107  1.00 29.49  ? 488  ILE A CG1   1 
ATOM   3633  C  CG2   . ILE A  1  488 ? 41.811  69.006  25.044  1.00 25.70  ? 488  ILE A CG2   1 
ATOM   3634  C  CD1   . ILE A  1  488 ? 44.105  69.144  27.069  1.00 27.24  ? 488  ILE A CD1   1 
ATOM   3635  N  N     . LEU A  1  489 ? 39.666  72.116  25.128  1.00 25.11  ? 489  LEU A N     1 
ATOM   3636  C  CA    . LEU A  1  489 ? 38.273  72.273  24.682  1.00 24.08  ? 489  LEU A CA    1 
ATOM   3637  C  C     . LEU A  1  489 ? 38.231  73.156  23.420  1.00 27.85  ? 489  LEU A C     1 
ATOM   3638  O  O     . LEU A  1  489 ? 37.519  72.859  22.462  1.00 27.22  ? 489  LEU A O     1 
ATOM   3639  C  CB    . LEU A  1  489 ? 37.429  72.937  25.765  1.00 21.01  ? 489  LEU A CB    1 
ATOM   3640  C  CG    . LEU A  1  489 ? 37.171  72.021  26.960  1.00 25.94  ? 489  LEU A CG    1 
ATOM   3641  C  CD1   . LEU A  1  489 ? 36.682  72.806  28.157  1.00 19.78  ? 489  LEU A CD1   1 
ATOM   3642  C  CD2   . LEU A  1  489 ? 36.171  70.941  26.537  1.00 21.87  ? 489  LEU A CD2   1 
ATOM   3643  N  N     . GLN A  1  490 ? 38.992  74.253  23.434  1.00 29.88  ? 490  GLN A N     1 
ATOM   3644  C  CA    . GLN A  1  490 ? 39.005  75.179  22.304  1.00 28.29  ? 490  GLN A CA    1 
ATOM   3645  C  C     . GLN A  1  490 ? 39.557  74.559  21.052  1.00 25.65  ? 490  GLN A C     1 
ATOM   3646  O  O     . GLN A  1  490 ? 39.042  74.794  19.966  1.00 27.14  ? 490  GLN A O     1 
ATOM   3647  C  CB    . GLN A  1  490 ? 39.785  76.446  22.657  1.00 27.43  ? 490  GLN A CB    1 
ATOM   3648  C  CG    . GLN A  1  490 ? 39.191  77.198  23.836  1.00 29.40  ? 490  GLN A CG    1 
ATOM   3649  C  CD    . GLN A  1  490 ? 39.874  78.533  24.122  1.00 38.07  ? 490  GLN A CD    1 
ATOM   3650  O  OE1   . GLN A  1  490 ? 41.104  78.646  24.068  1.00 42.98  ? 490  GLN A OE1   1 
ATOM   3651  N  NE2   . GLN A  1  490 ? 39.075  79.546  24.448  1.00 38.78  ? 490  GLN A NE2   1 
ATOM   3652  N  N     . GLU A  1  491 ? 40.605  73.764  21.168  1.00 25.02  ? 491  GLU A N     1 
ATOM   3653  C  CA    . GLU A  1  491 ? 41.106  73.142  19.965  1.00 28.16  ? 491  GLU A CA    1 
ATOM   3654  C  C     . GLU A  1  491 ? 40.069  72.129  19.473  1.00 26.55  ? 491  GLU A C     1 
ATOM   3655  O  O     . GLU A  1  491 ? 39.874  71.961  18.282  1.00 24.56  ? 491  GLU A O     1 
ATOM   3656  C  CB    . GLU A  1  491 ? 42.425  72.452  20.213  1.00 30.87  ? 491  GLU A CB    1 
ATOM   3657  C  CG    . GLU A  1  491 ? 42.894  71.674  19.007  1.00 42.40  ? 491  GLU A CG    1 
ATOM   3658  C  CD    . GLU A  1  491 ? 44.263  71.056  19.233  1.00 51.14  ? 491  GLU A CD    1 
ATOM   3659  O  OE1   . GLU A  1  491 ? 44.611  70.816  20.419  1.00 56.45  ? 491  GLU A OE1   1 
ATOM   3660  O  OE2   . GLU A  1  491 ? 44.983  70.807  18.232  1.00 53.79  ? 491  GLU A OE2   1 
ATOM   3661  N  N     . GLY A  1  492 ? 39.402  71.460  20.408  1.00 30.14  ? 492  GLY A N     1 
ATOM   3662  C  CA    . GLY A  1  492 ? 38.385  70.491  20.025  1.00 27.32  ? 492  GLY A CA    1 
ATOM   3663  C  C     . GLY A  1  492 ? 37.245  71.185  19.313  1.00 22.27  ? 492  GLY A C     1 
ATOM   3664  O  O     . GLY A  1  492 ? 36.728  70.664  18.336  1.00 20.89  ? 492  GLY A O     1 
ATOM   3665  N  N     . CYS A  1  493 ? 36.853  72.363  19.800  1.00 21.55  ? 493  CYS A N     1 
ATOM   3666  C  CA    . CYS A  1  493 ? 35.760  73.115  19.177  1.00 25.86  ? 493  CYS A CA    1 
ATOM   3667  C  C     . CYS A  1  493 ? 36.104  73.461  17.733  1.00 27.20  ? 493  CYS A C     1 
ATOM   3668  O  O     . CYS A  1  493 ? 35.271  73.362  16.835  1.00 27.28  ? 493  CYS A O     1 
ATOM   3669  C  CB    . CYS A  1  493 ? 35.487  74.445  19.912  1.00 23.30  ? 493  CYS A CB    1 
ATOM   3670  S  SG    . CYS A  1  493 ? 34.694  74.352  21.532  1.00 29.68  ? 493  CYS A SG    1 
ATOM   3671  N  N     . GLU A  1  494 ? 37.332  73.899  17.512  1.00 30.55  ? 494  GLU A N     1 
ATOM   3672  C  CA    . GLU A  1  494 ? 37.705  74.294  16.167  1.00 32.78  ? 494  GLU A CA    1 
ATOM   3673  C  C     . GLU A  1  494 ? 37.816  73.082  15.271  1.00 29.61  ? 494  GLU A C     1 
ATOM   3674  O  O     . GLU A  1  494 ? 37.455  73.129  14.106  1.00 27.88  ? 494  GLU A O     1 
ATOM   3675  C  CB    . GLU A  1  494 ? 38.980  75.133  16.188  1.00 35.89  ? 494  GLU A CB    1 
ATOM   3676  C  CG    . GLU A  1  494 ? 38.698  76.550  16.732  1.00 48.07  ? 494  GLU A CG    1 
ATOM   3677  C  CD    . GLU A  1  494 ? 37.313  77.116  16.278  1.00 57.62  ? 494  GLU A CD    1 
ATOM   3678  O  OE1   . GLU A  1  494 ? 37.109  77.362  15.052  1.00 54.08  ? 494  GLU A OE1   1 
ATOM   3679  O  OE2   . GLU A  1  494 ? 36.423  77.304  17.160  1.00 60.42  ? 494  GLU A OE2   1 
ATOM   3680  N  N     . LYS A  1  495 ? 38.283  71.983  15.835  1.00 29.03  ? 495  LYS A N     1 
ATOM   3681  C  CA    . LYS A  1  495 ? 38.363  70.746  15.077  1.00 29.96  ? 495  LYS A CA    1 
ATOM   3682  C  C     . LYS A  1  495 ? 36.967  70.302  14.639  1.00 27.42  ? 495  LYS A C     1 
ATOM   3683  O  O     . LYS A  1  495 ? 36.767  69.962  13.473  1.00 26.31  ? 495  LYS A O     1 
ATOM   3684  C  CB    . LYS A  1  495 ? 39.015  69.653  15.910  1.00 33.04  ? 495  LYS A CB    1 
ATOM   3685  C  CG    . LYS A  1  495 ? 40.531  69.767  15.980  1.00 32.21  ? 495  LYS A CG    1 
ATOM   3686  C  CD    . LYS A  1  495 ? 41.087  68.461  16.501  1.00 35.46  ? 495  LYS A CD    1 
ATOM   3687  C  CE    . LYS A  1  495 ? 42.567  68.522  16.729  1.00 41.03  ? 495  LYS A CE    1 
ATOM   3688  N  NZ    . LYS A  1  495 ? 43.003  67.305  17.461  1.00 45.75  ? 495  LYS A NZ    1 
ATOM   3689  N  N     . LEU A  1  496 ? 35.998  70.319  15.557  1.00 26.17  ? 496  LEU A N     1 
ATOM   3690  C  CA    . LEU A  1  496 ? 34.623  69.904  15.213  1.00 25.86  ? 496  LEU A CA    1 
ATOM   3691  C  C     . LEU A  1  496 ? 33.969  70.830  14.202  1.00 23.76  ? 496  LEU A C     1 
ATOM   3692  O  O     . LEU A  1  496 ? 33.240  70.381  13.335  1.00 22.55  ? 496  LEU A O     1 
ATOM   3693  C  CB    . LEU A  1  496 ? 33.720  69.842  16.437  1.00 24.49  ? 496  LEU A CB    1 
ATOM   3694  C  CG    . LEU A  1  496 ? 33.791  68.598  17.298  1.00 31.95  ? 496  LEU A CG    1 
ATOM   3695  C  CD1   . LEU A  1  496 ? 32.625  68.639  18.270  1.00 30.97  ? 496  LEU A CD1   1 
ATOM   3696  C  CD2   . LEU A  1  496 ? 33.695  67.333  16.416  1.00 28.54  ? 496  LEU A CD2   1 
ATOM   3697  N  N     . SER A  1  497 ? 34.224  72.130  14.333  1.00 23.18  ? 497  SER A N     1 
ATOM   3698  C  CA    . SER A  1  497 ? 33.680  73.109  13.423  1.00 20.97  ? 497  SER A CA    1 
ATOM   3699  C  C     . SER A  1  497 ? 34.168  72.863  12.012  1.00 22.33  ? 497  SER A C     1 
ATOM   3700  O  O     . SER A  1  497 ? 33.407  73.000  11.067  1.00 23.54  ? 497  SER A O     1 
ATOM   3701  C  CB    . SER A  1  497 ? 34.051  74.514  13.865  1.00 21.59  ? 497  SER A CB    1 
ATOM   3702  O  OG    . SER A  1  497 ? 33.284  74.864  14.994  1.00 25.45  ? 497  SER A OG    1 
ATOM   3703  N  N     . GLN A  1  498 ? 35.442  72.517  11.872  1.00 22.80  ? 498  GLN A N     1 
ATOM   3704  C  CA    . GLN A  1  498 ? 36.010  72.202  10.565  1.00 23.40  ? 498  GLN A CA    1 
ATOM   3705  C  C     . GLN A  1  498 ? 35.377  70.892  10.020  1.00 20.06  ? 498  GLN A C     1 
ATOM   3706  O  O     . GLN A  1  498 ? 35.003  70.797  8.841   1.00 20.64  ? 498  GLN A O     1 
ATOM   3707  C  CB    . GLN A  1  498 ? 37.530  72.025  10.701  1.00 25.59  ? 498  GLN A CB    1 
ATOM   3708  C  CG    . GLN A  1  498 ? 38.224  71.675  9.403   1.00 26.21  ? 498  GLN A CG    1 
ATOM   3709  C  CD    . GLN A  1  498 ? 37.958  72.727  8.335   1.00 32.78  ? 498  GLN A CD    1 
ATOM   3710  O  OE1   . GLN A  1  498 ? 37.943  73.937  8.615   1.00 36.66  ? 498  GLN A OE1   1 
ATOM   3711  N  NE2   . GLN A  1  498 ? 37.745  72.277  7.111   1.00 32.96  ? 498  GLN A NE2   1 
ATOM   3712  N  N     . ILE A  1  499 ? 35.272  69.878  10.880  1.00 20.11  ? 499  ILE A N     1 
ATOM   3713  C  CA    . ILE A  1  499 ? 34.687  68.620  10.454  1.00 19.28  ? 499  ILE A CA    1 
ATOM   3714  C  C     . ILE A  1  499 ? 33.256  68.905  10.036  1.00 19.61  ? 499  ILE A C     1 
ATOM   3715  O  O     . ILE A  1  499 ? 32.789  68.388  9.023   1.00 24.52  ? 499  ILE A O     1 
ATOM   3716  C  CB    . ILE A  1  499 ? 34.689  67.564  11.569  1.00 22.57  ? 499  ILE A CB    1 
ATOM   3717  C  CG1   . ILE A  1  499 ? 36.106  67.064  11.823  1.00 22.61  ? 499  ILE A CG1   1 
ATOM   3718  C  CG2   . ILE A  1  499 ? 33.822  66.381  11.181  1.00 20.70  ? 499  ILE A CG2   1 
ATOM   3719  C  CD1   . ILE A  1  499 ? 36.250  66.481  13.276  1.00 25.23  ? 499  ILE A CD1   1 
ATOM   3720  N  N     . TYR A  1  500 ? 32.569  69.766  10.772  1.00 21.07  ? 500  TYR A N     1 
ATOM   3721  C  CA    . TYR A  1  500 ? 31.189  70.081  10.397  1.00 22.90  ? 500  TYR A CA    1 
ATOM   3722  C  C     . TYR A  1  500 ? 31.171  70.741  9.001   1.00 28.73  ? 500  TYR A C     1 
ATOM   3723  O  O     . TYR A  1  500 ? 30.380  70.355  8.148   1.00 31.29  ? 500  TYR A O     1 
ATOM   3724  C  CB    . TYR A  1  500 ? 30.522  71.025  11.392  1.00 20.73  ? 500  TYR A CB    1 
ATOM   3725  C  CG    . TYR A  1  500 ? 29.030  71.155  11.144  1.00 21.22  ? 500  TYR A CG    1 
ATOM   3726  C  CD1   . TYR A  1  500 ? 28.161  70.141  11.528  1.00 21.25  ? 500  TYR A CD1   1 
ATOM   3727  C  CD2   . TYR A  1  500 ? 28.493  72.274  10.522  1.00 22.29  ? 500  TYR A CD2   1 
ATOM   3728  C  CE1   . TYR A  1  500 ? 26.812  70.239  11.310  1.00 23.03  ? 500  TYR A CE1   1 
ATOM   3729  C  CE2   . TYR A  1  500 ? 27.120  72.390  10.293  1.00 23.59  ? 500  TYR A CE2   1 
ATOM   3730  C  CZ    . TYR A  1  500 ? 26.288  71.370  10.692  1.00 26.28  ? 500  TYR A CZ    1 
ATOM   3731  O  OH    . TYR A  1  500 ? 24.926  71.447  10.481  1.00 28.07  ? 500  TYR A OH    1 
ATOM   3732  N  N     . ARG A  1  501 ? 32.029  71.733  8.766   1.00 27.14  ? 501  ARG A N     1 
ATOM   3733  C  CA    . ARG A  1  501 ? 32.064  72.381  7.452   1.00 29.49  ? 501  ARG A CA    1 
ATOM   3734  C  C     . ARG A  1  501 ? 32.410  71.359  6.381   1.00 28.20  ? 501  ARG A C     1 
ATOM   3735  O  O     . ARG A  1  501 ? 31.881  71.405  5.278   1.00 29.83  ? 501  ARG A O     1 
ATOM   3736  C  CB    . ARG A  1  501 ? 33.101  73.508  7.415   1.00 29.67  ? 501  ARG A CB    1 
ATOM   3737  C  CG    . ARG A  1  501 ? 32.678  74.761  8.139   1.00 30.65  ? 501  ARG A CG    1 
ATOM   3738  C  CD    . ARG A  1  501 ? 33.679  75.887  7.887   1.00 38.21  ? 501  ARG A CD    1 
ATOM   3739  N  NE    . ARG A  1  501 ? 34.943  75.685  8.596   1.00 37.12  ? 501  ARG A NE    1 
ATOM   3740  C  CZ    . ARG A  1  501 ? 35.146  76.031  9.868   1.00 38.07  ? 501  ARG A CZ    1 
ATOM   3741  N  NH1   . ARG A  1  501 ? 34.178  76.606  10.570  1.00 34.06  ? 501  ARG A NH1   1 
ATOM   3742  N  NH2   . ARG A  1  501 ? 36.317  75.780  10.446  1.00 38.21  ? 501  ARG A NH2   1 
ATOM   3743  N  N     . ASP A  1  502 ? 33.278  70.410  6.708   1.00 28.73  ? 502  ASP A N     1 
ATOM   3744  C  CA    . ASP A  1  502 ? 33.650  69.417  5.715   1.00 30.71  ? 502  ASP A CA    1 
ATOM   3745  C  C     . ASP A  1  502 ? 32.581  68.382  5.342   1.00 29.09  ? 502  ASP A C     1 
ATOM   3746  O  O     . ASP A  1  502 ? 32.771  67.586  4.436   1.00 28.63  ? 502  ASP A O     1 
ATOM   3747  C  CB    . ASP A  1  502 ? 34.955  68.742  6.131   1.00 37.07  ? 502  ASP A CB    1 
ATOM   3748  C  CG    . ASP A  1  502 ? 36.158  69.651  5.906   1.00 40.38  ? 502  ASP A CG    1 
ATOM   3749  O  OD1   . ASP A  1  502 ? 35.997  70.663  5.172   1.00 47.40  ? 502  ASP A OD1   1 
ATOM   3750  O  OD2   . ASP A  1  502 ? 37.252  69.355  6.438   1.00 40.71  ? 502  ASP A OD2   1 
ATOM   3751  N  N     . LEU A  1  503 ? 31.444  68.401  6.023   1.00 27.48  ? 503  LEU A N     1 
ATOM   3752  C  CA    . LEU A  1  503 ? 30.379  67.482  5.655   1.00 22.81  ? 503  LEU A CA    1 
ATOM   3753  C  C     . LEU A  1  503 ? 29.928  67.851  4.224   1.00 26.63  ? 503  LEU A C     1 
ATOM   3754  O  O     . LEU A  1  503 ? 29.252  67.063  3.559   1.00 25.79  ? 503  LEU A O     1 
ATOM   3755  C  CB    . LEU A  1  503 ? 29.222  67.609  6.622   1.00 20.91  ? 503  LEU A CB    1 
ATOM   3756  C  CG    . LEU A  1  503 ? 29.529  67.126  8.047   1.00 22.12  ? 503  LEU A CG    1 
ATOM   3757  C  CD1   . LEU A  1  503 ? 28.277  67.269  8.903   1.00 21.06  ? 503  LEU A CD1   1 
ATOM   3758  C  CD2   . LEU A  1  503 ? 29.997  65.656  8.012   1.00 19.44  ? 503  LEU A CD2   1 
ATOM   3759  N  N     . ALA A  1  504 ? 30.327  69.033  3.746   1.00 25.48  ? 504  ALA A N     1 
ATOM   3760  C  CA    . ALA A  1  504 ? 29.952  69.461  2.394   1.00 26.39  ? 504  ALA A CA    1 
ATOM   3761  C  C     . ALA A  1  504 ? 30.621  68.556  1.377   1.00 28.91  ? 504  ALA A C     1 
ATOM   3762  O  O     . ALA A  1  504 ? 30.184  68.438  0.225   1.00 32.98  ? 504  ALA A O     1 
ATOM   3763  C  CB    . ALA A  1  504 ? 30.367  70.905  2.155   1.00 25.06  ? 504  ALA A CB    1 
ATOM   3764  N  N     . HIS A  1  505 ? 31.684  67.904  1.814   1.00 26.88  ? 505  HIS A N     1 
ATOM   3765  C  CA    . HIS A  1  505 ? 32.436  67.025  0.958   1.00 26.28  ? 505  HIS A CA    1 
ATOM   3766  C  C     . HIS A  1  505 ? 32.173  65.533  1.175   1.00 26.31  ? 505  HIS A C     1 
ATOM   3767  O  O     . HIS A  1  505 ? 33.011  64.702  0.792   1.00 24.23  ? 505  HIS A O     1 
ATOM   3768  C  CB    . HIS A  1  505 ? 33.920  67.337  1.139   1.00 34.27  ? 505  HIS A CB    1 
ATOM   3769  C  CG    . HIS A  1  505 ? 34.243  68.782  0.943   1.00 40.76  ? 505  HIS A CG    1 
ATOM   3770  N  ND1   . HIS A  1  505 ? 34.025  69.430  -0.256  1.00 45.52  ? 505  HIS A ND1   1 
ATOM   3771  C  CD2   . HIS A  1  505 ? 34.665  69.731  1.813   1.00 43.75  ? 505  HIS A CD2   1 
ATOM   3772  C  CE1   . HIS A  1  505 ? 34.291  70.717  -0.113  1.00 48.81  ? 505  HIS A CE1   1 
ATOM   3773  N  NE2   . HIS A  1  505 ? 34.681  70.926  1.134   1.00 47.78  ? 505  HIS A NE2   1 
ATOM   3774  N  N     . LEU A  1  506 ? 31.006  65.195  1.747   1.00 24.99  ? 506  LEU A N     1 
ATOM   3775  C  CA    . LEU A  1  506 ? 30.659  63.792  2.009   1.00 28.04  ? 506  LEU A CA    1 
ATOM   3776  C  C     . LEU A  1  506 ? 30.572  62.937  0.760   1.00 25.20  ? 506  LEU A C     1 
ATOM   3777  O  O     . LEU A  1  506 ? 30.225  63.419  -0.314  1.00 26.92  ? 506  LEU A O     1 
ATOM   3778  C  CB    . LEU A  1  506 ? 29.342  63.690  2.799   1.00 29.99  ? 506  LEU A CB    1 
ATOM   3779  C  CG    . LEU A  1  506 ? 29.485  63.800  4.329   1.00 31.19  ? 506  LEU A CG    1 
ATOM   3780  C  CD1   . LEU A  1  506 ? 28.125  63.912  5.023   1.00 32.49  ? 506  LEU A CD1   1 
ATOM   3781  C  CD2   . LEU A  1  506 ? 30.205  62.561  4.846   1.00 32.26  ? 506  LEU A CD2   1 
ATOM   3782  N  N     . LYS A  1  507 ? 30.922  61.663  0.907   1.00 27.62  ? 507  LYS A N     1 
ATOM   3783  C  CA    . LYS A  1  507 ? 30.859  60.700  -0.185  1.00 24.87  ? 507  LYS A CA    1 
ATOM   3784  C  C     . LYS A  1  507 ? 30.141  59.429  0.265   1.00 26.81  ? 507  LYS A C     1 
ATOM   3785  O  O     . LYS A  1  507 ? 30.540  58.811  1.267   1.00 28.24  ? 507  LYS A O     1 
ATOM   3786  C  CB    . LYS A  1  507 ? 32.260  60.308  -0.641  1.00 27.10  ? 507  LYS A CB    1 
ATOM   3787  C  CG    . LYS A  1  507 ? 32.227  59.249  -1.740  1.00 30.50  ? 507  LYS A CG    1 
ATOM   3788  C  CD    . LYS A  1  507 ? 33.633  58.936  -2.192  1.00 44.72  ? 507  LYS A CD    1 
ATOM   3789  C  CE    . LYS A  1  507 ? 33.682  57.927  -3.330  1.00 48.77  ? 507  LYS A CE    1 
ATOM   3790  N  NZ    . LYS A  1  507 ? 35.052  57.828  -3.926  1.00 52.81  ? 507  LYS A NZ    1 
ATOM   3791  N  N     . THR A  1  508 ? 29.060  59.060  -0.423  1.00 22.81  ? 508  THR A N     1 
ATOM   3792  C  CA    . THR A  1  508 ? 28.377  57.824  -0.108  1.00 21.86  ? 508  THR A CA    1 
ATOM   3793  C  C     . THR A  1  508 ? 28.497  56.957  -1.352  1.00 25.70  ? 508  THR A C     1 
ATOM   3794  O  O     . THR A  1  508 ? 28.905  57.432  -2.398  1.00 22.17  ? 508  THR A O     1 
ATOM   3795  C  CB    . THR A  1  508 ? 26.882  58.043  0.288   1.00 27.21  ? 508  THR A CB    1 
ATOM   3796  O  OG1   . THR A  1  508 ? 26.198  58.809  -0.708  1.00 23.63  ? 508  THR A OG1   1 
ATOM   3797  C  CG2   . THR A  1  508 ? 26.810  58.800  1.623   1.00 25.54  ? 508  THR A CG2   1 
ATOM   3798  N  N     . PHE A  1  509 ? 28.146  55.689  -1.239  1.00 22.65  ? 509  PHE A N     1 
ATOM   3799  C  CA    . PHE A  1  509 ? 28.268  54.768  -2.342  1.00 24.05  ? 509  PHE A CA    1 
ATOM   3800  C  C     . PHE A  1  509 ? 26.975  54.054  -2.714  1.00 24.82  ? 509  PHE A C     1 
ATOM   3801  O  O     . PHE A  1  509 ? 26.727  53.798  -3.889  1.00 21.00  ? 509  PHE A O     1 
ATOM   3802  C  CB    . PHE A  1  509 ? 29.311  53.688  -2.020  1.00 23.54  ? 509  PHE A CB    1 
ATOM   3803  C  CG    . PHE A  1  509 ? 30.685  54.218  -1.737  1.00 31.08  ? 509  PHE A CG    1 
ATOM   3804  C  CD1   . PHE A  1  509 ? 30.994  54.757  -0.485  1.00 31.89  ? 509  PHE A CD1   1 
ATOM   3805  C  CD2   . PHE A  1  509 ? 31.694  54.129  -2.704  1.00 33.34  ? 509  PHE A CD2   1 
ATOM   3806  C  CE1   . PHE A  1  509 ? 32.276  55.188  -0.190  1.00 33.02  ? 509  PHE A CE1   1 
ATOM   3807  C  CE2   . PHE A  1  509 ? 32.986  54.562  -2.424  1.00 34.47  ? 509  PHE A CE2   1 
ATOM   3808  C  CZ    . PHE A  1  509 ? 33.281  55.095  -1.153  1.00 34.25  ? 509  PHE A CZ    1 
ATOM   3809  N  N     . ASP A  1  510 ? 26.171  53.689  -1.718  1.00 24.21  ? 510  ASP A N     1 
ATOM   3810  C  CA    . ASP A  1  510 ? 24.939  52.949  -2.022  1.00 25.12  ? 510  ASP A CA    1 
ATOM   3811  C  C     . ASP A  1  510 ? 23.968  53.946  -2.607  1.00 20.17  ? 510  ASP A C     1 
ATOM   3812  O  O     . ASP A  1  510 ? 23.715  54.965  -2.000  1.00 18.25  ? 510  ASP A O     1 
ATOM   3813  C  CB    . ASP A  1  510 ? 24.360  52.298  -0.758  1.00 22.38  ? 510  ASP A CB    1 
ATOM   3814  C  CG    . ASP A  1  510 ? 23.338  51.199  -1.070  1.00 30.85  ? 510  ASP A CG    1 
ATOM   3815  O  OD1   . ASP A  1  510 ? 22.624  51.314  -2.101  1.00 30.01  ? 510  ASP A OD1   1 
ATOM   3816  O  OD2   . ASP A  1  510 ? 23.230  50.223  -0.281  1.00 23.33  ? 510  ASP A OD2   1 
ATOM   3817  N  N     . ARG A  1  511 ? 23.444  53.659  -3.794  1.00 24.61  ? 511  ARG A N     1 
ATOM   3818  C  CA    . ARG A  1  511 ? 22.498  54.565  -4.450  1.00 24.29  ? 511  ARG A CA    1 
ATOM   3819  C  C     . ARG A  1  511 ? 21.065  54.067  -4.358  1.00 24.73  ? 511  ARG A C     1 
ATOM   3820  O  O     . ARG A  1  511 ? 20.137  54.716  -4.863  1.00 25.40  ? 511  ARG A O     1 
ATOM   3821  C  CB    . ARG A  1  511 ? 22.907  54.783  -5.917  1.00 30.27  ? 511  ARG A CB    1 
ATOM   3822  C  CG    . ARG A  1  511 ? 24.337  55.344  -6.100  1.00 25.42  ? 511  ARG A CG    1 
ATOM   3823  C  CD    . ARG A  1  511 ? 24.470  56.695  -5.408  1.00 24.74  ? 511  ARG A CD    1 
ATOM   3824  N  NE    . ARG A  1  511 ? 25.801  57.265  -5.616  1.00 25.86  ? 511  ARG A NE    1 
ATOM   3825  C  CZ    . ARG A  1  511 ? 26.469  57.992  -4.718  1.00 27.19  ? 511  ARG A CZ    1 
ATOM   3826  N  NH1   . ARG A  1  511 ? 25.940  58.259  -3.515  1.00 32.16  ? 511  ARG A NH1   1 
ATOM   3827  N  NH2   . ARG A  1  511 ? 27.686  58.446  -5.018  1.00 29.76  ? 511  ARG A NH2   1 
ATOM   3828  N  N     . GLY A  1  512 ? 20.877  52.937  -3.673  1.00 22.15  ? 512  GLY A N     1 
ATOM   3829  C  CA    . GLY A  1  512 ? 19.545  52.389  -3.490  1.00 18.11  ? 512  GLY A CA    1 
ATOM   3830  C  C     . GLY A  1  512 ? 18.744  53.145  -2.445  1.00 23.48  ? 512  GLY A C     1 
ATOM   3831  O  O     . GLY A  1  512 ? 19.242  54.100  -1.820  1.00 25.30  ? 512  GLY A O     1 
ATOM   3832  N  N     . ILE A  1  513 ? 17.486  52.736  -2.246  1.00 24.83  ? 513  ILE A N     1 
ATOM   3833  C  CA    . ILE A  1  513 ? 16.641  53.384  -1.246  1.00 22.61  ? 513  ILE A CA    1 
ATOM   3834  C  C     . ILE A  1  513 ? 16.146  52.356  -0.206  1.00 26.39  ? 513  ILE A C     1 
ATOM   3835  O  O     . ILE A  1  513 ? 15.944  52.675  0.975   1.00 27.06  ? 513  ILE A O     1 
ATOM   3836  C  CB    . ILE A  1  513 ? 15.483  54.159  -1.943  1.00 25.57  ? 513  ILE A CB    1 
ATOM   3837  C  CG1   . ILE A  1  513 ? 14.761  55.014  -0.914  1.00 22.85  ? 513  ILE A CG1   1 
ATOM   3838  C  CG2   . ILE A  1  513 ? 14.600  53.206  -2.746  1.00 23.68  ? 513  ILE A CG2   1 
ATOM   3839  C  CD1   . ILE A  1  513 ? 15.717  56.001  -0.240  1.00 24.58  ? 513  ILE A CD1   1 
ATOM   3840  N  N     . VAL A  1  514 ? 16.010  51.105  -0.630  1.00 24.88  ? 514  VAL A N     1 
ATOM   3841  C  CA    . VAL A  1  514 ? 15.580  50.032  0.275   1.00 22.45  ? 514  VAL A CA    1 
ATOM   3842  C  C     . VAL A  1  514 ? 16.753  49.591  1.167   1.00 20.08  ? 514  VAL A C     1 
ATOM   3843  O  O     . VAL A  1  514 ? 17.786  49.143  0.680   1.00 20.33  ? 514  VAL A O     1 
ATOM   3844  C  CB    . VAL A  1  514 ? 15.078  48.786  -0.533  1.00 25.53  ? 514  VAL A CB    1 
ATOM   3845  C  CG1   . VAL A  1  514 ? 14.848  47.603  0.401   1.00 29.29  ? 514  VAL A CG1   1 
ATOM   3846  C  CG2   . VAL A  1  514 ? 13.787  49.135  -1.289  1.00 22.52  ? 514  VAL A CG2   1 
ATOM   3847  N  N     . TRP A  1  515 ? 16.610  49.752  2.482   1.00 19.05  ? 515  TRP A N     1 
ATOM   3848  C  CA    . TRP A  1  515 ? 17.651  49.346  3.411   1.00 16.19  ? 515  TRP A CA    1 
ATOM   3849  C  C     . TRP A  1  515 ? 19.041  49.873  3.030   1.00 17.47  ? 515  TRP A C     1 
ATOM   3850  O  O     . TRP A  1  515 ? 20.055  49.150  2.969   1.00 16.37  ? 515  TRP A O     1 
ATOM   3851  C  CB    . TRP A  1  515 ? 17.647  47.798  3.540   1.00 20.45  ? 515  TRP A CB    1 
ATOM   3852  C  CG    . TRP A  1  515 ? 16.822  47.340  4.728   1.00 20.37  ? 515  TRP A CG    1 
ATOM   3853  C  CD1   . TRP A  1  515 ? 15.471  47.079  4.756   1.00 23.05  ? 515  TRP A CD1   1 
ATOM   3854  C  CD2   . TRP A  1  515 ? 17.276  47.222  6.083   1.00 19.05  ? 515  TRP A CD2   1 
ATOM   3855  N  NE1   . TRP A  1  515 ? 15.061  46.813  6.053   1.00 19.37  ? 515  TRP A NE1   1 
ATOM   3856  C  CE2   . TRP A  1  515 ? 16.151  46.897  6.882   1.00 20.15  ? 515  TRP A CE2   1 
ATOM   3857  C  CE3   . TRP A  1  515 ? 18.523  47.367  6.698   1.00 22.06  ? 515  TRP A CE3   1 
ATOM   3858  C  CZ2   . TRP A  1  515 ? 16.237  46.708  8.265   1.00 17.05  ? 515  TRP A CZ2   1 
ATOM   3859  C  CZ3   . TRP A  1  515 ? 18.610  47.178  8.097   1.00 23.67  ? 515  TRP A CZ3   1 
ATOM   3860  C  CH2   . TRP A  1  515 ? 17.469  46.850  8.851   1.00 24.51  ? 515  TRP A CH2   1 
ATOM   3861  N  N     . ASN A  1  516 ? 19.102  51.169  2.771   1.00 15.74  ? 516  ASN A N     1 
ATOM   3862  C  CA    . ASN A  1  516 ? 20.364  51.762  2.423   1.00 16.80  ? 516  ASN A CA    1 
ATOM   3863  C  C     . ASN A  1  516 ? 20.920  52.271  3.733   1.00 19.39  ? 516  ASN A C     1 
ATOM   3864  O  O     . ASN A  1  516 ? 20.671  53.425  4.116   1.00 18.74  ? 516  ASN A O     1 
ATOM   3865  C  CB    . ASN A  1  516 ? 20.149  52.935  1.471   1.00 19.48  ? 516  ASN A CB    1 
ATOM   3866  C  CG    . ASN A  1  516 ? 21.445  53.496  0.955   1.00 16.01  ? 516  ASN A CG    1 
ATOM   3867  O  OD1   . ASN A  1  516 ? 22.493  53.346  1.591   1.00 24.49  ? 516  ASN A OD1   1 
ATOM   3868  N  ND2   . ASN A  1  516 ? 21.392  54.152  -0.212  1.00 23.50  ? 516  ASN A ND2   1 
ATOM   3869  N  N     . THR A  1  517 ? 21.660  51.409  4.417   1.00 18.29  ? 517  THR A N     1 
ATOM   3870  C  CA    . THR A  1  517 ? 22.251  51.751  5.702   1.00 18.28  ? 517  THR A CA    1 
ATOM   3871  C  C     . THR A  1  517 ? 23.431  52.704  5.533   1.00 19.19  ? 517  THR A C     1 
ATOM   3872  O  O     . THR A  1  517 ? 23.847  53.355  6.510   1.00 18.19  ? 517  THR A O     1 
ATOM   3873  C  CB    . THR A  1  517 ? 22.715  50.468  6.448   1.00 23.32  ? 517  THR A CB    1 
ATOM   3874  O  OG1   . THR A  1  517 ? 23.586  49.733  5.605   1.00 22.69  ? 517  THR A OG1   1 
ATOM   3875  C  CG2   . THR A  1  517 ? 21.512  49.566  6.796   1.00 27.01  ? 517  THR A CG2   1 
ATOM   3876  N  N     . ASP A  1  518 ? 23.959  52.807  4.300   1.00 17.53  ? 518  ASP A N     1 
ATOM   3877  C  CA    . ASP A  1  518 ? 25.080  53.713  4.007   1.00 17.74  ? 518  ASP A CA    1 
ATOM   3878  C  C     . ASP A  1  518 ? 24.463  55.104  4.188   1.00 22.26  ? 518  ASP A C     1 
ATOM   3879  O  O     . ASP A  1  518 ? 25.032  55.987  4.840   1.00 23.17  ? 518  ASP A O     1 
ATOM   3880  C  CB    . ASP A  1  518 ? 25.581  53.512  2.566   1.00 19.87  ? 518  ASP A CB    1 
ATOM   3881  C  CG    . ASP A  1  518 ? 26.821  54.391  2.202   1.00 26.69  ? 518  ASP A CG    1 
ATOM   3882  O  OD1   . ASP A  1  518 ? 27.420  55.061  3.077   1.00 29.84  ? 518  ASP A OD1   1 
ATOM   3883  O  OD2   . ASP A  1  518 ? 27.220  54.400  1.012   1.00 24.98  ? 518  ASP A OD2   1 
ATOM   3884  N  N     . LEU A  1  519 ? 23.273  55.279  3.623   1.00 19.95  ? 519  LEU A N     1 
ATOM   3885  C  CA    . LEU A  1  519 ? 22.540  56.539  3.731   1.00 20.29  ? 519  LEU A CA    1 
ATOM   3886  C  C     . LEU A  1  519 ? 22.060  56.847  5.186   1.00 18.94  ? 519  LEU A C     1 
ATOM   3887  O  O     . LEU A  1  519 ? 22.258  57.946  5.688   1.00 19.21  ? 519  LEU A O     1 
ATOM   3888  C  CB    . LEU A  1  519 ? 21.339  56.485  2.800   1.00 16.13  ? 519  LEU A CB    1 
ATOM   3889  C  CG    . LEU A  1  519 ? 20.293  57.574  2.944   1.00 21.13  ? 519  LEU A CG    1 
ATOM   3890  C  CD1   . LEU A  1  519 ? 20.873  58.938  2.591   1.00 14.16  ? 519  LEU A CD1   1 
ATOM   3891  C  CD2   . LEU A  1  519 ? 19.113  57.226  2.031   1.00 22.93  ? 519  LEU A CD2   1 
ATOM   3892  N  N     . VAL A  1  520 ? 21.388  55.893  5.829   1.00 18.90  ? 520  VAL A N     1 
ATOM   3893  C  CA    . VAL A  1  520 ? 20.920  56.081  7.194   1.00 19.62  ? 520  VAL A CA    1 
ATOM   3894  C  C     . VAL A  1  520 ? 22.069  56.425  8.138   1.00 18.05  ? 520  VAL A C     1 
ATOM   3895  O  O     . VAL A  1  520 ? 21.919  57.264  9.023   1.00 17.55  ? 520  VAL A O     1 
ATOM   3896  C  CB    . VAL A  1  520 ? 20.179  54.829  7.720   1.00 23.20  ? 520  VAL A CB    1 
ATOM   3897  C  CG1   . VAL A  1  520 ? 19.822  55.014  9.228   1.00 21.13  ? 520  VAL A CG1   1 
ATOM   3898  C  CG2   . VAL A  1  520 ? 18.876  54.628  6.933   1.00 22.00  ? 520  VAL A CG2   1 
ATOM   3899  N  N     . GLU A  1  521 ? 23.229  55.795  7.965   1.00 21.30  ? 521  GLU A N     1 
ATOM   3900  C  CA    . GLU A  1  521 ? 24.326  56.150  8.856   1.00 20.98  ? 521  GLU A CA    1 
ATOM   3901  C  C     . GLU A  1  521 ? 24.855  57.553  8.559   1.00 18.56  ? 521  GLU A C     1 
ATOM   3902  O  O     . GLU A  1  521 ? 25.455  58.139  9.425   1.00 20.27  ? 521  GLU A O     1 
ATOM   3903  C  CB    . GLU A  1  521 ? 25.451  55.099  8.807   1.00 25.58  ? 521  GLU A CB    1 
ATOM   3904  C  CG    . GLU A  1  521 ? 25.045  53.789  9.504   1.00 25.55  ? 521  GLU A CG    1 
ATOM   3905  C  CD    . GLU A  1  521 ? 26.075  52.666  9.302   1.00 38.06  ? 521  GLU A CD    1 
ATOM   3906  O  OE1   . GLU A  1  521 ? 27.287  52.972  9.144   1.00 36.57  ? 521  GLU A OE1   1 
ATOM   3907  O  OE2   . GLU A  1  521 ? 25.671  51.470  9.319   1.00 41.50  ? 521  GLU A OE2   1 
ATOM   3908  N  N     . THR A  1  522 ? 24.637  58.093  7.344   1.00 13.99  ? 522  THR A N     1 
ATOM   3909  C  CA    . THR A  1  522 ? 25.089  59.459  7.028   1.00 12.96  ? 522  THR A CA    1 
ATOM   3910  C  C     . THR A  1  522 ? 24.125  60.454  7.681   1.00 16.66  ? 522  THR A C     1 
ATOM   3911  O  O     . THR A  1  522 ? 24.529  61.519  8.157   1.00 23.76  ? 522  THR A O     1 
ATOM   3912  C  CB    . THR A  1  522 ? 25.148  59.719  5.499   1.00 14.20  ? 522  THR A CB    1 
ATOM   3913  O  OG1   . THR A  1  522 ? 25.859  58.654  4.873   1.00 17.23  ? 522  THR A OG1   1 
ATOM   3914  C  CG2   . THR A  1  522 ? 25.874  61.020  5.218   1.00 6.97   ? 522  THR A CG2   1 
ATOM   3915  N  N     . LEU A  1  523 ? 22.837  60.119  7.685   1.00 14.19  ? 523  LEU A N     1 
ATOM   3916  C  CA    . LEU A  1  523 ? 21.855  60.931  8.381   1.00 14.69  ? 523  LEU A CA    1 
ATOM   3917  C  C     . LEU A  1  523 ? 22.215  60.929  9.903   1.00 16.53  ? 523  LEU A C     1 
ATOM   3918  O  O     . LEU A  1  523 ? 22.199  61.984  10.548  1.00 14.98  ? 523  LEU A O     1 
ATOM   3919  C  CB    . LEU A  1  523 ? 20.460  60.327  8.222   1.00 11.44  ? 523  LEU A CB    1 
ATOM   3920  C  CG    . LEU A  1  523 ? 19.784  60.526  6.873   1.00 22.38  ? 523  LEU A CG    1 
ATOM   3921  C  CD1   . LEU A  1  523 ? 18.571  59.585  6.799   1.00 19.72  ? 523  LEU A CD1   1 
ATOM   3922  C  CD2   . LEU A  1  523 ? 19.371  62.020  6.711   1.00 15.86  ? 523  LEU A CD2   1 
ATOM   3923  N  N     . GLU A  1  524 ? 22.514  59.748  10.456  1.00 13.02  ? 524  GLU A N     1 
ATOM   3924  C  CA    . GLU A  1  524 ? 22.871  59.656  11.894  1.00 15.70  ? 524  GLU A CA    1 
ATOM   3925  C  C     . GLU A  1  524 ? 24.139  60.478  12.159  1.00 19.99  ? 524  GLU A C     1 
ATOM   3926  O  O     . GLU A  1  524 ? 24.268  61.078  13.249  1.00 22.41  ? 524  GLU A O     1 
ATOM   3927  C  CB    . GLU A  1  524 ? 23.047  58.174  12.343  1.00 13.65  ? 524  GLU A CB    1 
ATOM   3928  C  CG    . GLU A  1  524 ? 21.732  57.394  12.352  1.00 15.88  ? 524  GLU A CG    1 
ATOM   3929  C  CD    . GLU A  1  524 ? 21.855  55.889  12.631  1.00 25.36  ? 524  GLU A CD    1 
ATOM   3930  O  OE1   . GLU A  1  524 ? 22.953  55.316  12.461  1.00 26.24  ? 524  GLU A OE1   1 
ATOM   3931  O  OE2   . GLU A  1  524 ? 20.836  55.256  13.004  1.00 28.38  ? 524  GLU A OE2   1 
ATOM   3932  N  N     . LEU A  1  525 ? 25.064  60.534  11.187  1.00 19.85  ? 525  LEU A N     1 
ATOM   3933  C  CA    . LEU A  1  525 ? 26.282  61.350  11.373  1.00 20.28  ? 525  LEU A CA    1 
ATOM   3934  C  C     . LEU A  1  525 ? 25.952  62.852  11.487  1.00 21.57  ? 525  LEU A C     1 
ATOM   3935  O  O     . LEU A  1  525 ? 26.533  63.559  12.325  1.00 22.63  ? 525  LEU A O     1 
ATOM   3936  C  CB    . LEU A  1  525 ? 27.300  61.138  10.250  1.00 21.61  ? 525  LEU A CB    1 
ATOM   3937  C  CG    . LEU A  1  525 ? 28.497  62.123  10.210  1.00 21.11  ? 525  LEU A CG    1 
ATOM   3938  C  CD1   . LEU A  1  525 ? 29.281  62.018  11.473  1.00 23.35  ? 525  LEU A CD1   1 
ATOM   3939  C  CD2   . LEU A  1  525 ? 29.402  61.844  9.016   1.00 19.51  ? 525  LEU A CD2   1 
ATOM   3940  N  N     . GLN A  1  526 ? 25.044  63.345  10.642  1.00 21.35  ? 526  GLN A N     1 
ATOM   3941  C  CA    . GLN A  1  526 ? 24.608  64.746  10.733  1.00 20.48  ? 526  GLN A CA    1 
ATOM   3942  C  C     . GLN A  1  526 ? 23.993  65.011  12.131  1.00 24.49  ? 526  GLN A C     1 
ATOM   3943  O  O     . GLN A  1  526 ? 24.199  66.068  12.729  1.00 26.03  ? 526  GLN A O     1 
ATOM   3944  C  CB    . GLN A  1  526 ? 23.534  65.048  9.686   1.00 21.77  ? 526  GLN A CB    1 
ATOM   3945  C  CG    . GLN A  1  526 ? 24.018  65.155  8.230   1.00 20.50  ? 526  GLN A CG    1 
ATOM   3946  C  CD    . GLN A  1  526 ? 22.859  65.485  7.323   1.00 23.00  ? 526  GLN A CD    1 
ATOM   3947  O  OE1   . GLN A  1  526 ? 21.785  64.889  7.435   1.00 22.99  ? 526  GLN A OE1   1 
ATOM   3948  N  NE2   . GLN A  1  526 ? 23.053  66.443  6.442   1.00 23.39  ? 526  GLN A NE2   1 
ATOM   3949  N  N     . ASN A  1  527 ? 23.219  64.049  12.630  1.00 23.45  ? 527  ASN A N     1 
ATOM   3950  C  CA    . ASN A  1  527 ? 22.577  64.171  13.939  1.00 19.74  ? 527  ASN A CA    1 
ATOM   3951  C  C     . ASN A  1  527 ? 23.658  64.166  15.031  1.00 16.46  ? 527  ASN A C     1 
ATOM   3952  O  O     . ASN A  1  527 ? 23.697  65.054  15.869  1.00 21.50  ? 527  ASN A O     1 
ATOM   3953  C  CB    . ASN A  1  527 ? 21.558  63.015  14.144  1.00 20.50  ? 527  ASN A CB    1 
ATOM   3954  C  CG    . ASN A  1  527 ? 20.383  63.081  13.161  1.00 19.49  ? 527  ASN A CG    1 
ATOM   3955  O  OD1   . ASN A  1  527 ? 20.059  64.148  12.622  1.00 15.08  ? 527  ASN A OD1   1 
ATOM   3956  N  ND2   . ASN A  1  527 ? 19.725  61.945  12.947  1.00 16.14  ? 527  ASN A ND2   1 
ATOM   3957  N  N     . LEU A  1  528 ? 24.547  63.175  15.000  1.00 16.94  ? 528  LEU A N     1 
ATOM   3958  C  CA    . LEU A  1  528 ? 25.649  63.085  15.967  1.00 17.19  ? 528  LEU A CA    1 
ATOM   3959  C  C     . LEU A  1  528 ? 26.479  64.385  16.062  1.00 19.09  ? 528  LEU A C     1 
ATOM   3960  O  O     . LEU A  1  528 ? 26.795  64.858  17.175  1.00 18.33  ? 528  LEU A O     1 
ATOM   3961  C  CB    . LEU A  1  528 ? 26.591  61.912  15.608  1.00 14.80  ? 528  LEU A CB    1 
ATOM   3962  C  CG    . LEU A  1  528 ? 26.061  60.503  15.965  1.00 10.87  ? 528  LEU A CG    1 
ATOM   3963  C  CD1   . LEU A  1  528 ? 26.836  59.425  15.184  1.00 14.67  ? 528  LEU A CD1   1 
ATOM   3964  C  CD2   . LEU A  1  528 ? 26.165  60.254  17.463  1.00 15.43  ? 528  LEU A CD2   1 
ATOM   3965  N  N     . MET A  1  529 ? 26.850  64.936  14.898  1.00 18.72  ? 529  MET A N     1 
ATOM   3966  C  CA    . MET A  1  529 ? 27.646  66.165  14.810  1.00 13.70  ? 529  MET A CA    1 
ATOM   3967  C  C     . MET A  1  529 ? 26.942  67.362  15.442  1.00 17.47  ? 529  MET A C     1 
ATOM   3968  O  O     . MET A  1  529 ? 27.585  68.206  16.042  1.00 19.71  ? 529  MET A O     1 
ATOM   3969  C  CB    . MET A  1  529 ? 27.963  66.509  13.349  1.00 15.49  ? 529  MET A CB    1 
ATOM   3970  C  CG    . MET A  1  529 ? 29.120  65.706  12.771  1.00 19.45  ? 529  MET A CG    1 
ATOM   3971  S  SD    . MET A  1  529 ? 30.671  66.067  13.676  1.00 24.53  ? 529  MET A SD    1 
ATOM   3972  C  CE    . MET A  1  529 ? 30.799  67.846  13.479  1.00 16.18  ? 529  MET A CE    1 
ATOM   3973  N  N     . LEU A  1  530 ? 25.626  67.463  15.298  1.00 19.11  ? 530  LEU A N     1 
ATOM   3974  C  CA    . LEU A  1  530 ? 24.949  68.600  15.897  1.00 18.84  ? 530  LEU A CA    1 
ATOM   3975  C  C     . LEU A  1  530 ? 24.994  68.465  17.406  1.00 19.71  ? 530  LEU A C     1 
ATOM   3976  O  O     . LEU A  1  530 ? 25.104  69.468  18.108  1.00 15.72  ? 530  LEU A O     1 
ATOM   3977  C  CB    . LEU A  1  530 ? 23.500  68.702  15.413  1.00 20.49  ? 530  LEU A CB    1 
ATOM   3978  C  CG    . LEU A  1  530 ? 23.278  69.135  13.950  1.00 26.78  ? 530  LEU A CG    1 
ATOM   3979  C  CD1   . LEU A  1  530 ? 21.774  69.122  13.656  1.00 17.00  ? 530  LEU A CD1   1 
ATOM   3980  C  CD2   . LEU A  1  530 ? 23.850  70.547  13.706  1.00 22.37  ? 530  LEU A CD2   1 
ATOM   3981  N  N     . CYS A  1  531 ? 24.880  67.225  17.897  1.00 19.60  ? 531  CYS A N     1 
ATOM   3982  C  CA    . CYS A  1  531 ? 24.940  66.958  19.335  1.00 21.19  ? 531  CYS A CA    1 
ATOM   3983  C  C     . CYS A  1  531 ? 26.347  67.242  19.831  1.00 16.22  ? 531  CYS A C     1 
ATOM   3984  O  O     . CYS A  1  531 ? 26.541  67.917  20.835  1.00 22.08  ? 531  CYS A O     1 
ATOM   3985  C  CB    . CYS A  1  531 ? 24.572  65.498  19.627  1.00 21.29  ? 531  CYS A CB    1 
ATOM   3986  S  SG    . CYS A  1  531 ? 22.807  65.133  19.346  1.00 21.70  ? 531  CYS A SG    1 
ATOM   3987  N  N     . ALA A  1  532 ? 27.336  66.733  19.118  1.00 17.52  ? 532  ALA A N     1 
ATOM   3988  C  CA    . ALA A  1  532 ? 28.731  66.962  19.525  1.00 16.50  ? 532  ALA A CA    1 
ATOM   3989  C  C     . ALA A  1  532 ? 29.126  68.451  19.569  1.00 20.38  ? 532  ALA A C     1 
ATOM   3990  O  O     . ALA A  1  532 ? 29.797  68.906  20.529  1.00 21.70  ? 532  ALA A O     1 
ATOM   3991  C  CB    . ALA A  1  532 ? 29.671  66.208  18.599  1.00 13.93  ? 532  ALA A CB    1 
ATOM   3992  N  N     . LEU A  1  533 ? 28.737  69.218  18.553  1.00 17.70  ? 533  LEU A N     1 
ATOM   3993  C  CA    . LEU A  1  533 ? 29.092  70.636  18.535  1.00 20.29  ? 533  LEU A CA    1 
ATOM   3994  C  C     . LEU A  1  533 ? 28.607  71.312  19.810  1.00 21.99  ? 533  LEU A C     1 
ATOM   3995  O  O     . LEU A  1  533 ? 29.350  72.014  20.480  1.00 23.82  ? 533  LEU A O     1 
ATOM   3996  C  CB    . LEU A  1  533 ? 28.462  71.344  17.336  1.00 20.15  ? 533  LEU A CB    1 
ATOM   3997  C  CG    . LEU A  1  533 ? 29.156  71.160  15.979  1.00 26.40  ? 533  LEU A CG    1 
ATOM   3998  C  CD1   . LEU A  1  533 ? 28.289  71.795  14.874  1.00 24.79  ? 533  LEU A CD1   1 
ATOM   3999  C  CD2   . LEU A  1  533 ? 30.550  71.806  15.981  1.00 19.30  ? 533  LEU A CD2   1 
ATOM   4000  N  N     . GLN A  1  534 ? 27.339  71.111  20.126  1.00 20.33  ? 534  GLN A N     1 
ATOM   4001  C  CA    . GLN A  1  534 ? 26.737  71.727  21.302  1.00 20.23  ? 534  GLN A CA    1 
ATOM   4002  C  C     . GLN A  1  534 ? 27.399  71.288  22.600  1.00 19.06  ? 534  GLN A C     1 
ATOM   4003  O  O     . GLN A  1  534 ? 27.580  72.082  23.503  1.00 17.78  ? 534  GLN A O     1 
ATOM   4004  C  CB    . GLN A  1  534 ? 25.245  71.399  21.320  1.00 20.34  ? 534  GLN A CB    1 
ATOM   4005  C  CG    . GLN A  1  534 ? 24.501  72.202  20.290  1.00 18.00  ? 534  GLN A CG    1 
ATOM   4006  C  CD    . GLN A  1  534 ? 23.075  71.761  20.102  1.00 21.41  ? 534  GLN A CD    1 
ATOM   4007  O  OE1   . GLN A  1  534 ? 22.791  70.754  19.421  1.00 31.00  ? 534  GLN A OE1   1 
ATOM   4008  N  NE2   . GLN A  1  534 ? 22.167  72.496  20.692  1.00 15.73  ? 534  GLN A NE2   1 
ATOM   4009  N  N     . THR A  1  535 ? 27.749  70.010  22.677  1.00 16.38  ? 535  THR A N     1 
ATOM   4010  C  CA    . THR A  1  535 ? 28.408  69.463  23.848  1.00 15.87  ? 535  THR A CA    1 
ATOM   4011  C  C     . THR A  1  535 ? 29.736  70.147  24.144  1.00 18.90  ? 535  THR A C     1 
ATOM   4012  O  O     . THR A  1  535 ? 29.993  70.594  25.264  1.00 18.22  ? 535  THR A O     1 
ATOM   4013  C  CB    . THR A  1  535 ? 28.707  67.947  23.625  1.00 17.60  ? 535  THR A CB    1 
ATOM   4014  O  OG1   . THR A  1  535 ? 27.476  67.255  23.473  1.00 19.19  ? 535  THR A OG1   1 
ATOM   4015  C  CG2   . THR A  1  535 ? 29.439  67.347  24.831  1.00 18.05  ? 535  THR A CG2   1 
ATOM   4016  N  N     . ILE A  1  536 ? 30.591  70.204  23.129  1.00 16.92  ? 536  ILE A N     1 
ATOM   4017  C  CA    . ILE A  1  536 ? 31.907  70.788  23.274  1.00 19.10  ? 536  ILE A CA    1 
ATOM   4018  C  C     . ILE A  1  536 ? 31.901  72.318  23.394  1.00 23.59  ? 536  ILE A C     1 
ATOM   4019  O  O     . ILE A  1  536 ? 32.669  72.878  24.203  1.00 20.71  ? 536  ILE A O     1 
ATOM   4020  C  CB    . ILE A  1  536 ? 32.840  70.295  22.158  1.00 20.80  ? 536  ILE A CB    1 
ATOM   4021  C  CG1   . ILE A  1  536 ? 34.288  70.384  22.627  1.00 23.73  ? 536  ILE A CG1   1 
ATOM   4022  C  CG2   . ILE A  1  536 ? 32.594  71.068  20.868  1.00 20.07  ? 536  ILE A CG2   1 
ATOM   4023  C  CD1   . ILE A  1  536 ? 35.216  69.386  21.920  1.00 26.07  ? 536  ILE A CD1   1 
ATOM   4024  N  N     . TYR A  1  537 ? 31.021  73.011  22.674  1.00 20.00  ? 537  TYR A N     1 
ATOM   4025  C  CA    . TYR A  1  537 ? 30.993  74.472  22.844  1.00 24.81  ? 537  TYR A CA    1 
ATOM   4026  C  C     . TYR A  1  537 ? 30.476  74.825  24.240  1.00 27.02  ? 537  TYR A C     1 
ATOM   4027  O  O     . TYR A  1  537 ? 31.009  75.689  24.911  1.00 29.38  ? 537  TYR A O     1 
ATOM   4028  C  CB    . TYR A  1  537 ? 30.134  75.151  21.789  1.00 22.84  ? 537  TYR A CB    1 
ATOM   4029  C  CG    . TYR A  1  537 ? 30.935  75.461  20.555  1.00 27.49  ? 537  TYR A CG    1 
ATOM   4030  C  CD1   . TYR A  1  537 ? 31.056  74.520  19.526  1.00 26.72  ? 537  TYR A CD1   1 
ATOM   4031  C  CD2   . TYR A  1  537 ? 31.664  76.647  20.464  1.00 26.66  ? 537  TYR A CD2   1 
ATOM   4032  C  CE1   . TYR A  1  537 ? 31.871  74.739  18.454  1.00 27.37  ? 537  TYR A CE1   1 
ATOM   4033  C  CE2   . TYR A  1  537 ? 32.506  76.886  19.379  1.00 29.06  ? 537  TYR A CE2   1 
ATOM   4034  C  CZ    . TYR A  1  537 ? 32.605  75.927  18.377  1.00 29.34  ? 537  TYR A CZ    1 
ATOM   4035  O  OH    . TYR A  1  537 ? 33.431  76.133  17.302  1.00 25.33  ? 537  TYR A OH    1 
ATOM   4036  N  N     . GLY A  1  538 ? 29.431  74.128  24.665  1.00 27.04  ? 538  GLY A N     1 
ATOM   4037  C  CA    . GLY A  1  538 ? 28.882  74.339  25.985  1.00 23.08  ? 538  GLY A CA    1 
ATOM   4038  C  C     . GLY A  1  538 ? 29.936  74.067  27.040  1.00 21.32  ? 538  GLY A C     1 
ATOM   4039  O  O     . GLY A  1  538 ? 30.033  74.839  27.999  1.00 24.58  ? 538  GLY A O     1 
ATOM   4040  N  N     . ALA A  1  539 ? 30.719  72.991  26.890  1.00 20.22  ? 539  ALA A N     1 
ATOM   4041  C  CA    . ALA A  1  539 ? 31.793  72.669  27.846  1.00 20.31  ? 539  ALA A CA    1 
ATOM   4042  C  C     . ALA A  1  539 ? 32.852  73.780  27.954  1.00 19.24  ? 539  ALA A C     1 
ATOM   4043  O  O     . ALA A  1  539 ? 33.291  74.137  29.056  1.00 20.38  ? 539  ALA A O     1 
ATOM   4044  C  CB    . ALA A  1  539 ? 32.487  71.351  27.471  1.00 16.07  ? 539  ALA A CB    1 
ATOM   4045  N  N     . GLU A  1  540 ? 33.274  74.301  26.808  1.00 21.41  ? 540  GLU A N     1 
ATOM   4046  C  CA    . GLU A  1  540 ? 34.274  75.367  26.741  1.00 19.01  ? 540  GLU A CA    1 
ATOM   4047  C  C     . GLU A  1  540 ? 33.792  76.637  27.441  1.00 20.69  ? 540  GLU A C     1 
ATOM   4048  O  O     . GLU A  1  540 ? 34.589  77.337  28.085  1.00 24.36  ? 540  GLU A O     1 
ATOM   4049  C  CB    . GLU A  1  540 ? 34.648  75.650  25.276  1.00 22.31  ? 540  GLU A CB    1 
ATOM   4050  C  CG    . GLU A  1  540 ? 35.847  76.595  25.050  1.00 26.90  ? 540  GLU A CG    1 
ATOM   4051  C  CD    . GLU A  1  540 ? 35.569  78.067  25.431  1.00 29.71  ? 540  GLU A CD    1 
ATOM   4052  O  OE1   . GLU A  1  540 ? 34.462  78.586  25.185  1.00 31.27  ? 540  GLU A OE1   1 
ATOM   4053  O  OE2   . GLU A  1  540 ? 36.482  78.723  25.966  1.00 37.18  ? 540  GLU A OE2   1 
ATOM   4054  N  N     . ALA A  1  541 ? 32.495  76.922  27.358  1.00 20.36  ? 541  ALA A N     1 
ATOM   4055  C  CA    . ALA A  1  541 ? 31.944  78.116  28.011  1.00 21.74  ? 541  ALA A CA    1 
ATOM   4056  C  C     . ALA A  1  541 ? 31.745  77.942  29.527  1.00 25.05  ? 541  ALA A C     1 
ATOM   4057  O  O     . ALA A  1  541 ? 31.895  78.901  30.299  1.00 24.96  ? 541  ALA A O     1 
ATOM   4058  C  CB    . ALA A  1  541 ? 30.600  78.519  27.367  1.00 21.58  ? 541  ALA A CB    1 
ATOM   4059  N  N     . ARG A  1  542 ? 31.402  76.729  29.967  1.00 22.97  ? 542  ARG A N     1 
ATOM   4060  C  CA    . ARG A  1  542 ? 31.197  76.493  31.392  1.00 21.02  ? 542  ARG A CA    1 
ATOM   4061  C  C     . ARG A  1  542 ? 32.524  76.478  32.139  1.00 25.03  ? 542  ARG A C     1 
ATOM   4062  O  O     . ARG A  1  542 ? 33.198  75.463  32.229  1.00 21.13  ? 542  ARG A O     1 
ATOM   4063  C  CB    . ARG A  1  542 ? 30.442  75.181  31.628  1.00 18.79  ? 542  ARG A CB    1 
ATOM   4064  C  CG    . ARG A  1  542 ? 30.072  74.958  33.101  1.00 18.92  ? 542  ARG A CG    1 
ATOM   4065  C  CD    . ARG A  1  542 ? 29.042  73.856  33.242  1.00 20.79  ? 542  ARG A CD    1 
ATOM   4066  N  NE    . ARG A  1  542 ? 27.736  74.253  32.714  1.00 22.29  ? 542  ARG A NE    1 
ATOM   4067  C  CZ    . ARG A  1  542 ? 26.774  74.797  33.450  1.00 23.26  ? 542  ARG A CZ    1 
ATOM   4068  N  NH1   . ARG A  1  542 ? 26.964  75.005  34.750  1.00 22.32  ? 542  ARG A NH1   1 
ATOM   4069  N  NH2   . ARG A  1  542 ? 25.629  75.152  32.887  1.00 19.88  ? 542  ARG A NH2   1 
ATOM   4070  N  N     . LYS A  1  543 ? 32.869  77.611  32.730  1.00 27.07  ? 543  LYS A N     1 
ATOM   4071  C  CA    . LYS A  1  543 ? 34.133  77.719  33.443  1.00 30.17  ? 543  LYS A CA    1 
ATOM   4072  C  C     . LYS A  1  543 ? 33.976  77.459  34.931  1.00 29.27  ? 543  LYS A C     1 
ATOM   4073  O  O     . LYS A  1  543 ? 34.063  78.374  35.732  1.00 26.29  ? 543  LYS A O     1 
ATOM   4074  C  CB    . LYS A  1  543 ? 34.741  79.113  33.187  1.00 34.10  ? 543  LYS A CB    1 
ATOM   4075  C  CG    . LYS A  1  543 ? 35.206  79.320  31.724  1.00 36.02  ? 543  LYS A CG    1 
ATOM   4076  C  CD    . LYS A  1  543 ? 35.563  80.778  31.433  1.00 41.87  ? 543  LYS A CD    1 
ATOM   4077  C  CE    . LYS A  1  543 ? 36.290  80.961  30.098  1.00 43.24  ? 543  LYS A CE    1 
ATOM   4078  N  NZ    . LYS A  1  543 ? 35.479  80.573  28.918  1.00 48.99  ? 543  LYS A NZ    1 
ATOM   4079  N  N     . GLU A  1  544 ? 33.718  76.197  35.279  1.00 27.62  ? 544  GLU A N     1 
ATOM   4080  C  CA    . GLU A  1  544 ? 33.561  75.768  36.667  1.00 25.83  ? 544  GLU A CA    1 
ATOM   4081  C  C     . GLU A  1  544 ? 33.590  74.260  36.564  1.00 25.10  ? 544  GLU A C     1 
ATOM   4082  O  O     . GLU A  1  544 ? 33.601  73.728  35.453  1.00 25.76  ? 544  GLU A O     1 
ATOM   4083  C  CB    . GLU A  1  544 ? 32.193  76.189  37.226  1.00 28.24  ? 544  GLU A CB    1 
ATOM   4084  C  CG    . GLU A  1  544 ? 31.006  75.441  36.553  1.00 25.66  ? 544  GLU A CG    1 
ATOM   4085  C  CD    . GLU A  1  544 ? 29.799  75.269  37.469  1.00 31.04  ? 544  GLU A CD    1 
ATOM   4086  O  OE1   . GLU A  1  544 ? 29.890  75.647  38.682  1.00 23.97  ? 544  GLU A OE1   1 
ATOM   4087  O  OE2   . GLU A  1  544 ? 28.765  74.740  36.976  1.00 26.96  ? 544  GLU A OE2   1 
ATOM   4088  N  N     . SER A  1  545 ? 33.646  73.574  37.707  1.00 23.78  ? 545  SER A N     1 
ATOM   4089  C  CA    . SER A  1  545 ? 33.586  72.109  37.731  1.00 22.00  ? 545  SER A CA    1 
ATOM   4090  C  C     . SER A  1  545 ? 32.281  71.769  38.472  1.00 24.31  ? 545  SER A C     1 
ATOM   4091  O  O     . SER A  1  545 ? 32.067  72.249  39.571  1.00 23.33  ? 545  SER A O     1 
ATOM   4092  C  CB    . SER A  1  545 ? 34.746  71.504  38.479  1.00 19.79  ? 545  SER A CB    1 
ATOM   4093  O  OG    . SER A  1  545 ? 35.967  71.806  37.834  1.00 23.04  ? 545  SER A OG    1 
ATOM   4094  N  N     . ARG A  1  546 ? 31.406  70.967  37.863  1.00 21.13  ? 546  ARG A N     1 
ATOM   4095  C  CA    . ARG A  1  546 ? 30.146  70.594  38.513  1.00 20.15  ? 546  ARG A CA    1 
ATOM   4096  C  C     . ARG A  1  546 ? 29.808  69.180  38.052  1.00 19.90  ? 546  ARG A C     1 
ATOM   4097  O  O     . ARG A  1  546 ? 29.724  68.897  36.834  1.00 16.30  ? 546  ARG A O     1 
ATOM   4098  C  CB    . ARG A  1  546 ? 29.024  71.579  38.131  1.00 14.34  ? 546  ARG A CB    1 
ATOM   4099  C  CG    . ARG A  1  546 ? 27.688  71.290  38.822  1.00 14.13  ? 546  ARG A CG    1 
ATOM   4100  C  CD    . ARG A  1  546 ? 26.606  72.313  38.427  1.00 21.72  ? 546  ARG A CD    1 
ATOM   4101  N  NE    . ARG A  1  546 ? 27.011  73.703  38.670  1.00 22.71  ? 546  ARG A NE    1 
ATOM   4102  C  CZ    . ARG A  1  546 ? 26.795  74.385  39.805  1.00 21.19  ? 546  ARG A CZ    1 
ATOM   4103  N  NH1   . ARG A  1  546 ? 26.168  73.824  40.819  1.00 21.73  ? 546  ARG A NH1   1 
ATOM   4104  N  NH2   . ARG A  1  546 ? 27.211  75.645  39.927  1.00 24.95  ? 546  ARG A NH2   1 
ATOM   4105  N  N     . GLY A  1  547 ? 29.610  68.289  39.016  1.00 19.86  ? 547  GLY A N     1 
ATOM   4106  C  CA    . GLY A  1  547 ? 29.290  66.919  38.679  1.00 21.03  ? 547  GLY A CA    1 
ATOM   4107  C  C     . GLY A  1  547 ? 30.248  66.316  37.659  1.00 22.54  ? 547  GLY A C     1 
ATOM   4108  O  O     . GLY A  1  547 ? 31.459  66.374  37.841  1.00 22.02  ? 547  GLY A O     1 
ATOM   4109  N  N     . ALA A  1  548 ? 29.715  65.759  36.577  1.00 20.36  ? 548  ALA A N     1 
ATOM   4110  C  CA    . ALA A  1  548 ? 30.541  65.128  35.546  1.00 20.64  ? 548  ALA A CA    1 
ATOM   4111  C  C     . ALA A  1  548 ? 31.462  66.050  34.738  1.00 19.90  ? 548  ALA A C     1 
ATOM   4112  O  O     . ALA A  1  548 ? 32.361  65.579  34.042  1.00 20.47  ? 548  ALA A O     1 
ATOM   4113  C  CB    . ALA A  1  548 ? 29.638  64.329  34.577  1.00 16.60  ? 548  ALA A CB    1 
ATOM   4114  N  N     . HIS A  1  549 ? 31.235  67.357  34.808  1.00 22.12  ? 549  HIS A N     1 
ATOM   4115  C  CA    . HIS A  1  549 ? 32.046  68.318  34.049  1.00 20.46  ? 549  HIS A CA    1 
ATOM   4116  C  C     . HIS A  1  549 ? 33.135  68.800  34.983  1.00 19.70  ? 549  HIS A C     1 
ATOM   4117  O  O     . HIS A  1  549 ? 32.854  69.505  35.937  1.00 19.71  ? 549  HIS A O     1 
ATOM   4118  C  CB    . HIS A  1  549 ? 31.164  69.486  33.587  1.00 17.70  ? 549  HIS A CB    1 
ATOM   4119  C  CG    . HIS A  1  549 ? 31.904  70.584  32.889  1.00 17.85  ? 549  HIS A CG    1 
ATOM   4120  N  ND1   . HIS A  1  549 ? 32.508  70.416  31.657  1.00 15.23  ? 549  HIS A ND1   1 
ATOM   4121  C  CD2   . HIS A  1  549 ? 32.076  71.891  33.217  1.00 16.59  ? 549  HIS A CD2   1 
ATOM   4122  C  CE1   . HIS A  1  549 ? 33.013  71.571  31.258  1.00 17.44  ? 549  HIS A CE1   1 
ATOM   4123  N  NE2   . HIS A  1  549 ? 32.759  72.482  32.184  1.00 19.24  ? 549  HIS A NE2   1 
ATOM   4124  N  N     . ALA A  1  550 ? 34.367  68.406  34.693  1.00 19.52  ? 550  ALA A N     1 
ATOM   4125  C  CA    . ALA A  1  550 ? 35.515  68.769  35.520  1.00 22.54  ? 550  ALA A CA    1 
ATOM   4126  C  C     . ALA A  1  550 ? 36.508  69.596  34.721  1.00 22.68  ? 550  ALA A C     1 
ATOM   4127  O  O     . ALA A  1  550 ? 36.988  69.156  33.689  1.00 22.20  ? 550  ALA A O     1 
ATOM   4128  C  CB    . ALA A  1  550 ? 36.194  67.502  36.058  1.00 17.62  ? 550  ALA A CB    1 
ATOM   4129  N  N     . ARG A  1  551 ? 36.781  70.811  35.193  1.00 23.73  ? 551  ARG A N     1 
ATOM   4130  C  CA    . ARG A  1  551 ? 37.727  71.711  34.539  1.00 25.07  ? 551  ARG A CA    1 
ATOM   4131  C  C     . ARG A  1  551 ? 38.988  71.790  35.420  1.00 24.25  ? 551  ARG A C     1 
ATOM   4132  O  O     . ARG A  1  551 ? 38.912  72.131  36.597  1.00 27.49  ? 551  ARG A O     1 
ATOM   4133  C  CB    . ARG A  1  551 ? 37.111  73.114  34.384  1.00 23.69  ? 551  ARG A CB    1 
ATOM   4134  C  CG    . ARG A  1  551 ? 36.000  73.270  33.321  1.00 28.07  ? 551  ARG A CG    1 
ATOM   4135  C  CD    . ARG A  1  551 ? 36.537  73.304  31.885  1.00 28.29  ? 551  ARG A CD    1 
ATOM   4136  N  NE    . ARG A  1  551 ? 37.417  74.446  31.580  1.00 25.65  ? 551  ARG A NE    1 
ATOM   4137  C  CZ    . ARG A  1  551 ? 37.066  75.524  30.879  1.00 24.31  ? 551  ARG A CZ    1 
ATOM   4138  N  NH1   . ARG A  1  551 ? 35.839  75.657  30.396  1.00 23.16  ? 551  ARG A NH1   1 
ATOM   4139  N  NH2   . ARG A  1  551 ? 37.974  76.460  30.617  1.00 18.56  ? 551  ARG A NH2   1 
ATOM   4140  N  N     . GLU A  1  552 ? 40.145  71.457  34.888  1.00 24.43  ? 552  GLU A N     1 
ATOM   4141  C  CA    . GLU A  1  552 ? 41.323  71.547  35.737  1.00 30.63  ? 552  GLU A CA    1 
ATOM   4142  C  C     . GLU A  1  552 ? 41.798  72.995  35.855  1.00 30.33  ? 552  GLU A C     1 
ATOM   4143  O  O     . GLU A  1  552 ? 42.652  73.308  36.673  1.00 31.60  ? 552  GLU A O     1 
ATOM   4144  C  CB    . GLU A  1  552 ? 42.413  70.612  35.216  1.00 33.89  ? 552  GLU A CB    1 
ATOM   4145  C  CG    . GLU A  1  552 ? 41.901  69.173  35.218  1.00 40.40  ? 552  GLU A CG    1 
ATOM   4146  C  CD    . GLU A  1  552 ? 42.956  68.114  34.924  1.00 46.16  ? 552  GLU A CD    1 
ATOM   4147  O  OE1   . GLU A  1  552 ? 43.404  68.008  33.748  1.00 49.15  ? 552  GLU A OE1   1 
ATOM   4148  O  OE2   . GLU A  1  552 ? 43.319  67.379  35.884  1.00 52.99  ? 552  GLU A OE2   1 
ATOM   4149  N  N     . ASP A  1  553 ? 41.204  73.876  35.054  1.00 31.34  ? 553  ASP A N     1 
ATOM   4150  C  CA    . ASP A  1  553 ? 41.537  75.301  35.064  1.00 29.41  ? 553  ASP A CA    1 
ATOM   4151  C  C     . ASP A  1  553 ? 40.496  76.097  35.858  1.00 29.71  ? 553  ASP A C     1 
ATOM   4152  O  O     . ASP A  1  553 ? 40.698  77.283  36.165  1.00 30.38  ? 553  ASP A O     1 
ATOM   4153  C  CB    . ASP A  1  553 ? 41.673  75.855  33.620  1.00 26.46  ? 553  ASP A CB    1 
ATOM   4154  C  CG    . ASP A  1  553 ? 40.482  75.514  32.706  1.00 27.50  ? 553  ASP A CG    1 
ATOM   4155  O  OD1   . ASP A  1  553 ? 39.697  74.589  33.000  1.00 27.64  ? 553  ASP A OD1   1 
ATOM   4156  O  OD2   . ASP A  1  553 ? 40.353  76.169  31.641  1.00 29.95  ? 553  ASP A OD2   1 
ATOM   4157  N  N     . TYR A  1  554 ? 39.386  75.429  36.186  1.00 29.65  ? 554  TYR A N     1 
ATOM   4158  C  CA    . TYR A  1  554 ? 38.284  76.011  36.956  1.00 25.96  ? 554  TYR A CA    1 
ATOM   4159  C  C     . TYR A  1  554 ? 37.728  74.882  37.807  1.00 29.16  ? 554  TYR A C     1 
ATOM   4160  O  O     . TYR A  1  554 ? 36.634  74.326  37.541  1.00 26.81  ? 554  TYR A O     1 
ATOM   4161  C  CB    . TYR A  1  554 ? 37.206  76.551  36.033  1.00 23.40  ? 554  TYR A CB    1 
ATOM   4162  C  CG    . TYR A  1  554 ? 37.639  77.766  35.249  1.00 25.19  ? 554  TYR A CG    1 
ATOM   4163  C  CD1   . TYR A  1  554 ? 38.098  77.646  33.922  1.00 24.98  ? 554  TYR A CD1   1 
ATOM   4164  C  CD2   . TYR A  1  554 ? 37.616  79.032  35.827  1.00 21.58  ? 554  TYR A CD2   1 
ATOM   4165  C  CE1   . TYR A  1  554 ? 38.513  78.758  33.209  1.00 25.78  ? 554  TYR A CE1   1 
ATOM   4166  C  CE2   . TYR A  1  554 ? 38.032  80.141  35.121  1.00 23.11  ? 554  TYR A CE2   1 
ATOM   4167  C  CZ    . TYR A  1  554 ? 38.475  79.997  33.815  1.00 23.71  ? 554  TYR A CZ    1 
ATOM   4168  O  OH    . TYR A  1  554 ? 38.864  81.103  33.106  1.00 28.84  ? 554  TYR A OH    1 
ATOM   4169  N  N     . LYS A  1  555 ? 38.490  74.562  38.849  1.00 30.83  ? 555  LYS A N     1 
ATOM   4170  C  CA    . LYS A  1  555 ? 38.182  73.459  39.754  1.00 29.28  ? 555  LYS A CA    1 
ATOM   4171  C  C     . LYS A  1  555 ? 37.043  73.593  40.736  1.00 28.49  ? 555  LYS A C     1 
ATOM   4172  O  O     . LYS A  1  555 ? 36.617  72.601  41.304  1.00 30.90  ? 555  LYS A O     1 
ATOM   4173  C  CB    . LYS A  1  555 ? 39.415  73.067  40.551  1.00 29.78  ? 555  LYS A CB    1 
ATOM   4174  C  CG    . LYS A  1  555 ? 40.649  72.798  39.722  1.00 36.04  ? 555  LYS A CG    1 
ATOM   4175  C  CD    . LYS A  1  555 ? 41.807  72.406  40.628  1.00 42.02  ? 555  LYS A CD    1 
ATOM   4176  C  CE    . LYS A  1  555 ? 43.084  72.167  39.815  1.00 48.24  ? 555  LYS A CE    1 
ATOM   4177  N  NZ    . LYS A  1  555 ? 42.896  71.182  38.706  1.00 49.74  ? 555  LYS A NZ    1 
ATOM   4178  N  N     . LEU A  1  556 ? 36.538  74.793  40.968  1.00 28.34  ? 556  LEU A N     1 
ATOM   4179  C  CA    . LEU A  1  556 ? 35.459  74.924  41.944  1.00 27.21  ? 556  LEU A CA    1 
ATOM   4180  C  C     . LEU A  1  556 ? 34.083  75.035  41.328  1.00 23.67  ? 556  LEU A C     1 
ATOM   4181  O  O     . LEU A  1  556 ? 33.928  75.525  40.212  1.00 25.28  ? 556  LEU A O     1 
ATOM   4182  C  CB    . LEU A  1  556 ? 35.694  76.166  42.797  1.00 31.00  ? 556  LEU A CB    1 
ATOM   4183  C  CG    . LEU A  1  556 ? 37.126  76.281  43.314  1.00 34.76  ? 556  LEU A CG    1 
ATOM   4184  C  CD1   . LEU A  1  556 ? 37.273  77.611  43.994  1.00 32.08  ? 556  LEU A CD1   1 
ATOM   4185  C  CD2   . LEU A  1  556 ? 37.456  75.132  44.264  1.00 34.99  ? 556  LEU A CD2   1 
ATOM   4186  N  N     . ARG A  1  557 ? 33.081  74.582  42.063  1.00 26.60  ? 557  ARG A N     1 
ATOM   4187  C  CA    . ARG A  1  557 ? 31.694  74.694  41.627  1.00 25.87  ? 557  ARG A CA    1 
ATOM   4188  C  C     . ARG A  1  557 ? 31.313  76.144  41.980  1.00 24.67  ? 557  ARG A C     1 
ATOM   4189  O  O     . ARG A  1  557 ? 31.509  76.562  43.102  1.00 25.86  ? 557  ARG A O     1 
ATOM   4190  C  CB    . ARG A  1  557 ? 30.823  73.714  42.412  1.00 24.74  ? 557  ARG A CB    1 
ATOM   4191  C  CG    . ARG A  1  557 ? 29.393  73.583  41.899  1.00 24.00  ? 557  ARG A CG    1 
ATOM   4192  C  CD    . ARG A  1  557 ? 28.613  72.664  42.838  1.00 28.46  ? 557  ARG A CD    1 
ATOM   4193  N  NE    . ARG A  1  557 ? 28.064  73.396  43.972  1.00 27.78  ? 557  ARG A NE    1 
ATOM   4194  C  CZ    . ARG A  1  557 ? 27.786  72.851  45.154  1.00 30.86  ? 557  ARG A CZ    1 
ATOM   4195  N  NH1   . ARG A  1  557 ? 28.019  71.555  45.377  1.00 20.39  ? 557  ARG A NH1   1 
ATOM   4196  N  NH2   . ARG A  1  557 ? 27.228  73.601  46.102  1.00 27.23  ? 557  ARG A NH2   1 
ATOM   4197  N  N     . ILE A  1  558 ? 30.778  76.902  41.032  1.00 27.45  ? 558  ILE A N     1 
ATOM   4198  C  CA    . ILE A  1  558 ? 30.439  78.310  41.262  1.00 23.97  ? 558  ILE A CA    1 
ATOM   4199  C  C     . ILE A  1  558 ? 28.934  78.607  41.328  1.00 25.23  ? 558  ILE A C     1 
ATOM   4200  O  O     . ILE A  1  558 ? 28.237  78.702  40.323  1.00 25.34  ? 558  ILE A O     1 
ATOM   4201  C  CB    . ILE A  1  558 ? 31.101  79.177  40.180  1.00 25.49  ? 558  ILE A CB    1 
ATOM   4202  C  CG1   . ILE A  1  558 ? 32.624  78.990  40.257  1.00 28.32  ? 558  ILE A CG1   1 
ATOM   4203  C  CG2   . ILE A  1  558 ? 30.732  80.650  40.379  1.00 20.79  ? 558  ILE A CG2   1 
ATOM   4204  C  CD1   . ILE A  1  558 ? 33.380  79.541  39.034  1.00 30.09  ? 558  ILE A CD1   1 
ATOM   4205  N  N     . ASP A  1  559 ? 28.449  78.774  42.542  1.00 23.08  ? 559  ASP A N     1 
ATOM   4206  C  CA    . ASP A  1  559 ? 27.039  79.004  42.794  1.00 25.26  ? 559  ASP A CA    1 
ATOM   4207  C  C     . ASP A  1  559 ? 26.717  80.509  42.986  1.00 25.98  ? 559  ASP A C     1 
ATOM   4208  O  O     . ASP A  1  559 ? 27.603  81.363  42.897  1.00 24.09  ? 559  ASP A O     1 
ATOM   4209  C  CB    . ASP A  1  559 ? 26.643  78.186  44.037  1.00 21.20  ? 559  ASP A CB    1 
ATOM   4210  C  CG    . ASP A  1  559 ? 26.902  76.692  43.871  1.00 25.42  ? 559  ASP A CG    1 
ATOM   4211  O  OD1   . ASP A  1  559 ? 27.318  76.041  44.849  1.00 25.06  ? 559  ASP A OD1   1 
ATOM   4212  O  OD2   . ASP A  1  559 ? 26.674  76.148  42.767  1.00 25.21  ? 559  ASP A OD2   1 
ATOM   4213  N  N     . GLU A  1  560 ? 25.445  80.821  43.226  1.00 27.54  ? 560  GLU A N     1 
ATOM   4214  C  CA    . GLU A  1  560 ? 24.999  82.196  43.423  1.00 30.74  ? 560  GLU A CA    1 
ATOM   4215  C  C     . GLU A  1  560 ? 25.518  82.722  44.779  1.00 34.89  ? 560  GLU A C     1 
ATOM   4216  O  O     . GLU A  1  560 ? 25.557  83.928  45.028  1.00 36.00  ? 560  GLU A O     1 
ATOM   4217  C  CB    . GLU A  1  560 ? 23.463  82.263  43.339  1.00 28.05  ? 560  GLU A CB    1 
ATOM   4218  C  CG    . GLU A  1  560 ? 22.699  81.614  44.515  1.00 28.44  ? 560  GLU A CG    1 
ATOM   4219  C  CD    . GLU A  1  560 ? 22.451  80.107  44.364  1.00 26.70  ? 560  GLU A CD    1 
ATOM   4220  O  OE1   . GLU A  1  560 ? 23.188  79.405  43.631  1.00 27.90  ? 560  GLU A OE1   1 
ATOM   4221  O  OE2   . GLU A  1  560 ? 21.520  79.611  45.015  1.00 27.20  ? 560  GLU A OE2   1 
ATOM   4222  N  N     . PHE A  1  561 ? 25.901  81.797  45.655  1.00 36.22  ? 561  PHE A N     1 
ATOM   4223  C  CA    . PHE A  1  561 ? 26.486  82.112  46.959  1.00 36.55  ? 561  PHE A CA    1 
ATOM   4224  C  C     . PHE A  1  561 ? 27.629  81.127  47.116  1.00 37.97  ? 561  PHE A C     1 
ATOM   4225  O  O     . PHE A  1  561 ? 27.751  80.179  46.339  1.00 35.87  ? 561  PHE A O     1 
ATOM   4226  C  CB    . PHE A  1  561 ? 25.521  81.846  48.130  1.00 34.73  ? 561  PHE A CB    1 
ATOM   4227  C  CG    . PHE A  1  561 ? 24.439  82.881  48.296  1.00 35.33  ? 561  PHE A CG    1 
ATOM   4228  C  CD1   . PHE A  1  561 ? 23.104  82.548  48.077  1.00 32.62  ? 561  PHE A CD1   1 
ATOM   4229  C  CD2   . PHE A  1  561 ? 24.755  84.189  48.665  1.00 37.60  ? 561  PHE A CD2   1 
ATOM   4230  C  CE1   . PHE A  1  561 ? 22.099  83.500  48.220  1.00 39.08  ? 561  PHE A CE1   1 
ATOM   4231  C  CE2   . PHE A  1  561 ? 23.762  85.156  48.811  1.00 37.02  ? 561  PHE A CE2   1 
ATOM   4232  C  CZ    . PHE A  1  561 ? 22.423  84.815  48.586  1.00 35.79  ? 561  PHE A CZ    1 
ATOM   4233  N  N     . ASP A  1  562 ? 28.463  81.347  48.123  1.00 39.86  ? 562  ASP A N     1 
ATOM   4234  C  CA    . ASP A  1  562 ? 29.543  80.415  48.424  1.00 38.24  ? 562  ASP A CA    1 
ATOM   4235  C  C     . ASP A  1  562 ? 28.909  79.551  49.514  1.00 39.70  ? 562  ASP A C     1 
ATOM   4236  O  O     . ASP A  1  562 ? 28.908  79.927  50.684  1.00 37.84  ? 562  ASP A O     1 
ATOM   4237  C  CB    . ASP A  1  562 ? 30.737  81.140  49.018  1.00 39.89  ? 562  ASP A CB    1 
ATOM   4238  C  CG    . ASP A  1  562 ? 31.843  80.193  49.425  1.00 42.80  ? 562  ASP A CG    1 
ATOM   4239  O  OD1   . ASP A  1  562 ? 31.539  79.011  49.713  1.00 41.88  ? 562  ASP A OD1   1 
ATOM   4240  O  OD2   . ASP A  1  562 ? 33.015  80.636  49.467  1.00 46.82  ? 562  ASP A OD2   1 
ATOM   4241  N  N     . TYR A  1  563 ? 28.361  78.401  49.152  1.00 37.89  ? 563  TYR A N     1 
ATOM   4242  C  CA    . TYR A  1  563 ? 27.711  77.591  50.154  1.00 38.37  ? 563  TYR A CA    1 
ATOM   4243  C  C     . TYR A  1  563 ? 28.609  76.816  51.097  1.00 40.10  ? 563  TYR A C     1 
ATOM   4244  O  O     . TYR A  1  563 ? 28.128  75.997  51.874  1.00 39.80  ? 563  TYR A O     1 
ATOM   4245  C  CB    . TYR A  1  563 ? 26.708  76.650  49.504  1.00 38.32  ? 563  TYR A CB    1 
ATOM   4246  C  CG    . TYR A  1  563 ? 25.475  77.351  48.983  1.00 35.80  ? 563  TYR A CG    1 
ATOM   4247  C  CD1   . TYR A  1  563 ? 25.393  77.780  47.657  1.00 31.75  ? 563  TYR A CD1   1 
ATOM   4248  C  CD2   . TYR A  1  563 ? 24.376  77.557  49.816  1.00 34.99  ? 563  TYR A CD2   1 
ATOM   4249  C  CE1   . TYR A  1  563 ? 24.241  78.393  47.176  1.00 29.79  ? 563  TYR A CE1   1 
ATOM   4250  C  CE2   . TYR A  1  563 ? 23.223  78.162  49.355  1.00 32.64  ? 563  TYR A CE2   1 
ATOM   4251  C  CZ    . TYR A  1  563 ? 23.152  78.576  48.035  1.00 33.73  ? 563  TYR A CZ    1 
ATOM   4252  O  OH    . TYR A  1  563 ? 21.969  79.117  47.580  1.00 32.57  ? 563  TYR A OH    1 
ATOM   4253  N  N     . SER A  1  564 ? 29.908  77.063  51.033  1.00 42.84  ? 564  SER A N     1 
ATOM   4254  C  CA    . SER A  1  564 ? 30.832  76.386  51.935  1.00 48.52  ? 564  SER A CA    1 
ATOM   4255  C  C     . SER A  1  564 ? 31.015  77.265  53.173  1.00 51.29  ? 564  SER A C     1 
ATOM   4256  O  O     . SER A  1  564 ? 31.639  76.851  54.143  1.00 53.55  ? 564  SER A O     1 
ATOM   4257  C  CB    . SER A  1  564 ? 32.189  76.176  51.273  1.00 46.07  ? 564  SER A CB    1 
ATOM   4258  O  OG    . SER A  1  564 ? 32.843  77.417  51.124  1.00 50.82  ? 564  SER A OG    1 
ATOM   4259  N  N     . LYS A  1  565 ? 30.474  78.482  53.120  1.00 52.19  ? 565  LYS A N     1 
ATOM   4260  C  CA    . LYS A  1  565 ? 30.551  79.433  54.230  1.00 54.07  ? 565  LYS A CA    1 
ATOM   4261  C  C     . LYS A  1  565 ? 29.145  79.848  54.652  1.00 55.11  ? 565  LYS A C     1 
ATOM   4262  O  O     . LYS A  1  565 ? 28.172  79.543  53.970  1.00 55.78  ? 565  LYS A O     1 
ATOM   4263  C  CB    . LYS A  1  565 ? 31.334  80.679  53.819  1.00 54.87  ? 565  LYS A CB    1 
ATOM   4264  C  CG    . LYS A  1  565 ? 32.794  80.426  53.465  1.00 58.61  ? 565  LYS A CG    1 
ATOM   4265  C  CD    . LYS A  1  565 ? 33.433  81.681  52.880  1.00 59.07  ? 565  LYS A CD    1 
ATOM   4266  C  CE    . LYS A  1  565 ? 34.897  81.458  52.522  1.00 62.77  ? 565  LYS A CE    1 
ATOM   4267  N  NZ    . LYS A  1  565 ? 35.533  82.667  51.893  1.00 66.07  ? 565  LYS A NZ    1 
ATOM   4268  N  N     . PRO A  1  566 ? 29.016  80.543  55.794  1.00 56.25  ? 566  PRO A N     1 
ATOM   4269  C  CA    . PRO A  1  566 ? 27.686  80.970  56.247  1.00 55.18  ? 566  PRO A CA    1 
ATOM   4270  C  C     . PRO A  1  566 ? 27.139  82.023  55.296  1.00 53.72  ? 566  PRO A C     1 
ATOM   4271  O  O     . PRO A  1  566 ? 27.869  82.912  54.880  1.00 50.58  ? 566  PRO A O     1 
ATOM   4272  C  CB    . PRO A  1  566 ? 27.957  81.543  57.636  1.00 56.34  ? 566  PRO A CB    1 
ATOM   4273  C  CG    . PRO A  1  566 ? 29.189  80.801  58.071  1.00 58.88  ? 566  PRO A CG    1 
ATOM   4274  C  CD    . PRO A  1  566 ? 30.030  80.805  56.829  1.00 56.50  ? 566  PRO A CD    1 
ATOM   4275  N  N     . LEU A  1  567 ? 25.857  81.927  54.962  1.00 53.74  ? 567  LEU A N     1 
ATOM   4276  C  CA    . LEU A  1  567 ? 25.256  82.879  54.039  1.00 55.81  ? 567  LEU A CA    1 
ATOM   4277  C  C     . LEU A  1  567 ? 25.056  84.264  54.653  1.00 57.42  ? 567  LEU A C     1 
ATOM   4278  O  O     . LEU A  1  567 ? 24.934  85.260  53.933  1.00 56.07  ? 567  LEU A O     1 
ATOM   4279  C  CB    . LEU A  1  567 ? 23.921  82.331  53.526  1.00 54.58  ? 567  LEU A CB    1 
ATOM   4280  C  CG    . LEU A  1  567 ? 24.022  81.057  52.682  1.00 54.72  ? 567  LEU A CG    1 
ATOM   4281  C  CD1   . LEU A  1  567 ? 22.633  80.673  52.178  1.00 54.25  ? 567  LEU A CD1   1 
ATOM   4282  C  CD2   . LEU A  1  567 ? 24.972  81.282  51.511  1.00 52.21  ? 567  LEU A CD2   1 
ATOM   4283  N  N     . GLN A  1  568 ? 25.029  84.309  55.985  1.00 59.67  ? 568  GLN A N     1 
ATOM   4284  C  CA    . GLN A  1  568 ? 24.850  85.547  56.739  1.00 61.87  ? 568  GLN A CA    1 
ATOM   4285  C  C     . GLN A  1  568 ? 25.803  86.640  56.279  1.00 59.88  ? 568  GLN A C     1 
ATOM   4286  O  O     . GLN A  1  568 ? 27.023  86.509  56.429  1.00 60.99  ? 568  GLN A O     1 
ATOM   4287  C  CB    . GLN A  1  568 ? 25.078  85.279  58.229  1.00 66.37  ? 568  GLN A CB    1 
ATOM   4288  C  CG    . GLN A  1  568 ? 24.951  86.507  59.108  1.00 72.57  ? 568  GLN A CG    1 
ATOM   4289  C  CD    . GLN A  1  568 ? 23.629  87.218  58.902  1.00 76.32  ? 568  GLN A CD    1 
ATOM   4290  O  OE1   . GLN A  1  568 ? 22.556  86.606  59.005  1.00 78.40  ? 568  GLN A OE1   1 
ATOM   4291  N  NE2   . GLN A  1  568 ? 23.694  88.518  58.610  1.00 77.69  ? 568  GLN A NE2   1 
ATOM   4292  N  N     . GLY A  1  569 ? 25.244  87.711  55.719  1.00 57.74  ? 569  GLY A N     1 
ATOM   4293  C  CA    . GLY A  1  569 ? 26.063  88.821  55.259  1.00 56.39  ? 569  GLY A CA    1 
ATOM   4294  C  C     . GLY A  1  569 ? 26.696  88.663  53.886  1.00 55.91  ? 569  GLY A C     1 
ATOM   4295  O  O     . GLY A  1  569 ? 27.420  89.549  53.425  1.00 54.47  ? 569  GLY A O     1 
ATOM   4296  N  N     . GLN A  1  570 ? 26.433  87.540  53.224  1.00 54.87  ? 570  GLN A N     1 
ATOM   4297  C  CA    . GLN A  1  570 ? 26.991  87.312  51.898  1.00 53.01  ? 570  GLN A CA    1 
ATOM   4298  C  C     . GLN A  1  570 ? 26.283  88.135  50.835  1.00 51.17  ? 570  GLN A C     1 
ATOM   4299  O  O     . GLN A  1  570 ? 25.095  88.448  50.955  1.00 50.32  ? 570  GLN A O     1 
ATOM   4300  C  CB    . GLN A  1  570 ? 26.883  85.838  51.508  1.00 53.26  ? 570  GLN A CB    1 
ATOM   4301  C  CG    . GLN A  1  570 ? 27.946  84.927  52.076  1.00 52.80  ? 570  GLN A CG    1 
ATOM   4302  C  CD    . GLN A  1  570 ? 28.047  83.633  51.280  1.00 52.88  ? 570  GLN A CD    1 
ATOM   4303  O  OE1   . GLN A  1  570 ? 28.200  83.666  50.054  1.00 53.33  ? 570  GLN A OE1   1 
ATOM   4304  N  NE2   . GLN A  1  570 ? 27.962  82.496  51.963  1.00 47.63  ? 570  GLN A NE2   1 
ATOM   4305  N  N     . GLN A  1  571 ? 27.021  88.469  49.784  1.00 51.20  ? 571  GLN A N     1 
ATOM   4306  C  CA    . GLN A  1  571 ? 26.473  89.230  48.666  1.00 51.87  ? 571  GLN A CA    1 
ATOM   4307  C  C     . GLN A  1  571 ? 26.125  88.270  47.521  1.00 51.02  ? 571  GLN A C     1 
ATOM   4308  O  O     . GLN A  1  571 ? 27.016  87.676  46.915  1.00 49.73  ? 571  GLN A O     1 
ATOM   4309  C  CB    . GLN A  1  571 ? 27.502  90.244  48.170  1.00 53.36  ? 571  GLN A CB    1 
ATOM   4310  C  CG    . GLN A  1  571 ? 27.019  91.025  46.973  1.00 58.51  ? 571  GLN A CG    1 
ATOM   4311  C  CD    . GLN A  1  571 ? 25.772  91.821  47.283  1.00 61.24  ? 571  GLN A CD    1 
ATOM   4312  O  OE1   . GLN A  1  571 ? 24.915  92.012  46.419  1.00 63.66  ? 571  GLN A OE1   1 
ATOM   4313  N  NE2   . GLN A  1  571 ? 25.667  92.305  48.523  1.00 65.24  ? 571  GLN A NE2   1 
ATOM   4314  N  N     . LYS A  1  572 ? 24.838  88.124  47.225  1.00 49.68  ? 572  LYS A N     1 
ATOM   4315  C  CA    . LYS A  1  572 ? 24.403  87.234  46.157  1.00 49.74  ? 572  LYS A CA    1 
ATOM   4316  C  C     . LYS A  1  572 ? 24.986  87.638  44.798  1.00 49.21  ? 572  LYS A C     1 
ATOM   4317  O  O     . LYS A  1  572 ? 24.954  88.807  44.431  1.00 50.62  ? 572  LYS A O     1 
ATOM   4318  C  CB    . LYS A  1  572 ? 22.885  87.233  46.086  1.00 50.28  ? 572  LYS A CB    1 
ATOM   4319  C  CG    . LYS A  1  572 ? 22.308  86.159  45.194  1.00 52.13  ? 572  LYS A CG    1 
ATOM   4320  C  CD    . LYS A  1  572 ? 20.799  86.116  45.345  1.00 53.45  ? 572  LYS A CD    1 
ATOM   4321  C  CE    . LYS A  1  572 ? 20.163  85.016  44.514  1.00 53.65  ? 572  LYS A CE    1 
ATOM   4322  N  NZ    . LYS A  1  572 ? 18.679  85.064  44.600  1.00 55.80  ? 572  LYS A NZ    1 
ATOM   4323  N  N     . ARG A  1  573 ? 25.518  86.671  44.049  1.00 48.12  ? 573  ARG A N     1 
ATOM   4324  C  CA    . ARG A  1  573 ? 26.098  86.958  42.741  1.00 43.76  ? 573  ARG A CA    1 
ATOM   4325  C  C     . ARG A  1  573 ? 25.020  87.054  41.676  1.00 42.08  ? 573  ARG A C     1 
ATOM   4326  O  O     . ARG A  1  573 ? 24.077  86.270  41.671  1.00 43.27  ? 573  ARG A O     1 
ATOM   4327  C  CB    . ARG A  1  573 ? 27.094  85.870  42.335  1.00 45.93  ? 573  ARG A CB    1 
ATOM   4328  C  CG    . ARG A  1  573 ? 28.251  85.665  43.301  1.00 47.33  ? 573  ARG A CG    1 
ATOM   4329  C  CD    . ARG A  1  573 ? 29.068  84.434  42.930  1.00 51.46  ? 573  ARG A CD    1 
ATOM   4330  N  NE    . ARG A  1  573 ? 30.093  84.154  43.933  1.00 57.69  ? 573  ARG A NE    1 
ATOM   4331  C  CZ    . ARG A  1  573 ? 30.579  82.943  44.225  1.00 60.09  ? 573  ARG A CZ    1 
ATOM   4332  N  NH1   . ARG A  1  573 ? 30.146  81.856  43.591  1.00 55.82  ? 573  ARG A NH1   1 
ATOM   4333  N  NH2   . ARG A  1  573 ? 31.498  82.817  45.180  1.00 61.61  ? 573  ARG A NH2   1 
ATOM   4334  N  N     . PRO A  1  574 ? 25.140  88.034  40.764  1.00 40.58  ? 574  PRO A N     1 
ATOM   4335  C  CA    . PRO A  1  574 ? 24.192  88.258  39.665  1.00 38.37  ? 574  PRO A CA    1 
ATOM   4336  C  C     . PRO A  1  574 ? 24.156  87.006  38.788  1.00 36.36  ? 574  PRO A C     1 
ATOM   4337  O  O     . PRO A  1  574 ? 25.170  86.327  38.646  1.00 31.84  ? 574  PRO A O     1 
ATOM   4338  C  CB    . PRO A  1  574 ? 24.810  89.432  38.901  1.00 37.57  ? 574  PRO A CB    1 
ATOM   4339  C  CG    . PRO A  1  574 ? 25.594  90.150  39.957  1.00 40.56  ? 574  PRO A CG    1 
ATOM   4340  C  CD    . PRO A  1  574 ? 26.224  89.029  40.731  1.00 39.67  ? 574  PRO A CD    1 
ATOM   4341  N  N     . PHE A  1  575 ? 23.007  86.738  38.173  1.00 36.27  ? 575  PHE A N     1 
ATOM   4342  C  CA    . PHE A  1  575 ? 22.826  85.561  37.330  1.00 38.36  ? 575  PHE A CA    1 
ATOM   4343  C  C     . PHE A  1  575 ? 23.964  85.363  36.329  1.00 38.74  ? 575  PHE A C     1 
ATOM   4344  O  O     . PHE A  1  575 ? 24.439  84.245  36.131  1.00 38.52  ? 575  PHE A O     1 
ATOM   4345  C  CB    . PHE A  1  575 ? 21.501  85.660  36.585  1.00 36.95  ? 575  PHE A CB    1 
ATOM   4346  C  CG    . PHE A  1  575 ? 21.136  84.415  35.828  1.00 36.88  ? 575  PHE A CG    1 
ATOM   4347  C  CD1   . PHE A  1  575 ? 20.727  83.269  36.504  1.00 36.78  ? 575  PHE A CD1   1 
ATOM   4348  C  CD2   . PHE A  1  575 ? 21.147  84.403  34.435  1.00 37.43  ? 575  PHE A CD2   1 
ATOM   4349  C  CE1   . PHE A  1  575 ? 20.327  82.136  35.808  1.00 33.18  ? 575  PHE A CE1   1 
ATOM   4350  C  CE2   . PHE A  1  575 ? 20.748  83.269  33.726  1.00 36.54  ? 575  PHE A CE2   1 
ATOM   4351  C  CZ    . PHE A  1  575 ? 20.337  82.139  34.415  1.00 35.07  ? 575  PHE A CZ    1 
ATOM   4352  N  N     . GLU A  1  576 ? 24.410  86.455  35.719  1.00 36.21  ? 576  GLU A N     1 
ATOM   4353  C  CA    . GLU A  1  576 ? 25.489  86.400  34.751  1.00 37.20  ? 576  GLU A CA    1 
ATOM   4354  C  C     . GLU A  1  576 ? 26.843  86.162  35.403  1.00 35.68  ? 576  GLU A C     1 
ATOM   4355  O  O     . GLU A  1  576 ? 27.827  85.993  34.706  1.00 34.19  ? 576  GLU A O     1 
ATOM   4356  C  CB    . GLU A  1  576 ? 25.587  87.707  33.955  1.00 39.45  ? 576  GLU A CB    1 
ATOM   4357  C  CG    . GLU A  1  576 ? 24.364  88.080  33.163  1.00 43.07  ? 576  GLU A CG    1 
ATOM   4358  C  CD    . GLU A  1  576 ? 23.224  88.547  34.037  1.00 47.94  ? 576  GLU A CD    1 
ATOM   4359  O  OE1   . GLU A  1  576 ? 23.491  89.021  35.175  1.00 48.37  ? 576  GLU A OE1   1 
ATOM   4360  O  OE2   . GLU A  1  576 ? 22.061  88.451  33.575  1.00 50.28  ? 576  GLU A OE2   1 
ATOM   4361  N  N     . GLU A  1  577 ? 26.909  86.154  36.726  1.00 36.30  ? 577  GLU A N     1 
ATOM   4362  C  CA    . GLU A  1  577 ? 28.195  85.957  37.362  1.00 37.56  ? 577  GLU A CA    1 
ATOM   4363  C  C     . GLU A  1  577 ? 28.424  84.647  38.098  1.00 37.37  ? 577  GLU A C     1 
ATOM   4364  O  O     . GLU A  1  577 ? 29.401  84.516  38.843  1.00 39.35  ? 577  GLU A O     1 
ATOM   4365  C  CB    . GLU A  1  577 ? 28.498  87.140  38.277  1.00 42.86  ? 577  GLU A CB    1 
ATOM   4366  C  CG    . GLU A  1  577 ? 28.902  88.385  37.477  1.00 50.36  ? 577  GLU A CG    1 
ATOM   4367  C  CD    . GLU A  1  577 ? 28.906  89.656  38.310  1.00 55.10  ? 577  GLU A CD    1 
ATOM   4368  O  OE1   . GLU A  1  577 ? 29.444  89.627  39.443  1.00 59.02  ? 577  GLU A OE1   1 
ATOM   4369  O  OE2   . GLU A  1  577 ? 28.377  90.685  37.823  1.00 57.87  ? 577  GLU A OE2   1 
ATOM   4370  N  N     . HIS A  1  578 ? 27.521  83.692  37.942  1.00 32.33  ? 578  HIS A N     1 
ATOM   4371  C  CA    . HIS A  1  578 ? 27.759  82.396  38.543  1.00 30.05  ? 578  HIS A CA    1 
ATOM   4372  C  C     . HIS A  1  578 ? 27.347  81.333  37.536  1.00 29.00  ? 578  HIS A C     1 
ATOM   4373  O  O     . HIS A  1  578 ? 26.893  81.657  36.428  1.00 26.99  ? 578  HIS A O     1 
ATOM   4374  C  CB    . HIS A  1  578 ? 27.046  82.243  39.875  1.00 28.47  ? 578  HIS A CB    1 
ATOM   4375  C  CG    . HIS A  1  578 ? 25.568  82.273  39.772  1.00 29.54  ? 578  HIS A CG    1 
ATOM   4376  N  ND1   . HIS A  1  578 ? 24.823  81.159  39.456  1.00 33.54  ? 578  HIS A ND1   1 
ATOM   4377  C  CD2   . HIS A  1  578 ? 24.687  83.282  39.943  1.00 31.59  ? 578  HIS A CD2   1 
ATOM   4378  C  CE1   . HIS A  1  578 ? 23.542  81.478  39.442  1.00 29.01  ? 578  HIS A CE1   1 
ATOM   4379  N  NE2   . HIS A  1  578 ? 23.434  82.762  39.735  1.00 33.12  ? 578  HIS A NE2   1 
ATOM   4380  N  N     . TRP A  1  579 ? 27.549  80.070  37.889  1.00 27.49  ? 579  TRP A N     1 
ATOM   4381  C  CA    . TRP A  1  579 ? 27.244  78.980  36.970  1.00 25.75  ? 579  TRP A CA    1 
ATOM   4382  C  C     . TRP A  1  579 ? 26.153  78.012  37.377  1.00 25.92  ? 579  TRP A C     1 
ATOM   4383  O  O     . TRP A  1  579 ? 25.939  77.002  36.711  1.00 25.15  ? 579  TRP A O     1 
ATOM   4384  C  CB    . TRP A  1  579 ? 28.523  78.201  36.657  1.00 22.52  ? 579  TRP A CB    1 
ATOM   4385  C  CG    . TRP A  1  579 ? 29.397  78.955  35.685  1.00 24.28  ? 579  TRP A CG    1 
ATOM   4386  C  CD1   . TRP A  1  579 ? 30.545  79.660  35.970  1.00 24.03  ? 579  TRP A CD1   1 
ATOM   4387  C  CD2   . TRP A  1  579 ? 29.134  79.162  34.302  1.00 22.86  ? 579  TRP A CD2   1 
ATOM   4388  N  NE1   . TRP A  1  579 ? 30.999  80.303  34.841  1.00 23.23  ? 579  TRP A NE1   1 
ATOM   4389  C  CE2   . TRP A  1  579 ? 30.159  80.018  33.800  1.00 25.61  ? 579  TRP A CE2   1 
ATOM   4390  C  CE3   . TRP A  1  579 ? 28.138  78.716  33.429  1.00 26.01  ? 579  TRP A CE3   1 
ATOM   4391  C  CZ2   . TRP A  1  579 ? 30.212  80.433  32.456  1.00 25.73  ? 579  TRP A CZ2   1 
ATOM   4392  C  CZ3   . TRP A  1  579 ? 28.188  79.134  32.068  1.00 27.50  ? 579  TRP A CZ3   1 
ATOM   4393  C  CH2   . TRP A  1  579 ? 29.224  79.984  31.607  1.00 27.58  ? 579  TRP A CH2   1 
ATOM   4394  N  N     . ARG A  1  580 ? 25.449  78.280  38.463  1.00 22.65  ? 580  ARG A N     1 
ATOM   4395  C  CA    . ARG A  1  580 ? 24.418  77.337  38.794  1.00 21.31  ? 580  ARG A CA    1 
ATOM   4396  C  C     . ARG A  1  580 ? 23.196  77.688  37.942  1.00 26.05  ? 580  ARG A C     1 
ATOM   4397  O  O     . ARG A  1  580 ? 22.224  78.333  38.397  1.00 23.84  ? 580  ARG A O     1 
ATOM   4398  C  CB    . ARG A  1  580 ? 24.086  77.338  40.277  1.00 18.14  ? 580  ARG A CB    1 
ATOM   4399  C  CG    . ARG A  1  580 ? 23.236  76.124  40.617  1.00 21.03  ? 580  ARG A CG    1 
ATOM   4400  C  CD    . ARG A  1  580 ? 23.225  75.859  42.073  1.00 18.10  ? 580  ARG A CD    1 
ATOM   4401  N  NE    . ARG A  1  580 ? 22.355  76.773  42.778  1.00 23.23  ? 580  ARG A NE    1 
ATOM   4402  C  CZ    . ARG A  1  580 ? 21.054  76.581  42.939  1.00 24.88  ? 580  ARG A CZ    1 
ATOM   4403  N  NH1   . ARG A  1  580 ? 20.459  75.505  42.429  1.00 20.42  ? 580  ARG A NH1   1 
ATOM   4404  N  NH2   . ARG A  1  580 ? 20.366  77.436  43.676  1.00 22.84  ? 580  ARG A NH2   1 
ATOM   4405  N  N     . LYS A  1  581 ? 23.263  77.243  36.687  1.00 21.34  ? 581  LYS A N     1 
ATOM   4406  C  CA    . LYS A  1  581 ? 22.206  77.510  35.745  1.00 24.82  ? 581  LYS A CA    1 
ATOM   4407  C  C     . LYS A  1  581 ? 22.387  76.540  34.589  1.00 23.59  ? 581  LYS A C     1 
ATOM   4408  O  O     . LYS A  1  581 ? 23.479  76.068  34.337  1.00 20.39  ? 581  LYS A O     1 
ATOM   4409  C  CB    . LYS A  1  581 ? 22.309  78.976  35.245  1.00 21.61  ? 581  LYS A CB    1 
ATOM   4410  C  CG    . LYS A  1  581 ? 23.618  79.316  34.532  1.00 22.41  ? 581  LYS A CG    1 
ATOM   4411  C  CD    . LYS A  1  581 ? 23.852  80.860  34.387  1.00 25.65  ? 581  LYS A CD    1 
ATOM   4412  C  CE    . LYS A  1  581 ? 25.236  81.116  33.775  1.00 23.79  ? 581  LYS A CE    1 
ATOM   4413  N  NZ    . LYS A  1  581 ? 25.653  82.548  33.671  1.00 22.68  ? 581  LYS A NZ    1 
ATOM   4414  N  N     . HIS A  1  582 ? 21.291  76.258  33.899  1.00 23.82  ? 582  HIS A N     1 
ATOM   4415  C  CA    . HIS A  1  582 ? 21.310  75.349  32.773  1.00 22.30  ? 582  HIS A CA    1 
ATOM   4416  C  C     . HIS A  1  582 ? 21.809  76.044  31.530  1.00 21.73  ? 582  HIS A C     1 
ATOM   4417  O  O     . HIS A  1  582 ? 21.502  77.220  31.292  1.00 21.18  ? 582  HIS A O     1 
ATOM   4418  C  CB    . HIS A  1  582 ? 19.903  74.856  32.474  1.00 17.48  ? 582  HIS A CB    1 
ATOM   4419  C  CG    . HIS A  1  582 ? 19.308  74.017  33.540  1.00 19.17  ? 582  HIS A CG    1 
ATOM   4420  N  ND1   . HIS A  1  582 ? 19.756  72.737  33.817  1.00 23.98  ? 582  HIS A ND1   1 
ATOM   4421  C  CD2   . HIS A  1  582 ? 18.225  74.218  34.324  1.00 19.20  ? 582  HIS A CD2   1 
ATOM   4422  C  CE1   . HIS A  1  582 ? 18.961  72.183  34.716  1.00 18.90  ? 582  HIS A CE1   1 
ATOM   4423  N  NE2   . HIS A  1  582 ? 18.022  73.059  35.041  1.00 23.71  ? 582  HIS A NE2   1 
ATOM   4424  N  N     . THR A  1  583 ? 22.570  75.313  30.731  1.00 22.16  ? 583  THR A N     1 
ATOM   4425  C  CA    . THR A  1  583 ? 23.070  75.834  29.453  1.00 19.22  ? 583  THR A CA    1 
ATOM   4426  C  C     . THR A  1  583 ? 21.998  75.510  28.417  1.00 20.79  ? 583  THR A C     1 
ATOM   4427  O  O     . THR A  1  583 ? 21.472  74.407  28.413  1.00 22.50  ? 583  THR A O     1 
ATOM   4428  C  CB    . THR A  1  583 ? 24.319  75.077  28.984  1.00 18.88  ? 583  THR A CB    1 
ATOM   4429  O  OG1   . THR A  1  583 ? 25.361  75.219  29.962  1.00 20.55  ? 583  THR A OG1   1 
ATOM   4430  C  CG2   . THR A  1  583 ? 24.778  75.568  27.628  1.00 11.80  ? 583  THR A CG2   1 
ATOM   4431  N  N     . LEU A  1  584 ? 21.666  76.474  27.567  1.00 17.59  ? 584  LEU A N     1 
ATOM   4432  C  CA    . LEU A  1  584 ? 20.715  76.285  26.491  1.00 19.93  ? 584  LEU A CA    1 
ATOM   4433  C  C     . LEU A  1  584 ? 21.564  76.492  25.254  1.00 21.14  ? 584  LEU A C     1 
ATOM   4434  O  O     . LEU A  1  584 ? 22.279  77.480  25.166  1.00 24.13  ? 584  LEU A O     1 
ATOM   4435  C  CB    . LEU A  1  584 ? 19.604  77.332  26.544  1.00 19.66  ? 584  LEU A CB    1 
ATOM   4436  C  CG    . LEU A  1  584 ? 18.630  77.247  27.717  1.00 22.89  ? 584  LEU A CG    1 
ATOM   4437  C  CD1   . LEU A  1  584 ? 17.654  78.443  27.609  1.00 23.09  ? 584  LEU A CD1   1 
ATOM   4438  C  CD2   . LEU A  1  584 ? 17.878  75.889  27.722  1.00 18.84  ? 584  LEU A CD2   1 
ATOM   4439  N  N     . SER A  1  585 ? 21.512  75.563  24.298  1.00 21.27  ? 585  SER A N     1 
ATOM   4440  C  CA    . SER A  1  585 ? 22.345  75.664  23.114  1.00 16.36  ? 585  SER A CA    1 
ATOM   4441  C  C     . SER A  1  585 ? 21.504  75.652  21.841  1.00 20.61  ? 585  SER A C     1 
ATOM   4442  O  O     . SER A  1  585 ? 20.436  75.047  21.806  1.00 24.01  ? 585  SER A O     1 
ATOM   4443  C  CB    . SER A  1  585 ? 23.373  74.528  23.129  1.00 16.75  ? 585  SER A CB    1 
ATOM   4444  O  OG    . SER A  1  585 ? 22.773  73.229  23.133  1.00 18.65  ? 585  SER A OG    1 
ATOM   4445  N  N     . TYR A  1  586 ? 21.974  76.372  20.817  1.00 20.44  ? 586  TYR A N     1 
ATOM   4446  C  CA    . TYR A  1  586 ? 21.282  76.475  19.537  1.00 20.54  ? 586  TYR A CA    1 
ATOM   4447  C  C     . TYR A  1  586 ? 22.327  76.346  18.458  1.00 22.39  ? 586  TYR A C     1 
ATOM   4448  O  O     . TYR A  1  586 ? 23.486  76.666  18.678  1.00 25.61  ? 586  TYR A O     1 
ATOM   4449  C  CB    . TYR A  1  586 ? 20.627  77.838  19.331  1.00 21.17  ? 586  TYR A CB    1 
ATOM   4450  C  CG    . TYR A  1  586 ? 19.663  78.278  20.385  1.00 23.79  ? 586  TYR A CG    1 
ATOM   4451  C  CD1   . TYR A  1  586 ? 20.109  78.804  21.593  1.00 25.92  ? 586  TYR A CD1   1 
ATOM   4452  C  CD2   . TYR A  1  586 ? 18.303  78.186  20.168  1.00 16.61  ? 586  TYR A CD2   1 
ATOM   4453  C  CE1   . TYR A  1  586 ? 19.213  79.229  22.558  1.00 27.35  ? 586  TYR A CE1   1 
ATOM   4454  C  CE2   . TYR A  1  586 ? 17.402  78.605  21.117  1.00 23.86  ? 586  TYR A CE2   1 
ATOM   4455  C  CZ    . TYR A  1  586 ? 17.853  79.124  22.307  1.00 26.62  ? 586  TYR A CZ    1 
ATOM   4456  O  OH    . TYR A  1  586 ? 16.927  79.514  23.248  1.00 30.64  ? 586  TYR A OH    1 
ATOM   4457  N  N     . VAL A  1  587 ? 21.927  75.871  17.288  1.00 22.96  ? 587  VAL A N     1 
ATOM   4458  C  CA    . VAL A  1  587 ? 22.880  75.744  16.216  1.00 23.38  ? 587  VAL A CA    1 
ATOM   4459  C  C     . VAL A  1  587 ? 22.245  76.271  14.929  1.00 27.37  ? 587  VAL A C     1 
ATOM   4460  O  O     . VAL A  1  587 ? 21.068  76.000  14.649  1.00 25.15  ? 587  VAL A O     1 
ATOM   4461  C  CB    . VAL A  1  587 ? 23.314  74.271  15.967  1.00 20.29  ? 587  VAL A CB    1 
ATOM   4462  C  CG1   . VAL A  1  587 ? 24.501  74.257  15.018  1.00 23.29  ? 587  VAL A CG1   1 
ATOM   4463  C  CG2   . VAL A  1  587 ? 23.714  73.587  17.260  1.00 27.22  ? 587  VAL A CG2   1 
ATOM   4464  N  N     . ASP A  1  588 ? 23.020  77.053  14.181  1.00 26.10  ? 588  ASP A N     1 
ATOM   4465  C  CA    . ASP A  1  588 ? 22.578  77.567  12.890  1.00 29.10  ? 588  ASP A CA    1 
ATOM   4466  C  C     . ASP A  1  588 ? 23.061  76.438  12.039  1.00 25.57  ? 588  ASP A C     1 
ATOM   4467  O  O     . ASP A  1  588 ? 24.265  76.274  11.827  1.00 25.36  ? 588  ASP A O     1 
ATOM   4468  C  CB    . ASP A  1  588 ? 23.299  78.858  12.515  1.00 33.56  ? 588  ASP A CB    1 
ATOM   4469  C  CG    . ASP A  1  588 ? 22.953  79.310  11.119  1.00 39.59  ? 588  ASP A CG    1 
ATOM   4470  O  OD1   . ASP A  1  588 ? 23.522  78.770  10.154  1.00 44.90  ? 588  ASP A OD1   1 
ATOM   4471  O  OD2   . ASP A  1  588 ? 22.086  80.191  10.982  1.00 47.12  ? 588  ASP A OD2   1 
ATOM   4472  N  N     . VAL A  1  589 ? 22.125  75.633  11.574  1.00 26.57  ? 589  VAL A N     1 
ATOM   4473  C  CA    . VAL A  1  589 ? 22.481  74.433  10.843  1.00 29.06  ? 589  VAL A CA    1 
ATOM   4474  C  C     . VAL A  1  589 ? 23.278  74.574  9.550   1.00 32.16  ? 589  VAL A C     1 
ATOM   4475  O  O     . VAL A  1  589 ? 24.076  73.692  9.217   1.00 29.98  ? 589  VAL A O     1 
ATOM   4476  C  CB    . VAL A  1  589 ? 21.203  73.563  10.664  1.00 32.61  ? 589  VAL A CB    1 
ATOM   4477  C  CG1   . VAL A  1  589 ? 21.429  72.446  9.689   1.00 36.46  ? 589  VAL A CG1   1 
ATOM   4478  C  CG2   . VAL A  1  589 ? 20.815  72.973  12.028  1.00 29.99  ? 589  VAL A CG2   1 
ATOM   4479  N  N     . LYS A  1  590 ? 23.109  75.675  8.831   1.00 34.98  ? 590  LYS A N     1 
ATOM   4480  C  CA    . LYS A  1  590 ? 23.853  75.829  7.591   1.00 39.24  ? 590  LYS A CA    1 
ATOM   4481  C  C     . LYS A  1  590 ? 25.304  76.170  7.868   1.00 39.78  ? 590  LYS A C     1 
ATOM   4482  O  O     . LYS A  1  590 ? 26.203  75.698  7.166   1.00 39.10  ? 590  LYS A O     1 
ATOM   4483  C  CB    . LYS A  1  590 ? 23.258  76.933  6.718   1.00 43.00  ? 590  LYS A CB    1 
ATOM   4484  C  CG    . LYS A  1  590 ? 22.040  76.543  5.918   1.00 49.38  ? 590  LYS A CG    1 
ATOM   4485  C  CD    . LYS A  1  590 ? 21.622  77.699  5.000   1.00 58.66  ? 590  LYS A CD    1 
ATOM   4486  C  CE    . LYS A  1  590 ? 20.452  77.325  4.083   1.00 63.09  ? 590  LYS A CE    1 
ATOM   4487  N  NZ    . LYS A  1  590 ? 20.133  78.427  3.101   1.00 64.46  ? 590  LYS A NZ    1 
ATOM   4488  N  N     . SER A  1  591 ? 25.534  76.983  8.896   1.00 37.21  ? 591  SER A N     1 
ATOM   4489  C  CA    . SER A  1  591 ? 26.891  77.403  9.205   1.00 38.19  ? 591  SER A CA    1 
ATOM   4490  C  C     . SER A  1  591 ? 27.549  76.552  10.248  1.00 40.12  ? 591  SER A C     1 
ATOM   4491  O  O     . SER A  1  591 ? 28.755  76.324  10.190  1.00 41.03  ? 591  SER A O     1 
ATOM   4492  C  CB    . SER A  1  591 ? 26.905  78.851  9.685   1.00 35.51  ? 591  SER A CB    1 
ATOM   4493  O  OG    . SER A  1  591 ? 26.069  79.010  10.816  1.00 40.36  ? 591  SER A OG    1 
ATOM   4494  N  N     . GLY A  1  592 ? 26.762  76.083  11.209  1.00 39.13  ? 592  GLY A N     1 
ATOM   4495  C  CA    . GLY A  1  592 ? 27.327  75.286  12.266  1.00 36.22  ? 592  GLY A CA    1 
ATOM   4496  C  C     . GLY A  1  592 ? 27.634  76.181  13.455  1.00 35.34  ? 592  GLY A C     1 
ATOM   4497  O  O     . GLY A  1  592 ? 28.171  75.728  14.458  1.00 35.69  ? 592  GLY A O     1 
ATOM   4498  N  N     . LYS A  1  593 ? 27.302  77.458  13.354  1.00 35.34  ? 593  LYS A N     1 
ATOM   4499  C  CA    . LYS A  1  593 ? 27.541  78.365  14.471  1.00 35.67  ? 593  LYS A CA    1 
ATOM   4500  C  C     . LYS A  1  593 ? 26.698  77.977  15.701  1.00 32.12  ? 593  LYS A C     1 
ATOM   4501  O  O     . LYS A  1  593 ? 25.481  77.811  15.606  1.00 32.93  ? 593  LYS A O     1 
ATOM   4502  C  CB    . LYS A  1  593 ? 27.196  79.808  14.083  1.00 39.70  ? 593  LYS A CB    1 
ATOM   4503  C  CG    . LYS A  1  593 ? 27.393  80.815  15.252  1.00 48.03  ? 593  LYS A CG    1 
ATOM   4504  C  CD    . LYS A  1  593 ? 27.228  82.297  14.843  1.00 55.41  ? 593  LYS A CD    1 
ATOM   4505  C  CE    . LYS A  1  593 ? 25.840  82.885  15.183  1.00 59.89  ? 593  LYS A CE    1 
ATOM   4506  N  NZ    . LYS A  1  593 ? 24.670  82.262  14.456  1.00 64.19  ? 593  LYS A NZ    1 
ATOM   4507  N  N     . VAL A  1  594 ? 27.343  77.858  16.850  1.00 26.92  ? 594  VAL A N     1 
ATOM   4508  C  CA    . VAL A  1  594 ? 26.639  77.520  18.086  1.00 27.78  ? 594  VAL A CA    1 
ATOM   4509  C  C     . VAL A  1  594 ? 26.378  78.768  18.917  1.00 26.07  ? 594  VAL A C     1 
ATOM   4510  O  O     . VAL A  1  594 ? 27.271  79.560  19.092  1.00 27.71  ? 594  VAL A O     1 
ATOM   4511  C  CB    . VAL A  1  594 ? 27.472  76.557  18.961  1.00 24.50  ? 594  VAL A CB    1 
ATOM   4512  C  CG1   . VAL A  1  594 ? 26.763  76.319  20.293  1.00 16.31  ? 594  VAL A CG1   1 
ATOM   4513  C  CG2   . VAL A  1  594 ? 27.695  75.239  18.223  1.00 26.44  ? 594  VAL A CG2   1 
ATOM   4514  N  N     . THR A  1  595 ? 25.163  78.933  19.428  1.00 26.71  ? 595  THR A N     1 
ATOM   4515  C  CA    . THR A  1  595 ? 24.840  80.069  20.284  1.00 27.09  ? 595  THR A CA    1 
ATOM   4516  C  C     . THR A  1  595 ? 24.428  79.542  21.673  1.00 27.14  ? 595  THR A C     1 
ATOM   4517  O  O     . THR A  1  595 ? 23.644  78.622  21.770  1.00 32.00  ? 595  THR A O     1 
ATOM   4518  C  CB    . THR A  1  595 ? 23.689  80.910  19.668  1.00 29.62  ? 595  THR A CB    1 
ATOM   4519  O  OG1   . THR A  1  595 ? 24.135  81.472  18.430  1.00 31.39  ? 595  THR A OG1   1 
ATOM   4520  C  CG2   . THR A  1  595 ? 23.251  82.034  20.615  1.00 24.93  ? 595  THR A CG2   1 
ATOM   4521  N  N     . LEU A  1  596 ? 24.967  80.123  22.739  1.00 27.10  ? 596  LEU A N     1 
ATOM   4522  C  CA    . LEU A  1  596 ? 24.655  79.692  24.095  1.00 25.91  ? 596  LEU A CA    1 
ATOM   4523  C  C     . LEU A  1  596 ? 23.901  80.751  24.923  1.00 27.41  ? 596  LEU A C     1 
ATOM   4524  O  O     . LEU A  1  596 ? 24.234  81.919  24.894  1.00 25.15  ? 596  LEU A O     1 
ATOM   4525  C  CB    . LEU A  1  596 ? 25.952  79.329  24.841  1.00 21.98  ? 596  LEU A CB    1 
ATOM   4526  C  CG    . LEU A  1  596 ? 26.874  78.300  24.194  1.00 23.82  ? 596  LEU A CG    1 
ATOM   4527  C  CD1   . LEU A  1  596 ? 28.073  78.060  25.108  1.00 22.47  ? 596  LEU A CD1   1 
ATOM   4528  C  CD2   . LEU A  1  596 ? 26.109  76.986  23.927  1.00 20.52  ? 596  LEU A CD2   1 
ATOM   4529  N  N     . LYS A  1  597 ? 22.882  80.306  25.647  1.00 23.67  ? 597  LYS A N     1 
ATOM   4530  C  CA    . LYS A  1  597 ? 22.088  81.146  26.536  1.00 27.79  ? 597  LYS A CA    1 
ATOM   4531  C  C     . LYS A  1  597 ? 21.916  80.363  27.837  1.00 26.60  ? 597  LYS A C     1 
ATOM   4532  O  O     . LYS A  1  597 ? 22.265  79.181  27.902  1.00 22.28  ? 597  LYS A O     1 
ATOM   4533  C  CB    . LYS A  1  597 ? 20.718  81.430  25.935  1.00 30.11  ? 597  LYS A CB    1 
ATOM   4534  C  CG    . LYS A  1  597 ? 20.805  82.260  24.698  1.00 36.75  ? 597  LYS A CG    1 
ATOM   4535  C  CD    . LYS A  1  597 ? 19.437  82.608  24.184  1.00 45.58  ? 597  LYS A CD    1 
ATOM   4536  C  CE    . LYS A  1  597 ? 19.573  83.413  22.886  1.00 51.00  ? 597  LYS A CE    1 
ATOM   4537  N  NZ    . LYS A  1  597 ? 20.621  84.495  23.043  1.00 52.31  ? 597  LYS A NZ    1 
ATOM   4538  N  N     . TYR A  1  598 ? 21.356  81.002  28.857  1.00 24.83  ? 598  TYR A N     1 
ATOM   4539  C  CA    . TYR A  1  598 ? 21.168  80.328  30.132  1.00 23.62  ? 598  TYR A CA    1 
ATOM   4540  C  C     . TYR A  1  598 ? 19.803  80.538  30.765  1.00 22.71  ? 598  TYR A C     1 
ATOM   4541  O  O     . TYR A  1  598 ? 19.157  81.550  30.530  1.00 25.02  ? 598  TYR A O     1 
ATOM   4542  C  CB    . TYR A  1  598 ? 22.270  80.757  31.086  1.00 17.80  ? 598  TYR A CB    1 
ATOM   4543  C  CG    . TYR A  1  598 ? 23.636  80.409  30.513  1.00 21.95  ? 598  TYR A CG    1 
ATOM   4544  C  CD1   . TYR A  1  598 ? 24.349  81.327  29.723  1.00 19.15  ? 598  TYR A CD1   1 
ATOM   4545  C  CD2   . TYR A  1  598 ? 24.169  79.118  30.685  1.00 20.71  ? 598  TYR A CD2   1 
ATOM   4546  C  CE1   . TYR A  1  598 ? 25.560  80.972  29.114  1.00 18.97  ? 598  TYR A CE1   1 
ATOM   4547  C  CE2   . TYR A  1  598 ? 25.374  78.749  30.077  1.00 21.55  ? 598  TYR A CE2   1 
ATOM   4548  C  CZ    . TYR A  1  598 ? 26.062  79.668  29.301  1.00 24.87  ? 598  TYR A CZ    1 
ATOM   4549  O  OH    . TYR A  1  598 ? 27.253  79.266  28.721  1.00 27.36  ? 598  TYR A OH    1 
ATOM   4550  N  N     . ARG A  1  599 ? 19.359  79.553  31.541  1.00 23.07  ? 599  ARG A N     1 
ATOM   4551  C  CA    . ARG A  1  599 ? 18.090  79.628  32.235  1.00 24.60  ? 599  ARG A CA    1 
ATOM   4552  C  C     . ARG A  1  599 ? 18.330  79.120  33.647  1.00 25.34  ? 599  ARG A C     1 
ATOM   4553  O  O     . ARG A  1  599 ? 19.212  78.311  33.882  1.00 23.41  ? 599  ARG A O     1 
ATOM   4554  C  CB    . ARG A  1  599 ? 17.000  78.811  31.529  1.00 23.64  ? 599  ARG A CB    1 
ATOM   4555  C  CG    . ARG A  1  599 ? 17.231  77.304  31.430  1.00 27.22  ? 599  ARG A CG    1 
ATOM   4556  C  CD    . ARG A  1  599 ? 16.025  76.641  30.794  1.00 23.04  ? 599  ARG A CD    1 
ATOM   4557  N  NE    . ARG A  1  599 ? 14.914  76.538  31.737  1.00 21.62  ? 599  ARG A NE    1 
ATOM   4558  C  CZ    . ARG A  1  599 ? 14.601  75.437  32.411  1.00 21.55  ? 599  ARG A CZ    1 
ATOM   4559  N  NH1   . ARG A  1  599 ? 15.309  74.326  32.246  1.00 21.09  ? 599  ARG A NH1   1 
ATOM   4560  N  NH2   . ARG A  1  599 ? 13.584  75.438  33.255  1.00 21.09  ? 599  ARG A NH2   1 
ATOM   4561  N  N     . PRO A  1  600 ? 17.550  79.613  34.607  1.00 27.89  ? 600  PRO A N     1 
ATOM   4562  C  CA    . PRO A  1  600 ? 17.699  79.202  36.010  1.00 28.01  ? 600  PRO A CA    1 
ATOM   4563  C  C     . PRO A  1  600 ? 17.283  77.772  36.343  1.00 28.66  ? 600  PRO A C     1 
ATOM   4564  O  O     . PRO A  1  600 ? 16.384  77.202  35.712  1.00 26.86  ? 600  PRO A O     1 
ATOM   4565  C  CB    . PRO A  1  600 ? 16.832  80.228  36.773  1.00 27.21  ? 600  PRO A CB    1 
ATOM   4566  C  CG    . PRO A  1  600 ? 16.749  81.424  35.824  1.00 27.39  ? 600  PRO A CG    1 
ATOM   4567  C  CD    . PRO A  1  600 ? 16.618  80.747  34.480  1.00 31.09  ? 600  PRO A CD    1 
ATOM   4568  N  N     . VAL A  1  601 ? 17.959  77.209  37.340  1.00 25.95  ? 601  VAL A N     1 
ATOM   4569  C  CA    . VAL A  1  601 ? 17.634  75.879  37.839  1.00 26.84  ? 601  VAL A CA    1 
ATOM   4570  C  C     . VAL A  1  601 ? 16.393  76.071  38.716  1.00 25.44  ? 601  VAL A C     1 
ATOM   4571  O  O     . VAL A  1  601 ? 16.262  77.093  39.376  1.00 31.07  ? 601  VAL A O     1 
ATOM   4572  C  CB    . VAL A  1  601 ? 18.751  75.320  38.738  1.00 21.47  ? 601  VAL A CB    1 
ATOM   4573  C  CG1   . VAL A  1  601 ? 18.266  74.085  39.425  1.00 20.68  ? 601  VAL A CG1   1 
ATOM   4574  C  CG2   . VAL A  1  601 ? 19.993  75.030  37.917  1.00 21.34  ? 601  VAL A CG2   1 
ATOM   4575  N  N     . ILE A  1  602 ? 15.487  75.112  38.714  1.00 24.64  ? 602  ILE A N     1 
ATOM   4576  C  CA    . ILE A  1  602 ? 14.292  75.199  39.547  1.00 27.76  ? 602  ILE A CA    1 
ATOM   4577  C  C     . ILE A  1  602 ? 14.572  74.524  40.895  1.00 30.79  ? 602  ILE A C     1 
ATOM   4578  O  O     . ILE A  1  602 ? 14.806  73.303  40.938  1.00 30.81  ? 602  ILE A O     1 
ATOM   4579  C  CB    . ILE A  1  602 ? 13.124  74.481  38.876  1.00 25.05  ? 602  ILE A CB    1 
ATOM   4580  C  CG1   . ILE A  1  602 ? 12.743  75.227  37.590  1.00 29.15  ? 602  ILE A CG1   1 
ATOM   4581  C  CG2   . ILE A  1  602 ? 11.920  74.407  39.836  1.00 24.11  ? 602  ILE A CG2   1 
ATOM   4582  C  CD1   . ILE A  1  602 ? 11.628  74.543  36.810  1.00 26.56  ? 602  ILE A CD1   1 
ATOM   4583  N  N     . ASP A  1  603 ? 14.537  75.298  41.982  1.00 29.10  ? 603  ASP A N     1 
ATOM   4584  C  CA    . ASP A  1  603 ? 14.798  74.757  43.320  1.00 28.77  ? 603  ASP A CA    1 
ATOM   4585  C  C     . ASP A  1  603 ? 13.546  74.371  44.095  1.00 30.90  ? 603  ASP A C     1 
ATOM   4586  O  O     . ASP A  1  603 ? 13.615  73.553  45.017  1.00 32.45  ? 603  ASP A O     1 
ATOM   4587  C  CB    . ASP A  1  603 ? 15.612  75.743  44.182  1.00 32.48  ? 603  ASP A CB    1 
ATOM   4588  C  CG    . ASP A  1  603 ? 17.051  75.905  43.704  1.00 32.55  ? 603  ASP A CG    1 
ATOM   4589  O  OD1   . ASP A  1  603 ? 17.618  74.972  43.078  1.00 35.82  ? 603  ASP A OD1   1 
ATOM   4590  O  OD2   . ASP A  1  603 ? 17.630  76.977  43.973  1.00 37.05  ? 603  ASP A OD2   1 
ATOM   4591  N  N     . ARG A  1  604 ? 12.404  74.951  43.745  1.00 31.32  ? 604  ARG A N     1 
ATOM   4592  C  CA    . ARG A  1  604 ? 11.176  74.630  44.454  1.00 30.48  ? 604  ARG A CA    1 
ATOM   4593  C  C     . ARG A  1  604 ? 10.726  73.191  44.162  1.00 30.29  ? 604  ARG A C     1 
ATOM   4594  O  O     . ARG A  1  604 ? 10.930  72.666  43.066  1.00 31.48  ? 604  ARG A O     1 
ATOM   4595  C  CB    . ARG A  1  604 ? 10.072  75.635  44.072  1.00 37.04  ? 604  ARG A CB    1 
ATOM   4596  C  CG    . ARG A  1  604 ? 9.373   75.381  42.737  1.00 45.81  ? 604  ARG A CG    1 
ATOM   4597  C  CD    . ARG A  1  604 ? 8.633   76.646  42.247  1.00 52.99  ? 604  ARG A CD    1 
ATOM   4598  N  NE    . ARG A  1  604 ? 9.469   77.487  41.378  1.00 58.60  ? 604  ARG A NE    1 
ATOM   4599  C  CZ    . ARG A  1  604 ? 9.469   77.426  40.043  1.00 59.94  ? 604  ARG A CZ    1 
ATOM   4600  N  NH1   . ARG A  1  604 ? 8.670   76.578  39.403  1.00 59.08  ? 604  ARG A NH1   1 
ATOM   4601  N  NH2   . ARG A  1  604 ? 10.295  78.192  39.341  1.00 62.95  ? 604  ARG A NH2   1 
ATOM   4602  N  N     . THR A  1  605 ? 10.145  72.535  45.150  1.00 26.39  ? 605  THR A N     1 
ATOM   4603  C  CA    . THR A  1  605 ? 9.666   71.183  44.937  1.00 27.23  ? 605  THR A CA    1 
ATOM   4604  C  C     . THR A  1  605 ? 8.194   71.320  44.541  1.00 30.36  ? 605  THR A C     1 
ATOM   4605  O  O     . THR A  1  605 ? 7.738   72.430  44.252  1.00 26.85  ? 605  THR A O     1 
ATOM   4606  C  CB    . THR A  1  605 ? 9.791   70.319  46.213  1.00 26.22  ? 605  THR A CB    1 
ATOM   4607  O  OG1   . THR A  1  605 ? 8.792   70.722  47.167  1.00 21.23  ? 605  THR A OG1   1 
ATOM   4608  C  CG2   . THR A  1  605 ? 11.195  70.458  46.814  1.00 22.41  ? 605  THR A CG2   1 
ATOM   4609  N  N     . LEU A  1  606 ? 7.457   70.216  44.508  1.00 27.48  ? 606  LEU A N     1 
ATOM   4610  C  CA    . LEU A  1  606 ? 6.056   70.291  44.150  1.00 31.02  ? 606  LEU A CA    1 
ATOM   4611  C  C     . LEU A  1  606 ? 5.199   70.590  45.372  1.00 33.57  ? 606  LEU A C     1 
ATOM   4612  O  O     . LEU A  1  606 ? 3.990   70.814  45.246  1.00 32.71  ? 606  LEU A O     1 
ATOM   4613  C  CB    . LEU A  1  606 ? 5.584   68.975  43.507  1.00 34.34  ? 606  LEU A CB    1 
ATOM   4614  C  CG    . LEU A  1  606 ? 6.251   68.582  42.178  1.00 34.66  ? 606  LEU A CG    1 
ATOM   4615  C  CD1   . LEU A  1  606 ? 5.681   67.255  41.672  1.00 36.23  ? 606  LEU A CD1   1 
ATOM   4616  C  CD2   . LEU A  1  606 ? 6.015   69.683  41.145  1.00 36.24  ? 606  LEU A CD2   1 
ATOM   4617  N  N     . ASN A  1  607 ? 5.810   70.585  46.555  1.00 30.19  ? 607  ASN A N     1 
ATOM   4618  C  CA    . ASN A  1  607 ? 5.075   70.842  47.784  1.00 30.25  ? 607  ASN A CA    1 
ATOM   4619  C  C     . ASN A  1  607 ? 6.067   70.955  48.948  1.00 30.13  ? 607  ASN A C     1 
ATOM   4620  O  O     . ASN A  1  607 ? 6.423   69.960  49.559  1.00 28.73  ? 607  ASN A O     1 
ATOM   4621  C  CB    . ASN A  1  607 ? 4.078   69.703  48.041  1.00 33.00  ? 607  ASN A CB    1 
ATOM   4622  C  CG    . ASN A  1  607 ? 3.339   69.868  49.364  1.00 37.36  ? 607  ASN A CG    1 
ATOM   4623  O  OD1   . ASN A  1  607 ? 3.515   70.868  50.045  1.00 37.76  ? 607  ASN A OD1   1 
ATOM   4624  N  ND2   . ASN A  1  607 ? 2.509   68.888  49.729  1.00 37.23  ? 607  ASN A ND2   1 
ATOM   4625  N  N     . GLU A  1  608 ? 6.507   72.178  49.229  1.00 31.48  ? 608  GLU A N     1 
ATOM   4626  C  CA    . GLU A  1  608 ? 7.484   72.445  50.264  1.00 32.82  ? 608  GLU A CA    1 
ATOM   4627  C  C     . GLU A  1  608 ? 7.131   71.774  51.557  1.00 33.24  ? 608  GLU A C     1 
ATOM   4628  O  O     . GLU A  1  608 ? 8.005   71.308  52.267  1.00 29.18  ? 608  GLU A O     1 
ATOM   4629  C  CB    . GLU A  1  608 ? 7.629   73.946  50.500  1.00 34.73  ? 608  GLU A CB    1 
ATOM   4630  C  CG    . GLU A  1  608 ? 8.713   74.329  51.535  1.00 36.56  ? 608  GLU A CG    1 
ATOM   4631  C  CD    . GLU A  1  608 ? 10.145  73.913  51.113  1.00 44.08  ? 608  GLU A CD    1 
ATOM   4632  O  OE1   . GLU A  1  608 ? 10.334  73.549  49.933  1.00 46.24  ? 608  GLU A OE1   1 
ATOM   4633  O  OE2   . GLU A  1  608 ? 11.089  73.959  51.952  1.00 41.23  ? 608  GLU A OE2   1 
ATOM   4634  N  N     . GLU A  1  609 ? 5.842   71.701  51.845  1.00 33.50  ? 609  GLU A N     1 
ATOM   4635  C  CA    . GLU A  1  609 ? 5.386   71.102  53.083  1.00 37.37  ? 609  GLU A CA    1 
ATOM   4636  C  C     . GLU A  1  609 ? 5.566   69.581  53.148  1.00 37.89  ? 609  GLU A C     1 
ATOM   4637  O  O     . GLU A  1  609 ? 5.830   69.035  54.225  1.00 36.78  ? 609  GLU A O     1 
ATOM   4638  C  CB    . GLU A  1  609 ? 3.913   71.459  53.328  1.00 41.52  ? 609  GLU A CB    1 
ATOM   4639  C  CG    . GLU A  1  609 ? 3.602   72.977  53.411  1.00 52.62  ? 609  GLU A CG    1 
ATOM   4640  C  CD    . GLU A  1  609 ? 3.650   73.719  52.052  1.00 58.52  ? 609  GLU A CD    1 
ATOM   4641  O  OE1   . GLU A  1  609 ? 2.998   73.271  51.074  1.00 56.89  ? 609  GLU A OE1   1 
ATOM   4642  O  OE2   . GLU A  1  609 ? 4.333   74.773  51.973  1.00 63.57  ? 609  GLU A OE2   1 
ATOM   4643  N  N     . ASP A  1  610 ? 5.432   68.891  52.018  1.00 35.36  ? 610  ASP A N     1 
ATOM   4644  C  CA    . ASP A  1  610 ? 5.595   67.432  52.014  1.00 35.21  ? 610  ASP A CA    1 
ATOM   4645  C  C     . ASP A  1  610 ? 7.051   67.011  51.727  1.00 35.98  ? 610  ASP A C     1 
ATOM   4646  O  O     . ASP A  1  610 ? 7.523   66.000  52.233  1.00 35.35  ? 610  ASP A O     1 
ATOM   4647  C  CB    . ASP A  1  610 ? 4.676   66.787  50.970  1.00 34.79  ? 610  ASP A CB    1 
ATOM   4648  C  CG    . ASP A  1  610 ? 4.547   65.271  51.159  1.00 36.93  ? 610  ASP A CG    1 
ATOM   4649  O  OD1   . ASP A  1  610 ? 4.483   64.517  50.167  1.00 38.90  ? 610  ASP A OD1   1 
ATOM   4650  O  OD2   . ASP A  1  610 ? 4.492   64.818  52.309  1.00 37.05  ? 610  ASP A OD2   1 
ATOM   4651  N  N     . CYS A  1  611 ? 7.753   67.790  50.911  1.00 35.09  ? 611  CYS A N     1 
ATOM   4652  C  CA    . CYS A  1  611 ? 9.140   67.494  50.550  1.00 32.66  ? 611  CYS A CA    1 
ATOM   4653  C  C     . CYS A  1  611 ? 9.798   68.845  50.399  1.00 30.37  ? 611  CYS A C     1 
ATOM   4654  O  O     . CYS A  1  611 ? 9.515   69.567  49.441  1.00 28.02  ? 611  CYS A O     1 
ATOM   4655  C  CB    . CYS A  1  611 ? 9.184   66.745  49.216  1.00 34.21  ? 611  CYS A CB    1 
ATOM   4656  S  SG    . CYS A  1  611 ? 10.826  66.232  48.697  1.00 41.29  ? 611  CYS A SG    1 
ATOM   4657  N  N     . SER A  1  612 ? 10.662  69.210  51.344  1.00 28.98  ? 612  SER A N     1 
ATOM   4658  C  CA    . SER A  1  612 ? 11.280  70.534  51.281  1.00 30.54  ? 612  SER A CA    1 
ATOM   4659  C  C     . SER A  1  612 ? 12.497  70.607  50.379  1.00 29.47  ? 612  SER A C     1 
ATOM   4660  O  O     . SER A  1  612 ? 13.214  69.632  50.208  1.00 28.17  ? 612  SER A O     1 
ATOM   4661  C  CB    . SER A  1  612 ? 11.618  71.040  52.683  1.00 35.57  ? 612  SER A CB    1 
ATOM   4662  O  OG    . SER A  1  612 ? 12.498  70.164  53.338  1.00 43.12  ? 612  SER A OG    1 
ATOM   4663  N  N     . SER A  1  613 ? 12.681  71.771  49.768  1.00 27.25  ? 613  SER A N     1 
ATOM   4664  C  CA    . SER A  1  613 ? 13.761  72.024  48.849  1.00 27.70  ? 613  SER A CA    1 
ATOM   4665  C  C     . SER A  1  613 ? 15.114  71.804  49.531  1.00 29.47  ? 613  SER A C     1 
ATOM   4666  O  O     . SER A  1  613 ? 15.262  72.114  50.716  1.00 31.60  ? 613  SER A O     1 
ATOM   4667  C  CB    . SER A  1  613 ? 13.640  73.462  48.312  1.00 25.45  ? 613  SER A CB    1 
ATOM   4668  O  OG    . SER A  1  613 ? 14.643  73.750  47.346  1.00 34.30  ? 613  SER A OG    1 
ATOM   4669  N  N     . VAL A  1  614 ? 16.087  71.260  48.796  1.00 24.23  ? 614  VAL A N     1 
ATOM   4670  C  CA    . VAL A  1  614 ? 17.413  71.028  49.351  1.00 24.94  ? 614  VAL A CA    1 
ATOM   4671  C  C     . VAL A  1  614 ? 18.362  72.071  48.801  1.00 24.74  ? 614  VAL A C     1 
ATOM   4672  O  O     . VAL A  1  614 ? 18.720  72.034  47.636  1.00 28.10  ? 614  VAL A O     1 
ATOM   4673  C  CB    . VAL A  1  614 ? 17.955  69.645  48.998  1.00 25.52  ? 614  VAL A CB    1 
ATOM   4674  C  CG1   . VAL A  1  614 ? 19.247  69.397  49.742  1.00 27.32  ? 614  VAL A CG1   1 
ATOM   4675  C  CG2   . VAL A  1  614 ? 16.942  68.591  49.344  1.00 28.61  ? 614  VAL A CG2   1 
ATOM   4676  N  N     . PRO A  1  615 ? 18.773  73.033  49.643  1.00 25.77  ? 615  PRO A N     1 
ATOM   4677  C  CA    . PRO A  1  615 ? 19.688  74.086  49.197  1.00 27.00  ? 615  PRO A CA    1 
ATOM   4678  C  C     . PRO A  1  615 ? 21.066  73.522  48.875  1.00 22.47  ? 615  PRO A C     1 
ATOM   4679  O  O     . PRO A  1  615 ? 21.478  72.510  49.425  1.00 25.30  ? 615  PRO A O     1 
ATOM   4680  C  CB    . PRO A  1  615 ? 19.713  75.060  50.391  1.00 28.48  ? 615  PRO A CB    1 
ATOM   4681  C  CG    . PRO A  1  615 ? 19.546  74.143  51.552  1.00 30.08  ? 615  PRO A CG    1 
ATOM   4682  C  CD    . PRO A  1  615 ? 18.471  73.164  51.085  1.00 27.73  ? 615  PRO A CD    1 
ATOM   4683  N  N     . PRO A  1  616 ? 21.792  74.178  47.975  1.00 23.84  ? 616  PRO A N     1 
ATOM   4684  C  CA    . PRO A  1  616 ? 23.137  73.729  47.584  1.00 26.18  ? 616  PRO A CA    1 
ATOM   4685  C  C     . PRO A  1  616 ? 24.031  73.544  48.810  1.00 30.51  ? 616  PRO A C     1 
ATOM   4686  O  O     . PRO A  1  616 ? 23.902  74.293  49.790  1.00 29.93  ? 616  PRO A O     1 
ATOM   4687  C  CB    . PRO A  1  616 ? 23.644  74.874  46.717  1.00 25.51  ? 616  PRO A CB    1 
ATOM   4688  C  CG    . PRO A  1  616 ? 22.389  75.484  46.148  1.00 23.55  ? 616  PRO A CG    1 
ATOM   4689  C  CD    . PRO A  1  616 ? 21.445  75.461  47.321  1.00 22.57  ? 616  PRO A CD    1 
ATOM   4690  N  N     . ALA A  1  617 ? 24.935  72.567  48.754  1.00 27.31  ? 617  ALA A N     1 
ATOM   4691  C  CA    . ALA A  1  617 ? 25.855  72.307  49.860  1.00 30.40  ? 617  ALA A CA    1 
ATOM   4692  C  C     . ALA A  1  617 ? 27.134  71.688  49.295  1.00 29.65  ? 617  ALA A C     1 
ATOM   4693  O  O     . ALA A  1  617 ? 27.191  71.360  48.119  1.00 26.81  ? 617  ALA A O     1 
ATOM   4694  C  CB    . ALA A  1  617 ? 25.205  71.349  50.893  1.00 26.37  ? 617  ALA A CB    1 
ATOM   4695  N  N     . ILE A  1  618 ? 28.170  71.548  50.109  1.00 26.66  ? 618  ILE A N     1 
ATOM   4696  C  CA    . ILE A  1  618 ? 29.377  70.920  49.583  1.00 29.99  ? 618  ILE A CA    1 
ATOM   4697  C  C     . ILE A  1  618 ? 28.984  69.467  49.287  1.00 28.60  ? 618  ILE A C     1 
ATOM   4698  O  O     . ILE A  1  618 ? 28.267  68.841  50.060  1.00 28.29  ? 618  ILE A O     1 
ATOM   4699  C  CB    . ILE A  1  618 ? 30.520  70.957  50.605  1.00 28.10  ? 618  ILE A CB    1 
ATOM   4700  C  CG1   . ILE A  1  618 ? 31.039  72.388  50.728  1.00 31.85  ? 618  ILE A CG1   1 
ATOM   4701  C  CG2   . ILE A  1  618 ? 31.649  70.058  50.159  1.00 31.89  ? 618  ILE A CG2   1 
ATOM   4702  C  CD1   . ILE A  1  618 ? 31.647  72.700  52.065  1.00 33.11  ? 618  ILE A CD1   1 
ATOM   4703  N  N     . ARG A  1  619 ? 29.445  68.944  48.160  1.00 30.00  ? 619  ARG A N     1 
ATOM   4704  C  CA    . ARG A  1  619 ? 29.113  67.586  47.739  1.00 24.69  ? 619  ARG A CA    1 
ATOM   4705  C  C     . ARG A  1  619 ? 30.273  66.627  47.934  1.00 26.43  ? 619  ARG A C     1 
ATOM   4706  O  O     . ARG A  1  619 ? 31.313  66.755  47.304  1.00 24.35  ? 619  ARG A O     1 
ATOM   4707  C  CB    . ARG A  1  619 ? 28.699  67.640  46.280  1.00 25.51  ? 619  ARG A CB    1 
ATOM   4708  C  CG    . ARG A  1  619 ? 28.284  66.334  45.647  1.00 27.75  ? 619  ARG A CG    1 
ATOM   4709  C  CD    . ARG A  1  619 ? 27.619  66.693  44.351  1.00 27.29  ? 619  ARG A CD    1 
ATOM   4710  N  NE    . ARG A  1  619 ? 27.262  65.558  43.509  1.00 24.48  ? 619  ARG A NE    1 
ATOM   4711  C  CZ    . ARG A  1  619 ? 28.124  64.844  42.812  1.00 22.41  ? 619  ARG A CZ    1 
ATOM   4712  N  NH1   . ARG A  1  619 ? 29.419  65.128  42.854  1.00 23.53  ? 619  ARG A NH1   1 
ATOM   4713  N  NH2   . ARG A  1  619 ? 27.687  63.869  42.037  1.00 20.66  ? 619  ARG A NH2   1 
ATOM   4714  N  N     . SER A  1  620 ? 30.119  65.680  48.850  1.00 31.57  ? 620  SER A N     1 
ATOM   4715  C  CA    . SER A  1  620 ? 31.192  64.718  49.085  1.00 34.40  ? 620  SER A CA    1 
ATOM   4716  C  C     . SER A  1  620 ? 30.678  63.320  49.416  1.00 33.97  ? 620  SER A C     1 
ATOM   4717  O  O     . SER A  1  620 ? 29.626  63.135  50.039  1.00 31.55  ? 620  SER A O     1 
ATOM   4718  C  CB    . SER A  1  620 ? 32.124  65.200  50.197  1.00 33.51  ? 620  SER A CB    1 
ATOM   4719  O  OG    . SER A  1  620 ? 31.361  65.762  51.239  1.00 43.34  ? 620  SER A OG    1 
ATOM   4720  N  N     . TYR A  1  621 ? 31.439  62.339  48.956  1.00 33.34  ? 621  TYR A N     1 
ATOM   4721  C  CA    . TYR A  1  621 ? 31.127  60.951  49.192  1.00 33.79  ? 621  TYR A CA    1 
ATOM   4722  C  C     . TYR A  1  621 ? 32.357  60.333  49.887  1.00 33.49  ? 621  TYR A C     1 
ATOM   4723  O  O     . TYR A  1  621 ? 32.123  59.359  50.632  1.00 36.84  ? 621  TYR A O     1 
ATOM   4724  C  CB    . TYR A  1  621 ? 30.792  60.243  47.847  1.00 30.82  ? 621  TYR A CB    1 
ATOM   4725  C  CG    . TYR A  1  621 ? 29.526  60.756  47.168  1.00 26.56  ? 621  TYR A CG    1 
ATOM   4726  C  CD1   . TYR A  1  621 ? 29.560  61.863  46.315  1.00 27.28  ? 621  TYR A CD1   1 
ATOM   4727  C  CD2   . TYR A  1  621 ? 28.286  60.169  47.426  1.00 24.52  ? 621  TYR A CD2   1 
ATOM   4728  C  CE1   . TYR A  1  621 ? 28.398  62.370  45.730  1.00 25.67  ? 621  TYR A CE1   1 
ATOM   4729  C  CE2   . TYR A  1  621 ? 27.107  60.677  46.856  1.00 23.78  ? 621  TYR A CE2   1 
ATOM   4730  C  CZ    . TYR A  1  621 ? 27.185  61.777  46.003  1.00 25.80  ? 621  TYR A CZ    1 
ATOM   4731  O  OH    . TYR A  1  621 ? 26.056  62.279  45.406  1.00 28.21  ? 621  TYR A OH    1 
ATOM   4732  N  N     . THR B  2  8   ? 53.322  42.906  8.729   1.00 67.92  ? 8    THR B N     1 
ATOM   4733  C  CA    . THR B  2  8   ? 53.003  41.576  9.337   1.00 66.67  ? 8    THR B CA    1 
ATOM   4734  C  C     . THR B  2  8   ? 51.487  41.453  9.499   1.00 64.26  ? 8    THR B C     1 
ATOM   4735  O  O     . THR B  2  8   ? 50.981  41.231  10.606  1.00 66.12  ? 8    THR B O     1 
ATOM   4736  C  CB    . THR B  2  8   ? 53.707  41.412  10.729  1.00 68.33  ? 8    THR B CB    1 
ATOM   4737  O  OG1   . THR B  2  8   ? 53.256  40.211  11.372  1.00 69.23  ? 8    THR B OG1   1 
ATOM   4738  C  CG2   . THR B  2  8   ? 53.418  42.615  11.633  1.00 68.91  ? 8    THR B CG2   1 
ATOM   4739  N  N     . SER B  2  9   ? 50.760  41.581  8.392   1.00 58.22  ? 9    SER B N     1 
ATOM   4740  C  CA    . SER B  2  9   ? 49.317  41.506  8.479   1.00 51.57  ? 9    SER B CA    1 
ATOM   4741  C  C     . SER B  2  9   ? 48.836  40.058  8.461   1.00 48.64  ? 9    SER B C     1 
ATOM   4742  O  O     . SER B  2  9   ? 49.588  39.152  8.106   1.00 49.83  ? 9    SER B O     1 
ATOM   4743  C  CB    . SER B  2  9   ? 48.692  42.286  7.328   1.00 51.45  ? 9    SER B CB    1 
ATOM   4744  O  OG    . SER B  2  9   ? 49.022  41.691  6.086   1.00 44.53  ? 9    SER B OG    1 
ATOM   4745  N  N     . ARG B  2  10  ? 47.589  39.841  8.868   1.00 44.31  ? 10   ARG B N     1 
ATOM   4746  C  CA    . ARG B  2  10  ? 46.998  38.508  8.882   1.00 38.35  ? 10   ARG B CA    1 
ATOM   4747  C  C     . ARG B  2  10  ? 45.679  38.638  8.135   1.00 37.07  ? 10   ARG B C     1 
ATOM   4748  O  O     . ARG B  2  10  ? 44.648  38.951  8.724   1.00 36.35  ? 10   ARG B O     1 
ATOM   4749  C  CB    . ARG B  2  10  ? 46.776  38.029  10.328  1.00 39.13  ? 10   ARG B CB    1 
ATOM   4750  C  CG    . ARG B  2  10  ? 48.060  37.629  11.067  1.00 37.69  ? 10   ARG B CG    1 
ATOM   4751  C  CD    . ARG B  2  10  ? 47.785  37.047  12.462  1.00 37.64  ? 10   ARG B CD    1 
ATOM   4752  N  NE    . ARG B  2  10  ? 47.172  38.038  13.352  1.00 39.24  ? 10   ARG B NE    1 
ATOM   4753  C  CZ    . ARG B  2  10  ? 45.988  37.896  13.934  1.00 36.79  ? 10   ARG B CZ    1 
ATOM   4754  N  NH1   . ARG B  2  10  ? 45.270  36.796  13.742  1.00 33.83  ? 10   ARG B NH1   1 
ATOM   4755  N  NH2   . ARG B  2  10  ? 45.502  38.874  14.684  1.00 41.91  ? 10   ARG B NH2   1 
ATOM   4756  N  N     . ILE B  2  11  ? 45.738  38.411  6.825   1.00 36.27  ? 11   ILE B N     1 
ATOM   4757  C  CA    . ILE B  2  11  ? 44.591  38.552  5.940   1.00 31.63  ? 11   ILE B CA    1 
ATOM   4758  C  C     . ILE B  2  11  ? 43.652  37.379  6.003   1.00 31.83  ? 11   ILE B C     1 
ATOM   4759  O  O     . ILE B  2  11  ? 44.017  36.264  5.663   1.00 30.57  ? 11   ILE B O     1 
ATOM   4760  C  CB    . ILE B  2  11  ? 45.055  38.769  4.485   1.00 33.04  ? 11   ILE B CB    1 
ATOM   4761  C  CG1   . ILE B  2  11  ? 45.974  39.984  4.432   1.00 34.49  ? 11   ILE B CG1   1 
ATOM   4762  C  CG2   . ILE B  2  11  ? 43.865  38.983  3.557   1.00 28.53  ? 11   ILE B CG2   1 
ATOM   4763  C  CD1   . ILE B  2  11  ? 45.328  41.255  4.934   1.00 40.22  ? 11   ILE B CD1   1 
ATOM   4764  N  N     . LYS B  2  12  ? 42.428  37.661  6.437   1.00 29.74  ? 12   LYS B N     1 
ATOM   4765  C  CA    . LYS B  2  12  ? 41.389  36.653  6.577   1.00 28.16  ? 12   LYS B CA    1 
ATOM   4766  C  C     . LYS B  2  12  ? 40.369  36.923  5.506   1.00 27.73  ? 12   LYS B C     1 
ATOM   4767  O  O     . LYS B  2  12  ? 40.067  38.098  5.204   1.00 21.76  ? 12   LYS B O     1 
ATOM   4768  C  CB    . LYS B  2  12  ? 40.728  36.782  7.954   1.00 30.93  ? 12   LYS B CB    1 
ATOM   4769  C  CG    . LYS B  2  12  ? 39.529  35.882  8.210   1.00 23.06  ? 12   LYS B CG    1 
ATOM   4770  C  CD    . LYS B  2  12  ? 39.941  34.433  8.325   1.00 23.41  ? 12   LYS B CD    1 
ATOM   4771  C  CE    . LYS B  2  12  ? 38.725  33.500  8.384   1.00 28.84  ? 12   LYS B CE    1 
ATOM   4772  N  NZ    . LYS B  2  12  ? 39.154  32.085  8.603   1.00 31.20  ? 12   LYS B NZ    1 
ATOM   4773  N  N     . LYS B  2  13  ? 39.841  35.849  4.931   1.00 27.64  ? 13   LYS B N     1 
ATOM   4774  C  CA    . LYS B  2  13  ? 38.839  35.979  3.886   1.00 30.60  ? 13   LYS B CA    1 
ATOM   4775  C  C     . LYS B  2  13  ? 37.450  35.609  4.366   1.00 28.37  ? 13   LYS B C     1 
ATOM   4776  O  O     . LYS B  2  13  ? 37.276  34.613  5.045   1.00 28.78  ? 13   LYS B O     1 
ATOM   4777  C  CB    . LYS B  2  13  ? 39.168  35.096  2.694   1.00 32.60  ? 13   LYS B CB    1 
ATOM   4778  C  CG    . LYS B  2  13  ? 40.424  35.465  1.988   1.00 37.43  ? 13   LYS B CG    1 
ATOM   4779  C  CD    . LYS B  2  13  ? 40.423  34.812  0.630   1.00 45.32  ? 13   LYS B CD    1 
ATOM   4780  C  CE    . LYS B  2  13  ? 41.779  34.916  -0.030  1.00 49.89  ? 13   LYS B CE    1 
ATOM   4781  N  NZ    . LYS B  2  13  ? 41.763  34.171  -1.314  1.00 53.57  ? 13   LYS B NZ    1 
ATOM   4782  N  N     . PHE B  2  14  ? 36.477  36.426  3.971   1.00 26.79  ? 14   PHE B N     1 
ATOM   4783  C  CA    . PHE B  2  14  ? 35.074  36.228  4.283   1.00 25.64  ? 14   PHE B CA    1 
ATOM   4784  C  C     . PHE B  2  14  ? 34.306  36.227  2.951   1.00 25.73  ? 14   PHE B C     1 
ATOM   4785  O  O     . PHE B  2  14  ? 34.522  37.094  2.116   1.00 27.80  ? 14   PHE B O     1 
ATOM   4786  C  CB    . PHE B  2  14  ? 34.544  37.371  5.162   1.00 21.20  ? 14   PHE B CB    1 
ATOM   4787  C  CG    . PHE B  2  14  ? 35.147  37.416  6.545   1.00 21.47  ? 14   PHE B CG    1 
ATOM   4788  C  CD1   . PHE B  2  14  ? 36.278  38.182  6.810   1.00 21.32  ? 14   PHE B CD1   1 
ATOM   4789  C  CD2   . PHE B  2  14  ? 34.576  36.697  7.578   1.00 22.44  ? 14   PHE B CD2   1 
ATOM   4790  C  CE1   . PHE B  2  14  ? 36.826  38.232  8.083   1.00 21.74  ? 14   PHE B CE1   1 
ATOM   4791  C  CE2   . PHE B  2  14  ? 35.117  36.737  8.863   1.00 25.46  ? 14   PHE B CE2   1 
ATOM   4792  C  CZ    . PHE B  2  14  ? 36.250  37.513  9.111   1.00 24.76  ? 14   PHE B CZ    1 
ATOM   4793  N  N     . SER B  2  15  ? 33.438  35.243  2.764   1.00 23.40  ? 15   SER B N     1 
ATOM   4794  C  CA    . SER B  2  15  ? 32.612  35.127  1.576   1.00 24.86  ? 15   SER B CA    1 
ATOM   4795  C  C     . SER B  2  15  ? 31.213  35.386  2.118   1.00 24.77  ? 15   SER B C     1 
ATOM   4796  O  O     . SER B  2  15  ? 30.684  34.590  2.927   1.00 22.33  ? 15   SER B O     1 
ATOM   4797  C  CB    . SER B  2  15  ? 32.700  33.707  0.998   1.00 25.80  ? 15   SER B CB    1 
ATOM   4798  O  OG    . SER B  2  15  ? 31.865  33.567  -0.141  1.00 30.40  ? 15   SER B OG    1 
ATOM   4799  N  N     . ILE B  2  16  ? 30.608  36.478  1.649   1.00 20.52  ? 16   ILE B N     1 
ATOM   4800  C  CA    . ILE B  2  16  ? 29.316  36.910  2.142   1.00 18.77  ? 16   ILE B CA    1 
ATOM   4801  C  C     . ILE B  2  16  ? 28.185  36.984  1.101   1.00 21.50  ? 16   ILE B C     1 
ATOM   4802  O  O     . ILE B  2  16  ? 28.371  37.495  0.003   1.00 19.02  ? 16   ILE B O     1 
ATOM   4803  C  CB    . ILE B  2  16  ? 29.500  38.310  2.824   1.00 20.64  ? 16   ILE B CB    1 
ATOM   4804  C  CG1   . ILE B  2  16  ? 30.646  38.235  3.842   1.00 16.50  ? 16   ILE B CG1   1 
ATOM   4805  C  CG2   . ILE B  2  16  ? 28.204  38.781  3.479   1.00 15.91  ? 16   ILE B CG2   1 
ATOM   4806  C  CD1   . ILE B  2  16  ? 30.964  39.567  4.518   1.00 18.55  ? 16   ILE B CD1   1 
ATOM   4807  N  N     . TYR B  2  17  ? 27.017  36.464  1.481   1.00 20.78  ? 17   TYR B N     1 
ATOM   4808  C  CA    . TYR B  2  17  ? 25.825  36.462  0.632   1.00 21.59  ? 17   TYR B CA    1 
ATOM   4809  C  C     . TYR B  2  17  ? 25.393  37.906  0.301   1.00 24.49  ? 17   TYR B C     1 
ATOM   4810  O  O     . TYR B  2  17  ? 25.346  38.772  1.177   1.00 24.46  ? 17   TYR B O     1 
ATOM   4811  C  CB    . TYR B  2  17  ? 24.703  35.720  1.361   1.00 20.41  ? 17   TYR B CB    1 
ATOM   4812  C  CG    . TYR B  2  17  ? 23.376  35.636  0.630   1.00 20.95  ? 17   TYR B CG    1 
ATOM   4813  C  CD1   . TYR B  2  17  ? 23.045  34.507  -0.119  1.00 17.97  ? 17   TYR B CD1   1 
ATOM   4814  C  CD2   . TYR B  2  17  ? 22.433  36.661  0.742   1.00 20.07  ? 17   TYR B CD2   1 
ATOM   4815  C  CE1   . TYR B  2  17  ? 21.795  34.395  -0.725  1.00 20.77  ? 17   TYR B CE1   1 
ATOM   4816  C  CE2   . TYR B  2  17  ? 21.181  36.560  0.135   1.00 21.13  ? 17   TYR B CE2   1 
ATOM   4817  C  CZ    . TYR B  2  17  ? 20.873  35.420  -0.582  1.00 19.30  ? 17   TYR B CZ    1 
ATOM   4818  O  OH    . TYR B  2  17  ? 19.625  35.264  -1.096  1.00 24.69  ? 17   TYR B OH    1 
ATOM   4819  N  N     . ARG B  2  18  ? 25.086  38.160  -0.969  1.00 21.98  ? 18   ARG B N     1 
ATOM   4820  C  CA    . ARG B  2  18  ? 24.667  39.482  -1.417  1.00 19.99  ? 18   ARG B CA    1 
ATOM   4821  C  C     . ARG B  2  18  ? 23.432  39.413  -2.290  1.00 21.97  ? 18   ARG B C     1 
ATOM   4822  O  O     . ARG B  2  18  ? 23.278  38.477  -3.057  1.00 19.66  ? 18   ARG B O     1 
ATOM   4823  C  CB    . ARG B  2  18  ? 25.791  40.121  -2.223  1.00 22.80  ? 18   ARG B CB    1 
ATOM   4824  C  CG    . ARG B  2  18  ? 27.031  40.388  -1.359  1.00 24.75  ? 18   ARG B CG    1 
ATOM   4825  C  CD    . ARG B  2  18  ? 26.718  41.558  -0.410  1.00 24.99  ? 18   ARG B CD    1 
ATOM   4826  N  NE    . ARG B  2  18  ? 27.623  42.580  -0.852  1.00 32.59  ? 18   ARG B NE    1 
ATOM   4827  C  CZ    . ARG B  2  18  ? 27.348  43.849  -1.055  1.00 22.58  ? 18   ARG B CZ    1 
ATOM   4828  N  NH1   . ARG B  2  18  ? 26.154  44.374  -0.845  1.00 22.17  ? 18   ARG B NH1   1 
ATOM   4829  N  NH2   . ARG B  2  18  ? 28.320  44.580  -1.535  1.00 34.90  ? 18   ARG B NH2   1 
ATOM   4830  N  N     . TRP B  2  19  ? 22.543  40.393  -2.125  1.00 17.76  ? 19   TRP B N     1 
ATOM   4831  C  CA    . TRP B  2  19  ? 21.350  40.527  -2.928  1.00 18.47  ? 19   TRP B CA    1 
ATOM   4832  C  C     . TRP B  2  19  ? 20.788  41.909  -2.729  1.00 21.24  ? 19   TRP B C     1 
ATOM   4833  O  O     . TRP B  2  19  ? 20.498  42.324  -1.600  1.00 23.18  ? 19   TRP B O     1 
ATOM   4834  C  CB    . TRP B  2  19  ? 20.279  39.509  -2.589  1.00 13.62  ? 19   TRP B CB    1 
ATOM   4835  C  CG    . TRP B  2  19  ? 19.192  39.607  -3.611  1.00 19.69  ? 19   TRP B CG    1 
ATOM   4836  C  CD1   . TRP B  2  19  ? 19.296  39.302  -4.935  1.00 16.93  ? 19   TRP B CD1   1 
ATOM   4837  C  CD2   . TRP B  2  19  ? 17.879  40.161  -3.427  1.00 21.30  ? 19   TRP B CD2   1 
ATOM   4838  N  NE1   . TRP B  2  19  ? 18.140  39.641  -5.599  1.00 21.13  ? 19   TRP B NE1   1 
ATOM   4839  C  CE2   . TRP B  2  19  ? 17.248  40.167  -4.700  1.00 22.06  ? 19   TRP B CE2   1 
ATOM   4840  C  CE3   . TRP B  2  19  ? 17.174  40.649  -2.313  1.00 17.60  ? 19   TRP B CE3   1 
ATOM   4841  C  CZ2   . TRP B  2  19  ? 15.943  40.645  -4.894  1.00 19.67  ? 19   TRP B CZ2   1 
ATOM   4842  C  CZ3   . TRP B  2  19  ? 15.862  41.128  -2.505  1.00 21.03  ? 19   TRP B CZ3   1 
ATOM   4843  C  CH2   . TRP B  2  19  ? 15.267  41.121  -3.788  1.00 23.75  ? 19   TRP B CH2   1 
ATOM   4844  N  N     . ASP B  2  20  ? 20.622  42.629  -3.830  1.00 21.45  ? 20   ASP B N     1 
ATOM   4845  C  CA    . ASP B  2  20  ? 20.122  44.011  -3.786  1.00 18.85  ? 20   ASP B CA    1 
ATOM   4846  C  C     . ASP B  2  20  ? 18.699  44.141  -4.315  1.00 17.38  ? 20   ASP B C     1 
ATOM   4847  O  O     . ASP B  2  20  ? 18.453  43.959  -5.500  1.00 18.47  ? 20   ASP B O     1 
ATOM   4848  C  CB    . ASP B  2  20  ? 21.061  44.897  -4.604  1.00 19.43  ? 20   ASP B CB    1 
ATOM   4849  C  CG    . ASP B  2  20  ? 20.721  46.378  -4.491  1.00 25.20  ? 20   ASP B CG    1 
ATOM   4850  O  OD1   . ASP B  2  20  ? 19.626  46.712  -3.999  1.00 22.66  ? 20   ASP B OD1   1 
ATOM   4851  O  OD2   . ASP B  2  20  ? 21.560  47.212  -4.914  1.00 25.48  ? 20   ASP B OD2   1 
ATOM   4852  N  N     . PRO B  2  21  ? 17.738  44.459  -3.433  1.00 22.90  ? 21   PRO B N     1 
ATOM   4853  C  CA    . PRO B  2  21  ? 16.349  44.601  -3.874  1.00 25.30  ? 21   PRO B CA    1 
ATOM   4854  C  C     . PRO B  2  21  ? 16.171  45.656  -4.973  1.00 31.00  ? 21   PRO B C     1 
ATOM   4855  O  O     . PRO B  2  21  ? 15.249  45.567  -5.799  1.00 27.20  ? 21   PRO B O     1 
ATOM   4856  C  CB    . PRO B  2  21  ? 15.612  44.980  -2.591  1.00 24.91  ? 21   PRO B CB    1 
ATOM   4857  C  CG    . PRO B  2  21  ? 16.680  45.673  -1.770  1.00 27.71  ? 21   PRO B CG    1 
ATOM   4858  C  CD    . PRO B  2  21  ? 17.868  44.771  -1.992  1.00 21.84  ? 21   PRO B CD    1 
ATOM   4859  N  N     . ASP B  2  22  ? 17.029  46.668  -4.974  1.00 29.28  ? 22   ASP B N     1 
ATOM   4860  C  CA    . ASP B  2  22  ? 16.902  47.701  -5.990  1.00 32.46  ? 22   ASP B CA    1 
ATOM   4861  C  C     . ASP B  2  22  ? 17.463  47.292  -7.372  1.00 34.45  ? 22   ASP B C     1 
ATOM   4862  O  O     . ASP B  2  22  ? 17.318  48.023  -8.348  1.00 34.37  ? 22   ASP B O     1 
ATOM   4863  C  CB    . ASP B  2  22  ? 17.503  49.013  -5.473  1.00 25.87  ? 22   ASP B CB    1 
ATOM   4864  C  CG    . ASP B  2  22  ? 16.637  49.644  -4.371  1.00 33.70  ? 22   ASP B CG    1 
ATOM   4865  O  OD1   . ASP B  2  22  ? 15.402  49.767  -4.576  1.00 26.38  ? 22   ASP B OD1   1 
ATOM   4866  O  OD2   . ASP B  2  22  ? 17.167  50.013  -3.294  1.00 34.96  ? 22   ASP B OD2   1 
ATOM   4867  N  N     . LYS B  2  23  ? 18.093  46.124  -7.465  1.00 33.50  ? 23   LYS B N     1 
ATOM   4868  C  CA    . LYS B  2  23  ? 18.586  45.605  -8.751  1.00 32.80  ? 23   LYS B CA    1 
ATOM   4869  C  C     . LYS B  2  23  ? 18.182  44.159  -8.642  1.00 32.88  ? 23   LYS B C     1 
ATOM   4870  O  O     . LYS B  2  23  ? 19.008  43.246  -8.720  1.00 34.47  ? 23   LYS B O     1 
ATOM   4871  C  CB    . LYS B  2  23  ? 20.109  45.700  -8.856  1.00 35.91  ? 23   LYS B CB    1 
ATOM   4872  C  CG    . LYS B  2  23  ? 20.658  47.112  -8.753  1.00 36.53  ? 23   LYS B CG    1 
ATOM   4873  C  CD    . LYS B  2  23  ? 22.172  47.062  -8.820  1.00 35.66  ? 23   LYS B CD    1 
ATOM   4874  C  CE    . LYS B  2  23  ? 22.797  48.380  -8.445  1.00 39.52  ? 23   LYS B CE    1 
ATOM   4875  N  NZ    . LYS B  2  23  ? 24.272  48.242  -8.422  1.00 36.10  ? 23   LYS B NZ    1 
ATOM   4876  N  N     . PRO B  2  24  ? 16.884  43.931  -8.470  1.00 34.17  ? 24   PRO B N     1 
ATOM   4877  C  CA    . PRO B  2  24  ? 16.323  42.588  -8.314  1.00 36.99  ? 24   PRO B CA    1 
ATOM   4878  C  C     . PRO B  2  24  ? 16.866  41.507  -9.233  1.00 38.47  ? 24   PRO B C     1 
ATOM   4879  O  O     . PRO B  2  24  ? 17.135  40.398  -8.791  1.00 41.32  ? 24   PRO B O     1 
ATOM   4880  C  CB    . PRO B  2  24  ? 14.817  42.821  -8.487  1.00 35.48  ? 24   PRO B CB    1 
ATOM   4881  C  CG    . PRO B  2  24  ? 14.770  44.037  -9.405  1.00 31.82  ? 24   PRO B CG    1 
ATOM   4882  C  CD    . PRO B  2  24  ? 15.826  44.907  -8.790  1.00 30.33  ? 24   PRO B CD    1 
ATOM   4883  N  N     . GLY B  2  25  ? 17.031  41.847  -10.502 1.00 38.49  ? 25   GLY B N     1 
ATOM   4884  C  CA    . GLY B  2  25  ? 17.499  40.901  -11.489 1.00 35.41  ? 25   GLY B CA    1 
ATOM   4885  C  C     . GLY B  2  25  ? 18.813  40.237  -11.207 1.00 34.55  ? 25   GLY B C     1 
ATOM   4886  O  O     . GLY B  2  25  ? 19.007  39.108  -11.636 1.00 33.39  ? 25   GLY B O     1 
ATOM   4887  N  N     . ASP B  2  26  ? 19.734  40.921  -10.529 1.00 33.59  ? 26   ASP B N     1 
ATOM   4888  C  CA    . ASP B  2  26  ? 21.006  40.288  -10.210 1.00 28.39  ? 26   ASP B CA    1 
ATOM   4889  C  C     . ASP B  2  26  ? 20.791  39.223  -9.153  1.00 27.92  ? 26   ASP B C     1 
ATOM   4890  O  O     . ASP B  2  26  ? 20.403  39.517  -8.020  1.00 28.28  ? 26   ASP B O     1 
ATOM   4891  C  CB    . ASP B  2  26  ? 22.013  41.317  -9.728  1.00 34.99  ? 26   ASP B CB    1 
ATOM   4892  C  CG    . ASP B  2  26  ? 22.350  42.335  -10.801 1.00 42.00  ? 26   ASP B CG    1 
ATOM   4893  O  OD1   . ASP B  2  26  ? 22.169  42.004  -12.003 1.00 47.85  ? 26   ASP B OD1   1 
ATOM   4894  O  OD2   . ASP B  2  26  ? 22.807  43.449  -10.453 1.00 44.47  ? 26   ASP B OD2   1 
ATOM   4895  N  N     . LYS B  2  27  ? 21.057  37.981  -9.526  1.00 26.62  ? 27   LYS B N     1 
ATOM   4896  C  CA    . LYS B  2  27  ? 20.862  36.853  -8.645  1.00 29.49  ? 27   LYS B CA    1 
ATOM   4897  C  C     . LYS B  2  27  ? 21.777  36.904  -7.430  1.00 26.17  ? 27   LYS B C     1 
ATOM   4898  O  O     . LYS B  2  27  ? 22.875  37.455  -7.485  1.00 25.61  ? 27   LYS B O     1 
ATOM   4899  C  CB    . LYS B  2  27  ? 21.109  35.529  -9.402  1.00 34.77  ? 27   LYS B CB    1 
ATOM   4900  C  CG    . LYS B  2  27  ? 20.138  35.246  -10.544 1.00 40.59  ? 27   LYS B CG    1 
ATOM   4901  C  CD    . LYS B  2  27  ? 18.687  35.345  -10.057 1.00 51.48  ? 27   LYS B CD    1 
ATOM   4902  C  CE    . LYS B  2  27  ? 17.678  35.467  -11.210 1.00 54.66  ? 27   LYS B CE    1 
ATOM   4903  N  NZ    . LYS B  2  27  ? 16.352  36.050  -10.780 1.00 58.36  ? 27   LYS B NZ    1 
ATOM   4904  N  N     . PRO B  2  28  ? 21.321  36.322  -6.317  1.00 24.36  ? 28   PRO B N     1 
ATOM   4905  C  CA    . PRO B  2  28  ? 22.083  36.277  -5.071  1.00 20.66  ? 28   PRO B CA    1 
ATOM   4906  C  C     . PRO B  2  28  ? 23.435  35.716  -5.433  1.00 27.04  ? 28   PRO B C     1 
ATOM   4907  O  O     . PRO B  2  28  ? 23.525  34.795  -6.253  1.00 29.72  ? 28   PRO B O     1 
ATOM   4908  C  CB    . PRO B  2  28  ? 21.293  35.305  -4.219  1.00 25.32  ? 28   PRO B CB    1 
ATOM   4909  C  CG    . PRO B  2  28  ? 19.812  35.563  -4.689  1.00 20.88  ? 28   PRO B CG    1 
ATOM   4910  C  CD    . PRO B  2  28  ? 20.021  35.618  -6.200  1.00 23.59  ? 28   PRO B CD    1 
ATOM   4911  N  N     . ARG B  2  29  ? 24.498  36.264  -4.854  1.00 26.15  ? 29   ARG B N     1 
ATOM   4912  C  CA    . ARG B  2  29  ? 25.847  35.789  -5.154  1.00 26.68  ? 29   ARG B CA    1 
ATOM   4913  C  C     . ARG B  2  29  ? 26.648  35.904  -3.875  1.00 28.46  ? 29   ARG B C     1 
ATOM   4914  O  O     . ARG B  2  29  ? 26.160  36.461  -2.900  1.00 30.04  ? 29   ARG B O     1 
ATOM   4915  C  CB    . ARG B  2  29  ? 26.473  36.699  -6.207  1.00 28.17  ? 29   ARG B CB    1 
ATOM   4916  C  CG    . ARG B  2  29  ? 26.523  38.113  -5.731  1.00 27.80  ? 29   ARG B CG    1 
ATOM   4917  C  CD    . ARG B  2  29  ? 27.130  39.125  -6.709  1.00 35.23  ? 29   ARG B CD    1 
ATOM   4918  N  NE    . ARG B  2  29  ? 26.945  40.488  -6.175  1.00 37.70  ? 29   ARG B NE    1 
ATOM   4919  C  CZ    . ARG B  2  29  ? 27.897  41.211  -5.578  1.00 39.53  ? 29   ARG B CZ    1 
ATOM   4920  N  NH1   . ARG B  2  29  ? 29.137  40.727  -5.446  1.00 41.27  ? 29   ARG B NH1   1 
ATOM   4921  N  NH2   . ARG B  2  29  ? 27.594  42.404  -5.061  1.00 36.76  ? 29   ARG B NH2   1 
ATOM   4922  N  N     . MET B  2  30  ? 27.873  35.386  -3.870  1.00 29.36  ? 30   MET B N     1 
ATOM   4923  C  CA    . MET B  2  30  ? 28.722  35.500  -2.696  1.00 28.33  ? 30   MET B CA    1 
ATOM   4924  C  C     . MET B  2  30  ? 29.844  36.440  -3.074  1.00 30.22  ? 30   MET B C     1 
ATOM   4925  O  O     . MET B  2  30  ? 30.364  36.362  -4.188  1.00 29.67  ? 30   MET B O     1 
ATOM   4926  C  CB    . MET B  2  30  ? 29.334  34.157  -2.305  1.00 28.23  ? 30   MET B CB    1 
ATOM   4927  C  CG    . MET B  2  30  ? 28.340  33.057  -1.961  1.00 27.87  ? 30   MET B CG    1 
ATOM   4928  S  SD    . MET B  2  30  ? 27.308  33.472  -0.560  1.00 27.01  ? 30   MET B SD    1 
ATOM   4929  C  CE    . MET B  2  30  ? 28.468  33.158  0.759   1.00 28.25  ? 30   MET B CE    1 
ATOM   4930  N  N     . GLN B  2  31  ? 30.211  37.332  -2.160  1.00 28.19  ? 31   GLN B N     1 
ATOM   4931  C  CA    . GLN B  2  31  ? 31.309  38.255  -2.406  1.00 25.94  ? 31   GLN B CA    1 
ATOM   4932  C  C     . GLN B  2  31  ? 32.377  38.043  -1.331  1.00 26.98  ? 31   GLN B C     1 
ATOM   4933  O  O     . GLN B  2  31  ? 32.076  37.947  -0.133  1.00 26.88  ? 31   GLN B O     1 
ATOM   4934  C  CB    . GLN B  2  31  ? 30.842  39.713  -2.360  1.00 27.04  ? 31   GLN B CB    1 
ATOM   4935  C  CG    . GLN B  2  31  ? 31.934  40.703  -2.826  1.00 20.52  ? 31   GLN B CG    1 
ATOM   4936  C  CD    . GLN B  2  31  ? 31.419  42.107  -3.027  1.00 24.63  ? 31   GLN B CD    1 
ATOM   4937  O  OE1   . GLN B  2  31  ? 30.251  42.310  -3.358  1.00 30.39  ? 31   GLN B OE1   1 
ATOM   4938  N  NE2   . GLN B  2  31  ? 32.285  43.091  -2.828  1.00 24.78  ? 31   GLN B NE2   1 
ATOM   4939  N  N     . THR B  2  32  ? 33.621  37.977  -1.767  1.00 24.93  ? 32   THR B N     1 
ATOM   4940  C  CA    . THR B  2  32  ? 34.754  37.761  -0.881  1.00 27.28  ? 32   THR B CA    1 
ATOM   4941  C  C     . THR B  2  32  ? 35.393  39.073  -0.467  1.00 26.15  ? 32   THR B C     1 
ATOM   4942  O  O     . THR B  2  32  ? 35.555  39.996  -1.272  1.00 27.85  ? 32   THR B O     1 
ATOM   4943  C  CB    . THR B  2  32  ? 35.829  36.918  -1.586  1.00 25.24  ? 32   THR B CB    1 
ATOM   4944  O  OG1   . THR B  2  32  ? 35.235  35.699  -2.028  1.00 28.30  ? 32   THR B OG1   1 
ATOM   4945  C  CG2   . THR B  2  32  ? 36.982  36.623  -0.650  1.00 28.09  ? 32   THR B CG2   1 
ATOM   4946  N  N     . TYR B  2  33  ? 35.769  39.151  0.790   1.00 27.03  ? 33   TYR B N     1 
ATOM   4947  C  CA    . TYR B  2  33  ? 36.403  40.359  1.286   1.00 26.98  ? 33   TYR B CA    1 
ATOM   4948  C  C     . TYR B  2  33  ? 37.615  39.919  2.047   1.00 28.05  ? 33   TYR B C     1 
ATOM   4949  O  O     . TYR B  2  33  ? 37.576  38.884  2.730   1.00 29.48  ? 33   TYR B O     1 
ATOM   4950  C  CB    . TYR B  2  33  ? 35.480  41.125  2.231   1.00 21.51  ? 33   TYR B CB    1 
ATOM   4951  C  CG    . TYR B  2  33  ? 34.200  41.629  1.591   1.00 20.98  ? 33   TYR B CG    1 
ATOM   4952  C  CD1   . TYR B  2  33  ? 33.031  40.889  1.691   1.00 17.40  ? 33   TYR B CD1   1 
ATOM   4953  C  CD2   . TYR B  2  33  ? 34.161  42.876  0.924   1.00 14.11  ? 33   TYR B CD2   1 
ATOM   4954  C  CE1   . TYR B  2  33  ? 31.837  41.370  1.165   1.00 23.42  ? 33   TYR B CE1   1 
ATOM   4955  C  CE2   . TYR B  2  33  ? 33.012  43.353  0.389   1.00 16.97  ? 33   TYR B CE2   1 
ATOM   4956  C  CZ    . TYR B  2  33  ? 31.834  42.608  0.512   1.00 24.13  ? 33   TYR B CZ    1 
ATOM   4957  O  OH    . TYR B  2  33  ? 30.644  43.099  0.016   1.00 25.73  ? 33   TYR B OH    1 
ATOM   4958  N  N     . GLU B  2  34  ? 38.688  40.692  1.933   1.00 28.79  ? 34   GLU B N     1 
ATOM   4959  C  CA    . GLU B  2  34  ? 39.918  40.385  2.653   1.00 28.51  ? 34   GLU B CA    1 
ATOM   4960  C  C     . GLU B  2  34  ? 40.095  41.360  3.804   1.00 27.85  ? 34   GLU B C     1 
ATOM   4961  O  O     . GLU B  2  34  ? 40.097  42.564  3.605   1.00 23.71  ? 34   GLU B O     1 
ATOM   4962  C  CB    . GLU B  2  34  ? 41.099  40.425  1.689   1.00 33.73  ? 34   GLU B CB    1 
ATOM   4963  C  CG    . GLU B  2  34  ? 40.975  39.280  0.675   1.00 43.25  ? 34   GLU B CG    1 
ATOM   4964  C  CD    . GLU B  2  34  ? 42.155  39.132  -0.281  1.00 49.42  ? 34   GLU B CD    1 
ATOM   4965  O  OE1   . GLU B  2  34  ? 42.204  38.102  -1.005  1.00 53.80  ? 34   GLU B OE1   1 
ATOM   4966  O  OE2   . GLU B  2  34  ? 43.023  40.030  -0.317  1.00 53.70  ? 34   GLU B OE2   1 
ATOM   4967  N  N     . VAL B  2  35  ? 40.222  40.824  5.017   1.00 25.08  ? 35   VAL B N     1 
ATOM   4968  C  CA    . VAL B  2  35  ? 40.356  41.647  6.199   1.00 26.28  ? 35   VAL B CA    1 
ATOM   4969  C  C     . VAL B  2  35  ? 41.629  41.338  7.016   1.00 27.49  ? 35   VAL B C     1 
ATOM   4970  O  O     . VAL B  2  35  ? 41.928  40.180  7.325   1.00 27.71  ? 35   VAL B O     1 
ATOM   4971  C  CB    . VAL B  2  35  ? 39.092  41.462  7.091   1.00 29.82  ? 35   VAL B CB    1 
ATOM   4972  C  CG1   . VAL B  2  35  ? 39.250  42.194  8.408   1.00 32.60  ? 35   VAL B CG1   1 
ATOM   4973  C  CG2   . VAL B  2  35  ? 37.865  41.971  6.344   1.00 30.59  ? 35   VAL B CG2   1 
ATOM   4974  N  N     . ASP B  2  36  ? 42.370  42.384  7.366   1.00 26.21  ? 36   ASP B N     1 
ATOM   4975  C  CA    . ASP B  2  36  ? 43.570  42.220  8.156   1.00 29.90  ? 36   ASP B CA    1 
ATOM   4976  C  C     . ASP B  2  36  ? 43.179  42.170  9.624   1.00 30.50  ? 36   ASP B C     1 
ATOM   4977  O  O     . ASP B  2  36  ? 42.837  43.194  10.210  1.00 32.63  ? 36   ASP B O     1 
ATOM   4978  C  CB    . ASP B  2  36  ? 44.556  43.378  7.942   1.00 31.25  ? 36   ASP B CB    1 
ATOM   4979  C  CG    . ASP B  2  36  ? 45.744  43.300  8.893   1.00 31.47  ? 36   ASP B CG    1 
ATOM   4980  O  OD1   . ASP B  2  36  ? 45.933  42.241  9.549   1.00 30.93  ? 36   ASP B OD1   1 
ATOM   4981  O  OD2   . ASP B  2  36  ? 46.487  44.293  8.992   1.00 36.77  ? 36   ASP B OD2   1 
ATOM   4982  N  N     . LEU B  2  37  ? 43.269  40.977  10.205  1.00 31.65  ? 37   LEU B N     1 
ATOM   4983  C  CA    . LEU B  2  37  ? 42.898  40.750  11.581  1.00 30.49  ? 37   LEU B CA    1 
ATOM   4984  C  C     . LEU B  2  37  ? 43.668  41.561  12.614  1.00 33.15  ? 37   LEU B C     1 
ATOM   4985  O  O     . LEU B  2  37  ? 43.205  41.709  13.748  1.00 34.47  ? 37   LEU B O     1 
ATOM   4986  C  CB    . LEU B  2  37  ? 43.002  39.258  11.911  1.00 32.04  ? 37   LEU B CB    1 
ATOM   4987  C  CG    . LEU B  2  37  ? 42.198  38.342  10.985  1.00 34.68  ? 37   LEU B CG    1 
ATOM   4988  C  CD1   . LEU B  2  37  ? 42.233  36.931  11.534  1.00 28.65  ? 37   LEU B CD1   1 
ATOM   4989  C  CD2   . LEU B  2  37  ? 40.748  38.827  10.883  1.00 30.26  ? 37   LEU B CD2   1 
ATOM   4990  N  N     . ASN B  2  38  ? 44.835  42.077  12.255  1.00 32.86  ? 38   ASN B N     1 
ATOM   4991  C  CA    . ASN B  2  38  ? 45.592  42.872  13.212  1.00 35.47  ? 38   ASN B CA    1 
ATOM   4992  C  C     . ASN B  2  38  ? 45.010  44.249  13.351  1.00 32.08  ? 38   ASN B C     1 
ATOM   4993  O  O     . ASN B  2  38  ? 45.421  45.001  14.214  1.00 33.39  ? 38   ASN B O     1 
ATOM   4994  C  CB    . ASN B  2  38  ? 47.054  43.019  12.804  1.00 34.99  ? 38   ASN B CB    1 
ATOM   4995  C  CG    . ASN B  2  38  ? 47.801  41.724  12.883  1.00 40.59  ? 38   ASN B CG    1 
ATOM   4996  O  OD1   . ASN B  2  38  ? 47.701  40.989  13.878  1.00 39.22  ? 38   ASN B OD1   1 
ATOM   4997  N  ND2   . ASN B  2  38  ? 48.574  41.427  11.838  1.00 42.82  ? 38   ASN B ND2   1 
ATOM   4998  N  N     . LYS B  2  39  ? 44.079  44.597  12.476  1.00 30.38  ? 39   LYS B N     1 
ATOM   4999  C  CA    . LYS B  2  39  ? 43.458  45.905  12.552  1.00 28.57  ? 39   LYS B CA    1 
ATOM   5000  C  C     . LYS B  2  39  ? 41.959  45.746  12.648  1.00 26.80  ? 39   LYS B C     1 
ATOM   5001  O  O     . LYS B  2  39  ? 41.205  46.578  12.142  1.00 26.15  ? 39   LYS B O     1 
ATOM   5002  C  CB    . LYS B  2  39  ? 43.805  46.731  11.323  1.00 28.05  ? 39   LYS B CB    1 
ATOM   5003  C  CG    . LYS B  2  39  ? 45.280  46.982  11.150  1.00 33.32  ? 39   LYS B CG    1 
ATOM   5004  C  CD    . LYS B  2  39  ? 45.506  47.963  10.011  1.00 44.68  ? 39   LYS B CD    1 
ATOM   5005  C  CE    . LYS B  2  39  ? 46.972  48.033  9.571   1.00 47.86  ? 39   LYS B CE    1 
ATOM   5006  N  NZ    . LYS B  2  39  ? 47.135  48.894  8.343   1.00 48.35  ? 39   LYS B NZ    1 
ATOM   5007  N  N     . CYS B  2  40  ? 41.536  44.677  13.303  1.00 26.89  ? 40   CYS B N     1 
ATOM   5008  C  CA    . CYS B  2  40  ? 40.112  44.392  13.458  1.00 26.81  ? 40   CYS B CA    1 
ATOM   5009  C  C     . CYS B  2  40  ? 39.826  43.804  14.835  1.00 25.59  ? 40   CYS B C     1 
ATOM   5010  O  O     . CYS B  2  40  ? 40.677  43.095  15.390  1.00 24.61  ? 40   CYS B O     1 
ATOM   5011  C  CB    . CYS B  2  40  ? 39.678  43.383  12.388  1.00 22.02  ? 40   CYS B CB    1 
ATOM   5012  S  SG    . CYS B  2  40  ? 37.904  43.018  12.345  1.00 27.71  ? 40   CYS B SG    1 
ATOM   5013  N  N     . GLY B  2  41  ? 38.641  44.093  15.384  1.00 22.50  ? 41   GLY B N     1 
ATOM   5014  C  CA    . GLY B  2  41  ? 38.258  43.501  16.667  1.00 20.06  ? 41   GLY B CA    1 
ATOM   5015  C  C     . GLY B  2  41  ? 38.170  41.983  16.499  1.00 21.45  ? 41   GLY B C     1 
ATOM   5016  O  O     . GLY B  2  41  ? 38.232  41.468  15.361  1.00 23.88  ? 41   GLY B O     1 
ATOM   5017  N  N     . PRO B  2  42  ? 37.966  41.228  17.589  1.00 20.57  ? 42   PRO B N     1 
ATOM   5018  C  CA    . PRO B  2  42  ? 37.892  39.757  17.543  1.00 20.94  ? 42   PRO B CA    1 
ATOM   5019  C  C     . PRO B  2  42  ? 36.614  39.064  17.060  1.00 19.26  ? 42   PRO B C     1 
ATOM   5020  O  O     . PRO B  2  42  ? 36.636  37.883  16.760  1.00 18.24  ? 42   PRO B O     1 
ATOM   5021  C  CB    . PRO B  2  42  ? 38.219  39.371  18.992  1.00 23.09  ? 42   PRO B CB    1 
ATOM   5022  C  CG    . PRO B  2  42  ? 37.523  40.470  19.768  1.00 20.19  ? 42   PRO B CG    1 
ATOM   5023  C  CD    . PRO B  2  42  ? 37.824  41.730  18.978  1.00 19.60  ? 42   PRO B CD    1 
ATOM   5024  N  N     . MET B  2  43  ? 35.499  39.785  16.992  1.00 19.69  ? 43   MET B N     1 
ATOM   5025  C  CA    . MET B  2  43  ? 34.234  39.170  16.583  1.00 18.82  ? 43   MET B CA    1 
ATOM   5026  C  C     . MET B  2  43  ? 33.875  39.372  15.117  1.00 19.22  ? 43   MET B C     1 
ATOM   5027  O  O     . MET B  2  43  ? 34.328  40.335  14.498  1.00 17.11  ? 43   MET B O     1 
ATOM   5028  C  CB    . MET B  2  43  ? 33.097  39.690  17.470  1.00 12.81  ? 43   MET B CB    1 
ATOM   5029  C  CG    . MET B  2  43  ? 33.393  39.531  18.973  1.00 16.71  ? 43   MET B CG    1 
ATOM   5030  S  SD    . MET B  2  43  ? 33.615  37.760  19.503  1.00 22.72  ? 43   MET B SD    1 
ATOM   5031  C  CE    . MET B  2  43  ? 33.851  38.072  21.201  1.00 17.91  ? 43   MET B CE    1 
ATOM   5032  N  N     . VAL B  2  44  ? 33.083  38.448  14.562  1.00 21.54  ? 44   VAL B N     1 
ATOM   5033  C  CA    . VAL B  2  44  ? 32.650  38.559  13.156  1.00 21.64  ? 44   VAL B CA    1 
ATOM   5034  C  C     . VAL B  2  44  ? 31.961  39.923  12.893  1.00 23.18  ? 44   VAL B C     1 
ATOM   5035  O  O     . VAL B  2  44  ? 32.168  40.535  11.850  1.00 22.89  ? 44   VAL B O     1 
ATOM   5036  C  CB    . VAL B  2  44  ? 31.676  37.405  12.764  1.00 21.03  ? 44   VAL B CB    1 
ATOM   5037  C  CG1   . VAL B  2  44  ? 31.100  37.658  11.367  1.00 21.59  ? 44   VAL B CG1   1 
ATOM   5038  C  CG2   . VAL B  2  44  ? 32.407  36.056  12.790  1.00 23.66  ? 44   VAL B CG2   1 
ATOM   5039  N  N     . LEU B  2  45  ? 31.156  40.419  13.834  1.00 24.70  ? 45   LEU B N     1 
ATOM   5040  C  CA    . LEU B  2  45  ? 30.520  41.729  13.622  1.00 25.45  ? 45   LEU B CA    1 
ATOM   5041  C  C     . LEU B  2  45  ? 31.595  42.836  13.438  1.00 24.67  ? 45   LEU B C     1 
ATOM   5042  O  O     . LEU B  2  45  ? 31.414  43.779  12.645  1.00 23.45  ? 45   LEU B O     1 
ATOM   5043  C  CB    . LEU B  2  45  ? 29.593  42.079  14.802  1.00 20.56  ? 45   LEU B CB    1 
ATOM   5044  C  CG    . LEU B  2  45  ? 28.838  43.424  14.680  1.00 24.86  ? 45   LEU B CG    1 
ATOM   5045  C  CD1   . LEU B  2  45  ? 28.011  43.455  13.372  1.00 22.63  ? 45   LEU B CD1   1 
ATOM   5046  C  CD2   . LEU B  2  45  ? 27.924  43.657  15.887  1.00 17.78  ? 45   LEU B CD2   1 
ATOM   5047  N  N     . ASP B  2  46  ? 32.720  42.714  14.149  1.00 22.15  ? 46   ASP B N     1 
ATOM   5048  C  CA    . ASP B  2  46  ? 33.793  43.709  14.029  1.00 21.82  ? 46   ASP B CA    1 
ATOM   5049  C  C     . ASP B  2  46  ? 34.267  43.757  12.568  1.00 17.59  ? 46   ASP B C     1 
ATOM   5050  O  O     . ASP B  2  46  ? 34.431  44.845  11.990  1.00 15.28  ? 46   ASP B O     1 
ATOM   5051  C  CB    . ASP B  2  46  ? 34.969  43.374  14.968  1.00 22.02  ? 46   ASP B CB    1 
ATOM   5052  C  CG    . ASP B  2  46  ? 34.600  43.511  16.440  1.00 25.67  ? 46   ASP B CG    1 
ATOM   5053  O  OD1   . ASP B  2  46  ? 33.914  44.505  16.794  1.00 27.86  ? 46   ASP B OD1   1 
ATOM   5054  O  OD2   . ASP B  2  46  ? 34.998  42.637  17.245  1.00 22.60  ? 46   ASP B OD2   1 
ATOM   5055  N  N     . ALA B  2  47  ? 34.500  42.588  11.993  1.00 12.53  ? 47   ALA B N     1 
ATOM   5056  C  CA    . ALA B  2  47  ? 34.898  42.472  10.575  1.00 13.86  ? 47   ALA B CA    1 
ATOM   5057  C  C     . ALA B  2  47  ? 33.830  43.005  9.634   1.00 13.72  ? 47   ALA B C     1 
ATOM   5058  O  O     . ALA B  2  47  ? 34.143  43.636  8.624   1.00 18.09  ? 47   ALA B O     1 
ATOM   5059  C  CB    . ALA B  2  47  ? 35.180  40.984  10.226  1.00 14.31  ? 47   ALA B CB    1 
ATOM   5060  N  N     . LEU B  2  48  ? 32.553  42.705  9.933   1.00 16.23  ? 48   LEU B N     1 
ATOM   5061  C  CA    . LEU B  2  48  ? 31.472  43.184  9.088   1.00 14.59  ? 48   LEU B CA    1 
ATOM   5062  C  C     . LEU B  2  48  ? 31.455  44.708  9.103   1.00 18.28  ? 48   LEU B C     1 
ATOM   5063  O  O     . LEU B  2  48  ? 31.330  45.336  8.049   1.00 18.81  ? 48   LEU B O     1 
ATOM   5064  C  CB    . LEU B  2  48  ? 30.111  42.639  9.555   1.00 18.52  ? 48   LEU B CB    1 
ATOM   5065  C  CG    . LEU B  2  48  ? 29.831  41.137  9.287   1.00 23.48  ? 48   LEU B CG    1 
ATOM   5066  C  CD1   . LEU B  2  48  ? 28.468  40.795  9.876   1.00 19.35  ? 48   LEU B CD1   1 
ATOM   5067  C  CD2   . LEU B  2  48  ? 29.863  40.796  7.774   1.00 16.23  ? 48   LEU B CD2   1 
ATOM   5068  N  N     . ILE B  2  49  ? 31.584  45.312  10.290  1.00 14.50  ? 49   ILE B N     1 
ATOM   5069  C  CA    . ILE B  2  49  ? 31.573  46.776  10.369  1.00 17.91  ? 49   ILE B CA    1 
ATOM   5070  C  C     . ILE B  2  49  ? 32.818  47.370  9.733   1.00 20.15  ? 49   ILE B C     1 
ATOM   5071  O  O     . ILE B  2  49  ? 32.760  48.425  9.107   1.00 24.98  ? 49   ILE B O     1 
ATOM   5072  C  CB    . ILE B  2  49  ? 31.471  47.248  11.818  1.00 20.05  ? 49   ILE B CB    1 
ATOM   5073  C  CG1   . ILE B  2  49  ? 30.085  46.876  12.359  1.00 22.83  ? 49   ILE B CG1   1 
ATOM   5074  C  CG2   . ILE B  2  49  ? 31.672  48.769  11.902  1.00 17.19  ? 49   ILE B CG2   1 
ATOM   5075  C  CD1   . ILE B  2  49  ? 29.931  47.108  13.895  1.00 27.83  ? 49   ILE B CD1   1 
ATOM   5076  N  N     . LYS B  2  50  ? 33.947  46.690  9.888   1.00 19.82  ? 50   LYS B N     1 
ATOM   5077  C  CA    . LYS B  2  50  ? 35.182  47.177  9.287   1.00 19.89  ? 50   LYS B CA    1 
ATOM   5078  C  C     . LYS B  2  50  ? 35.022  47.151  7.747   1.00 22.60  ? 50   LYS B C     1 
ATOM   5079  O  O     . LYS B  2  50  ? 35.427  48.095  7.061   1.00 21.28  ? 50   LYS B O     1 
ATOM   5080  C  CB    . LYS B  2  50  ? 36.354  46.292  9.698   1.00 18.13  ? 50   LYS B CB    1 
ATOM   5081  C  CG    . LYS B  2  50  ? 37.726  46.750  9.104   1.00 24.14  ? 50   LYS B CG    1 
ATOM   5082  C  CD    . LYS B  2  50  ? 38.867  45.909  9.709   1.00 25.46  ? 50   LYS B CD    1 
ATOM   5083  C  CE    . LYS B  2  50  ? 40.197  46.127  9.002   1.00 23.51  ? 50   LYS B CE    1 
ATOM   5084  N  NZ    . LYS B  2  50  ? 40.656  47.501  9.290   1.00 26.82  ? 50   LYS B NZ    1 
ATOM   5085  N  N     . ILE B  2  51  ? 34.408  46.094  7.211   1.00 21.36  ? 51   ILE B N     1 
ATOM   5086  C  CA    . ILE B  2  51  ? 34.219  45.995  5.742   1.00 22.55  ? 51   ILE B CA    1 
ATOM   5087  C  C     . ILE B  2  51  ? 33.334  47.138  5.233   1.00 22.64  ? 51   ILE B C     1 
ATOM   5088  O  O     . ILE B  2  51  ? 33.677  47.828  4.275   1.00 18.68  ? 51   ILE B O     1 
ATOM   5089  C  CB    . ILE B  2  51  ? 33.575  44.645  5.348   1.00 19.14  ? 51   ILE B CB    1 
ATOM   5090  C  CG1   . ILE B  2  51  ? 34.550  43.518  5.635   1.00 20.14  ? 51   ILE B CG1   1 
ATOM   5091  C  CG2   . ILE B  2  51  ? 33.180  44.641  3.882   1.00 24.39  ? 51   ILE B CG2   1 
ATOM   5092  C  CD1   . ILE B  2  51  ? 33.931  42.136  5.640   1.00 15.64  ? 51   ILE B CD1   1 
ATOM   5093  N  N     . LYS B  2  52  ? 32.188  47.332  5.879   1.00 21.53  ? 52   LYS B N     1 
ATOM   5094  C  CA    . LYS B  2  52  ? 31.292  48.401  5.500   1.00 22.57  ? 52   LYS B CA    1 
ATOM   5095  C  C     . LYS B  2  52  ? 31.971  49.810  5.648   1.00 25.26  ? 52   LYS B C     1 
ATOM   5096  O  O     . LYS B  2  52  ? 31.755  50.707  4.826   1.00 23.67  ? 52   LYS B O     1 
ATOM   5097  C  CB    . LYS B  2  52  ? 30.022  48.328  6.354   1.00 25.12  ? 52   LYS B CB    1 
ATOM   5098  C  CG    . LYS B  2  52  ? 28.879  49.211  5.859   1.00 28.07  ? 52   LYS B CG    1 
ATOM   5099  C  CD    . LYS B  2  52  ? 27.734  49.282  6.870   1.00 26.36  ? 52   LYS B CD    1 
ATOM   5100  C  CE    . LYS B  2  52  ? 26.629  50.213  6.378   1.00 31.81  ? 52   LYS B CE    1 
ATOM   5101  N  NZ    . LYS B  2  52  ? 26.066  49.800  5.046   1.00 24.45  ? 52   LYS B NZ    1 
ATOM   5102  N  N     . ASN B  2  53  ? 32.796  50.009  6.668   1.00 20.94  ? 53   ASN B N     1 
ATOM   5103  C  CA    . ASN B  2  53  ? 33.450  51.310  6.829   1.00 22.07  ? 53   ASN B CA    1 
ATOM   5104  C  C     . ASN B  2  53  ? 34.649  51.557  5.926   1.00 25.65  ? 53   ASN B C     1 
ATOM   5105  O  O     . ASN B  2  53  ? 34.996  52.711  5.668   1.00 25.60  ? 53   ASN B O     1 
ATOM   5106  C  CB    . ASN B  2  53  ? 33.992  51.498  8.251   1.00 22.65  ? 53   ASN B CB    1 
ATOM   5107  C  CG    . ASN B  2  53  ? 32.913  51.666  9.263   1.00 19.49  ? 53   ASN B CG    1 
ATOM   5108  O  OD1   . ASN B  2  53  ? 31.749  51.933  8.920   1.00 16.06  ? 53   ASN B OD1   1 
ATOM   5109  N  ND2   . ASN B  2  53  ? 33.276  51.504  10.531  1.00 19.32  ? 53   ASN B ND2   1 
ATOM   5110  N  N     . GLU B  2  54  ? 35.304  50.494  5.483   1.00 22.61  ? 54   GLU B N     1 
ATOM   5111  C  CA    . GLU B  2  54  ? 36.502  50.672  4.682   1.00 28.59  ? 54   GLU B CA    1 
ATOM   5112  C  C     . GLU B  2  54  ? 36.541  50.018  3.319   1.00 29.67  ? 54   GLU B C     1 
ATOM   5113  O  O     . GLU B  2  54  ? 37.335  50.410  2.480   1.00 34.28  ? 54   GLU B O     1 
ATOM   5114  C  CB    . GLU B  2  54  ? 37.713  50.171  5.476   1.00 28.37  ? 54   GLU B CB    1 
ATOM   5115  C  CG    . GLU B  2  54  ? 37.854  50.784  6.881   1.00 35.65  ? 54   GLU B CG    1 
ATOM   5116  C  CD    . GLU B  2  54  ? 38.880  50.049  7.762   1.00 38.81  ? 54   GLU B CD    1 
ATOM   5117  O  OE1   . GLU B  2  54  ? 38.963  50.359  8.971   1.00 41.66  ? 54   GLU B OE1   1 
ATOM   5118  O  OE2   . GLU B  2  54  ? 39.608  49.158  7.262   1.00 38.34  ? 54   GLU B OE2   1 
ATOM   5119  N  N     . LEU B  2  55  ? 35.696  49.032  3.066   1.00 30.40  ? 55   LEU B N     1 
ATOM   5120  C  CA    . LEU B  2  55  ? 35.781  48.348  1.788   1.00 29.30  ? 55   LEU B CA    1 
ATOM   5121  C  C     . LEU B  2  55  ? 34.549  48.382  0.901   1.00 30.14  ? 55   LEU B C     1 
ATOM   5122  O  O     . LEU B  2  55  ? 34.671  48.426  -0.314  1.00 31.56  ? 55   LEU B O     1 
ATOM   5123  C  CB    . LEU B  2  55  ? 36.189  46.891  2.029   1.00 31.21  ? 55   LEU B CB    1 
ATOM   5124  C  CG    . LEU B  2  55  ? 37.504  46.612  2.767   1.00 28.53  ? 55   LEU B CG    1 
ATOM   5125  C  CD1   . LEU B  2  55  ? 37.757  45.137  2.794   1.00 28.27  ? 55   LEU B CD1   1 
ATOM   5126  C  CD2   . LEU B  2  55  ? 38.657  47.268  2.071   1.00 30.21  ? 55   LEU B CD2   1 
ATOM   5127  N  N     . ASP B  2  56  ? 33.358  48.367  1.487   1.00 28.31  ? 56   ASP B N     1 
ATOM   5128  C  CA    . ASP B  2  56  ? 32.141  48.376  0.687   1.00 24.41  ? 56   ASP B CA    1 
ATOM   5129  C  C     . ASP B  2  56  ? 31.003  48.857  1.579   1.00 25.43  ? 56   ASP B C     1 
ATOM   5130  O  O     . ASP B  2  56  ? 30.445  48.088  2.349   1.00 22.48  ? 56   ASP B O     1 
ATOM   5131  C  CB    . ASP B  2  56  ? 31.868  46.962  0.191   1.00 24.16  ? 56   ASP B CB    1 
ATOM   5132  C  CG    . ASP B  2  56  ? 30.583  46.860  -0.607  1.00 25.02  ? 56   ASP B CG    1 
ATOM   5133  O  OD1   . ASP B  2  56  ? 29.906  47.880  -0.824  1.00 25.75  ? 56   ASP B OD1   1 
ATOM   5134  O  OD2   . ASP B  2  56  ? 30.245  45.743  -1.015  1.00 28.33  ? 56   ASP B OD2   1 
ATOM   5135  N  N     . SER B  2  57  ? 30.659  50.127  1.482   1.00 22.97  ? 57   SER B N     1 
ATOM   5136  C  CA    . SER B  2  57  ? 29.641  50.653  2.349   1.00 24.66  ? 57   SER B CA    1 
ATOM   5137  C  C     . SER B  2  57  ? 28.242  50.230  1.936   1.00 21.71  ? 57   SER B C     1 
ATOM   5138  O  O     . SER B  2  57  ? 27.286  50.598  2.603   1.00 21.74  ? 57   SER B O     1 
ATOM   5139  C  CB    . SER B  2  57  ? 29.770  52.192  2.450   1.00 29.07  ? 57   SER B CB    1 
ATOM   5140  O  OG    . SER B  2  57  ? 29.763  52.801  1.175   1.00 33.32  ? 57   SER B OG    1 
ATOM   5141  N  N     . THR B  2  58  ? 28.131  49.451  0.854   1.00 17.69  ? 58   THR B N     1 
ATOM   5142  C  CA    . THR B  2  58  ? 26.842  48.948  0.408   1.00 21.52  ? 58   THR B CA    1 
ATOM   5143  C  C     . THR B  2  58  ? 26.470  47.667  1.159   1.00 21.30  ? 58   THR B C     1 
ATOM   5144  O  O     . THR B  2  58  ? 25.300  47.269  1.182   1.00 16.92  ? 58   THR B O     1 
ATOM   5145  C  CB    . THR B  2  58  ? 26.823  48.616  -1.126  1.00 24.44  ? 58   THR B CB    1 
ATOM   5146  O  OG1   . THR B  2  58  ? 27.559  47.398  -1.381  1.00 21.48  ? 58   THR B OG1   1 
ATOM   5147  C  CG2   . THR B  2  58  ? 27.433  49.766  -1.920  1.00 22.57  ? 58   THR B CG2   1 
ATOM   5148  N  N     . LEU B  2  59  ? 27.459  46.998  1.750   1.00 18.67  ? 59   LEU B N     1 
ATOM   5149  C  CA    . LEU B  2  59  ? 27.181  45.770  2.511   1.00 21.88  ? 59   LEU B CA    1 
ATOM   5150  C  C     . LEU B  2  59  ? 26.176  46.103  3.633   1.00 23.27  ? 59   LEU B C     1 
ATOM   5151  O  O     . LEU B  2  59  ? 26.415  46.993  4.449   1.00 22.68  ? 59   LEU B O     1 
ATOM   5152  C  CB    . LEU B  2  59  ? 28.454  45.235  3.138   1.00 22.78  ? 59   LEU B CB    1 
ATOM   5153  C  CG    . LEU B  2  59  ? 28.163  43.944  3.903   1.00 31.07  ? 59   LEU B CG    1 
ATOM   5154  C  CD1   . LEU B  2  59  ? 27.672  42.869  2.897   1.00 27.70  ? 59   LEU B CD1   1 
ATOM   5155  C  CD2   . LEU B  2  59  ? 29.416  43.482  4.652   1.00 23.36  ? 59   LEU B CD2   1 
ATOM   5156  N  N     . THR B  2  60  ? 25.088  45.345  3.706   1.00 22.16  ? 60   THR B N     1 
ATOM   5157  C  CA    . THR B  2  60  ? 24.027  45.619  4.663   1.00 22.07  ? 60   THR B CA    1 
ATOM   5158  C  C     . THR B  2  60  ? 23.663  44.503  5.665   1.00 20.46  ? 60   THR B C     1 
ATOM   5159  O  O     . THR B  2  60  ? 23.534  43.352  5.301   1.00 22.38  ? 60   THR B O     1 
ATOM   5160  C  CB    . THR B  2  60  ? 22.807  46.068  3.844   1.00 24.47  ? 60   THR B CB    1 
ATOM   5161  O  OG1   . THR B  2  60  ? 23.194  47.209  3.059   1.00 24.53  ? 60   THR B OG1   1 
ATOM   5162  C  CG2   . THR B  2  60  ? 21.617  46.455  4.746   1.00 25.52  ? 60   THR B CG2   1 
ATOM   5163  N  N     . PHE B  2  61  ? 23.508  44.862  6.939   1.00 21.81  ? 61   PHE B N     1 
ATOM   5164  C  CA    . PHE B  2  61  ? 23.165  43.909  7.998   1.00 19.77  ? 61   PHE B CA    1 
ATOM   5165  C  C     . PHE B  2  61  ? 22.571  44.655  9.203   1.00 21.20  ? 61   PHE B C     1 
ATOM   5166  O  O     . PHE B  2  61  ? 22.739  45.861  9.332   1.00 22.87  ? 61   PHE B O     1 
ATOM   5167  C  CB    . PHE B  2  61  ? 24.414  43.142  8.452   1.00 21.93  ? 61   PHE B CB    1 
ATOM   5168  C  CG    . PHE B  2  61  ? 25.615  44.034  8.712   1.00 22.18  ? 61   PHE B CG    1 
ATOM   5169  C  CD1   . PHE B  2  61  ? 26.504  44.357  7.673   1.00 16.22  ? 61   PHE B CD1   1 
ATOM   5170  C  CD2   . PHE B  2  61  ? 25.829  44.584  9.982   1.00 18.03  ? 61   PHE B CD2   1 
ATOM   5171  C  CE1   . PHE B  2  61  ? 27.617  45.233  7.904   1.00 23.45  ? 61   PHE B CE1   1 
ATOM   5172  C  CE2   . PHE B  2  61  ? 26.919  45.447  10.223  1.00 16.13  ? 61   PHE B CE2   1 
ATOM   5173  C  CZ    . PHE B  2  61  ? 27.827  45.779  9.181   1.00 16.76  ? 61   PHE B CZ    1 
ATOM   5174  N  N     . ARG B  2  62  ? 21.851  43.953  10.066  1.00 17.00  ? 62   ARG B N     1 
ATOM   5175  C  CA    . ARG B  2  62  ? 21.307  44.603  11.240  1.00 17.57  ? 62   ARG B CA    1 
ATOM   5176  C  C     . ARG B  2  62  ? 22.299  44.422  12.363  1.00 17.58  ? 62   ARG B C     1 
ATOM   5177  O  O     . ARG B  2  62  ? 22.965  43.404  12.408  1.00 17.32  ? 62   ARG B O     1 
ATOM   5178  C  CB    . ARG B  2  62  ? 20.000  43.943  11.726  1.00 18.20  ? 62   ARG B CB    1 
ATOM   5179  C  CG    . ARG B  2  62  ? 18.772  44.185  10.929  1.00 18.53  ? 62   ARG B CG    1 
ATOM   5180  C  CD    . ARG B  2  62  ? 17.568  43.562  11.644  1.00 18.88  ? 62   ARG B CD    1 
ATOM   5181  N  NE    . ARG B  2  62  ? 16.331  43.871  10.923  1.00 18.21  ? 62   ARG B NE    1 
ATOM   5182  C  CZ    . ARG B  2  62  ? 15.633  43.004  10.180  1.00 20.59  ? 62   ARG B CZ    1 
ATOM   5183  N  NH1   . ARG B  2  62  ? 16.017  41.746  10.067  1.00 21.57  ? 62   ARG B NH1   1 
ATOM   5184  N  NH2   . ARG B  2  62  ? 14.572  43.421  9.485   1.00 20.07  ? 62   ARG B NH2   1 
ATOM   5185  N  N     . ARG B  2  63  ? 22.345  45.388  13.293  1.00 15.62  ? 63   ARG B N     1 
ATOM   5186  C  CA    . ARG B  2  63  ? 23.199  45.289  14.472  1.00 15.87  ? 63   ARG B CA    1 
ATOM   5187  C  C     . ARG B  2  63  ? 22.843  46.450  15.344  1.00 15.43  ? 63   ARG B C     1 
ATOM   5188  O  O     . ARG B  2  63  ? 22.337  47.440  14.858  1.00 18.01  ? 63   ARG B O     1 
ATOM   5189  C  CB    . ARG B  2  63  ? 24.696  45.387  14.116  1.00 17.89  ? 63   ARG B CB    1 
ATOM   5190  C  CG    . ARG B  2  63  ? 25.230  46.804  13.959  1.00 20.47  ? 63   ARG B CG    1 
ATOM   5191  C  CD    . ARG B  2  63  ? 24.662  47.518  12.694  1.00 25.24  ? 63   ARG B CD    1 
ATOM   5192  N  NE    . ARG B  2  63  ? 25.234  48.857  12.463  1.00 20.99  ? 63   ARG B NE    1 
ATOM   5193  C  CZ    . ARG B  2  63  ? 24.657  50.025  12.778  1.00 24.39  ? 63   ARG B CZ    1 
ATOM   5194  N  NH1   . ARG B  2  63  ? 23.464  50.065  13.357  1.00 17.78  ? 63   ARG B NH1   1 
ATOM   5195  N  NH2   . ARG B  2  63  ? 25.253  51.178  12.465  1.00 22.13  ? 63   ARG B NH2   1 
ATOM   5196  N  N     . SER B  2  64  ? 23.081  46.332  16.645  1.00 14.48  ? 64   SER B N     1 
ATOM   5197  C  CA    . SER B  2  64  ? 22.812  47.461  17.510  1.00 15.57  ? 64   SER B CA    1 
ATOM   5198  C  C     . SER B  2  64  ? 23.682  47.443  18.761  1.00 14.45  ? 64   SER B C     1 
ATOM   5199  O  O     . SER B  2  64  ? 24.515  48.327  18.919  1.00 15.56  ? 64   SER B O     1 
ATOM   5200  C  CB    . SER B  2  64  ? 21.330  47.536  17.888  1.00 12.65  ? 64   SER B CB    1 
ATOM   5201  O  OG    . SER B  2  64  ? 21.092  48.716  18.661  1.00 17.65  ? 64   SER B OG    1 
ATOM   5202  N  N     . CYS B  2  65  ? 23.560  46.408  19.595  1.00 16.16  ? 65   CYS B N     1 
ATOM   5203  C  CA    . CYS B  2  65  ? 24.299  46.352  20.866  1.00 16.28  ? 65   CYS B CA    1 
ATOM   5204  C  C     . CYS B  2  65  ? 25.770  45.930  20.965  1.00 17.09  ? 65   CYS B C     1 
ATOM   5205  O  O     . CYS B  2  65  ? 26.406  46.206  21.974  1.00 19.37  ? 65   CYS B O     1 
ATOM   5206  C  CB    . CYS B  2  65  ? 23.567  45.448  21.850  1.00 5.76   ? 65   CYS B CB    1 
ATOM   5207  S  SG    . CYS B  2  65  ? 23.773  43.624  21.502  1.00 15.34  ? 65   CYS B SG    1 
ATOM   5208  N  N     . ARG B  2  66  ? 26.359  45.308  19.971  1.00 20.64  ? 66   ARG B N     1 
ATOM   5209  C  CA    . ARG B  2  66  ? 27.731  44.798  20.239  1.00 30.35  ? 66   ARG B CA    1 
ATOM   5210  C  C     . ARG B  2  66  ? 27.999  43.838  21.511  1.00 31.83  ? 66   ARG B C     1 
ATOM   5211  O  O     . ARG B  2  66  ? 29.144  43.413  21.705  1.00 29.98  ? 66   ARG B O     1 
ATOM   5212  C  CB    . ARG B  2  66  ? 28.791  45.932  20.258  1.00 34.33  ? 66   ARG B CB    1 
ATOM   5213  C  CG    . ARG B  2  66  ? 28.301  47.368  20.083  1.00 38.94  ? 66   ARG B CG    1 
ATOM   5214  N  NE    . ARG B  2  66  ? 30.793  48.409  21.497  1.00 53.46  ? 66   ARG B NE    1 
ATOM   5215  C  CZ    . ARG B  2  66  ? 29.992  48.291  22.558  1.00 49.40  ? 66   ARG B CZ    1 
ATOM   5216  N  NH1   . ARG B  2  66  ? 29.142  47.266  22.660  1.00 48.40  ? 66   ARG B NH1   1 
ATOM   5217  N  NH2   . ARG B  2  66  ? 30.039  49.201  23.521  1.00 43.85  ? 66   ARG B NH2   1 
ATOM   5218  N  N     . GLU B  2  67  ? 27.037  43.502  22.392  1.00 24.00  ? 67   GLU B N     1 
ATOM   5219  C  CA    . GLU B  2  67  ? 27.388  42.520  23.448  1.00 23.21  ? 67   GLU B CA    1 
ATOM   5220  C  C     . GLU B  2  67  ? 26.488  41.286  23.509  1.00 19.79  ? 67   GLU B C     1 
ATOM   5221  O  O     . GLU B  2  67  ? 26.376  40.634  24.524  1.00 16.73  ? 67   GLU B O     1 
ATOM   5222  C  CB    . GLU B  2  67  ? 27.479  43.111  24.863  1.00 27.54  ? 67   GLU B CB    1 
ATOM   5223  C  CG    . GLU B  2  67  ? 26.190  43.445  25.557  1.00 28.45  ? 67   GLU B CG    1 
ATOM   5224  C  CD    . GLU B  2  67  ? 25.993  44.946  25.668  1.00 32.32  ? 67   GLU B CD    1 
ATOM   5225  O  OE1   . GLU B  2  67  ? 25.743  45.565  24.626  1.00 33.70  ? 67   GLU B OE1   1 
ATOM   5226  O  OE2   . GLU B  2  67  ? 26.097  45.516  26.775  1.00 34.25  ? 67   GLU B OE2   1 
ATOM   5227  N  N     . GLY B  2  68  ? 25.840  40.969  22.399  1.00 19.33  ? 68   GLY B N     1 
ATOM   5228  C  CA    . GLY B  2  68  ? 24.993  39.795  22.339  1.00 14.24  ? 68   GLY B CA    1 
ATOM   5229  C  C     . GLY B  2  68  ? 23.746  39.818  23.202  1.00 15.45  ? 68   GLY B C     1 
ATOM   5230  O  O     . GLY B  2  68  ? 23.275  38.773  23.624  1.00 14.02  ? 68   GLY B O     1 
ATOM   5231  N  N     . ILE B  2  69  ? 23.188  40.987  23.451  1.00 16.55  ? 69   ILE B N     1 
ATOM   5232  C  CA    . ILE B  2  69  ? 21.996  41.075  24.271  1.00 14.79  ? 69   ILE B CA    1 
ATOM   5233  C  C     . ILE B  2  69  ? 20.766  41.547  23.472  1.00 18.13  ? 69   ILE B C     1 
ATOM   5234  O  O     . ILE B  2  69  ? 19.620  41.202  23.804  1.00 22.66  ? 69   ILE B O     1 
ATOM   5235  C  CB    . ILE B  2  69  ? 22.227  42.029  25.487  1.00 12.06  ? 69   ILE B CB    1 
ATOM   5236  C  CG1   . ILE B  2  69  ? 21.003  42.049  26.406  1.00 13.62  ? 69   ILE B CG1   1 
ATOM   5237  C  CG2   . ILE B  2  69  ? 22.461  43.436  25.039  1.00 9.53   ? 69   ILE B CG2   1 
ATOM   5238  C  CD1   . ILE B  2  69  ? 20.529  40.658  26.938  1.00 14.24  ? 69   ILE B CD1   1 
ATOM   5239  N  N     . CYS B  2  70  ? 20.978  42.283  22.398  1.00 15.97  ? 70   CYS B N     1 
ATOM   5240  C  CA    . CYS B  2  70  ? 19.823  42.815  21.674  1.00 17.99  ? 70   CYS B CA    1 
ATOM   5241  C  C     . CYS B  2  70  ? 19.160  41.860  20.706  1.00 17.57  ? 70   CYS B C     1 
ATOM   5242  O  O     . CYS B  2  70  ? 17.961  41.977  20.436  1.00 17.02  ? 70   CYS B O     1 
ATOM   5243  C  CB    . CYS B  2  70  ? 20.198  44.130  20.975  1.00 13.95  ? 70   CYS B CB    1 
ATOM   5244  S  SG    . CYS B  2  70  ? 20.957  44.018  19.351  1.00 16.02  ? 70   CYS B SG    1 
ATOM   5245  N  N     . GLY B  2  71  ? 19.933  40.931  20.177  1.00 13.20  ? 71   GLY B N     1 
ATOM   5246  C  CA    . GLY B  2  71  ? 19.369  39.947  19.262  1.00 15.62  ? 71   GLY B CA    1 
ATOM   5247  C  C     . GLY B  2  71  ? 19.393  40.324  17.790  1.00 17.03  ? 71   GLY B C     1 
ATOM   5248  O  O     . GLY B  2  71  ? 19.047  39.483  16.922  1.00 16.51  ? 71   GLY B O     1 
ATOM   5249  N  N     . SER B  2  72  ? 19.826  41.560  17.504  1.00 10.42  ? 72   SER B N     1 
ATOM   5250  C  CA    . SER B  2  72  ? 19.853  42.091  16.136  1.00 13.80  ? 72   SER B CA    1 
ATOM   5251  C  C     . SER B  2  72  ? 20.654  41.407  15.043  1.00 16.85  ? 72   SER B C     1 
ATOM   5252  O  O     . SER B  2  72  ? 20.169  41.225  13.910  1.00 14.85  ? 72   SER B O     1 
ATOM   5253  C  CB    . SER B  2  72  ? 20.328  43.562  16.125  1.00 15.43  ? 72   SER B CB    1 
ATOM   5254  O  OG    . SER B  2  72  ? 19.462  44.447  16.780  1.00 20.78  ? 72   SER B OG    1 
ATOM   5255  N  N     . CYS B  2  73  ? 21.908  41.087  15.343  1.00 13.58  ? 73   CYS B N     1 
ATOM   5256  C  CA    . CYS B  2  73  ? 22.804  40.543  14.323  1.00 15.49  ? 73   CYS B CA    1 
ATOM   5257  C  C     . CYS B  2  73  ? 22.786  39.045  13.997  1.00 17.74  ? 73   CYS B C     1 
ATOM   5258  O  O     . CYS B  2  73  ? 23.752  38.527  13.443  1.00 25.44  ? 73   CYS B O     1 
ATOM   5259  C  CB    . CYS B  2  73  ? 24.244  40.948  14.688  1.00 17.94  ? 73   CYS B CB    1 
ATOM   5260  S  SG    . CYS B  2  73  ? 24.791  40.178  16.221  1.00 18.41  ? 73   CYS B SG    1 
ATOM   5261  N  N     . ALA B  2  74  ? 21.719  38.334  14.330  1.00 19.58  ? 74   ALA B N     1 
ATOM   5262  C  CA    . ALA B  2  74  ? 21.660  36.886  14.045  1.00 15.36  ? 74   ALA B CA    1 
ATOM   5263  C  C     . ALA B  2  74  ? 21.856  36.581  12.577  1.00 16.10  ? 74   ALA B C     1 
ATOM   5264  O  O     . ALA B  2  74  ? 21.260  37.238  11.731  1.00 16.42  ? 74   ALA B O     1 
ATOM   5265  C  CB    . ALA B  2  74  ? 20.302  36.329  14.532  1.00 15.33  ? 74   ALA B CB    1 
ATOM   5266  N  N     . MET B  2  75  ? 22.689  35.581  12.273  1.00 16.33  ? 75   MET B N     1 
ATOM   5267  C  CA    . MET B  2  75  ? 22.958  35.179  10.884  1.00 13.34  ? 75   MET B CA    1 
ATOM   5268  C  C     . MET B  2  75  ? 23.640  33.826  10.893  1.00 14.06  ? 75   MET B C     1 
ATOM   5269  O  O     . MET B  2  75  ? 23.903  33.271  11.974  1.00 14.45  ? 75   MET B O     1 
ATOM   5270  C  CB    . MET B  2  75  ? 23.827  36.213  10.164  1.00 15.19  ? 75   MET B CB    1 
ATOM   5271  C  CG    . MET B  2  75  ? 25.110  36.574  10.890  1.00 14.92  ? 75   MET B CG    1 
ATOM   5272  S  SD    . MET B  2  75  ? 26.092  37.889  10.095  1.00 20.08  ? 75   MET B SD    1 
ATOM   5273  C  CE    . MET B  2  75  ? 24.970  39.437  10.536  1.00 10.14  ? 75   MET B CE    1 
ATOM   5274  N  N     . ASN B  2  76  ? 23.888  33.265  9.707   1.00 15.95  ? 76   ASN B N     1 
ATOM   5275  C  CA    . ASN B  2  76  ? 24.508  31.940  9.615   1.00 15.57  ? 76   ASN B CA    1 
ATOM   5276  C  C     . ASN B  2  76  ? 25.983  32.068  9.267   1.00 15.66  ? 76   ASN B C     1 
ATOM   5277  O  O     . ASN B  2  76  ? 26.350  32.481  8.179   1.00 18.10  ? 76   ASN B O     1 
ATOM   5278  C  CB    . ASN B  2  76  ? 23.759  31.091  8.592   1.00 17.08  ? 76   ASN B CB    1 
ATOM   5279  C  CG    . ASN B  2  76  ? 24.299  29.658  8.490   1.00 22.92  ? 76   ASN B CG    1 
ATOM   5280  O  OD1   . ASN B  2  76  ? 25.290  29.397  7.788   1.00 21.63  ? 76   ASN B OD1   1 
ATOM   5281  N  ND2   . ASN B  2  76  ? 23.644  28.726  9.187   1.00 17.32  ? 76   ASN B ND2   1 
ATOM   5282  N  N     . ILE B  2  77  ? 26.823  31.718  10.223  1.00 17.19  ? 77   ILE B N     1 
ATOM   5283  C  CA    . ILE B  2  77  ? 28.271  31.837  10.074  1.00 21.80  ? 77   ILE B CA    1 
ATOM   5284  C  C     . ILE B  2  77  ? 28.892  30.433  10.203  1.00 24.86  ? 77   ILE B C     1 
ATOM   5285  O  O     . ILE B  2  77  ? 28.683  29.726  11.218  1.00 22.51  ? 77   ILE B O     1 
ATOM   5286  C  CB    . ILE B  2  77  ? 28.834  32.773  11.185  1.00 27.49  ? 77   ILE B CB    1 
ATOM   5287  C  CG1   . ILE B  2  77  ? 28.223  34.182  11.041  1.00 25.69  ? 77   ILE B CG1   1 
ATOM   5288  C  CG2   . ILE B  2  77  ? 30.382  32.843  11.113  1.00 27.21  ? 77   ILE B CG2   1 
ATOM   5289  C  CD1   . ILE B  2  77  ? 28.440  35.082  12.248  1.00 20.26  ? 77   ILE B CD1   1 
ATOM   5290  N  N     . ALA B  2  78  ? 29.626  30.041  9.162   1.00 25.23  ? 78   ALA B N     1 
ATOM   5291  C  CA    . ALA B  2  78  ? 30.291  28.750  9.106   1.00 25.82  ? 78   ALA B CA    1 
ATOM   5292  C  C     . ALA B  2  78  ? 29.266  27.624  9.309   1.00 27.77  ? 78   ALA B C     1 
ATOM   5293  O  O     . ALA B  2  78  ? 29.498  26.670  10.049  1.00 27.15  ? 78   ALA B O     1 
ATOM   5294  C  CB    . ALA B  2  78  ? 31.388  28.689  10.173  1.00 24.52  ? 78   ALA B CB    1 
ATOM   5295  N  N     . GLY B  2  79  ? 28.106  27.780  8.687   1.00 23.22  ? 79   GLY B N     1 
ATOM   5296  C  CA    . GLY B  2  79  ? 27.102  26.759  8.777   1.00 18.94  ? 79   GLY B CA    1 
ATOM   5297  C  C     . GLY B  2  79  ? 26.155  26.810  9.949   1.00 18.83  ? 79   GLY B C     1 
ATOM   5298  O  O     . GLY B  2  79  ? 25.128  26.141  9.915   1.00 21.13  ? 79   GLY B O     1 
ATOM   5299  N  N     . GLY B  2  80  ? 26.468  27.574  10.986  1.00 18.82  ? 80   GLY B N     1 
ATOM   5300  C  CA    . GLY B  2  80  ? 25.578  27.595  12.139  1.00 16.57  ? 80   GLY B CA    1 
ATOM   5301  C  C     . GLY B  2  80  ? 24.993  28.960  12.442  1.00 16.99  ? 80   GLY B C     1 
ATOM   5302  O  O     . GLY B  2  80  ? 25.642  29.966  12.220  1.00 20.34  ? 80   GLY B O     1 
ATOM   5303  N  N     . ASN B  2  81  ? 23.751  28.997  12.931  1.00 17.68  ? 81   ASN B N     1 
ATOM   5304  C  CA    . ASN B  2  81  ? 23.118  30.263  13.284  1.00 12.79  ? 81   ASN B CA    1 
ATOM   5305  C  C     . ASN B  2  81  ? 23.674  30.777  14.580  1.00 17.55  ? 81   ASN B C     1 
ATOM   5306  O  O     . ASN B  2  81  ? 23.758  30.025  15.589  1.00 14.07  ? 81   ASN B O     1 
ATOM   5307  C  CB    . ASN B  2  81  ? 21.603  30.104  13.438  1.00 15.74  ? 81   ASN B CB    1 
ATOM   5308  C  CG    . ASN B  2  81  ? 20.931  29.702  12.138  1.00 15.46  ? 81   ASN B CG    1 
ATOM   5309  O  OD1   . ASN B  2  81  ? 21.525  29.784  11.075  1.00 18.50  ? 81   ASN B OD1   1 
ATOM   5310  N  ND2   . ASN B  2  81  ? 19.692  29.273  12.226  1.00 19.72  ? 81   ASN B ND2   1 
ATOM   5311  N  N     . THR B  2  82  ? 24.007  32.063  14.611  1.00 13.59  ? 82   THR B N     1 
ATOM   5312  C  CA    . THR B  2  82  ? 24.568  32.585  15.839  1.00 16.32  ? 82   THR B CA    1 
ATOM   5313  C  C     . THR B  2  82  ? 24.554  34.114  15.771  1.00 17.61  ? 82   THR B C     1 
ATOM   5314  O  O     . THR B  2  82  ? 24.142  34.668  14.744  1.00 13.76  ? 82   THR B O     1 
ATOM   5315  C  CB    . THR B  2  82  ? 26.039  32.046  16.007  1.00 20.65  ? 82   THR B CB    1 
ATOM   5316  O  OG1   . THR B  2  82  ? 26.504  32.322  17.336  1.00 27.85  ? 82   THR B OG1   1 
ATOM   5317  C  CG2   . THR B  2  82  ? 27.000  32.705  14.978  1.00 10.89  ? 82   THR B CG2   1 
ATOM   5318  N  N     . LEU B  2  83  ? 24.989  34.785  16.850  1.00 13.47  ? 83   LEU B N     1 
ATOM   5319  C  CA    . LEU B  2  83  ? 25.068  36.264  16.869  1.00 16.29  ? 83   LEU B CA    1 
ATOM   5320  C  C     . LEU B  2  83  ? 26.463  36.660  16.401  1.00 18.38  ? 83   LEU B C     1 
ATOM   5321  O  O     . LEU B  2  83  ? 27.456  36.191  16.978  1.00 20.62  ? 83   LEU B O     1 
ATOM   5322  C  CB    . LEU B  2  83  ? 24.864  36.814  18.288  1.00 12.25  ? 83   LEU B CB    1 
ATOM   5323  C  CG    . LEU B  2  83  ? 23.607  36.348  19.019  1.00 18.59  ? 83   LEU B CG    1 
ATOM   5324  C  CD1   . LEU B  2  83  ? 23.645  36.879  20.448  1.00 14.11  ? 83   LEU B CD1   1 
ATOM   5325  C  CD2   . LEU B  2  83  ? 22.336  36.843  18.253  1.00 19.33  ? 83   LEU B CD2   1 
ATOM   5326  N  N     . ALA B  2  84  ? 26.553  37.503  15.369  1.00 18.19  ? 84   ALA B N     1 
ATOM   5327  C  CA    . ALA B  2  84  ? 27.860  37.940  14.860  1.00 18.38  ? 84   ALA B CA    1 
ATOM   5328  C  C     . ALA B  2  84  ? 28.711  38.695  15.898  1.00 19.20  ? 84   ALA B C     1 
ATOM   5329  O  O     . ALA B  2  84  ? 29.946  38.614  15.889  1.00 15.67  ? 84   ALA B O     1 
ATOM   5330  C  CB    . ALA B  2  84  ? 27.694  38.845  13.582  1.00 19.24  ? 84   ALA B CB    1 
ATOM   5331  N  N     . CYS B  2  85  ? 28.052  39.421  16.792  1.00 19.28  ? 85   CYS B N     1 
ATOM   5332  C  CA    . CYS B  2  85  ? 28.767  40.237  17.778  1.00 19.91  ? 85   CYS B CA    1 
ATOM   5333  C  C     . CYS B  2  85  ? 29.492  39.476  18.886  1.00 18.82  ? 85   CYS B C     1 
ATOM   5334  O  O     . CYS B  2  85  ? 30.325  40.057  19.584  1.00 20.23  ? 85   CYS B O     1 
ATOM   5335  C  CB    . CYS B  2  85  ? 27.793  41.249  18.391  1.00 17.64  ? 85   CYS B CB    1 
ATOM   5336  S  SG    . CYS B  2  85  ? 26.391  40.542  19.293  1.00 19.31  ? 85   CYS B SG    1 
ATOM   5337  N  N     . THR B  2  86  ? 29.173  38.189  19.045  1.00 20.83  ? 86   THR B N     1 
ATOM   5338  C  CA    . THR B  2  86  ? 29.800  37.335  20.058  1.00 21.87  ? 86   THR B CA    1 
ATOM   5339  C  C     . THR B  2  86  ? 30.464  36.117  19.409  1.00 19.20  ? 86   THR B C     1 
ATOM   5340  O  O     . THR B  2  86  ? 30.933  35.225  20.096  1.00 18.17  ? 86   THR B O     1 
ATOM   5341  C  CB    . THR B  2  86  ? 28.782  36.797  21.118  1.00 19.96  ? 86   THR B CB    1 
ATOM   5342  O  OG1   . THR B  2  86  ? 27.839  35.948  20.477  1.00 25.99  ? 86   THR B OG1   1 
ATOM   5343  C  CG2   . THR B  2  86  ? 28.052  37.908  21.808  1.00 21.41  ? 86   THR B CG2   1 
ATOM   5344  N  N     . LYS B  2  87  ? 30.499  36.073  18.085  1.00 21.27  ? 87   LYS B N     1 
ATOM   5345  C  CA    . LYS B  2  87  ? 31.125  34.945  17.375  1.00 20.46  ? 87   LYS B CA    1 
ATOM   5346  C  C     . LYS B  2  87  ? 32.596  35.251  17.032  1.00 20.15  ? 87   LYS B C     1 
ATOM   5347  O  O     . LYS B  2  87  ? 32.890  36.079  16.187  1.00 22.60  ? 87   LYS B O     1 
ATOM   5348  C  CB    . LYS B  2  87  ? 30.348  34.650  16.080  1.00 18.31  ? 87   LYS B CB    1 
ATOM   5349  C  CG    . LYS B  2  87  ? 30.888  33.487  15.217  1.00 23.73  ? 87   LYS B CG    1 
ATOM   5350  C  CD    . LYS B  2  87  ? 30.873  32.156  15.970  1.00 24.31  ? 87   LYS B CD    1 
ATOM   5351  C  CE    . LYS B  2  87  ? 31.213  31.035  15.015  1.00 28.75  ? 87   LYS B CE    1 
ATOM   5352  N  NZ    . LYS B  2  87  ? 31.259  29.739  15.722  1.00 26.95  ? 87   LYS B NZ    1 
ATOM   5353  N  N     . LYS B  2  88  ? 33.526  34.593  17.704  1.00 23.94  ? 88   LYS B N     1 
ATOM   5354  C  CA    . LYS B  2  88  ? 34.954  34.815  17.421  1.00 21.92  ? 88   LYS B CA    1 
ATOM   5355  C  C     . LYS B  2  88  ? 35.276  34.540  15.956  1.00 20.62  ? 88   LYS B C     1 
ATOM   5356  O  O     . LYS B  2  88  ? 34.813  33.556  15.398  1.00 23.38  ? 88   LYS B O     1 
ATOM   5357  C  CB    . LYS B  2  88  ? 35.814  33.874  18.253  1.00 25.19  ? 88   LYS B CB    1 
ATOM   5358  C  CG    . LYS B  2  88  ? 35.843  34.149  19.741  1.00 31.24  ? 88   LYS B CG    1 
ATOM   5359  C  CD    . LYS B  2  88  ? 36.689  35.356  20.092  1.00 40.80  ? 88   LYS B CD    1 
ATOM   5360  C  CE    . LYS B  2  88  ? 36.753  35.569  21.629  1.00 47.64  ? 88   LYS B CE    1 
ATOM   5361  N  NZ    . LYS B  2  88  ? 37.441  36.852  22.012  1.00 50.63  ? 88   LYS B NZ    1 
ATOM   5362  N  N     . ILE B  2  89  ? 36.049  35.407  15.327  1.00 22.73  ? 89   ILE B N     1 
ATOM   5363  C  CA    . ILE B  2  89  ? 36.479  35.182  13.940  1.00 22.14  ? 89   ILE B CA    1 
ATOM   5364  C  C     . ILE B  2  89  ? 37.428  33.968  14.019  1.00 23.56  ? 89   ILE B C     1 
ATOM   5365  O  O     . ILE B  2  89  ? 38.171  33.832  14.980  1.00 26.88  ? 89   ILE B O     1 
ATOM   5366  C  CB    . ILE B  2  89  ? 37.309  36.386  13.415  1.00 21.57  ? 89   ILE B CB    1 
ATOM   5367  C  CG1   . ILE B  2  89  ? 36.379  37.572  13.141  1.00 17.64  ? 89   ILE B CG1   1 
ATOM   5368  C  CG2   . ILE B  2  89  ? 38.156  35.987  12.157  1.00 22.12  ? 89   ILE B CG2   1 
ATOM   5369  C  CD1   . ILE B  2  89  ? 37.123  38.880  12.882  1.00 10.55  ? 89   ILE B CD1   1 
ATOM   5370  N  N     . ASP B  2  90  ? 37.415  33.096  13.023  1.00 29.04  ? 90   ASP B N     1 
ATOM   5371  C  CA    . ASP B  2  90  ? 38.327  31.937  13.022  1.00 29.83  ? 90   ASP B CA    1 
ATOM   5372  C  C     . ASP B  2  90  ? 39.665  32.421  12.448  1.00 28.45  ? 90   ASP B C     1 
ATOM   5373  O  O     . ASP B  2  90  ? 39.767  32.702  11.248  1.00 27.93  ? 90   ASP B O     1 
ATOM   5374  C  CB    . ASP B  2  90  ? 37.768  30.838  12.134  1.00 32.70  ? 90   ASP B CB    1 
ATOM   5375  C  CG    . ASP B  2  90  ? 38.665  29.596  12.085  1.00 40.93  ? 90   ASP B CG    1 
ATOM   5376  O  OD1   . ASP B  2  90  ? 39.739  29.561  12.747  1.00 41.39  ? 90   ASP B OD1   1 
ATOM   5377  O  OD2   . ASP B  2  90  ? 38.274  28.647  11.369  1.00 38.85  ? 90   ASP B OD2   1 
ATOM   5378  N  N     . PRO B  2  91  ? 40.712  32.485  13.286  1.00 29.57  ? 91   PRO B N     1 
ATOM   5379  C  CA    . PRO B  2  91  ? 42.034  32.951  12.844  1.00 31.41  ? 91   PRO B CA    1 
ATOM   5380  C  C     . PRO B  2  91  ? 42.833  32.047  11.888  1.00 34.00  ? 91   PRO B C     1 
ATOM   5381  O  O     . PRO B  2  91  ? 43.991  32.344  11.569  1.00 34.83  ? 91   PRO B O     1 
ATOM   5382  C  CB    . PRO B  2  91  ? 42.757  33.204  14.163  1.00 30.74  ? 91   PRO B CB    1 
ATOM   5383  C  CG    . PRO B  2  91  ? 42.264  32.068  15.006  1.00 31.95  ? 91   PRO B CG    1 
ATOM   5384  C  CD    . PRO B  2  91  ? 40.774  31.985  14.679  1.00 28.11  ? 91   PRO B CD    1 
ATOM   5385  N  N     . ASP B  2  92  ? 42.250  30.939  11.447  1.00 34.68  ? 92   ASP B N     1 
ATOM   5386  C  CA    . ASP B  2  92  ? 42.946  30.090  10.477  1.00 35.09  ? 92   ASP B CA    1 
ATOM   5387  C  C     . ASP B  2  92  ? 42.847  30.809  9.112   1.00 33.76  ? 92   ASP B C     1 
ATOM   5388  O  O     . ASP B  2  92  ? 41.796  30.813  8.471   1.00 31.17  ? 92   ASP B O     1 
ATOM   5389  C  CB    . ASP B  2  92  ? 42.273  28.729  10.375  1.00 39.04  ? 92   ASP B CB    1 
ATOM   5390  C  CG    . ASP B  2  92  ? 43.047  27.756  9.488   1.00 45.68  ? 92   ASP B CG    1 
ATOM   5391  O  OD1   . ASP B  2  92  ? 43.533  28.179  8.411   1.00 43.93  ? 92   ASP B OD1   1 
ATOM   5392  O  OD2   . ASP B  2  92  ? 43.158  26.561  9.870   1.00 47.98  ? 92   ASP B OD2   1 
ATOM   5393  N  N     . LEU B  2  93  ? 43.940  31.408  8.658   1.00 32.55  ? 93   LEU B N     1 
ATOM   5394  C  CA    . LEU B  2  93  ? 43.916  32.143  7.402   1.00 30.16  ? 93   LEU B CA    1 
ATOM   5395  C  C     . LEU B  2  93  ? 43.768  31.295  6.156   1.00 31.36  ? 93   LEU B C     1 
ATOM   5396  O  O     . LEU B  2  93  ? 43.582  31.825  5.062   1.00 30.82  ? 93   LEU B O     1 
ATOM   5397  C  CB    . LEU B  2  93  ? 45.172  33.000  7.260   1.00 29.75  ? 93   LEU B CB    1 
ATOM   5398  C  CG    . LEU B  2  93  ? 45.457  33.948  8.421   1.00 31.64  ? 93   LEU B CG    1 
ATOM   5399  C  CD1   . LEU B  2  93  ? 46.730  34.733  8.114   1.00 26.23  ? 93   LEU B CD1   1 
ATOM   5400  C  CD2   . LEU B  2  93  ? 44.264  34.864  8.653   1.00 31.06  ? 93   LEU B CD2   1 
ATOM   5401  N  N     . SER B  2  94  ? 43.842  29.986  6.291   1.00 33.00  ? 94   SER B N     1 
ATOM   5402  C  CA    . SER B  2  94  ? 43.705  29.170  5.105   1.00 36.75  ? 94   SER B CA    1 
ATOM   5403  C  C     . SER B  2  94  ? 42.227  28.871  4.859   1.00 39.00  ? 94   SER B C     1 
ATOM   5404  O  O     . SER B  2  94  ? 41.869  28.412  3.763   1.00 36.15  ? 94   SER B O     1 
ATOM   5405  C  CB    . SER B  2  94  ? 44.482  27.856  5.250   1.00 38.71  ? 94   SER B CB    1 
ATOM   5406  O  OG    . SER B  2  94  ? 43.821  26.946  6.124   1.00 41.62  ? 94   SER B OG    1 
ATOM   5407  N  N     . LYS B  2  95  ? 41.381  29.133  5.869   1.00 35.17  ? 95   LYS B N     1 
ATOM   5408  C  CA    . LYS B  2  95  ? 39.948  28.877  5.741   1.00 34.71  ? 95   LYS B CA    1 
ATOM   5409  C  C     . LYS B  2  95  ? 39.143  30.161  5.503   1.00 36.27  ? 95   LYS B C     1 
ATOM   5410  O  O     . LYS B  2  95  ? 39.382  31.206  6.134   1.00 35.30  ? 95   LYS B O     1 
ATOM   5411  C  CB    . LYS B  2  95  ? 39.419  28.179  6.988   1.00 38.33  ? 95   LYS B CB    1 
ATOM   5412  C  CG    . LYS B  2  95  ? 40.024  26.825  7.256   1.00 41.36  ? 95   LYS B CG    1 
ATOM   5413  C  CD    . LYS B  2  95  ? 39.571  26.330  8.600   1.00 48.81  ? 95   LYS B CD    1 
ATOM   5414  C  CE    . LYS B  2  95  ? 40.053  24.915  8.829   1.00 53.80  ? 95   LYS B CE    1 
ATOM   5415  N  NZ    . LYS B  2  95  ? 39.827  24.487  10.233  1.00 59.74  ? 95   LYS B NZ    1 
ATOM   5416  N  N     . THR B  2  96  ? 38.188  30.073  4.587   1.00 31.17  ? 96   THR B N     1 
ATOM   5417  C  CA    . THR B  2  96  ? 37.342  31.201  4.267   1.00 32.15  ? 96   THR B CA    1 
ATOM   5418  C  C     . THR B  2  96  ? 36.057  31.006  5.021   1.00 32.01  ? 96   THR B C     1 
ATOM   5419  O  O     . THR B  2  96  ? 35.457  29.943  4.970   1.00 30.77  ? 96   THR B O     1 
ATOM   5420  C  CB    . THR B  2  96  ? 37.041  31.257  2.779   1.00 31.52  ? 96   THR B CB    1 
ATOM   5421  O  OG1   . THR B  2  96  ? 38.243  31.618  2.095   1.00 31.64  ? 96   THR B OG1   1 
ATOM   5422  C  CG2   . THR B  2  96  ? 35.941  32.278  2.478   1.00 24.38  ? 96   THR B CG2   1 
ATOM   5423  N  N     . THR B  2  97  ? 35.644  32.035  5.751   1.00 31.76  ? 97   THR B N     1 
ATOM   5424  C  CA    . THR B  2  97  ? 34.411  31.943  6.523   1.00 26.73  ? 97   THR B CA    1 
ATOM   5425  C  C     . THR B  2  97  ? 33.234  32.398  5.681   1.00 26.29  ? 97   THR B C     1 
ATOM   5426  O  O     . THR B  2  97  ? 33.217  33.516  5.150   1.00 23.81  ? 97   THR B O     1 
ATOM   5427  C  CB    . THR B  2  97  ? 34.502  32.824  7.750   1.00 29.29  ? 97   THR B CB    1 
ATOM   5428  O  OG1   . THR B  2  97  ? 35.617  32.397  8.536   1.00 29.00  ? 97   THR B OG1   1 
ATOM   5429  C  CG2   . THR B  2  97  ? 33.211  32.764  8.556   1.00 23.87  ? 97   THR B CG2   1 
ATOM   5430  N  N     . LYS B  2  98  ? 32.243  31.530  5.563   1.00 26.60  ? 98   LYS B N     1 
ATOM   5431  C  CA    . LYS B  2  98  ? 31.044  31.840  4.786   1.00 26.83  ? 98   LYS B CA    1 
ATOM   5432  C  C     . LYS B  2  98  ? 29.938  32.376  5.709   1.00 22.51  ? 98   LYS B C     1 
ATOM   5433  O  O     . LYS B  2  98  ? 29.664  31.801  6.798   1.00 19.10  ? 98   LYS B O     1 
ATOM   5434  C  CB    . LYS B  2  98  ? 30.576  30.588  4.039   1.00 29.22  ? 98   LYS B CB    1 
ATOM   5435  C  CG    . LYS B  2  98  ? 31.703  30.011  3.174   1.00 41.87  ? 98   LYS B CG    1 
ATOM   5436  C  CD    . LYS B  2  98  ? 31.220  28.875  2.299   1.00 52.09  ? 98   LYS B CD    1 
ATOM   5437  C  CE    . LYS B  2  98  ? 30.877  27.625  3.119   1.00 58.04  ? 98   LYS B CE    1 
ATOM   5438  N  NZ    . LYS B  2  98  ? 32.085  26.921  3.671   1.00 62.50  ? 98   LYS B NZ    1 
ATOM   5439  N  N     . ILE B  2  99  ? 29.343  33.486  5.278   1.00 17.51  ? 99   ILE B N     1 
ATOM   5440  C  CA    . ILE B  2  99  ? 28.284  34.151  6.035   1.00 20.08  ? 99   ILE B CA    1 
ATOM   5441  C  C     . ILE B  2  99  ? 27.033  34.284  5.186   1.00 17.57  ? 99   ILE B C     1 
ATOM   5442  O  O     . ILE B  2  99  ? 27.078  34.855  4.115   1.00 22.32  ? 99   ILE B O     1 
ATOM   5443  C  CB    . ILE B  2  99  ? 28.725  35.571  6.502   1.00 22.61  ? 99   ILE B CB    1 
ATOM   5444  C  CG1   . ILE B  2  99  ? 29.980  35.462  7.365   1.00 19.62  ? 99   ILE B CG1   1 
ATOM   5445  C  CG2   . ILE B  2  99  ? 27.607  36.271  7.325   1.00 16.50  ? 99   ILE B CG2   1 
ATOM   5446  C  CD1   . ILE B  2  99  ? 30.548  36.821  7.737   1.00 23.13  ? 99   ILE B CD1   1 
ATOM   5447  N  N     . TYR B  2  100 ? 25.928  33.752  5.700   1.00 15.57  ? 100  TYR B N     1 
ATOM   5448  C  CA    . TYR B  2  100 ? 24.632  33.775  5.062   1.00 15.52  ? 100  TYR B CA    1 
ATOM   5449  C  C     . TYR B  2  100 ? 23.557  34.342  5.994   1.00 17.71  ? 100  TYR B C     1 
ATOM   5450  O  O     . TYR B  2  100 ? 23.738  34.441  7.213   1.00 13.70  ? 100  TYR B O     1 
ATOM   5451  C  CB    . TYR B  2  100 ? 24.193  32.329  4.719   1.00 20.13  ? 100  TYR B CB    1 
ATOM   5452  C  CG    . TYR B  2  100 ? 24.938  31.634  3.595   1.00 21.43  ? 100  TYR B CG    1 
ATOM   5453  C  CD1   . TYR B  2  100 ? 26.121  30.935  3.833   1.00 25.24  ? 100  TYR B CD1   1 
ATOM   5454  C  CD2   . TYR B  2  100 ? 24.463  31.694  2.296   1.00 21.92  ? 100  TYR B CD2   1 
ATOM   5455  C  CE1   . TYR B  2  100 ? 26.817  30.301  2.788   1.00 25.60  ? 100  TYR B CE1   1 
ATOM   5456  C  CE2   . TYR B  2  100 ? 25.138  31.073  1.248   1.00 28.49  ? 100  TYR B CE2   1 
ATOM   5457  C  CZ    . TYR B  2  100 ? 26.316  30.378  1.504   1.00 27.99  ? 100  TYR B CZ    1 
ATOM   5458  O  OH    . TYR B  2  100 ? 26.995  29.792  0.468   1.00 23.12  ? 100  TYR B OH    1 
ATOM   5459  N  N     . PRO B  2  101 ? 22.417  34.736  5.431   1.00 15.83  ? 101  PRO B N     1 
ATOM   5460  C  CA    . PRO B  2  101 ? 21.302  35.252  6.232   1.00 16.13  ? 101  PRO B CA    1 
ATOM   5461  C  C     . PRO B  2  101 ? 20.754  34.066  7.056   1.00 14.76  ? 101  PRO B C     1 
ATOM   5462  O  O     . PRO B  2  101 ? 21.115  32.904  6.811   1.00 13.70  ? 101  PRO B O     1 
ATOM   5463  C  CB    . PRO B  2  101 ? 20.253  35.633  5.195   1.00 15.97  ? 101  PRO B CB    1 
ATOM   5464  C  CG    . PRO B  2  101 ? 20.999  35.810  3.939   1.00 15.32  ? 101  PRO B CG    1 
ATOM   5465  C  CD    . PRO B  2  101 ? 22.143  34.829  3.990   1.00 15.11  ? 101  PRO B CD    1 
ATOM   5466  N  N     . LEU B  2  102 ? 19.880  34.331  8.018   1.00 19.21  ? 102  LEU B N     1 
ATOM   5467  C  CA    . LEU B  2  102 ? 19.276  33.227  8.771   1.00 21.20  ? 102  LEU B CA    1 
ATOM   5468  C  C     . LEU B  2  102 ? 18.595  32.367  7.677   1.00 22.97  ? 102  LEU B C     1 
ATOM   5469  O  O     . LEU B  2  102 ? 17.941  32.896  6.790   1.00 21.84  ? 102  LEU B O     1 
ATOM   5470  C  CB    . LEU B  2  102 ? 18.257  33.764  9.787   1.00 12.14  ? 102  LEU B CB    1 
ATOM   5471  C  CG    . LEU B  2  102 ? 18.892  34.392  11.048  1.00 21.97  ? 102  LEU B CG    1 
ATOM   5472  C  CD1   . LEU B  2  102 ? 17.821  34.798  12.047  1.00 14.90  ? 102  LEU B CD1   1 
ATOM   5473  C  CD2   . LEU B  2  102 ? 19.832  33.430  11.747  1.00 13.37  ? 102  LEU B CD2   1 
ATOM   5474  N  N     . PRO B  2  103 ? 18.737  31.031  7.745   1.00 23.88  ? 103  PRO B N     1 
ATOM   5475  C  CA    . PRO B  2  103 ? 18.173  30.092  6.771   1.00 21.30  ? 103  PRO B CA    1 
ATOM   5476  C  C     . PRO B  2  103 ? 16.671  30.023  6.514   1.00 22.30  ? 103  PRO B C     1 
ATOM   5477  O  O     . PRO B  2  103 ? 15.829  30.164  7.414   1.00 22.73  ? 103  PRO B O     1 
ATOM   5478  C  CB    . PRO B  2  103 ? 18.705  28.729  7.242   1.00 19.86  ? 103  PRO B CB    1 
ATOM   5479  C  CG    . PRO B  2  103 ? 19.837  29.052  8.119   1.00 27.64  ? 103  PRO B CG    1 
ATOM   5480  C  CD    . PRO B  2  103 ? 19.366  30.285  8.846   1.00 22.09  ? 103  PRO B CD    1 
ATOM   5481  N  N     . HIS B  2  104 ? 16.357  29.774  5.253   1.00 21.88  ? 104  HIS B N     1 
ATOM   5482  C  CA    . HIS B  2  104 ? 14.984  29.590  4.801   1.00 21.16  ? 104  HIS B CA    1 
ATOM   5483  C  C     . HIS B  2  104 ? 14.091  30.761  5.173   1.00 13.94  ? 104  HIS B C     1 
ATOM   5484  O  O     . HIS B  2  104 ? 12.980  30.598  5.655   1.00 19.51  ? 104  HIS B O     1 
ATOM   5485  C  CB    . HIS B  2  104 ? 14.438  28.248  5.348   1.00 18.76  ? 104  HIS B CB    1 
ATOM   5486  C  CG    . HIS B  2  104 ? 13.286  27.691  4.557   1.00 23.86  ? 104  HIS B CG    1 
ATOM   5487  N  ND1   . HIS B  2  104 ? 12.002  28.189  4.648   1.00 26.03  ? 104  HIS B ND1   1 
ATOM   5488  C  CD2   . HIS B  2  104 ? 13.230  26.679  3.656   1.00 24.84  ? 104  HIS B CD2   1 
ATOM   5489  C  CE1   . HIS B  2  104 ? 11.204  27.510  3.845   1.00 27.00  ? 104  HIS B CE1   1 
ATOM   5490  N  NE2   . HIS B  2  104 ? 11.923  26.588  3.230   1.00 29.03  ? 104  HIS B NE2   1 
ATOM   5491  N  N     . MET B  2  105 ? 14.601  31.959  4.954   1.00 17.23  ? 105  MET B N     1 
ATOM   5492  C  CA    . MET B  2  105 ? 13.854  33.175  5.230   1.00 18.61  ? 105  MET B CA    1 
ATOM   5493  C  C     . MET B  2  105 ? 13.868  34.040  3.972   1.00 20.87  ? 105  MET B C     1 
ATOM   5494  O  O     . MET B  2  105 ? 14.725  33.862  3.103   1.00 20.37  ? 105  MET B O     1 
ATOM   5495  C  CB    . MET B  2  105 ? 14.473  33.955  6.399   1.00 19.14  ? 105  MET B CB    1 
ATOM   5496  C  CG    . MET B  2  105 ? 14.436  33.224  7.748   1.00 19.51  ? 105  MET B CG    1 
ATOM   5497  S  SD    . MET B  2  105 ? 12.750  32.934  8.375   1.00 30.46  ? 105  MET B SD    1 
ATOM   5498  C  CE    . MET B  2  105 ? 12.656  34.291  9.628   1.00 28.14  ? 105  MET B CE    1 
ATOM   5499  N  N     . TYR B  2  106 ? 12.901  34.948  3.870   1.00 21.85  ? 106  TYR B N     1 
ATOM   5500  C  CA    . TYR B  2  106 ? 12.847  35.888  2.756   1.00 19.84  ? 106  TYR B CA    1 
ATOM   5501  C  C     . TYR B  2  106 ? 13.853  37.006  3.028   1.00 22.21  ? 106  TYR B C     1 
ATOM   5502  O  O     . TYR B  2  106 ? 13.839  37.687  4.088   1.00 17.82  ? 106  TYR B O     1 
ATOM   5503  C  CB    . TYR B  2  106 ? 11.450  36.482  2.607   1.00 19.82  ? 106  TYR B CB    1 
ATOM   5504  C  CG    . TYR B  2  106 ? 10.461  35.502  2.013   1.00 21.90  ? 106  TYR B CG    1 
ATOM   5505  C  CD1   . TYR B  2  106 ? 10.490  35.188  0.640   1.00 22.19  ? 106  TYR B CD1   1 
ATOM   5506  C  CD2   . TYR B  2  106 ? 9.528   34.845  2.837   1.00 22.50  ? 106  TYR B CD2   1 
ATOM   5507  C  CE1   . TYR B  2  106 ? 9.598   34.217  0.099   1.00 23.50  ? 106  TYR B CE1   1 
ATOM   5508  C  CE2   . TYR B  2  106 ? 8.641   33.900  2.325   1.00 28.00  ? 106  TYR B CE2   1 
ATOM   5509  C  CZ    . TYR B  2  106 ? 8.680   33.587  0.956   1.00 27.97  ? 106  TYR B CZ    1 
ATOM   5510  O  OH    . TYR B  2  106 ? 7.795   32.650  0.480   1.00 30.08  ? 106  TYR B OH    1 
ATOM   5511  N  N     . VAL B  2  107 ? 14.737  37.187  2.063   1.00 19.02  ? 107  VAL B N     1 
ATOM   5512  C  CA    . VAL B  2  107 ? 15.765  38.192  2.179   1.00 16.99  ? 107  VAL B CA    1 
ATOM   5513  C  C     . VAL B  2  107 ? 15.321  39.596  1.754   1.00 17.89  ? 107  VAL B C     1 
ATOM   5514  O  O     . VAL B  2  107 ? 14.876  39.791  0.613   1.00 19.69  ? 107  VAL B O     1 
ATOM   5515  C  CB    . VAL B  2  107 ? 16.969  37.779  1.334   1.00 20.11  ? 107  VAL B CB    1 
ATOM   5516  C  CG1   . VAL B  2  107 ? 18.047  38.863  1.418   1.00 11.40  ? 107  VAL B CG1   1 
ATOM   5517  C  CG2   . VAL B  2  107 ? 17.503  36.412  1.805   1.00 13.07  ? 107  VAL B CG2   1 
ATOM   5518  N  N     . VAL B  2  108 ? 15.438  40.574  2.656   1.00 19.53  ? 108  VAL B N     1 
ATOM   5519  C  CA    . VAL B  2  108 ? 15.110  41.985  2.336   1.00 18.40  ? 108  VAL B CA    1 
ATOM   5520  C  C     . VAL B  2  108 ? 16.287  42.541  1.522   1.00 17.91  ? 108  VAL B C     1 
ATOM   5521  O  O     . VAL B  2  108 ? 16.129  43.178  0.486   1.00 18.86  ? 108  VAL B O     1 
ATOM   5522  C  CB    . VAL B  2  108 ? 14.976  42.853  3.591   1.00 23.07  ? 108  VAL B CB    1 
ATOM   5523  C  CG1   . VAL B  2  108 ? 14.681  44.324  3.173   1.00 18.73  ? 108  VAL B CG1   1 
ATOM   5524  C  CG2   . VAL B  2  108 ? 13.901  42.283  4.511   1.00 22.70  ? 108  VAL B CG2   1 
ATOM   5525  N  N     . LYS B  2  109 ? 17.486  42.286  2.008   1.00 17.33  ? 109  LYS B N     1 
ATOM   5526  C  CA    . LYS B  2  109 ? 18.676  42.742  1.326   1.00 18.00  ? 109  LYS B CA    1 
ATOM   5527  C  C     . LYS B  2  109 ? 19.828  42.118  2.043   1.00 19.81  ? 109  LYS B C     1 
ATOM   5528  O  O     . LYS B  2  109 ? 19.804  42.011  3.269   1.00 19.36  ? 109  LYS B O     1 
ATOM   5529  C  CB    . LYS B  2  109 ? 18.796  44.266  1.411   1.00 21.79  ? 109  LYS B CB    1 
ATOM   5530  C  CG    . LYS B  2  109 ? 20.056  44.857  0.769   1.00 18.86  ? 109  LYS B CG    1 
ATOM   5531  C  CD    . LYS B  2  109 ? 19.871  46.390  0.586   1.00 21.96  ? 109  LYS B CD    1 
ATOM   5532  C  CE    . LYS B  2  109 ? 21.184  47.067  0.187   1.00 15.39  ? 109  LYS B CE    1 
ATOM   5533  N  NZ    . LYS B  2  109 ? 21.092  48.586  0.193   1.00 21.41  ? 109  LYS B NZ    1 
ATOM   5534  N  N     . ASP B  2  110 ? 20.827  41.697  1.279   1.00 19.40  ? 110  ASP B N     1 
ATOM   5535  C  CA    . ASP B  2  110 ? 22.029  41.083  1.833   1.00 21.21  ? 110  ASP B CA    1 
ATOM   5536  C  C     . ASP B  2  110 ? 21.770  40.128  3.009   1.00 21.52  ? 110  ASP B C     1 
ATOM   5537  O  O     . ASP B  2  110 ? 21.146  39.089  2.844   1.00 23.62  ? 110  ASP B O     1 
ATOM   5538  C  CB    . ASP B  2  110 ? 23.042  42.166  2.261   1.00 21.87  ? 110  ASP B CB    1 
ATOM   5539  C  CG    . ASP B  2  110 ? 23.565  43.005  1.080   1.00 29.64  ? 110  ASP B CG    1 
ATOM   5540  O  OD1   . ASP B  2  110 ? 23.503  42.514  -0.083  1.00 21.41  ? 110  ASP B OD1   1 
ATOM   5541  O  OD2   . ASP B  2  110 ? 24.044  44.152  1.320   1.00 23.54  ? 110  ASP B OD2   1 
ATOM   5542  N  N     . LEU B  2  111 ? 22.229  40.488  4.200   1.00 19.65  ? 111  LEU B N     1 
ATOM   5543  C  CA    . LEU B  2  111 ? 22.066  39.625  5.371   1.00 17.52  ? 111  LEU B CA    1 
ATOM   5544  C  C     . LEU B  2  111 ? 20.855  39.922  6.241   1.00 16.02  ? 111  LEU B C     1 
ATOM   5545  O  O     . LEU B  2  111 ? 20.804  39.483  7.390   1.00 17.99  ? 111  LEU B O     1 
ATOM   5546  C  CB    . LEU B  2  111 ? 23.304  39.740  6.246   1.00 15.81  ? 111  LEU B CB    1 
ATOM   5547  C  CG    . LEU B  2  111 ? 24.626  39.431  5.571   1.00 15.71  ? 111  LEU B CG    1 
ATOM   5548  C  CD1   . LEU B  2  111 ? 25.740  39.677  6.571   1.00 18.02  ? 111  LEU B CD1   1 
ATOM   5549  C  CD2   . LEU B  2  111 ? 24.659  37.951  5.124   1.00 13.07  ? 111  LEU B CD2   1 
ATOM   5550  N  N     . VAL B  2  112 ? 19.905  40.669  5.706   1.00 15.36  ? 112  VAL B N     1 
ATOM   5551  C  CA    . VAL B  2  112 ? 18.721  41.093  6.454   1.00 15.32  ? 112  VAL B CA    1 
ATOM   5552  C  C     . VAL B  2  112 ? 17.493  40.303  6.061   1.00 18.11  ? 112  VAL B C     1 
ATOM   5553  O  O     . VAL B  2  112 ? 16.982  40.456  4.949   1.00 16.45  ? 112  VAL B O     1 
ATOM   5554  C  CB    . VAL B  2  112 ? 18.401  42.610  6.202   1.00 18.53  ? 112  VAL B CB    1 
ATOM   5555  C  CG1   . VAL B  2  112 ? 17.181  43.019  6.986   1.00 18.68  ? 112  VAL B CG1   1 
ATOM   5556  C  CG2   . VAL B  2  112 ? 19.585  43.494  6.578   1.00 14.42  ? 112  VAL B CG2   1 
ATOM   5557  N  N     . PRO B  2  113 ? 16.991  39.454  6.969   1.00 18.90  ? 113  PRO B N     1 
ATOM   5558  C  CA    . PRO B  2  113 ? 15.806  38.639  6.699   1.00 19.20  ? 113  PRO B CA    1 
ATOM   5559  C  C     . PRO B  2  113 ? 14.508  39.303  7.147   1.00 21.71  ? 113  PRO B C     1 
ATOM   5560  O  O     . PRO B  2  113 ? 14.513  40.176  8.006   1.00 23.76  ? 113  PRO B O     1 
ATOM   5561  C  CB    . PRO B  2  113 ? 16.086  37.378  7.511   1.00 22.13  ? 113  PRO B CB    1 
ATOM   5562  C  CG    . PRO B  2  113 ? 16.722  37.952  8.761   1.00 17.40  ? 113  PRO B CG    1 
ATOM   5563  C  CD    . PRO B  2  113 ? 17.676  38.998  8.197   1.00 19.32  ? 113  PRO B CD    1 
ATOM   5564  N  N     . ASP B  2  114 ? 13.386  38.876  6.585   1.00 18.89  ? 114  ASP B N     1 
ATOM   5565  C  CA    . ASP B  2  114 ? 12.101  39.438  7.006   1.00 18.41  ? 114  ASP B CA    1 
ATOM   5566  C  C     . ASP B  2  114 ? 11.632  38.599  8.184   1.00 18.95  ? 114  ASP B C     1 
ATOM   5567  O  O     . ASP B  2  114 ? 11.291  37.415  8.029   1.00 16.56  ? 114  ASP B O     1 
ATOM   5568  C  CB    . ASP B  2  114 ? 11.077  39.356  5.882   1.00 21.06  ? 114  ASP B CB    1 
ATOM   5569  C  CG    . ASP B  2  114 ? 9.719   39.937  6.284   1.00 25.10  ? 114  ASP B CG    1 
ATOM   5570  O  OD1   . ASP B  2  114 ? 9.519   40.258  7.481   1.00 26.00  ? 114  ASP B OD1   1 
ATOM   5571  O  OD2   . ASP B  2  114 ? 8.844   40.056  5.393   1.00 26.99  ? 114  ASP B OD2   1 
ATOM   5572  N  N     . LEU B  2  115 ? 11.606  39.214  9.364   1.00 17.62  ? 115  LEU B N     1 
ATOM   5573  C  CA    . LEU B  2  115 ? 11.218  38.518  10.592  1.00 18.42  ? 115  LEU B CA    1 
ATOM   5574  C  C     . LEU B  2  115 ? 9.771   38.775  10.985  1.00 15.76  ? 115  LEU B C     1 
ATOM   5575  O  O     . LEU B  2  115 ? 9.349   38.383  12.080  1.00 17.19  ? 115  LEU B O     1 
ATOM   5576  C  CB    . LEU B  2  115 ? 12.110  38.963  11.732  1.00 16.10  ? 115  LEU B CB    1 
ATOM   5577  C  CG    . LEU B  2  115 ? 13.567  38.530  11.642  1.00 22.38  ? 115  LEU B CG    1 
ATOM   5578  C  CD1   . LEU B  2  115 ? 14.308  39.101  12.833  1.00 19.20  ? 115  LEU B CD1   1 
ATOM   5579  C  CD2   . LEU B  2  115 ? 13.662  36.989  11.639  1.00 21.94  ? 115  LEU B CD2   1 
ATOM   5580  N  N     . SER B  2  116 ? 9.002   39.397  10.095  1.00 15.89  ? 116  SER B N     1 
ATOM   5581  C  CA    . SER B  2  116 ? 7.630   39.727  10.491  1.00 19.84  ? 116  SER B CA    1 
ATOM   5582  C  C     . SER B  2  116 ? 6.723   38.526  10.801  1.00 18.38  ? 116  SER B C     1 
ATOM   5583  O  O     . SER B  2  116 ? 5.889   38.611  11.681  1.00 17.82  ? 116  SER B O     1 
ATOM   5584  C  CB    . SER B  2  116 ? 7.001   40.722  9.497   1.00 16.48  ? 116  SER B CB    1 
ATOM   5585  O  OG    . SER B  2  116 ? 7.025   40.258  8.159   1.00 27.94  ? 116  SER B OG    1 
ATOM   5586  N  N     . ASN B  2  117 ? 6.902   37.390  10.153  1.00 19.25  ? 117  ASN B N     1 
ATOM   5587  C  CA    . ASN B  2  117 ? 6.040   36.257  10.525  1.00 21.58  ? 117  ASN B CA    1 
ATOM   5588  C  C     . ASN B  2  117 ? 6.450   35.811  11.936  1.00 16.31  ? 117  ASN B C     1 
ATOM   5589  O  O     . ASN B  2  117 ? 5.616   35.540  12.787  1.00 17.16  ? 117  ASN B O     1 
ATOM   5590  C  CB    . ASN B  2  117 ? 6.189   35.086  9.545   1.00 19.78  ? 117  ASN B CB    1 
ATOM   5591  C  CG    . ASN B  2  117 ? 5.299   33.911  9.923   1.00 24.05  ? 117  ASN B CG    1 
ATOM   5592  O  OD1   . ASN B  2  117 ? 4.092   34.086  10.138  1.00 22.92  ? 117  ASN B OD1   1 
ATOM   5593  N  ND2   . ASN B  2  117 ? 5.889   32.711  10.023  1.00 19.40  ? 117  ASN B ND2   1 
ATOM   5594  N  N     . PHE B  2  118 ? 7.762   35.777  12.173  1.00 21.34  ? 118  PHE B N     1 
ATOM   5595  C  CA    . PHE B  2  118 ? 8.306   35.381  13.464  1.00 18.51  ? 118  PHE B CA    1 
ATOM   5596  C  C     . PHE B  2  118 ? 7.716   36.211  14.601  1.00 17.27  ? 118  PHE B C     1 
ATOM   5597  O  O     . PHE B  2  118 ? 7.317   35.650  15.626  1.00 18.25  ? 118  PHE B O     1 
ATOM   5598  C  CB    . PHE B  2  118 ? 9.834   35.526  13.428  1.00 21.70  ? 118  PHE B CB    1 
ATOM   5599  C  CG    . PHE B  2  118 ? 10.531  35.226  14.757  1.00 23.66  ? 118  PHE B CG    1 
ATOM   5600  C  CD1   . PHE B  2  118 ? 10.818  33.907  15.147  1.00 22.51  ? 118  PHE B CD1   1 
ATOM   5601  C  CD2   . PHE B  2  118 ? 10.980  36.266  15.558  1.00 22.52  ? 118  PHE B CD2   1 
ATOM   5602  C  CE1   . PHE B  2  118 ? 11.558  33.634  16.304  1.00 17.74  ? 118  PHE B CE1   1 
ATOM   5603  C  CE2   . PHE B  2  118 ? 11.723  36.008  16.728  1.00 22.53  ? 118  PHE B CE2   1 
ATOM   5604  C  CZ    . PHE B  2  118 ? 12.012  34.692  17.092  1.00 21.34  ? 118  PHE B CZ    1 
ATOM   5605  N  N     . TYR B  2  119 ? 7.650   37.543  14.426  1.00 17.59  ? 119  TYR B N     1 
ATOM   5606  C  CA    . TYR B  2  119 ? 7.110   38.419  15.482  1.00 14.66  ? 119  TYR B CA    1 
ATOM   5607  C  C     . TYR B  2  119 ? 5.605   38.222  15.647  1.00 16.25  ? 119  TYR B C     1 
ATOM   5608  O  O     . TYR B  2  119 ? 5.066   38.294  16.761  1.00 15.81  ? 119  TYR B O     1 
ATOM   5609  C  CB    . TYR B  2  119 ? 7.389   39.912  15.174  1.00 11.28  ? 119  TYR B CB    1 
ATOM   5610  C  CG    . TYR B  2  119 ? 8.890   40.287  15.049  1.00 15.90  ? 119  TYR B CG    1 
ATOM   5611  C  CD1   . TYR B  2  119 ? 9.812   39.836  15.978  1.00 13.56  ? 119  TYR B CD1   1 
ATOM   5612  C  CD2   . TYR B  2  119 ? 9.353   41.117  14.005  1.00 9.93   ? 119  TYR B CD2   1 
ATOM   5613  C  CE1   . TYR B  2  119 ? 11.154  40.192  15.894  1.00 19.05  ? 119  TYR B CE1   1 
ATOM   5614  C  CE2   . TYR B  2  119 ? 10.696  41.480  13.898  1.00 17.81  ? 119  TYR B CE2   1 
ATOM   5615  C  CZ    . TYR B  2  119 ? 11.594  41.014  14.856  1.00 22.23  ? 119  TYR B CZ    1 
ATOM   5616  O  OH    . TYR B  2  119 ? 12.920  41.390  14.806  1.00 21.86  ? 119  TYR B OH    1 
ATOM   5617  N  N     . ALA B  2  120 ? 4.920   37.950  14.540  1.00 14.56  ? 120  ALA B N     1 
ATOM   5618  C  CA    . ALA B  2  120 ? 3.482   37.774  14.601  1.00 16.13  ? 120  ALA B CA    1 
ATOM   5619  C  C     . ALA B  2  120 ? 3.173   36.480  15.327  1.00 17.22  ? 120  ALA B C     1 
ATOM   5620  O  O     . ALA B  2  120 ? 2.184   36.420  16.045  1.00 19.35  ? 120  ALA B O     1 
ATOM   5621  C  CB    . ALA B  2  120 ? 2.858   37.774  13.194  1.00 14.16  ? 120  ALA B CB    1 
ATOM   5622  N  N     . GLN B  2  121 ? 4.004   35.454  15.151  1.00 16.66  ? 121  GLN B N     1 
ATOM   5623  C  CA    . GLN B  2  121 ? 3.778   34.185  15.854  1.00 13.38  ? 121  GLN B CA    1 
ATOM   5624  C  C     . GLN B  2  121 ? 3.972   34.461  17.328  1.00 15.32  ? 121  GLN B C     1 
ATOM   5625  O  O     . GLN B  2  121 ? 3.218   33.971  18.140  1.00 16.03  ? 121  GLN B O     1 
ATOM   5626  C  CB    . GLN B  2  121 ? 4.750   33.094  15.364  1.00 11.57  ? 121  GLN B CB    1 
ATOM   5627  C  CG    . GLN B  2  121 ? 4.362   32.538  13.966  1.00 14.95  ? 121  GLN B CG    1 
ATOM   5628  C  CD    . GLN B  2  121 ? 5.392   31.610  13.356  1.00 21.47  ? 121  GLN B CD    1 
ATOM   5629  O  OE1   . GLN B  2  121 ? 5.041   30.556  12.802  1.00 23.82  ? 121  GLN B OE1   1 
ATOM   5630  N  NE2   . GLN B  2  121 ? 6.666   31.998  13.424  1.00 18.84  ? 121  GLN B NE2   1 
ATOM   5631  N  N     . TYR B  2  122 ? 4.979   35.272  17.668  1.00 16.82  ? 122  TYR B N     1 
ATOM   5632  C  CA    . TYR B  2  122 ? 5.248   35.616  19.064  1.00 18.40  ? 122  TYR B CA    1 
ATOM   5633  C  C     . TYR B  2  122 ? 4.035   36.364  19.632  1.00 21.99  ? 122  TYR B C     1 
ATOM   5634  O  O     . TYR B  2  122 ? 3.586   36.094  20.748  1.00 20.61  ? 122  TYR B O     1 
ATOM   5635  C  CB    . TYR B  2  122 ? 6.510   36.487  19.165  1.00 17.22  ? 122  TYR B CB    1 
ATOM   5636  C  CG    . TYR B  2  122 ? 6.803   36.933  20.553  1.00 15.19  ? 122  TYR B CG    1 
ATOM   5637  C  CD1   . TYR B  2  122 ? 6.983   36.008  21.570  1.00 12.68  ? 122  TYR B CD1   1 
ATOM   5638  C  CD2   . TYR B  2  122 ? 6.958   38.305  20.856  1.00 19.42  ? 122  TYR B CD2   1 
ATOM   5639  C  CE1   . TYR B  2  122 ? 7.326   36.414  22.869  1.00 14.73  ? 122  TYR B CE1   1 
ATOM   5640  C  CE2   . TYR B  2  122 ? 7.306   38.725  22.161  1.00 15.82  ? 122  TYR B CE2   1 
ATOM   5641  C  CZ    . TYR B  2  122 ? 7.486   37.771  23.151  1.00 16.71  ? 122  TYR B CZ    1 
ATOM   5642  O  OH    . TYR B  2  122 ? 7.778   38.150  24.432  1.00 19.90  ? 122  TYR B OH    1 
ATOM   5643  N  N     . LYS B  2  123 ? 3.488   37.287  18.849  1.00 21.54  ? 123  LYS B N     1 
ATOM   5644  C  CA    . LYS B  2  123 ? 2.299   38.019  19.300  1.00 24.93  ? 123  LYS B CA    1 
ATOM   5645  C  C     . LYS B  2  123 ? 1.110   37.061  19.522  1.00 22.06  ? 123  LYS B C     1 
ATOM   5646  O  O     . LYS B  2  123 ? 0.351   37.188  20.487  1.00 22.00  ? 123  LYS B O     1 
ATOM   5647  C  CB    . LYS B  2  123 ? 1.907   39.071  18.250  1.00 27.14  ? 123  LYS B CB    1 
ATOM   5648  C  CG    . LYS B  2  123 ? 0.662   39.896  18.613  1.00 32.01  ? 123  LYS B CG    1 
ATOM   5649  C  CD    . LYS B  2  123 ? 0.463   41.087  17.671  1.00 35.39  ? 123  LYS B CD    1 
ATOM   5650  C  CE    . LYS B  2  123 ? -0.656  41.986  18.188  1.00 44.08  ? 123  LYS B CE    1 
ATOM   5651  N  NZ    . LYS B  2  123 ? -0.965  43.124  17.261  1.00 49.75  ? 123  LYS B NZ    1 
ATOM   5652  N  N     . SER B  2  124 ? 0.967   36.078  18.646  1.00 20.11  ? 124  SER B N     1 
ATOM   5653  C  CA    . SER B  2  124 ? -0.156  35.166  18.748  1.00 21.73  ? 124  SER B CA    1 
ATOM   5654  C  C     . SER B  2  124 ? -0.265  34.362  20.036  1.00 21.23  ? 124  SER B C     1 
ATOM   5655  O  O     . SER B  2  124 ? -1.331  33.858  20.327  1.00 21.78  ? 124  SER B O     1 
ATOM   5656  C  CB    . SER B  2  124 ? -0.175  34.215  17.550  1.00 16.61  ? 124  SER B CB    1 
ATOM   5657  O  OG    . SER B  2  124 ? 0.738   33.164  17.752  1.00 22.60  ? 124  SER B OG    1 
ATOM   5658  N  N     . ILE B  2  125 ? 0.809   34.231  20.812  1.00 23.60  ? 125  ILE B N     1 
ATOM   5659  C  CA    . ILE B  2  125 ? 0.724   33.459  22.048  1.00 21.65  ? 125  ILE B CA    1 
ATOM   5660  C  C     . ILE B  2  125 ? 0.510   34.301  23.298  1.00 23.23  ? 125  ILE B C     1 
ATOM   5661  O  O     . ILE B  2  125 ? 0.554   33.776  24.408  1.00 25.38  ? 125  ILE B O     1 
ATOM   5662  C  CB    . ILE B  2  125 ? 1.971   32.516  22.248  1.00 23.94  ? 125  ILE B CB    1 
ATOM   5663  C  CG1   . ILE B  2  125 ? 3.285   33.304  22.218  1.00 25.49  ? 125  ILE B CG1   1 
ATOM   5664  C  CG2   . ILE B  2  125 ? 2.017   31.490  21.124  1.00 22.51  ? 125  ILE B CG2   1 
ATOM   5665  C  CD1   . ILE B  2  125 ? 3.921   33.462  23.549  1.00 22.56  ? 125  ILE B CD1   1 
ATOM   5666  N  N     . GLU B  2  126 ? 0.268   35.600  23.113  1.00 20.70  ? 126  GLU B N     1 
ATOM   5667  C  CA    . GLU B  2  126 ? -0.001  36.557  24.190  1.00 16.85  ? 126  GLU B CA    1 
ATOM   5668  C  C     . GLU B  2  126 ? 1.061   36.540  25.272  1.00 17.00  ? 126  GLU B C     1 
ATOM   5669  O  O     . GLU B  2  126 ? 0.809   36.169  26.432  1.00 19.07  ? 126  GLU B O     1 
ATOM   5670  C  CB    . GLU B  2  126 ? -1.419  36.287  24.759  1.00 17.70  ? 126  GLU B CB    1 
ATOM   5671  C  CG    . GLU B  2  126 ? -2.482  36.367  23.662  1.00 23.61  ? 126  GLU B CG    1 
ATOM   5672  C  CD    . GLU B  2  126 ? -3.935  36.341  24.155  1.00 32.68  ? 126  GLU B CD    1 
ATOM   5673  O  OE1   . GLU B  2  126 ? -4.179  36.357  25.373  1.00 32.62  ? 126  GLU B OE1   1 
ATOM   5674  O  OE2   . GLU B  2  126 ? -4.853  36.317  23.296  1.00 38.38  ? 126  GLU B OE2   1 
ATOM   5675  N  N     . PRO B  2  127 ? 2.271   36.995  24.926  1.00 20.24  ? 127  PRO B N     1 
ATOM   5676  C  CA    . PRO B  2  127 ? 3.354   37.000  25.891  1.00 20.81  ? 127  PRO B CA    1 
ATOM   5677  C  C     . PRO B  2  127 ? 3.233   38.069  26.932  1.00 22.05  ? 127  PRO B C     1 
ATOM   5678  O  O     . PRO B  2  127 ? 4.075   38.970  26.985  1.00 23.49  ? 127  PRO B O     1 
ATOM   5679  C  CB    . PRO B  2  127 ? 4.582   37.193  25.018  1.00 23.04  ? 127  PRO B CB    1 
ATOM   5680  C  CG    . PRO B  2  127 ? 4.094   38.135  24.015  1.00 24.34  ? 127  PRO B CG    1 
ATOM   5681  C  CD    . PRO B  2  127 ? 2.701   37.617  23.658  1.00 20.89  ? 127  PRO B CD    1 
ATOM   5682  N  N     . TYR B  2  128 ? 2.184   38.011  27.746  1.00 19.27  ? 128  TYR B N     1 
ATOM   5683  C  CA    . TYR B  2  128 ? 2.038   38.987  28.823  1.00 20.24  ? 128  TYR B CA    1 
ATOM   5684  C  C     . TYR B  2  128 ? 1.295   38.367  29.996  1.00 19.20  ? 128  TYR B C     1 
ATOM   5685  O  O     . TYR B  2  128 ? 0.587   37.381  29.835  1.00 22.72  ? 128  TYR B O     1 
ATOM   5686  C  CB    . TYR B  2  128 ? 1.335   40.253  28.315  1.00 18.59  ? 128  TYR B CB    1 
ATOM   5687  C  CG    . TYR B  2  128 ? 0.177   39.990  27.380  1.00 20.76  ? 128  TYR B CG    1 
ATOM   5688  C  CD1   . TYR B  2  128 ? -1.087  39.675  27.878  1.00 18.68  ? 128  TYR B CD1   1 
ATOM   5689  C  CD2   . TYR B  2  128 ? 0.333   40.112  25.993  1.00 20.70  ? 128  TYR B CD2   1 
ATOM   5690  C  CE1   . TYR B  2  128 ? -2.166  39.509  27.036  1.00 23.98  ? 128  TYR B CE1   1 
ATOM   5691  C  CE2   . TYR B  2  128 ? -0.744  39.946  25.141  1.00 22.52  ? 128  TYR B CE2   1 
ATOM   5692  C  CZ    . TYR B  2  128 ? -1.987  39.654  25.662  1.00 22.32  ? 128  TYR B CZ    1 
ATOM   5693  O  OH    . TYR B  2  128 ? -3.059  39.544  24.827  1.00 19.31  ? 128  TYR B OH    1 
ATOM   5694  N  N     . LEU B  2  129 ? 1.476   38.930  31.182  1.00 19.89  ? 129  LEU B N     1 
ATOM   5695  C  CA    . LEU B  2  129 ? 0.832   38.396  32.377  1.00 19.83  ? 129  LEU B CA    1 
ATOM   5696  C  C     . LEU B  2  129 ? -0.678  38.608  32.354  1.00 20.92  ? 129  LEU B C     1 
ATOM   5697  O  O     . LEU B  2  129 ? -1.141  39.723  32.153  1.00 17.99  ? 129  LEU B O     1 
ATOM   5698  C  CB    . LEU B  2  129 ? 1.392   39.067  33.633  1.00 18.56  ? 129  LEU B CB    1 
ATOM   5699  C  CG    . LEU B  2  129 ? 0.926   38.458  34.955  1.00 20.55  ? 129  LEU B CG    1 
ATOM   5700  C  CD1   . LEU B  2  129 ? 1.469   37.024  34.960  1.00 20.50  ? 129  LEU B CD1   1 
ATOM   5701  C  CD2   . LEU B  2  129 ? 1.466   39.214  36.178  1.00 17.63  ? 129  LEU B CD2   1 
ATOM   5702  N  N     . LYS B  2  130 ? -1.432  37.525  32.563  1.00 21.27  ? 130  LYS B N     1 
ATOM   5703  C  CA    . LYS B  2  130 ? -2.894  37.580  32.603  1.00 21.89  ? 130  LYS B CA    1 
ATOM   5704  C  C     . LYS B  2  130 ? -3.374  36.938  33.909  1.00 25.54  ? 130  LYS B C     1 
ATOM   5705  O  O     . LYS B  2  130 ? -3.003  35.817  34.240  1.00 27.03  ? 130  LYS B O     1 
ATOM   5706  C  CB    . LYS B  2  130 ? -3.508  36.809  31.437  1.00 20.89  ? 130  LYS B CB    1 
ATOM   5707  C  CG    . LYS B  2  130 ? -2.975  37.200  30.085  1.00 27.35  ? 130  LYS B CG    1 
ATOM   5708  C  CD    . LYS B  2  130 ? -3.557  36.333  28.956  1.00 30.83  ? 130  LYS B CD    1 
ATOM   5709  C  CE    . LYS B  2  130 ? -5.061  36.561  28.806  1.00 33.94  ? 130  LYS B CE    1 
ATOM   5710  N  NZ    . LYS B  2  130 ? -5.619  35.641  27.783  1.00 36.25  ? 130  LYS B NZ    1 
ATOM   5711  N  N     . LYS B  2  131 ? -4.184  37.667  34.658  1.00 27.26  ? 131  LYS B N     1 
ATOM   5712  C  CA    . LYS B  2  131 ? -4.739  37.148  35.881  1.00 27.55  ? 131  LYS B CA    1 
ATOM   5713  C  C     . LYS B  2  131 ? -6.254  37.182  35.688  1.00 26.80  ? 131  LYS B C     1 
ATOM   5714  O  O     . LYS B  2  131 ? -6.753  37.946  34.856  1.00 26.67  ? 131  LYS B O     1 
ATOM   5715  C  CB    . LYS B  2  131 ? -4.286  38.025  37.046  1.00 28.38  ? 131  LYS B CB    1 
ATOM   5716  C  CG    . LYS B  2  131 ? -2.781  37.910  37.245  1.00 32.04  ? 131  LYS B CG    1 
ATOM   5717  C  CD    . LYS B  2  131 ? -2.273  38.835  38.297  1.00 34.54  ? 131  LYS B CD    1 
ATOM   5718  C  CE    . LYS B  2  131 ? -2.421  38.269  39.684  1.00 32.06  ? 131  LYS B CE    1 
ATOM   5719  N  NZ    . LYS B  2  131 ? -1.677  37.013  39.883  1.00 24.26  ? 131  LYS B NZ    1 
ATOM   5720  N  N     . LYS B  2  132 ? -6.976  36.342  36.419  1.00 26.94  ? 132  LYS B N     1 
ATOM   5721  C  CA    . LYS B  2  132 ? -8.427  36.296  36.304  1.00 28.55  ? 132  LYS B CA    1 
ATOM   5722  C  C     . LYS B  2  132 ? -9.053  37.650  36.668  1.00 28.99  ? 132  LYS B C     1 
ATOM   5723  O  O     . LYS B  2  132 ? -10.068 38.018  36.104  1.00 30.35  ? 132  LYS B O     1 
ATOM   5724  C  CB    . LYS B  2  132 ? -9.012  35.181  37.190  1.00 33.74  ? 132  LYS B CB    1 
ATOM   5725  C  CG    . LYS B  2  132 ? -8.678  33.769  36.712  1.00 40.05  ? 132  LYS B CG    1 
ATOM   5726  C  CD    . LYS B  2  132 ? -9.143  33.484  35.253  1.00 48.23  ? 132  LYS B CD    1 
ATOM   5727  C  CE    . LYS B  2  132 ? -8.745  32.048  34.787  1.00 49.84  ? 132  LYS B CE    1 
ATOM   5728  N  NZ    . LYS B  2  132 ? -9.103  31.752  33.350  1.00 48.97  ? 132  LYS B NZ    1 
ATOM   5729  N  N     . ASP B  2  133 ? -8.461  38.373  37.616  1.00 27.48  ? 133  ASP B N     1 
ATOM   5730  C  CA    . ASP B  2  133 ? -8.954  39.714  37.987  1.00 27.76  ? 133  ASP B CA    1 
ATOM   5731  C  C     . ASP B  2  133 ? -7.788  40.701  37.966  1.00 24.99  ? 133  ASP B C     1 
ATOM   5732  O  O     . ASP B  2  133 ? -6.970  40.700  38.861  1.00 28.13  ? 133  ASP B O     1 
ATOM   5733  C  CB    . ASP B  2  133 ? -9.539  39.726  39.386  1.00 27.02  ? 133  ASP B CB    1 
ATOM   5734  C  CG    . ASP B  2  133 ? -10.348 40.982  39.656  1.00 34.16  ? 133  ASP B CG    1 
ATOM   5735  O  OD1   . ASP B  2  133 ? -9.924  42.086  39.241  1.00 22.48  ? 133  ASP B OD1   1 
ATOM   5736  O  OD2   . ASP B  2  133 ? -11.428 40.861  40.283  1.00 40.82  ? 133  ASP B OD2   1 
ATOM   5737  N  N     . GLU B  2  134 ? -7.733  41.543  36.943  1.00 27.83  ? 134  GLU B N     1 
ATOM   5738  C  CA    . GLU B  2  134 ? -6.679  42.526  36.764  1.00 23.80  ? 134  GLU B CA    1 
ATOM   5739  C  C     . GLU B  2  134 ? -7.029  43.912  37.330  1.00 26.67  ? 134  GLU B C     1 
ATOM   5740  O  O     . GLU B  2  134 ? -6.217  44.844  37.270  1.00 25.07  ? 134  GLU B O     1 
ATOM   5741  C  CB    . GLU B  2  134 ? -6.390  42.635  35.279  1.00 25.05  ? 134  GLU B CB    1 
ATOM   5742  C  CG    . GLU B  2  134 ? -5.845  41.346  34.685  1.00 37.69  ? 134  GLU B CG    1 
ATOM   5743  C  CD    . GLU B  2  134 ? -5.363  41.491  33.226  1.00 41.41  ? 134  GLU B CD    1 
ATOM   5744  O  OE1   . GLU B  2  134 ? -5.071  42.626  32.783  1.00 44.27  ? 134  GLU B OE1   1 
ATOM   5745  O  OE2   . GLU B  2  134 ? -5.248  40.461  32.532  1.00 43.04  ? 134  GLU B OE2   1 
ATOM   5746  N  N     . SER B  2  135 ? -8.213  44.065  37.918  1.00 21.46  ? 135  SER B N     1 
ATOM   5747  C  CA    . SER B  2  135 ? -8.563  45.389  38.426  1.00 24.06  ? 135  SER B CA    1 
ATOM   5748  C  C     . SER B  2  135 ? -7.692  45.949  39.575  1.00 22.47  ? 135  SER B C     1 
ATOM   5749  O  O     . SER B  2  135 ? -7.691  47.167  39.800  1.00 21.36  ? 135  SER B O     1 
ATOM   5750  C  CB    . SER B  2  135 ? -10.078 45.465  38.786  1.00 17.79  ? 135  SER B CB    1 
ATOM   5751  O  OG    . SER B  2  135 ? -10.391 44.592  39.832  1.00 24.43  ? 135  SER B OG    1 
ATOM   5752  N  N     . LYS B  2  136 ? -6.933  45.114  40.283  1.00 24.44  ? 136  LYS B N     1 
ATOM   5753  C  CA    . LYS B  2  136 ? -6.065  45.653  41.353  1.00 26.87  ? 136  LYS B CA    1 
ATOM   5754  C  C     . LYS B  2  136 ? -4.655  45.930  40.828  1.00 25.95  ? 136  LYS B C     1 
ATOM   5755  O  O     . LYS B  2  136 ? -3.741  46.195  41.605  1.00 28.25  ? 136  LYS B O     1 
ATOM   5756  C  CB    . LYS B  2  136 ? -5.916  44.681  42.526  1.00 28.95  ? 136  LYS B CB    1 
ATOM   5757  C  CG    . LYS B  2  136 ? -7.194  44.219  43.155  1.00 34.43  ? 136  LYS B CG    1 
ATOM   5758  C  CD    . LYS B  2  136 ? -7.866  45.305  43.930  1.00 41.55  ? 136  LYS B CD    1 
ATOM   5759  C  CE    . LYS B  2  136 ? -8.708  44.688  45.050  1.00 46.23  ? 136  LYS B CE    1 
ATOM   5760  N  NZ    . LYS B  2  136 ? -9.323  45.725  45.927  1.00 49.62  ? 136  LYS B NZ    1 
ATOM   5761  N  N     . GLN B  2  137 ? -4.476  45.847  39.521  1.00 24.76  ? 137  GLN B N     1 
ATOM   5762  C  CA    . GLN B  2  137 ? -3.174  46.071  38.916  1.00 23.99  ? 137  GLN B CA    1 
ATOM   5763  C  C     . GLN B  2  137 ? -2.580  47.422  39.338  1.00 27.42  ? 137  GLN B C     1 
ATOM   5764  O  O     . GLN B  2  137 ? -3.273  48.461  39.318  1.00 24.79  ? 137  GLN B O     1 
ATOM   5765  C  CB    . GLN B  2  137 ? -3.310  46.034  37.397  1.00 25.22  ? 137  GLN B CB    1 
ATOM   5766  C  CG    . GLN B  2  137 ? -3.871  47.323  36.837  1.00 31.16  ? 137  GLN B CG    1 
ATOM   5767  C  CD    . GLN B  2  137 ? -4.123  47.267  35.339  1.00 36.87  ? 137  GLN B CD    1 
ATOM   5768  O  OE1   . GLN B  2  137 ? -4.905  46.439  34.848  1.00 29.89  ? 137  GLN B OE1   1 
ATOM   5769  N  NE2   . GLN B  2  137 ? -3.456  48.159  34.603  1.00 40.17  ? 137  GLN B NE2   1 
ATOM   5770  N  N     . GLY B  2  138 ? -1.290  47.418  39.687  1.00 24.34  ? 138  GLY B N     1 
ATOM   5771  C  CA    . GLY B  2  138 ? -0.639  48.650  40.079  1.00 24.58  ? 138  GLY B CA    1 
ATOM   5772  C  C     . GLY B  2  138 ? -0.669  49.039  41.556  1.00 24.53  ? 138  GLY B C     1 
ATOM   5773  O  O     . GLY B  2  138 ? 0.000   49.985  41.956  1.00 26.47  ? 138  GLY B O     1 
ATOM   5774  N  N     . LYS B  2  139 ? -1.421  48.313  42.368  1.00 24.55  ? 139  LYS B N     1 
ATOM   5775  C  CA    . LYS B  2  139 ? -1.559  48.630  43.796  1.00 24.05  ? 139  LYS B CA    1 
ATOM   5776  C  C     . LYS B  2  139 ? -0.507  48.044  44.727  1.00 24.35  ? 139  LYS B C     1 
ATOM   5777  O  O     . LYS B  2  139 ? -0.001  48.717  45.611  1.00 24.74  ? 139  LYS B O     1 
ATOM   5778  C  CB    . LYS B  2  139 ? -2.939  48.186  44.294  1.00 31.15  ? 139  LYS B CB    1 
ATOM   5779  C  CG    . LYS B  2  139 ? -4.078  49.156  43.979  1.00 42.15  ? 139  LYS B CG    1 
ATOM   5780  C  CD    . LYS B  2  139 ? -5.394  48.687  44.666  1.00 51.36  ? 139  LYS B CD    1 
ATOM   5781  C  CE    . LYS B  2  139 ? -5.213  48.462  46.193  1.00 56.85  ? 139  LYS B CE    1 
ATOM   5782  N  NZ    . LYS B  2  139 ? -6.419  47.911  46.909  1.00 58.79  ? 139  LYS B NZ    1 
ATOM   5783  N  N     . GLU B  2  140 ? -0.205  46.768  44.556  1.00 22.35  ? 140  GLU B N     1 
ATOM   5784  C  CA    . GLU B  2  140 ? 0.805   46.136  45.374  1.00 24.84  ? 140  GLU B CA    1 
ATOM   5785  C  C     . GLU B  2  140 ? 1.584   45.118  44.574  1.00 24.79  ? 140  GLU B C     1 
ATOM   5786  O  O     . GLU B  2  140 ? 1.081   44.607  43.571  1.00 23.25  ? 140  GLU B O     1 
ATOM   5787  C  CB    . GLU B  2  140 ? 0.177   45.397  46.549  1.00 29.80  ? 140  GLU B CB    1 
ATOM   5788  C  CG    . GLU B  2  140 ? -0.371  46.287  47.607  1.00 40.79  ? 140  GLU B CG    1 
ATOM   5789  C  CD    . GLU B  2  140 ? -0.915  45.481  48.763  1.00 47.89  ? 140  GLU B CD    1 
ATOM   5790  O  OE1   . GLU B  2  140 ? -1.859  44.691  48.533  1.00 51.34  ? 140  GLU B OE1   1 
ATOM   5791  O  OE2   . GLU B  2  140 ? -0.389  45.633  49.894  1.00 55.95  ? 140  GLU B OE2   1 
ATOM   5792  N  N     . GLN B  2  141 ? 2.788   44.798  45.049  1.00 17.26  ? 141  GLN B N     1 
ATOM   5793  C  CA    . GLN B  2  141 ? 3.601   43.802  44.381  1.00 25.15  ? 141  GLN B CA    1 
ATOM   5794  C  C     . GLN B  2  141 ? 2.892   42.452  44.533  1.00 24.36  ? 141  GLN B C     1 
ATOM   5795  O  O     . GLN B  2  141 ? 2.394   42.154  45.602  1.00 24.63  ? 141  GLN B O     1 
ATOM   5796  C  CB    . GLN B  2  141 ? 4.952   43.620  45.083  1.00 25.56  ? 141  GLN B CB    1 
ATOM   5797  C  CG    . GLN B  2  141 ? 5.707   44.857  45.433  1.00 32.93  ? 141  GLN B CG    1 
ATOM   5798  C  CD    . GLN B  2  141 ? 6.859   44.538  46.375  1.00 32.29  ? 141  GLN B CD    1 
ATOM   5799  O  OE1   . GLN B  2  141 ? 7.737   43.735  46.053  1.00 29.46  ? 141  GLN B OE1   1 
ATOM   5800  N  NE2   . GLN B  2  141 ? 6.856   45.166  47.544  1.00 29.74  ? 141  GLN B NE2   1 
ATOM   5801  N  N     . TYR B  2  142 ? 2.874   41.649  43.475  1.00 24.41  ? 142  TYR B N     1 
ATOM   5802  C  CA    . TYR B  2  142 ? 2.335   40.286  43.525  1.00 23.27  ? 142  TYR B CA    1 
ATOM   5803  C  C     . TYR B  2  142 ? 3.461   39.501  44.202  1.00 24.02  ? 142  TYR B C     1 
ATOM   5804  O  O     . TYR B  2  142 ? 4.650   39.800  43.992  1.00 27.83  ? 142  TYR B O     1 
ATOM   5805  C  CB    . TYR B  2  142 ? 2.089   39.722  42.103  1.00 21.31  ? 142  TYR B CB    1 
ATOM   5806  C  CG    . TYR B  2  142 ? 0.956   40.416  41.339  1.00 28.55  ? 142  TYR B CG    1 
ATOM   5807  C  CD1   . TYR B  2  142 ? -0.142  40.982  42.016  1.00 20.02  ? 142  TYR B CD1   1 
ATOM   5808  C  CD2   . TYR B  2  142 ? 0.968   40.482  39.942  1.00 27.93  ? 142  TYR B CD2   1 
ATOM   5809  C  CE1   . TYR B  2  142 ? -1.185  41.595  41.308  1.00 28.80  ? 142  TYR B CE1   1 
ATOM   5810  C  CE2   . TYR B  2  142 ? -0.086  41.085  39.229  1.00 28.22  ? 142  TYR B CE2   1 
ATOM   5811  C  CZ    . TYR B  2  142 ? -1.149  41.637  39.908  1.00 30.34  ? 142  TYR B CZ    1 
ATOM   5812  O  OH    . TYR B  2  142 ? -2.161  42.226  39.182  1.00 24.62  ? 142  TYR B OH    1 
ATOM   5813  N  N     . LEU B  2  143 ? 3.118   38.519  45.027  1.00 22.18  ? 143  LEU B N     1 
ATOM   5814  C  CA    . LEU B  2  143 ? 4.148   37.752  45.714  1.00 25.44  ? 143  LEU B CA    1 
ATOM   5815  C  C     . LEU B  2  143 ? 4.574   36.562  44.914  1.00 25.35  ? 143  LEU B C     1 
ATOM   5816  O  O     . LEU B  2  143 ? 3.741   35.905  44.309  1.00 27.38  ? 143  LEU B O     1 
ATOM   5817  C  CB    . LEU B  2  143 ? 3.669   37.252  47.084  1.00 23.79  ? 143  LEU B CB    1 
ATOM   5818  C  CG    . LEU B  2  143 ? 3.373   38.375  48.071  1.00 25.86  ? 143  LEU B CG    1 
ATOM   5819  C  CD1   . LEU B  2  143 ? 2.832   37.764  49.368  1.00 29.02  ? 143  LEU B CD1   1 
ATOM   5820  C  CD2   . LEU B  2  143 ? 4.638   39.183  48.339  1.00 33.15  ? 143  LEU B CD2   1 
ATOM   5821  N  N     . GLN B  2  144 ? 5.876   36.283  44.906  1.00 22.33  ? 144  GLN B N     1 
ATOM   5822  C  CA    . GLN B  2  144 ? 6.388   35.118  44.198  1.00 21.90  ? 144  GLN B CA    1 
ATOM   5823  C  C     . GLN B  2  144 ? 7.552   34.567  45.013  1.00 24.34  ? 144  GLN B C     1 
ATOM   5824  O  O     . GLN B  2  144 ? 8.478   35.305  45.374  1.00 22.45  ? 144  GLN B O     1 
ATOM   5825  C  CB    . GLN B  2  144 ? 6.872   35.462  42.770  1.00 21.94  ? 144  GLN B CB    1 
ATOM   5826  C  CG    . GLN B  2  144 ? 7.176   34.186  41.918  1.00 23.64  ? 144  GLN B CG    1 
ATOM   5827  C  CD    . GLN B  2  144 ? 7.579   34.483  40.437  1.00 22.30  ? 144  GLN B CD    1 
ATOM   5828  O  OE1   . GLN B  2  144 ? 8.551   35.195  40.166  1.00 22.10  ? 144  GLN B OE1   1 
ATOM   5829  N  NE2   . GLN B  2  144 ? 6.838   33.920  39.500  1.00 17.46  ? 144  GLN B NE2   1 
ATOM   5830  N  N     . SER B  2  145 ? 7.501   33.277  45.323  1.00 21.94  ? 145  SER B N     1 
ATOM   5831  C  CA    . SER B  2  145 ? 8.568   32.675  46.101  1.00 21.82  ? 145  SER B CA    1 
ATOM   5832  C  C     . SER B  2  145 ? 9.828   32.508  45.281  1.00 23.21  ? 145  SER B C     1 
ATOM   5833  O  O     . SER B  2  145 ? 9.822   32.456  44.021  1.00 21.91  ? 145  SER B O     1 
ATOM   5834  C  CB    . SER B  2  145 ? 8.148   31.305  46.636  1.00 21.22  ? 145  SER B CB    1 
ATOM   5835  O  OG    . SER B  2  145 ? 8.141   30.347  45.611  1.00 28.93  ? 145  SER B OG    1 
ATOM   5836  N  N     . ILE B  2  146 ? 10.929  32.418  45.999  1.00 21.79  ? 146  ILE B N     1 
ATOM   5837  C  CA    . ILE B  2  146 ? 12.195  32.213  45.347  1.00 21.16  ? 146  ILE B CA    1 
ATOM   5838  C  C     . ILE B  2  146 ? 12.104  30.939  44.501  1.00 25.12  ? 146  ILE B C     1 
ATOM   5839  O  O     . ILE B  2  146 ? 12.511  30.920  43.325  1.00 23.41  ? 146  ILE B O     1 
ATOM   5840  C  CB    . ILE B  2  146 ? 13.315  32.119  46.410  1.00 23.80  ? 146  ILE B CB    1 
ATOM   5841  C  CG1   . ILE B  2  146 ? 13.622  33.534  46.939  1.00 20.72  ? 146  ILE B CG1   1 
ATOM   5842  C  CG2   . ILE B  2  146 ? 14.527  31.408  45.840  1.00 18.83  ? 146  ILE B CG2   1 
ATOM   5843  C  CD1   . ILE B  2  146 ? 14.740  33.611  47.989  1.00 19.30  ? 146  ILE B CD1   1 
ATOM   5844  N  N     . GLU B  2  147 ? 11.554  29.877  45.080  1.00 23.62  ? 147  GLU B N     1 
ATOM   5845  C  CA    . GLU B  2  147 ? 11.450  28.629  44.350  1.00 27.40  ? 147  GLU B CA    1 
ATOM   5846  C  C     . GLU B  2  147 ? 10.616  28.761  43.072  1.00 25.30  ? 147  GLU B C     1 
ATOM   5847  O  O     . GLU B  2  147 ? 10.970  28.199  42.049  1.00 23.30  ? 147  GLU B O     1 
ATOM   5848  C  CB    . GLU B  2  147 ? 10.857  27.527  45.243  1.00 31.48  ? 147  GLU B CB    1 
ATOM   5849  C  CG    . GLU B  2  147 ? 10.109  26.475  44.450  1.00 42.09  ? 147  GLU B CG    1 
ATOM   5850  C  CD    . GLU B  2  147 ? 9.600   25.320  45.306  1.00 53.15  ? 147  GLU B CD    1 
ATOM   5851  O  OE1   . GLU B  2  147 ? 9.179   25.563  46.463  1.00 57.38  ? 147  GLU B OE1   1 
ATOM   5852  O  OE2   . GLU B  2  147 ? 9.603   24.167  44.813  1.00 58.33  ? 147  GLU B OE2   1 
ATOM   5853  N  N     . ASP B  2  148 ? 9.495   29.471  43.128  1.00 24.18  ? 148  ASP B N     1 
ATOM   5854  C  CA    . ASP B  2  148 ? 8.681   29.630  41.911  1.00 23.64  ? 148  ASP B CA    1 
ATOM   5855  C  C     . ASP B  2  148 ? 9.382   30.533  40.881  1.00 19.26  ? 148  ASP B C     1 
ATOM   5856  O  O     . ASP B  2  148 ? 9.279   30.310  39.691  1.00 21.61  ? 148  ASP B O     1 
ATOM   5857  C  CB    . ASP B  2  148 ? 7.312   30.208  42.261  1.00 29.93  ? 148  ASP B CB    1 
ATOM   5858  C  CG    . ASP B  2  148 ? 6.284   29.132  42.574  1.00 36.20  ? 148  ASP B CG    1 
ATOM   5859  O  OD1   . ASP B  2  148 ? 6.617   27.933  42.478  1.00 41.05  ? 148  ASP B OD1   1 
ATOM   5860  O  OD2   . ASP B  2  148 ? 5.132   29.493  42.912  1.00 42.07  ? 148  ASP B OD2   1 
ATOM   5861  N  N     . ARG B  2  149 ? 10.095  31.549  41.347  1.00 18.68  ? 149  ARG B N     1 
ATOM   5862  C  CA    . ARG B  2  149 ? 10.822  32.444  40.459  1.00 20.26  ? 149  ARG B CA    1 
ATOM   5863  C  C     . ARG B  2  149 ? 11.939  31.681  39.720  1.00 21.56  ? 149  ARG B C     1 
ATOM   5864  O  O     . ARG B  2  149 ? 12.239  31.919  38.545  1.00 15.54  ? 149  ARG B O     1 
ATOM   5865  C  CB    . ARG B  2  149 ? 11.423  33.588  41.279  1.00 17.82  ? 149  ARG B CB    1 
ATOM   5866  C  CG    . ARG B  2  149 ? 12.393  34.456  40.504  1.00 20.84  ? 149  ARG B CG    1 
ATOM   5867  C  CD    . ARG B  2  149 ? 11.804  34.996  39.194  1.00 21.86  ? 149  ARG B CD    1 
ATOM   5868  N  NE    . ARG B  2  149 ? 12.778  35.865  38.538  1.00 24.99  ? 149  ARG B NE    1 
ATOM   5869  C  CZ    . ARG B  2  149 ? 13.808  35.450  37.786  1.00 22.76  ? 149  ARG B CZ    1 
ATOM   5870  N  NH1   . ARG B  2  149 ? 14.043  34.160  37.551  1.00 22.41  ? 149  ARG B NH1   1 
ATOM   5871  N  NH2   . ARG B  2  149 ? 14.610  36.349  37.251  1.00 25.99  ? 149  ARG B NH2   1 
ATOM   5872  N  N     . GLN B  2  150 ? 12.532  30.732  40.412  1.00 24.62  ? 150  GLN B N     1 
ATOM   5873  C  CA    . GLN B  2  150 ? 13.616  29.969  39.833  1.00 25.03  ? 150  GLN B CA    1 
ATOM   5874  C  C     . GLN B  2  150 ? 13.172  29.152  38.632  1.00 22.97  ? 150  GLN B C     1 
ATOM   5875  O  O     . GLN B  2  150 ? 13.966  28.856  37.736  1.00 21.14  ? 150  GLN B O     1 
ATOM   5876  C  CB    . GLN B  2  150 ? 14.242  29.072  40.898  1.00 30.30  ? 150  GLN B CB    1 
ATOM   5877  C  CG    . GLN B  2  150 ? 15.457  28.374  40.377  1.00 41.05  ? 150  GLN B CG    1 
ATOM   5878  C  CD    . GLN B  2  150 ? 16.264  27.762  41.467  1.00 51.04  ? 150  GLN B CD    1 
ATOM   5879  O  OE1   . GLN B  2  150 ? 16.528  28.404  42.499  1.00 54.44  ? 150  GLN B OE1   1 
ATOM   5880  N  NE2   . GLN B  2  150 ? 16.689  26.512  41.258  1.00 55.31  ? 150  GLN B NE2   1 
ATOM   5881  N  N     . LYS B  2  151 ? 11.901  28.791  38.597  1.00 20.12  ? 151  LYS B N     1 
ATOM   5882  C  CA    . LYS B  2  151 ? 11.393  28.044  37.459  1.00 19.79  ? 151  LYS B CA    1 
ATOM   5883  C  C     . LYS B  2  151 ? 11.501  28.828  36.156  1.00 19.71  ? 151  LYS B C     1 
ATOM   5884  O  O     . LYS B  2  151 ? 11.449  28.242  35.089  1.00 17.24  ? 151  LYS B O     1 
ATOM   5885  C  CB    . LYS B  2  151 ? 9.929   27.673  37.682  1.00 23.05  ? 151  LYS B CB    1 
ATOM   5886  C  CG    . LYS B  2  151 ? 9.787   26.773  38.896  1.00 31.86  ? 151  LYS B CG    1 
ATOM   5887  C  CD    . LYS B  2  151 ? 8.351   26.316  39.113  1.00 34.68  ? 151  LYS B CD    1 
ATOM   5888  C  CE    . LYS B  2  151 ? 8.279   25.357  40.299  1.00 36.28  ? 151  LYS B CE    1 
ATOM   5889  N  NZ    . LYS B  2  151 ? 6.878   24.865  40.518  1.00 42.26  ? 151  LYS B NZ    1 
ATOM   5890  N  N     . LEU B  2  152 ? 11.624  30.149  36.236  1.00 18.13  ? 152  LEU B N     1 
ATOM   5891  C  CA    . LEU B  2  152 ? 11.715  30.955  35.027  1.00 19.91  ? 152  LEU B CA    1 
ATOM   5892  C  C     . LEU B  2  152 ? 13.144  31.024  34.508  1.00 20.11  ? 152  LEU B C     1 
ATOM   5893  O  O     . LEU B  2  152 ? 13.364  31.424  33.373  1.00 22.43  ? 152  LEU B O     1 
ATOM   5894  C  CB    . LEU B  2  152 ? 11.166  32.371  35.298  1.00 18.54  ? 152  LEU B CB    1 
ATOM   5895  C  CG    . LEU B  2  152 ? 9.673   32.473  35.650  1.00 17.32  ? 152  LEU B CG    1 
ATOM   5896  C  CD1   . LEU B  2  152 ? 9.325   33.940  35.858  1.00 17.35  ? 152  LEU B CD1   1 
ATOM   5897  C  CD2   . LEU B  2  152 ? 8.815   31.906  34.529  1.00 13.17  ? 152  LEU B CD2   1 
ATOM   5898  N  N     . ASP B  2  153 ? 14.122  30.632  35.322  1.00 19.50  ? 153  ASP B N     1 
ATOM   5899  C  CA    . ASP B  2  153 ? 15.502  30.667  34.837  1.00 23.40  ? 153  ASP B CA    1 
ATOM   5900  C  C     . ASP B  2  153 ? 15.655  29.754  33.609  1.00 24.27  ? 153  ASP B C     1 
ATOM   5901  O  O     . ASP B  2  153 ? 15.120  28.642  33.564  1.00 30.01  ? 153  ASP B O     1 
ATOM   5902  C  CB    . ASP B  2  153 ? 16.476  30.252  35.944  1.00 18.87  ? 153  ASP B CB    1 
ATOM   5903  C  CG    . ASP B  2  153 ? 16.642  31.335  37.009  1.00 21.82  ? 153  ASP B CG    1 
ATOM   5904  O  OD1   . ASP B  2  153 ? 16.412  32.535  36.721  1.00 19.69  ? 153  ASP B OD1   1 
ATOM   5905  O  OD2   . ASP B  2  153 ? 17.015  30.998  38.152  1.00 31.30  ? 153  ASP B OD2   1 
ATOM   5906  N  N     . GLY B  2  154 ? 16.375  30.229  32.603  1.00 23.82  ? 154  GLY B N     1 
ATOM   5907  C  CA    . GLY B  2  154 ? 16.563  29.447  31.397  1.00 16.97  ? 154  GLY B CA    1 
ATOM   5908  C  C     . GLY B  2  154 ? 15.465  29.704  30.377  1.00 23.55  ? 154  GLY B C     1 
ATOM   5909  O  O     . GLY B  2  154 ? 15.556  29.242  29.247  1.00 21.87  ? 154  GLY B O     1 
ATOM   5910  N  N     . LEU B  2  155 ? 14.420  30.443  30.770  1.00 24.38  ? 155  LEU B N     1 
ATOM   5911  C  CA    . LEU B  2  155 ? 13.314  30.751  29.874  1.00 21.06  ? 155  LEU B CA    1 
ATOM   5912  C  C     . LEU B  2  155 ? 13.228  32.270  29.598  1.00 23.36  ? 155  LEU B C     1 
ATOM   5913  O  O     . LEU B  2  155 ? 13.114  32.686  28.439  1.00 22.66  ? 155  LEU B O     1 
ATOM   5914  C  CB    . LEU B  2  155 ? 11.969  30.259  30.475  1.00 21.56  ? 155  LEU B CB    1 
ATOM   5915  C  CG    . LEU B  2  155 ? 11.816  28.809  30.996  1.00 16.16  ? 155  LEU B CG    1 
ATOM   5916  C  CD1   . LEU B  2  155 ? 10.431  28.590  31.606  1.00 18.88  ? 155  LEU B CD1   1 
ATOM   5917  C  CD2   . LEU B  2  155 ? 12.014  27.855  29.866  1.00 20.88  ? 155  LEU B CD2   1 
ATOM   5918  N  N     . TYR B  2  156 ? 13.326  33.096  30.645  1.00 14.60  ? 156  TYR B N     1 
ATOM   5919  C  CA    . TYR B  2  156 ? 13.173  34.532  30.447  1.00 15.20  ? 156  TYR B CA    1 
ATOM   5920  C  C     . TYR B  2  156 ? 14.350  35.235  29.811  1.00 16.38  ? 156  TYR B C     1 
ATOM   5921  O  O     . TYR B  2  156 ? 14.233  36.386  29.425  1.00 22.87  ? 156  TYR B O     1 
ATOM   5922  C  CB    . TYR B  2  156 ? 12.803  35.237  31.765  1.00 17.97  ? 156  TYR B CB    1 
ATOM   5923  C  CG    . TYR B  2  156 ? 14.006  35.627  32.578  1.00 22.09  ? 156  TYR B CG    1 
ATOM   5924  C  CD1   . TYR B  2  156 ? 14.556  36.900  32.474  1.00 22.50  ? 156  TYR B CD1   1 
ATOM   5925  C  CD2   . TYR B  2  156 ? 14.662  34.684  33.386  1.00 25.24  ? 156  TYR B CD2   1 
ATOM   5926  C  CE1   . TYR B  2  156 ? 15.747  37.224  33.155  1.00 22.67  ? 156  TYR B CE1   1 
ATOM   5927  C  CE2   . TYR B  2  156 ? 15.837  34.991  34.065  1.00 22.21  ? 156  TYR B CE2   1 
ATOM   5928  C  CZ    . TYR B  2  156 ? 16.379  36.259  33.944  1.00 22.61  ? 156  TYR B CZ    1 
ATOM   5929  O  OH    . TYR B  2  156 ? 17.574  36.547  34.580  1.00 22.93  ? 156  TYR B OH    1 
ATOM   5930  N  N     . GLU B  2  157 ? 15.476  34.556  29.662  1.00 13.54  ? 157  GLU B N     1 
ATOM   5931  C  CA    . GLU B  2  157 ? 16.654  35.183  29.094  1.00 16.39  ? 157  GLU B CA    1 
ATOM   5932  C  C     . GLU B  2  157 ? 16.639  35.284  27.561  1.00 17.26  ? 157  GLU B C     1 
ATOM   5933  O  O     . GLU B  2  157 ? 17.516  35.924  26.988  1.00 17.08  ? 157  GLU B O     1 
ATOM   5934  C  CB    . GLU B  2  157 ? 17.903  34.424  29.520  1.00 17.71  ? 157  GLU B CB    1 
ATOM   5935  C  CG    . GLU B  2  157 ? 18.090  34.261  31.033  1.00 24.97  ? 157  GLU B CG    1 
ATOM   5936  C  CD    . GLU B  2  157 ? 17.533  32.941  31.595  1.00 28.50  ? 157  GLU B CD    1 
ATOM   5937  O  OE1   . GLU B  2  157 ? 16.549  32.397  31.025  1.00 27.58  ? 157  GLU B OE1   1 
ATOM   5938  O  OE2   . GLU B  2  157 ? 18.078  32.465  32.625  1.00 31.53  ? 157  GLU B OE2   1 
ATOM   5939  N  N     . CYS B  2  158 ? 15.664  34.645  26.901  1.00 18.31  ? 158  CYS B N     1 
ATOM   5940  C  CA    . CYS B  2  158 ? 15.594  34.654  25.414  1.00 16.61  ? 158  CYS B CA    1 
ATOM   5941  C  C     . CYS B  2  158 ? 15.627  36.077  24.875  1.00 17.86  ? 158  CYS B C     1 
ATOM   5942  O  O     . CYS B  2  158 ? 14.866  36.953  25.343  1.00 17.91  ? 158  CYS B O     1 
ATOM   5943  C  CB    . CYS B  2  158 ? 14.298  33.962  24.915  1.00 13.24  ? 158  CYS B CB    1 
ATOM   5944  S  SG    . CYS B  2  158 ? 14.054  34.005  23.069  1.00 18.99  ? 158  CYS B SG    1 
ATOM   5945  N  N     . ILE B  2  159 ? 16.485  36.321  23.889  1.00 15.77  ? 159  ILE B N     1 
ATOM   5946  C  CA    . ILE B  2  159 ? 16.558  37.660  23.304  1.00 15.30  ? 159  ILE B CA    1 
ATOM   5947  C  C     . ILE B  2  159 ? 15.809  37.732  21.939  1.00 19.61  ? 159  ILE B C     1 
ATOM   5948  O  O     . ILE B  2  159 ? 15.978  38.690  21.209  1.00 16.15  ? 159  ILE B O     1 
ATOM   5949  C  CB    . ILE B  2  159 ? 18.038  38.079  23.076  1.00 16.68  ? 159  ILE B CB    1 
ATOM   5950  C  CG1   . ILE B  2  159 ? 18.668  37.140  22.031  1.00 14.87  ? 159  ILE B CG1   1 
ATOM   5951  C  CG2   . ILE B  2  159 ? 18.829  38.017  24.408  1.00 15.54  ? 159  ILE B CG2   1 
ATOM   5952  C  CD1   . ILE B  2  159 ? 20.192  37.372  21.768  1.00 12.66  ? 159  ILE B CD1   1 
ATOM   5953  N  N     . LEU B  2  160 ? 15.008  36.718  21.607  1.00 19.59  ? 160  LEU B N     1 
ATOM   5954  C  CA    . LEU B  2  160 ? 14.231  36.678  20.359  1.00 20.08  ? 160  LEU B CA    1 
ATOM   5955  C  C     . LEU B  2  160 ? 15.044  36.973  19.107  1.00 18.89  ? 160  LEU B C     1 
ATOM   5956  O  O     . LEU B  2  160 ? 14.629  37.754  18.261  1.00 18.33  ? 160  LEU B O     1 
ATOM   5957  C  CB    . LEU B  2  160 ? 13.029  37.646  20.411  1.00 22.26  ? 160  LEU B CB    1 
ATOM   5958  C  CG    . LEU B  2  160 ? 11.857  37.359  21.373  1.00 27.62  ? 160  LEU B CG    1 
ATOM   5959  C  CD1   . LEU B  2  160 ? 10.850  38.538  21.361  1.00 28.02  ? 160  LEU B CD1   1 
ATOM   5960  C  CD2   . LEU B  2  160 ? 11.151  36.089  20.967  1.00 25.16  ? 160  LEU B CD2   1 
ATOM   5961  N  N     . CYS B  2  161 ? 16.198  36.320  18.994  1.00 16.84  ? 161  CYS B N     1 
ATOM   5962  C  CA    . CYS B  2  161 ? 17.096  36.505  17.870  1.00 16.57  ? 161  CYS B CA    1 
ATOM   5963  C  C     . CYS B  2  161 ? 16.649  35.664  16.659  1.00 17.15  ? 161  CYS B C     1 
ATOM   5964  O  O     . CYS B  2  161 ? 16.965  36.000  15.520  1.00 18.85  ? 161  CYS B O     1 
ATOM   5965  C  CB    . CYS B  2  161 ? 18.525  36.098  18.287  1.00 13.58  ? 161  CYS B CB    1 
ATOM   5966  S  SG    . CYS B  2  161 ? 18.770  34.321  18.663  1.00 20.42  ? 161  CYS B SG    1 
ATOM   5967  N  N     . ALA B  2  162 ? 15.945  34.567  16.937  1.00 18.48  ? 162  ALA B N     1 
ATOM   5968  C  CA    . ALA B  2  162 ? 15.411  33.624  15.939  1.00 19.33  ? 162  ALA B CA    1 
ATOM   5969  C  C     . ALA B  2  162 ? 16.422  32.640  15.359  1.00 20.76  ? 162  ALA B C     1 
ATOM   5970  O  O     . ALA B  2  162 ? 16.157  31.996  14.331  1.00 19.93  ? 162  ALA B O     1 
ATOM   5971  C  CB    . ALA B  2  162 ? 14.698  34.367  14.803  1.00 17.82  ? 162  ALA B CB    1 
ATOM   5972  N  N     . CYS B  2  163 ? 17.577  32.542  16.014  1.00 19.26  ? 163  CYS B N     1 
ATOM   5973  C  CA    . CYS B  2  163 ? 18.602  31.600  15.592  1.00 23.63  ? 163  CYS B CA    1 
ATOM   5974  C  C     . CYS B  2  163 ? 18.090  30.158  15.680  1.00 22.97  ? 163  CYS B C     1 
ATOM   5975  O  O     . CYS B  2  163 ? 18.397  29.353  14.806  1.00 21.50  ? 163  CYS B O     1 
ATOM   5976  C  CB    . CYS B  2  163 ? 19.850  31.697  16.480  1.00 20.66  ? 163  CYS B CB    1 
ATOM   5977  S  SG    . CYS B  2  163 ? 20.881  33.095  16.110  1.00 23.28  ? 163  CYS B SG    1 
ATOM   5978  N  N     . CYS B  2  164 ? 17.344  29.855  16.749  1.00 20.00  ? 164  CYS B N     1 
ATOM   5979  C  CA    . CYS B  2  164 ? 16.820  28.512  16.968  1.00 18.71  ? 164  CYS B CA    1 
ATOM   5980  C  C     . CYS B  2  164 ? 15.737  28.118  15.983  1.00 22.28  ? 164  CYS B C     1 
ATOM   5981  O  O     . CYS B  2  164 ? 15.811  27.046  15.368  1.00 18.31  ? 164  CYS B O     1 
ATOM   5982  C  CB    . CYS B  2  164 ? 16.289  28.344  18.394  1.00 17.71  ? 164  CYS B CB    1 
ATOM   5983  S  SG    . CYS B  2  164 ? 15.023  29.535  18.894  1.00 24.20  ? 164  CYS B SG    1 
ATOM   5984  N  N     . SER B  2  165 ? 14.713  28.962  15.841  1.00 22.28  ? 165  SER B N     1 
ATOM   5985  C  CA    . SER B  2  165 ? 13.643  28.656  14.919  1.00 20.95  ? 165  SER B CA    1 
ATOM   5986  C  C     . SER B  2  165 ? 14.161  28.498  13.488  1.00 19.04  ? 165  SER B C     1 
ATOM   5987  O  O     . SER B  2  165 ? 13.791  27.566  12.781  1.00 23.67  ? 165  SER B O     1 
ATOM   5988  C  CB    . SER B  2  165 ? 12.573  29.747  14.966  1.00 25.07  ? 165  SER B CB    1 
ATOM   5989  O  OG    . SER B  2  165 ? 11.908  29.741  16.218  1.00 21.38  ? 165  SER B OG    1 
ATOM   5990  N  N     . THR B  2  166 ? 15.026  29.385  13.044  1.00 15.66  ? 166  THR B N     1 
ATOM   5991  C  CA    . THR B  2  166 ? 15.504  29.259  11.674  1.00 17.28  ? 166  THR B CA    1 
ATOM   5992  C  C     . THR B  2  166 ? 16.542  28.162  11.493  1.00 16.67  ? 166  THR B C     1 
ATOM   5993  O  O     . THR B  2  166 ? 17.098  28.014  10.415  1.00 19.43  ? 166  THR B O     1 
ATOM   5994  C  CB    . THR B  2  166 ? 16.060  30.605  11.107  1.00 19.02  ? 166  THR B CB    1 
ATOM   5995  O  OG1   . THR B  2  166 ? 17.212  30.996  11.856  1.00 17.05  ? 166  THR B OG1   1 
ATOM   5996  C  CG2   . THR B  2  166 ? 14.964  31.718  11.198  1.00 14.25  ? 166  THR B CG2   1 
ATOM   5997  N  N     . SER B  2  167 ? 16.792  27.379  12.542  1.00 16.26  ? 167  SER B N     1 
ATOM   5998  C  CA    . SER B  2  167 ? 17.715  26.231  12.436  1.00 15.87  ? 167  SER B CA    1 
ATOM   5999  C  C     . SER B  2  167 ? 16.921  24.924  12.459  1.00 16.41  ? 167  SER B C     1 
ATOM   6000  O  O     . SER B  2  167 ? 17.485  23.854  12.243  1.00 19.67  ? 167  SER B O     1 
ATOM   6001  C  CB    . SER B  2  167 ? 18.681  26.179  13.614  1.00 13.96  ? 167  SER B CB    1 
ATOM   6002  O  OG    . SER B  2  167 ? 17.984  25.676  14.740  1.00 19.81  ? 167  SER B OG    1 
ATOM   6003  N  N     . CYS B  2  168 ? 15.623  25.017  12.747  1.00 19.50  ? 168  CYS B N     1 
ATOM   6004  C  CA    . CYS B  2  168 ? 14.724  23.856  12.863  1.00 17.45  ? 168  CYS B CA    1 
ATOM   6005  C  C     . CYS B  2  168 ? 14.147  23.440  11.534  1.00 20.58  ? 168  CYS B C     1 
ATOM   6006  O  O     . CYS B  2  168 ? 13.403  24.209  10.940  1.00 21.64  ? 168  CYS B O     1 
ATOM   6007  C  CB    . CYS B  2  168 ? 13.559  24.198  13.789  1.00 17.34  ? 168  CYS B CB    1 
ATOM   6008  S  SG    . CYS B  2  168 ? 12.380  22.859  13.956  1.00 20.45  ? 168  CYS B SG    1 
ATOM   6009  N  N     . PRO B  2  169 ? 14.466  22.214  11.056  1.00 20.37  ? 169  PRO B N     1 
ATOM   6010  C  CA    . PRO B  2  169 ? 13.961  21.723  9.776   1.00 19.11  ? 169  PRO B CA    1 
ATOM   6011  C  C     . PRO B  2  169 ? 12.471  21.789  9.724   1.00 16.37  ? 169  PRO B C     1 
ATOM   6012  O  O     . PRO B  2  169 ? 11.914  22.076  8.657   1.00 16.18  ? 169  PRO B O     1 
ATOM   6013  C  CB    . PRO B  2  169 ? 14.475  20.282  9.714   1.00 20.44  ? 169  PRO B CB    1 
ATOM   6014  C  CG    . PRO B  2  169 ? 15.808  20.391  10.424  1.00 16.98  ? 169  PRO B CG    1 
ATOM   6015  C  CD    . PRO B  2  169 ? 15.419  21.251  11.633  1.00 19.82  ? 169  PRO B CD    1 
ATOM   6016  N  N     . SER B  2  170 ? 11.810  21.519  10.849  1.00 16.66  ? 170  SER B N     1 
ATOM   6017  C  CA    . SER B  2  170 ? 10.343  21.596  10.843  1.00 21.45  ? 170  SER B CA    1 
ATOM   6018  C  C     . SER B  2  170 ? 9.828   23.015  10.575  1.00 24.08  ? 170  SER B C     1 
ATOM   6019  O  O     . SER B  2  170 ? 8.755   23.206  9.956   1.00 21.35  ? 170  SER B O     1 
ATOM   6020  C  CB    . SER B  2  170 ? 9.759   21.126  12.163  1.00 23.34  ? 170  SER B CB    1 
ATOM   6021  O  OG    . SER B  2  170 ? 9.612   19.719  12.164  1.00 24.51  ? 170  SER B OG    1 
ATOM   6022  N  N     . TYR B  2  171 ? 10.584  24.011  11.061  1.00 22.93  ? 171  TYR B N     1 
ATOM   6023  C  CA    . TYR B  2  171 ? 10.194  25.414  10.869  1.00 20.70  ? 171  TYR B CA    1 
ATOM   6024  C  C     . TYR B  2  171 ? 10.464  25.788  9.411   1.00 20.43  ? 171  TYR B C     1 
ATOM   6025  O  O     . TYR B  2  171 ? 9.796   26.637  8.852   1.00 22.62  ? 171  TYR B O     1 
ATOM   6026  C  CB    . TYR B  2  171 ? 10.963  26.351  11.820  1.00 17.98  ? 171  TYR B CB    1 
ATOM   6027  C  CG    . TYR B  2  171 ? 10.374  27.757  11.890  1.00 15.72  ? 171  TYR B CG    1 
ATOM   6028  C  CD1   . TYR B  2  171 ? 9.204   28.006  12.615  1.00 13.35  ? 171  TYR B CD1   1 
ATOM   6029  C  CD2   . TYR B  2  171 ? 11.009  28.823  11.295  1.00 12.70  ? 171  TYR B CD2   1 
ATOM   6030  C  CE1   . TYR B  2  171 ? 8.701   29.306  12.756  1.00 19.12  ? 171  TYR B CE1   1 
ATOM   6031  C  CE2   . TYR B  2  171 ? 10.522  30.136  11.415  1.00 14.72  ? 171  TYR B CE2   1 
ATOM   6032  C  CZ    . TYR B  2  171 ? 9.367   30.369  12.158  1.00 20.52  ? 171  TYR B CZ    1 
ATOM   6033  O  OH    . TYR B  2  171 ? 8.881   31.656  12.344  1.00 21.71  ? 171  TYR B OH    1 
ATOM   6034  N  N     . TRP B  2  172 ? 11.456  25.154  8.805   1.00 21.55  ? 172  TRP B N     1 
ATOM   6035  C  CA    . TRP B  2  172 ? 11.719  25.403  7.393   1.00 22.45  ? 172  TRP B CA    1 
ATOM   6036  C  C     . TRP B  2  172 ? 10.547  24.938  6.538   1.00 21.36  ? 172  TRP B C     1 
ATOM   6037  O  O     . TRP B  2  172 ? 10.107  25.647  5.652   1.00 22.26  ? 172  TRP B O     1 
ATOM   6038  C  CB    . TRP B  2  172 ? 12.954  24.643  6.907   1.00 16.53  ? 172  TRP B CB    1 
ATOM   6039  C  CG    . TRP B  2  172 ? 14.226  25.085  7.528   1.00 23.16  ? 172  TRP B CG    1 
ATOM   6040  C  CD1   . TRP B  2  172 ? 14.417  26.167  8.352   1.00 26.51  ? 172  TRP B CD1   1 
ATOM   6041  C  CD2   . TRP B  2  172 ? 15.493  24.452  7.398   1.00 20.99  ? 172  TRP B CD2   1 
ATOM   6042  N  NE1   . TRP B  2  172 ? 15.742  26.238  8.742   1.00 22.11  ? 172  TRP B NE1   1 
ATOM   6043  C  CE2   . TRP B  2  172 ? 16.419  25.196  8.170   1.00 21.47  ? 172  TRP B CE2   1 
ATOM   6044  C  CE3   . TRP B  2  172 ? 15.942  23.323  6.702   1.00 25.27  ? 172  TRP B CE3   1 
ATOM   6045  C  CZ2   . TRP B  2  172 ? 17.774  24.845  8.268   1.00 26.55  ? 172  TRP B CZ2   1 
ATOM   6046  C  CZ3   . TRP B  2  172 ? 17.299  22.973  6.798   1.00 29.69  ? 172  TRP B CZ3   1 
ATOM   6047  C  CH2   . TRP B  2  172 ? 18.191  23.733  7.577   1.00 30.39  ? 172  TRP B CH2   1 
ATOM   6048  N  N     . TRP B  2  173 ? 10.056  23.730  6.802   1.00 20.91  ? 173  TRP B N     1 
ATOM   6049  C  CA    . TRP B  2  173 ? 8.983   23.161  6.008   1.00 22.16  ? 173  TRP B CA    1 
ATOM   6050  C  C     . TRP B  2  173 ? 7.607   23.650  6.414   1.00 21.73  ? 173  TRP B C     1 
ATOM   6051  O  O     . TRP B  2  173 ? 6.703   23.722  5.576   1.00 26.22  ? 173  TRP B O     1 
ATOM   6052  C  CB    . TRP B  2  173 ? 8.987   21.609  6.080   1.00 17.40  ? 173  TRP B CB    1 
ATOM   6053  C  CG    . TRP B  2  173 ? 10.340  20.951  5.970   1.00 21.60  ? 173  TRP B CG    1 
ATOM   6054  C  CD1   . TRP B  2  173 ? 10.807  19.898  6.737   1.00 20.86  ? 173  TRP B CD1   1 
ATOM   6055  C  CD2   . TRP B  2  173 ? 11.425  21.334  5.117   1.00 15.83  ? 173  TRP B CD2   1 
ATOM   6056  N  NE1   . TRP B  2  173 ? 12.116  19.617  6.405   1.00 18.52  ? 173  TRP B NE1   1 
ATOM   6057  C  CE2   . TRP B  2  173 ? 12.518  20.481  5.419   1.00 18.97  ? 173  TRP B CE2   1 
ATOM   6058  C  CE3   . TRP B  2  173 ? 11.590  22.316  4.141   1.00 21.64  ? 173  TRP B CE3   1 
ATOM   6059  C  CZ2   . TRP B  2  173 ? 13.752  20.586  4.776   1.00 20.38  ? 173  TRP B CZ2   1 
ATOM   6060  C  CZ3   . TRP B  2  173 ? 12.828  22.421  3.499   1.00 21.51  ? 173  TRP B CZ3   1 
ATOM   6061  C  CH2   . TRP B  2  173 ? 13.887  21.563  3.820   1.00 23.36  ? 173  TRP B CH2   1 
ATOM   6062  N  N     . ASN B  2  174 ? 7.429   24.000  7.672   1.00 15.28  ? 174  ASN B N     1 
ATOM   6063  C  CA    . ASN B  2  174 ? 6.107   24.423  8.085   1.00 18.66  ? 174  ASN B CA    1 
ATOM   6064  C  C     . ASN B  2  174 ? 6.072   25.704  8.895   1.00 20.75  ? 174  ASN B C     1 
ATOM   6065  O  O     . ASN B  2  174 ? 5.201   25.868  9.752   1.00 19.94  ? 174  ASN B O     1 
ATOM   6066  C  CB    . ASN B  2  174 ? 5.446   23.297  8.879   1.00 18.74  ? 174  ASN B CB    1 
ATOM   6067  C  CG    . ASN B  2  174 ? 5.216   22.076  8.039   1.00 23.77  ? 174  ASN B CG    1 
ATOM   6068  O  OD1   . ASN B  2  174 ? 4.347   22.058  7.167   1.00 26.27  ? 174  ASN B OD1   1 
ATOM   6069  N  ND2   . ASN B  2  174 ? 6.031   21.053  8.259   1.00 26.25  ? 174  ASN B ND2   1 
ATOM   6070  N  N     . GLY B  2  175 ? 7.013   26.601  8.640   1.00 17.66  ? 175  GLY B N     1 
ATOM   6071  C  CA    . GLY B  2  175 ? 7.016   27.854  9.385   1.00 22.24  ? 175  GLY B CA    1 
ATOM   6072  C  C     . GLY B  2  175 ? 5.728   28.674  9.300   1.00 21.28  ? 175  GLY B C     1 
ATOM   6073  O  O     . GLY B  2  175 ? 5.552   29.621  10.070  1.00 19.34  ? 175  GLY B O     1 
ATOM   6074  N  N     . ASP B  2  176 ? 4.832   28.350  8.371   1.00 17.85  ? 176  ASP B N     1 
ATOM   6075  C  CA    . ASP B  2  176 ? 3.587   29.114  8.309   1.00 21.65  ? 176  ASP B CA    1 
ATOM   6076  C  C     . ASP B  2  176 ? 2.654   28.723  9.459   1.00 22.60  ? 176  ASP B C     1 
ATOM   6077  O  O     . ASP B  2  176 ? 1.895   29.551  9.966   1.00 24.07  ? 176  ASP B O     1 
ATOM   6078  C  CB    . ASP B  2  176 ? 2.872   28.929  6.948   1.00 17.59  ? 176  ASP B CB    1 
ATOM   6079  C  CG    . ASP B  2  176 ? 2.517   27.440  6.636   1.00 23.06  ? 176  ASP B CG    1 
ATOM   6080  O  OD1   . ASP B  2  176 ? 3.176   26.501  7.134   1.00 23.35  ? 176  ASP B OD1   1 
ATOM   6081  O  OD2   . ASP B  2  176 ? 1.591   27.205  5.851   1.00 23.68  ? 176  ASP B OD2   1 
ATOM   6082  N  N     . LYS B  2  177 ? 2.737   27.478  9.911   1.00 24.35  ? 177  LYS B N     1 
ATOM   6083  C  CA    . LYS B  2  177 ? 1.846   27.018  10.972  1.00 23.35  ? 177  LYS B CA    1 
ATOM   6084  C  C     . LYS B  2  177 ? 2.498   26.517  12.237  1.00 23.10  ? 177  LYS B C     1 
ATOM   6085  O  O     . LYS B  2  177 ? 1.869   26.453  13.292  1.00 18.63  ? 177  LYS B O     1 
ATOM   6086  C  CB    . LYS B  2  177 ? 0.917   25.934  10.423  1.00 25.66  ? 177  LYS B CB    1 
ATOM   6087  C  CG    . LYS B  2  177 ? 0.065   26.438  9.287   1.00 26.31  ? 177  LYS B CG    1 
ATOM   6088  C  CD    . LYS B  2  177 ? -1.228  25.636  9.129   1.00 35.74  ? 177  LYS B CD    1 
ATOM   6089  C  CE    . LYS B  2  177 ? -0.996  24.399  8.293   1.00 41.93  ? 177  LYS B CE    1 
ATOM   6090  N  NZ    . LYS B  2  177 ? -0.565  24.776  6.918   1.00 43.99  ? 177  LYS B NZ    1 
ATOM   6091  N  N     . TYR B  2  178 ? 3.762   26.129  12.140  1.00 23.53  ? 178  TYR B N     1 
ATOM   6092  C  CA    . TYR B  2  178 ? 4.493   25.647  13.310  1.00 21.06  ? 178  TYR B CA    1 
ATOM   6093  C  C     . TYR B  2  178 ? 5.024   26.884  14.038  1.00 21.87  ? 178  TYR B C     1 
ATOM   6094  O  O     . TYR B  2  178 ? 5.755   27.667  13.453  1.00 25.54  ? 178  TYR B O     1 
ATOM   6095  C  CB    . TYR B  2  178 ? 5.628   24.751  12.827  1.00 19.37  ? 178  TYR B CB    1 
ATOM   6096  C  CG    . TYR B  2  178 ? 6.564   24.285  13.902  1.00 19.36  ? 178  TYR B CG    1 
ATOM   6097  C  CD1   . TYR B  2  178 ? 6.078   23.877  15.145  1.00 20.03  ? 178  TYR B CD1   1 
ATOM   6098  C  CD2   . TYR B  2  178 ? 7.941   24.236  13.681  1.00 17.14  ? 178  TYR B CD2   1 
ATOM   6099  C  CE1   . TYR B  2  178 ? 6.921   23.443  16.143  1.00 15.42  ? 178  TYR B CE1   1 
ATOM   6100  C  CE2   . TYR B  2  178 ? 8.812   23.778  14.692  1.00 20.21  ? 178  TYR B CE2   1 
ATOM   6101  C  CZ    . TYR B  2  178 ? 8.289   23.395  15.907  1.00 16.36  ? 178  TYR B CZ    1 
ATOM   6102  O  OH    . TYR B  2  178 ? 9.108   22.990  16.924  1.00 22.59  ? 178  TYR B OH    1 
ATOM   6103  N  N     . LEU B  2  179 ? 4.680   27.076  15.308  1.00 23.39  ? 179  LEU B N     1 
ATOM   6104  C  CA    . LEU B  2  179 ? 5.142   28.293  15.998  1.00 17.81  ? 179  LEU B CA    1 
ATOM   6105  C  C     . LEU B  2  179 ? 6.656   28.372  16.108  1.00 18.47  ? 179  LEU B C     1 
ATOM   6106  O  O     . LEU B  2  179 ? 7.219   29.480  16.127  1.00 16.46  ? 179  LEU B O     1 
ATOM   6107  C  CB    . LEU B  2  179 ? 4.507   28.410  17.385  1.00 17.39  ? 179  LEU B CB    1 
ATOM   6108  C  CG    . LEU B  2  179 ? 2.975   28.536  17.379  1.00 18.19  ? 179  LEU B CG    1 
ATOM   6109  C  CD1   . LEU B  2  179 ? 2.471   28.547  18.803  1.00 20.23  ? 179  LEU B CD1   1 
ATOM   6110  C  CD2   . LEU B  2  179 ? 2.545   29.823  16.644  1.00 19.72  ? 179  LEU B CD2   1 
ATOM   6111  N  N     . GLY B  2  180 ? 7.308   27.221  16.198  1.00 16.38  ? 180  GLY B N     1 
ATOM   6112  C  CA    . GLY B  2  180 ? 8.763   27.205  16.252  1.00 16.05  ? 180  GLY B CA    1 
ATOM   6113  C  C     . GLY B  2  180 ? 9.278   27.257  17.682  1.00 18.77  ? 180  GLY B C     1 
ATOM   6114  O  O     . GLY B  2  180 ? 8.565   27.727  18.557  1.00 18.47  ? 180  GLY B O     1 
ATOM   6115  N  N     . PRO B  2  181 ? 10.528  26.829  17.926  1.00 16.93  ? 181  PRO B N     1 
ATOM   6116  C  CA    . PRO B  2  181 ? 11.120  26.819  19.262  1.00 17.80  ? 181  PRO B CA    1 
ATOM   6117  C  C     . PRO B  2  181 ? 11.144  28.112  20.074  1.00 19.45  ? 181  PRO B C     1 
ATOM   6118  O  O     . PRO B  2  181 ? 10.806  28.085  21.270  1.00 24.63  ? 181  PRO B O     1 
ATOM   6119  C  CB    . PRO B  2  181 ? 12.516  26.199  19.030  1.00 14.61  ? 181  PRO B CB    1 
ATOM   6120  C  CG    . PRO B  2  181 ? 12.825  26.548  17.575  1.00 14.23  ? 181  PRO B CG    1 
ATOM   6121  C  CD    . PRO B  2  181 ? 11.485  26.348  16.905  1.00 15.79  ? 181  PRO B CD    1 
ATOM   6122  N  N     . ALA B  2  182 ? 11.524  29.239  19.479  1.00 17.67  ? 182  ALA B N     1 
ATOM   6123  C  CA    . ALA B  2  182 ? 11.549  30.470  20.268  1.00 16.20  ? 182  ALA B CA    1 
ATOM   6124  C  C     . ALA B  2  182 ? 10.173  30.822  20.834  1.00 16.75  ? 182  ALA B C     1 
ATOM   6125  O  O     . ALA B  2  182 ? 10.019  31.121  22.034  1.00 17.06  ? 182  ALA B O     1 
ATOM   6126  C  CB    . ALA B  2  182 ? 12.083  31.649  19.426  1.00 13.26  ? 182  ALA B CB    1 
ATOM   6127  N  N     . VAL B  2  183 ? 9.158   30.741  19.992  1.00 15.19  ? 183  VAL B N     1 
ATOM   6128  C  CA    . VAL B  2  183 ? 7.819   31.108  20.440  1.00 14.27  ? 183  VAL B CA    1 
ATOM   6129  C  C     . VAL B  2  183 ? 7.264   30.101  21.425  1.00 17.99  ? 183  VAL B C     1 
ATOM   6130  O  O     . VAL B  2  183 ? 6.747   30.485  22.482  1.00 20.31  ? 183  VAL B O     1 
ATOM   6131  C  CB    . VAL B  2  183 ? 6.915   31.311  19.204  1.00 18.64  ? 183  VAL B CB    1 
ATOM   6132  C  CG1   . VAL B  2  183 ? 5.442   31.403  19.593  1.00 13.20  ? 183  VAL B CG1   1 
ATOM   6133  C  CG2   . VAL B  2  183 ? 7.368   32.566  18.492  1.00 12.81  ? 183  VAL B CG2   1 
ATOM   6134  N  N     . LEU B  2  184 ? 7.408   28.808  21.128  1.00 17.57  ? 184  LEU B N     1 
ATOM   6135  C  CA    . LEU B  2  184 ? 6.897   27.803  22.059  1.00 16.38  ? 184  LEU B CA    1 
ATOM   6136  C  C     . LEU B  2  184 ? 7.577   27.906  23.419  1.00 17.41  ? 184  LEU B C     1 
ATOM   6137  O  O     . LEU B  2  184 ? 6.919   27.728  24.442  1.00 17.50  ? 184  LEU B O     1 
ATOM   6138  C  CB    . LEU B  2  184 ? 7.090   26.400  21.501  1.00 14.46  ? 184  LEU B CB    1 
ATOM   6139  C  CG    . LEU B  2  184 ? 6.181   26.167  20.299  1.00 18.97  ? 184  LEU B CG    1 
ATOM   6140  C  CD1   . LEU B  2  184 ? 6.567   24.872  19.606  1.00 18.83  ? 184  LEU B CD1   1 
ATOM   6141  C  CD2   . LEU B  2  184 ? 4.729   26.118  20.790  1.00 15.38  ? 184  LEU B CD2   1 
ATOM   6142  N  N     . MET B  2  185 ? 8.887   28.203  23.458  1.00 15.14  ? 185  MET B N     1 
ATOM   6143  C  CA    . MET B  2  185 ? 9.522   28.306  24.768  1.00 14.70  ? 185  MET B CA    1 
ATOM   6144  C  C     . MET B  2  185 ? 8.971   29.524  25.543  1.00 18.49  ? 185  MET B C     1 
ATOM   6145  O  O     . MET B  2  185 ? 8.814   29.478  26.778  1.00 18.17  ? 185  MET B O     1 
ATOM   6146  C  CB    . MET B  2  185 ? 11.051  28.418  24.647  1.00 16.10  ? 185  MET B CB    1 
ATOM   6147  C  CG    . MET B  2  185 ? 11.737  28.459  26.053  1.00 16.63  ? 185  MET B CG    1 
ATOM   6148  S  SD    . MET B  2  185 ? 13.549  28.180  26.052  1.00 24.18  ? 185  MET B SD    1 
ATOM   6149  C  CE    . MET B  2  185 ? 14.143  29.728  25.625  1.00 20.93  ? 185  MET B CE    1 
ATOM   6150  N  N     . GLN B  2  186 ? 8.710   30.630  24.851  1.00 17.03  ? 186  GLN B N     1 
ATOM   6151  C  CA    . GLN B  2  186 ? 8.123   31.779  25.540  1.00 20.81  ? 186  GLN B CA    1 
ATOM   6152  C  C     . GLN B  2  186 ? 6.701   31.383  25.973  1.00 19.62  ? 186  GLN B C     1 
ATOM   6153  O  O     . GLN B  2  186 ? 6.248   31.803  27.031  1.00 17.53  ? 186  GLN B O     1 
ATOM   6154  C  CB    . GLN B  2  186 ? 8.113   33.045  24.658  1.00 19.60  ? 186  GLN B CB    1 
ATOM   6155  C  CG    . GLN B  2  186 ? 9.499   33.685  24.586  1.00 19.71  ? 186  GLN B CG    1 
ATOM   6156  C  CD    . GLN B  2  186 ? 10.115  33.828  25.994  1.00 22.78  ? 186  GLN B CD    1 
ATOM   6157  O  OE1   . GLN B  2  186 ? 9.621   34.600  26.816  1.00 22.45  ? 186  GLN B OE1   1 
ATOM   6158  N  NE2   . GLN B  2  186 ? 11.169  33.063  26.278  1.00 15.60  ? 186  GLN B NE2   1 
ATOM   6159  N  N     . ALA B  2  187 ? 5.987   30.584  25.175  1.00 19.38  ? 187  ALA B N     1 
ATOM   6160  C  CA    . ALA B  2  187 ? 4.656   30.140  25.650  1.00 19.73  ? 187  ALA B CA    1 
ATOM   6161  C  C     . ALA B  2  187 ? 4.816   29.336  26.971  1.00 22.24  ? 187  ALA B C     1 
ATOM   6162  O  O     . ALA B  2  187 ? 4.028   29.478  27.892  1.00 18.61  ? 187  ALA B O     1 
ATOM   6163  C  CB    . ALA B  2  187 ? 3.967   29.267  24.633  1.00 22.77  ? 187  ALA B CB    1 
ATOM   6164  N  N     . TYR B  2  188 ? 5.836   28.482  27.052  1.00 18.08  ? 188  TYR B N     1 
ATOM   6165  C  CA    . TYR B  2  188 ? 6.051   27.699  28.257  1.00 19.81  ? 188  TYR B CA    1 
ATOM   6166  C  C     . TYR B  2  188 ? 6.350   28.636  29.434  1.00 22.25  ? 188  TYR B C     1 
ATOM   6167  O  O     . TYR B  2  188 ? 5.863   28.402  30.545  1.00 23.99  ? 188  TYR B O     1 
ATOM   6168  C  CB    . TYR B  2  188 ? 7.219   26.722  28.039  1.00 17.04  ? 188  TYR B CB    1 
ATOM   6169  C  CG    . TYR B  2  188 ? 7.507   25.851  29.215  1.00 22.93  ? 188  TYR B CG    1 
ATOM   6170  C  CD1   . TYR B  2  188 ? 6.535   24.968  29.704  1.00 26.80  ? 188  TYR B CD1   1 
ATOM   6171  C  CD2   . TYR B  2  188 ? 8.760   25.865  29.826  1.00 19.66  ? 188  TYR B CD2   1 
ATOM   6172  C  CE1   . TYR B  2  188 ? 6.801   24.110  30.767  1.00 26.77  ? 188  TYR B CE1   1 
ATOM   6173  C  CE2   . TYR B  2  188 ? 9.045   25.018  30.884  1.00 27.04  ? 188  TYR B CE2   1 
ATOM   6174  C  CZ    . TYR B  2  188 ? 8.059   24.136  31.349  1.00 30.96  ? 188  TYR B CZ    1 
ATOM   6175  O  OH    . TYR B  2  188 ? 8.341   23.257  32.361  1.00 31.58  ? 188  TYR B OH    1 
ATOM   6176  N  N     . ARG B  2  189 ? 7.149   29.690  29.174  1.00 23.31  ? 189  ARG B N     1 
ATOM   6177  C  CA    . ARG B  2  189 ? 7.538   30.711  30.171  1.00 18.10  ? 189  ARG B CA    1 
ATOM   6178  C  C     . ARG B  2  189 ? 6.324   31.382  30.828  1.00 21.82  ? 189  ARG B C     1 
ATOM   6179  O  O     . ARG B  2  189 ? 6.372   31.771  32.002  1.00 18.76  ? 189  ARG B O     1 
ATOM   6180  C  CB    . ARG B  2  189 ? 8.458   31.769  29.525  1.00 17.74  ? 189  ARG B CB    1 
ATOM   6181  C  CG    . ARG B  2  189 ? 8.852   32.972  30.413  1.00 18.01  ? 189  ARG B CG    1 
ATOM   6182  C  CD    . ARG B  2  189 ? 7.909   34.129  30.202  1.00 20.59  ? 189  ARG B CD    1 
ATOM   6183  N  NE    . ARG B  2  189 ? 8.188   35.337  30.990  1.00 19.66  ? 189  ARG B NE    1 
ATOM   6184  C  CZ    . ARG B  2  189 ? 7.732   35.537  32.226  1.00 23.25  ? 189  ARG B CZ    1 
ATOM   6185  N  NH1   . ARG B  2  189 ? 6.992   34.601  32.819  1.00 23.43  ? 189  ARG B NH1   1 
ATOM   6186  N  NH2   . ARG B  2  189 ? 7.928   36.698  32.841  1.00 17.84  ? 189  ARG B NH2   1 
ATOM   6187  N  N     . TRP B  2  190 ? 5.241   31.547  30.080  1.00 16.90  ? 190  TRP B N     1 
ATOM   6188  C  CA    . TRP B  2  190 ? 4.048   32.144  30.691  1.00 19.48  ? 190  TRP B CA    1 
ATOM   6189  C  C     . TRP B  2  190 ? 3.203   31.055  31.338  1.00 18.37  ? 190  TRP B C     1 
ATOM   6190  O  O     . TRP B  2  190 ? 2.511   31.305  32.332  1.00 20.52  ? 190  TRP B O     1 
ATOM   6191  C  CB    . TRP B  2  190 ? 3.236   32.963  29.665  1.00 13.57  ? 190  TRP B CB    1 
ATOM   6192  C  CG    . TRP B  2  190 ? 3.950   34.255  29.332  1.00 16.48  ? 190  TRP B CG    1 
ATOM   6193  C  CD1   . TRP B  2  190 ? 4.721   34.500  28.232  1.00 17.23  ? 190  TRP B CD1   1 
ATOM   6194  C  CD2   . TRP B  2  190 ? 4.128   35.384  30.201  1.00 14.23  ? 190  TRP B CD2   1 
ATOM   6195  N  NE1   . TRP B  2  190 ? 5.370   35.704  28.360  1.00 15.97  ? 190  TRP B NE1   1 
ATOM   6196  C  CE2   . TRP B  2  190 ? 5.032   36.268  29.559  1.00 17.11  ? 190  TRP B CE2   1 
ATOM   6197  C  CE3   . TRP B  2  190 ? 3.622   35.729  31.472  1.00 17.17  ? 190  TRP B CE3   1 
ATOM   6198  C  CZ2   . TRP B  2  190 ? 5.448   37.488  30.136  1.00 10.62  ? 190  TRP B CZ2   1 
ATOM   6199  C  CZ3   . TRP B  2  190 ? 4.046   36.959  32.056  1.00 17.06  ? 190  TRP B CZ3   1 
ATOM   6200  C  CH2   . TRP B  2  190 ? 4.945   37.811  31.380  1.00 18.73  ? 190  TRP B CH2   1 
ATOM   6201  N  N     . MET B  2  191 ? 3.302   29.839  30.807  1.00 21.65  ? 191  MET B N     1 
ATOM   6202  C  CA    . MET B  2  191 ? 2.558   28.714  31.365  1.00 23.42  ? 191  MET B CA    1 
ATOM   6203  C  C     . MET B  2  191 ? 3.020   28.434  32.786  1.00 22.38  ? 191  MET B C     1 
ATOM   6204  O  O     . MET B  2  191 ? 2.197   28.201  33.656  1.00 22.80  ? 191  MET B O     1 
ATOM   6205  C  CB    . MET B  2  191 ? 2.738   27.454  30.527  1.00 24.00  ? 191  MET B CB    1 
ATOM   6206  C  CG    . MET B  2  191 ? 1.886   27.391  29.278  1.00 24.02  ? 191  MET B CG    1 
ATOM   6207  S  SD    . MET B  2  191 ? 2.415   26.050  28.118  1.00 29.93  ? 191  MET B SD    1 
ATOM   6208  C  CE    . MET B  2  191 ? 2.404   24.729  29.176  1.00 39.96  ? 191  MET B CE    1 
ATOM   6209  N  N     . ILE B  2  192 ? 4.324   28.478  33.049  1.00 22.51  ? 192  ILE B N     1 
ATOM   6210  C  CA    . ILE B  2  192 ? 4.752   28.186  34.404  1.00 24.09  ? 192  ILE B CA    1 
ATOM   6211  C  C     . ILE B  2  192 ? 5.013   29.371  35.289  1.00 24.12  ? 192  ILE B C     1 
ATOM   6212  O  O     . ILE B  2  192 ? 5.543   29.200  36.381  1.00 24.46  ? 192  ILE B O     1 
ATOM   6213  C  CB    . ILE B  2  192 ? 5.998   27.289  34.459  1.00 31.74  ? 192  ILE B CB    1 
ATOM   6214  C  CG1   . ILE B  2  192 ? 7.174   28.005  33.831  1.00 29.54  ? 192  ILE B CG1   1 
ATOM   6215  C  CG2   . ILE B  2  192 ? 5.713   25.950  33.782  1.00 33.85  ? 192  ILE B CG2   1 
ATOM   6216  C  CD1   . ILE B  2  192 ? 8.440   27.171  33.918  1.00 37.58  ? 192  ILE B CD1   1 
ATOM   6217  N  N     . ASP B  2  193 ? 4.661   30.577  34.841  1.00 22.10  ? 193  ASP B N     1 
ATOM   6218  C  CA    . ASP B  2  193 ? 4.854   31.711  35.724  1.00 18.90  ? 193  ASP B CA    1 
ATOM   6219  C  C     . ASP B  2  193 ? 3.771   31.541  36.789  1.00 21.12  ? 193  ASP B C     1 
ATOM   6220  O  O     . ASP B  2  193 ? 2.581   31.501  36.469  1.00 18.30  ? 193  ASP B O     1 
ATOM   6221  C  CB    . ASP B  2  193 ? 4.670   33.030  34.972  1.00 20.99  ? 193  ASP B CB    1 
ATOM   6222  C  CG    . ASP B  2  193 ? 5.118   34.236  35.791  1.00 24.67  ? 193  ASP B CG    1 
ATOM   6223  O  OD1   . ASP B  2  193 ? 4.820   34.288  37.011  1.00 23.40  ? 193  ASP B OD1   1 
ATOM   6224  O  OD2   . ASP B  2  193 ? 5.770   35.135  35.212  1.00 28.58  ? 193  ASP B OD2   1 
ATOM   6225  N  N     . SER B  2  194 ? 4.162   31.454  38.057  1.00 20.98  ? 194  SER B N     1 
ATOM   6226  C  CA    . SER B  2  194 ? 3.171   31.261  39.113  1.00 23.12  ? 194  SER B CA    1 
ATOM   6227  C  C     . SER B  2  194 ? 2.124   32.381  39.193  1.00 23.28  ? 194  SER B C     1 
ATOM   6228  O  O     . SER B  2  194 ? 1.052   32.198  39.733  1.00 27.59  ? 194  SER B O     1 
ATOM   6229  C  CB    . SER B  2  194 ? 3.884   31.121  40.465  1.00 20.64  ? 194  SER B CB    1 
ATOM   6230  O  OG    . SER B  2  194 ? 4.479   32.344  40.820  1.00 24.33  ? 194  SER B OG    1 
ATOM   6231  N  N     . ARG B  2  195 ? 2.448   33.555  38.678  1.00 21.52  ? 195  ARG B N     1 
ATOM   6232  C  CA    . ARG B  2  195 ? 1.531   34.679  38.719  1.00 18.34  ? 195  ARG B CA    1 
ATOM   6233  C  C     . ARG B  2  195 ? 0.479   34.674  37.589  1.00 19.46  ? 195  ARG B C     1 
ATOM   6234  O  O     . ARG B  2  195 ? -0.477  35.421  37.644  1.00 18.04  ? 195  ARG B O     1 
ATOM   6235  C  CB    . ARG B  2  195 ? 2.331   35.968  38.626  1.00 21.39  ? 195  ARG B CB    1 
ATOM   6236  C  CG    . ARG B  2  195 ? 3.175   36.300  39.855  1.00 20.11  ? 195  ARG B CG    1 
ATOM   6237  C  CD    . ARG B  2  195 ? 4.210   37.406  39.513  1.00 16.70  ? 195  ARG B CD    1 
ATOM   6238  N  NE    . ARG B  2  195 ? 4.935   37.064  38.289  1.00 14.46  ? 195  ARG B NE    1 
ATOM   6239  C  CZ    . ARG B  2  195 ? 5.881   37.840  37.761  1.00 20.06  ? 195  ARG B CZ    1 
ATOM   6240  N  NH1   . ARG B  2  195 ? 6.214   39.000  38.339  1.00 19.25  ? 195  ARG B NH1   1 
ATOM   6241  N  NH2   . ARG B  2  195 ? 6.498   37.461  36.665  1.00 23.43  ? 195  ARG B NH2   1 
ATOM   6242  N  N     . ASP B  2  196 ? 0.665   33.845  36.568  1.00 18.54  ? 196  ASP B N     1 
ATOM   6243  C  CA    . ASP B  2  196 ? -0.266  33.810  35.441  1.00 23.85  ? 196  ASP B CA    1 
ATOM   6244  C  C     . ASP B  2  196 ? -1.409  32.819  35.687  1.00 21.82  ? 196  ASP B C     1 
ATOM   6245  O  O     . ASP B  2  196 ? -1.173  31.703  36.108  1.00 28.51  ? 196  ASP B O     1 
ATOM   6246  C  CB    . ASP B  2  196 ? 0.504   33.445  34.174  1.00 21.76  ? 196  ASP B CB    1 
ATOM   6247  C  CG    . ASP B  2  196 ? -0.318  33.654  32.905  1.00 24.01  ? 196  ASP B CG    1 
ATOM   6248  O  OD1   . ASP B  2  196 ? -0.221  34.743  32.293  1.00 24.08  ? 196  ASP B OD1   1 
ATOM   6249  O  OD2   . ASP B  2  196 ? -1.068  32.722  32.528  1.00 24.37  ? 196  ASP B OD2   1 
ATOM   6250  N  N     . ASP B  2  197 ? -2.639  33.212  35.420  1.00 22.45  ? 197  ASP B N     1 
ATOM   6251  C  CA    . ASP B  2  197 ? -3.779  32.332  35.675  1.00 22.14  ? 197  ASP B CA    1 
ATOM   6252  C  C     . ASP B  2  197 ? -4.384  31.682  34.441  1.00 23.32  ? 197  ASP B C     1 
ATOM   6253  O  O     . ASP B  2  197 ? -5.453  31.101  34.535  1.00 23.59  ? 197  ASP B O     1 
ATOM   6254  C  CB    . ASP B  2  197 ? -4.918  33.100  36.393  1.00 21.65  ? 197  ASP B CB    1 
ATOM   6255  C  CG    . ASP B  2  197 ? -4.506  33.656  37.751  1.00 23.47  ? 197  ASP B CG    1 
ATOM   6256  O  OD1   . ASP B  2  197 ? -3.819  32.925  38.497  1.00 29.07  ? 197  ASP B OD1   1 
ATOM   6257  O  OD2   . ASP B  2  197 ? -4.875  34.817  38.092  1.00 21.67  ? 197  ASP B OD2   1 
ATOM   6258  N  N     . TYR B  2  198 ? -3.719  31.770  33.293  1.00 22.87  ? 198  TYR B N     1 
ATOM   6259  C  CA    . TYR B  2  198 ? -4.284  31.213  32.056  1.00 23.47  ? 198  TYR B CA    1 
ATOM   6260  C  C     . TYR B  2  198 ? -3.576  29.988  31.477  1.00 21.48  ? 198  TYR B C     1 
ATOM   6261  O  O     . TYR B  2  198 ? -3.556  29.760  30.262  1.00 24.99  ? 198  TYR B O     1 
ATOM   6262  C  CB    . TYR B  2  198 ? -4.351  32.335  31.005  1.00 19.92  ? 198  TYR B CB    1 
ATOM   6263  C  CG    . TYR B  2  198 ? -5.497  33.290  31.269  1.00 23.65  ? 198  TYR B CG    1 
ATOM   6264  C  CD1   . TYR B  2  198 ? -5.555  34.046  32.439  1.00 20.46  ? 198  TYR B CD1   1 
ATOM   6265  C  CD2   . TYR B  2  198 ? -6.580  33.356  30.390  1.00 29.36  ? 198  TYR B CD2   1 
ATOM   6266  C  CE1   . TYR B  2  198 ? -6.665  34.836  32.740  1.00 25.84  ? 198  TYR B CE1   1 
ATOM   6267  C  CE2   . TYR B  2  198 ? -7.684  34.133  30.672  1.00 31.09  ? 198  TYR B CE2   1 
ATOM   6268  C  CZ    . TYR B  2  198 ? -7.729  34.865  31.848  1.00 31.62  ? 198  TYR B CZ    1 
ATOM   6269  O  OH    . TYR B  2  198 ? -8.860  35.596  32.121  1.00 38.98  ? 198  TYR B OH    1 
ATOM   6270  N  N     . THR B  2  199 ? -2.993  29.188  32.346  1.00 25.05  ? 199  THR B N     1 
ATOM   6271  C  CA    . THR B  2  199 ? -2.260  28.026  31.880  1.00 26.56  ? 199  THR B CA    1 
ATOM   6272  C  C     . THR B  2  199 ? -3.075  27.094  30.973  1.00 26.02  ? 199  THR B C     1 
ATOM   6273  O  O     . THR B  2  199 ? -2.620  26.729  29.898  1.00 24.55  ? 199  THR B O     1 
ATOM   6274  C  CB    . THR B  2  199 ? -1.733  27.207  33.056  1.00 27.83  ? 199  THR B CB    1 
ATOM   6275  O  OG1   . THR B  2  199 ? -1.153  28.084  34.021  1.00 33.69  ? 199  THR B OG1   1 
ATOM   6276  C  CG2   . THR B  2  199 ? -0.681  26.238  32.584  1.00 27.03  ? 199  THR B CG2   1 
ATOM   6277  N  N     . GLU B  2  200 ? -4.268  26.703  31.407  1.00 24.94  ? 200  GLU B N     1 
ATOM   6278  C  CA    . GLU B  2  200 ? -5.054  25.779  30.614  1.00 26.82  ? 200  GLU B CA    1 
ATOM   6279  C  C     . GLU B  2  200 ? -5.337  26.340  29.236  1.00 25.36  ? 200  GLU B C     1 
ATOM   6280  O  O     . GLU B  2  200 ? -5.253  25.621  28.244  1.00 24.98  ? 200  GLU B O     1 
ATOM   6281  C  CB    . GLU B  2  200 ? -6.369  25.452  31.306  1.00 33.72  ? 200  GLU B CB    1 
ATOM   6282  C  CG    . GLU B  2  200 ? -7.073  24.271  30.637  1.00 47.08  ? 200  GLU B CG    1 
ATOM   6283  C  CD    . GLU B  2  200 ? -8.493  24.066  31.141  1.00 54.47  ? 200  GLU B CD    1 
ATOM   6284  O  OE1   . GLU B  2  200 ? -8.698  24.148  32.379  1.00 58.50  ? 200  GLU B OE1   1 
ATOM   6285  O  OE2   . GLU B  2  200 ? -9.391  23.820  30.296  1.00 56.36  ? 200  GLU B OE2   1 
ATOM   6286  N  N     . GLU B  2  201 ? -5.670  27.625  29.178  1.00 21.71  ? 201  GLU B N     1 
ATOM   6287  C  CA    . GLU B  2  201 ? -5.946  28.279  27.907  1.00 24.11  ? 201  GLU B CA    1 
ATOM   6288  C  C     . GLU B  2  201 ? -4.684  28.335  27.057  1.00 23.06  ? 201  GLU B C     1 
ATOM   6289  O  O     . GLU B  2  201 ? -4.744  28.168  25.848  1.00 24.17  ? 201  GLU B O     1 
ATOM   6290  C  CB    . GLU B  2  201 ? -6.488  29.702  28.134  1.00 24.54  ? 201  GLU B CB    1 
ATOM   6291  C  CG    . GLU B  2  201 ? -7.875  29.736  28.778  1.00 32.74  ? 201  GLU B CG    1 
ATOM   6292  C  CD    . GLU B  2  201 ? -7.849  29.694  30.311  1.00 42.60  ? 201  GLU B CD    1 
ATOM   6293  O  OE1   . GLU B  2  201 ? -6.824  29.291  30.921  1.00 44.08  ? 201  GLU B OE1   1 
ATOM   6294  O  OE2   . GLU B  2  201 ? -8.883  30.065  30.918  1.00 48.16  ? 201  GLU B OE2   1 
ATOM   6295  N  N     . ARG B  2  202 ? -3.535  28.579  27.682  1.00 18.70  ? 202  ARG B N     1 
ATOM   6296  C  CA    . ARG B  2  202 ? -2.325  28.630  26.907  1.00 20.92  ? 202  ARG B CA    1 
ATOM   6297  C  C     . ARG B  2  202 ? -2.118  27.251  26.293  1.00 21.49  ? 202  ARG B C     1 
ATOM   6298  O  O     . ARG B  2  202 ? -1.758  27.131  25.138  1.00 21.58  ? 202  ARG B O     1 
ATOM   6299  C  CB    . ARG B  2  202 ? -1.158  29.061  27.798  1.00 20.88  ? 202  ARG B CB    1 
ATOM   6300  C  CG    . ARG B  2  202 ? -1.361  30.512  28.326  1.00 22.90  ? 202  ARG B CG    1 
ATOM   6301  C  CD    . ARG B  2  202 ? -0.175  30.995  29.131  1.00 20.92  ? 202  ARG B CD    1 
ATOM   6302  N  NE    . ARG B  2  202 ? -0.313  32.386  29.611  1.00 18.04  ? 202  ARG B NE    1 
ATOM   6303  C  CZ    . ARG B  2  202 ? -0.109  33.487  28.884  1.00 15.47  ? 202  ARG B CZ    1 
ATOM   6304  N  NH1   . ARG B  2  202 ? 0.250   33.408  27.598  1.00 14.92  ? 202  ARG B NH1   1 
ATOM   6305  N  NH2   . ARG B  2  202 ? -0.237  34.689  29.459  1.00 12.72  ? 202  ARG B NH2   1 
ATOM   6306  N  N     . LEU B  2  203 ? -2.401  26.206  27.054  1.00 22.90  ? 203  LEU B N     1 
ATOM   6307  C  CA    . LEU B  2  203 ? -2.233  24.852  26.525  1.00 24.74  ? 203  LEU B CA    1 
ATOM   6308  C  C     . LEU B  2  203 ? -3.266  24.566  25.433  1.00 23.27  ? 203  LEU B C     1 
ATOM   6309  O  O     . LEU B  2  203 ? -2.921  24.007  24.403  1.00 25.30  ? 203  LEU B O     1 
ATOM   6310  C  CB    . LEU B  2  203 ? -2.350  23.818  27.666  1.00 19.23  ? 203  LEU B CB    1 
ATOM   6311  C  CG    . LEU B  2  203 ? -1.152  23.768  28.611  1.00 23.61  ? 203  LEU B CG    1 
ATOM   6312  C  CD1   . LEU B  2  203 ? -1.549  23.116  29.913  1.00 16.95  ? 203  LEU B CD1   1 
ATOM   6313  C  CD2   . LEU B  2  203 ? -0.020  23.029  27.947  1.00 22.84  ? 203  LEU B CD2   1 
ATOM   6314  N  N     . ALA B  2  204 ? -4.522  24.969  25.655  1.00 21.57  ? 204  ALA B N     1 
ATOM   6315  C  CA    . ALA B  2  204 ? -5.575  24.737  24.670  1.00 25.44  ? 204  ALA B CA    1 
ATOM   6316  C  C     . ALA B  2  204 ? -5.257  25.321  23.314  1.00 25.76  ? 204  ALA B C     1 
ATOM   6317  O  O     . ALA B  2  204 ? -5.701  24.809  22.276  1.00 24.87  ? 204  ALA B O     1 
ATOM   6318  C  CB    . ALA B  2  204 ? -6.900  25.322  25.153  1.00 26.80  ? 204  ALA B CB    1 
ATOM   6319  N  N     . GLN B  2  205 ? -4.513  26.419  23.306  1.00 25.47  ? 205  GLN B N     1 
ATOM   6320  C  CA    . GLN B  2  205 ? -4.196  27.041  22.039  1.00 27.92  ? 205  GLN B CA    1 
ATOM   6321  C  C     . GLN B  2  205 ? -3.364  26.145  21.114  1.00 25.95  ? 205  GLN B C     1 
ATOM   6322  O  O     . GLN B  2  205 ? -3.386  26.314  19.912  1.00 26.61  ? 205  GLN B O     1 
ATOM   6323  C  CB    . GLN B  2  205 ? -3.472  28.365  22.286  1.00 29.39  ? 205  GLN B CB    1 
ATOM   6324  C  CG    . GLN B  2  205 ? -2.961  29.018  21.010  1.00 29.72  ? 205  GLN B CG    1 
ATOM   6325  C  CD    . GLN B  2  205 ? -2.287  30.368  21.265  1.00 35.93  ? 205  GLN B CD    1 
ATOM   6326  O  OE1   . GLN B  2  205 ? -1.607  30.557  22.275  1.00 37.54  ? 205  GLN B OE1   1 
ATOM   6327  N  NE2   . GLN B  2  205 ? -2.452  31.299  20.328  1.00 39.05  ? 205  GLN B NE2   1 
ATOM   6328  N  N     . LEU B  2  206 ? -2.639  25.193  21.684  1.00 27.27  ? 206  LEU B N     1 
ATOM   6329  C  CA    . LEU B  2  206 ? -1.772  24.319  20.902  1.00 28.13  ? 206  LEU B CA    1 
ATOM   6330  C  C     . LEU B  2  206 ? -2.433  23.004  20.483  1.00 27.24  ? 206  LEU B C     1 
ATOM   6331  O  O     . LEU B  2  206 ? -1.773  22.092  19.972  1.00 25.87  ? 206  LEU B O     1 
ATOM   6332  C  CB    . LEU B  2  206 ? -0.494  24.038  21.706  1.00 24.63  ? 206  LEU B CB    1 
ATOM   6333  C  CG    . LEU B  2  206 ? 0.128   25.323  22.292  1.00 29.02  ? 206  LEU B CG    1 
ATOM   6334  C  CD1   . LEU B  2  206 ? 1.265   24.962  23.235  1.00 22.92  ? 206  LEU B CD1   1 
ATOM   6335  C  CD2   . LEU B  2  206 ? 0.608   26.257  21.168  1.00 24.10  ? 206  LEU B CD2   1 
ATOM   6336  N  N     . GLN B  2  207 ? -3.741  22.902  20.693  1.00 24.87  ? 207  GLN B N     1 
ATOM   6337  C  CA    . GLN B  2  207 ? -4.451  21.677  20.337  1.00 22.74  ? 207  GLN B CA    1 
ATOM   6338  C  C     . GLN B  2  207 ? -4.796  21.638  18.862  1.00 21.58  ? 207  GLN B C     1 
ATOM   6339  O  O     . GLN B  2  207 ? -5.945  21.815  18.489  1.00 24.88  ? 207  GLN B O     1 
ATOM   6340  C  CB    . GLN B  2  207 ? -5.730  21.546  21.167  1.00 21.30  ? 207  GLN B CB    1 
ATOM   6341  C  CG    . GLN B  2  207 ? -5.481  21.247  22.640  1.00 19.97  ? 207  GLN B CG    1 
ATOM   6342  C  CD    . GLN B  2  207 ? -5.109  19.774  22.873  1.00 26.13  ? 207  GLN B CD    1 
ATOM   6343  O  OE1   . GLN B  2  207 ? -5.020  18.993  21.933  1.00 23.30  ? 207  GLN B OE1   1 
ATOM   6344  N  NE2   . GLN B  2  207 ? -4.899  19.403  24.134  1.00 23.90  ? 207  GLN B NE2   1 
ATOM   6345  N  N     . ASP B  2  208 ? -3.792  21.407  18.031  1.00 21.32  ? 208  ASP B N     1 
ATOM   6346  C  CA    . ASP B  2  208 ? -3.969  21.306  16.593  1.00 21.58  ? 208  ASP B CA    1 
ATOM   6347  C  C     . ASP B  2  208 ? -2.722  20.562  16.105  1.00 23.36  ? 208  ASP B C     1 
ATOM   6348  O  O     . ASP B  2  208 ? -1.767  20.384  16.849  1.00 21.37  ? 208  ASP B O     1 
ATOM   6349  C  CB    . ASP B  2  208 ? -4.153  22.693  15.939  1.00 20.57  ? 208  ASP B CB    1 
ATOM   6350  C  CG    . ASP B  2  208 ? -2.879  23.554  15.949  1.00 25.51  ? 208  ASP B CG    1 
ATOM   6351  O  OD1   . ASP B  2  208 ? -1.956  23.235  15.177  1.00 26.23  ? 208  ASP B OD1   1 
ATOM   6352  O  OD2   . ASP B  2  208 ? -2.817  24.560  16.713  1.00 24.00  ? 208  ASP B OD2   1 
ATOM   6353  N  N     . PRO B  2  209 ? -2.708  20.122  14.849  1.00 23.90  ? 209  PRO B N     1 
ATOM   6354  C  CA    . PRO B  2  209 ? -1.545  19.384  14.360  1.00 22.78  ? 209  PRO B CA    1 
ATOM   6355  C  C     . PRO B  2  209 ? -0.235  20.132  14.153  1.00 22.95  ? 209  PRO B C     1 
ATOM   6356  O  O     . PRO B  2  209 ? 0.797   19.496  14.074  1.00 19.10  ? 209  PRO B O     1 
ATOM   6357  C  CB    . PRO B  2  209 ? -2.028  18.800  13.014  1.00 23.53  ? 209  PRO B CB    1 
ATOM   6358  C  CG    . PRO B  2  209 ? -3.558  19.006  13.026  1.00 26.14  ? 209  PRO B CG    1 
ATOM   6359  C  CD    . PRO B  2  209 ? -3.702  20.308  13.780  1.00 26.12  ? 209  PRO B CD    1 
ATOM   6360  N  N     . PHE B  2  210 ? -0.264  21.459  14.085  1.00 21.28  ? 210  PHE B N     1 
ATOM   6361  C  CA    . PHE B  2  210 ? 0.945   22.196  13.739  1.00 21.21  ? 210  PHE B CA    1 
ATOM   6362  C  C     . PHE B  2  210 ? 1.672   23.060  14.751  1.00 22.88  ? 210  PHE B C     1 
ATOM   6363  O  O     . PHE B  2  210 ? 2.896   22.985  14.853  1.00 17.58  ? 210  PHE B O     1 
ATOM   6364  C  CB    . PHE B  2  210 ? 0.641   23.090  12.526  1.00 20.65  ? 210  PHE B CB    1 
ATOM   6365  C  CG    . PHE B  2  210 ? 0.294   22.328  11.268  1.00 20.84  ? 210  PHE B CG    1 
ATOM   6366  C  CD1   . PHE B  2  210 ? 1.293   21.918  10.396  1.00 21.24  ? 210  PHE B CD1   1 
ATOM   6367  C  CD2   . PHE B  2  210 ? -1.045  22.041  10.949  1.00 24.88  ? 210  PHE B CD2   1 
ATOM   6368  C  CE1   . PHE B  2  210 ? 0.994   21.230  9.208   1.00 18.74  ? 210  PHE B CE1   1 
ATOM   6369  C  CE2   . PHE B  2  210 ? -1.365  21.348  9.758   1.00 25.42  ? 210  PHE B CE2   1 
ATOM   6370  C  CZ    . PHE B  2  210 ? -0.327  20.946  8.889   1.00 22.69  ? 210  PHE B CZ    1 
ATOM   6371  N  N     . SER B  2  211 ? 0.915   23.915  15.445  1.00 21.48  ? 211  SER B N     1 
ATOM   6372  C  CA    . SER B  2  211 ? 1.475   24.883  16.370  1.00 22.11  ? 211  SER B CA    1 
ATOM   6373  C  C     . SER B  2  211 ? 2.657   24.363  17.178  1.00 21.69  ? 211  SER B C     1 
ATOM   6374  O  O     . SER B  2  211 ? 3.754   24.958  17.179  1.00 22.67  ? 211  SER B O     1 
ATOM   6375  C  CB    . SER B  2  211 ? 0.387   25.372  17.309  1.00 20.50  ? 211  SER B CB    1 
ATOM   6376  O  OG    . SER B  2  211 ? -0.647  25.950  16.550  1.00 22.69  ? 211  SER B OG    1 
ATOM   6377  N  N     . LEU B  2  212 ? 2.399   23.257  17.866  1.00 20.96  ? 212  LEU B N     1 
ATOM   6378  C  CA    . LEU B  2  212 ? 3.370   22.600  18.719  1.00 21.33  ? 212  LEU B CA    1 
ATOM   6379  C  C     . LEU B  2  212 ? 3.835   21.284  18.164  1.00 23.80  ? 212  LEU B C     1 
ATOM   6380  O  O     . LEU B  2  212 ? 5.029   20.953  18.242  1.00 21.85  ? 212  LEU B O     1 
ATOM   6381  C  CB    . LEU B  2  212 ? 2.747   22.326  20.092  1.00 21.57  ? 212  LEU B CB    1 
ATOM   6382  C  CG    . LEU B  2  212 ? 3.429   21.239  20.951  1.00 21.95  ? 212  LEU B CG    1 
ATOM   6383  C  CD1   . LEU B  2  212 ? 4.791   21.779  21.437  1.00 21.64  ? 212  LEU B CD1   1 
ATOM   6384  C  CD2   . LEU B  2  212 ? 2.570   20.854  22.188  1.00 19.35  ? 212  LEU B CD2   1 
ATOM   6385  N  N     . TYR B  2  213 ? 2.899   20.533  17.574  1.00 24.37  ? 213  TYR B N     1 
ATOM   6386  C  CA    . TYR B  2  213 ? 3.244   19.183  17.151  1.00 26.39  ? 213  TYR B CA    1 
ATOM   6387  C  C     . TYR B  2  213 ? 4.093   18.914  15.928  1.00 24.52  ? 213  TYR B C     1 
ATOM   6388  O  O     . TYR B  2  213 ? 4.291   17.763  15.603  1.00 22.97  ? 213  TYR B O     1 
ATOM   6389  C  CB    . TYR B  2  213 ? 1.984   18.301  17.169  1.00 22.66  ? 213  TYR B CB    1 
ATOM   6390  C  CG    . TYR B  2  213 ? 1.467   18.084  18.602  1.00 21.99  ? 213  TYR B CG    1 
ATOM   6391  C  CD1   . TYR B  2  213 ? 2.197   17.331  19.530  1.00 17.46  ? 213  TYR B CD1   1 
ATOM   6392  C  CD2   . TYR B  2  213 ? 0.255   18.646  19.026  1.00 17.07  ? 213  TYR B CD2   1 
ATOM   6393  C  CE1   . TYR B  2  213 ? 1.734   17.156  20.842  1.00 20.31  ? 213  TYR B CE1   1 
ATOM   6394  C  CE2   . TYR B  2  213 ? -0.223  18.465  20.332  1.00 15.38  ? 213  TYR B CE2   1 
ATOM   6395  C  CZ    . TYR B  2  213 ? 0.523   17.725  21.230  1.00 19.86  ? 213  TYR B CZ    1 
ATOM   6396  O  OH    . TYR B  2  213 ? 0.068   17.562  22.523  1.00 25.66  ? 213  TYR B OH    1 
ATOM   6397  N  N     . ARG B  2  214 ? 4.614   19.941  15.252  1.00 25.10  ? 214  ARG B N     1 
ATOM   6398  C  CA    . ARG B  2  214 ? 5.518   19.647  14.123  1.00 23.85  ? 214  ARG B CA    1 
ATOM   6399  C  C     . ARG B  2  214 ? 6.922   19.382  14.712  1.00 23.91  ? 214  ARG B C     1 
ATOM   6400  O  O     . ARG B  2  214 ? 7.829   18.924  14.020  1.00 23.72  ? 214  ARG B O     1 
ATOM   6401  C  CB    . ARG B  2  214 ? 5.586   20.794  13.096  1.00 21.09  ? 214  ARG B CB    1 
ATOM   6402  C  CG    . ARG B  2  214 ? 4.384   20.887  12.124  1.00 20.94  ? 214  ARG B CG    1 
ATOM   6403  C  CD    . ARG B  2  214 ? 4.017   19.521  11.468  1.00 20.37  ? 214  ARG B CD    1 
ATOM   6404  N  NE    . ARG B  2  214 ? 3.057   18.777  12.295  1.00 23.27  ? 214  ARG B NE    1 
ATOM   6405  C  CZ    . ARG B  2  214 ? 2.989   17.445  12.382  1.00 27.16  ? 214  ARG B CZ    1 
ATOM   6406  N  NH1   . ARG B  2  214 ? 3.832   16.661  11.693  1.00 23.17  ? 214  ARG B NH1   1 
ATOM   6407  N  NH2   . ARG B  2  214 ? 2.062   16.887  13.156  1.00 22.77  ? 214  ARG B NH2   1 
ATOM   6408  N  N     . CYS B  2  215 ? 7.109   19.678  15.996  1.00 21.56  ? 215  CYS B N     1 
ATOM   6409  C  CA    . CYS B  2  215 ? 8.397   19.407  16.637  1.00 22.05  ? 215  CYS B CA    1 
ATOM   6410  C  C     . CYS B  2  215 ? 8.609   17.873  16.705  1.00 22.04  ? 215  CYS B C     1 
ATOM   6411  O  O     . CYS B  2  215 ? 7.771   17.165  17.270  1.00 21.37  ? 215  CYS B O     1 
ATOM   6412  C  CB    . CYS B  2  215 ? 8.432   19.962  18.075  1.00 18.42  ? 215  CYS B CB    1 
ATOM   6413  S  SG    . CYS B  2  215 ? 9.989   19.596  18.923  1.00 20.17  ? 215  CYS B SG    1 
ATOM   6414  N  N     . HIS B  2  216 ? 9.721   17.384  16.150  1.00 18.96  ? 216  HIS B N     1 
ATOM   6415  C  CA    . HIS B  2  216 ? 10.046  15.958  16.177  1.00 23.23  ? 216  HIS B CA    1 
ATOM   6416  C  C     . HIS B  2  216 ? 11.347  15.689  16.914  1.00 23.88  ? 216  HIS B C     1 
ATOM   6417  O  O     . HIS B  2  216 ? 12.072  14.761  16.579  1.00 23.50  ? 216  HIS B O     1 
ATOM   6418  C  CB    . HIS B  2  216 ? 10.134  15.408  14.750  1.00 23.94  ? 216  HIS B CB    1 
ATOM   6419  C  CG    . HIS B  2  216 ? 8.856   15.563  13.997  1.00 26.57  ? 216  HIS B CG    1 
ATOM   6420  N  ND1   . HIS B  2  216 ? 7.635   15.238  14.549  1.00 23.85  ? 216  HIS B ND1   1 
ATOM   6421  C  CD2   . HIS B  2  216 ? 8.591   16.115  12.789  1.00 22.72  ? 216  HIS B CD2   1 
ATOM   6422  C  CE1   . HIS B  2  216 ? 6.672   15.594  13.717  1.00 27.76  ? 216  HIS B CE1   1 
ATOM   6423  N  NE2   . HIS B  2  216 ? 7.226   16.128  12.642  1.00 27.68  ? 216  HIS B NE2   1 
ATOM   6424  N  N     . THR B  2  217 ? 11.638  16.551  17.891  1.00 26.28  ? 217  THR B N     1 
ATOM   6425  C  CA    . THR B  2  217 ? 12.800  16.453  18.764  1.00 22.79  ? 217  THR B CA    1 
ATOM   6426  C  C     . THR B  2  217 ? 14.167  16.355  18.056  1.00 24.46  ? 217  THR B C     1 
ATOM   6427  O  O     . THR B  2  217 ? 15.067  15.650  18.525  1.00 22.63  ? 217  THR B O     1 
ATOM   6428  C  CB    . THR B  2  217 ? 12.622  15.245  19.735  1.00 22.31  ? 217  THR B CB    1 
ATOM   6429  O  OG1   . THR B  2  217 ? 11.254  15.194  20.211  1.00 22.00  ? 217  THR B OG1   1 
ATOM   6430  C  CG2   . THR B  2  217 ? 13.558  15.397  20.956  1.00 20.89  ? 217  THR B CG2   1 
ATOM   6431  N  N     . ILE B  2  218 ? 14.313  17.075  16.942  1.00 21.30  ? 218  ILE B N     1 
ATOM   6432  C  CA    . ILE B  2  218 ? 15.552  17.112  16.158  1.00 21.50  ? 218  ILE B CA    1 
ATOM   6433  C  C     . ILE B  2  218 ? 16.694  17.746  16.950  1.00 20.86  ? 218  ILE B C     1 
ATOM   6434  O  O     . ILE B  2  218 ? 17.860  17.428  16.734  1.00 19.87  ? 218  ILE B O     1 
ATOM   6435  C  CB    . ILE B  2  218 ? 15.348  17.923  14.861  1.00 22.32  ? 218  ILE B CB    1 
ATOM   6436  C  CG1   . ILE B  2  218 ? 14.362  17.177  13.955  1.00 18.49  ? 218  ILE B CG1   1 
ATOM   6437  C  CG2   . ILE B  2  218 ? 16.708  18.186  14.190  1.00 19.62  ? 218  ILE B CG2   1 
ATOM   6438  C  CD1   . ILE B  2  218 ? 13.952  17.967  12.712  1.00 23.55  ? 218  ILE B CD1   1 
ATOM   6439  N  N     . MET B  2  219 ? 16.350  18.687  17.822  1.00 22.58  ? 219  MET B N     1 
ATOM   6440  C  CA    . MET B  2  219 ? 17.310  19.355  18.723  1.00 22.83  ? 219  MET B CA    1 
ATOM   6441  C  C     . MET B  2  219 ? 18.389  20.309  18.167  1.00 24.17  ? 219  MET B C     1 
ATOM   6442  O  O     . MET B  2  219 ? 19.421  20.569  18.814  1.00 21.57  ? 219  MET B O     1 
ATOM   6443  C  CB    . MET B  2  219 ? 17.949  18.299  19.651  1.00 24.64  ? 219  MET B CB    1 
ATOM   6444  C  CG    . MET B  2  219 ? 16.983  17.758  20.751  1.00 23.73  ? 219  MET B CG    1 
ATOM   6445  S  SD    . MET B  2  219 ? 16.478  19.064  21.963  1.00 31.80  ? 219  MET B SD    1 
ATOM   6446  C  CE    . MET B  2  219 ? 18.038  19.287  22.889  1.00 29.03  ? 219  MET B CE    1 
ATOM   6447  N  N     . ASN B  2  220 ? 18.138  20.855  16.976  1.00 24.97  ? 220  ASN B N     1 
ATOM   6448  C  CA    . ASN B  2  220 ? 19.037  21.828  16.369  1.00 24.01  ? 220  ASN B CA    1 
ATOM   6449  C  C     . ASN B  2  220 ? 18.909  23.139  17.123  1.00 22.69  ? 220  ASN B C     1 
ATOM   6450  O  O     . ASN B  2  220 ? 19.872  23.895  17.269  1.00 24.87  ? 220  ASN B O     1 
ATOM   6451  C  CB    . ASN B  2  220 ? 18.641  22.100  14.920  1.00 27.12  ? 220  ASN B CB    1 
ATOM   6452  C  CG    . ASN B  2  220 ? 19.494  21.357  13.944  1.00 29.49  ? 220  ASN B CG    1 
ATOM   6453  O  OD1   . ASN B  2  220 ? 20.256  20.452  14.328  1.00 33.92  ? 220  ASN B OD1   1 
ATOM   6454  N  ND2   . ASN B  2  220 ? 19.377  21.708  12.671  1.00 32.95  ? 220  ASN B ND2   1 
ATOM   6455  N  N     . CYS B  2  221 ? 17.693  23.410  17.568  1.00 21.26  ? 221  CYS B N     1 
ATOM   6456  C  CA    . CYS B  2  221 ? 17.382  24.638  18.305  1.00 23.10  ? 221  CYS B CA    1 
ATOM   6457  C  C     . CYS B  2  221 ? 18.272  24.806  19.527  1.00 23.19  ? 221  CYS B C     1 
ATOM   6458  O  O     . CYS B  2  221 ? 18.913  25.842  19.688  1.00 20.89  ? 221  CYS B O     1 
ATOM   6459  C  CB    . CYS B  2  221 ? 15.894  24.656  18.737  1.00 18.57  ? 221  CYS B CB    1 
ATOM   6460  S  SG    . CYS B  2  221 ? 15.271  23.215  19.661  1.00 22.93  ? 221  CYS B SG    1 
ATOM   6461  N  N     . THR B  2  222 ? 18.313  23.789  20.386  1.00 23.83  ? 222  THR B N     1 
ATOM   6462  C  CA    . THR B  2  222 ? 19.132  23.876  21.590  1.00 24.43  ? 222  THR B CA    1 
ATOM   6463  C  C     . THR B  2  222 ? 20.629  23.969  21.269  1.00 24.38  ? 222  THR B C     1 
ATOM   6464  O  O     . THR B  2  222 ? 21.384  24.642  21.950  1.00 28.46  ? 222  THR B O     1 
ATOM   6465  C  CB    . THR B  2  222 ? 18.878  22.666  22.520  1.00 23.53  ? 222  THR B CB    1 
ATOM   6466  O  OG1   . THR B  2  222 ? 17.564  22.775  23.110  1.00 21.56  ? 222  THR B OG1   1 
ATOM   6467  C  CG2   . THR B  2  222 ? 19.937  22.620  23.640  1.00 22.49  ? 222  THR B CG2   1 
ATOM   6468  N  N     . ARG B  2  223 ? 21.056  23.301  20.218  1.00 24.94  ? 223  ARG B N     1 
ATOM   6469  C  CA    . ARG B  2  223 ? 22.458  23.310  19.854  1.00 25.38  ? 223  ARG B CA    1 
ATOM   6470  C  C     . ARG B  2  223 ? 22.911  24.677  19.364  1.00 27.10  ? 223  ARG B C     1 
ATOM   6471  O  O     . ARG B  2  223 ? 24.064  25.065  19.573  1.00 23.37  ? 223  ARG B O     1 
ATOM   6472  C  CB    . ARG B  2  223 ? 22.724  22.273  18.743  1.00 30.22  ? 223  ARG B CB    1 
ATOM   6473  C  CG    . ARG B  2  223 ? 24.061  22.469  17.966  1.00 37.53  ? 223  ARG B CG    1 
ATOM   6474  C  CD    . ARG B  2  223 ? 24.248  21.428  16.841  1.00 39.87  ? 223  ARG B CD    1 
ATOM   6475  N  NE    . ARG B  2  223 ? 24.097  20.090  17.397  1.00 44.96  ? 223  ARG B NE    1 
ATOM   6476  C  CZ    . ARG B  2  223 ? 25.094  19.321  17.815  1.00 44.83  ? 223  ARG B CZ    1 
ATOM   6477  N  NH1   . ARG B  2  223 ? 26.360  19.731  17.726  1.00 48.85  ? 223  ARG B NH1   1 
ATOM   6478  N  NH2   . ARG B  2  223 ? 24.811  18.157  18.382  1.00 41.12  ? 223  ARG B NH2   1 
ATOM   6479  N  N     . THR B  2  224 ? 22.004  25.425  18.741  1.00 26.27  ? 224  THR B N     1 
ATOM   6480  C  CA    . THR B  2  224 ? 22.386  26.699  18.158  1.00 23.04  ? 224  THR B CA    1 
ATOM   6481  C  C     . THR B  2  224 ? 22.153  27.943  19.012  1.00 24.81  ? 224  THR B C     1 
ATOM   6482  O  O     . THR B  2  224 ? 22.677  29.016  18.677  1.00 29.29  ? 224  THR B O     1 
ATOM   6483  C  CB    . THR B  2  224 ? 21.677  26.880  16.783  1.00 22.39  ? 224  THR B CB    1 
ATOM   6484  O  OG1   . THR B  2  224 ? 22.437  27.776  15.954  1.00 25.73  ? 224  THR B OG1   1 
ATOM   6485  C  CG2   . THR B  2  224 ? 20.284  27.462  16.981  1.00 21.40  ? 224  THR B CG2   1 
ATOM   6486  N  N     . CYS B  2  225 ? 21.403  27.828  20.108  1.00 20.46  ? 225  CYS B N     1 
ATOM   6487  C  CA    . CYS B  2  225 ? 21.136  29.018  20.905  1.00 20.20  ? 225  CYS B CA    1 
ATOM   6488  C  C     . CYS B  2  225 ? 22.393  29.718  21.450  1.00 22.68  ? 225  CYS B C     1 
ATOM   6489  O  O     . CYS B  2  225 ? 23.128  29.143  22.239  1.00 26.83  ? 225  CYS B O     1 
ATOM   6490  C  CB    . CYS B  2  225 ? 20.221  28.687  22.062  1.00 17.61  ? 225  CYS B CB    1 
ATOM   6491  S  SG    . CYS B  2  225 ? 19.748  30.119  23.091  1.00 22.12  ? 225  CYS B SG    1 
ATOM   6492  N  N     . PRO B  2  226 ? 22.615  30.993  21.078  1.00 23.03  ? 226  PRO B N     1 
ATOM   6493  C  CA    . PRO B  2  226 ? 23.778  31.769  21.530  1.00 27.32  ? 226  PRO B CA    1 
ATOM   6494  C  C     . PRO B  2  226 ? 23.690  32.133  23.005  1.00 26.37  ? 226  PRO B C     1 
ATOM   6495  O  O     . PRO B  2  226 ? 24.672  32.567  23.597  1.00 26.14  ? 226  PRO B O     1 
ATOM   6496  C  CB    . PRO B  2  226 ? 23.726  32.994  20.649  1.00 26.21  ? 226  PRO B CB    1 
ATOM   6497  C  CG    . PRO B  2  226 ? 22.247  33.225  20.571  1.00 26.65  ? 226  PRO B CG    1 
ATOM   6498  C  CD    . PRO B  2  226 ? 21.708  31.846  20.301  1.00 26.86  ? 226  PRO B CD    1 
ATOM   6499  N  N     . LYS B  2  227 ? 22.512  31.961  23.595  1.00 24.25  ? 227  LYS B N     1 
ATOM   6500  C  CA    . LYS B  2  227 ? 22.338  32.272  24.999  1.00 24.88  ? 227  LYS B CA    1 
ATOM   6501  C  C     . LYS B  2  227 ? 22.412  31.015  25.869  1.00 25.47  ? 227  LYS B C     1 
ATOM   6502  O  O     . LYS B  2  227 ? 22.193  31.091  27.077  1.00 29.38  ? 227  LYS B O     1 
ATOM   6503  C  CB    . LYS B  2  227 ? 21.000  32.971  25.219  1.00 29.60  ? 227  LYS B CB    1 
ATOM   6504  C  CG    . LYS B  2  227 ? 20.891  34.339  24.546  1.00 31.98  ? 227  LYS B CG    1 
ATOM   6505  C  CD    . LYS B  2  227 ? 21.759  35.372  25.230  1.00 35.98  ? 227  LYS B CD    1 
ATOM   6506  C  CE    . LYS B  2  227 ? 21.345  35.514  26.665  1.00 39.01  ? 227  LYS B CE    1 
ATOM   6507  N  NZ    . LYS B  2  227 ? 21.763  36.843  27.230  1.00 43.67  ? 227  LYS B NZ    1 
ATOM   6508  N  N     . GLY B  2  228 ? 22.705  29.866  25.253  1.00 23.96  ? 228  GLY B N     1 
ATOM   6509  C  CA    . GLY B  2  228 ? 22.818  28.603  25.985  1.00 22.18  ? 228  GLY B CA    1 
ATOM   6510  C  C     . GLY B  2  228 ? 21.514  28.065  26.567  1.00 24.69  ? 228  GLY B C     1 
ATOM   6511  O  O     . GLY B  2  228 ? 21.533  27.308  27.531  1.00 25.89  ? 228  GLY B O     1 
ATOM   6512  N  N     . LEU B  2  229 ? 20.379  28.438  25.981  1.00 19.65  ? 229  LEU B N     1 
ATOM   6513  C  CA    . LEU B  2  229 ? 19.086  27.991  26.489  1.00 23.69  ? 229  LEU B CA    1 
ATOM   6514  C  C     . LEU B  2  229 ? 18.686  26.645  25.883  1.00 23.79  ? 229  LEU B C     1 
ATOM   6515  O  O     . LEU B  2  229 ? 19.373  26.125  25.005  1.00 24.80  ? 229  LEU B O     1 
ATOM   6516  C  CB    . LEU B  2  229 ? 18.031  29.076  26.215  1.00 20.45  ? 229  LEU B CB    1 
ATOM   6517  C  CG    . LEU B  2  229 ? 17.807  30.283  27.174  1.00 26.94  ? 229  LEU B CG    1 
ATOM   6518  C  CD1   . LEU B  2  229 ? 18.873  30.437  28.276  1.00 21.84  ? 229  LEU B CD1   1 
ATOM   6519  C  CD2   . LEU B  2  229 ? 17.698  31.506  26.373  1.00 18.08  ? 229  LEU B CD2   1 
ATOM   6520  N  N     . ASN B  2  230 ? 17.569  26.075  26.322  1.00 23.84  ? 230  ASN B N     1 
ATOM   6521  C  CA    . ASN B  2  230 ? 17.178  24.767  25.801  1.00 22.44  ? 230  ASN B CA    1 
ATOM   6522  C  C     . ASN B  2  230 ? 15.700  24.716  25.428  1.00 23.49  ? 230  ASN B C     1 
ATOM   6523  O  O     . ASN B  2  230 ? 14.870  24.182  26.162  1.00 22.02  ? 230  ASN B O     1 
ATOM   6524  C  CB    . ASN B  2  230 ? 17.472  23.690  26.842  1.00 22.36  ? 230  ASN B CB    1 
ATOM   6525  C  CG    . ASN B  2  230 ? 17.471  22.294  26.244  1.00 26.57  ? 230  ASN B CG    1 
ATOM   6526  O  OD1   . ASN B  2  230 ? 16.719  22.000  25.306  1.00 24.13  ? 230  ASN B OD1   1 
ATOM   6527  N  ND2   . ASN B  2  230 ? 18.309  21.419  26.794  1.00 27.35  ? 230  ASN B ND2   1 
ATOM   6528  N  N     . PRO B  2  231 ? 15.353  25.285  24.274  1.00 21.36  ? 231  PRO B N     1 
ATOM   6529  C  CA    . PRO B  2  231 ? 13.942  25.252  23.900  1.00 20.03  ? 231  PRO B CA    1 
ATOM   6530  C  C     . PRO B  2  231 ? 13.409  23.831  23.604  1.00 20.90  ? 231  PRO B C     1 
ATOM   6531  O  O     . PRO B  2  231 ? 12.231  23.568  23.752  1.00 22.26  ? 231  PRO B O     1 
ATOM   6532  C  CB    . PRO B  2  231 ? 13.872  26.252  22.708  1.00 16.31  ? 231  PRO B CB    1 
ATOM   6533  C  CG    . PRO B  2  231 ? 15.335  26.319  22.186  1.00 14.02  ? 231  PRO B CG    1 
ATOM   6534  C  CD    . PRO B  2  231 ? 16.142  26.222  23.442  1.00 15.15  ? 231  PRO B CD    1 
ATOM   6535  N  N     . GLY B  2  232 ? 14.283  22.913  23.196  1.00 23.99  ? 232  GLY B N     1 
ATOM   6536  C  CA    . GLY B  2  232 ? 13.825  21.558  22.943  1.00 18.38  ? 232  GLY B CA    1 
ATOM   6537  C  C     . GLY B  2  232 ? 13.255  20.989  24.224  1.00 19.52  ? 232  GLY B C     1 
ATOM   6538  O  O     . GLY B  2  232 ? 12.188  20.386  24.234  1.00 18.98  ? 232  GLY B O     1 
ATOM   6539  N  N     . LYS B  2  233 ? 13.976  21.189  25.321  1.00 20.15  ? 233  LYS B N     1 
ATOM   6540  C  CA    . LYS B  2  233 ? 13.518  20.709  26.601  1.00 21.10  ? 233  LYS B CA    1 
ATOM   6541  C  C     . LYS B  2  233 ? 12.196  21.383  26.975  1.00 21.03  ? 233  LYS B C     1 
ATOM   6542  O  O     . LYS B  2  233 ? 11.259  20.730  27.471  1.00 22.00  ? 233  LYS B O     1 
ATOM   6543  C  CB    . LYS B  2  233 ? 14.560  20.971  27.690  1.00 23.74  ? 233  LYS B CB    1 
ATOM   6544  C  CG    . LYS B  2  233 ? 14.144  20.328  28.993  1.00 29.94  ? 233  LYS B CG    1 
ATOM   6545  C  CD    . LYS B  2  233 ? 15.134  20.566  30.137  1.00 34.95  ? 233  LYS B CD    1 
ATOM   6546  C  CE    . LYS B  2  233 ? 14.579  19.937  31.419  1.00 34.85  ? 233  LYS B CE    1 
ATOM   6547  N  NZ    . LYS B  2  233 ? 13.728  18.718  31.122  1.00 37.89  ? 233  LYS B NZ    1 
ATOM   6548  N  N     . ALA B  2  234 ? 12.105  22.684  26.723  1.00 17.84  ? 234  ALA B N     1 
ATOM   6549  C  CA    . ALA B  2  234 ? 10.882  23.399  27.044  1.00 17.67  ? 234  ALA B CA    1 
ATOM   6550  C  C     . ALA B  2  234 ? 9.709   22.850  26.239  1.00 17.71  ? 234  ALA B C     1 
ATOM   6551  O  O     . ALA B  2  234 ? 8.591   22.747  26.738  1.00 22.65  ? 234  ALA B O     1 
ATOM   6552  C  CB    . ALA B  2  234 ? 11.059  24.893  26.772  1.00 15.89  ? 234  ALA B CB    1 
ATOM   6553  N  N     . ILE B  2  235 ? 9.962   22.501  24.990  1.00 19.70  ? 235  ILE B N     1 
ATOM   6554  C  CA    . ILE B  2  235 ? 8.907   21.968  24.140  1.00 23.26  ? 235  ILE B CA    1 
ATOM   6555  C  C     . ILE B  2  235 ? 8.495   20.601  24.687  1.00 25.25  ? 235  ILE B C     1 
ATOM   6556  O  O     . ILE B  2  235 ? 7.303   20.260  24.707  1.00 25.50  ? 235  ILE B O     1 
ATOM   6557  C  CB    . ILE B  2  235 ? 9.396   21.810  22.691  1.00 24.77  ? 235  ILE B CB    1 
ATOM   6558  C  CG1   . ILE B  2  235 ? 9.549   23.189  22.022  1.00 19.52  ? 235  ILE B CG1   1 
ATOM   6559  C  CG2   . ILE B  2  235 ? 8.446   20.904  21.948  1.00 23.21  ? 235  ILE B CG2   1 
ATOM   6560  C  CD1   . ILE B  2  235 ? 10.303  23.129  20.673  1.00 17.10  ? 235  ILE B CD1   1 
ATOM   6561  N  N     . ALA B  2  236 ? 9.470   19.825  25.166  1.00 21.22  ? 236  ALA B N     1 
ATOM   6562  C  CA    . ALA B  2  236 ? 9.122   18.506  25.726  1.00 22.18  ? 236  ALA B CA    1 
ATOM   6563  C  C     . ALA B  2  236 ? 8.237   18.677  26.967  1.00 23.34  ? 236  ALA B C     1 
ATOM   6564  O  O     . ALA B  2  236 ? 7.335   17.871  27.200  1.00 26.00  ? 236  ALA B O     1 
ATOM   6565  C  CB    . ALA B  2  236 ? 10.402  17.698  26.084  1.00 16.40  ? 236  ALA B CB    1 
ATOM   6566  N  N     . GLU B  2  237 ? 8.510   19.704  27.783  1.00 23.08  ? 237  GLU B N     1 
ATOM   6567  C  CA    . GLU B  2  237 ? 7.697   19.934  28.971  1.00 23.45  ? 237  GLU B CA    1 
ATOM   6568  C  C     . GLU B  2  237 ? 6.268   20.336  28.600  1.00 23.75  ? 237  GLU B C     1 
ATOM   6569  O  O     . GLU B  2  237 ? 5.330   20.000  29.310  1.00 20.35  ? 237  GLU B O     1 
ATOM   6570  C  CB    . GLU B  2  237 ? 8.319   20.984  29.897  1.00 25.57  ? 237  GLU B CB    1 
ATOM   6571  C  CG    . GLU B  2  237 ? 9.574   20.508  30.675  1.00 31.02  ? 237  GLU B CG    1 
ATOM   6572  C  CD    . GLU B  2  237 ? 9.365   19.199  31.466  1.00 37.16  ? 237  GLU B CD    1 
ATOM   6573  O  OE1   . GLU B  2  237 ? 8.342   19.037  32.157  1.00 39.19  ? 237  GLU B OE1   1 
ATOM   6574  O  OE2   . GLU B  2  237 ? 10.246  18.313  31.410  1.00 45.85  ? 237  GLU B OE2   1 
ATOM   6575  N  N     . ILE B  2  238 ? 6.090   21.044  27.488  1.00 24.49  ? 238  ILE B N     1 
ATOM   6576  C  CA    . ILE B  2  238 ? 4.737   21.398  27.078  1.00 22.39  ? 238  ILE B CA    1 
ATOM   6577  C  C     . ILE B  2  238 ? 3.986   20.143  26.653  1.00 22.17  ? 238  ILE B C     1 
ATOM   6578  O  O     . ILE B  2  238 ? 2.827   19.943  27.060  1.00 19.62  ? 238  ILE B O     1 
ATOM   6579  C  CB    . ILE B  2  238 ? 4.700   22.413  25.910  1.00 20.56  ? 238  ILE B CB    1 
ATOM   6580  C  CG1   . ILE B  2  238 ? 5.248   23.770  26.376  1.00 21.14  ? 238  ILE B CG1   1 
ATOM   6581  C  CG2   . ILE B  2  238 ? 3.229   22.650  25.493  1.00 18.30  ? 238  ILE B CG2   1 
ATOM   6582  C  CD1   . ILE B  2  238 ? 5.521   24.777  25.202  1.00 24.63  ? 238  ILE B CD1   1 
ATOM   6583  N  N     . LYS B  2  239 ? 4.643   19.286  25.861  1.00 21.13  ? 239  LYS B N     1 
ATOM   6584  C  CA    . LYS B  2  239 ? 4.016   18.040  25.416  1.00 22.81  ? 239  LYS B CA    1 
ATOM   6585  C  C     . LYS B  2  239 ? 3.557   17.244  26.646  1.00 24.74  ? 239  LYS B C     1 
ATOM   6586  O  O     . LYS B  2  239 ? 2.456   16.695  26.653  1.00 24.85  ? 239  LYS B O     1 
ATOM   6587  C  CB    . LYS B  2  239 ? 4.979   17.203  24.547  1.00 24.10  ? 239  LYS B CB    1 
ATOM   6588  C  CG    . LYS B  2  239 ? 5.208   17.788  23.160  1.00 18.60  ? 239  LYS B CG    1 
ATOM   6589  C  CD    . LYS B  2  239 ? 6.443   17.216  22.477  1.00 19.86  ? 239  LYS B CD    1 
ATOM   6590  C  CE    . LYS B  2  239 ? 6.458   17.552  20.973  1.00 17.18  ? 239  LYS B CE    1 
ATOM   6591  N  NZ    . LYS B  2  239 ? 7.580   16.893  20.267  1.00 16.41  ? 239  LYS B NZ    1 
ATOM   6592  N  N     . LYS B  2  240 ? 4.379   17.191  27.692  1.00 23.92  ? 240  LYS B N     1 
ATOM   6593  C  CA    . LYS B  2  240 ? 3.956   16.458  28.897  1.00 25.94  ? 240  LYS B CA    1 
ATOM   6594  C  C     . LYS B  2  240 ? 2.728   17.083  29.561  1.00 27.14  ? 240  LYS B C     1 
ATOM   6595  O  O     . LYS B  2  240 ? 1.805   16.373  29.995  1.00 26.86  ? 240  LYS B O     1 
ATOM   6596  C  CB    . LYS B  2  240 ? 5.110   16.342  29.884  1.00 26.84  ? 240  LYS B CB    1 
ATOM   6597  C  CG    . LYS B  2  240 ? 6.123   15.313  29.422  1.00 31.28  ? 240  LYS B CG    1 
ATOM   6598  C  CD    . LYS B  2  240 ? 7.330   15.286  30.312  1.00 37.73  ? 240  LYS B CD    1 
ATOM   6599  C  CE    . LYS B  2  240 ? 6.921   14.961  31.725  1.00 39.93  ? 240  LYS B CE    1 
ATOM   6600  N  NZ    . LYS B  2  240 ? 8.109   14.732  32.585  1.00 46.49  ? 240  LYS B NZ    1 
ATOM   6601  N  N     . MET B  2  241 ? 2.689   18.416  29.618  1.00 26.71  ? 241  MET B N     1 
ATOM   6602  C  CA    . MET B  2  241 ? 1.528   19.100  30.184  1.00 27.42  ? 241  MET B CA    1 
ATOM   6603  C  C     . MET B  2  241 ? 0.292   18.921  29.276  1.00 27.31  ? 241  MET B C     1 
ATOM   6604  O  O     . MET B  2  241 ? -0.833  18.798  29.759  1.00 26.03  ? 241  MET B O     1 
ATOM   6605  C  CB    . MET B  2  241 ? 1.821   20.594  30.358  1.00 27.62  ? 241  MET B CB    1 
ATOM   6606  C  CG    . MET B  2  241 ? 2.798   20.920  31.498  1.00 31.41  ? 241  MET B CG    1 
ATOM   6607  S  SD    . MET B  2  241 ? 3.334   22.708  31.513  1.00 33.40  ? 241  MET B SD    1 
ATOM   6608  C  CE    . MET B  2  241 ? 1.825   23.468  32.004  1.00 30.15  ? 241  MET B CE    1 
ATOM   6609  N  N     . MET B  2  242 ? 0.504   18.928  27.964  1.00 25.24  ? 242  MET B N     1 
ATOM   6610  C  CA    . MET B  2  242 ? -0.600  18.759  27.017  1.00 27.75  ? 242  MET B CA    1 
ATOM   6611  C  C     . MET B  2  242 ? -1.232  17.378  27.199  1.00 30.14  ? 242  MET B C     1 
ATOM   6612  O  O     . MET B  2  242 ? -2.435  17.200  27.028  1.00 28.99  ? 242  MET B O     1 
ATOM   6613  C  CB    . MET B  2  242 ? -0.100  18.874  25.567  1.00 24.25  ? 242  MET B CB    1 
ATOM   6614  C  CG    . MET B  2  242 ? 0.367   20.282  25.127  1.00 27.03  ? 242  MET B CG    1 
ATOM   6615  S  SD    . MET B  2  242 ? -1.027  21.405  24.787  1.00 28.51  ? 242  MET B SD    1 
ATOM   6616  C  CE    . MET B  2  242 ? -1.613  20.768  23.135  1.00 21.63  ? 242  MET B CE    1 
ATOM   6617  N  N     . ALA B  2  243 ? -0.398  16.407  27.547  1.00 32.35  ? 243  ALA B N     1 
ATOM   6618  C  CA    . ALA B  2  243 ? -0.853  15.043  27.715  1.00 33.69  ? 243  ALA B CA    1 
ATOM   6619  C  C     . ALA B  2  243 ? -1.535  14.795  29.042  1.00 34.00  ? 243  ALA B C     1 
ATOM   6620  O  O     . ALA B  2  243 ? -2.344  13.883  29.158  1.00 39.69  ? 243  ALA B O     1 
ATOM   6621  C  CB    . ALA B  2  243 ? 0.326   14.095  27.552  1.00 30.56  ? 243  ALA B CB    1 
ATOM   6622  N  N     . THR B  2  244 ? -1.234  15.597  30.047  1.00 37.96  ? 244  THR B N     1 
ATOM   6623  C  CA    . THR B  2  244 ? -1.833  15.355  31.349  1.00 39.96  ? 244  THR B CA    1 
ATOM   6624  C  C     . THR B  2  244 ? -2.821  16.339  31.945  1.00 43.68  ? 244  THR B C     1 
ATOM   6625  O  O     . THR B  2  244 ? -3.448  16.012  32.963  1.00 43.06  ? 244  THR B O     1 
ATOM   6626  C  CB    . THR B  2  244 ? -0.755  15.149  32.370  1.00 40.80  ? 244  THR B CB    1 
ATOM   6627  O  OG1   . THR B  2  244 ? 0.013   16.349  32.480  1.00 45.98  ? 244  THR B OG1   1 
ATOM   6628  C  CG2   . THR B  2  244 ? 0.165   14.017  31.931  1.00 41.14  ? 244  THR B CG2   1 
ATOM   6629  N  N     . TYR B  2  245 ? -2.980  17.520  31.338  1.00 44.16  ? 245  TYR B N     1 
ATOM   6630  C  CA    . TYR B  2  245 ? -3.896  18.536  31.873  1.00 47.03  ? 245  TYR B CA    1 
ATOM   6631  C  C     . TYR B  2  245 ? -5.386  18.234  31.732  1.00 48.56  ? 245  TYR B C     1 
ATOM   6632  O  O     . TYR B  2  245 ? -5.799  17.490  30.848  1.00 47.67  ? 245  TYR B O     1 
ATOM   6633  C  CB    . TYR B  2  245 ? -3.595  19.930  31.260  1.00 47.05  ? 245  TYR B CB    1 
ATOM   6634  C  CG    . TYR B  2  245 ? -4.262  20.286  29.919  1.00 42.40  ? 245  TYR B CG    1 
ATOM   6635  C  CD1   . TYR B  2  245 ? -5.473  20.989  29.876  1.00 40.55  ? 245  TYR B CD1   1 
ATOM   6636  C  CD2   . TYR B  2  245 ? -3.641  19.981  28.699  1.00 43.41  ? 245  TYR B CD2   1 
ATOM   6637  C  CE1   . TYR B  2  245 ? -6.040  21.383  28.653  1.00 43.29  ? 245  TYR B CE1   1 
ATOM   6638  C  CE2   . TYR B  2  245 ? -4.206  20.369  27.467  1.00 40.75  ? 245  TYR B CE2   1 
ATOM   6639  C  CZ    . TYR B  2  245 ? -5.399  21.068  27.455  1.00 40.35  ? 245  TYR B CZ    1 
ATOM   6640  O  OH    . TYR B  2  245 ? -5.954  21.443  26.253  1.00 39.52  ? 245  TYR B OH    1 
ATOM   6641  N  N     . LYS B  2  246 ? -6.174  18.829  32.624  1.00 51.76  ? 246  LYS B N     1 
ATOM   6642  C  CA    . LYS B  2  246 ? -7.629  18.681  32.639  1.00 56.43  ? 246  LYS B CA    1 
ATOM   6643  C  C     . LYS B  2  246 ? -8.301  20.019  32.286  1.00 58.04  ? 246  LYS B C     1 
ATOM   6644  O  O     . LYS B  2  246 ? -9.162  20.045  31.367  1.00 59.39  ? 246  LYS B O     1 
ATOM   6645  C  CB    . LYS B  2  246 ? -8.099  18.249  34.026  1.00 58.71  ? 246  LYS B CB    1 
ATOM   6646  C  CG    . LYS B  2  246 ? -7.378  17.042  34.588  1.00 62.47  ? 246  LYS B CG    1 
ATOM   6647  C  CD    . LYS B  2  246 ? -7.936  16.690  35.956  1.00 66.36  ? 246  LYS B CD    1 
ATOM   6648  C  CE    . LYS B  2  246 ? -7.166  15.554  36.607  1.00 68.05  ? 246  LYS B CE    1 
ATOM   6649  N  NZ    . LYS B  2  246 ? -7.690  15.249  37.972  1.00 70.03  ? 246  LYS B NZ    1 
ATOM   6650  N  N     . ALA C  3  2   ? -3.717  49.341  14.314  1.00 44.10  ? 2    ALA C N     1 
ATOM   6651  C  CA    . ALA C  3  2   ? -3.242  48.091  14.985  1.00 43.34  ? 2    ALA C CA    1 
ATOM   6652  C  C     . ALA C  3  2   ? -3.692  46.881  14.170  1.00 43.47  ? 2    ALA C C     1 
ATOM   6653  O  O     . ALA C  3  2   ? -4.809  46.849  13.643  1.00 48.13  ? 2    ALA C O     1 
ATOM   6654  C  CB    . ALA C  3  2   ? -3.813  47.998  16.410  1.00 40.36  ? 2    ALA C CB    1 
ATOM   6655  N  N     . THR C  3  3   ? -2.830  45.884  14.068  1.00 40.32  ? 3    THR C N     1 
ATOM   6656  C  CA    . THR C  3  3   ? -3.183  44.685  13.333  1.00 38.81  ? 3    THR C CA    1 
ATOM   6657  C  C     . THR C  3  3   ? -3.034  43.463  14.221  1.00 35.83  ? 3    THR C C     1 
ATOM   6658  O  O     . THR C  3  3   ? -2.131  43.404  15.060  1.00 35.12  ? 3    THR C O     1 
ATOM   6659  C  CB    . THR C  3  3   ? -2.289  44.515  12.125  1.00 39.69  ? 3    THR C CB    1 
ATOM   6660  O  OG1   . THR C  3  3   ? -2.405  45.671  11.296  1.00 47.83  ? 3    THR C OG1   1 
ATOM   6661  C  CG2   . THR C  3  3   ? -2.701  43.315  11.339  1.00 41.33  ? 3    THR C CG2   1 
ATOM   6662  N  N     . THR C  3  4   ? -3.915  42.486  14.035  1.00 33.42  ? 4    THR C N     1 
ATOM   6663  C  CA    . THR C  3  4   ? -3.863  41.258  14.814  1.00 29.16  ? 4    THR C CA    1 
ATOM   6664  C  C     . THR C  3  4   ? -2.747  40.375  14.280  1.00 31.41  ? 4    THR C C     1 
ATOM   6665  O  O     . THR C  3  4   ? -2.264  40.556  13.154  1.00 30.83  ? 4    THR C O     1 
ATOM   6666  C  CB    . THR C  3  4   ? -5.178  40.464  14.714  1.00 28.48  ? 4    THR C CB    1 
ATOM   6667  O  OG1   . THR C  3  4   ? -5.317  39.959  13.385  1.00 32.43  ? 4    THR C OG1   1 
ATOM   6668  C  CG2   . THR C  3  4   ? -6.378  41.361  15.032  1.00 27.04  ? 4    THR C CG2   1 
ATOM   6669  N  N     . ALA C  3  5   ? -2.340  39.411  15.094  1.00 31.65  ? 5    ALA C N     1 
ATOM   6670  C  CA    . ALA C  3  5   ? -1.286  38.490  14.686  1.00 30.39  ? 5    ALA C CA    1 
ATOM   6671  C  C     . ALA C  3  5   ? -1.692  37.769  13.393  1.00 27.55  ? 5    ALA C C     1 
ATOM   6672  O  O     . ALA C  3  5   ? -0.876  37.578  12.496  1.00 23.09  ? 5    ALA C O     1 
ATOM   6673  C  CB    . ALA C  3  5   ? -1.043  37.488  15.788  1.00 27.21  ? 5    ALA C CB    1 
ATOM   6674  N  N     . LYS C  3  6   ? -2.963  37.384  13.297  1.00 30.30  ? 6    LYS C N     1 
ATOM   6675  C  CA    . LYS C  3  6   ? -3.435  36.678  12.111  1.00 33.62  ? 6    LYS C CA    1 
ATOM   6676  C  C     . LYS C  3  6   ? -3.372  37.535  10.860  1.00 32.82  ? 6    LYS C C     1 
ATOM   6677  O  O     . LYS C  3  6   ? -2.977  37.037  9.804   1.00 33.46  ? 6    LYS C O     1 
ATOM   6678  C  CB    . LYS C  3  6   ? -4.858  36.139  12.305  1.00 38.53  ? 6    LYS C CB    1 
ATOM   6679  C  CG    . LYS C  3  6   ? -4.911  34.969  13.266  1.00 50.21  ? 6    LYS C CG    1 
ATOM   6680  C  CD    . LYS C  3  6   ? -6.054  33.994  12.956  1.00 59.41  ? 6    LYS C CD    1 
ATOM   6681  C  CE    . LYS C  3  6   ? -5.984  32.762  13.868  1.00 61.93  ? 6    LYS C CE    1 
ATOM   6682  N  NZ    . LYS C  3  6   ? -6.848  31.634  13.391  1.00 65.84  ? 6    LYS C NZ    1 
ATOM   6683  N  N     . GLU C  3  7   ? -3.752  38.813  10.967  1.00 29.19  ? 7    GLU C N     1 
ATOM   6684  C  CA    . GLU C  3  7   ? -3.684  39.698  9.813   1.00 27.11  ? 7    GLU C CA    1 
ATOM   6685  C  C     . GLU C  3  7   ? -2.211  39.920  9.442   1.00 26.58  ? 7    GLU C C     1 
ATOM   6686  O  O     . GLU C  3  7   ? -1.869  39.989  8.266   1.00 23.87  ? 7    GLU C O     1 
ATOM   6687  C  CB    . GLU C  3  7   ? -4.348  41.045  10.115  1.00 28.85  ? 7    GLU C CB    1 
ATOM   6688  C  CG    . GLU C  3  7   ? -5.769  40.947  10.675  1.00 38.04  ? 7    GLU C CG    1 
ATOM   6689  C  CD    . GLU C  3  7   ? -6.356  42.292  11.189  1.00 43.40  ? 7    GLU C CD    1 
ATOM   6690  O  OE1   . GLU C  3  7   ? -5.611  43.150  11.716  1.00 38.94  ? 7    GLU C OE1   1 
ATOM   6691  O  OE2   . GLU C  3  7   ? -7.593  42.475  11.091  1.00 50.18  ? 7    GLU C OE2   1 
ATOM   6692  N  N     . GLU C  3  8   ? -1.328  40.023  10.439  1.00 23.96  ? 8    GLU C N     1 
ATOM   6693  C  CA    . GLU C  3  8   ? 0.092   40.232  10.127  1.00 23.60  ? 8    GLU C CA    1 
ATOM   6694  C  C     . GLU C  3  8   ? 0.645   39.047  9.379   1.00 25.01  ? 8    GLU C C     1 
ATOM   6695  O  O     . GLU C  3  8   ? 1.378   39.221  8.401   1.00 21.93  ? 8    GLU C O     1 
ATOM   6696  C  CB    . GLU C  3  8   ? 0.906   40.474  11.391  1.00 28.33  ? 8    GLU C CB    1 
ATOM   6697  C  CG    . GLU C  3  8   ? 0.796   41.890  11.927  1.00 34.30  ? 8    GLU C CG    1 
ATOM   6698  C  CD    . GLU C  3  8   ? 1.207   41.981  13.405  1.00 43.35  ? 8    GLU C CD    1 
ATOM   6699  O  OE1   . GLU C  3  8   ? 2.078   41.191  13.832  1.00 43.83  ? 8    GLU C OE1   1 
ATOM   6700  O  OE2   . GLU C  3  8   ? 0.677   42.851  14.144  1.00 45.27  ? 8    GLU C OE2   1 
ATOM   6701  N  N     . MET C  3  9   ? 0.307   37.833  9.828   1.00 23.10  ? 9    MET C N     1 
ATOM   6702  C  CA    . MET C  3  9   ? 0.796   36.639  9.136   1.00 24.97  ? 9    MET C CA    1 
ATOM   6703  C  C     . MET C  3  9   ? 0.301   36.627  7.691   1.00 22.26  ? 9    MET C C     1 
ATOM   6704  O  O     . MET C  3  9   ? 1.067   36.388  6.788   1.00 26.29  ? 9    MET C O     1 
ATOM   6705  C  CB    . MET C  3  9   ? 0.351   35.354  9.855   1.00 22.04  ? 9    MET C CB    1 
ATOM   6706  C  CG    . MET C  3  9   ? 1.162   35.016  11.080  1.00 26.49  ? 9    MET C CG    1 
ATOM   6707  S  SD    . MET C  3  9   ? 0.286   33.794  12.127  1.00 36.20  ? 9    MET C SD    1 
ATOM   6708  C  CE    . MET C  3  9   ? 0.848   34.237  13.734  1.00 34.66  ? 9    MET C CE    1 
ATOM   6709  N  N     . ALA C  3  10  ? -0.974  36.918  7.465   1.00 27.17  ? 10   ALA C N     1 
ATOM   6710  C  CA    . ALA C  3  10  ? -1.484  36.925  6.090   1.00 28.83  ? 10   ALA C CA    1 
ATOM   6711  C  C     . ALA C  3  10  ? -0.797  37.980  5.230   1.00 28.27  ? 10   ALA C C     1 
ATOM   6712  O  O     . ALA C  3  10  ? -0.489  37.712  4.061   1.00 27.97  ? 10   ALA C O     1 
ATOM   6713  C  CB    . ALA C  3  10  ? -3.029  37.146  6.067   1.00 28.40  ? 10   ALA C CB    1 
ATOM   6714  N  N     . ARG C  3  11  ? -0.563  39.181  5.761   1.00 30.62  ? 11   ARG C N     1 
ATOM   6715  C  CA    . ARG C  3  11  ? 0.102   40.172  4.911   1.00 33.18  ? 11   ARG C CA    1 
ATOM   6716  C  C     . ARG C  3  11  ? 1.527   39.756  4.665   1.00 30.81  ? 11   ARG C C     1 
ATOM   6717  O  O     . ARG C  3  11  ? 2.049   39.967  3.572   1.00 23.88  ? 11   ARG C O     1 
ATOM   6718  C  CB    . ARG C  3  11  ? 0.039   41.611  5.452   1.00 38.59  ? 11   ARG C CB    1 
ATOM   6719  C  CG    . ARG C  3  11  ? -0.123  41.766  6.927   1.00 52.10  ? 11   ARG C CG    1 
ATOM   6720  C  CD    . ARG C  3  11  ? -0.802  43.108  7.263   1.00 56.31  ? 11   ARG C CD    1 
ATOM   6721  N  NE    . ARG C  3  11  ? -0.241  43.691  8.482   1.00 62.77  ? 11   ARG C NE    1 
ATOM   6722  C  CZ    . ARG C  3  11  ? 1.006   44.161  8.578   1.00 64.55  ? 11   ARG C CZ    1 
ATOM   6723  N  NH1   . ARG C  3  11  ? 1.817   44.121  7.523   1.00 62.58  ? 11   ARG C NH1   1 
ATOM   6724  N  NH2   . ARG C  3  11  ? 1.450   44.656  9.732   1.00 63.83  ? 11   ARG C NH2   1 
ATOM   6725  N  N     . PHE C  3  12  ? 2.149   39.135  5.667   1.00 29.10  ? 12   PHE C N     1 
ATOM   6726  C  CA    . PHE C  3  12  ? 3.516   38.657  5.489   1.00 27.50  ? 12   PHE C CA    1 
ATOM   6727  C  C     . PHE C  3  12  ? 3.586   37.757  4.242   1.00 28.49  ? 12   PHE C C     1 
ATOM   6728  O  O     . PHE C  3  12  ? 4.446   37.961  3.388   1.00 27.82  ? 12   PHE C O     1 
ATOM   6729  C  CB    . PHE C  3  12  ? 3.963   37.849  6.695   1.00 25.56  ? 12   PHE C CB    1 
ATOM   6730  C  CG    . PHE C  3  12  ? 5.248   37.104  6.481   1.00 24.17  ? 12   PHE C CG    1 
ATOM   6731  C  CD1   . PHE C  3  12  ? 6.466   37.747  6.635   1.00 22.15  ? 12   PHE C CD1   1 
ATOM   6732  C  CD2   . PHE C  3  12  ? 5.232   35.750  6.113   1.00 19.55  ? 12   PHE C CD2   1 
ATOM   6733  C  CE1   . PHE C  3  12  ? 7.667   37.064  6.423   1.00 22.51  ? 12   PHE C CE1   1 
ATOM   6734  C  CE2   . PHE C  3  12  ? 6.432   35.041  5.897   1.00 21.97  ? 12   PHE C CE2   1 
ATOM   6735  C  CZ    . PHE C  3  12  ? 7.649   35.702  6.049   1.00 21.38  ? 12   PHE C CZ    1 
ATOM   6736  N  N     . TRP C  3  13  ? 2.694   36.765  4.138   1.00 27.29  ? 13   TRP C N     1 
ATOM   6737  C  CA    . TRP C  3  13  ? 2.735   35.850  2.983   1.00 31.60  ? 13   TRP C CA    1 
ATOM   6738  C  C     . TRP C  3  13  ? 2.310   36.485  1.674   1.00 33.60  ? 13   TRP C C     1 
ATOM   6739  O  O     . TRP C  3  13  ? 2.859   36.172  0.622   1.00 33.51  ? 13   TRP C O     1 
ATOM   6740  C  CB    . TRP C  3  13  ? 1.886   34.587  3.229   1.00 25.36  ? 13   TRP C CB    1 
ATOM   6741  C  CG    . TRP C  3  13  ? 2.466   33.714  4.276   1.00 22.51  ? 13   TRP C CG    1 
ATOM   6742  C  CD1   . TRP C  3  13  ? 2.033   33.580  5.559   1.00 21.32  ? 13   TRP C CD1   1 
ATOM   6743  C  CD2   . TRP C  3  13  ? 3.633   32.883  4.148   1.00 18.94  ? 13   TRP C CD2   1 
ATOM   6744  N  NE1   . TRP C  3  13  ? 2.854   32.710  6.245   1.00 20.83  ? 13   TRP C NE1   1 
ATOM   6745  C  CE2   . TRP C  3  13  ? 3.846   32.270  5.401   1.00 20.99  ? 13   TRP C CE2   1 
ATOM   6746  C  CE3   . TRP C  3  13  ? 4.515   32.602  3.098   1.00 18.92  ? 13   TRP C CE3   1 
ATOM   6747  C  CZ2   . TRP C  3  13  ? 4.916   31.377  5.635   1.00 20.28  ? 13   TRP C CZ2   1 
ATOM   6748  C  CZ3   . TRP C  3  13  ? 5.576   31.715  3.323   1.00 19.96  ? 13   TRP C CZ3   1 
ATOM   6749  C  CH2   . TRP C  3  13  ? 5.762   31.115  4.584   1.00 21.56  ? 13   TRP C CH2   1 
ATOM   6750  N  N     . GLU C  3  14  ? 1.331   37.379  1.734   1.00 35.79  ? 14   GLU C N     1 
ATOM   6751  C  CA    . GLU C  3  14  ? 0.874   38.046  0.524   1.00 35.65  ? 14   GLU C CA    1 
ATOM   6752  C  C     . GLU C  3  14  ? 2.018   38.897  -0.020  1.00 33.98  ? 14   GLU C C     1 
ATOM   6753  O  O     . GLU C  3  14  ? 2.306   38.883  -1.210  1.00 31.23  ? 14   GLU C O     1 
ATOM   6754  C  CB    . GLU C  3  14  ? -0.336  38.911  0.844   1.00 41.55  ? 14   GLU C CB    1 
ATOM   6755  C  CG    . GLU C  3  14  ? -1.172  39.277  -0.348  1.00 49.26  ? 14   GLU C CG    1 
ATOM   6756  C  CD    . GLU C  3  14  ? -0.887  40.672  -0.840  1.00 56.87  ? 14   GLU C CD    1 
ATOM   6757  O  OE1   . GLU C  3  14  ? -0.884  41.604  -0.001  1.00 60.33  ? 14   GLU C OE1   1 
ATOM   6758  O  OE2   . GLU C  3  14  ? -0.677  40.841  -2.064  1.00 63.73  ? 14   GLU C OE2   1 
ATOM   6759  N  N     . LYS C  3  15  ? 2.669   39.630  0.866   1.00 32.59  ? 15   LYS C N     1 
ATOM   6760  C  CA    . LYS C  3  15  ? 3.793   40.474  0.483   1.00 34.45  ? 15   LYS C CA    1 
ATOM   6761  C  C     . LYS C  3  15  ? 4.947   39.668  -0.118  1.00 32.61  ? 15   LYS C C     1 
ATOM   6762  O  O     . LYS C  3  15  ? 5.337   39.891  -1.266  1.00 32.12  ? 15   LYS C O     1 
ATOM   6763  C  CB    . LYS C  3  15  ? 4.301   41.245  1.700   1.00 35.70  ? 15   LYS C CB    1 
ATOM   6764  C  CG    . LYS C  3  15  ? 5.326   42.345  1.413   1.00 41.13  ? 15   LYS C CG    1 
ATOM   6765  C  CD    . LYS C  3  15  ? 5.884   42.998  2.733   1.00 40.57  ? 15   LYS C CD    1 
ATOM   6766  C  CE    . LYS C  3  15  ? 6.945   42.104  3.450   1.00 42.64  ? 15   LYS C CE    1 
ATOM   6767  N  NZ    . LYS C  3  15  ? 7.078   42.328  4.947   1.00 31.22  ? 15   LYS C NZ    1 
ATOM   6768  N  N     . ASN C  3  16  ? 5.477   38.709  0.636   1.00 30.81  ? 16   ASN C N     1 
ATOM   6769  C  CA    . ASN C  3  16  ? 6.615   37.941  0.136   1.00 31.23  ? 16   ASN C CA    1 
ATOM   6770  C  C     . ASN C  3  16  ? 6.395   36.999  -1.050  1.00 33.00  ? 16   ASN C C     1 
ATOM   6771  O  O     . ASN C  3  16  ? 7.228   36.952  -1.968  1.00 29.90  ? 16   ASN C O     1 
ATOM   6772  C  CB    . ASN C  3  16  ? 7.281   37.216  1.288   1.00 24.07  ? 16   ASN C CB    1 
ATOM   6773  C  CG    . ASN C  3  16  ? 7.988   38.187  2.224   1.00 27.52  ? 16   ASN C CG    1 
ATOM   6774  O  OD1   . ASN C  3  16  ? 8.990   38.800  1.848   1.00 24.44  ? 16   ASN C OD1   1 
ATOM   6775  N  ND2   . ASN C  3  16  ? 7.458   38.353  3.434   1.00 20.77  ? 16   ASN C ND2   1 
ATOM   6776  N  N     . THR C  3  17  ? 5.292   36.264  -1.071  1.00 34.06  ? 17   THR C N     1 
ATOM   6777  C  CA    . THR C  3  17  ? 5.075   35.369  -2.206  1.00 36.15  ? 17   THR C CA    1 
ATOM   6778  C  C     . THR C  3  17  ? 4.980   36.160  -3.513  1.00 37.66  ? 17   THR C C     1 
ATOM   6779  O  O     . THR C  3  17  ? 5.318   35.652  -4.577  1.00 39.72  ? 17   THR C O     1 
ATOM   6780  C  CB    . THR C  3  17  ? 3.800   34.538  -2.056  1.00 34.29  ? 17   THR C CB    1 
ATOM   6781  O  OG1   . THR C  3  17  ? 2.674   35.415  -2.048  1.00 35.32  ? 17   THR C OG1   1 
ATOM   6782  C  CG2   . THR C  3  17  ? 3.831   33.707  -0.773  1.00 35.10  ? 17   THR C CG2   1 
ATOM   6783  N  N     . LYS C  3  18  ? 4.539   37.413  -3.450  1.00 40.01  ? 18   LYS C N     1 
ATOM   6784  C  CA    . LYS C  3  18  ? 4.438   38.195  -4.676  1.00 40.10  ? 18   LYS C CA    1 
ATOM   6785  C  C     . LYS C  3  18  ? 5.641   39.131  -4.904  1.00 40.62  ? 18   LYS C C     1 
ATOM   6786  O  O     . LYS C  3  18  ? 5.674   39.908  -5.868  1.00 42.08  ? 18   LYS C O     1 
ATOM   6787  C  CB    . LYS C  3  18  ? 3.121   38.980  -4.681  1.00 44.90  ? 18   LYS C CB    1 
ATOM   6788  C  CG    . LYS C  3  18  ? 3.143   40.270  -3.897  1.00 52.32  ? 18   LYS C CG    1 
ATOM   6789  C  CD    . LYS C  3  18  ? 1.845   41.076  -4.065  1.00 56.63  ? 18   LYS C CD    1 
ATOM   6790  C  CE    . LYS C  3  18  ? 2.002   42.496  -3.479  1.00 58.44  ? 18   LYS C CE    1 
ATOM   6791  N  NZ    . LYS C  3  18  ? 0.743   43.306  -3.509  1.00 59.89  ? 18   LYS C NZ    1 
ATOM   6792  N  N     . SER C  3  19  ? 6.642   39.043  -4.031  1.00 36.68  ? 19   SER C N     1 
ATOM   6793  C  CA    . SER C  3  19  ? 7.845   39.882  -4.145  1.00 32.11  ? 19   SER C CA    1 
ATOM   6794  C  C     . SER C  3  19  ? 8.886   39.166  -4.961  1.00 30.26  ? 19   SER C C     1 
ATOM   6795  O  O     . SER C  3  19  ? 8.704   38.013  -5.336  1.00 26.38  ? 19   SER C O     1 
ATOM   6796  C  CB    . SER C  3  19  ? 8.481   40.124  -2.778  1.00 33.26  ? 19   SER C CB    1 
ATOM   6797  O  OG    . SER C  3  19  ? 9.112   38.925  -2.345  1.00 28.86  ? 19   SER C OG    1 
ATOM   6798  N  N     . SER C  3  20  ? 10.012  39.845  -5.178  1.00 30.10  ? 20   SER C N     1 
ATOM   6799  C  CA    . SER C  3  20  ? 11.106  39.248  -5.906  1.00 30.33  ? 20   SER C CA    1 
ATOM   6800  C  C     . SER C  3  20  ? 12.170  38.814  -4.897  1.00 26.95  ? 20   SER C C     1 
ATOM   6801  O  O     . SER C  3  20  ? 13.286  38.459  -5.272  1.00 28.79  ? 20   SER C O     1 
ATOM   6802  C  CB    . SER C  3  20  ? 11.662  40.245  -6.927  1.00 30.91  ? 20   SER C CB    1 
ATOM   6803  O  OG    . SER C  3  20  ? 11.702  41.541  -6.351  1.00 41.82  ? 20   SER C OG    1 
ATOM   6804  N  N     . ARG C  3  21  ? 11.816  38.807  -3.614  1.00 23.29  ? 21   ARG C N     1 
ATOM   6805  C  CA    . ARG C  3  21  ? 12.778  38.397  -2.596  1.00 18.65  ? 21   ARG C CA    1 
ATOM   6806  C  C     . ARG C  3  21  ? 13.119  36.927  -2.691  1.00 19.12  ? 21   ARG C C     1 
ATOM   6807  O  O     . ARG C  3  21  ? 12.254  36.062  -2.819  1.00 16.70  ? 21   ARG C O     1 
ATOM   6808  C  CB    . ARG C  3  21  ? 12.251  38.688  -1.179  1.00 15.29  ? 21   ARG C CB    1 
ATOM   6809  C  CG    . ARG C  3  21  ? 12.049  40.194  -0.912  1.00 10.83  ? 21   ARG C CG    1 
ATOM   6810  C  CD    . ARG C  3  21  ? 11.474  40.369  0.493   1.00 20.65  ? 21   ARG C CD    1 
ATOM   6811  N  NE    . ARG C  3  21  ? 11.385  41.769  0.920   1.00 21.34  ? 21   ARG C NE    1 
ATOM   6812  C  CZ    . ARG C  3  21  ? 10.751  42.160  2.017   1.00 23.12  ? 21   ARG C CZ    1 
ATOM   6813  N  NH1   . ARG C  3  21  ? 10.147  41.256  2.795   1.00 21.27  ? 21   ARG C NH1   1 
ATOM   6814  N  NH2   . ARG C  3  21  ? 10.723  43.445  2.347   1.00 17.97  ? 21   ARG C NH2   1 
ATOM   6815  N  N     . PRO C  3  22  ? 14.401  36.613  -2.640  1.00 17.70  ? 22   PRO C N     1 
ATOM   6816  C  CA    . PRO C  3  22  ? 14.755  35.194  -2.707  1.00 19.11  ? 22   PRO C CA    1 
ATOM   6817  C  C     . PRO C  3  22  ? 14.636  34.547  -1.310  1.00 20.32  ? 22   PRO C C     1 
ATOM   6818  O  O     . PRO C  3  22  ? 14.580  35.250  -0.305  1.00 17.40  ? 22   PRO C O     1 
ATOM   6819  C  CB    . PRO C  3  22  ? 16.202  35.228  -3.156  1.00 22.11  ? 22   PRO C CB    1 
ATOM   6820  C  CG    . PRO C  3  22  ? 16.715  36.510  -2.480  1.00 22.31  ? 22   PRO C CG    1 
ATOM   6821  C  CD    . PRO C  3  22  ? 15.579  37.483  -2.728  1.00 16.99  ? 22   PRO C CD    1 
ATOM   6822  N  N     . LEU C  3  23  ? 14.594  33.214  -1.275  1.00 16.26  ? 23   LEU C N     1 
ATOM   6823  C  CA    . LEU C  3  23  ? 14.554  32.474  -0.029  1.00 23.13  ? 23   LEU C CA    1 
ATOM   6824  C  C     . LEU C  3  23  ? 16.044  32.163  0.257   1.00 22.73  ? 23   LEU C C     1 
ATOM   6825  O  O     . LEU C  3  23  ? 16.772  31.730  -0.633  1.00 22.60  ? 23   LEU C O     1 
ATOM   6826  C  CB    . LEU C  3  23  ? 13.736  31.185  -0.209  1.00 27.64  ? 23   LEU C CB    1 
ATOM   6827  C  CG    . LEU C  3  23  ? 13.360  30.462  1.093   1.00 32.86  ? 23   LEU C CG    1 
ATOM   6828  C  CD1   . LEU C  3  23  ? 12.375  31.312  1.899   1.00 29.23  ? 23   LEU C CD1   1 
ATOM   6829  C  CD2   . LEU C  3  23  ? 12.770  29.100  0.766   1.00 36.79  ? 23   LEU C CD2   1 
ATOM   6830  N  N     . SER C  3  24  ? 16.500  32.434  1.476   1.00 22.47  ? 24   SER C N     1 
ATOM   6831  C  CA    . SER C  3  24  ? 17.892  32.207  1.804   1.00 21.15  ? 24   SER C CA    1 
ATOM   6832  C  C     . SER C  3  24  ? 18.129  30.712  1.859   1.00 21.01  ? 24   SER C C     1 
ATOM   6833  O  O     . SER C  3  24  ? 17.241  29.941  2.220   1.00 19.67  ? 24   SER C O     1 
ATOM   6834  C  CB    . SER C  3  24  ? 18.245  32.862  3.140   1.00 21.37  ? 24   SER C CB    1 
ATOM   6835  O  OG    . SER C  3  24  ? 17.422  32.383  4.182   1.00 25.39  ? 24   SER C OG    1 
ATOM   6836  N  N     . PRO C  3  25  ? 19.329  30.278  1.461   1.00 19.73  ? 25   PRO C N     1 
ATOM   6837  C  CA    . PRO C  3  25  ? 19.656  28.851  1.466   1.00 21.36  ? 25   PRO C CA    1 
ATOM   6838  C  C     . PRO C  3  25  ? 19.538  28.243  2.849   1.00 21.45  ? 25   PRO C C     1 
ATOM   6839  O  O     . PRO C  3  25  ? 19.693  28.934  3.855   1.00 21.78  ? 25   PRO C O     1 
ATOM   6840  C  CB    . PRO C  3  25  ? 21.081  28.815  0.894   1.00 19.40  ? 25   PRO C CB    1 
ATOM   6841  C  CG    . PRO C  3  25  ? 21.613  30.214  1.170   1.00 18.99  ? 25   PRO C CG    1 
ATOM   6842  C  CD    . PRO C  3  25  ? 20.417  31.073  0.882   1.00 18.71  ? 25   PRO C CD    1 
ATOM   6843  N  N     . HIS C  3  26  ? 19.253  26.950  2.906   1.00 19.31  ? 26   HIS C N     1 
ATOM   6844  C  CA    . HIS C  3  26  ? 19.093  26.291  4.194   1.00 22.99  ? 26   HIS C CA    1 
ATOM   6845  C  C     . HIS C  3  26  ? 19.802  24.940  4.203   1.00 26.26  ? 26   HIS C C     1 
ATOM   6846  O  O     . HIS C  3  26  ? 20.904  24.774  4.786   1.00 28.45  ? 26   HIS C O     1 
ATOM   6847  C  CB    . HIS C  3  26  ? 17.596  26.114  4.481   1.00 19.98  ? 26   HIS C CB    1 
ATOM   6848  C  CG    . HIS C  3  26  ? 16.806  25.689  3.281   1.00 27.33  ? 26   HIS C CG    1 
ATOM   6849  N  ND1   . HIS C  3  26  ? 16.349  26.586  2.333   1.00 27.10  ? 26   HIS C ND1   1 
ATOM   6850  C  CD2   . HIS C  3  26  ? 16.438  24.457  2.843   1.00 24.22  ? 26   HIS C CD2   1 
ATOM   6851  C  CE1   . HIS C  3  26  ? 15.733  25.925  1.363   1.00 24.25  ? 26   HIS C CE1   1 
ATOM   6852  N  NE2   . HIS C  3  26  ? 15.773  24.634  1.649   1.00 25.28  ? 26   HIS C NE2   1 
ATOM   6853  N  N     . ILE C  3  27  ? 19.164  23.977  3.543   1.00 25.35  ? 27   ILE C N     1 
ATOM   6854  C  CA    . ILE C  3  27  ? 19.684  22.625  3.447   1.00 29.92  ? 27   ILE C CA    1 
ATOM   6855  C  C     . ILE C  3  27  ? 21.104  22.560  2.848   1.00 27.32  ? 27   ILE C C     1 
ATOM   6856  O  O     . ILE C  3  27  ? 21.945  21.796  3.316   1.00 27.30  ? 27   ILE C O     1 
ATOM   6857  C  CB    . ILE C  3  27  ? 18.687  21.781  2.630   1.00 34.36  ? 27   ILE C CB    1 
ATOM   6858  C  CG1   . ILE C  3  27  ? 18.876  20.312  2.920   1.00 38.62  ? 27   ILE C CG1   1 
ATOM   6859  C  CG2   . ILE C  3  27  ? 18.841  22.071  1.142   1.00 38.07  ? 27   ILE C CG2   1 
ATOM   6860  C  CD1   . ILE C  3  27  ? 17.871  19.469  2.173   1.00 48.82  ? 27   ILE C CD1   1 
ATOM   6861  N  N     . SER C  3  28  ? 21.389  23.392  1.852   1.00 26.90  ? 28   SER C N     1 
ATOM   6862  C  CA    . SER C  3  28  ? 22.698  23.379  1.217   1.00 27.30  ? 28   SER C CA    1 
ATOM   6863  C  C     . SER C  3  28  ? 23.819  24.063  1.956   1.00 26.97  ? 28   SER C C     1 
ATOM   6864  O  O     . SER C  3  28  ? 24.961  23.938  1.547   1.00 27.15  ? 28   SER C O     1 
ATOM   6865  C  CB    . SER C  3  28  ? 22.629  23.964  -0.193  1.00 28.88  ? 28   SER C CB    1 
ATOM   6866  O  OG    . SER C  3  28  ? 22.340  25.352  -0.214  1.00 35.11  ? 28   SER C OG    1 
ATOM   6867  N  N     . ILE C  3  29  ? 23.517  24.799  3.023   1.00 28.31  ? 29   ILE C N     1 
ATOM   6868  C  CA    . ILE C  3  29  ? 24.577  25.471  3.761   1.00 27.41  ? 29   ILE C CA    1 
ATOM   6869  C  C     . ILE C  3  29  ? 24.606  25.171  5.259   1.00 26.66  ? 29   ILE C C     1 
ATOM   6870  O  O     . ILE C  3  29  ? 25.565  25.523  5.917   1.00 29.09  ? 29   ILE C O     1 
ATOM   6871  C  CB    . ILE C  3  29  ? 24.535  27.027  3.544   1.00 29.39  ? 29   ILE C CB    1 
ATOM   6872  C  CG1   . ILE C  3  29  ? 23.199  27.612  4.002   1.00 31.56  ? 29   ILE C CG1   1 
ATOM   6873  C  CG2   . ILE C  3  29  ? 24.666  27.352  2.071   1.00 29.08  ? 29   ILE C CG2   1 
ATOM   6874  C  CD1   . ILE C  3  29  ? 23.100  27.843  5.471   1.00 20.37  ? 29   ILE C CD1   1 
ATOM   6875  N  N     . TYR C  3  30  ? 23.583  24.524  5.808   1.00 26.05  ? 30   TYR C N     1 
ATOM   6876  C  CA    . TYR C  3  30  ? 23.607  24.263  7.250   1.00 28.02  ? 30   TYR C CA    1 
ATOM   6877  C  C     . TYR C  3  30  ? 24.593  23.163  7.602   1.00 31.59  ? 30   TYR C C     1 
ATOM   6878  O  O     . TYR C  3  30  ? 24.660  22.145  6.926   1.00 30.32  ? 30   TYR C O     1 
ATOM   6879  C  CB    . TYR C  3  30  ? 22.224  23.871  7.789   1.00 26.79  ? 30   TYR C CB    1 
ATOM   6880  C  CG    . TYR C  3  30  ? 22.017  24.342  9.209   1.00 25.05  ? 30   TYR C CG    1 
ATOM   6881  C  CD1   . TYR C  3  30  ? 21.691  25.668  9.470   1.00 27.92  ? 30   TYR C CD1   1 
ATOM   6882  C  CD2   . TYR C  3  30  ? 22.296  23.512  10.297  1.00 26.27  ? 30   TYR C CD2   1 
ATOM   6883  C  CE1   . TYR C  3  30  ? 21.658  26.183  10.789  1.00 25.57  ? 30   TYR C CE1   1 
ATOM   6884  C  CE2   . TYR C  3  30  ? 22.281  24.010  11.619  1.00 27.24  ? 30   TYR C CE2   1 
ATOM   6885  C  CZ    . TYR C  3  30  ? 21.967  25.354  11.847  1.00 30.63  ? 30   TYR C CZ    1 
ATOM   6886  O  OH    . TYR C  3  30  ? 22.050  25.925  13.102  1.00 28.19  ? 30   TYR C OH    1 
ATOM   6887  N  N     . LYS C  3  31  ? 25.356  23.368  8.671   1.00 31.99  ? 31   LYS C N     1 
ATOM   6888  C  CA    . LYS C  3  31  ? 26.331  22.391  9.105   1.00 31.96  ? 31   LYS C CA    1 
ATOM   6889  C  C     . LYS C  3  31  ? 25.631  21.191  9.741   1.00 34.25  ? 31   LYS C C     1 
ATOM   6890  O  O     . LYS C  3  31  ? 24.714  21.360  10.548  1.00 30.76  ? 31   LYS C O     1 
ATOM   6891  C  CB    . LYS C  3  31  ? 27.260  23.025  10.127  1.00 34.33  ? 31   LYS C CB    1 
ATOM   6892  C  CG    . LYS C  3  31  ? 28.365  22.124  10.588  1.00 40.64  ? 31   LYS C CG    1 
ATOM   6893  C  CD    . LYS C  3  31  ? 29.260  22.846  11.598  1.00 47.53  ? 31   LYS C CD    1 
ATOM   6894  C  CE    . LYS C  3  31  ? 30.669  22.237  11.648  1.00 48.65  ? 31   LYS C CE    1 
ATOM   6895  N  NZ    . LYS C  3  31  ? 30.687  20.790  12.017  1.00 52.39  ? 31   LYS C NZ    1 
ATOM   6896  N  N     . TRP C  3  32  ? 26.079  19.983  9.411   1.00 31.86  ? 32   TRP C N     1 
ATOM   6897  C  CA    . TRP C  3  32  ? 25.476  18.772  9.966   1.00 35.05  ? 32   TRP C CA    1 
ATOM   6898  C  C     . TRP C  3  32  ? 25.999  18.419  11.344  1.00 32.05  ? 32   TRP C C     1 
ATOM   6899  O  O     . TRP C  3  32  ? 27.041  18.896  11.776  1.00 31.96  ? 32   TRP C O     1 
ATOM   6900  C  CB    . TRP C  3  32  ? 25.730  17.581  9.043   1.00 40.88  ? 32   TRP C CB    1 
ATOM   6901  C  CG    . TRP C  3  32  ? 24.881  17.609  7.859   1.00 48.41  ? 32   TRP C CG    1 
ATOM   6902  C  CD1   . TRP C  3  32  ? 25.103  18.304  6.704   1.00 52.01  ? 32   TRP C CD1   1 
ATOM   6903  C  CD2   . TRP C  3  32  ? 23.582  17.024  7.738   1.00 52.83  ? 32   TRP C CD2   1 
ATOM   6904  N  NE1   . TRP C  3  32  ? 24.012  18.198  5.876   1.00 54.85  ? 32   TRP C NE1   1 
ATOM   6905  C  CE2   . TRP C  3  32  ? 23.063  17.418  6.486   1.00 52.97  ? 32   TRP C CE2   1 
ATOM   6906  C  CE3   . TRP C  3  32  ? 22.802  16.209  8.572   1.00 52.07  ? 32   TRP C CE3   1 
ATOM   6907  C  CZ2   . TRP C  3  32  ? 21.796  17.027  6.046   1.00 53.78  ? 32   TRP C CZ2   1 
ATOM   6908  C  CZ3   . TRP C  3  32  ? 21.542  15.821  8.137   1.00 53.47  ? 32   TRP C CZ3   1 
ATOM   6909  C  CH2   . TRP C  3  32  ? 21.052  16.232  6.882   1.00 54.39  ? 32   TRP C CH2   1 
ATOM   6910  N  N     . SER C  3  33  ? 25.246  17.597  12.046  1.00 31.88  ? 33   SER C N     1 
ATOM   6911  C  CA    . SER C  3  33  ? 25.655  17.120  13.360  1.00 33.10  ? 33   SER C CA    1 
ATOM   6912  C  C     . SER C  3  33  ? 25.135  15.682  13.448  1.00 31.27  ? 33   SER C C     1 
ATOM   6913  O  O     . SER C  3  33  ? 24.253  15.300  12.693  1.00 34.07  ? 33   SER C O     1 
ATOM   6914  C  CB    . SER C  3  33  ? 25.050  17.987  14.469  1.00 31.78  ? 33   SER C CB    1 
ATOM   6915  O  OG    . SER C  3  33  ? 23.654  17.781  14.581  1.00 33.31  ? 33   SER C OG    1 
ATOM   6916  N  N     . LEU C  3  34  ? 25.692  14.882  14.348  1.00 33.84  ? 34   LEU C N     1 
ATOM   6917  C  CA    . LEU C  3  34  ? 25.254  13.501  14.503  1.00 32.61  ? 34   LEU C CA    1 
ATOM   6918  C  C     . LEU C  3  34  ? 23.781  13.447  14.893  1.00 29.81  ? 34   LEU C C     1 
ATOM   6919  O  O     . LEU C  3  34  ? 23.022  12.637  14.381  1.00 31.80  ? 34   LEU C O     1 
ATOM   6920  C  CB    . LEU C  3  34  ? 26.100  12.804  15.563  1.00 36.71  ? 34   LEU C CB    1 
ATOM   6921  C  CG    . LEU C  3  34  ? 25.929  11.279  15.628  1.00 41.77  ? 34   LEU C CG    1 
ATOM   6922  C  CD1   . LEU C  3  34  ? 26.209  10.710  14.244  1.00 41.98  ? 34   LEU C CD1   1 
ATOM   6923  C  CD2   . LEU C  3  34  ? 26.878  10.663  16.661  1.00 39.73  ? 34   LEU C CD2   1 
ATOM   6924  N  N     . PRO C  3  35  ? 23.355  14.309  15.812  1.00 26.96  ? 35   PRO C N     1 
ATOM   6925  C  CA    . PRO C  3  35  ? 21.939  14.238  16.173  1.00 25.62  ? 35   PRO C CA    1 
ATOM   6926  C  C     . PRO C  3  35  ? 21.018  14.543  15.002  1.00 26.68  ? 35   PRO C C     1 
ATOM   6927  O  O     . PRO C  3  35  ? 19.975  13.918  14.850  1.00 27.29  ? 35   PRO C O     1 
ATOM   6928  C  CB    . PRO C  3  35  ? 21.828  15.249  17.300  1.00 26.21  ? 35   PRO C CB    1 
ATOM   6929  C  CG    . PRO C  3  35  ? 23.142  15.073  18.008  1.00 27.90  ? 35   PRO C CG    1 
ATOM   6930  C  CD    . PRO C  3  35  ? 24.115  15.068  16.818  1.00 26.30  ? 35   PRO C CD    1 
ATOM   6931  N  N     . MET C  3  36  ? 21.398  15.498  14.161  1.00 28.87  ? 36   MET C N     1 
ATOM   6932  C  CA    . MET C  3  36  ? 20.576  15.829  13.007  1.00 28.85  ? 36   MET C CA    1 
ATOM   6933  C  C     . MET C  3  36  ? 20.548  14.653  12.027  1.00 26.25  ? 36   MET C C     1 
ATOM   6934  O  O     . MET C  3  36  ? 19.493  14.329  11.480  1.00 29.03  ? 36   MET C O     1 
ATOM   6935  C  CB    . MET C  3  36  ? 21.111  17.084  12.306  1.00 29.56  ? 36   MET C CB    1 
ATOM   6936  C  CG    . MET C  3  36  ? 20.147  17.717  11.287  1.00 33.71  ? 36   MET C CG    1 
ATOM   6937  S  SD    . MET C  3  36  ? 20.892  19.214  10.561  1.00 41.94  ? 36   MET C SD    1 
ATOM   6938  C  CE    . MET C  3  36  ? 19.515  19.973  9.697   1.00 41.27  ? 36   MET C CE    1 
ATOM   6939  N  N     . ALA C  3  37  ? 21.699  14.022  11.795  1.00 26.14  ? 37   ALA C N     1 
ATOM   6940  C  CA    . ALA C  3  37  ? 21.772  12.877  10.880  1.00 27.09  ? 37   ALA C CA    1 
ATOM   6941  C  C     . ALA C  3  37  ? 20.987  11.683  11.404  1.00 26.50  ? 37   ALA C C     1 
ATOM   6942  O  O     . ALA C  3  37  ? 20.303  10.988  10.649  1.00 25.73  ? 37   ALA C O     1 
ATOM   6943  C  CB    . ALA C  3  37  ? 23.248  12.471  10.609  1.00 28.37  ? 37   ALA C CB    1 
ATOM   6944  N  N     . MET C  3  38  ? 21.066  11.446  12.703  1.00 27.36  ? 38   MET C N     1 
ATOM   6945  C  CA    . MET C  3  38  ? 20.335  10.327  13.279  1.00 27.36  ? 38   MET C CA    1 
ATOM   6946  C  C     . MET C  3  38  ? 18.836  10.543  13.157  1.00 28.91  ? 38   MET C C     1 
ATOM   6947  O  O     . MET C  3  38  ? 18.061  9.590   13.006  1.00 27.94  ? 38   MET C O     1 
ATOM   6948  C  CB    . MET C  3  38  ? 20.756  10.136  14.743  1.00 21.49  ? 38   MET C CB    1 
ATOM   6949  C  CG    . MET C  3  38  ? 22.156  9.512   14.805  1.00 29.19  ? 38   MET C CG    1 
ATOM   6950  S  SD    . MET C  3  38  ? 22.783  9.074   16.447  1.00 30.97  ? 38   MET C SD    1 
ATOM   6951  C  CE    . MET C  3  38  ? 21.474  8.050   17.103  1.00 27.12  ? 38   MET C CE    1 
ATOM   6952  N  N     . SER C  3  39  ? 18.438  11.809  13.206  1.00 28.44  ? 39   SER C N     1 
ATOM   6953  C  CA    . SER C  3  39  ? 17.040  12.194  13.107  1.00 27.06  ? 39   SER C CA    1 
ATOM   6954  C  C     . SER C  3  39  ? 16.518  11.827  11.716  1.00 25.61  ? 39   SER C C     1 
ATOM   6955  O  O     . SER C  3  39  ? 15.453  11.234  11.592  1.00 23.55  ? 39   SER C O     1 
ATOM   6956  C  CB    . SER C  3  39  ? 16.919  13.708  13.341  1.00 30.15  ? 39   SER C CB    1 
ATOM   6957  O  OG    . SER C  3  39  ? 15.574  14.118  13.397  1.00 35.41  ? 39   SER C OG    1 
ATOM   6958  N  N     . ILE C  3  40  ? 17.253  12.180  10.665  1.00 25.58  ? 40   ILE C N     1 
ATOM   6959  C  CA    . ILE C  3  40  ? 16.781  11.831  9.337   1.00 32.22  ? 40   ILE C CA    1 
ATOM   6960  C  C     . ILE C  3  40  ? 16.788  10.310  9.176   1.00 27.01  ? 40   ILE C C     1 
ATOM   6961  O  O     . ILE C  3  40  ? 15.900  9.742   8.544   1.00 28.03  ? 40   ILE C O     1 
ATOM   6962  C  CB    . ILE C  3  40  ? 17.649  12.454  8.206   1.00 39.42  ? 40   ILE C CB    1 
ATOM   6963  C  CG1   . ILE C  3  40  ? 19.075  11.922  8.312   1.00 46.29  ? 40   ILE C CG1   1 
ATOM   6964  C  CG2   . ILE C  3  40  ? 17.633  13.976  8.295   1.00 40.86  ? 40   ILE C CG2   1 
ATOM   6965  C  CD1   . ILE C  3  40  ? 20.067  12.569  7.370   1.00 54.56  ? 40   ILE C CD1   1 
ATOM   6966  N  N     . THR C  3  41  ? 17.784  9.666   9.761   1.00 22.12  ? 41   THR C N     1 
ATOM   6967  C  CA    . THR C  3  41  ? 17.924  8.224   9.689   1.00 25.51  ? 41   THR C CA    1 
ATOM   6968  C  C     . THR C  3  41  ? 16.807  7.499   10.396  1.00 26.85  ? 41   THR C C     1 
ATOM   6969  O  O     . THR C  3  41  ? 16.377  6.445   9.949   1.00 29.56  ? 41   THR C O     1 
ATOM   6970  C  CB    . THR C  3  41  ? 19.261  7.757   10.276  1.00 28.07  ? 41   THR C CB    1 
ATOM   6971  O  OG1   . THR C  3  41  ? 20.336  8.375   9.551   1.00 31.29  ? 41   THR C OG1   1 
ATOM   6972  C  CG2   . THR C  3  41  ? 19.391  6.252   10.122  1.00 25.88  ? 41   THR C CG2   1 
ATOM   6973  N  N     . HIS C  3  42  ? 16.330  8.051   11.503  1.00 25.39  ? 42   HIS C N     1 
ATOM   6974  C  CA    . HIS C  3  42  ? 15.227  7.413   12.196  1.00 29.54  ? 42   HIS C CA    1 
ATOM   6975  C  C     . HIS C  3  42  ? 13.979  7.440   11.309  1.00 31.13  ? 42   HIS C C     1 
ATOM   6976  O  O     . HIS C  3  42  ? 13.180  6.498   11.311  1.00 28.07  ? 42   HIS C O     1 
ATOM   6977  C  CB    . HIS C  3  42  ? 14.928  8.121   13.508  1.00 29.56  ? 42   HIS C CB    1 
ATOM   6978  C  CG    . HIS C  3  42  ? 13.992  7.362   14.388  1.00 28.64  ? 42   HIS C CG    1 
ATOM   6979  N  ND1   . HIS C  3  42  ? 12.651  7.657   14.481  1.00 32.56  ? 42   HIS C ND1   1 
ATOM   6980  C  CD2   . HIS C  3  42  ? 14.199  6.285   15.180  1.00 31.74  ? 42   HIS C CD2   1 
ATOM   6981  C  CE1   . HIS C  3  42  ? 12.069  6.790   15.291  1.00 30.26  ? 42   HIS C CE1   1 
ATOM   6982  N  NE2   . HIS C  3  42  ? 12.987  5.948   15.729  1.00 33.93  ? 42   HIS C NE2   1 
ATOM   6983  N  N     . ARG C  3  43  ? 13.813  8.536   10.561  1.00 31.76  ? 43   ARG C N     1 
ATOM   6984  C  CA    . ARG C  3  43  ? 12.677  8.673   9.672   1.00 28.89  ? 43   ARG C CA    1 
ATOM   6985  C  C     . ARG C  3  43  ? 12.886  7.724   8.493   1.00 29.57  ? 43   ARG C C     1 
ATOM   6986  O  O     . ARG C  3  43  ? 11.963  7.046   8.084   1.00 29.10  ? 43   ARG C O     1 
ATOM   6987  C  CB    . ARG C  3  43  ? 12.557  10.123  9.184   1.00 30.85  ? 43   ARG C CB    1 
ATOM   6988  C  CG    . ARG C  3  43  ? 11.527  10.363  8.054   1.00 24.75  ? 43   ARG C CG    1 
ATOM   6989  C  CD    . ARG C  3  43  ? 11.017  11.820  8.050   1.00 23.59  ? 43   ARG C CD    1 
ATOM   6990  N  NE    . ARG C  3  43  ? 10.049  12.034  9.135   1.00 30.08  ? 43   ARG C NE    1 
ATOM   6991  C  CZ    . ARG C  3  43  ? 9.324   13.135  9.304   1.00 25.58  ? 43   ARG C CZ    1 
ATOM   6992  N  NH1   . ARG C  3  43  ? 9.455   14.155  8.465   1.00 27.71  ? 43   ARG C NH1   1 
ATOM   6993  N  NH2   . ARG C  3  43  ? 8.439   13.195  10.291  1.00 22.50  ? 43   ARG C NH2   1 
ATOM   6994  N  N     . GLY C  3  44  ? 14.107  7.689   7.959   1.00 28.76  ? 44   GLY C N     1 
ATOM   6995  C  CA    . GLY C  3  44  ? 14.408  6.822   6.841   1.00 28.03  ? 44   GLY C CA    1 
ATOM   6996  C  C     . GLY C  3  44  ? 14.170  5.348   7.175   1.00 30.08  ? 44   GLY C C     1 
ATOM   6997  O  O     . GLY C  3  44  ? 13.588  4.618   6.377   1.00 27.42  ? 44   GLY C O     1 
ATOM   6998  N  N     . THR C  3  45  ? 14.601  4.897   8.348   1.00 29.03  ? 45   THR C N     1 
ATOM   6999  C  CA    . THR C  3  45  ? 14.399  3.496   8.695   1.00 28.15  ? 45   THR C CA    1 
ATOM   7000  C  C     . THR C  3  45  ? 12.925  3.210   8.920   1.00 30.30  ? 45   THR C C     1 
ATOM   7001  O  O     . THR C  3  45  ? 12.433  2.169   8.500   1.00 30.92  ? 45   THR C O     1 
ATOM   7002  C  CB    . THR C  3  45  ? 15.215  3.074   9.938   1.00 28.73  ? 45   THR C CB    1 
ATOM   7003  O  OG1   . THR C  3  45  ? 14.901  3.921   11.054  1.00 31.83  ? 45   THR C OG1   1 
ATOM   7004  C  CG2   . THR C  3  45  ? 16.701  3.139   9.626   1.00 23.39  ? 45   THR C CG2   1 
ATOM   7005  N  N     . GLY C  3  46  ? 12.206  4.136   9.555   1.00 28.25  ? 46   GLY C N     1 
ATOM   7006  C  CA    . GLY C  3  46  ? 10.780  3.923   9.764   1.00 27.13  ? 46   GLY C CA    1 
ATOM   7007  C  C     . GLY C  3  46  ? 10.008  3.738   8.458   1.00 31.09  ? 46   GLY C C     1 
ATOM   7008  O  O     . GLY C  3  46  ? 9.137   2.870   8.339   1.00 31.12  ? 46   GLY C O     1 
ATOM   7009  N  N     . VAL C  3  47  ? 10.320  4.566   7.469   1.00 29.11  ? 47   VAL C N     1 
ATOM   7010  C  CA    . VAL C  3  47  ? 9.645   4.475   6.187   1.00 31.27  ? 47   VAL C CA    1 
ATOM   7011  C  C     . VAL C  3  47  ? 10.057  3.180   5.489   1.00 34.23  ? 47   VAL C C     1 
ATOM   7012  O  O     . VAL C  3  47  ? 9.241   2.509   4.870   1.00 37.43  ? 47   VAL C O     1 
ATOM   7013  C  CB    . VAL C  3  47  ? 10.012  5.675   5.279   1.00 29.14  ? 47   VAL C CB    1 
ATOM   7014  C  CG1   . VAL C  3  47  ? 9.435   5.480   3.896   1.00 26.17  ? 47   VAL C CG1   1 
ATOM   7015  C  CG2   . VAL C  3  47  ? 9.488   6.982   5.892   1.00 28.93  ? 47   VAL C CG2   1 
ATOM   7016  N  N     . ALA C  3  48  ? 11.329  2.825   5.584   1.00 33.53  ? 48   ALA C N     1 
ATOM   7017  C  CA    . ALA C  3  48  ? 11.785  1.612   4.936   1.00 32.98  ? 48   ALA C CA    1 
ATOM   7018  C  C     . ALA C  3  48  ? 11.085  0.408   5.566   1.00 33.58  ? 48   ALA C C     1 
ATOM   7019  O  O     . ALA C  3  48  ? 10.635  -0.506  4.865   1.00 30.04  ? 48   ALA C O     1 
ATOM   7020  C  CB    . ALA C  3  48  ? 13.304  1.476   5.077   1.00 31.83  ? 48   ALA C CB    1 
ATOM   7021  N  N     . LEU C  3  49  ? 10.998  0.416   6.894   1.00 33.31  ? 49   LEU C N     1 
ATOM   7022  C  CA    . LEU C  3  49  ? 10.375  -0.681  7.596   1.00 34.33  ? 49   LEU C CA    1 
ATOM   7023  C  C     . LEU C  3  49  ? 8.928   -0.795  7.188   1.00 34.02  ? 49   LEU C C     1 
ATOM   7024  O  O     . LEU C  3  49  ? 8.404   -1.893  7.034   1.00 35.24  ? 49   LEU C O     1 
ATOM   7025  C  CB    . LEU C  3  49  ? 10.473  -0.491  9.107   1.00 31.79  ? 49   LEU C CB    1 
ATOM   7026  C  CG    . LEU C  3  49  ? 11.853  -0.685  9.751   1.00 38.02  ? 49   LEU C CG    1 
ATOM   7027  C  CD1   . LEU C  3  49  ? 11.775  -0.264  11.216  1.00 32.28  ? 49   LEU C CD1   1 
ATOM   7028  C  CD2   . LEU C  3  49  ? 12.316  -2.158  9.632   1.00 34.71  ? 49   LEU C CD2   1 
ATOM   7029  N  N     . SER C  3  50  ? 8.288   0.344   7.005   1.00 32.98  ? 50   SER C N     1 
ATOM   7030  C  CA    . SER C  3  50  ? 6.886   0.354   6.643   1.00 34.65  ? 50   SER C CA    1 
ATOM   7031  C  C     . SER C  3  50  ? 6.644   -0.163  5.252   1.00 35.57  ? 50   SER C C     1 
ATOM   7032  O  O     . SER C  3  50  ? 5.687   -0.910  5.031   1.00 34.81  ? 50   SER C O     1 
ATOM   7033  C  CB    . SER C  3  50  ? 6.312   1.760   6.781   1.00 33.29  ? 50   SER C CB    1 
ATOM   7034  O  OG    . SER C  3  50  ? 5.739   1.917   8.064   1.00 28.49  ? 50   SER C OG    1 
ATOM   7035  N  N     . LEU C  3  51  ? 7.505   0.233   4.320   1.00 34.63  ? 51   LEU C N     1 
ATOM   7036  C  CA    . LEU C  3  51  ? 7.362   -0.203  2.939   1.00 40.48  ? 51   LEU C CA    1 
ATOM   7037  C  C     . LEU C  3  51  ? 7.659   -1.696  2.884   1.00 41.83  ? 51   LEU C C     1 
ATOM   7038  O  O     . LEU C  3  51  ? 7.140   -2.403  2.030   1.00 42.23  ? 51   LEU C O     1 
ATOM   7039  C  CB    . LEU C  3  51  ? 8.326   0.568   2.034   1.00 43.12  ? 51   LEU C CB    1 
ATOM   7040  C  CG    . LEU C  3  51  ? 8.133   2.083   2.158   1.00 50.06  ? 51   LEU C CG    1 
ATOM   7041  C  CD1   . LEU C  3  51  ? 9.274   2.829   1.463   1.00 51.67  ? 51   LEU C CD1   1 
ATOM   7042  C  CD2   . LEU C  3  51  ? 6.761   2.469   1.587   1.00 49.68  ? 51   LEU C CD2   1 
ATOM   7043  N  N     . GLY C  3  52  ? 8.485   -2.159  3.820   1.00 42.47  ? 52   GLY C N     1 
ATOM   7044  C  CA    . GLY C  3  52  ? 8.834   -3.565  3.887   1.00 40.56  ? 52   GLY C CA    1 
ATOM   7045  C  C     . GLY C  3  52  ? 7.622   -4.379  4.285   1.00 39.48  ? 52   GLY C C     1 
ATOM   7046  O  O     . GLY C  3  52  ? 7.280   -5.370  3.634   1.00 39.72  ? 52   GLY C O     1 
ATOM   7047  N  N     . VAL C  3  53  ? 6.966   -3.958  5.357   1.00 37.19  ? 53   VAL C N     1 
ATOM   7048  C  CA    . VAL C  3  53  ? 5.778   -4.642  5.829   1.00 36.05  ? 53   VAL C CA    1 
ATOM   7049  C  C     . VAL C  3  53  ? 4.675   -4.619  4.770   1.00 37.04  ? 53   VAL C C     1 
ATOM   7050  O  O     . VAL C  3  53  ? 3.976   -5.617  4.584   1.00 32.41  ? 53   VAL C O     1 
ATOM   7051  C  CB    . VAL C  3  53  ? 5.257   -3.999  7.122   1.00 35.96  ? 53   VAL C CB    1 
ATOM   7052  C  CG1   . VAL C  3  53  ? 3.876   -4.532  7.462   1.00 30.94  ? 53   VAL C CG1   1 
ATOM   7053  C  CG2   . VAL C  3  53  ? 6.241   -4.275  8.254   1.00 32.83  ? 53   VAL C CG2   1 
ATOM   7054  N  N     . SER C  3  54  ? 4.519   -3.492  4.077   1.00 33.52  ? 54   SER C N     1 
ATOM   7055  C  CA    . SER C  3  54  ? 3.490   -3.405  3.047   1.00 38.17  ? 54   SER C CA    1 
ATOM   7056  C  C     . SER C  3  54  ? 3.781   -4.354  1.882   1.00 36.93  ? 54   SER C C     1 
ATOM   7057  O  O     . SER C  3  54  ? 2.879   -5.034  1.410   1.00 36.51  ? 54   SER C O     1 
ATOM   7058  C  CB    . SER C  3  54  ? 3.343   -1.964  2.538   1.00 38.49  ? 54   SER C CB    1 
ATOM   7059  O  OG    . SER C  3  54  ? 2.605   -1.175  3.456   1.00 41.34  ? 54   SER C OG    1 
ATOM   7060  N  N     . LEU C  3  55  ? 5.035   -4.389  1.436   1.00 36.53  ? 55   LEU C N     1 
ATOM   7061  C  CA    . LEU C  3  55  ? 5.460   -5.262  0.347   1.00 41.78  ? 55   LEU C CA    1 
ATOM   7062  C  C     . LEU C  3  55  ? 5.263   -6.738  0.655   1.00 44.44  ? 55   LEU C C     1 
ATOM   7063  O  O     . LEU C  3  55  ? 4.909   -7.524  -0.218  1.00 46.64  ? 55   LEU C O     1 
ATOM   7064  C  CB    . LEU C  3  55  ? 6.932   -5.042  0.036   1.00 41.34  ? 55   LEU C CB    1 
ATOM   7065  C  CG    . LEU C  3  55  ? 7.140   -3.873  -0.912  1.00 46.76  ? 55   LEU C CG    1 
ATOM   7066  C  CD1   . LEU C  3  55  ? 8.621   -3.697  -1.202  1.00 46.20  ? 55   LEU C CD1   1 
ATOM   7067  C  CD2   . LEU C  3  55  ? 6.355   -4.136  -2.192  1.00 45.47  ? 55   LEU C CD2   1 
ATOM   7068  N  N     . PHE C  3  56  ? 5.540   -7.114  1.894   1.00 43.25  ? 56   PHE C N     1 
ATOM   7069  C  CA    . PHE C  3  56  ? 5.390   -8.483  2.316   1.00 44.41  ? 56   PHE C CA    1 
ATOM   7070  C  C     . PHE C  3  56  ? 3.906   -8.827  2.351   1.00 45.37  ? 56   PHE C C     1 
ATOM   7071  O  O     . PHE C  3  56  ? 3.486   -9.893  1.914   1.00 46.27  ? 56   PHE C O     1 
ATOM   7072  C  CB    . PHE C  3  56  ? 5.990   -8.650  3.706   1.00 43.49  ? 56   PHE C CB    1 
ATOM   7073  C  CG    . PHE C  3  56  ? 5.665   -9.958  4.348   1.00 44.25  ? 56   PHE C CG    1 
ATOM   7074  C  CD1   . PHE C  3  56  ? 6.399   -11.095 4.047   1.00 44.33  ? 56   PHE C CD1   1 
ATOM   7075  C  CD2   . PHE C  3  56  ? 4.610   -10.060 5.243   1.00 45.29  ? 56   PHE C CD2   1 
ATOM   7076  C  CE1   . PHE C  3  56  ? 6.084   -12.316 4.632   1.00 43.44  ? 56   PHE C CE1   1 
ATOM   7077  C  CE2   . PHE C  3  56  ? 4.292   -11.283 5.831   1.00 46.07  ? 56   PHE C CE2   1 
ATOM   7078  C  CZ    . PHE C  3  56  ? 5.033   -12.408 5.522   1.00 43.05  ? 56   PHE C CZ    1 
ATOM   7079  N  N     . SER C  3  57  ? 3.121   -7.903  2.879   1.00 44.91  ? 57   SER C N     1 
ATOM   7080  C  CA    . SER C  3  57  ? 1.691   -8.081  3.011   1.00 47.01  ? 57   SER C CA    1 
ATOM   7081  C  C     . SER C  3  57  ? 1.066   -8.292  1.638   1.00 47.42  ? 57   SER C C     1 
ATOM   7082  O  O     . SER C  3  57  ? 0.197   -9.144  1.466   1.00 46.09  ? 57   SER C O     1 
ATOM   7083  C  CB    . SER C  3  57  ? 1.089   -6.849  3.683   1.00 47.25  ? 57   SER C CB    1 
ATOM   7084  O  OG    . SER C  3  57  ? -0.222  -7.113  4.131   1.00 55.27  ? 57   SER C OG    1 
ATOM   7085  N  N     . VAL C  3  58  ? 1.530   -7.516  0.665   1.00 46.76  ? 58   VAL C N     1 
ATOM   7086  C  CA    . VAL C  3  58  ? 1.031   -7.601  -0.699  1.00 48.82  ? 58   VAL C CA    1 
ATOM   7087  C  C     . VAL C  3  58  ? 1.540   -8.876  -1.406  1.00 49.71  ? 58   VAL C C     1 
ATOM   7088  O  O     . VAL C  3  58  ? 0.862   -9.422  -2.269  1.00 50.13  ? 58   VAL C O     1 
ATOM   7089  C  CB    . VAL C  3  58  ? 1.434   -6.332  -1.505  1.00 47.89  ? 58   VAL C CB    1 
ATOM   7090  C  CG1   . VAL C  3  58  ? 2.920   -6.305  -1.722  1.00 53.11  ? 58   VAL C CG1   1 
ATOM   7091  C  CG2   . VAL C  3  58  ? 0.703   -6.284  -2.834  1.00 49.11  ? 58   VAL C CG2   1 
ATOM   7092  N  N     . ALA C  3  59  ? 2.723   -9.352  -1.026  1.00 49.19  ? 59   ALA C N     1 
ATOM   7093  C  CA    . ALA C  3  59  ? 3.280   -10.568 -1.614  1.00 49.14  ? 59   ALA C CA    1 
ATOM   7094  C  C     . ALA C  3  59  ? 2.490   -11.778 -1.102  1.00 49.65  ? 59   ALA C C     1 
ATOM   7095  O  O     . ALA C  3  59  ? 2.250   -12.730 -1.840  1.00 51.24  ? 59   ALA C O     1 
ATOM   7096  C  CB    . ALA C  3  59  ? 4.732   -10.707 -1.242  1.00 45.68  ? 59   ALA C CB    1 
ATOM   7097  N  N     . ALA C  3  60  ? 2.087   -11.730 0.163   1.00 49.84  ? 60   ALA C N     1 
ATOM   7098  C  CA    . ALA C  3  60  ? 1.324   -12.812 0.773   1.00 51.96  ? 60   ALA C CA    1 
ATOM   7099  C  C     . ALA C  3  60  ? -0.050  -12.947 0.120   1.00 54.70  ? 60   ALA C C     1 
ATOM   7100  O  O     . ALA C  3  60  ? -0.596  -14.044 0.030   1.00 57.72  ? 60   ALA C O     1 
ATOM   7101  C  CB    . ALA C  3  60  ? 1.157   -12.560 2.267   1.00 49.94  ? 60   ALA C CB    1 
ATOM   7102  N  N     . LEU C  3  61  ? -0.605  -11.828 -0.335  1.00 55.97  ? 61   LEU C N     1 
ATOM   7103  C  CA    . LEU C  3  61  ? -1.915  -11.823 -0.967  1.00 54.46  ? 61   LEU C CA    1 
ATOM   7104  C  C     . LEU C  3  61  ? -1.837  -12.098 -2.453  1.00 54.04  ? 61   LEU C C     1 
ATOM   7105  O  O     . LEU C  3  61  ? -2.833  -12.472 -3.055  1.00 55.92  ? 61   LEU C O     1 
ATOM   7106  C  CB    . LEU C  3  61  ? -2.597  -10.470 -0.776  1.00 53.09  ? 61   LEU C CB    1 
ATOM   7107  C  CG    . LEU C  3  61  ? -2.994  -10.058 0.635   1.00 54.23  ? 61   LEU C CG    1 
ATOM   7108  C  CD1   . LEU C  3  61  ? -3.221  -8.558  0.666   1.00 52.92  ? 61   LEU C CD1   1 
ATOM   7109  C  CD2   . LEU C  3  61  ? -4.232  -10.815 1.066   1.00 52.54  ? 61   LEU C CD2   1 
ATOM   7110  N  N     . LEU C  3  62  ? -0.666  -11.924 -3.050  1.00 51.94  ? 62   LEU C N     1 
ATOM   7111  C  CA    . LEU C  3  62  ? -0.549  -12.114 -4.486  1.00 51.84  ? 62   LEU C CA    1 
ATOM   7112  C  C     . LEU C  3  62  ? 0.267   -13.287 -4.979  1.00 52.56  ? 62   LEU C C     1 
ATOM   7113  O  O     . LEU C  3  62  ? -0.004  -13.798 -6.060  1.00 52.91  ? 62   LEU C O     1 
ATOM   7114  C  CB    . LEU C  3  62  ? 0.000   -10.840 -5.138  1.00 51.75  ? 62   LEU C CB    1 
ATOM   7115  C  CG    . LEU C  3  62  ? -0.805  -9.541  -5.032  1.00 52.13  ? 62   LEU C CG    1 
ATOM   7116  C  CD1   . LEU C  3  62  ? -0.092  -8.482  -5.855  1.00 52.46  ? 62   LEU C CD1   1 
ATOM   7117  C  CD2   . LEU C  3  62  ? -2.240  -9.732  -5.539  1.00 51.94  ? 62   LEU C CD2   1 
ATOM   7118  N  N     . LEU C  3  63  ? 1.280   -13.704 -4.228  1.00 52.02  ? 63   LEU C N     1 
ATOM   7119  C  CA    . LEU C  3  63  ? 2.095   -14.819 -4.687  1.00 52.38  ? 63   LEU C CA    1 
ATOM   7120  C  C     . LEU C  3  63  ? 1.331   -16.139 -4.736  1.00 50.22  ? 63   LEU C C     1 
ATOM   7121  O  O     . LEU C  3  63  ? 0.434   -16.385 -3.931  1.00 48.98  ? 63   LEU C O     1 
ATOM   7122  C  CB    . LEU C  3  63  ? 3.348   -14.972 -3.827  1.00 52.60  ? 63   LEU C CB    1 
ATOM   7123  C  CG    . LEU C  3  63  ? 4.410   -13.917 -4.114  1.00 52.50  ? 63   LEU C CG    1 
ATOM   7124  C  CD1   . LEU C  3  63  ? 5.662   -14.258 -3.322  1.00 53.80  ? 63   LEU C CD1   1 
ATOM   7125  C  CD2   . LEU C  3  63  ? 4.714   -13.870 -5.610  1.00 49.25  ? 63   LEU C CD2   1 
ATOM   7126  N  N     . PRO C  3  64  ? 1.685   -17.000 -5.701  1.00 49.52  ? 64   PRO C N     1 
ATOM   7127  C  CA    . PRO C  3  64  ? 1.083   -18.317 -5.933  1.00 50.51  ? 64   PRO C CA    1 
ATOM   7128  C  C     . PRO C  3  64  ? 1.283   -19.295 -4.785  1.00 52.93  ? 64   PRO C C     1 
ATOM   7129  O  O     . PRO C  3  64  ? 0.316   -19.856 -4.267  1.00 52.92  ? 64   PRO C O     1 
ATOM   7130  C  CB    . PRO C  3  64  ? 1.786   -18.807 -7.199  1.00 49.36  ? 64   PRO C CB    1 
ATOM   7131  C  CG    . PRO C  3  64  ? 2.264   -17.535 -7.867  1.00 48.89  ? 64   PRO C CG    1 
ATOM   7132  C  CD    . PRO C  3  64  ? 2.728   -16.721 -6.705  1.00 48.84  ? 64   PRO C CD    1 
ATOM   7133  N  N     . GLU C  3  65  ? 2.544   -19.487 -4.389  1.00 54.33  ? 65   GLU C N     1 
ATOM   7134  C  CA    . GLU C  3  65  ? 2.883   -20.435 -3.331  1.00 55.07  ? 65   GLU C CA    1 
ATOM   7135  C  C     . GLU C  3  65  ? 2.833   -19.869 -1.928  1.00 52.86  ? 65   GLU C C     1 
ATOM   7136  O  O     . GLU C  3  65  ? 2.705   -18.673 -1.745  1.00 53.81  ? 65   GLU C O     1 
ATOM   7137  C  CB    . GLU C  3  65  ? 4.274   -21.009 -3.596  1.00 55.68  ? 65   GLU C CB    1 
ATOM   7138  C  CG    . GLU C  3  65  ? 4.449   -21.576 -4.995  1.00 59.49  ? 65   GLU C CG    1 
ATOM   7139  C  CD    . GLU C  3  65  ? 3.468   -22.702 -5.307  1.00 60.82  ? 65   GLU C CD    1 
ATOM   7140  O  OE1   . GLU C  3  65  ? 3.411   -23.683 -4.533  1.00 57.31  ? 65   GLU C OE1   1 
ATOM   7141  O  OE2   . GLU C  3  65  ? 2.757   -22.599 -6.334  1.00 64.60  ? 65   GLU C OE2   1 
ATOM   7142  N  N     . GLN C  3  66  ? 2.926   -20.751 -0.938  1.00 55.05  ? 66   GLN C N     1 
ATOM   7143  C  CA    . GLN C  3  66  ? 2.931   -20.339 0.466   1.00 54.10  ? 66   GLN C CA    1 
ATOM   7144  C  C     . GLN C  3  66  ? 4.380   -20.106 0.904   1.00 51.83  ? 66   GLN C C     1 
ATOM   7145  O  O     . GLN C  3  66  ? 5.320   -20.461 0.190   1.00 50.20  ? 66   GLN C O     1 
ATOM   7146  C  CB    . GLN C  3  66  ? 2.301   -21.406 1.349   1.00 55.77  ? 66   GLN C CB    1 
ATOM   7147  C  CG    . GLN C  3  66  ? 0.891   -21.748 0.971   1.00 61.87  ? 66   GLN C CG    1 
ATOM   7148  C  CD    . GLN C  3  66  ? -0.078  -21.456 2.089   1.00 64.25  ? 66   GLN C CD    1 
ATOM   7149  O  OE1   . GLN C  3  66  ? -0.650  -20.364 2.171   1.00 65.80  ? 66   GLN C OE1   1 
ATOM   7150  N  NE2   . GLN C  3  66  ? -0.257  -22.428 2.973   1.00 65.47  ? 66   GLN C NE2   1 
ATOM   7151  N  N     . PHE C  3  67  ? 4.553   -19.540 2.094   1.00 50.40  ? 67   PHE C N     1 
ATOM   7152  C  CA    . PHE C  3  67  ? 5.880   -19.205 2.589   1.00 47.70  ? 67   PHE C CA    1 
ATOM   7153  C  C     . PHE C  3  67  ? 6.931   -20.310 2.644   1.00 45.15  ? 67   PHE C C     1 
ATOM   7154  O  O     . PHE C  3  67  ? 8.045   -20.127 2.146   1.00 43.02  ? 67   PHE C O     1 
ATOM   7155  C  CB    . PHE C  3  67  ? 5.775   -18.537 3.960   1.00 49.61  ? 67   PHE C CB    1 
ATOM   7156  C  CG    . PHE C  3  67  ? 7.001   -17.752 4.336   1.00 52.27  ? 67   PHE C CG    1 
ATOM   7157  C  CD1   . PHE C  3  67  ? 7.456   -16.720 3.512   1.00 51.79  ? 67   PHE C CD1   1 
ATOM   7158  C  CD2   . PHE C  3  67  ? 7.713   -18.047 5.502   1.00 50.53  ? 67   PHE C CD2   1 
ATOM   7159  C  CE1   . PHE C  3  67  ? 8.608   -15.990 3.844   1.00 54.15  ? 67   PHE C CE1   1 
ATOM   7160  C  CE2   . PHE C  3  67  ? 8.859   -17.327 5.839   1.00 52.12  ? 67   PHE C CE2   1 
ATOM   7161  C  CZ    . PHE C  3  67  ? 9.308   -16.296 5.009   1.00 52.80  ? 67   PHE C CZ    1 
ATOM   7162  N  N     . PRO C  3  68  ? 6.604   -21.465 3.256   1.00 44.81  ? 68   PRO C N     1 
ATOM   7163  C  CA    . PRO C  3  68  ? 7.589   -22.554 3.336   1.00 43.34  ? 68   PRO C CA    1 
ATOM   7164  C  C     . PRO C  3  68  ? 8.180   -22.908 1.978   1.00 41.93  ? 68   PRO C C     1 
ATOM   7165  O  O     . PRO C  3  68  ? 9.367   -23.226 1.870   1.00 42.68  ? 68   PRO C O     1 
ATOM   7166  C  CB    . PRO C  3  68  ? 6.793   -23.696 3.963   1.00 42.44  ? 68   PRO C CB    1 
ATOM   7167  C  CG    . PRO C  3  68  ? 5.835   -22.963 4.868   1.00 43.65  ? 68   PRO C CG    1 
ATOM   7168  C  CD    . PRO C  3  68  ? 5.365   -21.823 3.968   1.00 44.07  ? 68   PRO C CD    1 
ATOM   7169  N  N     . HIS C  3  69  ? 7.356   -22.828 0.939   1.00 43.81  ? 69   HIS C N     1 
ATOM   7170  C  CA    . HIS C  3  69  ? 7.820   -23.131 -0.412  1.00 45.29  ? 69   HIS C CA    1 
ATOM   7171  C  C     . HIS C  3  69  ? 9.011   -22.283 -0.833  1.00 45.86  ? 69   HIS C C     1 
ATOM   7172  O  O     . HIS C  3  69  ? 10.017  -22.813 -1.305  1.00 45.59  ? 69   HIS C O     1 
ATOM   7173  C  CB    . HIS C  3  69  ? 6.710   -22.915 -1.435  1.00 48.82  ? 69   HIS C CB    1 
ATOM   7174  C  CG    . HIS C  3  69  ? 7.197   -22.956 -2.848  1.00 52.53  ? 69   HIS C CG    1 
ATOM   7175  N  ND1   . HIS C  3  69  ? 7.565   -24.129 -3.472  1.00 54.24  ? 69   HIS C ND1   1 
ATOM   7176  C  CD2   . HIS C  3  69  ? 7.466   -21.962 -3.728  1.00 56.05  ? 69   HIS C CD2   1 
ATOM   7177  C  CE1   . HIS C  3  69  ? 8.045   -23.856 -4.673  1.00 53.57  ? 69   HIS C CE1   1 
ATOM   7178  N  NE2   . HIS C  3  69  ? 7.997   -22.549 -4.853  1.00 57.32  ? 69   HIS C NE2   1 
ATOM   7179  N  N     . TYR C  3  70  ? 8.888   -20.962 -0.686  1.00 44.33  ? 70   TYR C N     1 
ATOM   7180  C  CA    . TYR C  3  70  ? 9.972   -20.063 -1.075  1.00 43.95  ? 70   TYR C CA    1 
ATOM   7181  C  C     . TYR C  3  70  ? 11.185  -20.225 -0.154  1.00 41.28  ? 70   TYR C C     1 
ATOM   7182  O  O     . TYR C  3  70  ? 12.322  -20.021 -0.568  1.00 39.97  ? 70   TYR C O     1 
ATOM   7183  C  CB    . TYR C  3  70  ? 9.496   -18.600 -1.074  1.00 45.15  ? 70   TYR C CB    1 
ATOM   7184  C  CG    . TYR C  3  70  ? 8.322   -18.339 -1.991  1.00 44.74  ? 70   TYR C CG    1 
ATOM   7185  C  CD1   . TYR C  3  70  ? 7.015   -18.406 -1.510  1.00 43.90  ? 70   TYR C CD1   1 
ATOM   7186  C  CD2   . TYR C  3  70  ? 8.515   -18.065 -3.347  1.00 46.02  ? 70   TYR C CD2   1 
ATOM   7187  C  CE1   . TYR C  3  70  ? 5.923   -18.209 -2.358  1.00 47.33  ? 70   TYR C CE1   1 
ATOM   7188  C  CE2   . TYR C  3  70  ? 7.428   -17.868 -4.207  1.00 46.16  ? 70   TYR C CE2   1 
ATOM   7189  C  CZ    . TYR C  3  70  ? 6.135   -17.943 -3.704  1.00 47.23  ? 70   TYR C CZ    1 
ATOM   7190  O  OH    . TYR C  3  70  ? 5.046   -17.775 -4.527  1.00 49.41  ? 70   TYR C OH    1 
ATOM   7191  N  N     . VAL C  3  71  ? 10.940  -20.578 1.097   1.00 39.55  ? 71   VAL C N     1 
ATOM   7192  C  CA    . VAL C  3  71  ? 12.038  -20.788 2.023   1.00 39.65  ? 71   VAL C CA    1 
ATOM   7193  C  C     . VAL C  3  71  ? 12.845  -21.990 1.511   1.00 40.12  ? 71   VAL C C     1 
ATOM   7194  O  O     . VAL C  3  71  ? 14.076  -21.938 1.416   1.00 41.07  ? 71   VAL C O     1 
ATOM   7195  C  CB    . VAL C  3  71  ? 11.515  -21.098 3.436   1.00 40.25  ? 71   VAL C CB    1 
ATOM   7196  C  CG1   . VAL C  3  71  ? 12.674  -21.514 4.343   1.00 39.72  ? 71   VAL C CG1   1 
ATOM   7197  C  CG2   . VAL C  3  71  ? 10.803  -19.874 4.001   1.00 36.30  ? 71   VAL C CG2   1 
ATOM   7198  N  N     . ALA C  3  72  ? 12.144  -23.067 1.169   1.00 37.26  ? 72   ALA C N     1 
ATOM   7199  C  CA    . ALA C  3  72  ? 12.798  -24.270 0.659   1.00 37.04  ? 72   ALA C CA    1 
ATOM   7200  C  C     . ALA C  3  72  ? 13.580  -23.986 -0.617  1.00 39.21  ? 72   ALA C C     1 
ATOM   7201  O  O     . ALA C  3  72  ? 14.728  -24.413 -0.773  1.00 41.93  ? 72   ALA C O     1 
ATOM   7202  C  CB    . ALA C  3  72  ? 11.750  -25.339 0.396   1.00 38.61  ? 72   ALA C CB    1 
ATOM   7203  N  N     . VAL C  3  73  ? 12.953  -23.266 -1.538  1.00 39.91  ? 73   VAL C N     1 
ATOM   7204  C  CA    . VAL C  3  73  ? 13.595  -22.933 -2.794  1.00 42.13  ? 73   VAL C CA    1 
ATOM   7205  C  C     . VAL C  3  73  ? 14.929  -22.264 -2.513  1.00 42.99  ? 73   VAL C C     1 
ATOM   7206  O  O     . VAL C  3  73  ? 15.939  -22.581 -3.138  1.00 43.85  ? 73   VAL C O     1 
ATOM   7207  C  CB    . VAL C  3  73  ? 12.711  -21.981 -3.647  1.00 43.04  ? 73   VAL C CB    1 
ATOM   7208  C  CG1   . VAL C  3  73  ? 13.418  -21.628 -4.927  1.00 41.37  ? 73   VAL C CG1   1 
ATOM   7209  C  CG2   . VAL C  3  73  ? 11.364  -22.645 -3.953  1.00 45.73  ? 73   VAL C CG2   1 
ATOM   7210  N  N     . VAL C  3  74  ? 14.932  -21.334 -1.563  1.00 43.69  ? 74   VAL C N     1 
ATOM   7211  C  CA    . VAL C  3  74  ? 16.161  -20.633 -1.218  1.00 42.35  ? 74   VAL C CA    1 
ATOM   7212  C  C     . VAL C  3  74  ? 17.208  -21.583 -0.624  1.00 40.87  ? 74   VAL C C     1 
ATOM   7213  O  O     . VAL C  3  74  ? 18.380  -21.569 -1.016  1.00 37.69  ? 74   VAL C O     1 
ATOM   7214  C  CB    . VAL C  3  74  ? 15.880  -19.498 -0.215  1.00 42.96  ? 74   VAL C CB    1 
ATOM   7215  C  CG1   . VAL C  3  74  ? 17.182  -18.810 0.155   1.00 42.43  ? 74   VAL C CG1   1 
ATOM   7216  C  CG2   . VAL C  3  74  ? 14.913  -18.497 -0.823  1.00 42.73  ? 74   VAL C CG2   1 
ATOM   7217  N  N     . LYS C  3  75  ? 16.786  -22.406 0.327   1.00 39.48  ? 75   LYS C N     1 
ATOM   7218  C  CA    . LYS C  3  75  ? 17.704  -23.353 0.942   1.00 39.48  ? 75   LYS C CA    1 
ATOM   7219  C  C     . LYS C  3  75  ? 18.317  -24.290 -0.092  1.00 41.08  ? 75   LYS C C     1 
ATOM   7220  O  O     . LYS C  3  75  ? 19.493  -24.649 -0.006  1.00 37.66  ? 75   LYS C O     1 
ATOM   7221  C  CB    . LYS C  3  75  ? 16.982  -24.163 2.024   1.00 36.50  ? 75   LYS C CB    1 
ATOM   7222  C  CG    . LYS C  3  75  ? 16.706  -23.367 3.281   1.00 28.56  ? 75   LYS C CG    1 
ATOM   7223  C  CD    . LYS C  3  75  ? 15.928  -24.160 4.315   1.00 30.42  ? 75   LYS C CD    1 
ATOM   7224  C  CE    . LYS C  3  75  ? 15.779  -23.345 5.588   1.00 28.53  ? 75   LYS C CE    1 
ATOM   7225  N  NZ    . LYS C  3  75  ? 14.886  -24.022 6.558   1.00 36.90  ? 75   LYS C NZ    1 
ATOM   7226  N  N     . SER C  3  76  ? 17.525  -24.666 -1.087  1.00 45.29  ? 76   SER C N     1 
ATOM   7227  C  CA    . SER C  3  76  ? 18.001  -25.577 -2.125  1.00 47.95  ? 76   SER C CA    1 
ATOM   7228  C  C     . SER C  3  76  ? 19.124  -24.986 -2.973  1.00 48.70  ? 76   SER C C     1 
ATOM   7229  O  O     . SER C  3  76  ? 19.928  -25.728 -3.539  1.00 51.18  ? 76   SER C O     1 
ATOM   7230  C  CB    . SER C  3  76  ? 16.849  -25.998 -3.033  1.00 47.85  ? 76   SER C CB    1 
ATOM   7231  O  OG    . SER C  3  76  ? 16.478  -24.935 -3.888  1.00 53.50  ? 76   SER C OG    1 
ATOM   7232  N  N     . LEU C  3  77  ? 19.201  -23.664 -3.067  1.00 47.59  ? 77   LEU C N     1 
ATOM   7233  C  CA    . LEU C  3  77  ? 20.269  -23.072 -3.871  1.00 48.01  ? 77   LEU C CA    1 
ATOM   7234  C  C     . LEU C  3  77  ? 21.658  -23.172 -3.224  1.00 46.79  ? 77   LEU C C     1 
ATOM   7235  O  O     . LEU C  3  77  ? 22.665  -22.848 -3.854  1.00 45.08  ? 77   LEU C O     1 
ATOM   7236  C  CB    . LEU C  3  77  ? 19.967  -21.601 -4.175  1.00 50.61  ? 77   LEU C CB    1 
ATOM   7237  C  CG    . LEU C  3  77  ? 18.676  -21.298 -4.936  1.00 52.20  ? 77   LEU C CG    1 
ATOM   7238  C  CD1   . LEU C  3  77  ? 18.651  -19.810 -5.271  1.00 48.44  ? 77   LEU C CD1   1 
ATOM   7239  C  CD2   . LEU C  3  77  ? 18.593  -22.150 -6.202  1.00 50.67  ? 77   LEU C CD2   1 
ATOM   7240  N  N     . SER C  3  78  ? 21.712  -23.603 -1.967  1.00 44.44  ? 78   SER C N     1 
ATOM   7241  C  CA    . SER C  3  78  ? 22.991  -23.726 -1.271  1.00 46.07  ? 78   SER C CA    1 
ATOM   7242  C  C     . SER C  3  78  ? 23.867  -22.483 -1.429  1.00 47.20  ? 78   SER C C     1 
ATOM   7243  O  O     . SER C  3  78  ? 25.006  -22.576 -1.899  1.00 45.79  ? 78   SER C O     1 
ATOM   7244  C  CB    . SER C  3  78  ? 23.750  -24.940 -1.797  1.00 44.72  ? 78   SER C CB    1 
ATOM   7245  O  OG    . SER C  3  78  ? 22.972  -26.118 -1.661  1.00 50.23  ? 78   SER C OG    1 
ATOM   7246  N  N     . LEU C  3  79  ? 23.340  -21.324 -1.031  1.00 48.12  ? 79   LEU C N     1 
ATOM   7247  C  CA    . LEU C  3  79  ? 24.084  -20.070 -1.134  1.00 46.93  ? 79   LEU C CA    1 
ATOM   7248  C  C     . LEU C  3  79  ? 25.157  -19.996 -0.053  1.00 44.92  ? 79   LEU C C     1 
ATOM   7249  O  O     . LEU C  3  79  ? 25.029  -20.616 1.000   1.00 45.48  ? 79   LEU C O     1 
ATOM   7250  C  CB    . LEU C  3  79  ? 23.125  -18.882 -1.006  1.00 48.69  ? 79   LEU C CB    1 
ATOM   7251  C  CG    . LEU C  3  79  ? 21.974  -18.858 -2.019  1.00 50.38  ? 79   LEU C CG    1 
ATOM   7252  C  CD1   . LEU C  3  79  ? 20.983  -17.777 -1.649  1.00 49.89  ? 79   LEU C CD1   1 
ATOM   7253  C  CD2   . LEU C  3  79  ? 22.524  -18.640 -3.421  1.00 47.12  ? 79   LEU C CD2   1 
ATOM   7254  N  N     . SER C  3  80  ? 26.213  -19.233 -0.319  1.00 44.12  ? 80   SER C N     1 
ATOM   7255  C  CA    . SER C  3  80  ? 27.304  -19.088 0.628   1.00 44.02  ? 80   SER C CA    1 
ATOM   7256  C  C     . SER C  3  80  ? 26.809  -18.573 1.969   1.00 42.90  ? 80   SER C C     1 
ATOM   7257  O  O     . SER C  3  80  ? 26.059  -17.615 2.020   1.00 43.23  ? 80   SER C O     1 
ATOM   7258  C  CB    . SER C  3  80  ? 28.355  -18.128 0.086   1.00 45.67  ? 80   SER C CB    1 
ATOM   7259  O  OG    . SER C  3  80  ? 29.398  -17.966 1.035   1.00 48.01  ? 80   SER C OG    1 
ATOM   7260  N  N     . PRO C  3  81  ? 27.187  -19.234 3.072   1.00 43.55  ? 81   PRO C N     1 
ATOM   7261  C  CA    . PRO C  3  81  ? 26.721  -18.742 4.375   1.00 42.93  ? 81   PRO C CA    1 
ATOM   7262  C  C     . PRO C  3  81  ? 27.165  -17.312 4.679   1.00 42.92  ? 81   PRO C C     1 
ATOM   7263  O  O     . PRO C  3  81  ? 26.459  -16.600 5.388   1.00 42.83  ? 81   PRO C O     1 
ATOM   7264  C  CB    . PRO C  3  81  ? 27.276  -19.767 5.351   1.00 41.85  ? 81   PRO C CB    1 
ATOM   7265  C  CG    . PRO C  3  81  ? 27.125  -21.063 4.550   1.00 41.95  ? 81   PRO C CG    1 
ATOM   7266  C  CD    . PRO C  3  81  ? 27.649  -20.634 3.170   1.00 41.74  ? 81   PRO C CD    1 
ATOM   7267  N  N     . ALA C  3  82  ? 28.319  -16.897 4.151   1.00 42.58  ? 82   ALA C N     1 
ATOM   7268  C  CA    . ALA C  3  82  ? 28.798  -15.524 4.339   1.00 42.67  ? 82   ALA C CA    1 
ATOM   7269  C  C     . ALA C  3  82  ? 27.797  -14.548 3.707   1.00 42.57  ? 82   ALA C C     1 
ATOM   7270  O  O     . ALA C  3  82  ? 27.421  -13.540 4.313   1.00 42.23  ? 82   ALA C O     1 
ATOM   7271  C  CB    . ALA C  3  82  ? 30.169  -15.349 3.686   1.00 42.49  ? 82   ALA C CB    1 
ATOM   7272  N  N     . LEU C  3  83  ? 27.380  -14.853 2.481   1.00 40.68  ? 83   LEU C N     1 
ATOM   7273  C  CA    . LEU C  3  83  ? 26.421  -14.023 1.774   1.00 41.54  ? 83   LEU C CA    1 
ATOM   7274  C  C     . LEU C  3  83  ? 25.112  -14.021 2.535   1.00 39.93  ? 83   LEU C C     1 
ATOM   7275  O  O     . LEU C  3  83  ? 24.452  -13.001 2.664   1.00 38.53  ? 83   LEU C O     1 
ATOM   7276  C  CB    . LEU C  3  83  ? 26.194  -14.562 0.366   1.00 44.53  ? 83   LEU C CB    1 
ATOM   7277  C  CG    . LEU C  3  83  ? 24.885  -14.167 -0.315  1.00 49.13  ? 83   LEU C CG    1 
ATOM   7278  C  CD1   . LEU C  3  83  ? 24.775  -12.644 -0.411  1.00 49.74  ? 83   LEU C CD1   1 
ATOM   7279  C  CD2   . LEU C  3  83  ? 24.835  -14.802 -1.701  1.00 48.07  ? 83   LEU C CD2   1 
ATOM   7280  N  N     . ILE C  3  84  ? 24.712  -15.171 3.036   1.00 36.78  ? 84   ILE C N     1 
ATOM   7281  C  CA    . ILE C  3  84  ? 23.478  -15.188 3.767   1.00 34.34  ? 84   ILE C CA    1 
ATOM   7282  C  C     . ILE C  3  84  ? 23.590  -14.405 5.068   1.00 33.79  ? 84   ILE C C     1 
ATOM   7283  O  O     . ILE C  3  84  ? 22.611  -13.797 5.495   1.00 31.96  ? 84   ILE C O     1 
ATOM   7284  C  CB    . ILE C  3  84  ? 23.029  -16.611 4.056   1.00 32.70  ? 84   ILE C CB    1 
ATOM   7285  C  CG1   . ILE C  3  84  ? 22.401  -17.192 2.789   1.00 30.82  ? 84   ILE C CG1   1 
ATOM   7286  C  CG2   . ILE C  3  84  ? 22.068  -16.621 5.229   1.00 24.31  ? 84   ILE C CG2   1 
ATOM   7287  C  CD1   . ILE C  3  84  ? 22.097  -18.691 2.888   1.00 38.40  ? 84   ILE C CD1   1 
ATOM   7288  N  N     . TYR C  3  85  ? 24.755  -14.446 5.703   1.00 31.88  ? 85   TYR C N     1 
ATOM   7289  C  CA    . TYR C  3  85  ? 24.980  -13.709 6.933   1.00 36.61  ? 85   TYR C CA    1 
ATOM   7290  C  C     . TYR C  3  85  ? 24.877  -12.218 6.639   1.00 39.51  ? 85   TYR C C     1 
ATOM   7291  O  O     . TYR C  3  85  ? 24.280  -11.457 7.410   1.00 40.81  ? 85   TYR C O     1 
ATOM   7292  C  CB    . TYR C  3  85  ? 26.375  -13.993 7.477   1.00 40.43  ? 85   TYR C CB    1 
ATOM   7293  C  CG    . TYR C  3  85  ? 26.777  -13.101 8.633   1.00 43.14  ? 85   TYR C CG    1 
ATOM   7294  C  CD1   . TYR C  3  85  ? 26.414  -13.419 9.947   1.00 42.42  ? 85   TYR C CD1   1 
ATOM   7295  C  CD2   . TYR C  3  85  ? 27.544  -11.953 8.417   1.00 45.38  ? 85   TYR C CD2   1 
ATOM   7296  C  CE1   . TYR C  3  85  ? 26.811  -12.625 11.012  1.00 44.94  ? 85   TYR C CE1   1 
ATOM   7297  C  CE2   . TYR C  3  85  ? 27.947  -11.144 9.485   1.00 46.51  ? 85   TYR C CE2   1 
ATOM   7298  C  CZ    . TYR C  3  85  ? 27.581  -11.492 10.776  1.00 46.45  ? 85   TYR C CZ    1 
ATOM   7299  O  OH    . TYR C  3  85  ? 28.012  -10.734 11.837  1.00 48.96  ? 85   TYR C OH    1 
ATOM   7300  N  N     . SER C  3  86  ? 25.476  -11.803 5.526   1.00 38.63  ? 86   SER C N     1 
ATOM   7301  C  CA    . SER C  3  86  ? 25.447  -10.407 5.135   1.00 38.27  ? 86   SER C CA    1 
ATOM   7302  C  C     . SER C  3  86  ? 24.018  -9.942  4.958   1.00 37.01  ? 86   SER C C     1 
ATOM   7303  O  O     . SER C  3  86  ? 23.647  -8.874  5.441   1.00 37.35  ? 86   SER C O     1 
ATOM   7304  C  CB    . SER C  3  86  ? 26.206  -10.208 3.832   1.00 40.65  ? 86   SER C CB    1 
ATOM   7305  O  OG    . SER C  3  86  ? 27.570  -10.532 3.998   1.00 47.18  ? 86   SER C OG    1 
ATOM   7306  N  N     . ALA C  3  87  ? 23.221  -10.752 4.272   1.00 35.86  ? 87   ALA C N     1 
ATOM   7307  C  CA    . ALA C  3  87  ? 21.830  -10.421 4.009   1.00 36.30  ? 87   ALA C CA    1 
ATOM   7308  C  C     . ALA C  3  87  ? 21.038  -10.313 5.311   1.00 37.23  ? 87   ALA C C     1 
ATOM   7309  O  O     . ALA C  3  87  ? 20.137  -9.476  5.433   1.00 36.71  ? 87   ALA C O     1 
ATOM   7310  C  CB    . ALA C  3  87  ? 21.219  -11.473 3.099   1.00 34.52  ? 87   ALA C CB    1 
ATOM   7311  N  N     . LYS C  3  88  ? 21.369  -11.164 6.281   1.00 37.48  ? 88   LYS C N     1 
ATOM   7312  C  CA    . LYS C  3  88  ? 20.688  -11.129 7.567   1.00 38.39  ? 88   LYS C CA    1 
ATOM   7313  C  C     . LYS C  3  88  ? 21.027  -9.800  8.253   1.00 38.73  ? 88   LYS C C     1 
ATOM   7314  O  O     . LYS C  3  88  ? 20.171  -9.168  8.867   1.00 38.68  ? 88   LYS C O     1 
ATOM   7315  C  CB    . LYS C  3  88  ? 21.144  -12.287 8.458   1.00 39.18  ? 88   LYS C CB    1 
ATOM   7316  C  CG    . LYS C  3  88  ? 20.567  -13.653 8.099   1.00 43.97  ? 88   LYS C CG    1 
ATOM   7317  C  CD    . LYS C  3  88  ? 21.096  -14.716 9.059   1.00 41.19  ? 88   LYS C CD    1 
ATOM   7318  C  CE    . LYS C  3  88  ? 20.423  -16.058 8.856   1.00 47.35  ? 88   LYS C CE    1 
ATOM   7319  N  NZ    . LYS C  3  88  ? 20.987  -17.085 9.786   1.00 46.81  ? 88   LYS C NZ    1 
ATOM   7320  N  N     . PHE C  3  89  ? 22.282  -9.385  8.145   1.00 37.21  ? 89   PHE C N     1 
ATOM   7321  C  CA    . PHE C  3  89  ? 22.716  -8.136  8.747   1.00 38.87  ? 89   PHE C CA    1 
ATOM   7322  C  C     . PHE C  3  89  ? 21.925  -6.979  8.135   1.00 39.33  ? 89   PHE C C     1 
ATOM   7323  O  O     . PHE C  3  89  ? 21.338  -6.180  8.855   1.00 37.86  ? 89   PHE C O     1 
ATOM   7324  C  CB    . PHE C  3  89  ? 24.211  -7.906  8.520   1.00 33.21  ? 89   PHE C CB    1 
ATOM   7325  C  CG    . PHE C  3  89  ? 24.766  -6.777  9.333   1.00 37.16  ? 89   PHE C CG    1 
ATOM   7326  C  CD1   . PHE C  3  89  ? 25.191  -6.987  10.649  1.00 35.93  ? 89   PHE C CD1   1 
ATOM   7327  C  CD2   . PHE C  3  89  ? 24.830  -5.486  8.807   1.00 35.84  ? 89   PHE C CD2   1 
ATOM   7328  C  CE1   . PHE C  3  89  ? 25.670  -5.929  11.427  1.00 36.05  ? 89   PHE C CE1   1 
ATOM   7329  C  CE2   . PHE C  3  89  ? 25.309  -4.421  9.579   1.00 39.01  ? 89   PHE C CE2   1 
ATOM   7330  C  CZ    . PHE C  3  89  ? 25.732  -4.642  10.892  1.00 35.59  ? 89   PHE C CZ    1 
ATOM   7331  N  N     . ALA C  3  90  ? 21.893  -6.910  6.806   1.00 41.40  ? 90   ALA C N     1 
ATOM   7332  C  CA    . ALA C  3  90  ? 21.180  -5.833  6.123   1.00 42.30  ? 90   ALA C CA    1 
ATOM   7333  C  C     . ALA C  3  90  ? 19.711  -5.822  6.484   1.00 42.08  ? 90   ALA C C     1 
ATOM   7334  O  O     . ALA C  3  90  ? 19.089  -4.766  6.536   1.00 42.83  ? 90   ALA C O     1 
ATOM   7335  C  CB    . ALA C  3  90  ? 21.343  -5.950  4.612   1.00 43.94  ? 90   ALA C CB    1 
ATOM   7336  N  N     . LEU C  3  91  ? 19.142  -6.987  6.740   1.00 41.42  ? 91   LEU C N     1 
ATOM   7337  C  CA    . LEU C  3  91  ? 17.739  -7.003  7.086   1.00 42.42  ? 91   LEU C CA    1 
ATOM   7338  C  C     . LEU C  3  91  ? 17.461  -6.514  8.483   1.00 39.56  ? 91   LEU C C     1 
ATOM   7339  O  O     . LEU C  3  91  ? 16.527  -5.751  8.688   1.00 39.28  ? 91   LEU C O     1 
ATOM   7340  C  CB    . LEU C  3  91  ? 17.139  -8.400  6.937   1.00 46.57  ? 91   LEU C CB    1 
ATOM   7341  C  CG    . LEU C  3  91  ? 16.729  -8.783  5.513   1.00 50.79  ? 91   LEU C CG    1 
ATOM   7342  C  CD1   . LEU C  3  91  ? 15.763  -9.964  5.575   1.00 50.93  ? 91   LEU C CD1   1 
ATOM   7343  C  CD2   . LEU C  3  91  ? 16.057  -7.593  4.833   1.00 50.80  ? 91   LEU C CD2   1 
ATOM   7344  N  N     . VAL C  3  92  ? 18.260  -6.950  9.448   1.00 36.19  ? 92   VAL C N     1 
ATOM   7345  C  CA    . VAL C  3  92  ? 18.024  -6.556  10.833  1.00 34.24  ? 92   VAL C CA    1 
ATOM   7346  C  C     . VAL C  3  92  ? 18.555  -5.140  11.174  1.00 33.84  ? 92   VAL C C     1 
ATOM   7347  O  O     . VAL C  3  92  ? 18.074  -4.511  12.102  1.00 35.66  ? 92   VAL C O     1 
ATOM   7348  C  CB    . VAL C  3  92  ? 18.641  -7.619  11.809  1.00 33.17  ? 92   VAL C CB    1 
ATOM   7349  C  CG1   . VAL C  3  92  ? 20.152  -7.430  11.908  1.00 28.66  ? 92   VAL C CG1   1 
ATOM   7350  C  CG2   . VAL C  3  92  ? 18.015  -7.513  13.194  1.00 30.02  ? 92   VAL C CG2   1 
ATOM   7351  N  N     . PHE C  3  93  ? 19.524  -4.630  10.420  1.00 34.17  ? 93   PHE C N     1 
ATOM   7352  C  CA    . PHE C  3  93  ? 20.080  -3.309  10.726  1.00 36.25  ? 93   PHE C CA    1 
ATOM   7353  C  C     . PHE C  3  93  ? 19.054  -2.167  10.882  1.00 33.48  ? 93   PHE C C     1 
ATOM   7354  O  O     . PHE C  3  93  ? 18.972  -1.543  11.943  1.00 29.18  ? 93   PHE C O     1 
ATOM   7355  C  CB    . PHE C  3  93  ? 21.136  -2.900  9.695   1.00 35.59  ? 93   PHE C CB    1 
ATOM   7356  C  CG    . PHE C  3  93  ? 22.006  -1.769  10.159  1.00 43.86  ? 93   PHE C CG    1 
ATOM   7357  C  CD1   . PHE C  3  93  ? 22.937  -1.970  11.174  1.00 46.01  ? 93   PHE C CD1   1 
ATOM   7358  C  CD2   . PHE C  3  93  ? 21.823  -0.480  9.660   1.00 47.17  ? 93   PHE C CD2   1 
ATOM   7359  C  CE1   . PHE C  3  93  ? 23.671  -0.912  11.698  1.00 51.58  ? 93   PHE C CE1   1 
ATOM   7360  C  CE2   . PHE C  3  93  ? 22.550  0.595   10.177  1.00 50.35  ? 93   PHE C CE2   1 
ATOM   7361  C  CZ    . PHE C  3  93  ? 23.478  0.378   11.203  1.00 52.36  ? 93   PHE C CZ    1 
ATOM   7362  N  N     . PRO C  3  94  ? 18.262  -1.882  9.833   1.00 34.10  ? 94   PRO C N     1 
ATOM   7363  C  CA    . PRO C  3  94  ? 17.286  -0.801  9.974   1.00 32.49  ? 94   PRO C CA    1 
ATOM   7364  C  C     . PRO C  3  94  ? 16.315  -0.973  11.118  1.00 32.72  ? 94   PRO C C     1 
ATOM   7365  O  O     . PRO C  3  94  ? 15.935  0.010   11.768  1.00 34.78  ? 94   PRO C O     1 
ATOM   7366  C  CB    . PRO C  3  94  ? 16.591  -0.775  8.616   1.00 37.17  ? 94   PRO C CB    1 
ATOM   7367  C  CG    . PRO C  3  94  ? 16.790  -2.184  8.075   1.00 37.33  ? 94   PRO C CG    1 
ATOM   7368  C  CD    . PRO C  3  94  ? 18.229  -2.440  8.473   1.00 32.19  ? 94   PRO C CD    1 
ATOM   7369  N  N     . LEU C  3  95  ? 15.917  -2.213  11.392  1.00 30.75  ? 95   LEU C N     1 
ATOM   7370  C  CA    . LEU C  3  95  ? 14.959  -2.465  12.458  1.00 30.05  ? 95   LEU C CA    1 
ATOM   7371  C  C     . LEU C  3  95  ? 15.582  -2.287  13.833  1.00 30.84  ? 95   LEU C C     1 
ATOM   7372  O  O     . LEU C  3  95  ? 14.927  -1.870  14.777  1.00 30.21  ? 95   LEU C O     1 
ATOM   7373  C  CB    . LEU C  3  95  ? 14.379  -3.870  12.323  1.00 32.23  ? 95   LEU C CB    1 
ATOM   7374  C  CG    . LEU C  3  95  ? 13.538  -4.371  13.500  1.00 33.85  ? 95   LEU C CG    1 
ATOM   7375  C  CD1   . LEU C  3  95  ? 12.342  -3.467  13.723  1.00 33.31  ? 95   LEU C CD1   1 
ATOM   7376  C  CD2   . LEU C  3  95  ? 13.085  -5.793  13.218  1.00 33.05  ? 95   LEU C CD2   1 
ATOM   7377  N  N     . SER C  3  96  ? 16.862  -2.604  13.928  1.00 30.46  ? 96   SER C N     1 
ATOM   7378  C  CA    . SER C  3  96  ? 17.598  -2.490  15.171  1.00 30.27  ? 96   SER C CA    1 
ATOM   7379  C  C     . SER C  3  96  ? 17.842  -1.007  15.465  1.00 29.84  ? 96   SER C C     1 
ATOM   7380  O  O     . SER C  3  96  ? 17.676  -0.520  16.606  1.00 24.36  ? 96   SER C O     1 
ATOM   7381  C  CB    . SER C  3  96  ? 18.937  -3.218  15.021  1.00 32.20  ? 96   SER C CB    1 
ATOM   7382  O  OG    . SER C  3  96  ? 19.558  -3.393  16.275  1.00 37.79  ? 96   SER C OG    1 
ATOM   7383  N  N     . TYR C  3  97  ? 18.237  -0.296  14.419  1.00 27.16  ? 97   TYR C N     1 
ATOM   7384  C  CA    . TYR C  3  97  ? 18.501  1.122   14.547  1.00 28.02  ? 97   TYR C CA    1 
ATOM   7385  C  C     . TYR C  3  97  ? 17.232  1.824   15.034  1.00 27.94  ? 97   TYR C C     1 
ATOM   7386  O  O     . TYR C  3  97  ? 17.225  2.494   16.082  1.00 23.50  ? 97   TYR C O     1 
ATOM   7387  C  CB    . TYR C  3  97  ? 18.915  1.720   13.210  1.00 30.11  ? 97   TYR C CB    1 
ATOM   7388  C  CG    . TYR C  3  97  ? 19.156  3.199   13.333  1.00 30.87  ? 97   TYR C CG    1 
ATOM   7389  C  CD1   . TYR C  3  97  ? 20.380  3.684   13.767  1.00 30.81  ? 97   TYR C CD1   1 
ATOM   7390  C  CD2   . TYR C  3  97  ? 18.118  4.107   13.138  1.00 34.88  ? 97   TYR C CD2   1 
ATOM   7391  C  CE1   . TYR C  3  97  ? 20.568  5.022   14.008  1.00 31.46  ? 97   TYR C CE1   1 
ATOM   7392  C  CE2   . TYR C  3  97  ? 18.294  5.455   13.386  1.00 33.64  ? 97   TYR C CE2   1 
ATOM   7393  C  CZ    . TYR C  3  97  ? 19.518  5.907   13.820  1.00 32.43  ? 97   TYR C CZ    1 
ATOM   7394  O  OH    . TYR C  3  97  ? 19.694  7.237   14.088  1.00 33.68  ? 97   TYR C OH    1 
ATOM   7395  N  N     . HIS C  3  98  ? 16.151  1.628   14.285  1.00 25.38  ? 98   HIS C N     1 
ATOM   7396  C  CA    . HIS C  3  98  ? 14.886  2.261   14.605  1.00 23.06  ? 98   HIS C CA    1 
ATOM   7397  C  C     . HIS C  3  98  ? 14.377  1.940   15.995  1.00 26.28  ? 98   HIS C C     1 
ATOM   7398  O  O     . HIS C  3  98  ? 13.804  2.815   16.666  1.00 25.66  ? 98   HIS C O     1 
ATOM   7399  C  CB    . HIS C  3  98  ? 13.849  1.860   13.572  1.00 24.61  ? 98   HIS C CB    1 
ATOM   7400  C  CG    . HIS C  3  98  ? 12.569  2.639   13.660  1.00 29.53  ? 98   HIS C CG    1 
ATOM   7401  N  ND1   . HIS C  3  98  ? 12.398  3.868   13.049  1.00 26.45  ? 98   HIS C ND1   1 
ATOM   7402  C  CD2   . HIS C  3  98  ? 11.391  2.348   14.266  1.00 26.70  ? 98   HIS C CD2   1 
ATOM   7403  C  CE1   . HIS C  3  98  ? 11.164  4.294   13.271  1.00 29.34  ? 98   HIS C CE1   1 
ATOM   7404  N  NE2   . HIS C  3  98  ? 10.532  3.392   14.007  1.00 28.64  ? 98   HIS C NE2   1 
ATOM   7405  N  N     . THR C  3  99  ? 14.571  0.683   16.416  1.00 23.35  ? 99   THR C N     1 
ATOM   7406  C  CA    . THR C  3  99  ? 14.122  0.208   17.716  1.00 21.95  ? 99   THR C CA    1 
ATOM   7407  C  C     . THR C  3  99  ? 14.873  0.896   18.854  1.00 23.04  ? 99   THR C C     1 
ATOM   7408  O  O     . THR C  3  99  ? 14.252  1.415   19.800  1.00 23.73  ? 99   THR C O     1 
ATOM   7409  C  CB    . THR C  3  99  ? 14.330  -1.329  17.849  1.00 22.73  ? 99   THR C CB    1 
ATOM   7410  O  OG1   . THR C  3  99  ? 13.506  -1.993  16.888  1.00 28.49  ? 99   THR C OG1   1 
ATOM   7411  C  CG2   . THR C  3  99  ? 13.963  -1.823  19.256  1.00 20.55  ? 99   THR C CG2   1 
ATOM   7412  N  N     . TRP C  3  100 ? 16.203  0.887   18.785  1.00 20.73  ? 100  TRP C N     1 
ATOM   7413  C  CA    . TRP C  3  100 ? 16.983  1.532   19.834  1.00 21.37  ? 100  TRP C CA    1 
ATOM   7414  C  C     . TRP C  3  100 ? 16.777  3.052   19.847  1.00 21.89  ? 100  TRP C C     1 
ATOM   7415  O  O     . TRP C  3  100 ? 16.631  3.665   20.923  1.00 23.62  ? 100  TRP C O     1 
ATOM   7416  C  CB    . TRP C  3  100 ? 18.482  1.226   19.666  1.00 22.53  ? 100  TRP C CB    1 
ATOM   7417  C  CG    . TRP C  3  100 ? 18.831  -0.225  19.913  1.00 26.31  ? 100  TRP C CG    1 
ATOM   7418  C  CD1   . TRP C  3  100 ? 19.249  -1.135  18.986  1.00 26.16  ? 100  TRP C CD1   1 
ATOM   7419  C  CD2   . TRP C  3  100 ? 18.774  -0.926  21.165  1.00 24.76  ? 100  TRP C CD2   1 
ATOM   7420  N  NE1   . TRP C  3  100 ? 19.455  -2.351  19.583  1.00 28.03  ? 100  TRP C NE1   1 
ATOM   7421  C  CE2   . TRP C  3  100 ? 19.166  -2.251  20.916  1.00 22.22  ? 100  TRP C CE2   1 
ATOM   7422  C  CE3   . TRP C  3  100 ? 18.427  -0.555  22.474  1.00 26.40  ? 100  TRP C CE3   1 
ATOM   7423  C  CZ2   . TRP C  3  100 ? 19.223  -3.220  21.923  1.00 29.93  ? 100  TRP C CZ2   1 
ATOM   7424  C  CZ3   . TRP C  3  100 ? 18.482  -1.515  23.481  1.00 32.43  ? 100  TRP C CZ3   1 
ATOM   7425  C  CH2   . TRP C  3  100 ? 18.878  -2.838  23.198  1.00 27.43  ? 100  TRP C CH2   1 
ATOM   7426  N  N     . ASN C  3  101 ? 16.781  3.663   18.666  1.00 23.11  ? 101  ASN C N     1 
ATOM   7427  C  CA    . ASN C  3  101 ? 16.618  5.119   18.580  1.00 26.13  ? 101  ASN C CA    1 
ATOM   7428  C  C     . ASN C  3  101 ? 15.217  5.472   19.015  1.00 28.10  ? 101  ASN C C     1 
ATOM   7429  O  O     . ASN C  3  101 ? 14.987  6.522   19.620  1.00 27.80  ? 101  ASN C O     1 
ATOM   7430  C  CB    . ASN C  3  101 ? 16.861  5.630   17.155  1.00 27.64  ? 101  ASN C CB    1 
ATOM   7431  C  CG    . ASN C  3  101 ? 17.091  7.144   17.115  1.00 31.85  ? 101  ASN C CG    1 
ATOM   7432  O  OD1   . ASN C  3  101 ? 16.674  7.825   16.175  1.00 31.76  ? 101  ASN C OD1   1 
ATOM   7433  N  ND2   . ASN C  3  101 ? 17.759  7.669   18.135  1.00 31.86  ? 101  ASN C ND2   1 
ATOM   7434  N  N     . GLY C  3  102 ? 14.279  4.574   18.711  1.00 27.56  ? 102  GLY C N     1 
ATOM   7435  C  CA    . GLY C  3  102 ? 12.908  4.790   19.097  1.00 27.07  ? 102  GLY C CA    1 
ATOM   7436  C  C     . GLY C  3  102 ? 12.813  4.875   20.606  1.00 27.25  ? 102  GLY C C     1 
ATOM   7437  O  O     . GLY C  3  102 ? 12.077  5.701   21.139  1.00 27.37  ? 102  GLY C O     1 
ATOM   7438  N  N     . ILE C  3  103 ? 13.537  4.009   21.304  1.00 27.64  ? 103  ILE C N     1 
ATOM   7439  C  CA    . ILE C  3  103 ? 13.520  4.027   22.762  1.00 27.43  ? 103  ILE C CA    1 
ATOM   7440  C  C     . ILE C  3  103 ? 14.122  5.369   23.205  1.00 25.16  ? 103  ILE C C     1 
ATOM   7441  O  O     . ILE C  3  103 ? 13.674  5.969   24.169  1.00 25.38  ? 103  ILE C O     1 
ATOM   7442  C  CB    . ILE C  3  103 ? 14.354  2.852   23.339  1.00 30.78  ? 103  ILE C CB    1 
ATOM   7443  C  CG1   . ILE C  3  103 ? 13.598  1.531   23.130  1.00 29.91  ? 103  ILE C CG1   1 
ATOM   7444  C  CG2   . ILE C  3  103 ? 14.651  3.068   24.838  1.00 22.16  ? 103  ILE C CG2   1 
ATOM   7445  C  CD1   . ILE C  3  103 ? 14.432  0.311   23.497  1.00 33.25  ? 103  ILE C CD1   1 
ATOM   7446  N  N     . ARG C  3  104 ? 15.130  5.839   22.483  1.00 26.80  ? 104  ARG C N     1 
ATOM   7447  C  CA    . ARG C  3  104 ? 15.772  7.119   22.814  1.00 29.18  ? 104  ARG C CA    1 
ATOM   7448  C  C     . ARG C  3  104 ? 14.695  8.218   22.735  1.00 27.20  ? 104  ARG C C     1 
ATOM   7449  O  O     . ARG C  3  104 ? 14.581  9.055   23.632  1.00 28.54  ? 104  ARG C O     1 
ATOM   7450  C  CB    . ARG C  3  104 ? 16.924  7.373   21.842  1.00 29.57  ? 104  ARG C CB    1 
ATOM   7451  C  CG    . ARG C  3  104 ? 17.743  8.652   22.057  1.00 30.02  ? 104  ARG C CG    1 
ATOM   7452  C  CD    . ARG C  3  104 ? 18.889  8.592   21.082  1.00 29.17  ? 104  ARG C CD    1 
ATOM   7453  N  NE    . ARG C  3  104 ? 19.649  9.821   20.976  1.00 31.20  ? 104  ARG C NE    1 
ATOM   7454  C  CZ    . ARG C  3  104 ? 19.766  10.513  19.851  1.00 32.54  ? 104  ARG C CZ    1 
ATOM   7455  N  NH1   . ARG C  3  104 ? 19.164  10.090  18.742  1.00 25.74  ? 104  ARG C NH1   1 
ATOM   7456  N  NH2   . ARG C  3  104 ? 20.493  11.620  19.833  1.00 35.21  ? 104  ARG C NH2   1 
ATOM   7457  N  N     . HIS C  3  105 ? 13.877  8.180   21.688  1.00 26.77  ? 105  HIS C N     1 
ATOM   7458  C  CA    . HIS C  3  105 ? 12.773  9.137   21.557  1.00 27.05  ? 105  HIS C CA    1 
ATOM   7459  C  C     . HIS C  3  105 ? 11.767  9.044   22.697  1.00 28.34  ? 105  HIS C C     1 
ATOM   7460  O  O     . HIS C  3  105 ? 11.289  10.069  23.189  1.00 27.91  ? 105  HIS C O     1 
ATOM   7461  C  CB    . HIS C  3  105 ? 12.024  8.927   20.251  1.00 23.25  ? 105  HIS C CB    1 
ATOM   7462  C  CG    . HIS C  3  105 ? 12.596  9.696   19.105  1.00 28.87  ? 105  HIS C CG    1 
ATOM   7463  N  ND1   . HIS C  3  105 ? 12.265  11.013  18.857  1.00 30.44  ? 105  HIS C ND1   1 
ATOM   7464  C  CD2   . HIS C  3  105 ? 13.481  9.344   18.143  1.00 27.98  ? 105  HIS C CD2   1 
ATOM   7465  C  CE1   . HIS C  3  105 ? 12.917  11.435  17.790  1.00 29.65  ? 105  HIS C CE1   1 
ATOM   7466  N  NE2   . HIS C  3  105 ? 13.662  10.442  17.335  1.00 30.82  ? 105  HIS C NE2   1 
ATOM   7467  N  N     . LEU C  3  106 ? 11.413  7.826   23.111  1.00 29.82  ? 106  LEU C N     1 
ATOM   7468  C  CA    . LEU C  3  106 ? 10.436  7.677   24.183  1.00 26.72  ? 106  LEU C CA    1 
ATOM   7469  C  C     . LEU C  3  106 ? 10.974  8.207   25.511  1.00 27.76  ? 106  LEU C C     1 
ATOM   7470  O  O     . LEU C  3  106 ? 10.206  8.686   26.346  1.00 28.88  ? 106  LEU C O     1 
ATOM   7471  C  CB    . LEU C  3  106 ? 10.001  6.215   24.325  1.00 30.06  ? 106  LEU C CB    1 
ATOM   7472  C  CG    . LEU C  3  106 ? 9.159   5.671   23.164  1.00 29.40  ? 106  LEU C CG    1 
ATOM   7473  C  CD1   . LEU C  3  106 ? 9.021   4.161   23.285  1.00 32.21  ? 106  LEU C CD1   1 
ATOM   7474  C  CD2   . LEU C  3  106 ? 7.796   6.335   23.163  1.00 26.42  ? 106  LEU C CD2   1 
ATOM   7475  N  N     . VAL C  3  107 ? 12.285  8.113   25.717  1.00 25.08  ? 107  VAL C N     1 
ATOM   7476  C  CA    . VAL C  3  107 ? 12.877  8.655   26.929  1.00 25.70  ? 107  VAL C CA    1 
ATOM   7477  C  C     . VAL C  3  107 ? 12.791  10.213  26.863  1.00 26.88  ? 107  VAL C C     1 
ATOM   7478  O  O     . VAL C  3  107 ? 12.596  10.868  27.884  1.00 22.28  ? 107  VAL C O     1 
ATOM   7479  C  CB    . VAL C  3  107 ? 14.335  8.163   27.056  1.00 27.83  ? 107  VAL C CB    1 
ATOM   7480  C  CG1   . VAL C  3  107 ? 15.052  8.913   28.142  1.00 27.03  ? 107  VAL C CG1   1 
ATOM   7481  C  CG2   . VAL C  3  107 ? 14.328  6.661   27.384  1.00 28.83  ? 107  VAL C CG2   1 
ATOM   7482  N  N     . TRP C  3  108 ? 12.932  10.798  25.662  1.00 24.68  ? 108  TRP C N     1 
ATOM   7483  C  CA    . TRP C  3  108 ? 12.820  12.264  25.504  1.00 25.62  ? 108  TRP C CA    1 
ATOM   7484  C  C     . TRP C  3  108 ? 11.383  12.681  25.783  1.00 29.02  ? 108  TRP C C     1 
ATOM   7485  O  O     . TRP C  3  108 ? 11.119  13.732  26.381  1.00 29.61  ? 108  TRP C O     1 
ATOM   7486  C  CB    . TRP C  3  108 ? 13.179  12.726  24.076  1.00 27.10  ? 108  TRP C CB    1 
ATOM   7487  C  CG    . TRP C  3  108 ? 14.653  12.916  23.828  1.00 23.81  ? 108  TRP C CG    1 
ATOM   7488  C  CD1   . TRP C  3  108 ? 15.571  13.349  24.724  1.00 27.62  ? 108  TRP C CD1   1 
ATOM   7489  C  CD2   . TRP C  3  108 ? 15.356  12.729  22.591  1.00 24.71  ? 108  TRP C CD2   1 
ATOM   7490  N  NE1   . TRP C  3  108 ? 16.807  13.443  24.132  1.00 28.28  ? 108  TRP C NE1   1 
ATOM   7491  C  CE2   . TRP C  3  108 ? 16.703  13.069  22.823  1.00 23.36  ? 108  TRP C CE2   1 
ATOM   7492  C  CE3   . TRP C  3  108 ? 14.977  12.314  21.305  1.00 18.86  ? 108  TRP C CE3   1 
ATOM   7493  C  CZ2   . TRP C  3  108 ? 17.675  13.011  21.820  1.00 22.83  ? 108  TRP C CZ2   1 
ATOM   7494  C  CZ3   . TRP C  3  108 ? 15.928  12.261  20.317  1.00 17.11  ? 108  TRP C CZ3   1 
ATOM   7495  C  CH2   . TRP C  3  108 ? 17.267  12.608  20.573  1.00 20.91  ? 108  TRP C CH2   1 
ATOM   7496  N  N     . ASP C  3  109 ? 10.439  11.863  25.335  1.00 30.04  ? 109  ASP C N     1 
ATOM   7497  C  CA    . ASP C  3  109 ? 9.055   12.200  25.572  1.00 32.76  ? 109  ASP C CA    1 
ATOM   7498  C  C     . ASP C  3  109 ? 8.732   12.151  27.068  1.00 31.34  ? 109  ASP C C     1 
ATOM   7499  O  O     . ASP C  3  109 ? 7.732   12.716  27.498  1.00 31.08  ? 109  ASP C O     1 
ATOM   7500  C  CB    . ASP C  3  109 ? 8.135   11.281  24.765  1.00 35.22  ? 109  ASP C CB    1 
ATOM   7501  C  CG    . ASP C  3  109 ? 8.290   11.481  23.251  1.00 43.52  ? 109  ASP C CG    1 
ATOM   7502  O  OD1   . ASP C  3  109 ? 8.665   12.604  22.807  1.00 40.08  ? 109  ASP C OD1   1 
ATOM   7503  O  OD2   . ASP C  3  109 ? 8.022   10.513  22.498  1.00 44.89  ? 109  ASP C OD2   1 
ATOM   7504  N  N     . MET C  3  110 ? 9.573   11.488  27.865  1.00 31.07  ? 110  MET C N     1 
ATOM   7505  C  CA    . MET C  3  110 ? 9.340   11.450  29.315  1.00 32.00  ? 110  MET C CA    1 
ATOM   7506  C  C     . MET C  3  110 ? 10.059  12.653  29.889  1.00 31.23  ? 110  MET C C     1 
ATOM   7507  O  O     . MET C  3  110 ? 10.111  12.847  31.109  1.00 31.67  ? 110  MET C O     1 
ATOM   7508  C  CB    . MET C  3  110 ? 9.895   10.173  29.961  1.00 35.99  ? 110  MET C CB    1 
ATOM   7509  C  CG    . MET C  3  110 ? 9.493   8.903   29.237  1.00 43.90  ? 110  MET C CG    1 
ATOM   7510  S  SD    . MET C  3  110 ? 9.831   7.365   30.154  1.00 54.37  ? 110  MET C SD    1 
ATOM   7511  C  CE    . MET C  3  110 ? 11.555  7.668   30.768  1.00 53.15  ? 110  MET C CE    1 
ATOM   7512  N  N     . GLY C  3  111 ? 10.638  13.444  28.986  1.00 32.75  ? 111  GLY C N     1 
ATOM   7513  C  CA    . GLY C  3  111 ? 11.339  14.658  29.362  1.00 33.82  ? 111  GLY C CA    1 
ATOM   7514  C  C     . GLY C  3  111 ? 12.751  14.444  29.881  1.00 33.90  ? 111  GLY C C     1 
ATOM   7515  O  O     . GLY C  3  111 ? 13.273  15.294  30.588  1.00 35.34  ? 111  GLY C O     1 
ATOM   7516  N  N     . LYS C  3  112 ? 13.382  13.333  29.517  1.00 33.03  ? 112  LYS C N     1 
ATOM   7517  C  CA    . LYS C  3  112 ? 14.728  13.056  29.997  1.00 32.32  ? 112  LYS C CA    1 
ATOM   7518  C  C     . LYS C  3  112 ? 15.794  13.041  28.911  1.00 29.97  ? 112  LYS C C     1 
ATOM   7519  O  O     . LYS C  3  112 ? 15.528  12.738  27.750  1.00 31.30  ? 112  LYS C O     1 
ATOM   7520  C  CB    . LYS C  3  112 ? 14.734  11.717  30.745  1.00 37.42  ? 112  LYS C CB    1 
ATOM   7521  C  CG    . LYS C  3  112 ? 13.801  11.676  31.938  1.00 42.97  ? 112  LYS C CG    1 
ATOM   7522  C  CD    . LYS C  3  112 ? 13.594  10.234  32.397  1.00 51.44  ? 112  LYS C CD    1 
ATOM   7523  C  CE    . LYS C  3  112 ? 12.488  10.122  33.444  1.00 54.27  ? 112  LYS C CE    1 
ATOM   7524  N  NZ    . LYS C  3  112 ? 12.037  8.710   33.631  1.00 58.89  ? 112  LYS C NZ    1 
ATOM   7525  N  N     . GLY C  3  113 ? 17.010  13.392  29.299  1.00 29.08  ? 113  GLY C N     1 
ATOM   7526  C  CA    . GLY C  3  113 ? 18.123  13.390  28.370  1.00 26.64  ? 113  GLY C CA    1 
ATOM   7527  C  C     . GLY C  3  113 ? 18.241  14.566  27.413  1.00 25.75  ? 113  GLY C C     1 
ATOM   7528  O  O     . GLY C  3  113 ? 18.738  14.376  26.308  1.00 23.56  ? 113  GLY C O     1 
ATOM   7529  N  N     . PHE C  3  114 ? 17.827  15.766  27.833  1.00 28.36  ? 114  PHE C N     1 
ATOM   7530  C  CA    . PHE C  3  114 ? 17.879  16.958  26.960  1.00 28.81  ? 114  PHE C CA    1 
ATOM   7531  C  C     . PHE C  3  114 ? 19.131  17.834  26.944  1.00 31.24  ? 114  PHE C C     1 
ATOM   7532  O  O     . PHE C  3  114 ? 19.265  18.722  26.080  1.00 31.40  ? 114  PHE C O     1 
ATOM   7533  C  CB    . PHE C  3  114 ? 16.649  17.833  27.190  1.00 24.51  ? 114  PHE C CB    1 
ATOM   7534  C  CG    . PHE C  3  114 ? 15.439  17.347  26.446  1.00 26.03  ? 114  PHE C CG    1 
ATOM   7535  C  CD1   . PHE C  3  114 ? 14.541  16.483  27.044  1.00 21.95  ? 114  PHE C CD1   1 
ATOM   7536  C  CD2   . PHE C  3  114 ? 15.246  17.702  25.095  1.00 22.35  ? 114  PHE C CD2   1 
ATOM   7537  C  CE1   . PHE C  3  114 ? 13.448  15.956  26.316  1.00 27.31  ? 114  PHE C CE1   1 
ATOM   7538  C  CE2   . PHE C  3  114 ? 14.164  17.187  24.353  1.00 22.74  ? 114  PHE C CE2   1 
ATOM   7539  C  CZ    . PHE C  3  114 ? 13.260  16.309  24.960  1.00 24.55  ? 114  PHE C CZ    1 
ATOM   7540  N  N     . LYS C  3  115 ? 20.054  17.604  27.872  1.00 32.32  ? 115  LYS C N     1 
ATOM   7541  C  CA    . LYS C  3  115 ? 21.288  18.382  27.849  1.00 35.79  ? 115  LYS C CA    1 
ATOM   7542  C  C     . LYS C  3  115 ? 22.056  18.017  26.589  1.00 33.65  ? 115  LYS C C     1 
ATOM   7543  O  O     . LYS C  3  115 ? 22.108  16.862  26.207  1.00 33.06  ? 115  LYS C O     1 
ATOM   7544  C  CB    . LYS C  3  115 ? 22.168  18.080  29.054  1.00 38.15  ? 115  LYS C CB    1 
ATOM   7545  C  CG    . LYS C  3  115 ? 21.698  18.683  30.353  1.00 45.93  ? 115  LYS C CG    1 
ATOM   7546  C  CD    . LYS C  3  115 ? 22.765  18.501  31.424  1.00 54.30  ? 115  LYS C CD    1 
ATOM   7547  C  CE    . LYS C  3  115 ? 24.103  19.075  30.927  1.00 62.58  ? 115  LYS C CE    1 
ATOM   7548  N  NZ    . LYS C  3  115 ? 25.173  19.187  31.978  1.00 68.43  ? 115  LYS C NZ    1 
ATOM   7549  N  N     . LEU C  3  116 ? 22.669  18.999  25.950  1.00 32.75  ? 116  LEU C N     1 
ATOM   7550  C  CA    . LEU C  3  116 ? 23.419  18.733  24.732  1.00 35.71  ? 116  LEU C CA    1 
ATOM   7551  C  C     . LEU C  3  116 ? 24.399  17.557  24.878  1.00 33.63  ? 116  LEU C C     1 
ATOM   7552  O  O     . LEU C  3  116 ? 24.567  16.755  23.956  1.00 28.22  ? 116  LEU C O     1 
ATOM   7553  C  CB    . LEU C  3  116 ? 24.165  19.995  24.303  1.00 39.07  ? 116  LEU C CB    1 
ATOM   7554  C  CG    . LEU C  3  116 ? 24.050  20.391  22.830  1.00 46.00  ? 116  LEU C CG    1 
ATOM   7555  C  CD1   . LEU C  3  116 ? 22.679  20.009  22.257  1.00 45.48  ? 116  LEU C CD1   1 
ATOM   7556  C  CD2   . LEU C  3  116 ? 24.294  21.903  22.734  1.00 45.87  ? 116  LEU C CD2   1 
ATOM   7557  N  N     . SER C  3  117 ? 25.039  17.444  26.034  1.00 30.79  ? 117  SER C N     1 
ATOM   7558  C  CA    . SER C  3  117 ? 25.979  16.345  26.232  1.00 31.71  ? 117  SER C CA    1 
ATOM   7559  C  C     . SER C  3  117 ? 25.249  14.988  26.263  1.00 29.26  ? 117  SER C C     1 
ATOM   7560  O  O     . SER C  3  117 ? 25.760  13.988  25.747  1.00 30.61  ? 117  SER C O     1 
ATOM   7561  C  CB    . SER C  3  117 ? 26.780  16.562  27.515  1.00 26.47  ? 117  SER C CB    1 
ATOM   7562  O  OG    . SER C  3  117 ? 25.889  16.710  28.606  1.00 34.80  ? 117  SER C OG    1 
ATOM   7563  N  N     . GLN C  3  118 ? 24.058  14.946  26.849  1.00 28.96  ? 118  GLN C N     1 
ATOM   7564  C  CA    . GLN C  3  118 ? 23.312  13.694  26.884  1.00 29.06  ? 118  GLN C CA    1 
ATOM   7565  C  C     . GLN C  3  118 ? 22.775  13.340  25.509  1.00 31.82  ? 118  GLN C C     1 
ATOM   7566  O  O     . GLN C  3  118 ? 22.714  12.168  25.146  1.00 35.72  ? 118  GLN C O     1 
ATOM   7567  C  CB    . GLN C  3  118 ? 22.167  13.790  27.861  1.00 26.63  ? 118  GLN C CB    1 
ATOM   7568  C  CG    . GLN C  3  118 ? 22.580  14.377  29.175  1.00 33.28  ? 118  GLN C CG    1 
ATOM   7569  C  CD    . GLN C  3  118 ? 21.399  14.609  30.088  1.00 33.98  ? 118  GLN C CD    1 
ATOM   7570  O  OE1   . GLN C  3  118 ? 20.395  15.223  29.706  1.00 34.10  ? 118  GLN C OE1   1 
ATOM   7571  N  NE2   . GLN C  3  118 ? 21.513  14.128  31.312  1.00 41.41  ? 118  GLN C NE2   1 
ATOM   7572  N  N     . VAL C  3  119 ? 22.379  14.348  24.743  1.00 32.39  ? 119  VAL C N     1 
ATOM   7573  C  CA    . VAL C  3  119 ? 21.878  14.116  23.405  1.00 30.11  ? 119  VAL C CA    1 
ATOM   7574  C  C     . VAL C  3  119 ? 22.942  13.460  22.545  1.00 32.26  ? 119  VAL C C     1 
ATOM   7575  O  O     . VAL C  3  119 ? 22.657  12.519  21.800  1.00 30.70  ? 119  VAL C O     1 
ATOM   7576  C  CB    . VAL C  3  119 ? 21.443  15.424  22.724  1.00 30.42  ? 119  VAL C CB    1 
ATOM   7577  C  CG1   . VAL C  3  119 ? 21.179  15.171  21.234  1.00 32.16  ? 119  VAL C CG1   1 
ATOM   7578  C  CG2   . VAL C  3  119 ? 20.180  15.961  23.400  1.00 27.05  ? 119  VAL C CG2   1 
ATOM   7579  N  N     . GLU C  3  120 ? 24.166  13.968  22.627  1.00 34.24  ? 120  GLU C N     1 
ATOM   7580  C  CA    . GLU C  3  120 ? 25.261  13.408  21.842  1.00 33.74  ? 120  GLU C CA    1 
ATOM   7581  C  C     . GLU C  3  120 ? 25.602  12.017  22.371  1.00 34.54  ? 120  GLU C C     1 
ATOM   7582  O  O     . GLU C  3  120 ? 25.791  11.089  21.611  1.00 36.35  ? 120  GLU C O     1 
ATOM   7583  C  CB    . GLU C  3  120 ? 26.484  14.310  21.929  1.00 37.12  ? 120  GLU C CB    1 
ATOM   7584  C  CG    . GLU C  3  120 ? 26.284  15.676  21.287  1.00 47.23  ? 120  GLU C CG    1 
ATOM   7585  C  CD    . GLU C  3  120 ? 26.617  15.679  19.811  1.00 51.16  ? 120  GLU C CD    1 
ATOM   7586  O  OE1   . GLU C  3  120 ? 26.415  14.630  19.162  1.00 58.36  ? 120  GLU C OE1   1 
ATOM   7587  O  OE2   . GLU C  3  120 ? 27.072  16.725  19.297  1.00 53.99  ? 120  GLU C OE2   1 
ATOM   7588  N  N     . GLN C  3  121 ? 25.666  11.861  23.680  1.00 34.57  ? 121  GLN C N     1 
ATOM   7589  C  CA    . GLN C  3  121 ? 26.002  10.566  24.240  1.00 36.26  ? 121  GLN C CA    1 
ATOM   7590  C  C     . GLN C  3  121 ? 24.986  9.467   23.932  1.00 35.23  ? 121  GLN C C     1 
ATOM   7591  O  O     . GLN C  3  121 ? 25.357  8.377   23.483  1.00 30.65  ? 121  GLN C O     1 
ATOM   7592  C  CB    . GLN C  3  121 ? 26.202  10.695  25.739  1.00 39.34  ? 121  GLN C CB    1 
ATOM   7593  C  CG    . GLN C  3  121 ? 27.612  11.121  26.090  1.00 48.18  ? 121  GLN C CG    1 
ATOM   7594  C  CD    . GLN C  3  121 ? 27.686  11.924  27.371  1.00 52.28  ? 121  GLN C CD    1 
ATOM   7595  O  OE1   . GLN C  3  121 ? 27.034  11.600  28.372  1.00 56.21  ? 121  GLN C OE1   1 
ATOM   7596  N  NE2   . GLN C  3  121 ? 28.497  12.978  27.351  1.00 56.01  ? 121  GLN C NE2   1 
ATOM   7597  N  N     . SER C  3  122 ? 23.709  9.756   24.147  1.00 31.87  ? 122  SER C N     1 
ATOM   7598  C  CA    . SER C  3  122 ? 22.672  8.779   23.887  1.00 31.79  ? 122  SER C CA    1 
ATOM   7599  C  C     . SER C  3  122 ? 22.674  8.348   22.423  1.00 32.40  ? 122  SER C C     1 
ATOM   7600  O  O     . SER C  3  122 ? 22.407  7.186   22.126  1.00 30.65  ? 122  SER C O     1 
ATOM   7601  C  CB    . SER C  3  122 ? 21.298  9.337   24.285  1.00 32.79  ? 122  SER C CB    1 
ATOM   7602  O  OG    . SER C  3  122 ? 20.859  10.374  23.419  1.00 31.71  ? 122  SER C OG    1 
ATOM   7603  N  N     . GLY C  3  123 ? 22.977  9.278   21.520  1.00 30.61  ? 123  GLY C N     1 
ATOM   7604  C  CA    . GLY C  3  123 ? 23.019  8.955   20.102  1.00 32.38  ? 123  GLY C CA    1 
ATOM   7605  C  C     . GLY C  3  123 ? 24.159  7.988   19.786  1.00 35.70  ? 123  GLY C C     1 
ATOM   7606  O  O     . GLY C  3  123 ? 24.030  7.097   18.938  1.00 36.30  ? 123  GLY C O     1 
ATOM   7607  N  N     . VAL C  3  124 ? 25.297  8.168   20.448  1.00 34.48  ? 124  VAL C N     1 
ATOM   7608  C  CA    . VAL C  3  124 ? 26.422  7.272   20.223  1.00 34.02  ? 124  VAL C CA    1 
ATOM   7609  C  C     . VAL C  3  124 ? 26.111  5.897   20.841  1.00 34.59  ? 124  VAL C C     1 
ATOM   7610  O  O     . VAL C  3  124 ? 26.478  4.868   20.277  1.00 33.55  ? 124  VAL C O     1 
ATOM   7611  C  CB    . VAL C  3  124 ? 27.721  7.845   20.820  1.00 34.14  ? 124  VAL C CB    1 
ATOM   7612  C  CG1   . VAL C  3  124 ? 28.791  6.753   20.896  1.00 32.76  ? 124  VAL C CG1   1 
ATOM   7613  C  CG2   . VAL C  3  124 ? 28.223  8.978   19.935  1.00 27.61  ? 124  VAL C CG2   1 
ATOM   7614  N  N     . VAL C  3  125 ? 25.425  5.875   21.982  1.00 29.99  ? 125  VAL C N     1 
ATOM   7615  C  CA    . VAL C  3  125 ? 25.075  4.609   22.582  1.00 33.15  ? 125  VAL C CA    1 
ATOM   7616  C  C     . VAL C  3  125 ? 24.130  3.864   21.646  1.00 33.17  ? 125  VAL C C     1 
ATOM   7617  O  O     . VAL C  3  125 ? 24.276  2.654   21.445  1.00 34.14  ? 125  VAL C O     1 
ATOM   7618  C  CB    . VAL C  3  125 ? 24.393  4.778   23.936  1.00 33.83  ? 125  VAL C CB    1 
ATOM   7619  C  CG1   . VAL C  3  125 ? 23.821  3.441   24.390  1.00 38.47  ? 125  VAL C CG1   1 
ATOM   7620  C  CG2   . VAL C  3  125 ? 25.386  5.275   24.947  1.00 33.15  ? 125  VAL C CG2   1 
ATOM   7621  N  N     . VAL C  3  126 ? 23.165  4.577   21.073  1.00 29.65  ? 126  VAL C N     1 
ATOM   7622  C  CA    . VAL C  3  126 ? 22.232  3.951   20.144  1.00 28.17  ? 126  VAL C CA    1 
ATOM   7623  C  C     . VAL C  3  126 ? 22.959  3.332   18.916  1.00 30.77  ? 126  VAL C C     1 
ATOM   7624  O  O     . VAL C  3  126 ? 22.548  2.271   18.393  1.00 29.13  ? 126  VAL C O     1 
ATOM   7625  C  CB    . VAL C  3  126 ? 21.130  4.973   19.679  1.00 25.16  ? 126  VAL C CB    1 
ATOM   7626  C  CG1   . VAL C  3  126 ? 20.455  4.515   18.354  1.00 18.62  ? 126  VAL C CG1   1 
ATOM   7627  C  CG2   . VAL C  3  126 ? 20.086  5.107   20.770  1.00 22.05  ? 126  VAL C CG2   1 
ATOM   7628  N  N     . LEU C  3  127 ? 24.037  3.966   18.463  1.00 27.68  ? 127  LEU C N     1 
ATOM   7629  C  CA    . LEU C  3  127 ? 24.781  3.433   17.321  1.00 27.89  ? 127  LEU C CA    1 
ATOM   7630  C  C     . LEU C  3  127 ? 25.556  2.149   17.674  1.00 31.07  ? 127  LEU C C     1 
ATOM   7631  O  O     . LEU C  3  127 ? 25.663  1.216   16.870  1.00 29.82  ? 127  LEU C O     1 
ATOM   7632  C  CB    . LEU C  3  127 ? 25.746  4.476   16.786  1.00 27.84  ? 127  LEU C CB    1 
ATOM   7633  C  CG    . LEU C  3  127 ? 25.128  5.726   16.141  1.00 30.74  ? 127  LEU C CG    1 
ATOM   7634  C  CD1   . LEU C  3  127 ? 26.258  6.557   15.552  1.00 33.84  ? 127  LEU C CD1   1 
ATOM   7635  C  CD2   . LEU C  3  127 ? 24.135  5.366   15.067  1.00 26.99  ? 127  LEU C CD2   1 
ATOM   7636  N  N     . ILE C  3  128 ? 26.092  2.092   18.884  1.00 32.13  ? 128  ILE C N     1 
ATOM   7637  C  CA    . ILE C  3  128 ? 26.822  0.915   19.312  1.00 33.39  ? 128  ILE C CA    1 
ATOM   7638  C  C     . ILE C  3  128 ? 25.860  -0.251  19.537  1.00 33.85  ? 128  ILE C C     1 
ATOM   7639  O  O     . ILE C  3  128 ? 26.127  -1.367  19.081  1.00 32.84  ? 128  ILE C O     1 
ATOM   7640  C  CB    . ILE C  3  128 ? 27.603  1.192   20.602  1.00 31.20  ? 128  ILE C CB    1 
ATOM   7641  C  CG1   . ILE C  3  128 ? 28.713  2.224   20.324  1.00 32.37  ? 128  ILE C CG1   1 
ATOM   7642  C  CG2   . ILE C  3  128 ? 28.236  -0.089  21.097  1.00 34.25  ? 128  ILE C CG2   1 
ATOM   7643  C  CD1   . ILE C  3  128 ? 29.355  2.788   21.576  1.00 30.49  ? 128  ILE C CD1   1 
ATOM   7644  N  N     . LEU C  3  129 ? 24.753  0.007   20.239  1.00 32.63  ? 129  LEU C N     1 
ATOM   7645  C  CA    . LEU C  3  129 ? 23.755  -1.025  20.498  1.00 32.48  ? 129  LEU C CA    1 
ATOM   7646  C  C     . LEU C  3  129 ? 23.220  -1.567  19.186  1.00 31.88  ? 129  LEU C C     1 
ATOM   7647  O  O     . LEU C  3  129 ? 22.907  -2.745  19.075  1.00 33.87  ? 129  LEU C O     1 
ATOM   7648  C  CB    . LEU C  3  129 ? 22.595  -0.467  21.313  1.00 34.09  ? 129  LEU C CB    1 
ATOM   7649  C  CG    . LEU C  3  129 ? 22.921  -0.173  22.771  1.00 34.91  ? 129  LEU C CG    1 
ATOM   7650  C  CD1   . LEU C  3  129 ? 21.729  0.472   23.444  1.00 34.41  ? 129  LEU C CD1   1 
ATOM   7651  C  CD2   . LEU C  3  129 ? 23.267  -1.467  23.466  1.00 40.66  ? 129  LEU C CD2   1 
ATOM   7652  N  N     . THR C  3  130 ? 23.112  -0.704  18.187  1.00 30.65  ? 130  THR C N     1 
ATOM   7653  C  CA    . THR C  3  130 ? 22.605  -1.122  16.894  1.00 30.75  ? 130  THR C CA    1 
ATOM   7654  C  C     . THR C  3  130 ? 23.572  -2.071  16.225  1.00 32.58  ? 130  THR C C     1 
ATOM   7655  O  O     . THR C  3  130 ? 23.158  -3.095  15.689  1.00 33.65  ? 130  THR C O     1 
ATOM   7656  C  CB    . THR C  3  130 ? 22.358  0.083   15.993  1.00 29.21  ? 130  THR C CB    1 
ATOM   7657  O  OG1   . THR C  3  130 ? 21.385  0.924   16.626  1.00 29.57  ? 130  THR C OG1   1 
ATOM   7658  C  CG2   . THR C  3  130 ? 21.853  -0.347  14.628  1.00 25.72  ? 130  THR C CG2   1 
ATOM   7659  N  N     . LEU C  3  131 ? 24.857  -1.742  16.261  1.00 29.61  ? 131  LEU C N     1 
ATOM   7660  C  CA    . LEU C  3  131 ? 25.852  -2.597  15.649  1.00 28.81  ? 131  LEU C CA    1 
ATOM   7661  C  C     . LEU C  3  131 ? 26.058  -3.928  16.384  1.00 29.60  ? 131  LEU C C     1 
ATOM   7662  O  O     . LEU C  3  131 ? 26.249  -4.943  15.751  1.00 32.26  ? 131  LEU C O     1 
ATOM   7663  C  CB    . LEU C  3  131 ? 27.169  -1.835  15.514  1.00 30.97  ? 131  LEU C CB    1 
ATOM   7664  C  CG    . LEU C  3  131 ? 27.048  -0.724  14.455  1.00 34.11  ? 131  LEU C CG    1 
ATOM   7665  C  CD1   . LEU C  3  131 ? 28.266  0.194   14.468  1.00 34.96  ? 131  LEU C CD1   1 
ATOM   7666  C  CD2   . LEU C  3  131 ? 26.866  -1.381  13.080  1.00 31.48  ? 131  LEU C CD2   1 
ATOM   7667  N  N     . LEU C  3  132 ? 26.015  -3.928  17.715  1.00 32.57  ? 132  LEU C N     1 
ATOM   7668  C  CA    . LEU C  3  132 ? 26.190  -5.162  18.480  1.00 31.29  ? 132  LEU C CA    1 
ATOM   7669  C  C     . LEU C  3  132 ? 25.025  -6.108  18.251  1.00 32.21  ? 132  LEU C C     1 
ATOM   7670  O  O     . LEU C  3  132 ? 25.203  -7.248  17.834  1.00 32.67  ? 132  LEU C O     1 
ATOM   7671  C  CB    . LEU C  3  132 ? 26.272  -4.889  19.974  1.00 29.55  ? 132  LEU C CB    1 
ATOM   7672  C  CG    . LEU C  3  132 ? 27.454  -4.073  20.457  1.00 36.21  ? 132  LEU C CG    1 
ATOM   7673  C  CD1   . LEU C  3  132 ? 27.342  -3.931  21.976  1.00 36.42  ? 132  LEU C CD1   1 
ATOM   7674  C  CD2   . LEU C  3  132 ? 28.762  -4.745  20.046  1.00 35.83  ? 132  LEU C CD2   1 
ATOM   7675  N  N     . SER C  3  133 ? 23.822  -5.635  18.533  1.00 30.50  ? 133  SER C N     1 
ATOM   7676  C  CA    . SER C  3  133 ? 22.650  -6.461  18.366  1.00 30.11  ? 133  SER C CA    1 
ATOM   7677  C  C     . SER C  3  133 ? 22.513  -6.966  16.940  1.00 30.56  ? 133  SER C C     1 
ATOM   7678  O  O     . SER C  3  133 ? 22.157  -8.123  16.724  1.00 33.10  ? 133  SER C O     1 
ATOM   7679  C  CB    . SER C  3  133 ? 21.403  -5.696  18.805  1.00 30.36  ? 133  SER C CB    1 
ATOM   7680  O  OG    . SER C  3  133 ? 21.197  -4.561  18.012  1.00 38.21  ? 133  SER C OG    1 
ATOM   7681  N  N     . SER C  3  134 ? 22.816  -6.125  15.960  1.00 28.27  ? 134  SER C N     1 
ATOM   7682  C  CA    . SER C  3  134 ? 22.712  -6.541  14.575  1.00 27.63  ? 134  SER C CA    1 
ATOM   7683  C  C     . SER C  3  134 ? 23.717  -7.630  14.215  1.00 30.88  ? 134  SER C C     1 
ATOM   7684  O  O     . SER C  3  134 ? 23.405  -8.543  13.438  1.00 31.32  ? 134  SER C O     1 
ATOM   7685  C  CB    . SER C  3  134 ? 22.903  -5.349  13.641  1.00 30.24  ? 134  SER C CB    1 
ATOM   7686  O  OG    . SER C  3  134 ? 21.760  -4.502  13.672  1.00 36.37  ? 134  SER C OG    1 
ATOM   7687  N  N     . ALA C  3  135 ? 24.928  -7.529  14.753  1.00 29.07  ? 135  ALA C N     1 
ATOM   7688  C  CA    . ALA C  3  135 ? 25.949  -8.530  14.473  1.00 33.16  ? 135  ALA C CA    1 
ATOM   7689  C  C     . ALA C  3  135 ? 25.607  -9.825  15.226  1.00 32.34  ? 135  ALA C C     1 
ATOM   7690  O  O     . ALA C  3  135 ? 25.829  -10.919 14.727  1.00 35.75  ? 135  ALA C O     1 
ATOM   7691  C  CB    . ALA C  3  135 ? 27.296  -8.026  14.903  1.00 33.06  ? 135  ALA C CB    1 
ATOM   7692  N  N     . GLY C  3  136 ? 25.051  -9.682  16.422  1.00 33.10  ? 136  GLY C N     1 
ATOM   7693  C  CA    . GLY C  3  136 ? 24.681  -10.836 17.216  1.00 35.10  ? 136  GLY C CA    1 
ATOM   7694  C  C     . GLY C  3  136 ? 23.527  -11.596 16.571  1.00 38.06  ? 136  GLY C C     1 
ATOM   7695  O  O     . GLY C  3  136 ? 23.522  -12.837 16.508  1.00 37.89  ? 136  GLY C O     1 
ATOM   7696  N  N     . ILE C  3  137 ? 22.546  -10.857 16.074  1.00 35.92  ? 137  ILE C N     1 
ATOM   7697  C  CA    . ILE C  3  137 ? 21.391  -11.473 15.455  1.00 36.75  ? 137  ILE C CA    1 
ATOM   7698  C  C     . ILE C  3  137 ? 21.691  -12.078 14.087  1.00 38.67  ? 137  ILE C C     1 
ATOM   7699  O  O     . ILE C  3  137 ? 21.162  -13.138 13.750  1.00 35.68  ? 137  ILE C O     1 
ATOM   7700  C  CB    . ILE C  3  137 ? 20.240  -10.449 15.356  1.00 37.47  ? 137  ILE C CB    1 
ATOM   7701  C  CG1   . ILE C  3  137 ? 19.769  -10.098 16.778  1.00 36.91  ? 137  ILE C CG1   1 
ATOM   7702  C  CG2   . ILE C  3  137 ? 19.103  -10.999 14.524  1.00 31.01  ? 137  ILE C CG2   1 
ATOM   7703  C  CD1   . ILE C  3  137 ? 18.930  -8.835  16.885  1.00 36.30  ? 137  ILE C CD1   1 
ATOM   7704  N  N     . ALA C  3  138 ? 22.549  -11.429 13.305  1.00 39.67  ? 138  ALA C N     1 
ATOM   7705  C  CA    . ALA C  3  138 ? 22.882  -11.945 11.977  1.00 41.41  ? 138  ALA C CA    1 
ATOM   7706  C  C     . ALA C  3  138 ? 23.526  -13.346 12.067  1.00 45.33  ? 138  ALA C C     1 
ATOM   7707  O  O     . ALA C  3  138 ? 23.438  -14.142 11.131  1.00 42.26  ? 138  ALA C O     1 
ATOM   7708  C  CB    . ALA C  3  138 ? 23.832  -10.980 11.258  1.00 35.74  ? 138  ALA C CB    1 
ATOM   7709  N  N     . ALA C  3  139 ? 24.201  -13.626 13.177  1.00 46.54  ? 139  ALA C N     1 
ATOM   7710  C  CA    . ALA C  3  139 ? 24.836  -14.923 13.354  1.00 53.14  ? 139  ALA C CA    1 
ATOM   7711  C  C     . ALA C  3  139 ? 23.795  -15.852 13.985  1.00 55.69  ? 139  ALA C C     1 
ATOM   7712  O  O     . ALA C  3  139 ? 24.124  -16.868 14.584  1.00 55.35  ? 139  ALA C O     1 
ATOM   7713  C  CB    . ALA C  3  139 ? 26.059  -14.786 14.248  1.00 49.57  ? 139  ALA C CB    1 
ATOM   7714  N  N     . ILE C  3  140 ? 22.537  -15.449 13.816  1.00 62.40  ? 140  ILE C N     1 
ATOM   7715  C  CA    . ILE C  3  140 ? 21.321  -16.117 14.306  1.00 66.22  ? 140  ILE C CA    1 
ATOM   7716  C  C     . ILE C  3  140 ? 21.031  -15.875 15.783  1.00 67.62  ? 140  ILE C C     1 
ATOM   7717  O  O     . ILE C  3  140 ? 21.690  -16.431 16.655  1.00 68.61  ? 140  ILE C O     1 
ATOM   7718  C  CB    . ILE C  3  140 ? 21.328  -17.630 14.030  1.00 67.31  ? 140  ILE C CB    1 
ATOM   7719  C  CG1   . ILE C  3  140 ? 21.452  -17.882 12.527  1.00 66.00  ? 140  ILE C CG1   1 
ATOM   7720  C  CG2   . ILE C  3  140 ? 20.021  -18.255 14.548  1.00 69.43  ? 140  ILE C CG2   1 
ATOM   7721  C  CD1   . ILE C  3  140 ? 21.275  -19.354 12.136  1.00 66.90  ? 140  ILE C CD1   1 
ATOM   7722  N  N     . SER C  3  141 ? 20.022  -15.042 16.037  1.00 71.81  ? 141  SER C N     1 
ATOM   7723  C  CA    . SER C  3  141 ? 19.597  -14.642 17.385  1.00 73.14  ? 141  SER C CA    1 
ATOM   7724  C  C     . SER C  3  141 ? 20.693  -13.901 18.152  1.00 73.89  ? 141  SER C C     1 
ATOM   7725  O  O     . SER C  3  141 ? 21.742  -14.517 18.434  1.00 75.11  ? 141  SER C O     1 
ATOM   7726  C  CB    . SER C  3  141 ? 19.136  -15.847 18.204  1.00 75.33  ? 141  SER C CB    1 
ATOM   7727  O  OG    . SER C  3  141 ? 18.633  -15.436 19.469  1.00 78.71  ? 141  SER C OG    1 
ATOM   7728  N  N     . SER D  4  3   ? -11.789 18.516  21.641  1.00 49.49  ? 3    SER D N     1 
ATOM   7729  C  CA    . SER D  4  3   ? -11.011 19.660  22.227  1.00 50.99  ? 3    SER D CA    1 
ATOM   7730  C  C     . SER D  4  3   ? -9.555  19.273  22.547  1.00 47.48  ? 3    SER D C     1 
ATOM   7731  O  O     . SER D  4  3   ? -8.658  20.119  22.496  1.00 48.05  ? 3    SER D O     1 
ATOM   7732  C  CB    . SER D  4  3   ? -11.711 20.204  23.490  1.00 51.68  ? 3    SER D CB    1 
ATOM   7733  O  OG    . SER D  4  3   ? -11.993 19.163  24.414  1.00 57.89  ? 3    SER D OG    1 
ATOM   7734  N  N     . LYS D  4  4   ? -9.317  18.000  22.846  1.00 40.97  ? 4    LYS D N     1 
ATOM   7735  C  CA    . LYS D  4  4   ? -7.966  17.557  23.152  1.00 39.85  ? 4    LYS D CA    1 
ATOM   7736  C  C     . LYS D  4  4   ? -7.525  16.497  22.171  1.00 37.69  ? 4    LYS D C     1 
ATOM   7737  O  O     . LYS D  4  4   ? -6.656  15.685  22.466  1.00 41.42  ? 4    LYS D O     1 
ATOM   7738  C  CB    . LYS D  4  4   ? -7.898  17.015  24.573  1.00 37.82  ? 4    LYS D CB    1 
ATOM   7739  C  CG    . LYS D  4  4   ? -8.224  18.059  25.601  1.00 42.94  ? 4    LYS D CG    1 
ATOM   7740  C  CD    . LYS D  4  4   ? -7.771  17.624  26.967  1.00 48.43  ? 4    LYS D CD    1 
ATOM   7741  C  CE    . LYS D  4  4   ? -8.066  18.708  27.993  1.00 55.16  ? 4    LYS D CE    1 
ATOM   7742  N  NZ    . LYS D  4  4   ? -7.591  18.327  29.357  1.00 57.15  ? 4    LYS D NZ    1 
ATOM   7743  N  N     . ALA D  4  5   ? -8.117  16.520  20.988  1.00 35.58  ? 5    ALA D N     1 
ATOM   7744  C  CA    . ALA D  4  5   ? -7.788  15.540  19.976  1.00 33.93  ? 5    ALA D CA    1 
ATOM   7745  C  C     . ALA D  4  5   ? -6.294  15.499  19.676  1.00 33.96  ? 5    ALA D C     1 
ATOM   7746  O  O     . ALA D  4  5   ? -5.728  14.424  19.473  1.00 33.08  ? 5    ALA D O     1 
ATOM   7747  C  CB    . ALA D  4  5   ? -8.564  15.833  18.694  1.00 32.32  ? 5    ALA D CB    1 
ATOM   7748  N  N     . ALA D  4  6   ? -5.647  16.662  19.630  1.00 29.38  ? 6    ALA D N     1 
ATOM   7749  C  CA    . ALA D  4  6   ? -4.229  16.678  19.317  1.00 27.99  ? 6    ALA D CA    1 
ATOM   7750  C  C     . ALA D  4  6   ? -3.373  15.964  20.375  1.00 26.00  ? 6    ALA D C     1 
ATOM   7751  O  O     . ALA D  4  6   ? -2.584  15.100  20.040  1.00 27.14  ? 6    ALA D O     1 
ATOM   7752  C  CB    . ALA D  4  6   ? -3.754  18.108  19.117  1.00 25.85  ? 6    ALA D CB    1 
ATOM   7753  N  N     . SER D  4  7   ? -3.517  16.320  21.640  1.00 24.43  ? 7    SER D N     1 
ATOM   7754  C  CA    . SER D  4  7   ? -2.714  15.659  22.662  1.00 27.13  ? 7    SER D CA    1 
ATOM   7755  C  C     . SER D  4  7   ? -3.100  14.183  22.783  1.00 28.10  ? 7    SER D C     1 
ATOM   7756  O  O     . SER D  4  7   ? -2.260  13.331  23.032  1.00 29.40  ? 7    SER D O     1 
ATOM   7757  C  CB    . SER D  4  7   ? -2.853  16.369  24.016  1.00 19.29  ? 7    SER D CB    1 
ATOM   7758  O  OG    . SER D  4  7   ? -4.214  16.575  24.346  1.00 29.20  ? 7    SER D OG    1 
ATOM   7759  N  N     . LEU D  4  8   ? -4.370  13.870  22.586  1.00 34.21  ? 8    LEU D N     1 
ATOM   7760  C  CA    . LEU D  4  8   ? -4.801  12.479  22.665  1.00 34.93  ? 8    LEU D CA    1 
ATOM   7761  C  C     . LEU D  4  8   ? -4.085  11.663  21.609  1.00 34.35  ? 8    LEU D C     1 
ATOM   7762  O  O     . LEU D  4  8   ? -3.561  10.599  21.914  1.00 33.05  ? 8    LEU D O     1 
ATOM   7763  C  CB    . LEU D  4  8   ? -6.313  12.368  22.469  1.00 37.81  ? 8    LEU D CB    1 
ATOM   7764  C  CG    . LEU D  4  8   ? -6.980  12.458  23.834  1.00 41.08  ? 8    LEU D CG    1 
ATOM   7765  C  CD1   . LEU D  4  8   ? -8.463  12.827  23.720  1.00 44.52  ? 8    LEU D CD1   1 
ATOM   7766  C  CD2   . LEU D  4  8   ? -6.765  11.125  24.523  1.00 42.58  ? 8    LEU D CD2   1 
ATOM   7767  N  N     . HIS D  4  9   ? -4.052  12.160  20.372  1.00 28.29  ? 9    HIS D N     1 
ATOM   7768  C  CA    . HIS D  4  9   ? -3.379  11.436  19.308  1.00 28.92  ? 9    HIS D CA    1 
ATOM   7769  C  C     . HIS D  4  9   ? -1.900  11.230  19.626  1.00 29.23  ? 9    HIS D C     1 
ATOM   7770  O  O     . HIS D  4  9   ? -1.356  10.136  19.482  1.00 30.18  ? 9    HIS D O     1 
ATOM   7771  C  CB    . HIS D  4  9   ? -3.496  12.180  17.993  1.00 33.48  ? 9    HIS D CB    1 
ATOM   7772  C  CG    . HIS D  4  9   ? -2.865  11.453  16.853  1.00 36.55  ? 9    HIS D CG    1 
ATOM   7773  N  ND1   . HIS D  4  9   ? -3.501  10.434  16.183  1.00 38.91  ? 9    HIS D ND1   1 
ATOM   7774  C  CD2   . HIS D  4  9   ? -1.651  11.589  16.270  1.00 40.46  ? 9    HIS D CD2   1 
ATOM   7775  C  CE1   . HIS D  4  9   ? -2.712  9.977   15.226  1.00 42.24  ? 9    HIS D CE1   1 
ATOM   7776  N  NE2   . HIS D  4  9   ? -1.583  10.662  15.256  1.00 43.90  ? 9    HIS D NE2   1 
ATOM   7777  N  N     . TRP D  4  10  ? -1.248  12.299  20.052  1.00 28.49  ? 10   TRP D N     1 
ATOM   7778  C  CA    . TRP D  4  10  ? 0.154   12.224  20.430  1.00 27.67  ? 10   TRP D CA    1 
ATOM   7779  C  C     . TRP D  4  10  ? 0.326   11.125  21.498  1.00 27.25  ? 10   TRP D C     1 
ATOM   7780  O  O     . TRP D  4  10  ? 1.253   10.321  21.424  1.00 25.28  ? 10   TRP D O     1 
ATOM   7781  C  CB    . TRP D  4  10  ? 0.634   13.569  21.008  1.00 22.03  ? 10   TRP D CB    1 
ATOM   7782  C  CG    . TRP D  4  10  ? 2.104   13.578  21.391  1.00 21.07  ? 10   TRP D CG    1 
ATOM   7783  C  CD1   . TRP D  4  10  ? 3.175   13.862  20.572  1.00 18.46  ? 10   TRP D CD1   1 
ATOM   7784  C  CD2   . TRP D  4  10  ? 2.654   13.336  22.692  1.00 16.23  ? 10   TRP D CD2   1 
ATOM   7785  N  NE1   . TRP D  4  10  ? 4.332   13.828  21.288  1.00 16.39  ? 10   TRP D NE1   1 
ATOM   7786  C  CE2   . TRP D  4  10  ? 4.046   13.502  22.592  1.00 20.75  ? 10   TRP D CE2   1 
ATOM   7787  C  CE3   . TRP D  4  10  ? 2.101   12.999  23.933  1.00 20.52  ? 10   TRP D CE3   1 
ATOM   7788  C  CZ2   . TRP D  4  10  ? 4.908   13.338  23.701  1.00 18.05  ? 10   TRP D CZ2   1 
ATOM   7789  C  CZ3   . TRP D  4  10  ? 2.958   12.840  25.037  1.00 18.24  ? 10   TRP D CZ3   1 
ATOM   7790  C  CH2   . TRP D  4  10  ? 4.338   13.011  24.909  1.00 13.30  ? 10   TRP D CH2   1 
ATOM   7791  N  N     . THR D  4  11  ? -0.563  11.097  22.486  1.00 27.45  ? 11   THR D N     1 
ATOM   7792  C  CA    . THR D  4  11  ? -0.466  10.094  23.541  1.00 31.59  ? 11   THR D CA    1 
ATOM   7793  C  C     . THR D  4  11  ? -0.656  8.673   22.974  1.00 33.06  ? 11   THR D C     1 
ATOM   7794  O  O     . THR D  4  11  ? 0.095   7.748   23.308  1.00 31.54  ? 11   THR D O     1 
ATOM   7795  C  CB    . THR D  4  11  ? -1.504  10.358  24.642  1.00 30.48  ? 11   THR D CB    1 
ATOM   7796  O  OG1   . THR D  4  11  ? -1.263  11.655  25.211  1.00 32.52  ? 11   THR D OG1   1 
ATOM   7797  C  CG2   . THR D  4  11  ? -1.401  9.321   25.732  1.00 32.43  ? 11   THR D CG2   1 
ATOM   7798  N  N     . SER D  4  12  ? -1.656  8.508   22.113  1.00 32.38  ? 12   SER D N     1 
ATOM   7799  C  CA    . SER D  4  12  ? -1.927  7.209   21.487  1.00 32.93  ? 12   SER D CA    1 
ATOM   7800  C  C     . SER D  4  12  ? -0.704  6.676   20.753  1.00 31.52  ? 12   SER D C     1 
ATOM   7801  O  O     . SER D  4  12  ? -0.361  5.502   20.897  1.00 30.27  ? 12   SER D O     1 
ATOM   7802  C  CB    . SER D  4  12  ? -3.093  7.309   20.498  1.00 32.18  ? 12   SER D CB    1 
ATOM   7803  O  OG    . SER D  4  12  ? -4.306  7.606   21.175  1.00 35.00  ? 12   SER D OG    1 
ATOM   7804  N  N     . GLU D  4  13  ? -0.063  7.544   19.972  1.00 31.36  ? 13   GLU D N     1 
ATOM   7805  C  CA    . GLU D  4  13  ? 1.131   7.186   19.199  1.00 33.79  ? 13   GLU D CA    1 
ATOM   7806  C  C     . GLU D  4  13  ? 2.250   6.639   20.050  1.00 33.15  ? 13   GLU D C     1 
ATOM   7807  O  O     . GLU D  4  13  ? 2.945   5.710   19.642  1.00 34.89  ? 13   GLU D O     1 
ATOM   7808  C  CB    . GLU D  4  13  ? 1.676   8.383   18.433  1.00 31.85  ? 13   GLU D CB    1 
ATOM   7809  C  CG    . GLU D  4  13  ? 0.788   8.844   17.309  1.00 35.88  ? 13   GLU D CG    1 
ATOM   7810  C  CD    . GLU D  4  13  ? 1.280   10.138  16.684  1.00 37.65  ? 13   GLU D CD    1 
ATOM   7811  O  OE1   . GLU D  4  13  ? 1.545   11.117  17.435  1.00 43.10  ? 13   GLU D OE1   1 
ATOM   7812  O  OE2   . GLU D  4  13  ? 1.398   10.178  15.443  1.00 38.67  ? 13   GLU D OE2   1 
ATOM   7813  N  N     . ARG D  4  14  ? 2.449   7.226   21.221  1.00 33.92  ? 14   ARG D N     1 
ATOM   7814  C  CA    . ARG D  4  14  ? 3.489   6.743   22.095  1.00 34.47  ? 14   ARG D CA    1 
ATOM   7815  C  C     . ARG D  4  14  ? 3.080   5.382   22.668  1.00 35.55  ? 14   ARG D C     1 
ATOM   7816  O  O     . ARG D  4  14  ? 3.893   4.449   22.697  1.00 35.78  ? 14   ARG D O     1 
ATOM   7817  C  CB    . ARG D  4  14  ? 3.757   7.737   23.222  1.00 32.80  ? 14   ARG D CB    1 
ATOM   7818  C  CG    . ARG D  4  14  ? 4.889   8.705   22.905  1.00 33.92  ? 14   ARG D CG    1 
ATOM   7819  C  CD    . ARG D  4  14  ? 4.390   9.838   22.051  1.00 37.37  ? 14   ARG D CD    1 
ATOM   7820  N  NE    . ARG D  4  14  ? 5.414   10.293  21.123  1.00 39.78  ? 14   ARG D NE    1 
ATOM   7821  C  CZ    . ARG D  4  14  ? 5.152   10.820  19.940  1.00 37.50  ? 14   ARG D CZ    1 
ATOM   7822  N  NH1   . ARG D  4  14  ? 3.895   10.957  19.552  1.00 41.07  ? 14   ARG D NH1   1 
ATOM   7823  N  NH2   . ARG D  4  14  ? 6.140   11.192  19.141  1.00 38.68  ? 14   ARG D NH2   1 
ATOM   7824  N  N     . ALA D  4  15  ? 1.826   5.267   23.112  1.00 31.22  ? 15   ALA D N     1 
ATOM   7825  C  CA    . ALA D  4  15  ? 1.336   4.013   23.675  1.00 30.14  ? 15   ALA D CA    1 
ATOM   7826  C  C     . ALA D  4  15  ? 1.565   2.890   22.651  1.00 32.27  ? 15   ALA D C     1 
ATOM   7827  O  O     . ALA D  4  15  ? 2.184   1.870   22.961  1.00 32.79  ? 15   ALA D O     1 
ATOM   7828  C  CB    . ALA D  4  15  ? -0.139  4.141   24.023  1.00 24.99  ? 15   ALA D CB    1 
ATOM   7829  N  N     . VAL D  4  16  ? 1.104   3.088   21.421  1.00 30.17  ? 16   VAL D N     1 
ATOM   7830  C  CA    . VAL D  4  16  ? 1.306   2.074   20.404  1.00 28.82  ? 16   VAL D CA    1 
ATOM   7831  C  C     . VAL D  4  16  ? 2.796   1.783   20.197  1.00 30.64  ? 16   VAL D C     1 
ATOM   7832  O  O     . VAL D  4  16  ? 3.187   0.634   20.011  1.00 29.15  ? 16   VAL D O     1 
ATOM   7833  C  CB    . VAL D  4  16  ? 0.613   2.488   19.085  1.00 29.75  ? 16   VAL D CB    1 
ATOM   7834  C  CG1   . VAL D  4  16  ? 1.092   1.636   17.922  1.00 24.77  ? 16   VAL D CG1   1 
ATOM   7835  C  CG2   . VAL D  4  16  ? -0.889  2.326   19.252  1.00 24.82  ? 16   VAL D CG2   1 
ATOM   7836  N  N     . SER D  4  17  ? 3.645   2.805   20.241  1.00 34.78  ? 17   SER D N     1 
ATOM   7837  C  CA    . SER D  4  17  ? 5.089   2.564   20.075  1.00 35.25  ? 17   SER D CA    1 
ATOM   7838  C  C     . SER D  4  17  ? 5.596   1.658   21.183  1.00 33.83  ? 17   SER D C     1 
ATOM   7839  O  O     . SER D  4  17  ? 6.410   0.772   20.942  1.00 35.95  ? 17   SER D O     1 
ATOM   7840  C  CB    . SER D  4  17  ? 5.897   3.871   20.120  1.00 36.78  ? 17   SER D CB    1 
ATOM   7841  O  OG    . SER D  4  17  ? 5.769   4.604   18.909  1.00 41.50  ? 17   SER D OG    1 
ATOM   7842  N  N     . ALA D  4  18  ? 5.132   1.907   22.401  1.00 31.12  ? 18   ALA D N     1 
ATOM   7843  C  CA    . ALA D  4  18  ? 5.537   1.119   23.549  1.00 35.04  ? 18   ALA D CA    1 
ATOM   7844  C  C     . ALA D  4  18  ? 5.113   -0.349  23.339  1.00 37.10  ? 18   ALA D C     1 
ATOM   7845  O  O     . ALA D  4  18  ? 5.915   -1.264  23.506  1.00 36.00  ? 18   ALA D O     1 
ATOM   7846  C  CB    . ALA D  4  18  ? 4.900   1.689   24.833  1.00 31.12  ? 18   ALA D CB    1 
ATOM   7847  N  N     . LEU D  4  19  ? 3.852   -0.547  22.971  1.00 38.13  ? 19   LEU D N     1 
ATOM   7848  C  CA    . LEU D  4  19  ? 3.302   -1.862  22.697  1.00 40.56  ? 19   LEU D CA    1 
ATOM   7849  C  C     . LEU D  4  19  ? 4.233   -2.623  21.764  1.00 43.84  ? 19   LEU D C     1 
ATOM   7850  O  O     . LEU D  4  19  ? 4.722   -3.701  22.116  1.00 42.30  ? 19   LEU D O     1 
ATOM   7851  C  CB    . LEU D  4  19  ? 1.938   -1.722  22.035  1.00 45.75  ? 19   LEU D CB    1 
ATOM   7852  C  CG    . LEU D  4  19  ? 1.230   -3.017  21.623  1.00 46.44  ? 19   LEU D CG    1 
ATOM   7853  C  CD1   . LEU D  4  19  ? 0.661   -3.690  22.867  1.00 43.82  ? 19   LEU D CD1   1 
ATOM   7854  C  CD2   . LEU D  4  19  ? 0.101   -2.714  20.642  1.00 45.88  ? 19   LEU D CD2   1 
ATOM   7855  N  N     . LEU D  4  20  ? 4.473   -2.071  20.573  1.00 42.50  ? 20   LEU D N     1 
ATOM   7856  C  CA    . LEU D  4  20  ? 5.367   -2.724  19.622  1.00 45.10  ? 20   LEU D CA    1 
ATOM   7857  C  C     . LEU D  4  20  ? 6.635   -3.184  20.326  1.00 46.22  ? 20   LEU D C     1 
ATOM   7858  O  O     . LEU D  4  20  ? 7.109   -4.311  20.143  1.00 47.01  ? 20   LEU D O     1 
ATOM   7859  C  CB    . LEU D  4  20  ? 5.773   -1.779  18.490  1.00 45.27  ? 20   LEU D CB    1 
ATOM   7860  C  CG    . LEU D  4  20  ? 4.905   -1.688  17.248  1.00 45.89  ? 20   LEU D CG    1 
ATOM   7861  C  CD1   . LEU D  4  20  ? 5.671   -0.916  16.207  1.00 48.42  ? 20   LEU D CD1   1 
ATOM   7862  C  CD2   . LEU D  4  20  ? 4.588   -3.078  16.725  1.00 47.94  ? 20   LEU D CD2   1 
ATOM   7863  N  N     . LEU D  4  21  ? 7.189   -2.302  21.137  1.00 46.48  ? 21   LEU D N     1 
ATOM   7864  C  CA    . LEU D  4  21  ? 8.408   -2.628  21.847  1.00 47.50  ? 21   LEU D CA    1 
ATOM   7865  C  C     . LEU D  4  21  ? 8.214   -3.916  22.642  1.00 47.39  ? 21   LEU D C     1 
ATOM   7866  O  O     . LEU D  4  21  ? 9.022   -4.827  22.545  1.00 49.35  ? 21   LEU D O     1 
ATOM   7867  C  CB    . LEU D  4  21  ? 8.795   -1.472  22.765  1.00 45.84  ? 21   LEU D CB    1 
ATOM   7868  C  CG    . LEU D  4  21  ? 10.209  -1.506  23.334  1.00 47.13  ? 21   LEU D CG    1 
ATOM   7869  C  CD1   . LEU D  4  21  ? 11.248  -1.743  22.226  1.00 40.62  ? 21   LEU D CD1   1 
ATOM   7870  C  CD2   . LEU D  4  21  ? 10.436  -0.190  24.062  1.00 46.70  ? 21   LEU D CD2   1 
ATOM   7871  N  N     . GLY D  4  22  ? 7.131   -3.993  23.411  1.00 47.44  ? 22   GLY D N     1 
ATOM   7872  C  CA    . GLY D  4  22  ? 6.863   -5.186  24.193  1.00 45.07  ? 22   GLY D CA    1 
ATOM   7873  C  C     . GLY D  4  22  ? 6.578   -6.421  23.347  1.00 44.60  ? 22   GLY D C     1 
ATOM   7874  O  O     . GLY D  4  22  ? 6.865   -7.542  23.770  1.00 44.94  ? 22   GLY D O     1 
ATOM   7875  N  N     . LEU D  4  23  ? 6.010   -6.237  22.156  1.00 43.01  ? 23   LEU D N     1 
ATOM   7876  C  CA    . LEU D  4  23  ? 5.705   -7.380  21.296  1.00 40.90  ? 23   LEU D CA    1 
ATOM   7877  C  C     . LEU D  4  23  ? 6.953   -8.049  20.742  1.00 41.26  ? 23   LEU D C     1 
ATOM   7878  O  O     . LEU D  4  23  ? 6.913   -9.214  20.373  1.00 39.34  ? 23   LEU D O     1 
ATOM   7879  C  CB    . LEU D  4  23  ? 4.783   -6.972  20.148  1.00 36.80  ? 23   LEU D CB    1 
ATOM   7880  C  CG    . LEU D  4  23  ? 3.311   -6.725  20.493  1.00 38.98  ? 23   LEU D CG    1 
ATOM   7881  C  CD1   . LEU D  4  23  ? 2.565   -6.231  19.248  1.00 41.83  ? 23   LEU D CD1   1 
ATOM   7882  C  CD2   . LEU D  4  23  ? 2.673   -8.002  21.010  1.00 38.38  ? 23   LEU D CD2   1 
ATOM   7883  N  N     . LEU D  4  24  ? 8.065   -7.324  20.678  1.00 43.60  ? 24   LEU D N     1 
ATOM   7884  C  CA    . LEU D  4  24  ? 9.290   -7.924  20.178  1.00 45.69  ? 24   LEU D CA    1 
ATOM   7885  C  C     . LEU D  4  24  ? 9.679   -9.107  21.068  1.00 47.54  ? 24   LEU D C     1 
ATOM   7886  O  O     . LEU D  4  24  ? 9.777   -10.240 20.589  1.00 45.26  ? 24   LEU D O     1 
ATOM   7887  C  CB    . LEU D  4  24  ? 10.427  -6.897  20.123  1.00 46.60  ? 24   LEU D CB    1 
ATOM   7888  C  CG    . LEU D  4  24  ? 10.204  -5.802  19.075  1.00 51.52  ? 24   LEU D CG    1 
ATOM   7889  C  CD1   . LEU D  4  24  ? 11.483  -4.975  18.905  1.00 52.41  ? 24   LEU D CD1   1 
ATOM   7890  C  CD2   . LEU D  4  24  ? 9.801   -6.442  17.739  1.00 51.66  ? 24   LEU D CD2   1 
ATOM   7891  N  N     . PRO D  4  25  ? 9.889   -8.863  22.376  1.00 47.78  ? 25   PRO D N     1 
ATOM   7892  C  CA    . PRO D  4  25  ? 10.261  -9.926  23.315  1.00 48.33  ? 25   PRO D CA    1 
ATOM   7893  C  C     . PRO D  4  25  ? 9.182   -11.007 23.346  1.00 47.74  ? 25   PRO D C     1 
ATOM   7894  O  O     . PRO D  4  25  ? 9.465   -12.204 23.397  1.00 47.59  ? 25   PRO D O     1 
ATOM   7895  C  CB    . PRO D  4  25  ? 10.342  -9.193  24.655  1.00 48.35  ? 25   PRO D CB    1 
ATOM   7896  C  CG    . PRO D  4  25  ? 10.642  -7.789  24.264  1.00 50.25  ? 25   PRO D CG    1 
ATOM   7897  C  CD    . PRO D  4  25  ? 9.744   -7.585  23.088  1.00 47.73  ? 25   PRO D CD    1 
ATOM   7898  N  N     . ALA D  4  26  ? 7.933   -10.564 23.320  1.00 46.97  ? 26   ALA D N     1 
ATOM   7899  C  CA    . ALA D  4  26  ? 6.807   -11.472 23.352  1.00 45.89  ? 26   ALA D CA    1 
ATOM   7900  C  C     . ALA D  4  26  ? 6.840   -12.445 22.185  1.00 46.63  ? 26   ALA D C     1 
ATOM   7901  O  O     . ALA D  4  26  ? 6.556   -13.625 22.355  1.00 48.51  ? 26   ALA D O     1 
ATOM   7902  C  CB    . ALA D  4  26  ? 5.526   -10.683 23.338  1.00 46.63  ? 26   ALA D CB    1 
ATOM   7903  N  N     . ALA D  4  27  ? 7.189   -11.946 21.004  1.00 47.22  ? 27   ALA D N     1 
ATOM   7904  C  CA    . ALA D  4  27  ? 7.248   -12.769 19.798  1.00 50.23  ? 27   ALA D CA    1 
ATOM   7905  C  C     . ALA D  4  27  ? 8.300   -13.857 19.946  1.00 53.19  ? 27   ALA D C     1 
ATOM   7906  O  O     . ALA D  4  27  ? 8.162   -14.957 19.403  1.00 52.19  ? 27   ALA D O     1 
ATOM   7907  C  CB    . ALA D  4  27  ? 7.559   -11.899 18.572  1.00 47.24  ? 27   ALA D CB    1 
ATOM   7908  N  N     . TYR D  4  28  ? 9.353   -13.539 20.688  1.00 55.10  ? 28   TYR D N     1 
ATOM   7909  C  CA    . TYR D  4  28  ? 10.423  -14.484 20.911  1.00 57.46  ? 28   TYR D CA    1 
ATOM   7910  C  C     . TYR D  4  28  ? 10.058  -15.489 21.988  1.00 57.61  ? 28   TYR D C     1 
ATOM   7911  O  O     . TYR D  4  28  ? 10.380  -16.664 21.872  1.00 59.25  ? 28   TYR D O     1 
ATOM   7912  C  CB    . TYR D  4  28  ? 11.689  -13.760 21.337  1.00 59.52  ? 28   TYR D CB    1 
ATOM   7913  C  CG    . TYR D  4  28  ? 12.861  -14.686 21.528  1.00 61.90  ? 28   TYR D CG    1 
ATOM   7914  C  CD1   . TYR D  4  28  ? 13.503  -15.261 20.431  1.00 64.36  ? 28   TYR D CD1   1 
ATOM   7915  C  CD2   . TYR D  4  28  ? 13.337  -14.986 22.805  1.00 64.00  ? 28   TYR D CD2   1 
ATOM   7916  C  CE1   . TYR D  4  28  ? 14.597  -16.113 20.598  1.00 66.18  ? 28   TYR D CE1   1 
ATOM   7917  C  CE2   . TYR D  4  28  ? 14.432  -15.836 22.990  1.00 65.53  ? 28   TYR D CE2   1 
ATOM   7918  C  CZ    . TYR D  4  28  ? 15.057  -16.394 21.882  1.00 66.87  ? 28   TYR D CZ    1 
ATOM   7919  O  OH    . TYR D  4  28  ? 16.149  -17.216 22.051  1.00 68.00  ? 28   TYR D OH    1 
ATOM   7920  N  N     . LEU D  4  29  ? 9.384   -15.031 23.035  1.00 58.12  ? 29   LEU D N     1 
ATOM   7921  C  CA    . LEU D  4  29  ? 9.026   -15.915 24.135  1.00 58.22  ? 29   LEU D CA    1 
ATOM   7922  C  C     . LEU D  4  29  ? 7.721   -16.665 23.987  1.00 57.94  ? 29   LEU D C     1 
ATOM   7923  O  O     . LEU D  4  29  ? 7.572   -17.747 24.549  1.00 58.65  ? 29   LEU D O     1 
ATOM   7924  C  CB    . LEU D  4  29  ? 8.999   -15.141 25.446  1.00 57.55  ? 29   LEU D CB    1 
ATOM   7925  C  CG    . LEU D  4  29  ? 10.303  -14.457 25.833  1.00 59.97  ? 29   LEU D CG    1 
ATOM   7926  C  CD1   . LEU D  4  29  ? 10.165  -13.960 27.263  1.00 61.69  ? 29   LEU D CD1   1 
ATOM   7927  C  CD2   . LEU D  4  29  ? 11.479  -15.420 25.703  1.00 61.33  ? 29   LEU D CD2   1 
ATOM   7928  N  N     . TYR D  4  30  ? 6.775   -16.099 23.240  1.00 57.85  ? 30   TYR D N     1 
ATOM   7929  C  CA    . TYR D  4  30  ? 5.478   -16.741 23.058  1.00 54.04  ? 30   TYR D CA    1 
ATOM   7930  C  C     . TYR D  4  30  ? 4.928   -16.656 21.644  1.00 52.98  ? 30   TYR D C     1 
ATOM   7931  O  O     . TYR D  4  30  ? 3.857   -16.097 21.426  1.00 52.96  ? 30   TYR D O     1 
ATOM   7932  C  CB    . TYR D  4  30  ? 4.462   -16.138 24.018  1.00 56.29  ? 30   TYR D CB    1 
ATOM   7933  C  CG    . TYR D  4  30  ? 4.989   -15.987 25.415  1.00 61.88  ? 30   TYR D CG    1 
ATOM   7934  C  CD1   . TYR D  4  30  ? 5.721   -14.860 25.785  1.00 64.15  ? 30   TYR D CD1   1 
ATOM   7935  C  CD2   . TYR D  4  30  ? 4.805   -16.995 26.361  1.00 63.83  ? 30   TYR D CD2   1 
ATOM   7936  C  CE1   . TYR D  4  30  ? 6.262   -14.742 27.066  1.00 68.42  ? 30   TYR D CE1   1 
ATOM   7937  C  CE2   . TYR D  4  30  ? 5.343   -16.890 27.643  1.00 66.64  ? 30   TYR D CE2   1 
ATOM   7938  C  CZ    . TYR D  4  30  ? 6.069   -15.764 27.988  1.00 68.70  ? 30   TYR D CZ    1 
ATOM   7939  O  OH    . TYR D  4  30  ? 6.604   -15.660 29.249  1.00 71.28  ? 30   TYR D OH    1 
ATOM   7940  N  N     . PRO D  4  31  ? 5.639   -17.228 20.662  1.00 52.51  ? 31   PRO D N     1 
ATOM   7941  C  CA    . PRO D  4  31  ? 5.167   -17.188 19.272  1.00 53.91  ? 31   PRO D CA    1 
ATOM   7942  C  C     . PRO D  4  31  ? 3.728   -17.677 19.216  1.00 55.47  ? 31   PRO D C     1 
ATOM   7943  O  O     . PRO D  4  31  ? 3.238   -18.269 20.170  1.00 55.53  ? 31   PRO D O     1 
ATOM   7944  C  CB    . PRO D  4  31  ? 6.109   -18.144 18.557  1.00 53.25  ? 31   PRO D CB    1 
ATOM   7945  C  CG    . PRO D  4  31  ? 7.359   -18.064 19.372  1.00 53.64  ? 31   PRO D CG    1 
ATOM   7946  C  CD    . PRO D  4  31  ? 6.853   -18.055 20.783  1.00 52.08  ? 31   PRO D CD    1 
ATOM   7947  N  N     . GLY D  4  32  ? 3.044   -17.430 18.109  1.00 56.92  ? 32   GLY D N     1 
ATOM   7948  C  CA    . GLY D  4  32  ? 1.675   -17.891 18.016  1.00 58.96  ? 32   GLY D CA    1 
ATOM   7949  C  C     . GLY D  4  32  ? 0.660   -16.827 17.649  1.00 59.87  ? 32   GLY D C     1 
ATOM   7950  O  O     . GLY D  4  32  ? 0.979   -15.638 17.614  1.00 59.17  ? 32   GLY D O     1 
ATOM   7951  N  N     . PRO D  4  33  ? -0.593  -17.238 17.396  1.00 59.38  ? 33   PRO D N     1 
ATOM   7952  C  CA    . PRO D  4  33  ? -1.705  -16.364 17.021  1.00 57.12  ? 33   PRO D CA    1 
ATOM   7953  C  C     . PRO D  4  33  ? -1.851  -15.063 17.803  1.00 53.45  ? 33   PRO D C     1 
ATOM   7954  O  O     . PRO D  4  33  ? -1.951  -13.996 17.206  1.00 52.84  ? 33   PRO D O     1 
ATOM   7955  C  CB    . PRO D  4  33  ? -2.930  -17.283 17.156  1.00 58.58  ? 33   PRO D CB    1 
ATOM   7956  C  CG    . PRO D  4  33  ? -2.494  -18.303 18.169  1.00 58.78  ? 33   PRO D CG    1 
ATOM   7957  C  CD    . PRO D  4  33  ? -1.091  -18.590 17.711  1.00 60.51  ? 33   PRO D CD    1 
ATOM   7958  N  N     . ALA D  4  34  ? -1.878  -15.145 19.127  1.00 50.64  ? 34   ALA D N     1 
ATOM   7959  C  CA    . ALA D  4  34  ? -2.034  -13.943 19.936  1.00 48.61  ? 34   ALA D CA    1 
ATOM   7960  C  C     . ALA D  4  34  ? -1.035  -12.878 19.497  1.00 48.16  ? 34   ALA D C     1 
ATOM   7961  O  O     . ALA D  4  34  ? -1.420  -11.781 19.075  1.00 46.84  ? 34   ALA D O     1 
ATOM   7962  C  CB    . ALA D  4  34  ? -1.839  -14.263 21.402  1.00 49.73  ? 34   ALA D CB    1 
ATOM   7963  N  N     . VAL D  4  35  ? 0.244   -13.206 19.599  1.00 44.01  ? 35   VAL D N     1 
ATOM   7964  C  CA    . VAL D  4  35  ? 1.282   -12.283 19.197  1.00 45.73  ? 35   VAL D CA    1 
ATOM   7965  C  C     . VAL D  4  35  ? 1.195   -11.973 17.708  1.00 45.06  ? 35   VAL D C     1 
ATOM   7966  O  O     . VAL D  4  35  ? 1.315   -10.812 17.314  1.00 44.01  ? 35   VAL D O     1 
ATOM   7967  C  CB    . VAL D  4  35  ? 2.683   -12.842 19.511  1.00 43.11  ? 35   VAL D CB    1 
ATOM   7968  C  CG1   . VAL D  4  35  ? 3.756   -11.968 18.875  1.00 46.94  ? 35   VAL D CG1   1 
ATOM   7969  C  CG2   . VAL D  4  35  ? 2.883   -12.892 21.015  1.00 47.06  ? 35   VAL D CG2   1 
ATOM   7970  N  N     . ASP D  4  36  ? 0.972   -12.994 16.885  1.00 43.37  ? 36   ASP D N     1 
ATOM   7971  C  CA    . ASP D  4  36  ? 0.909   -12.777 15.442  1.00 46.33  ? 36   ASP D CA    1 
ATOM   7972  C  C     . ASP D  4  36  ? -0.108  -11.728 15.009  1.00 45.93  ? 36   ASP D C     1 
ATOM   7973  O  O     . ASP D  4  36  ? 0.177   -10.920 14.118  1.00 42.20  ? 36   ASP D O     1 
ATOM   7974  C  CB    . ASP D  4  36  ? 0.640   -14.091 14.703  1.00 50.77  ? 36   ASP D CB    1 
ATOM   7975  C  CG    . ASP D  4  36  ? 1.910   -14.889 14.469  1.00 56.93  ? 36   ASP D CG    1 
ATOM   7976  O  OD1   . ASP D  4  36  ? 2.483   -15.411 15.447  1.00 62.66  ? 36   ASP D OD1   1 
ATOM   7977  O  OD2   . ASP D  4  36  ? 2.351   -14.984 13.307  1.00 60.36  ? 36   ASP D OD2   1 
ATOM   7978  N  N     . TYR D  4  37  ? -1.287  -11.743 15.630  1.00 43.18  ? 37   TYR D N     1 
ATOM   7979  C  CA    . TYR D  4  37  ? -2.321  -10.773 15.298  1.00 44.68  ? 37   TYR D CA    1 
ATOM   7980  C  C     . TYR D  4  37  ? -2.073  -9.416  15.965  1.00 44.10  ? 37   TYR D C     1 
ATOM   7981  O  O     . TYR D  4  37  ? -2.409  -8.368  15.410  1.00 40.23  ? 37   TYR D O     1 
ATOM   7982  C  CB    . TYR D  4  37  ? -3.684  -11.324 15.691  1.00 45.73  ? 37   TYR D CB    1 
ATOM   7983  C  CG    . TYR D  4  37  ? -4.129  -12.391 14.729  1.00 50.55  ? 37   TYR D CG    1 
ATOM   7984  C  CD1   . TYR D  4  37  ? -4.545  -12.059 13.444  1.00 47.69  ? 37   TYR D CD1   1 
ATOM   7985  C  CD2   . TYR D  4  37  ? -4.079  -13.744 15.083  1.00 51.68  ? 37   TYR D CD2   1 
ATOM   7986  C  CE1   . TYR D  4  37  ? -4.901  -13.040 12.524  1.00 52.98  ? 37   TYR D CE1   1 
ATOM   7987  C  CE2   . TYR D  4  37  ? -4.431  -14.737 14.172  1.00 54.45  ? 37   TYR D CE2   1 
ATOM   7988  C  CZ    . TYR D  4  37  ? -4.844  -14.378 12.892  1.00 55.01  ? 37   TYR D CZ    1 
ATOM   7989  O  OH    . TYR D  4  37  ? -5.205  -15.353 11.985  1.00 56.88  ? 37   TYR D OH    1 
ATOM   7990  N  N     . SER D  4  38  ? -1.478  -9.432  17.151  1.00 41.46  ? 38   SER D N     1 
ATOM   7991  C  CA    . SER D  4  38  ? -1.186  -8.182  17.820  1.00 42.49  ? 38   SER D CA    1 
ATOM   7992  C  C     . SER D  4  38  ? -0.174  -7.410  16.990  1.00 42.63  ? 38   SER D C     1 
ATOM   7993  O  O     . SER D  4  38  ? -0.346  -6.218  16.759  1.00 43.91  ? 38   SER D O     1 
ATOM   7994  C  CB    . SER D  4  38  ? -0.645  -8.450  19.212  1.00 41.65  ? 38   SER D CB    1 
ATOM   7995  O  OG    . SER D  4  38  ? -1.680  -8.975  20.013  1.00 37.54  ? 38   SER D OG    1 
ATOM   7996  N  N     . LEU D  4  39  ? 0.873   -8.095  16.538  1.00 42.04  ? 39   LEU D N     1 
ATOM   7997  C  CA    . LEU D  4  39  ? 1.882   -7.469  15.700  1.00 42.02  ? 39   LEU D CA    1 
ATOM   7998  C  C     . LEU D  4  39  ? 1.230   -6.934  14.438  1.00 41.52  ? 39   LEU D C     1 
ATOM   7999  O  O     . LEU D  4  39  ? 1.539   -5.825  14.008  1.00 41.70  ? 39   LEU D O     1 
ATOM   8000  C  CB    . LEU D  4  39  ? 2.979   -8.463  15.310  1.00 43.55  ? 39   LEU D CB    1 
ATOM   8001  C  CG    . LEU D  4  39  ? 4.011   -8.719  16.409  1.00 46.21  ? 39   LEU D CG    1 
ATOM   8002  C  CD1   . LEU D  4  39  ? 4.941   -9.853  15.983  1.00 45.53  ? 39   LEU D CD1   1 
ATOM   8003  C  CD2   . LEU D  4  39  ? 4.796   -7.429  16.694  1.00 44.54  ? 39   LEU D CD2   1 
ATOM   8004  N  N     . ALA D  4  40  ? 0.335   -7.714  13.843  1.00 36.36  ? 40   ALA D N     1 
ATOM   8005  C  CA    . ALA D  4  40  ? -0.342  -7.266  12.621  1.00 37.69  ? 40   ALA D CA    1 
ATOM   8006  C  C     . ALA D  4  40  ? -1.067  -5.932  12.871  1.00 37.25  ? 40   ALA D C     1 
ATOM   8007  O  O     . ALA D  4  40  ? -1.021  -5.019  12.050  1.00 37.69  ? 40   ALA D O     1 
ATOM   8008  C  CB    . ALA D  4  40  ? -1.342  -8.325  12.145  1.00 33.06  ? 40   ALA D CB    1 
ATOM   8009  N  N     . ALA D  4  41  ? -1.720  -5.824  14.019  1.00 35.95  ? 41   ALA D N     1 
ATOM   8010  C  CA    . ALA D  4  41  ? -2.446  -4.613  14.365  1.00 37.31  ? 41   ALA D CA    1 
ATOM   8011  C  C     . ALA D  4  41  ? -1.503  -3.437  14.733  1.00 37.79  ? 41   ALA D C     1 
ATOM   8012  O  O     . ALA D  4  41  ? -1.638  -2.329  14.207  1.00 35.57  ? 41   ALA D O     1 
ATOM   8013  C  CB    . ALA D  4  41  ? -3.390  -4.916  15.506  1.00 36.86  ? 41   ALA D CB    1 
ATOM   8014  N  N     . ALA D  4  42  ? -0.550  -3.689  15.627  1.00 38.09  ? 42   ALA D N     1 
ATOM   8015  C  CA    . ALA D  4  42  ? 0.397   -2.664  16.058  1.00 37.90  ? 42   ALA D CA    1 
ATOM   8016  C  C     . ALA D  4  42  ? 1.272   -2.183  14.912  1.00 39.58  ? 42   ALA D C     1 
ATOM   8017  O  O     . ALA D  4  42  ? 1.460   -0.979  14.741  1.00 41.98  ? 42   ALA D O     1 
ATOM   8018  C  CB    . ALA D  4  42  ? 1.254   -3.189  17.193  1.00 37.48  ? 42   ALA D CB    1 
ATOM   8019  N  N     . LEU D  4  43  ? 1.813   -3.105  14.121  1.00 39.93  ? 43   LEU D N     1 
ATOM   8020  C  CA    . LEU D  4  43  ? 2.642   -2.705  12.981  1.00 41.15  ? 43   LEU D CA    1 
ATOM   8021  C  C     . LEU D  4  43  ? 1.861   -1.846  11.992  1.00 39.94  ? 43   LEU D C     1 
ATOM   8022  O  O     . LEU D  4  43  ? 2.403   -0.919  11.388  1.00 39.34  ? 43   LEU D O     1 
ATOM   8023  C  CB    . LEU D  4  43  ? 3.170   -3.918  12.217  1.00 40.34  ? 43   LEU D CB    1 
ATOM   8024  C  CG    . LEU D  4  43  ? 4.297   -4.770  12.803  1.00 41.02  ? 43   LEU D CG    1 
ATOM   8025  C  CD1   . LEU D  4  43  ? 4.561   -5.952  11.836  1.00 40.37  ? 43   LEU D CD1   1 
ATOM   8026  C  CD2   . LEU D  4  43  ? 5.547   -3.937  12.976  1.00 36.15  ? 43   LEU D CD2   1 
ATOM   8027  N  N     . THR D  4  44  ? 0.592   -2.165  11.800  1.00 36.79  ? 44   THR D N     1 
ATOM   8028  C  CA    . THR D  4  44  ? -0.186  -1.398  10.854  1.00 37.66  ? 44   THR D CA    1 
ATOM   8029  C  C     . THR D  4  44  ? -0.477  -0.007  11.400  1.00 35.99  ? 44   THR D C     1 
ATOM   8030  O  O     . THR D  4  44  ? -0.253  0.982   10.721  1.00 38.09  ? 44   THR D O     1 
ATOM   8031  C  CB    . THR D  4  44  ? -1.509  -2.110  10.505  1.00 38.56  ? 44   THR D CB    1 
ATOM   8032  O  OG1   . THR D  4  44  ? -1.208  -3.378  9.910   1.00 41.22  ? 44   THR D OG1   1 
ATOM   8033  C  CG2   . THR D  4  44  ? -2.316  -1.279  9.496   1.00 39.82  ? 44   THR D CG2   1 
ATOM   8034  N  N     . LEU D  4  45  ? -0.941  0.057   12.643  1.00 36.44  ? 45   LEU D N     1 
ATOM   8035  C  CA    . LEU D  4  45  ? -1.287  1.319   13.285  1.00 34.75  ? 45   LEU D CA    1 
ATOM   8036  C  C     . LEU D  4  45  ? -0.072  2.254   13.472  1.00 35.47  ? 45   LEU D C     1 
ATOM   8037  O  O     . LEU D  4  45  ? -0.123  3.420   13.076  1.00 38.87  ? 45   LEU D O     1 
ATOM   8038  C  CB    . LEU D  4  45  ? -1.972  1.017   14.616  1.00 34.94  ? 45   LEU D CB    1 
ATOM   8039  C  CG    . LEU D  4  45  ? -2.672  2.156   15.344  1.00 38.71  ? 45   LEU D CG    1 
ATOM   8040  C  CD1   . LEU D  4  45  ? -3.588  2.900   14.391  1.00 39.27  ? 45   LEU D CD1   1 
ATOM   8041  C  CD2   . LEU D  4  45  ? -3.459  1.592   16.508  1.00 36.43  ? 45   LEU D CD2   1 
ATOM   8042  N  N     . HIS D  4  46  ? 1.007   1.752   14.068  1.00 33.94  ? 46   HIS D N     1 
ATOM   8043  C  CA    . HIS D  4  46  ? 2.230   2.537   14.273  1.00 29.34  ? 46   HIS D CA    1 
ATOM   8044  C  C     . HIS D  4  46  ? 2.691   3.057   12.921  1.00 26.64  ? 46   HIS D C     1 
ATOM   8045  O  O     . HIS D  4  46  ? 3.045   4.214   12.784  1.00 25.21  ? 46   HIS D O     1 
ATOM   8046  C  CB    . HIS D  4  46  ? 3.327   1.658   14.865  1.00 27.01  ? 46   HIS D CB    1 
ATOM   8047  C  CG    . HIS D  4  46  ? 4.634   2.361   15.093  1.00 29.86  ? 46   HIS D CG    1 
ATOM   8048  N  ND1   . HIS D  4  46  ? 4.860   3.167   16.188  1.00 33.55  ? 46   HIS D ND1   1 
ATOM   8049  C  CD2   . HIS D  4  46  ? 5.801   2.327   14.410  1.00 25.46  ? 46   HIS D CD2   1 
ATOM   8050  C  CE1   . HIS D  4  46  ? 6.110   3.591   16.172  1.00 31.46  ? 46   HIS D CE1   1 
ATOM   8051  N  NE2   . HIS D  4  46  ? 6.704   3.097   15.105  1.00 28.67  ? 46   HIS D NE2   1 
ATOM   8052  N  N     . GLY D  4  47  ? 2.660   2.195   11.913  1.00 30.31  ? 47   GLY D N     1 
ATOM   8053  C  CA    . GLY D  4  47  ? 3.089   2.599   10.583  1.00 27.25  ? 47   GLY D CA    1 
ATOM   8054  C  C     . GLY D  4  47  ? 2.179   3.634   9.940   1.00 29.37  ? 47   GLY D C     1 
ATOM   8055  O  O     . GLY D  4  47  ? 2.672   4.565   9.291   1.00 27.66  ? 47   GLY D O     1 
ATOM   8056  N  N     . HIS D  4  48  ? 0.862   3.482   10.109  1.00 27.07  ? 48   HIS D N     1 
ATOM   8057  C  CA    . HIS D  4  48  ? -0.101  4.405   9.504   1.00 27.40  ? 48   HIS D CA    1 
ATOM   8058  C  C     . HIS D  4  48  ? 0.131   5.806   10.038  1.00 29.65  ? 48   HIS D C     1 
ATOM   8059  O  O     . HIS D  4  48  ? 0.232   6.767   9.262   1.00 24.30  ? 48   HIS D O     1 
ATOM   8060  C  CB    . HIS D  4  48  ? -1.540  3.987   9.821   1.00 28.11  ? 48   HIS D CB    1 
ATOM   8061  C  CG    . HIS D  4  48  ? -2.576  4.896   9.233   1.00 31.92  ? 48   HIS D CG    1 
ATOM   8062  N  ND1   . HIS D  4  48  ? -2.685  5.118   7.874   1.00 32.44  ? 48   HIS D ND1   1 
ATOM   8063  C  CD2   . HIS D  4  48  ? -3.538  5.653   9.815   1.00 32.45  ? 48   HIS D CD2   1 
ATOM   8064  C  CE1   . HIS D  4  48  ? -3.666  5.974   7.646   1.00 30.82  ? 48   HIS D CE1   1 
ATOM   8065  N  NE2   . HIS D  4  48  ? -4.199  6.315   8.805   1.00 31.24  ? 48   HIS D NE2   1 
ATOM   8066  N  N     . TRP D  4  49  ? 0.217   5.913   11.365  1.00 27.83  ? 49   TRP D N     1 
ATOM   8067  C  CA    . TRP D  4  49  ? 0.431   7.200   12.012  1.00 26.76  ? 49   TRP D CA    1 
ATOM   8068  C  C     . TRP D  4  49  ? 1.767   7.817   11.657  1.00 27.75  ? 49   TRP D C     1 
ATOM   8069  O  O     . TRP D  4  49  ? 1.855   9.028   11.450  1.00 27.95  ? 49   TRP D O     1 
ATOM   8070  C  CB    . TRP D  4  49  ? 0.301   7.046   13.517  1.00 22.89  ? 49   TRP D CB    1 
ATOM   8071  C  CG    . TRP D  4  49  ? -1.130  6.885   13.933  1.00 22.72  ? 49   TRP D CG    1 
ATOM   8072  C  CD1   . TRP D  4  49  ? -2.224  7.309   13.241  1.00 22.39  ? 49   TRP D CD1   1 
ATOM   8073  C  CD2   . TRP D  4  49  ? -1.624  6.345   15.165  1.00 19.59  ? 49   TRP D CD2   1 
ATOM   8074  N  NE1   . TRP D  4  49  ? -3.367  7.078   13.968  1.00 23.38  ? 49   TRP D NE1   1 
ATOM   8075  C  CE2   . TRP D  4  49  ? -3.024  6.484   15.152  1.00 22.63  ? 49   TRP D CE2   1 
ATOM   8076  C  CE3   . TRP D  4  49  ? -1.016  5.757   16.281  1.00 25.22  ? 49   TRP D CE3   1 
ATOM   8077  C  CZ2   . TRP D  4  49  ? -3.831  6.061   16.213  1.00 24.14  ? 49   TRP D CZ2   1 
ATOM   8078  C  CZ3   . TRP D  4  49  ? -1.816  5.334   17.335  1.00 23.08  ? 49   TRP D CZ3   1 
ATOM   8079  C  CH2   . TRP D  4  49  ? -3.207  5.490   17.293  1.00 23.15  ? 49   TRP D CH2   1 
ATOM   8080  N  N     . GLY D  4  50  ? 2.791   6.974   11.538  1.00 27.05  ? 50   GLY D N     1 
ATOM   8081  C  CA    . GLY D  4  50  ? 4.124   7.450   11.216  1.00 26.52  ? 50   GLY D CA    1 
ATOM   8082  C  C     . GLY D  4  50  ? 4.207   8.076   9.842   1.00 30.48  ? 50   GLY D C     1 
ATOM   8083  O  O     . GLY D  4  50  ? 4.761   9.171   9.656   1.00 28.56  ? 50   GLY D O     1 
ATOM   8084  N  N     . LEU D  4  51  ? 3.663   7.378   8.860   1.00 30.31  ? 51   LEU D N     1 
ATOM   8085  C  CA    . LEU D  4  51  ? 3.677   7.896   7.501   1.00 31.31  ? 51   LEU D CA    1 
ATOM   8086  C  C     . LEU D  4  51  ? 2.768   9.109   7.502   1.00 29.03  ? 51   LEU D C     1 
ATOM   8087  O  O     . LEU D  4  51  ? 2.964   10.038  6.721   1.00 32.23  ? 51   LEU D O     1 
ATOM   8088  C  CB    . LEU D  4  51  ? 3.176   6.843   6.517   1.00 28.89  ? 51   LEU D CB    1 
ATOM   8089  C  CG    . LEU D  4  51  ? 4.103   5.630   6.421   1.00 29.90  ? 51   LEU D CG    1 
ATOM   8090  C  CD1   . LEU D  4  51  ? 3.494   4.584   5.472   1.00 30.98  ? 51   LEU D CD1   1 
ATOM   8091  C  CD2   . LEU D  4  51  ? 5.459   6.090   5.899   1.00 27.80  ? 51   LEU D CD2   1 
ATOM   8092  N  N     . GLY D  4  52  ? 1.783   9.092   8.398   1.00 24.94  ? 52   GLY D N     1 
ATOM   8093  C  CA    . GLY D  4  52  ? 0.865   10.206  8.520   1.00 28.11  ? 52   GLY D CA    1 
ATOM   8094  C  C     . GLY D  4  52  ? 1.627   11.468  8.929   1.00 30.36  ? 52   GLY D C     1 
ATOM   8095  O  O     . GLY D  4  52  ? 1.368   12.567  8.421   1.00 30.53  ? 52   GLY D O     1 
ATOM   8096  N  N     . GLN D  4  53  ? 2.571   11.314  9.855   1.00 28.46  ? 53   GLN D N     1 
ATOM   8097  C  CA    . GLN D  4  53  ? 3.372   12.441  10.295  1.00 28.14  ? 53   GLN D CA    1 
ATOM   8098  C  C     . GLN D  4  53  ? 4.276   12.884  9.165   1.00 27.77  ? 53   GLN D C     1 
ATOM   8099  O  O     . GLN D  4  53  ? 4.553   14.075  9.031   1.00 27.10  ? 53   GLN D O     1 
ATOM   8100  C  CB    . GLN D  4  53  ? 4.234   12.079  11.498  1.00 26.20  ? 53   GLN D CB    1 
ATOM   8101  C  CG    . GLN D  4  53  ? 3.436   11.835  12.763  1.00 27.46  ? 53   GLN D CG    1 
ATOM   8102  C  CD    . GLN D  4  53  ? 2.768   13.100  13.295  1.00 31.03  ? 53   GLN D CD    1 
ATOM   8103  O  OE1   . GLN D  4  53  ? 2.053   13.059  14.290  1.00 37.38  ? 53   GLN D OE1   1 
ATOM   8104  N  NE2   . GLN D  4  53  ? 2.989   14.209  12.633  1.00 27.36  ? 53   GLN D NE2   1 
ATOM   8105  N  N     . VAL D  4  54  ? 4.734   11.941  8.354   1.00 25.94  ? 54   VAL D N     1 
ATOM   8106  C  CA    . VAL D  4  54  ? 5.625   12.289  7.255   1.00 25.36  ? 54   VAL D CA    1 
ATOM   8107  C  C     . VAL D  4  54  ? 4.867   13.126  6.226   1.00 27.41  ? 54   VAL D C     1 
ATOM   8108  O  O     . VAL D  4  54  ? 5.408   14.084  5.665   1.00 26.48  ? 54   VAL D O     1 
ATOM   8109  C  CB    . VAL D  4  54  ? 6.216   11.018  6.606   1.00 23.13  ? 54   VAL D CB    1 
ATOM   8110  C  CG1   . VAL D  4  54  ? 6.902   11.360  5.287   1.00 20.24  ? 54   VAL D CG1   1 
ATOM   8111  C  CG2   . VAL D  4  54  ? 7.246   10.391  7.554   1.00 24.39  ? 54   VAL D CG2   1 
ATOM   8112  N  N     . ILE D  4  55  ? 3.600   12.780  6.014   1.00 25.50  ? 55   ILE D N     1 
ATOM   8113  C  CA    . ILE D  4  55  ? 2.755   13.494  5.070   1.00 28.06  ? 55   ILE D CA    1 
ATOM   8114  C  C     . ILE D  4  55  ? 2.474   14.922  5.551   1.00 26.69  ? 55   ILE D C     1 
ATOM   8115  O  O     . ILE D  4  55  ? 2.554   15.875  4.781   1.00 22.54  ? 55   ILE D O     1 
ATOM   8116  C  CB    . ILE D  4  55  ? 1.405   12.741  4.875   1.00 25.96  ? 55   ILE D CB    1 
ATOM   8117  C  CG1   . ILE D  4  55  ? 1.640   11.520  3.980   1.00 26.14  ? 55   ILE D CG1   1 
ATOM   8118  C  CG2   . ILE D  4  55  ? 0.335   13.652  4.264   1.00 26.40  ? 55   ILE D CG2   1 
ATOM   8119  C  CD1   . ILE D  4  55  ? 0.414   10.648  3.865   1.00 21.01  ? 55   ILE D CD1   1 
ATOM   8120  N  N     . THR D  4  56  ? 2.133   15.051  6.824   1.00 27.42  ? 56   THR D N     1 
ATOM   8121  C  CA    . THR D  4  56  ? 1.825   16.357  7.385   1.00 27.60  ? 56   THR D CA    1 
ATOM   8122  C  C     . THR D  4  56  ? 3.001   17.308  7.271   1.00 30.01  ? 56   THR D C     1 
ATOM   8123  O  O     . THR D  4  56  ? 2.815   18.504  7.049   1.00 32.67  ? 56   THR D O     1 
ATOM   8124  C  CB    . THR D  4  56  ? 1.404   16.229  8.843   1.00 27.75  ? 56   THR D CB    1 
ATOM   8125  O  OG1   . THR D  4  56  ? 0.281   15.344  8.913   1.00 29.83  ? 56   THR D OG1   1 
ATOM   8126  C  CG2   . THR D  4  56  ? 1.007   17.594  9.421   1.00 21.23  ? 56   THR D CG2   1 
ATOM   8127  N  N     . ASP D  4  57  ? 4.212   16.776  7.403   1.00 30.36  ? 57   ASP D N     1 
ATOM   8128  C  CA    . ASP D  4  57  ? 5.425   17.577  7.304   1.00 27.44  ? 57   ASP D CA    1 
ATOM   8129  C  C     . ASP D  4  57  ? 5.751   18.051  5.899   1.00 25.20  ? 57   ASP D C     1 
ATOM   8130  O  O     . ASP D  4  57  ? 6.089   19.206  5.688   1.00 26.68  ? 57   ASP D O     1 
ATOM   8131  C  CB    . ASP D  4  57  ? 6.658   16.784  7.785   1.00 29.34  ? 57   ASP D CB    1 
ATOM   8132  C  CG    . ASP D  4  57  ? 6.743   16.661  9.306   1.00 33.87  ? 57   ASP D CG    1 
ATOM   8133  O  OD1   . ASP D  4  57  ? 5.951   17.317  10.029  1.00 32.23  ? 57   ASP D OD1   1 
ATOM   8134  O  OD2   . ASP D  4  57  ? 7.629   15.898  9.763   1.00 31.12  ? 57   ASP D OD2   1 
ATOM   8135  N  N     . TYR D  4  58  ? 5.668   17.157  4.935   1.00 24.59  ? 58   TYR D N     1 
ATOM   8136  C  CA    . TYR D  4  58  ? 6.082   17.495  3.587   1.00 26.94  ? 58   TYR D CA    1 
ATOM   8137  C  C     . TYR D  4  58  ? 5.057   17.805  2.510   1.00 28.14  ? 58   TYR D C     1 
ATOM   8138  O  O     . TYR D  4  58  ? 5.411   18.393  1.491   1.00 29.73  ? 58   TYR D O     1 
ATOM   8139  C  CB    . TYR D  4  58  ? 7.001   16.389  3.066   1.00 26.19  ? 58   TYR D CB    1 
ATOM   8140  C  CG    . TYR D  4  58  ? 8.158   16.046  3.983   1.00 30.85  ? 58   TYR D CG    1 
ATOM   8141  C  CD1   . TYR D  4  58  ? 8.961   17.047  4.522   1.00 30.50  ? 58   TYR D CD1   1 
ATOM   8142  C  CD2   . TYR D  4  58  ? 8.467   14.716  4.291   1.00 33.58  ? 58   TYR D CD2   1 
ATOM   8143  C  CE1   . TYR D  4  58  ? 10.032  16.743  5.340   1.00 34.24  ? 58   TYR D CE1   1 
ATOM   8144  C  CE2   . TYR D  4  58  ? 9.547   14.396  5.112   1.00 33.61  ? 58   TYR D CE2   1 
ATOM   8145  C  CZ    . TYR D  4  58  ? 10.326  15.415  5.639   1.00 36.48  ? 58   TYR D CZ    1 
ATOM   8146  O  OH    . TYR D  4  58  ? 11.401  15.140  6.464   1.00 29.08  ? 58   TYR D OH    1 
ATOM   8147  N  N     . VAL D  4  59  ? 3.811   17.394  2.695   1.00 29.87  ? 59   VAL D N     1 
ATOM   8148  C  CA    . VAL D  4  59  ? 2.801   17.654  1.686   1.00 30.89  ? 59   VAL D CA    1 
ATOM   8149  C  C     . VAL D  4  59  ? 1.989   18.886  2.066   1.00 31.96  ? 59   VAL D C     1 
ATOM   8150  O  O     . VAL D  4  59  ? 1.489   18.979  3.190   1.00 32.89  ? 59   VAL D O     1 
ATOM   8151  C  CB    . VAL D  4  59  ? 1.813   16.472  1.547   1.00 31.86  ? 59   VAL D CB    1 
ATOM   8152  C  CG1   . VAL D  4  59  ? 0.789   16.793  0.448   1.00 30.58  ? 59   VAL D CG1   1 
ATOM   8153  C  CG2   . VAL D  4  59  ? 2.560   15.180  1.216   1.00 29.08  ? 59   VAL D CG2   1 
ATOM   8154  N  N     . HIS D  4  60  ? 1.857   19.836  1.150   1.00 29.43  ? 60   HIS D N     1 
ATOM   8155  C  CA    . HIS D  4  60  ? 1.059   21.032  1.454   1.00 33.32  ? 60   HIS D CA    1 
ATOM   8156  C  C     . HIS D  4  60  ? 0.115   21.310  0.302   1.00 33.47  ? 60   HIS D C     1 
ATOM   8157  O  O     . HIS D  4  60  ? 0.360   20.872  -0.822  1.00 34.67  ? 60   HIS D O     1 
ATOM   8158  C  CB    . HIS D  4  60  ? 1.946   22.250  1.697   1.00 30.35  ? 60   HIS D CB    1 
ATOM   8159  C  CG    . HIS D  4  60  ? 3.088   21.980  2.613   1.00 32.12  ? 60   HIS D CG    1 
ATOM   8160  N  ND1   . HIS D  4  60  ? 4.314   21.540  2.165   1.00 34.92  ? 60   HIS D ND1   1 
ATOM   8161  C  CD2   . HIS D  4  60  ? 3.170   22.020  3.963   1.00 33.00  ? 60   HIS D CD2   1 
ATOM   8162  C  CE1   . HIS D  4  60  ? 5.101   21.317  3.203   1.00 34.48  ? 60   HIS D CE1   1 
ATOM   8163  N  NE2   . HIS D  4  60  ? 4.429   21.600  4.303   1.00 29.05  ? 60   HIS D NE2   1 
ATOM   8164  N  N     . GLY D  4  61  ? -0.939  22.065  0.584   1.00 33.84  ? 61   GLY D N     1 
ATOM   8165  C  CA    . GLY D  4  61  ? -1.944  22.348  -0.422  1.00 38.04  ? 61   GLY D CA    1 
ATOM   8166  C  C     . GLY D  4  61  ? -3.076  21.414  -0.045  1.00 40.03  ? 61   GLY D C     1 
ATOM   8167  O  O     . GLY D  4  61  ? -2.878  20.196  0.066   1.00 38.46  ? 61   GLY D O     1 
ATOM   8168  N  N     . ASP D  4  62  ? -4.255  21.980  0.168   1.00 43.23  ? 62   ASP D N     1 
ATOM   8169  C  CA    . ASP D  4  62  ? -5.414  21.210  0.589   1.00 46.47  ? 62   ASP D CA    1 
ATOM   8170  C  C     . ASP D  4  62  ? -5.718  19.962  -0.230  1.00 44.74  ? 62   ASP D C     1 
ATOM   8171  O  O     . ASP D  4  62  ? -6.017  18.914  0.333   1.00 42.24  ? 62   ASP D O     1 
ATOM   8172  C  CB    . ASP D  4  62  ? -6.642  22.127  0.665   1.00 53.52  ? 62   ASP D CB    1 
ATOM   8173  C  CG    . ASP D  4  62  ? -6.533  23.170  1.805   1.00 62.27  ? 62   ASP D CG    1 
ATOM   8174  O  OD1   . ASP D  4  62  ? -6.325  22.761  2.974   1.00 65.39  ? 62   ASP D OD1   1 
ATOM   8175  O  OD2   . ASP D  4  62  ? -6.656  24.395  1.539   1.00 66.86  ? 62   ASP D OD2   1 
ATOM   8176  N  N     . THR D  4  63  ? -5.632  20.052  -1.550  1.00 43.89  ? 63   THR D N     1 
ATOM   8177  C  CA    . THR D  4  63  ? -5.926  18.877  -2.362  1.00 43.10  ? 63   THR D CA    1 
ATOM   8178  C  C     . THR D  4  63  ? -4.815  17.841  -2.245  1.00 40.25  ? 63   THR D C     1 
ATOM   8179  O  O     . THR D  4  63  ? -5.067  16.674  -1.949  1.00 36.95  ? 63   THR D O     1 
ATOM   8180  C  CB    . THR D  4  63  ? -6.159  19.257  -3.849  1.00 46.03  ? 63   THR D CB    1 
ATOM   8181  O  OG1   . THR D  4  63  ? -7.429  19.908  -3.967  1.00 47.51  ? 63   THR D OG1   1 
ATOM   8182  C  CG2   . THR D  4  63  ? -6.153  18.018  -4.748  1.00 45.84  ? 63   THR D CG2   1 
ATOM   8183  N  N     . PRO D  4  64  ? -3.567  18.249  -2.505  1.00 38.90  ? 64   PRO D N     1 
ATOM   8184  C  CA    . PRO D  4  64  ? -2.482  17.275  -2.389  1.00 36.94  ? 64   PRO D CA    1 
ATOM   8185  C  C     . PRO D  4  64  ? -2.524  16.520  -1.031  1.00 37.26  ? 64   PRO D C     1 
ATOM   8186  O  O     . PRO D  4  64  ? -2.288  15.316  -0.982  1.00 38.87  ? 64   PRO D O     1 
ATOM   8187  C  CB    . PRO D  4  64  ? -1.236  18.138  -2.559  1.00 35.57  ? 64   PRO D CB    1 
ATOM   8188  C  CG    . PRO D  4  64  ? -1.707  19.197  -3.543  1.00 35.65  ? 64   PRO D CG    1 
ATOM   8189  C  CD    . PRO D  4  64  ? -3.085  19.541  -3.035  1.00 35.74  ? 64   PRO D CD    1 
ATOM   8190  N  N     . ILE D  4  65  ? -2.835  17.219  0.057   1.00 34.69  ? 65   ILE D N     1 
ATOM   8191  C  CA    . ILE D  4  65  ? -2.898  16.589  1.376   1.00 36.07  ? 65   ILE D CA    1 
ATOM   8192  C  C     . ILE D  4  65  ? -4.036  15.573  1.480   1.00 40.33  ? 65   ILE D C     1 
ATOM   8193  O  O     . ILE D  4  65  ? -3.859  14.475  2.027   1.00 40.42  ? 65   ILE D O     1 
ATOM   8194  C  CB    . ILE D  4  65  ? -3.074  17.652  2.504   1.00 35.10  ? 65   ILE D CB    1 
ATOM   8195  C  CG1   . ILE D  4  65  ? -1.845  18.560  2.563   1.00 34.69  ? 65   ILE D CG1   1 
ATOM   8196  C  CG2   . ILE D  4  65  ? -3.250  16.979  3.862   1.00 31.83  ? 65   ILE D CG2   1 
ATOM   8197  C  CD1   . ILE D  4  65  ? -1.960  19.704  3.561   1.00 30.78  ? 65   ILE D CD1   1 
ATOM   8198  N  N     . LYS D  4  66  ? -5.215  15.931  0.980   1.00 41.94  ? 66   LYS D N     1 
ATOM   8199  C  CA    . LYS D  4  66  ? -6.337  15.000  1.045   1.00 45.20  ? 66   LYS D CA    1 
ATOM   8200  C  C     . LYS D  4  66  ? -6.012  13.775  0.204   1.00 44.72  ? 66   LYS D C     1 
ATOM   8201  O  O     . LYS D  4  66  ? -6.249  12.643  0.626   1.00 46.29  ? 66   LYS D O     1 
ATOM   8202  C  CB    . LYS D  4  66  ? -7.629  15.656  0.552   1.00 47.69  ? 66   LYS D CB    1 
ATOM   8203  C  CG    . LYS D  4  66  ? -8.121  16.774  1.459   1.00 53.79  ? 66   LYS D CG    1 
ATOM   8204  C  CD    . LYS D  4  66  ? -9.337  17.501  0.882   1.00 58.82  ? 66   LYS D CD    1 
ATOM   8205  C  CE    . LYS D  4  66  ? -9.713  18.716  1.737   1.00 63.18  ? 66   LYS D CE    1 
ATOM   8206  N  NZ    . LYS D  4  66  ? -10.782 19.559  1.121   1.00 64.53  ? 66   LYS D NZ    1 
ATOM   8207  N  N     . VAL D  4  67  ? -5.447  14.003  -0.974  1.00 42.94  ? 67   VAL D N     1 
ATOM   8208  C  CA    . VAL D  4  67  ? -5.086  12.902  -1.843  1.00 43.39  ? 67   VAL D CA    1 
ATOM   8209  C  C     . VAL D  4  67  ? -4.091  11.976  -1.158  1.00 43.19  ? 67   VAL D C     1 
ATOM   8210  O  O     . VAL D  4  67  ? -4.281  10.762  -1.130  1.00 46.11  ? 67   VAL D O     1 
ATOM   8211  C  CB    . VAL D  4  67  ? -4.475  13.417  -3.154  1.00 44.43  ? 67   VAL D CB    1 
ATOM   8212  C  CG1   . VAL D  4  67  ? -3.933  12.265  -3.967  1.00 40.57  ? 67   VAL D CG1   1 
ATOM   8213  C  CG2   . VAL D  4  67  ? -5.531  14.165  -3.944  1.00 42.12  ? 67   VAL D CG2   1 
ATOM   8214  N  N     . ALA D  4  68  ? -3.033  12.552  -0.601  1.00 43.22  ? 68   ALA D N     1 
ATOM   8215  C  CA    . ALA D  4  68  ? -1.997  11.775  0.071   1.00 42.12  ? 68   ALA D CA    1 
ATOM   8216  C  C     . ALA D  4  68  ? -2.551  10.966  1.230   1.00 41.97  ? 68   ALA D C     1 
ATOM   8217  O  O     . ALA D  4  68  ? -2.148  9.814   1.444   1.00 38.24  ? 68   ALA D O     1 
ATOM   8218  C  CB    . ALA D  4  68  ? -0.887  12.686  0.572   1.00 40.99  ? 68   ALA D CB    1 
ATOM   8219  N  N     . ASN D  4  69  ? -3.455  11.564  1.993   1.00 40.38  ? 69   ASN D N     1 
ATOM   8220  C  CA    . ASN D  4  69  ? -4.018  10.841  3.110   1.00 41.96  ? 69   ASN D CA    1 
ATOM   8221  C  C     . ASN D  4  69  ? -5.001  9.760   2.699   1.00 43.43  ? 69   ASN D C     1 
ATOM   8222  O  O     . ASN D  4  69  ? -5.159  8.772   3.422   1.00 42.15  ? 69   ASN D O     1 
ATOM   8223  C  CB    . ASN D  4  69  ? -4.661  11.792  4.111   1.00 42.02  ? 69   ASN D CB    1 
ATOM   8224  C  CG    . ASN D  4  69  ? -3.628  12.547  4.924   1.00 45.33  ? 69   ASN D CG    1 
ATOM   8225  O  OD1   . ASN D  4  69  ? -3.396  13.737  4.706   1.00 45.24  ? 69   ASN D OD1   1 
ATOM   8226  N  ND2   . ASN D  4  69  ? -2.982  11.849  5.857   1.00 43.06  ? 69   ASN D ND2   1 
ATOM   8227  N  N     . THR D  4  70  ? -5.661  9.927   1.553   1.00 43.58  ? 70   THR D N     1 
ATOM   8228  C  CA    . THR D  4  70  ? -6.598  8.897   1.113   1.00 44.71  ? 70   THR D CA    1 
ATOM   8229  C  C     . THR D  4  70  ? -5.757  7.685   0.726   1.00 45.68  ? 70   THR D C     1 
ATOM   8230  O  O     . THR D  4  70  ? -6.053  6.551   1.118   1.00 45.95  ? 70   THR D O     1 
ATOM   8231  C  CB    . THR D  4  70  ? -7.461  9.344   -0.103  1.00 44.76  ? 70   THR D CB    1 
ATOM   8232  O  OG1   . THR D  4  70  ? -8.315  10.428  0.283   1.00 45.40  ? 70   THR D OG1   1 
ATOM   8233  C  CG2   . THR D  4  70  ? -8.346  8.193   -0.574  1.00 41.37  ? 70   THR D CG2   1 
ATOM   8234  N  N     . GLY D  4  71  ? -4.690  7.941   -0.025  1.00 44.37  ? 71   GLY D N     1 
ATOM   8235  C  CA    . GLY D  4  71  ? -3.800  6.872   -0.436  1.00 43.78  ? 71   GLY D CA    1 
ATOM   8236  C  C     . GLY D  4  71  ? -3.236  6.098   0.740   1.00 42.23  ? 71   GLY D C     1 
ATOM   8237  O  O     . GLY D  4  71  ? -3.289  4.874   0.757   1.00 39.05  ? 71   GLY D O     1 
ATOM   8238  N  N     . LEU D  4  72  ? -2.689  6.807   1.724   1.00 40.39  ? 72   LEU D N     1 
ATOM   8239  C  CA    . LEU D  4  72  ? -2.129  6.151   2.897   1.00 38.15  ? 72   LEU D CA    1 
ATOM   8240  C  C     . LEU D  4  72  ? -3.158  5.210   3.501   1.00 37.24  ? 72   LEU D C     1 
ATOM   8241  O  O     . LEU D  4  72  ? -2.866  4.062   3.762   1.00 37.35  ? 72   LEU D O     1 
ATOM   8242  C  CB    . LEU D  4  72  ? -1.687  7.182   3.956   1.00 32.52  ? 72   LEU D CB    1 
ATOM   8243  C  CG    . LEU D  4  72  ? -1.149  6.569   5.261   1.00 32.87  ? 72   LEU D CG    1 
ATOM   8244  C  CD1   . LEU D  4  72  ? 0.138   5.822   4.936   1.00 31.38  ? 72   LEU D CD1   1 
ATOM   8245  C  CD2   . LEU D  4  72  ? -0.892  7.627   6.331   1.00 29.51  ? 72   LEU D CD2   1 
ATOM   8246  N  N     . TYR D  4  73  ? -4.367  5.700   3.716   1.00 40.18  ? 73   TYR D N     1 
ATOM   8247  C  CA    . TYR D  4  73  ? -5.436  4.889   4.301   1.00 43.37  ? 73   TYR D CA    1 
ATOM   8248  C  C     . TYR D  4  73  ? -5.681  3.590   3.504   1.00 43.20  ? 73   TYR D C     1 
ATOM   8249  O  O     . TYR D  4  73  ? -6.000  2.533   4.065   1.00 39.48  ? 73   TYR D O     1 
ATOM   8250  C  CB    . TYR D  4  73  ? -6.717  5.719   4.351   1.00 50.20  ? 73   TYR D CB    1 
ATOM   8251  C  CG    . TYR D  4  73  ? -7.752  5.187   5.292   1.00 57.59  ? 73   TYR D CG    1 
ATOM   8252  C  CD1   . TYR D  4  73  ? -7.635  5.379   6.673   1.00 60.65  ? 73   TYR D CD1   1 
ATOM   8253  C  CD2   . TYR D  4  73  ? -8.851  4.463   4.808   1.00 63.03  ? 73   TYR D CD2   1 
ATOM   8254  C  CE1   . TYR D  4  73  ? -8.597  4.860   7.564   1.00 65.69  ? 73   TYR D CE1   1 
ATOM   8255  C  CE2   . TYR D  4  73  ? -9.823  3.933   5.685   1.00 66.88  ? 73   TYR D CE2   1 
ATOM   8256  C  CZ    . TYR D  4  73  ? -9.692  4.134   7.061   1.00 67.61  ? 73   TYR D CZ    1 
ATOM   8257  O  OH    . TYR D  4  73  ? -10.648 3.611   7.916   1.00 68.43  ? 73   TYR D OH    1 
ATOM   8258  N  N     . VAL D  4  74  ? -5.535  3.681   2.189   1.00 43.78  ? 74   VAL D N     1 
ATOM   8259  C  CA    . VAL D  4  74  ? -5.724  2.543   1.298   1.00 43.89  ? 74   VAL D CA    1 
ATOM   8260  C  C     . VAL D  4  74  ? -4.594  1.533   1.508   1.00 45.48  ? 74   VAL D C     1 
ATOM   8261  O  O     . VAL D  4  74  ? -4.828  0.323   1.536   1.00 45.73  ? 74   VAL D O     1 
ATOM   8262  C  CB    . VAL D  4  74  ? -5.733  3.010   -0.185  1.00 45.33  ? 74   VAL D CB    1 
ATOM   8263  C  CG1   . VAL D  4  74  ? -5.567  1.826   -1.130  1.00 46.32  ? 74   VAL D CG1   1 
ATOM   8264  C  CG2   . VAL D  4  74  ? -7.034  3.740   -0.485  1.00 47.20  ? 74   VAL D CG2   1 
ATOM   8265  N  N     . LEU D  4  75  ? -3.371  2.039   1.645   1.00 41.74  ? 75   LEU D N     1 
ATOM   8266  C  CA    . LEU D  4  75  ? -2.210  1.199   1.853   1.00 39.43  ? 75   LEU D CA    1 
ATOM   8267  C  C     . LEU D  4  75  ? -2.300  0.482   3.194   1.00 40.04  ? 75   LEU D C     1 
ATOM   8268  O  O     . LEU D  4  75  ? -2.027  -0.708  3.280   1.00 41.69  ? 75   LEU D O     1 
ATOM   8269  C  CB    . LEU D  4  75  ? -0.942  2.047   1.801   1.00 40.24  ? 75   LEU D CB    1 
ATOM   8270  C  CG    . LEU D  4  75  ? 0.411   1.362   2.021   1.00 37.94  ? 75   LEU D CG    1 
ATOM   8271  C  CD1   . LEU D  4  75  ? 0.581   0.204   1.059   1.00 35.23  ? 75   LEU D CD1   1 
ATOM   8272  C  CD2   . LEU D  4  75  ? 1.511   2.398   1.830   1.00 38.33  ? 75   LEU D CD2   1 
ATOM   8273  N  N     . SER D  4  76  ? -2.695  1.199   4.239   1.00 39.34  ? 76   SER D N     1 
ATOM   8274  C  CA    . SER D  4  76  ? -2.814  0.603   5.567   1.00 38.92  ? 76   SER D CA    1 
ATOM   8275  C  C     . SER D  4  76  ? -3.823  -0.531  5.609   1.00 40.39  ? 76   SER D C     1 
ATOM   8276  O  O     . SER D  4  76  ? -3.586  -1.554  6.247   1.00 38.75  ? 76   SER D O     1 
ATOM   8277  C  CB    . SER D  4  76  ? -3.210  1.656   6.598   1.00 37.86  ? 76   SER D CB    1 
ATOM   8278  O  OG    . SER D  4  76  ? -2.163  2.580   6.765   1.00 40.52  ? 76   SER D OG    1 
ATOM   8279  N  N     . ALA D  4  77  ? -4.960  -0.327  4.948   1.00 42.54  ? 77   ALA D N     1 
ATOM   8280  C  CA    . ALA D  4  77  ? -6.021  -1.326  4.901   1.00 43.09  ? 77   ALA D CA    1 
ATOM   8281  C  C     . ALA D  4  77  ? -5.486  -2.599  4.230   1.00 41.85  ? 77   ALA D C     1 
ATOM   8282  O  O     . ALA D  4  77  ? -5.544  -3.688  4.800   1.00 43.68  ? 77   ALA D O     1 
ATOM   8283  C  CB    . ALA D  4  77  ? -7.214  -0.771  4.126   1.00 45.04  ? 77   ALA D CB    1 
ATOM   8284  N  N     . ILE D  4  78  ? -4.958  -2.453  3.023   1.00 40.88  ? 78   ILE D N     1 
ATOM   8285  C  CA    . ILE D  4  78  ? -4.394  -3.580  2.308   1.00 42.25  ? 78   ILE D CA    1 
ATOM   8286  C  C     . ILE D  4  78  ? -3.327  -4.287  3.155   1.00 43.45  ? 78   ILE D C     1 
ATOM   8287  O  O     . ILE D  4  78  ? -3.282  -5.524  3.228   1.00 42.03  ? 78   ILE D O     1 
ATOM   8288  C  CB    . ILE D  4  78  ? -3.739  -3.119  1.024   1.00 43.38  ? 78   ILE D CB    1 
ATOM   8289  C  CG1   . ILE D  4  78  ? -4.785  -2.458  0.126   1.00 39.14  ? 78   ILE D CG1   1 
ATOM   8290  C  CG2   . ILE D  4  78  ? -3.050  -4.299  0.350   1.00 42.71  ? 78   ILE D CG2   1 
ATOM   8291  C  CD1   . ILE D  4  78  ? -4.207  -1.908  -1.151  1.00 38.94  ? 78   ILE D CD1   1 
ATOM   8292  N  N     . THR D  4  79  ? -2.484  -3.496  3.811   1.00 42.09  ? 79   THR D N     1 
ATOM   8293  C  CA    . THR D  4  79  ? -1.417  -4.049  4.625   1.00 41.23  ? 79   THR D CA    1 
ATOM   8294  C  C     . THR D  4  79  ? -1.959  -4.861  5.794   1.00 43.86  ? 79   THR D C     1 
ATOM   8295  O  O     . THR D  4  79  ? -1.532  -5.995  6.019   1.00 43.47  ? 79   THR D O     1 
ATOM   8296  C  CB    . THR D  4  79  ? -0.469  -2.935  5.145   1.00 41.14  ? 79   THR D CB    1 
ATOM   8297  O  OG1   . THR D  4  79  ? 0.098   -2.229  4.031   1.00 40.67  ? 79   THR D OG1   1 
ATOM   8298  C  CG2   . THR D  4  79  ? 0.673   -3.528  5.959   1.00 38.46  ? 79   THR D CG2   1 
ATOM   8299  N  N     . PHE D  4  80  ? -2.897  -4.302  6.546   1.00 43.43  ? 80   PHE D N     1 
ATOM   8300  C  CA    . PHE D  4  80  ? -3.441  -5.048  7.662   1.00 44.25  ? 80   PHE D CA    1 
ATOM   8301  C  C     . PHE D  4  80  ? -4.133  -6.329  7.148   1.00 47.24  ? 80   PHE D C     1 
ATOM   8302  O  O     . PHE D  4  80  ? -4.040  -7.392  7.758   1.00 45.28  ? 80   PHE D O     1 
ATOM   8303  C  CB    . PHE D  4  80  ? -4.444  -4.205  8.431   1.00 42.59  ? 80   PHE D CB    1 
ATOM   8304  C  CG    . PHE D  4  80  ? -5.016  -4.905  9.628   1.00 44.31  ? 80   PHE D CG    1 
ATOM   8305  C  CD1   . PHE D  4  80  ? -4.188  -5.343  10.654  1.00 46.05  ? 80   PHE D CD1   1 
ATOM   8306  C  CD2   . PHE D  4  80  ? -6.384  -5.143  9.725   1.00 46.28  ? 80   PHE D CD2   1 
ATOM   8307  C  CE1   . PHE D  4  80  ? -4.713  -6.013  11.767  1.00 46.32  ? 80   PHE D CE1   1 
ATOM   8308  C  CE2   . PHE D  4  80  ? -6.921  -5.804  10.823  1.00 43.09  ? 80   PHE D CE2   1 
ATOM   8309  C  CZ    . PHE D  4  80  ? -6.081  -6.243  11.850  1.00 47.88  ? 80   PHE D CZ    1 
ATOM   8310  N  N     . THR D  4  81  ? -4.824  -6.220  6.020   1.00 45.85  ? 81   THR D N     1 
ATOM   8311  C  CA    . THR D  4  81  ? -5.510  -7.367  5.461   1.00 47.17  ? 81   THR D CA    1 
ATOM   8312  C  C     . THR D  4  81  ? -4.546  -8.489  5.079   1.00 47.63  ? 81   THR D C     1 
ATOM   8313  O  O     . THR D  4  81  ? -4.773  -9.653  5.419   1.00 47.00  ? 81   THR D O     1 
ATOM   8314  C  CB    . THR D  4  81  ? -6.303  -6.962  4.228   1.00 47.87  ? 81   THR D CB    1 
ATOM   8315  O  OG1   . THR D  4  81  ? -7.285  -5.990  4.608   1.00 48.84  ? 81   THR D OG1   1 
ATOM   8316  C  CG2   . THR D  4  81  ? -6.982  -8.179  3.607   1.00 42.96  ? 81   THR D CG2   1 
ATOM   8317  N  N     . GLY D  4  82  ? -3.480  -8.132  4.364   1.00 46.98  ? 82   GLY D N     1 
ATOM   8318  C  CA    . GLY D  4  82  ? -2.498  -9.119  3.959   1.00 45.03  ? 82   GLY D CA    1 
ATOM   8319  C  C     . GLY D  4  82  ? -1.879  -9.846  5.147   1.00 46.74  ? 82   GLY D C     1 
ATOM   8320  O  O     . GLY D  4  82  ? -1.724  -11.075 5.121   1.00 44.12  ? 82   GLY D O     1 
ATOM   8321  N  N     . LEU D  4  83  ? -1.533  -9.099  6.196   1.00 43.43  ? 83   LEU D N     1 
ATOM   8322  C  CA    . LEU D  4  83  ? -0.916  -9.695  7.378   1.00 41.71  ? 83   LEU D CA    1 
ATOM   8323  C  C     . LEU D  4  83  ? -1.834  -10.664 8.107   1.00 42.91  ? 83   LEU D C     1 
ATOM   8324  O  O     . LEU D  4  83  ? -1.384  -11.718 8.566   1.00 41.62  ? 83   LEU D O     1 
ATOM   8325  C  CB    . LEU D  4  83  ? -0.443  -8.607  8.349   1.00 39.24  ? 83   LEU D CB    1 
ATOM   8326  C  CG    . LEU D  4  83  ? 0.666   -7.677  7.839   1.00 36.29  ? 83   LEU D CG    1 
ATOM   8327  C  CD1   . LEU D  4  83  ? 1.052   -6.752  8.960   1.00 34.28  ? 83   LEU D CD1   1 
ATOM   8328  C  CD2   . LEU D  4  83  ? 1.879   -8.475  7.374   1.00 31.66  ? 83   LEU D CD2   1 
ATOM   8329  N  N     . CYS D  4  84  ? -3.108  -10.296 8.231   1.00 43.51  ? 84   CYS D N     1 
ATOM   8330  C  CA    . CYS D  4  84  ? -4.095  -11.145 8.880   1.00 46.31  ? 84   CYS D CA    1 
ATOM   8331  C  C     . CYS D  4  84  ? -4.299  -12.404 8.027   1.00 46.09  ? 84   CYS D C     1 
ATOM   8332  O  O     . CYS D  4  84  ? -4.385  -13.515 8.550   1.00 44.91  ? 84   CYS D O     1 
ATOM   8333  C  CB    . CYS D  4  84  ? -5.409  -10.377 9.040   1.00 49.50  ? 84   CYS D CB    1 
ATOM   8334  S  SG    . CYS D  4  84  ? -5.358  -9.134  10.377  1.00 54.70  ? 84   CYS D SG    1 
ATOM   8335  N  N     . TYR D  4  85  ? -4.362  -12.207 6.715   1.00 45.46  ? 85   TYR D N     1 
ATOM   8336  C  CA    . TYR D  4  85  ? -4.512  -13.285 5.741   1.00 48.73  ? 85   TYR D CA    1 
ATOM   8337  C  C     . TYR D  4  85  ? -3.358  -14.268 5.918   1.00 48.39  ? 85   TYR D C     1 
ATOM   8338  O  O     . TYR D  4  85  ? -3.571  -15.474 5.993   1.00 50.73  ? 85   TYR D O     1 
ATOM   8339  C  CB    . TYR D  4  85  ? -4.462  -12.702 4.327   1.00 52.88  ? 85   TYR D CB    1 
ATOM   8340  C  CG    . TYR D  4  85  ? -4.483  -13.712 3.202   1.00 60.51  ? 85   TYR D CG    1 
ATOM   8341  C  CD1   . TYR D  4  85  ? -5.693  -14.222 2.714   1.00 65.56  ? 85   TYR D CD1   1 
ATOM   8342  C  CD2   . TYR D  4  85  ? -3.299  -14.141 2.603   1.00 62.61  ? 85   TYR D CD2   1 
ATOM   8343  C  CE1   . TYR D  4  85  ? -5.721  -15.129 1.655   1.00 67.88  ? 85   TYR D CE1   1 
ATOM   8344  C  CE2   . TYR D  4  85  ? -3.314  -15.047 1.547   1.00 67.05  ? 85   TYR D CE2   1 
ATOM   8345  C  CZ    . TYR D  4  85  ? -4.527  -15.537 1.075   1.00 69.97  ? 85   TYR D CZ    1 
ATOM   8346  O  OH    . TYR D  4  85  ? -4.547  -16.421 0.017   1.00 73.78  ? 85   TYR D OH    1 
ATOM   8347  N  N     . PHE D  4  86  ? -2.137  -13.738 5.975   1.00 44.73  ? 86   PHE D N     1 
ATOM   8348  C  CA    . PHE D  4  86  ? -0.940  -14.554 6.155   1.00 43.10  ? 86   PHE D CA    1 
ATOM   8349  C  C     . PHE D  4  86  ? -0.975  -15.282 7.498   1.00 44.70  ? 86   PHE D C     1 
ATOM   8350  O  O     . PHE D  4  86  ? -0.545  -16.427 7.589   1.00 44.62  ? 86   PHE D O     1 
ATOM   8351  C  CB    . PHE D  4  86  ? 0.312   -13.676 6.082   1.00 38.23  ? 86   PHE D CB    1 
ATOM   8352  C  CG    . PHE D  4  86  ? 1.610   -14.436 6.183   1.00 33.47  ? 86   PHE D CG    1 
ATOM   8353  C  CD1   . PHE D  4  86  ? 2.188   -15.009 5.056   1.00 30.23  ? 86   PHE D CD1   1 
ATOM   8354  C  CD2   . PHE D  4  86  ? 2.264   -14.559 7.408   1.00 31.58  ? 86   PHE D CD2   1 
ATOM   8355  C  CE1   . PHE D  4  86  ? 3.405   -15.691 5.130   1.00 31.74  ? 86   PHE D CE1   1 
ATOM   8356  C  CE2   . PHE D  4  86  ? 3.490   -15.244 7.500   1.00 35.93  ? 86   PHE D CE2   1 
ATOM   8357  C  CZ    . PHE D  4  86  ? 4.059   -15.809 6.349   1.00 34.67  ? 86   PHE D CZ    1 
ATOM   8358  N  N     . ASN D  4  87  ? -1.469  -14.620 8.542   1.00 46.27  ? 87   ASN D N     1 
ATOM   8359  C  CA    . ASN D  4  87  ? -1.543  -15.247 9.863   1.00 48.91  ? 87   ASN D CA    1 
ATOM   8360  C  C     . ASN D  4  87  ? -2.583  -16.365 9.838   1.00 51.74  ? 87   ASN D C     1 
ATOM   8361  O  O     . ASN D  4  87  ? -2.472  -17.355 10.566  1.00 53.38  ? 87   ASN D O     1 
ATOM   8362  C  CB    . ASN D  4  87  ? -1.968  -14.250 10.956  1.00 45.07  ? 87   ASN D CB    1 
ATOM   8363  C  CG    . ASN D  4  87  ? -0.849  -13.305 11.391  1.00 47.58  ? 87   ASN D CG    1 
ATOM   8364  O  OD1   . ASN D  4  87  ? 0.329   -13.672 11.453  1.00 42.97  ? 87   ASN D OD1   1 
ATOM   8365  N  ND2   . ASN D  4  87  ? -1.233  -12.077 11.732  1.00 45.11  ? 87   ASN D ND2   1 
ATOM   8366  N  N     . TYR D  4  88  ? -3.597  -16.189 8.997   1.00 53.67  ? 88   TYR D N     1 
ATOM   8367  C  CA    . TYR D  4  88  ? -4.688  -17.144 8.891   1.00 54.02  ? 88   TYR D CA    1 
ATOM   8368  C  C     . TYR D  4  88  ? -4.416  -18.339 7.984   1.00 51.92  ? 88   TYR D C     1 
ATOM   8369  O  O     . TYR D  4  88  ? -4.495  -19.473 8.430   1.00 50.77  ? 88   TYR D O     1 
ATOM   8370  C  CB    . TYR D  4  88  ? -5.939  -16.438 8.396   1.00 58.02  ? 88   TYR D CB    1 
ATOM   8371  C  CG    . TYR D  4  88  ? -7.177  -17.273 8.554   1.00 62.58  ? 88   TYR D CG    1 
ATOM   8372  C  CD1   . TYR D  4  88  ? -7.788  -17.403 9.800   1.00 63.91  ? 88   TYR D CD1   1 
ATOM   8373  C  CD2   . TYR D  4  88  ? -7.726  -17.953 7.466   1.00 63.49  ? 88   TYR D CD2   1 
ATOM   8374  C  CE1   . TYR D  4  88  ? -8.924  -18.187 9.963   1.00 67.26  ? 88   TYR D CE1   1 
ATOM   8375  C  CE2   . TYR D  4  88  ? -8.860  -18.746 7.615   1.00 67.05  ? 88   TYR D CE2   1 
ATOM   8376  C  CZ    . TYR D  4  88  ? -9.457  -18.857 8.869   1.00 67.27  ? 88   TYR D CZ    1 
ATOM   8377  O  OH    . TYR D  4  88  ? -10.590 -19.621 9.032   1.00 69.55  ? 88   TYR D OH    1 
ATOM   8378  N  N     . TYR D  4  89  ? -4.101  -18.075 6.720   1.00 50.05  ? 89   TYR D N     1 
ATOM   8379  C  CA    . TYR D  4  89  ? -3.844  -19.126 5.743   1.00 51.39  ? 89   TYR D CA    1 
ATOM   8380  C  C     . TYR D  4  89  ? -2.410  -19.615 5.583   1.00 50.02  ? 89   TYR D C     1 
ATOM   8381  O  O     . TYR D  4  89  ? -2.159  -20.547 4.814   1.00 49.80  ? 89   TYR D O     1 
ATOM   8382  C  CB    . TYR D  4  89  ? -4.352  -18.686 4.375   1.00 55.62  ? 89   TYR D CB    1 
ATOM   8383  C  CG    . TYR D  4  89  ? -5.844  -18.530 4.326   1.00 61.89  ? 89   TYR D CG    1 
ATOM   8384  C  CD1   . TYR D  4  89  ? -6.683  -19.633 4.481   1.00 61.86  ? 89   TYR D CD1   1 
ATOM   8385  C  CD2   . TYR D  4  89  ? -6.427  -17.277 4.143   1.00 64.76  ? 89   TYR D CD2   1 
ATOM   8386  C  CE1   . TYR D  4  89  ? -8.066  -19.495 4.454   1.00 63.88  ? 89   TYR D CE1   1 
ATOM   8387  C  CE2   . TYR D  4  89  ? -7.816  -17.128 4.117   1.00 65.87  ? 89   TYR D CE2   1 
ATOM   8388  C  CZ    . TYR D  4  89  ? -8.626  -18.243 4.274   1.00 66.31  ? 89   TYR D CZ    1 
ATOM   8389  O  OH    . TYR D  4  89  ? -9.995  -18.108 4.266   1.00 67.16  ? 89   TYR D OH    1 
ATOM   8390  N  N     . ASP D  4  90  ? -1.459  -19.000 6.277   1.00 46.52  ? 90   ASP D N     1 
ATOM   8391  C  CA    . ASP D  4  90  ? -0.080  -19.442 6.147   1.00 43.00  ? 90   ASP D CA    1 
ATOM   8392  C  C     . ASP D  4  90  ? 0.492   -19.655 7.541   1.00 41.22  ? 90   ASP D C     1 
ATOM   8393  O  O     . ASP D  4  90  ? -0.259  -19.685 8.511   1.00 35.66  ? 90   ASP D O     1 
ATOM   8394  C  CB    . ASP D  4  90  ? 0.736   -18.415 5.362   1.00 46.73  ? 90   ASP D CB    1 
ATOM   8395  C  CG    . ASP D  4  90  ? 1.908   -19.039 4.616   1.00 48.16  ? 90   ASP D CG    1 
ATOM   8396  O  OD1   . ASP D  4  90  ? 2.708   -19.756 5.264   1.00 49.43  ? 90   ASP D OD1   1 
ATOM   8397  O  OD2   . ASP D  4  90  ? 2.031   -18.798 3.387   1.00 43.90  ? 90   ASP D OD2   1 
ATOM   8398  N  N     . VAL D  4  91  ? 1.812   -19.804 7.637   1.00 40.16  ? 91   VAL D N     1 
ATOM   8399  C  CA    . VAL D  4  91  ? 2.479   -20.053 8.919   1.00 40.48  ? 91   VAL D CA    1 
ATOM   8400  C  C     . VAL D  4  91  ? 2.386   -18.967 9.990   1.00 41.92  ? 91   VAL D C     1 
ATOM   8401  O  O     . VAL D  4  91  ? 2.575   -19.254 11.175  1.00 42.50  ? 91   VAL D O     1 
ATOM   8402  C  CB    . VAL D  4  91  ? 3.970   -20.364 8.703   1.00 42.11  ? 91   VAL D CB    1 
ATOM   8403  C  CG1   . VAL D  4  91  ? 4.125   -21.701 7.992   1.00 40.53  ? 91   VAL D CG1   1 
ATOM   8404  C  CG2   . VAL D  4  91  ? 4.608   -19.263 7.872   1.00 41.32  ? 91   VAL D CG2   1 
ATOM   8405  N  N     . GLY D  4  92  ? 2.112   -17.726 9.590   1.00 42.12  ? 92   GLY D N     1 
ATOM   8406  C  CA    . GLY D  4  92  ? 2.022   -16.646 10.563  1.00 42.06  ? 92   GLY D CA    1 
ATOM   8407  C  C     . GLY D  4  92  ? 3.327   -15.888 10.709  1.00 42.44  ? 92   GLY D C     1 
ATOM   8408  O  O     . GLY D  4  92  ? 4.408   -16.441 10.475  1.00 43.98  ? 92   GLY D O     1 
ATOM   8409  N  N     . ILE D  4  93  ? 3.242   -14.624 11.114  1.00 42.13  ? 93   ILE D N     1 
ATOM   8410  C  CA    . ILE D  4  93  ? 4.439   -13.782 11.247  1.00 41.32  ? 93   ILE D CA    1 
ATOM   8411  C  C     . ILE D  4  93  ? 5.597   -14.344 12.081  1.00 40.00  ? 93   ILE D C     1 
ATOM   8412  O  O     . ILE D  4  93  ? 6.726   -14.405 11.600  1.00 36.37  ? 93   ILE D O     1 
ATOM   8413  C  CB    . ILE D  4  93  ? 4.075   -12.359 11.777  1.00 42.97  ? 93   ILE D CB    1 
ATOM   8414  C  CG1   . ILE D  4  93  ? 3.229   -11.619 10.739  1.00 41.24  ? 93   ILE D CG1   1 
ATOM   8415  C  CG2   . ILE D  4  93  ? 5.341   -11.557 12.041  1.00 44.29  ? 93   ILE D CG2   1 
ATOM   8416  C  CD1   . ILE D  4  93  ? 2.751   -10.261 11.190  1.00 46.22  ? 93   ILE D CD1   1 
ATOM   8417  N  N     . CYS D  4  94  ? 5.330   -14.744 13.320  1.00 41.19  ? 94   CYS D N     1 
ATOM   8418  C  CA    . CYS D  4  94  ? 6.388   -15.276 14.180  1.00 45.09  ? 94   CYS D CA    1 
ATOM   8419  C  C     . CYS D  4  94  ? 7.133   -16.453 13.542  1.00 46.43  ? 94   CYS D C     1 
ATOM   8420  O  O     . CYS D  4  94  ? 8.375   -16.477 13.502  1.00 46.44  ? 94   CYS D O     1 
ATOM   8421  C  CB    . CYS D  4  94  ? 5.803   -15.722 15.519  1.00 46.16  ? 94   CYS D CB    1 
ATOM   8422  S  SG    . CYS D  4  94  ? 5.058   -14.400 16.482  1.00 52.34  ? 94   CYS D SG    1 
ATOM   8423  N  N     . LYS D  4  95  ? 6.364   -17.422 13.051  1.00 44.02  ? 95   LYS D N     1 
ATOM   8424  C  CA    . LYS D  4  95  ? 6.911   -18.613 12.413  1.00 43.34  ? 95   LYS D CA    1 
ATOM   8425  C  C     . LYS D  4  95  ? 7.633   -18.270 11.104  1.00 40.03  ? 95   LYS D C     1 
ATOM   8426  O  O     . LYS D  4  95  ? 8.672   -18.853 10.786  1.00 34.66  ? 95   LYS D O     1 
ATOM   8427  C  CB    . LYS D  4  95  ? 5.777   -19.610 12.145  1.00 49.22  ? 95   LYS D CB    1 
ATOM   8428  C  CG    . LYS D  4  95  ? 6.249   -20.999 11.755  1.00 57.41  ? 95   LYS D CG    1 
ATOM   8429  C  CD    . LYS D  4  95  ? 7.093   -21.606 12.871  1.00 63.06  ? 95   LYS D CD    1 
ATOM   8430  C  CE    . LYS D  4  95  ? 7.594   -23.011 12.514  1.00 66.45  ? 95   LYS D CE    1 
ATOM   8431  N  NZ    . LYS D  4  95  ? 8.488   -23.562 13.580  1.00 67.61  ? 95   LYS D NZ    1 
ATOM   8432  N  N     . ALA D  4  96  ? 7.087   -17.325 10.338  1.00 38.07  ? 96   ALA D N     1 
ATOM   8433  C  CA    . ALA D  4  96  ? 7.728   -16.940 9.087   1.00 37.54  ? 96   ALA D CA    1 
ATOM   8434  C  C     . ALA D  4  96  ? 9.132   -16.381 9.366   1.00 37.23  ? 96   ALA D C     1 
ATOM   8435  O  O     . ALA D  4  96  ? 10.077  -16.617 8.617   1.00 37.75  ? 96   ALA D O     1 
ATOM   8436  C  CB    . ALA D  4  96  ? 6.873   -15.892 8.349   1.00 38.20  ? 96   ALA D CB    1 
ATOM   8437  N  N     . VAL D  4  97  ? 9.265   -15.641 10.455  1.00 37.05  ? 97   VAL D N     1 
ATOM   8438  C  CA    . VAL D  4  97  ? 10.550  -15.052 10.795  1.00 39.66  ? 97   VAL D CA    1 
ATOM   8439  C  C     . VAL D  4  97  ? 11.572  -16.116 11.202  1.00 38.35  ? 97   VAL D C     1 
ATOM   8440  O  O     . VAL D  4  97  ? 12.733  -16.051 10.803  1.00 35.93  ? 97   VAL D O     1 
ATOM   8441  C  CB    . VAL D  4  97  ? 10.388  -14.002 11.924  1.00 40.34  ? 97   VAL D CB    1 
ATOM   8442  C  CG1   . VAL D  4  97  ? 11.740  -13.435 12.310  1.00 39.12  ? 97   VAL D CG1   1 
ATOM   8443  C  CG2   . VAL D  4  97  ? 9.479   -12.875 11.442  1.00 41.84  ? 97   VAL D CG2   1 
ATOM   8444  N  N     . ALA D  4  98  ? 11.140  -17.089 12.001  1.00 40.44  ? 98   ALA D N     1 
ATOM   8445  C  CA    . ALA D  4  98  ? 12.028  -18.170 12.420  1.00 39.68  ? 98   ALA D CA    1 
ATOM   8446  C  C     . ALA D  4  98  ? 12.469  -18.963 11.192  1.00 39.47  ? 98   ALA D C     1 
ATOM   8447  O  O     . ALA D  4  98  ? 13.649  -19.256 11.036  1.00 40.04  ? 98   ALA D O     1 
ATOM   8448  C  CB    . ALA D  4  98  ? 11.317  -19.077 13.400  1.00 42.41  ? 98   ALA D CB    1 
ATOM   8449  N  N     . MET D  4  99  ? 11.519  -19.282 10.311  1.00 40.83  ? 99   MET D N     1 
ATOM   8450  C  CA    . MET D  4  99  ? 11.809  -20.025 9.085   1.00 41.36  ? 99   MET D CA    1 
ATOM   8451  C  C     . MET D  4  99  ? 12.779  -19.265 8.202   1.00 42.63  ? 99   MET D C     1 
ATOM   8452  O  O     . MET D  4  99  ? 13.712  -19.846 7.630   1.00 41.48  ? 99   MET D O     1 
ATOM   8453  C  CB    . MET D  4  99  ? 10.535  -20.274 8.284   1.00 42.57  ? 99   MET D CB    1 
ATOM   8454  C  CG    . MET D  4  99  ? 9.662   -21.410 8.781   1.00 47.49  ? 99   MET D CG    1 
ATOM   8455  S  SD    . MET D  4  99  ? 8.232   -21.686 7.686   1.00 49.20  ? 99   MET D SD    1 
ATOM   8456  C  CE    . MET D  4  99  ? 9.031   -22.286 6.222   1.00 51.38  ? 99   MET D CE    1 
ATOM   8457  N  N     . LEU D  4  100 ? 12.535  -17.959 8.062   1.00 42.20  ? 100  LEU D N     1 
ATOM   8458  C  CA    . LEU D  4  100 ? 13.409  -17.122 7.251   1.00 40.68  ? 100  LEU D CA    1 
ATOM   8459  C  C     . LEU D  4  100 ? 14.827  -17.145 7.836   1.00 37.10  ? 100  LEU D C     1 
ATOM   8460  O  O     . LEU D  4  100 ? 15.803  -17.182 7.098   1.00 33.75  ? 100  LEU D O     1 
ATOM   8461  C  CB    . LEU D  4  100 ? 12.901  -15.674 7.209   1.00 41.62  ? 100  LEU D CB    1 
ATOM   8462  C  CG    . LEU D  4  100 ? 13.775  -14.716 6.378   1.00 43.71  ? 100  LEU D CG    1 
ATOM   8463  C  CD1   . LEU D  4  100 ? 13.616  -15.052 4.908   1.00 46.19  ? 100  LEU D CD1   1 
ATOM   8464  C  CD2   . LEU D  4  100 ? 13.391  -13.261 6.620   1.00 45.04  ? 100  LEU D CD2   1 
ATOM   8465  N  N     . TRP D  4  101 ? 14.926  -17.134 9.165   1.00 38.21  ? 101  TRP D N     1 
ATOM   8466  C  CA    . TRP D  4  101 ? 16.225  -17.131 9.834   1.00 37.81  ? 101  TRP D CA    1 
ATOM   8467  C  C     . TRP D  4  101 ? 16.904  -18.501 9.886   1.00 39.96  ? 101  TRP D C     1 
ATOM   8468  O  O     . TRP D  4  101 ? 18.027  -18.626 10.401  1.00 38.04  ? 101  TRP D O     1 
ATOM   8469  C  CB    . TRP D  4  101 ? 16.090  -16.559 11.256  1.00 41.21  ? 101  TRP D CB    1 
ATOM   8470  C  CG    . TRP D  4  101 ? 16.991  -15.387 11.467  1.00 40.53  ? 101  TRP D CG    1 
ATOM   8471  C  CD1   . TRP D  4  101 ? 18.095  -15.324 12.273  1.00 43.24  ? 101  TRP D CD1   1 
ATOM   8472  C  CD2   . TRP D  4  101 ? 16.955  -14.162 10.739  1.00 41.21  ? 101  TRP D CD2   1 
ATOM   8473  N  NE1   . TRP D  4  101 ? 18.760  -14.138 12.077  1.00 40.77  ? 101  TRP D NE1   1 
ATOM   8474  C  CE2   . TRP D  4  101 ? 18.079  -13.404 11.139  1.00 43.31  ? 101  TRP D CE2   1 
ATOM   8475  C  CE3   . TRP D  4  101 ? 16.082  -13.630 9.776   1.00 41.99  ? 101  TRP D CE3   1 
ATOM   8476  C  CZ2   . TRP D  4  101 ? 18.357  -12.137 10.607  1.00 43.25  ? 101  TRP D CZ2   1 
ATOM   8477  C  CZ3   . TRP D  4  101 ? 16.355  -12.371 9.244   1.00 43.00  ? 101  TRP D CZ3   1 
ATOM   8478  C  CH2   . TRP D  4  101 ? 17.484  -11.639 9.661   1.00 42.44  ? 101  TRP D CH2   1 
ATOM   8479  N  N     . SER D  4  102 ? 16.229  -19.533 9.368   1.00 37.66  ? 102  SER D N     1 
ATOM   8480  C  CA    . SER D  4  102 ? 16.822  -20.862 9.371   1.00 35.05  ? 102  SER D CA    1 
ATOM   8481  C  C     . SER D  4  102 ? 17.561  -21.100 8.058   1.00 34.72  ? 102  SER D C     1 
ATOM   8482  O  O     . SER D  4  102 ? 18.209  -22.126 7.871   1.00 34.12  ? 102  SER D O     1 
ATOM   8483  C  CB    . SER D  4  102 ? 15.743  -21.932 9.583   1.00 34.89  ? 102  SER D CB    1 
ATOM   8484  O  OG    . SER D  4  102 ? 14.891  -22.035 8.459   1.00 34.97  ? 102  SER D OG    1 
ATOM   8485  N  N     . ILE D  4  103 ? 17.485  -20.137 7.149   1.00 34.72  ? 103  ILE D N     1 
ATOM   8486  C  CA    . ILE D  4  103 ? 18.153  -20.275 5.862   1.00 35.65  ? 103  ILE D CA    1 
ATOM   8487  C  C     . ILE D  4  103 ? 19.664  -20.124 6.010   1.00 39.64  ? 103  ILE D C     1 
ATOM   8488  O  O     . ILE D  4  103 ? 20.075  -19.796 7.152   1.00 46.12  ? 103  ILE D O     1 
ATOM   8489  C  CB    . ILE D  4  103 ? 17.633  -19.233 4.874   1.00 35.53  ? 103  ILE D CB    1 
ATOM   8490  C  CG1   . ILE D  4  103 ? 16.141  -19.478 4.635   1.00 35.31  ? 103  ILE D CG1   1 
ATOM   8491  C  CG2   . ILE D  4  103 ? 18.439  -19.279 3.573   1.00 36.89  ? 103  ILE D CG2   1 
ATOM   8492  C  CD1   . ILE D  4  103 ? 15.493  -18.437 3.772   1.00 38.81  ? 103  ILE D CD1   1 
ATOM   8493  N  N     . THR E  1  10  ? 50.764  -65.242 -8.321  1.00 79.96  ? 10   THR N N     1 
ATOM   8494  C  CA    . THR E  1  10  ? 51.621  -64.428 -9.235  1.00 80.04  ? 10   THR N CA    1 
ATOM   8495  C  C     . THR E  1  10  ? 51.022  -63.063 -9.617  1.00 77.86  ? 10   THR N C     1 
ATOM   8496  O  O     . THR E  1  10  ? 51.768  -62.109 -9.872  1.00 78.32  ? 10   THR N O     1 
ATOM   8497  C  CB    . THR E  1  10  ? 51.963  -65.214 -10.537 1.00 82.17  ? 10   THR N CB    1 
ATOM   8498  O  OG1   . THR E  1  10  ? 50.892  -66.114 -10.859 1.00 84.33  ? 10   THR N OG1   1 
ATOM   8499  C  CG2   . THR E  1  10  ? 53.259  -66.006 -10.365 1.00 83.50  ? 10   THR N CG2   1 
ATOM   8500  N  N     . GLN E  1  11  ? 49.691  -62.971 -9.671  1.00 73.65  ? 11   GLN N N     1 
ATOM   8501  C  CA    . GLN E  1  11  ? 49.026  -61.715 -9.997  1.00 69.02  ? 11   GLN N CA    1 
ATOM   8502  C  C     . GLN E  1  11  ? 49.158  -60.676 -8.893  1.00 63.32  ? 11   GLN N C     1 
ATOM   8503  O  O     . GLN E  1  11  ? 48.937  -59.489 -9.120  1.00 64.09  ? 11   GLN N O     1 
ATOM   8504  C  CB    . GLN E  1  11  ? 47.550  -61.952 -10.323 1.00 72.79  ? 11   GLN N CB    1 
ATOM   8505  C  CG    . GLN E  1  11  ? 46.894  -63.070 -9.554  1.00 75.23  ? 11   GLN N CG    1 
ATOM   8506  C  CD    . GLN E  1  11  ? 45.466  -63.303 -10.015 1.00 77.98  ? 11   GLN N CD    1 
ATOM   8507  O  OE1   . GLN E  1  11  ? 45.178  -63.281 -11.216 1.00 74.98  ? 11   GLN N OE1   1 
ATOM   8508  N  NE2   . GLN E  1  11  ? 44.564  -63.538 -9.062  1.00 80.64  ? 11   GLN N NE2   1 
ATOM   8509  N  N     . TYR E  1  12  ? 49.501  -61.113 -7.691  1.00 56.26  ? 12   TYR N N     1 
ATOM   8510  C  CA    . TYR E  1  12  ? 49.692  -60.157 -6.614  1.00 50.55  ? 12   TYR N CA    1 
ATOM   8511  C  C     . TYR E  1  12  ? 51.176  -60.011 -6.309  1.00 47.28  ? 12   TYR N C     1 
ATOM   8512  O  O     . TYR E  1  12  ? 51.893  -60.992 -6.143  1.00 46.46  ? 12   TYR N O     1 
ATOM   8513  C  CB    . TYR E  1  12  ? 48.939  -60.579 -5.347  1.00 44.52  ? 12   TYR N CB    1 
ATOM   8514  C  CG    . TYR E  1  12  ? 47.450  -60.388 -5.452  1.00 40.98  ? 12   TYR N CG    1 
ATOM   8515  C  CD1   . TYR E  1  12  ? 46.639  -61.372 -6.016  1.00 37.01  ? 12   TYR N CD1   1 
ATOM   8516  C  CD2   . TYR E  1  12  ? 46.848  -59.201 -5.013  1.00 37.50  ? 12   TYR N CD2   1 
ATOM   8517  C  CE1   . TYR E  1  12  ? 45.259  -61.180 -6.139  1.00 37.62  ? 12   TYR N CE1   1 
ATOM   8518  C  CE2   . TYR E  1  12  ? 45.476  -59.000 -5.137  1.00 37.41  ? 12   TYR N CE2   1 
ATOM   8519  C  CZ    . TYR E  1  12  ? 44.688  -59.991 -5.701  1.00 34.71  ? 12   TYR N CZ    1 
ATOM   8520  O  OH    . TYR E  1  12  ? 43.337  -59.781 -5.846  1.00 36.35  ? 12   TYR N OH    1 
ATOM   8521  N  N     . PRO E  1  13  ? 51.669  -58.774 -6.285  1.00 45.54  ? 13   PRO N N     1 
ATOM   8522  C  CA    . PRO E  1  13  ? 53.096  -58.606 -5.980  1.00 43.18  ? 13   PRO N CA    1 
ATOM   8523  C  C     . PRO E  1  13  ? 53.302  -58.990 -4.507  1.00 39.50  ? 13   PRO N C     1 
ATOM   8524  O  O     . PRO E  1  13  ? 52.511  -58.573 -3.650  1.00 38.83  ? 13   PRO N O     1 
ATOM   8525  C  CB    . PRO E  1  13  ? 53.333  -57.124 -6.245  1.00 45.35  ? 13   PRO N CB    1 
ATOM   8526  C  CG    . PRO E  1  13  ? 51.956  -56.491 -6.019  1.00 48.15  ? 13   PRO N CG    1 
ATOM   8527  C  CD    . PRO E  1  13  ? 51.013  -57.494 -6.613  1.00 45.86  ? 13   PRO N CD    1 
ATOM   8528  N  N     . VAL E  1  14  ? 54.326  -59.795 -4.231  1.00 30.54  ? 14   VAL N N     1 
ATOM   8529  C  CA    . VAL E  1  14  ? 54.625  -60.250 -2.879  1.00 29.11  ? 14   VAL N CA    1 
ATOM   8530  C  C     . VAL E  1  14  ? 55.943  -59.713 -2.343  1.00 32.60  ? 14   VAL N C     1 
ATOM   8531  O  O     . VAL E  1  14  ? 56.982  -59.874 -2.984  1.00 30.34  ? 14   VAL N O     1 
ATOM   8532  C  CB    . VAL E  1  14  ? 54.731  -61.757 -2.822  1.00 27.06  ? 14   VAL N CB    1 
ATOM   8533  C  CG1   . VAL E  1  14  ? 55.016  -62.225 -1.365  1.00 30.23  ? 14   VAL N CG1   1 
ATOM   8534  C  CG2   . VAL E  1  14  ? 53.442  -62.367 -3.304  1.00 29.91  ? 14   VAL N CG2   1 
ATOM   8535  N  N     . VAL E  1  15  ? 55.902  -59.108 -1.154  1.00 29.91  ? 15   VAL N N     1 
ATOM   8536  C  CA    . VAL E  1  15  ? 57.092  -58.562 -0.518  1.00 27.72  ? 15   VAL N CA    1 
ATOM   8537  C  C     . VAL E  1  15  ? 57.421  -59.373 0.742   1.00 31.30  ? 15   VAL N C     1 
ATOM   8538  O  O     . VAL E  1  15  ? 56.552  -59.635 1.588   1.00 30.81  ? 15   VAL N O     1 
ATOM   8539  C  CB    . VAL E  1  15  ? 56.886  -57.084 -0.127  1.00 28.64  ? 15   VAL N CB    1 
ATOM   8540  C  CG1   . VAL E  1  15  ? 58.111  -56.556 0.582   1.00 29.60  ? 15   VAL N CG1   1 
ATOM   8541  C  CG2   . VAL E  1  15  ? 56.621  -56.254 -1.354  1.00 26.48  ? 15   VAL N CG2   1 
ATOM   8542  N  N     . ASP E  1  16  ? 58.679  -59.780 0.864   1.00 27.58  ? 16   ASP N N     1 
ATOM   8543  C  CA    . ASP E  1  16  ? 59.101  -60.569 1.999   1.00 31.26  ? 16   ASP N CA    1 
ATOM   8544  C  C     . ASP E  1  16  ? 59.974  -59.766 2.944   1.00 30.33  ? 16   ASP N C     1 
ATOM   8545  O  O     . ASP E  1  16  ? 60.819  -58.983 2.514   1.00 32.91  ? 16   ASP N O     1 
ATOM   8546  C  CB    . ASP E  1  16  ? 59.844  -61.816 1.521   1.00 35.41  ? 16   ASP N CB    1 
ATOM   8547  C  CG    . ASP E  1  16  ? 58.895  -62.961 1.166   1.00 39.84  ? 16   ASP N CG    1 
ATOM   8548  O  OD1   . ASP E  1  16  ? 57.663  -62.756 1.195   1.00 46.13  ? 16   ASP N OD1   1 
ATOM   8549  O  OD2   . ASP E  1  16  ? 59.373  -64.074 0.857   1.00 41.09  ? 16   ASP N OD2   1 
ATOM   8550  N  N     . HIS E  1  17  ? 59.734  -59.950 4.236   1.00 30.13  ? 17   HIS N N     1 
ATOM   8551  C  CA    . HIS E  1  17  ? 60.473  -59.257 5.294   1.00 29.20  ? 17   HIS N CA    1 
ATOM   8552  C  C     . HIS E  1  17  ? 61.006  -60.323 6.249   1.00 29.61  ? 17   HIS N C     1 
ATOM   8553  O  O     . HIS E  1  17  ? 60.396  -61.382 6.411   1.00 30.45  ? 17   HIS N O     1 
ATOM   8554  C  CB    . HIS E  1  17  ? 59.527  -58.322 6.076   1.00 29.02  ? 17   HIS N CB    1 
ATOM   8555  C  CG    . HIS E  1  17  ? 58.732  -57.379 5.213   1.00 24.57  ? 17   HIS N CG    1 
ATOM   8556  N  ND1   . HIS E  1  17  ? 59.094  -56.064 5.008   1.00 23.87  ? 17   HIS N ND1   1 
ATOM   8557  C  CD2   . HIS E  1  17  ? 57.576  -57.558 4.528   1.00 24.57  ? 17   HIS N CD2   1 
ATOM   8558  C  CE1   . HIS E  1  17  ? 58.197  -55.474 4.239   1.00 22.99  ? 17   HIS N CE1   1 
ATOM   8559  N  NE2   . HIS E  1  17  ? 57.265  -56.359 3.933   1.00 19.30  ? 17   HIS N NE2   1 
ATOM   8560  N  N     . GLU E  1  18  ? 62.146  -60.051 6.877   1.00 30.76  ? 18   GLU N N     1 
ATOM   8561  C  CA    . GLU E  1  18  ? 62.728  -60.973 7.846   1.00 29.51  ? 18   GLU N CA    1 
ATOM   8562  C  C     . GLU E  1  18  ? 62.939  -60.161 9.094   1.00 26.21  ? 18   GLU N C     1 
ATOM   8563  O  O     . GLU E  1  18  ? 63.574  -59.124 9.037   1.00 29.00  ? 18   GLU N O     1 
ATOM   8564  C  CB    . GLU E  1  18  ? 64.079  -61.515 7.354   1.00 33.83  ? 18   GLU N CB    1 
ATOM   8565  C  CG    . GLU E  1  18  ? 64.004  -62.310 6.053   1.00 45.16  ? 18   GLU N CG    1 
ATOM   8566  C  CD    . GLU E  1  18  ? 65.362  -62.871 5.614   1.00 51.63  ? 18   GLU N CD    1 
ATOM   8567  O  OE1   . GLU E  1  18  ? 65.908  -63.742 6.327   1.00 52.65  ? 18   GLU N OE1   1 
ATOM   8568  O  OE2   . GLU E  1  18  ? 65.885  -62.437 4.555   1.00 57.34  ? 18   GLU N OE2   1 
ATOM   8569  N  N     . PHE E  1  19  ? 62.386  -60.607 10.217  1.00 25.33  ? 19   PHE N N     1 
ATOM   8570  C  CA    . PHE E  1  19  ? 62.539  -59.888 11.489  1.00 20.81  ? 19   PHE N CA    1 
ATOM   8571  C  C     . PHE E  1  19  ? 62.833  -60.928 12.563  1.00 19.16  ? 19   PHE N C     1 
ATOM   8572  O  O     . PHE E  1  19  ? 62.711  -62.114 12.287  1.00 17.73  ? 19   PHE N O     1 
ATOM   8573  C  CB    . PHE E  1  19  ? 61.241  -59.124 11.846  1.00 24.73  ? 19   PHE N CB    1 
ATOM   8574  C  CG    . PHE E  1  19  ? 61.032  -57.853 11.051  1.00 21.63  ? 19   PHE N CG    1 
ATOM   8575  C  CD1   . PHE E  1  19  ? 60.274  -57.854 9.880   1.00 17.86  ? 19   PHE N CD1   1 
ATOM   8576  C  CD2   . PHE E  1  19  ? 61.640  -56.667 11.455  1.00 19.18  ? 19   PHE N CD2   1 
ATOM   8577  C  CE1   . PHE E  1  19  ? 60.125  -56.679 9.114   1.00 18.54  ? 19   PHE N CE1   1 
ATOM   8578  C  CE2   . PHE E  1  19  ? 61.511  -55.486 10.709  1.00 17.15  ? 19   PHE N CE2   1 
ATOM   8579  C  CZ    . PHE E  1  19  ? 60.742  -55.492 9.523   1.00 18.21  ? 19   PHE N CZ    1 
ATOM   8580  N  N     . ASP E  1  20  ? 63.266  -60.514 13.754  1.00 19.64  ? 20   ASP N N     1 
ATOM   8581  C  CA    . ASP E  1  20  ? 63.456  -61.495 14.831  1.00 20.96  ? 20   ASP N CA    1 
ATOM   8582  C  C     . ASP E  1  20  ? 62.068  -61.859 15.356  1.00 24.17  ? 20   ASP N C     1 
ATOM   8583  O  O     . ASP E  1  20  ? 61.784  -63.017 15.754  1.00 22.38  ? 20   ASP N O     1 
ATOM   8584  C  CB    . ASP E  1  20  ? 64.218  -60.912 16.033  1.00 20.62  ? 20   ASP N CB    1 
ATOM   8585  C  CG    . ASP E  1  20  ? 65.712  -60.762 15.768  1.00 22.78  ? 20   ASP N CG    1 
ATOM   8586  O  OD1   . ASP E  1  20  ? 66.342  -61.742 15.283  1.00 25.28  ? 20   ASP N OD1   1 
ATOM   8587  O  OD2   . ASP E  1  20  ? 66.245  -59.668 16.048  1.00 23.45  ? 20   ASP N OD2   1 
ATOM   8588  N  N     . ALA E  1  21  ? 61.213  -60.834 15.393  1.00 24.99  ? 21   ALA N N     1 
ATOM   8589  C  CA    . ALA E  1  21  ? 59.861  -60.985 15.910  1.00 23.61  ? 21   ALA N CA    1 
ATOM   8590  C  C     . ALA E  1  21  ? 58.822  -60.118 15.207  1.00 23.17  ? 21   ALA N C     1 
ATOM   8591  O  O     . ALA E  1  21  ? 59.123  -59.029 14.713  1.00 24.53  ? 21   ALA N O     1 
ATOM   8592  C  CB    . ALA E  1  21  ? 59.863  -60.683 17.413  1.00 21.07  ? 21   ALA N CB    1 
ATOM   8593  N  N     . VAL E  1  22  ? 57.597  -60.626 15.163  1.00 23.14  ? 22   VAL N N     1 
ATOM   8594  C  CA    . VAL E  1  22  ? 56.491  -59.920 14.543  1.00 20.84  ? 22   VAL N CA    1 
ATOM   8595  C  C     . VAL E  1  22  ? 55.367  -59.822 15.538  1.00 18.05  ? 22   VAL N C     1 
ATOM   8596  O  O     . VAL E  1  22  ? 54.967  -60.838 16.104  1.00 18.61  ? 22   VAL N O     1 
ATOM   8597  C  CB    . VAL E  1  22  ? 55.914  -60.694 13.374  1.00 23.37  ? 22   VAL N CB    1 
ATOM   8598  C  CG1   . VAL E  1  22  ? 54.706  -59.948 12.827  1.00 19.18  ? 22   VAL N CG1   1 
ATOM   8599  C  CG2   . VAL E  1  22  ? 56.964  -60.884 12.352  1.00 22.39  ? 22   VAL N CG2   1 
ATOM   8600  N  N     . VAL E  1  23  ? 54.855  -58.616 15.758  1.00 16.25  ? 23   VAL N N     1 
ATOM   8601  C  CA    . VAL E  1  23  ? 53.726  -58.467 16.680  1.00 15.52  ? 23   VAL N CA    1 
ATOM   8602  C  C     . VAL E  1  23  ? 52.511  -58.038 15.846  1.00 10.49  ? 23   VAL N C     1 
ATOM   8603  O  O     . VAL E  1  23  ? 52.599  -57.079 15.133  1.00 12.98  ? 23   VAL N O     1 
ATOM   8604  C  CB    . VAL E  1  23  ? 54.008  -57.363 17.763  1.00 15.38  ? 23   VAL N CB    1 
ATOM   8605  C  CG1   . VAL E  1  23  ? 52.746  -57.149 18.632  1.00 13.01  ? 23   VAL N CG1   1 
ATOM   8606  C  CG2   . VAL E  1  23  ? 55.179  -57.762 18.605  1.00 12.02  ? 23   VAL N CG2   1 
ATOM   8607  N  N     . VAL E  1  24  ? 51.381  -58.734 15.930  1.00 15.01  ? 24   VAL N N     1 
ATOM   8608  C  CA    . VAL E  1  24  ? 50.207  -58.305 15.153  1.00 13.89  ? 24   VAL N CA    1 
ATOM   8609  C  C     . VAL E  1  24  ? 49.274  -57.633 16.164  1.00 13.48  ? 24   VAL N C     1 
ATOM   8610  O  O     . VAL E  1  24  ? 48.704  -58.298 17.014  1.00 17.27  ? 24   VAL N O     1 
ATOM   8611  C  CB    . VAL E  1  24  ? 49.479  -59.517 14.487  1.00 16.50  ? 24   VAL N CB    1 
ATOM   8612  C  CG1   . VAL E  1  24  ? 48.347  -59.026 13.580  1.00 13.64  ? 24   VAL N CG1   1 
ATOM   8613  C  CG2   . VAL E  1  24  ? 50.463  -60.358 13.703  1.00 12.69  ? 24   VAL N CG2   1 
ATOM   8614  N  N     . GLY E  1  25  ? 49.181  -56.308 16.077  1.00 16.76  ? 25   GLY N N     1 
ATOM   8615  C  CA    . GLY E  1  25  ? 48.347  -55.524 16.974  1.00 16.02  ? 25   GLY N CA    1 
ATOM   8616  C  C     . GLY E  1  25  ? 49.138  -54.379 17.591  1.00 19.34  ? 25   GLY N C     1 
ATOM   8617  O  O     . GLY E  1  25  ? 50.293  -54.564 17.994  1.00 20.70  ? 25   GLY N O     1 
ATOM   8618  N  N     . ALA E  1  26  ? 48.513  -53.206 17.669  1.00 15.61  ? 26   ALA N N     1 
ATOM   8619  C  CA    . ALA E  1  26  ? 49.130  -52.012 18.236  1.00 15.64  ? 26   ALA N CA    1 
ATOM   8620  C  C     . ALA E  1  26  ? 48.223  -51.344 19.267  1.00 16.97  ? 26   ALA N C     1 
ATOM   8621  O  O     . ALA E  1  26  ? 48.109  -50.097 19.333  1.00 16.33  ? 26   ALA N O     1 
ATOM   8622  C  CB    . ALA E  1  26  ? 49.477  -51.028 17.135  1.00 12.35  ? 26   ALA N CB    1 
ATOM   8623  N  N     . GLY E  1  27  ? 47.563  -52.178 20.062  1.00 14.35  ? 27   GLY N N     1 
ATOM   8624  C  CA    . GLY E  1  27  ? 46.704  -51.669 21.117  1.00 8.66   ? 27   GLY N CA    1 
ATOM   8625  C  C     . GLY E  1  27  ? 47.621  -51.622 22.324  1.00 10.55  ? 27   GLY N C     1 
ATOM   8626  O  O     . GLY E  1  27  ? 48.830  -51.577 22.158  1.00 14.43  ? 27   GLY N O     1 
ATOM   8627  N  N     . GLY E  1  28  ? 47.080  -51.664 23.530  1.00 11.57  ? 28   GLY N N     1 
ATOM   8628  C  CA    . GLY E  1  28  ? 47.945  -51.603 24.695  1.00 11.30  ? 28   GLY N CA    1 
ATOM   8629  C  C     . GLY E  1  28  ? 48.879  -52.793 24.739  1.00 13.70  ? 28   GLY N C     1 
ATOM   8630  O  O     . GLY E  1  28  ? 50.081  -52.661 25.052  1.00 14.64  ? 28   GLY N O     1 
ATOM   8631  N  N     . ALA E  1  29  ? 48.336  -53.973 24.443  1.00 9.76   ? 29   ALA N N     1 
ATOM   8632  C  CA    . ALA E  1  29  ? 49.178  -55.172 24.491  1.00 12.46  ? 29   ALA N CA    1 
ATOM   8633  C  C     . ALA E  1  29  ? 50.221  -55.210 23.404  1.00 14.13  ? 29   ALA N C     1 
ATOM   8634  O  O     . ALA E  1  29  ? 51.415  -55.344 23.676  1.00 18.06  ? 29   ALA N O     1 
ATOM   8635  C  CB    . ALA E  1  29  ? 48.333  -56.410 24.432  1.00 6.92   ? 29   ALA N CB    1 
ATOM   8636  N  N     . GLY E  1  30  ? 49.787  -55.086 22.155  1.00 14.44  ? 30   GLY N N     1 
ATOM   8637  C  CA    . GLY E  1  30  ? 50.743  -55.128 21.049  1.00 9.18   ? 30   GLY N CA    1 
ATOM   8638  C  C     . GLY E  1  30  ? 51.877  -54.126 21.157  1.00 12.43  ? 30   GLY N C     1 
ATOM   8639  O  O     . GLY E  1  30  ? 53.056  -54.444 20.893  1.00 14.92  ? 30   GLY N O     1 
ATOM   8640  N  N     . LEU E  1  31  ? 51.542  -52.892 21.515  1.00 11.56  ? 31   LEU N N     1 
ATOM   8641  C  CA    . LEU E  1  31  ? 52.577  -51.879 21.661  1.00 13.43  ? 31   LEU N CA    1 
ATOM   8642  C  C     . LEU E  1  31  ? 53.519  -52.259 22.796  1.00 14.03  ? 31   LEU N C     1 
ATOM   8643  O  O     . LEU E  1  31  ? 54.730  -52.160 22.631  1.00 16.76  ? 31   LEU N O     1 
ATOM   8644  C  CB    . LEU E  1  31  ? 51.964  -50.487 21.936  1.00 13.38  ? 31   LEU N CB    1 
ATOM   8645  C  CG    . LEU E  1  31  ? 51.328  -49.714 20.762  1.00 16.85  ? 31   LEU N CG    1 
ATOM   8646  C  CD1   . LEU E  1  31  ? 50.727  -48.394 21.254  1.00 16.43  ? 31   LEU N CD1   1 
ATOM   8647  C  CD2   . LEU E  1  31  ? 52.424  -49.434 19.676  1.00 16.40  ? 31   LEU N CD2   1 
ATOM   8648  N  N     . ARG E  1  32  ? 52.986  -52.680 23.948  1.00 16.92  ? 32   ARG N N     1 
ATOM   8649  C  CA    . ARG E  1  32  ? 53.884  -53.024 25.060  1.00 17.86  ? 32   ARG N CA    1 
ATOM   8650  C  C     . ARG E  1  32  ? 54.820  -54.189 24.700  1.00 18.90  ? 32   ARG N C     1 
ATOM   8651  O  O     . ARG E  1  32  ? 55.995  -54.188 25.090  1.00 15.37  ? 32   ARG N O     1 
ATOM   8652  C  CB    . ARG E  1  32  ? 53.117  -53.407 26.340  1.00 16.50  ? 32   ARG N CB    1 
ATOM   8653  C  CG    . ARG E  1  32  ? 54.063  -53.701 27.509  1.00 16.00  ? 32   ARG N CG    1 
ATOM   8654  C  CD    . ARG E  1  32  ? 54.765  -52.391 27.917  1.00 21.65  ? 32   ARG N CD    1 
ATOM   8655  N  NE    . ARG E  1  32  ? 55.801  -52.543 28.934  1.00 14.40  ? 32   ARG N NE    1 
ATOM   8656  C  CZ    . ARG E  1  32  ? 57.034  -52.979 28.674  1.00 20.73  ? 32   ARG N CZ    1 
ATOM   8657  N  NH1   . ARG E  1  32  ? 57.362  -53.309 27.444  1.00 18.24  ? 32   ARG N NH1   1 
ATOM   8658  N  NH2   . ARG E  1  32  ? 57.958  -53.055 29.631  1.00 13.07  ? 32   ARG N NH2   1 
ATOM   8659  N  N     . ALA E  1  33  ? 54.289  -55.190 23.987  1.00 15.95  ? 33   ALA N N     1 
ATOM   8660  C  CA    . ALA E  1  33  ? 55.074  -56.345 23.562  1.00 17.41  ? 33   ALA N CA    1 
ATOM   8661  C  C     . ALA E  1  33  ? 56.098  -55.890 22.528  1.00 19.20  ? 33   ALA N C     1 
ATOM   8662  O  O     . ALA E  1  33  ? 57.275  -56.260 22.597  1.00 20.49  ? 33   ALA N O     1 
ATOM   8663  C  CB    . ALA E  1  33  ? 54.192  -57.411 22.945  1.00 8.59   ? 33   ALA N CB    1 
ATOM   8664  N  N     . ALA E  1  34  ? 55.637  -55.097 21.561  1.00 21.37  ? 34   ALA N N     1 
ATOM   8665  C  CA    . ALA E  1  34  ? 56.493  -54.631 20.485  1.00 17.01  ? 34   ALA N CA    1 
ATOM   8666  C  C     . ALA E  1  34  ? 57.701  -53.824 20.981  1.00 21.69  ? 34   ALA N C     1 
ATOM   8667  O  O     . ALA E  1  34  ? 58.844  -54.161 20.637  1.00 21.74  ? 34   ALA N O     1 
ATOM   8668  C  CB    . ALA E  1  34  ? 55.681  -53.788 19.479  1.00 17.95  ? 34   ALA N CB    1 
ATOM   8669  N  N     . PHE E  1  35  ? 57.500  -52.757 21.763  1.00 15.55  ? 35   PHE N N     1 
ATOM   8670  C  CA    . PHE E  1  35  ? 58.707  -52.049 22.159  1.00 20.30  ? 35   PHE N CA    1 
ATOM   8671  C  C     . PHE E  1  35  ? 59.442  -52.799 23.257  1.00 19.07  ? 35   PHE N C     1 
ATOM   8672  O  O     . PHE E  1  35  ? 60.623  -52.588 23.477  1.00 20.49  ? 35   PHE N O     1 
ATOM   8673  C  CB    . PHE E  1  35  ? 58.448  -50.545 22.485  1.00 18.42  ? 35   PHE N CB    1 
ATOM   8674  C  CG    . PHE E  1  35  ? 57.748  -50.285 23.774  1.00 21.42  ? 35   PHE N CG    1 
ATOM   8675  C  CD1   . PHE E  1  35  ? 58.425  -50.376 24.973  1.00 22.21  ? 35   PHE N CD1   1 
ATOM   8676  C  CD2   . PHE E  1  35  ? 56.425  -49.831 23.781  1.00 20.81  ? 35   PHE N CD2   1 
ATOM   8677  C  CE1   . PHE E  1  35  ? 57.799  -50.008 26.174  1.00 24.97  ? 35   PHE N CE1   1 
ATOM   8678  C  CE2   . PHE E  1  35  ? 55.802  -49.465 24.967  1.00 17.39  ? 35   PHE N CE2   1 
ATOM   8679  C  CZ    . PHE E  1  35  ? 56.492  -49.553 26.162  1.00 22.97  ? 35   PHE N CZ    1 
ATOM   8680  N  N     . GLY E  1  36  ? 58.763  -53.738 23.904  1.00 22.50  ? 36   GLY N N     1 
ATOM   8681  C  CA    . GLY E  1  36  ? 59.436  -54.540 24.907  1.00 22.12  ? 36   GLY N CA    1 
ATOM   8682  C  C     . GLY E  1  36  ? 60.459  -55.418 24.189  1.00 26.62  ? 36   GLY N C     1 
ATOM   8683  O  O     . GLY E  1  36  ? 61.569  -55.634 24.687  1.00 29.93  ? 36   GLY N O     1 
ATOM   8684  N  N     . LEU E  1  37  ? 60.083  -55.958 23.037  1.00 21.66  ? 37   LEU N N     1 
ATOM   8685  C  CA    . LEU E  1  37  ? 60.987  -56.785 22.261  1.00 22.21  ? 37   LEU N CA    1 
ATOM   8686  C  C     . LEU E  1  37  ? 62.128  -55.886 21.779  1.00 22.91  ? 37   LEU N C     1 
ATOM   8687  O  O     . LEU E  1  37  ? 63.282  -56.252 21.924  1.00 24.10  ? 37   LEU N O     1 
ATOM   8688  C  CB    . LEU E  1  37  ? 60.249  -57.430 21.067  1.00 18.13  ? 37   LEU N CB    1 
ATOM   8689  C  CG    . LEU E  1  37  ? 59.422  -58.671 21.458  1.00 18.43  ? 37   LEU N CG    1 
ATOM   8690  C  CD1   . LEU E  1  37  ? 58.333  -58.996 20.416  1.00 13.45  ? 37   LEU N CD1   1 
ATOM   8691  C  CD2   . LEU E  1  37  ? 60.366  -59.872 21.638  1.00 16.75  ? 37   LEU N CD2   1 
ATOM   8692  N  N     . SER E  1  38  ? 61.807  -54.713 21.232  1.00 22.19  ? 38   SER N N     1 
ATOM   8693  C  CA    . SER E  1  38  ? 62.848  -53.794 20.758  1.00 23.76  ? 38   SER N CA    1 
ATOM   8694  C  C     . SER E  1  38  ? 63.798  -53.366 21.869  1.00 24.86  ? 38   SER N C     1 
ATOM   8695  O  O     . SER E  1  38  ? 65.000  -53.249 21.631  1.00 28.94  ? 38   SER N O     1 
ATOM   8696  C  CB    . SER E  1  38  ? 62.268  -52.520 20.133  1.00 21.55  ? 38   SER N CB    1 
ATOM   8697  O  OG    . SER E  1  38  ? 61.564  -52.776 18.949  1.00 26.03  ? 38   SER N OG    1 
ATOM   8698  N  N     . GLU E  1  39  ? 63.286  -53.117 23.071  1.00 24.64  ? 39   GLU N N     1 
ATOM   8699  C  CA    . GLU E  1  39  ? 64.165  -52.699 24.152  1.00 29.48  ? 39   GLU N CA    1 
ATOM   8700  C  C     . GLU E  1  39  ? 65.059  -53.847 24.601  1.00 29.35  ? 39   GLU N C     1 
ATOM   8701  O  O     . GLU E  1  39  ? 66.067  -53.614 25.262  1.00 32.04  ? 39   GLU N O     1 
ATOM   8702  C  CB    . GLU E  1  39  ? 63.389  -52.113 25.348  1.00 29.73  ? 39   GLU N CB    1 
ATOM   8703  C  CG    . GLU E  1  39  ? 62.565  -53.082 26.147  1.00 44.55  ? 39   GLU N CG    1 
ATOM   8704  C  CD    . GLU E  1  39  ? 61.940  -52.430 27.398  1.00 54.01  ? 39   GLU N CD    1 
ATOM   8705  O  OE1   . GLU E  1  39  ? 60.798  -52.826 27.794  1.00 57.50  ? 39   GLU N OE1   1 
ATOM   8706  O  OE2   . GLU E  1  39  ? 62.599  -51.537 27.991  1.00 53.70  ? 39   GLU N OE2   1 
ATOM   8707  N  N     . ALA E  1  40  ? 64.706  -55.081 24.237  1.00 27.51  ? 40   ALA N N     1 
ATOM   8708  C  CA    . ALA E  1  40  ? 65.537  -56.237 24.591  1.00 29.12  ? 40   ALA N CA    1 
ATOM   8709  C  C     . ALA E  1  40  ? 66.551  -56.539 23.473  1.00 28.85  ? 40   ALA N C     1 
ATOM   8710  O  O     . ALA E  1  40  ? 67.272  -57.539 23.514  1.00 32.41  ? 40   ALA N O     1 
ATOM   8711  C  CB    . ALA E  1  40  ? 64.669  -57.462 24.830  1.00 28.08  ? 40   ALA N CB    1 
ATOM   8712  N  N     . GLY E  1  41  ? 66.585  -55.702 22.453  1.00 28.84  ? 41   GLY N N     1 
ATOM   8713  C  CA    . GLY E  1  41  ? 67.518  -55.952 21.374  1.00 27.68  ? 41   GLY N CA    1 
ATOM   8714  C  C     . GLY E  1  41  ? 66.985  -56.696 20.159  1.00 26.51  ? 41   GLY N C     1 
ATOM   8715  O  O     . GLY E  1  41  ? 67.738  -56.936 19.222  1.00 24.68  ? 41   GLY N O     1 
ATOM   8716  N  N     . PHE E  1  42  ? 65.705  -57.075 20.153  1.00 24.97  ? 42   PHE N N     1 
ATOM   8717  C  CA    . PHE E  1  42  ? 65.168  -57.787 18.990  1.00 20.61  ? 42   PHE N CA    1 
ATOM   8718  C  C     . PHE E  1  42  ? 64.724  -56.855 17.859  1.00 22.61  ? 42   PHE N C     1 
ATOM   8719  O  O     . PHE E  1  42  ? 64.138  -55.813 18.125  1.00 23.19  ? 42   PHE N O     1 
ATOM   8720  C  CB    . PHE E  1  42  ? 63.995  -58.673 19.402  1.00 19.49  ? 42   PHE N CB    1 
ATOM   8721  C  CG    . PHE E  1  42  ? 64.379  -59.809 20.307  1.00 21.68  ? 42   PHE N CG    1 
ATOM   8722  C  CD1   . PHE E  1  42  ? 64.703  -59.584 21.636  1.00 23.55  ? 42   PHE N CD1   1 
ATOM   8723  C  CD2   . PHE E  1  42  ? 64.467  -61.102 19.819  1.00 23.29  ? 42   PHE N CD2   1 
ATOM   8724  C  CE1   . PHE E  1  42  ? 65.110  -60.634 22.465  1.00 19.26  ? 42   PHE N CE1   1 
ATOM   8725  C  CE2   . PHE E  1  42  ? 64.875  -62.164 20.639  1.00 20.34  ? 42   PHE N CE2   1 
ATOM   8726  C  CZ    . PHE E  1  42  ? 65.193  -61.931 21.954  1.00 19.41  ? 42   PHE N CZ    1 
ATOM   8727  N  N     . ASN E  1  43  ? 65.036  -57.226 16.605  1.00 22.18  ? 43   ASN N N     1 
ATOM   8728  C  CA    . ASN E  1  43  ? 64.611  -56.469 15.392  1.00 20.86  ? 43   ASN N CA    1 
ATOM   8729  C  C     . ASN E  1  43  ? 63.134  -56.879 15.253  1.00 15.65  ? 43   ASN N C     1 
ATOM   8730  O  O     . ASN E  1  43  ? 62.832  -57.978 14.792  1.00 18.13  ? 43   ASN N O     1 
ATOM   8731  C  CB    . ASN E  1  43  ? 65.358  -56.968 14.153  1.00 17.21  ? 43   ASN N CB    1 
ATOM   8732  C  CG    . ASN E  1  43  ? 64.984  -56.203 12.907  1.00 24.80  ? 43   ASN N CG    1 
ATOM   8733  O  OD1   . ASN E  1  43  ? 65.146  -56.694 11.781  1.00 29.59  ? 43   ASN N OD1   1 
ATOM   8734  N  ND2   . ASN E  1  43  ? 64.480  -54.994 13.091  1.00 24.95  ? 43   ASN N ND2   1 
ATOM   8735  N  N     . THR E  1  44  ? 62.249  -55.990 15.654  1.00 19.17  ? 44   THR N N     1 
ATOM   8736  C  CA    . THR E  1  44  ? 60.802  -56.255 15.699  1.00 18.79  ? 44   THR N CA    1 
ATOM   8737  C  C     . THR E  1  44  ? 59.886  -55.473 14.733  1.00 18.10  ? 44   THR N C     1 
ATOM   8738  O  O     . THR E  1  44  ? 60.093  -54.290 14.455  1.00 18.45  ? 44   THR N O     1 
ATOM   8739  C  CB    . THR E  1  44  ? 60.347  -55.981 17.153  1.00 21.54  ? 44   THR N CB    1 
ATOM   8740  O  OG1   . THR E  1  44  ? 61.237  -56.674 18.037  1.00 16.34  ? 44   THR N OG1   1 
ATOM   8741  C  CG2   . THR E  1  44  ? 58.906  -56.406 17.401  1.00 14.81  ? 44   THR N CG2   1 
ATOM   8742  N  N     . ALA E  1  45  ? 58.863  -56.161 14.237  1.00 20.83  ? 45   ALA N N     1 
ATOM   8743  C  CA    . ALA E  1  45  ? 57.863  -55.555 13.366  1.00 19.62  ? 45   ALA N CA    1 
ATOM   8744  C  C     . ALA E  1  45  ? 56.516  -55.527 14.081  1.00 19.76  ? 45   ALA N C     1 
ATOM   8745  O  O     . ALA E  1  45  ? 56.139  -56.486 14.745  1.00 21.99  ? 45   ALA N O     1 
ATOM   8746  C  CB    . ALA E  1  45  ? 57.740  -56.350 12.078  1.00 19.93  ? 45   ALA N CB    1 
ATOM   8747  N  N     . CYS E  1  46  ? 55.799  -54.420 13.963  1.00 21.24  ? 46   CYS N N     1 
ATOM   8748  C  CA    . CYS E  1  46  ? 54.466  -54.310 14.560  1.00 23.44  ? 46   CYS N CA    1 
ATOM   8749  C  C     . CYS E  1  46  ? 53.544  -53.994 13.396  1.00 19.95  ? 46   CYS N C     1 
ATOM   8750  O  O     . CYS E  1  46  ? 53.608  -52.922 12.838  1.00 22.81  ? 46   CYS N O     1 
ATOM   8751  C  CB    . CYS E  1  46  ? 54.396  -53.184 15.619  1.00 22.48  ? 46   CYS N CB    1 
ATOM   8752  S  SG    . CYS E  1  46  ? 52.797  -53.048 16.380  1.00 25.59  ? 46   CYS N SG    1 
ATOM   8753  N  N     . VAL E  1  47  ? 52.700  -54.958 13.058  1.00 21.68  ? 47   VAL N N     1 
ATOM   8754  C  CA    . VAL E  1  47  ? 51.773  -54.901 11.938  1.00 18.64  ? 47   VAL N CA    1 
ATOM   8755  C  C     . VAL E  1  47  ? 50.394  -54.590 12.508  1.00 20.35  ? 47   VAL N C     1 
ATOM   8756  O  O     . VAL E  1  47  ? 49.889  -55.346 13.332  1.00 19.73  ? 47   VAL N O     1 
ATOM   8757  C  CB    . VAL E  1  47  ? 51.775  -56.319 11.226  1.00 21.39  ? 47   VAL N CB    1 
ATOM   8758  C  CG1   . VAL E  1  47  ? 50.758  -56.390 10.111  1.00 17.54  ? 47   VAL N CG1   1 
ATOM   8759  C  CG2   . VAL E  1  47  ? 53.183  -56.631 10.689  1.00 18.45  ? 47   VAL N CG2   1 
ATOM   8760  N  N     . THR E  1  48  ? 49.773  -53.502 12.060  1.00 18.66  ? 48   THR N N     1 
ATOM   8761  C  CA    . THR E  1  48  ? 48.474  -53.124 12.590  1.00 15.51  ? 48   THR N CA    1 
ATOM   8762  C  C     . THR E  1  48  ? 47.533  -52.595 11.512  1.00 13.38  ? 48   THR N C     1 
ATOM   8763  O  O     . THR E  1  48  ? 47.962  -51.864 10.607  1.00 14.53  ? 48   THR N O     1 
ATOM   8764  C  CB    . THR E  1  48  ? 48.645  -52.062 13.733  1.00 17.53  ? 48   THR N CB    1 
ATOM   8765  O  OG1   . THR E  1  48  ? 47.365  -51.493 14.089  1.00 16.41  ? 48   THR N OG1   1 
ATOM   8766  C  CG2   . THR E  1  48  ? 49.609  -50.934 13.280  1.00 11.59  ? 48   THR N CG2   1 
ATOM   8767  N  N     . LYS E  1  49  ? 46.253  -52.986 11.576  1.00 13.71  ? 49   LYS N N     1 
ATOM   8768  C  CA    . LYS E  1  49  ? 45.331  -52.507 10.558  1.00 13.36  ? 49   LYS N CA    1 
ATOM   8769  C  C     . LYS E  1  49  ? 44.910  -51.060 10.796  1.00 16.02  ? 49   LYS N C     1 
ATOM   8770  O  O     . LYS E  1  49  ? 44.375  -50.418 9.912   1.00 15.04  ? 49   LYS N O     1 
ATOM   8771  C  CB    . LYS E  1  49  ? 44.109  -53.424 10.414  1.00 14.99  ? 49   LYS N CB    1 
ATOM   8772  C  CG    . LYS E  1  49  ? 43.155  -53.501 11.593  1.00 19.32  ? 49   LYS N CG    1 
ATOM   8773  C  CD    . LYS E  1  49  ? 41.929  -54.378 11.269  1.00 16.77  ? 49   LYS N CD    1 
ATOM   8774  C  CE    . LYS E  1  49  ? 40.978  -54.497 12.438  1.00 16.11  ? 49   LYS N CE    1 
ATOM   8775  N  NZ    . LYS E  1  49  ? 39.762  -55.347 12.155  1.00 16.14  ? 49   LYS N NZ    1 
ATOM   8776  N  N     . LEU E  1  50  ? 45.205  -50.528 11.980  1.00 17.88  ? 50   LEU N N     1 
ATOM   8777  C  CA    . LEU E  1  50  ? 44.874  -49.135 12.301  1.00 15.25  ? 50   LEU N CA    1 
ATOM   8778  C  C     . LEU E  1  50  ? 46.108  -48.366 12.762  1.00 15.72  ? 50   LEU N C     1 
ATOM   8779  O  O     . LEU E  1  50  ? 47.087  -48.959 13.159  1.00 16.61  ? 50   LEU N O     1 
ATOM   8780  C  CB    . LEU E  1  50  ? 43.879  -49.096 13.452  1.00 18.86  ? 50   LEU N CB    1 
ATOM   8781  C  CG    . LEU E  1  50  ? 42.507  -49.766 13.404  1.00 17.67  ? 50   LEU N CG    1 
ATOM   8782  C  CD1   . LEU E  1  50  ? 41.894  -49.885 14.836  1.00 17.28  ? 50   LEU N CD1   1 
ATOM   8783  C  CD2   . LEU E  1  50  ? 41.636  -48.912 12.550  1.00 24.24  ? 50   LEU N CD2   1 
ATOM   8784  N  N     . PHE E  1  51  ? 46.053  -47.038 12.697  1.00 17.84  ? 51   PHE N N     1 
ATOM   8785  C  CA    . PHE E  1  51  ? 47.119  -46.207 13.239  1.00 15.01  ? 51   PHE N CA    1 
ATOM   8786  C  C     . PHE E  1  51  ? 46.946  -46.576 14.740  1.00 14.66  ? 51   PHE N C     1 
ATOM   8787  O  O     . PHE E  1  51  ? 45.822  -46.625 15.255  1.00 14.69  ? 51   PHE N O     1 
ATOM   8788  C  CB    . PHE E  1  51  ? 46.823  -44.724 12.982  1.00 14.27  ? 51   PHE N CB    1 
ATOM   8789  C  CG    . PHE E  1  51  ? 47.839  -43.822 13.578  1.00 18.08  ? 51   PHE N CG    1 
ATOM   8790  C  CD1   . PHE E  1  51  ? 49.117  -43.737 13.017  1.00 12.07  ? 51   PHE N CD1   1 
ATOM   8791  C  CD2   . PHE E  1  51  ? 47.578  -43.167 14.795  1.00 14.29  ? 51   PHE N CD2   1 
ATOM   8792  C  CE1   . PHE E  1  51  ? 50.128  -43.026 13.671  1.00 20.32  ? 51   PHE N CE1   1 
ATOM   8793  C  CE2   . PHE E  1  51  ? 48.581  -42.456 15.454  1.00 20.60  ? 51   PHE N CE2   1 
ATOM   8794  C  CZ    . PHE E  1  51  ? 49.861  -42.391 14.893  1.00 17.05  ? 51   PHE N CZ    1 
ATOM   8795  N  N     . PRO E  1  52  ? 48.042  -46.815 15.455  1.00 11.78  ? 52   PRO N N     1 
ATOM   8796  C  CA    . PRO E  1  52  ? 47.942  -47.215 16.866  1.00 14.74  ? 52   PRO N CA    1 
ATOM   8797  C  C     . PRO E  1  52  ? 46.959  -46.605 17.842  1.00 13.83  ? 52   PRO N C     1 
ATOM   8798  O  O     . PRO E  1  52  ? 46.210  -47.348 18.492  1.00 14.53  ? 52   PRO N O     1 
ATOM   8799  C  CB    . PRO E  1  52  ? 49.395  -47.114 17.357  1.00 8.85   ? 52   PRO N CB    1 
ATOM   8800  C  CG    . PRO E  1  52  ? 50.187  -47.436 16.106  1.00 14.80  ? 52   PRO N CG    1 
ATOM   8801  C  CD    . PRO E  1  52  ? 49.451  -46.591 15.094  1.00 8.01   ? 52   PRO N CD    1 
ATOM   8802  N  N     . THR E  1  53  ? 46.936  -45.274 17.920  1.00 12.53  ? 53   THR N N     1 
ATOM   8803  C  CA    . THR E  1  53  ? 46.121  -44.591 18.872  1.00 13.43  ? 53   THR N CA    1 
ATOM   8804  C  C     . THR E  1  53  ? 44.633  -44.648 18.545  1.00 21.11  ? 53   THR N C     1 
ATOM   8805  O  O     . THR E  1  53  ? 43.831  -44.078 19.274  1.00 15.58  ? 53   THR N O     1 
ATOM   8806  C  CB    . THR E  1  53  ? 46.583  -43.104 19.059  1.00 15.20  ? 53   THR N CB    1 
ATOM   8807  O  OG1   . THR E  1  53  ? 46.332  -42.349 17.862  1.00 17.34  ? 53   THR N OG1   1 
ATOM   8808  C  CG2   . THR E  1  53  ? 48.118  -43.050 19.387  1.00 18.34  ? 53   THR N CG2   1 
ATOM   8809  N  N     . ARG E  1  54  ? 44.278  -45.325 17.442  1.00 18.05  ? 54   ARG N N     1 
ATOM   8810  C  CA    . ARG E  1  54  ? 42.883  -45.494 17.074  1.00 15.92  ? 54   ARG N CA    1 
ATOM   8811  C  C     . ARG E  1  54  ? 42.320  -46.821 17.641  1.00 16.39  ? 54   ARG N C     1 
ATOM   8812  O  O     . ARG E  1  54  ? 41.092  -47.060 17.553  1.00 16.80  ? 54   ARG N O     1 
ATOM   8813  C  CB    . ARG E  1  54  ? 42.717  -45.553 15.548  1.00 16.51  ? 54   ARG N CB    1 
ATOM   8814  C  CG    . ARG E  1  54  ? 43.326  -44.452 14.751  1.00 12.41  ? 54   ARG N CG    1 
ATOM   8815  C  CD    . ARG E  1  54  ? 42.949  -43.053 15.189  1.00 8.78   ? 54   ARG N CD    1 
ATOM   8816  N  NE    . ARG E  1  54  ? 43.625  -42.108 14.323  1.00 10.39  ? 54   ARG N NE    1 
ATOM   8817  C  CZ    . ARG E  1  54  ? 43.831  -40.808 14.595  1.00 11.33  ? 54   ARG N CZ    1 
ATOM   8818  N  NH1   . ARG E  1  54  ? 43.398  -40.226 15.710  1.00 18.57  ? 54   ARG N NH1   1 
ATOM   8819  N  NH2   . ARG E  1  54  ? 44.611  -40.107 13.800  1.00 16.12  ? 54   ARG N NH2   1 
ATOM   8820  N  N     . SER E  1  55  ? 43.196  -47.669 18.210  1.00 13.48  ? 55   SER N N     1 
ATOM   8821  C  CA    . SER E  1  55  ? 42.801  -48.987 18.752  1.00 15.06  ? 55   SER N CA    1 
ATOM   8822  C  C     . SER E  1  55  ? 41.765  -48.868 19.875  1.00 17.37  ? 55   SER N C     1 
ATOM   8823  O  O     . SER E  1  55  ? 41.724  -47.865 20.590  1.00 19.34  ? 55   SER N O     1 
ATOM   8824  C  CB    . SER E  1  55  ? 44.026  -49.739 19.286  1.00 13.37  ? 55   SER N CB    1 
ATOM   8825  O  OG    . SER E  1  55  ? 45.050  -49.801 18.308  1.00 19.77  ? 55   SER N OG    1 
ATOM   8826  N  N     . HIS E  1  56  ? 40.938  -49.896 20.032  1.00 10.11  ? 56   HIS N N     1 
ATOM   8827  C  CA    . HIS E  1  56  ? 39.893  -49.866 21.051  1.00 13.28  ? 56   HIS N CA    1 
ATOM   8828  C  C     . HIS E  1  56  ? 40.372  -49.460 22.461  1.00 12.57  ? 56   HIS N C     1 
ATOM   8829  O  O     . HIS E  1  56  ? 39.615  -48.875 23.227  1.00 12.77  ? 56   HIS N O     1 
ATOM   8830  C  CB    . HIS E  1  56  ? 39.189  -51.224 21.128  1.00 9.42   ? 56   HIS N CB    1 
ATOM   8831  C  CG    . HIS E  1  56  ? 37.920  -51.187 21.927  1.00 14.99  ? 56   HIS N CG    1 
ATOM   8832  N  ND1   . HIS E  1  56  ? 36.863  -50.368 21.592  1.00 17.02  ? 56   HIS N ND1   1 
ATOM   8833  C  CD2   . HIS E  1  56  ? 37.578  -51.780 23.101  1.00 15.30  ? 56   HIS N CD2   1 
ATOM   8834  C  CE1   . HIS E  1  56  ? 35.925  -50.450 22.530  1.00 17.84  ? 56   HIS N CE1   1 
ATOM   8835  N  NE2   . HIS E  1  56  ? 36.335  -51.300 23.457  1.00 15.59  ? 56   HIS N NE2   1 
ATOM   8836  N  N     . THR E  1  57  ? 41.627  -49.776 22.788  1.00 10.97  ? 57   THR N N     1 
ATOM   8837  C  CA    . THR E  1  57  ? 42.220  -49.468 24.088  1.00 10.92  ? 57   THR N CA    1 
ATOM   8838  C  C     . THR E  1  57  ? 42.039  -47.970 24.395  1.00 13.74  ? 57   THR N C     1 
ATOM   8839  O  O     . THR E  1  57  ? 41.889  -47.567 25.560  1.00 16.53  ? 57   THR N O     1 
ATOM   8840  C  CB    . THR E  1  57  ? 43.782  -49.776 24.077  1.00 16.27  ? 57   THR N CB    1 
ATOM   8841  O  OG1   . THR E  1  57  ? 43.982  -51.193 23.993  1.00 18.54  ? 57   THR N OG1   1 
ATOM   8842  C  CG2   . THR E  1  57  ? 44.482  -49.247 25.373  1.00 9.46   ? 57   THR N CG2   1 
ATOM   8843  N  N     . VAL E  1  58  ? 42.061  -47.171 23.339  1.00 8.38   ? 58   VAL N N     1 
ATOM   8844  C  CA    . VAL E  1  58  ? 41.958  -45.705 23.403  1.00 14.37  ? 58   VAL N CA    1 
ATOM   8845  C  C     . VAL E  1  58  ? 40.603  -45.347 23.990  1.00 15.69  ? 58   VAL N C     1 
ATOM   8846  O  O     . VAL E  1  58  ? 40.394  -44.253 24.506  1.00 13.20  ? 58   VAL N O     1 
ATOM   8847  C  CB    . VAL E  1  58  ? 42.061  -45.067 21.948  1.00 14.82  ? 58   VAL N CB    1 
ATOM   8848  C  CG1   . VAL E  1  58  ? 40.696  -45.089 21.270  1.00 8.52   ? 58   VAL N CG1   1 
ATOM   8849  C  CG2   . VAL E  1  58  ? 42.564  -43.565 22.030  1.00 18.13  ? 58   VAL N CG2   1 
ATOM   8850  N  N     . ALA E  1  59  ? 39.661  -46.279 23.904  1.00 13.80  ? 59   ALA N N     1 
ATOM   8851  C  CA    . ALA E  1  59  ? 38.345  -45.941 24.414  1.00 16.35  ? 59   ALA N CA    1 
ATOM   8852  C  C     . ALA E  1  59  ? 38.147  -46.368 25.863  1.00 12.25  ? 59   ALA N C     1 
ATOM   8853  O  O     . ALA E  1  59  ? 37.102  -46.085 26.438  1.00 15.34  ? 59   ALA N O     1 
ATOM   8854  C  CB    . ALA E  1  59  ? 37.234  -46.546 23.511  1.00 10.15  ? 59   ALA N CB    1 
ATOM   8855  N  N     . ALA E  1  60  ? 39.124  -47.038 26.457  1.00 14.08  ? 60   ALA N N     1 
ATOM   8856  C  CA    . ALA E  1  60  ? 38.954  -47.478 27.851  1.00 14.14  ? 60   ALA N CA    1 
ATOM   8857  C  C     . ALA E  1  60  ? 38.825  -46.261 28.800  1.00 16.81  ? 60   ALA N C     1 
ATOM   8858  O  O     . ALA E  1  60  ? 39.464  -45.216 28.587  1.00 15.78  ? 60   ALA N O     1 
ATOM   8859  C  CB    . ALA E  1  60  ? 40.081  -48.383 28.247  1.00 13.10  ? 60   ALA N CB    1 
ATOM   8860  N  N     . GLN E  1  61  ? 38.005  -46.411 29.837  1.00 16.25  ? 61   GLN N N     1 
ATOM   8861  C  CA    . GLN E  1  61  ? 37.706  -45.316 30.757  1.00 15.68  ? 61   GLN N CA    1 
ATOM   8862  C  C     . GLN E  1  61  ? 38.065  -45.407 32.223  1.00 16.08  ? 61   GLN N C     1 
ATOM   8863  O  O     . GLN E  1  61  ? 38.839  -44.580 32.769  1.00 21.45  ? 61   GLN N O     1 
ATOM   8864  C  CB    . GLN E  1  61  ? 36.187  -45.043 30.711  1.00 15.24  ? 61   GLN N CB    1 
ATOM   8865  C  CG    . GLN E  1  61  ? 35.610  -44.679 29.342  1.00 22.82  ? 61   GLN N CG    1 
ATOM   8866  C  CD    . GLN E  1  61  ? 34.094  -44.571 29.406  1.00 22.03  ? 61   GLN N CD    1 
ATOM   8867  O  OE1   . GLN E  1  61  ? 33.528  -44.587 30.489  1.00 18.68  ? 61   GLN N OE1   1 
ATOM   8868  N  NE2   . GLN E  1  61  ? 33.439  -44.478 28.249  1.00 18.35  ? 61   GLN N NE2   1 
ATOM   8869  N  N     . GLY E  1  62  ? 37.407  -46.353 32.876  1.00 16.48  ? 62   GLY N N     1 
ATOM   8870  C  CA    . GLY E  1  62  ? 37.525  -46.551 34.315  1.00 14.26  ? 62   GLY N CA    1 
ATOM   8871  C  C     . GLY E  1  62  ? 38.880  -46.599 34.969  1.00 17.18  ? 62   GLY N C     1 
ATOM   8872  O  O     . GLY E  1  62  ? 39.088  -45.918 35.979  1.00 14.55  ? 62   GLY N O     1 
ATOM   8873  N  N     . GLY E  1  63  ? 39.780  -47.439 34.461  1.00 14.21  ? 63   GLY N N     1 
ATOM   8874  C  CA    . GLY E  1  63  ? 41.100  -47.496 35.061  1.00 14.49  ? 63   GLY N CA    1 
ATOM   8875  C  C     . GLY E  1  63  ? 41.829  -48.803 34.960  1.00 15.79  ? 63   GLY N C     1 
ATOM   8876  O  O     . GLY E  1  63  ? 41.445  -49.695 34.205  1.00 17.88  ? 63   GLY N O     1 
ATOM   8877  N  N     . ILE E  1  64  ? 42.907  -48.923 35.727  1.00 16.57  ? 64   ILE N N     1 
ATOM   8878  C  CA    . ILE E  1  64  ? 43.711  -50.122 35.712  1.00 11.38  ? 64   ILE N CA    1 
ATOM   8879  C  C     . ILE E  1  64  ? 44.022  -50.480 37.174  1.00 14.29  ? 64   ILE N C     1 
ATOM   8880  O  O     . ILE E  1  64  ? 44.438  -49.620 37.951  1.00 15.41  ? 64   ILE N O     1 
ATOM   8881  C  CB    . ILE E  1  64  ? 44.988  -49.875 34.822  1.00 12.38  ? 64   ILE N CB    1 
ATOM   8882  C  CG1   . ILE E  1  64  ? 45.961  -51.023 34.949  1.00 13.89  ? 64   ILE N CG1   1 
ATOM   8883  C  CG2   . ILE E  1  64  ? 45.663  -48.520 35.136  1.00 11.07  ? 64   ILE N CG2   1 
ATOM   8884  C  CD1   . ILE E  1  64  ? 46.972  -50.985 33.833  1.00 16.05  ? 64   ILE N CD1   1 
ATOM   8885  N  N     . ASN E  1  65  ? 43.792  -51.740 37.541  1.00 12.38  ? 65   ASN N N     1 
ATOM   8886  C  CA    . ASN E  1  65  ? 44.003  -52.222 38.906  1.00 16.26  ? 65   ASN N CA    1 
ATOM   8887  C  C     . ASN E  1  65  ? 45.421  -52.536 39.354  1.00 20.08  ? 65   ASN N C     1 
ATOM   8888  O  O     . ASN E  1  65  ? 46.207  -53.182 38.635  1.00 14.69  ? 65   ASN N O     1 
ATOM   8889  C  CB    . ASN E  1  65  ? 43.166  -53.487 39.187  1.00 16.33  ? 65   ASN N CB    1 
ATOM   8890  C  CG    . ASN E  1  65  ? 41.641  -53.239 39.119  1.00 16.48  ? 65   ASN N CG    1 
ATOM   8891  O  OD1   . ASN E  1  65  ? 41.147  -52.185 39.519  1.00 15.88  ? 65   ASN N OD1   1 
ATOM   8892  N  ND2   . ASN E  1  65  ? 40.899  -54.236 38.625  1.00 14.02  ? 65   ASN N ND2   1 
ATOM   8893  N  N     . ALA E  1  66  ? 45.726  -52.106 40.581  1.00 15.61  ? 66   ALA N N     1 
ATOM   8894  C  CA    . ALA E  1  66  ? 47.031  -52.376 41.166  1.00 19.46  ? 66   ALA N CA    1 
ATOM   8895  C  C     . ALA E  1  66  ? 46.961  -52.097 42.673  1.00 19.93  ? 66   ALA N C     1 
ATOM   8896  O  O     . ALA E  1  66  ? 46.411  -51.062 43.103  1.00 18.70  ? 66   ALA N O     1 
ATOM   8897  C  CB    . ALA E  1  66  ? 48.103  -51.490 40.501  1.00 16.67  ? 66   ALA N CB    1 
ATOM   8898  N  N     . ALA E  1  67  ? 47.467  -53.030 43.470  1.00 16.53  ? 67   ALA N N     1 
ATOM   8899  C  CA    . ALA E  1  67  ? 47.456  -52.827 44.914  1.00 18.89  ? 67   ALA N CA    1 
ATOM   8900  C  C     . ALA E  1  67  ? 48.589  -51.890 45.300  1.00 14.06  ? 67   ALA N C     1 
ATOM   8901  O  O     . ALA E  1  67  ? 49.496  -52.319 45.957  1.00 25.17  ? 67   ALA N O     1 
ATOM   8902  C  CB    . ALA E  1  67  ? 47.623  -54.161 45.626  1.00 15.20  ? 67   ALA N CB    1 
ATOM   8903  N  N     . LEU E  1  68  ? 48.545  -50.618 44.912  1.00 14.15  ? 68   LEU N N     1 
ATOM   8904  C  CA    . LEU E  1  68  ? 49.616  -49.678 45.266  1.00 13.55  ? 68   LEU N CA    1 
ATOM   8905  C  C     . LEU E  1  68  ? 49.446  -49.240 46.731  1.00 18.09  ? 68   LEU N C     1 
ATOM   8906  O  O     . LEU E  1  68  ? 50.410  -48.896 47.404  1.00 19.30  ? 68   LEU N O     1 
ATOM   8907  C  CB    . LEU E  1  68  ? 49.564  -48.425 44.400  1.00 16.34  ? 68   LEU N CB    1 
ATOM   8908  C  CG    . LEU E  1  68  ? 49.912  -48.604 42.915  1.00 17.04  ? 68   LEU N CG    1 
ATOM   8909  C  CD1   . LEU E  1  68  ? 49.552  -47.322 42.178  1.00 11.40  ? 68   LEU N CD1   1 
ATOM   8910  C  CD2   . LEU E  1  68  ? 51.393  -48.938 42.784  1.00 17.46  ? 68   LEU N CD2   1 
ATOM   8911  N  N     . GLY E  1  69  ? 48.214  -49.243 47.221  1.00 15.05  ? 69   GLY N N     1 
ATOM   8912  C  CA    . GLY E  1  69  ? 47.985  -48.836 48.585  1.00 17.79  ? 69   GLY N CA    1 
ATOM   8913  C  C     . GLY E  1  69  ? 48.012  -47.319 48.736  1.00 21.72  ? 69   GLY N C     1 
ATOM   8914  O  O     . GLY E  1  69  ? 48.322  -46.815 49.808  1.00 18.27  ? 69   GLY N O     1 
ATOM   8915  N  N     . ASN E  1  70  ? 47.688  -46.579 47.684  1.00 18.85  ? 70   ASN N N     1 
ATOM   8916  C  CA    . ASN E  1  70  ? 47.674  -45.111 47.793  1.00 21.56  ? 70   ASN N CA    1 
ATOM   8917  C  C     . ASN E  1  70  ? 46.498  -44.480 48.572  1.00 23.44  ? 70   ASN N C     1 
ATOM   8918  O  O     . ASN E  1  70  ? 46.590  -43.320 49.010  1.00 20.50  ? 70   ASN N O     1 
ATOM   8919  C  CB    . ASN E  1  70  ? 47.653  -44.466 46.412  1.00 17.63  ? 70   ASN N CB    1 
ATOM   8920  C  CG    . ASN E  1  70  ? 48.971  -44.610 45.662  1.00 22.35  ? 70   ASN N CG    1 
ATOM   8921  O  OD1   . ASN E  1  70  ? 50.015  -44.883 46.255  1.00 16.05  ? 70   ASN N OD1   1 
ATOM   8922  N  ND2   . ASN E  1  70  ? 48.926  -44.392 44.337  1.00 18.76  ? 70   ASN N ND2   1 
ATOM   8923  N  N     . MET E  1  71  ? 45.391  -45.211 48.691  1.00 20.76  ? 71   MET N N     1 
ATOM   8924  C  CA    . MET E  1  71  ? 44.183  -44.683 49.323  1.00 21.77  ? 71   MET N CA    1 
ATOM   8925  C  C     . MET E  1  71  ? 43.955  -45.248 50.724  1.00 25.38  ? 71   MET N C     1 
ATOM   8926  O  O     . MET E  1  71  ? 43.443  -44.564 51.613  1.00 25.15  ? 71   MET N O     1 
ATOM   8927  C  CB    . MET E  1  71  ? 42.955  -44.998 48.454  1.00 26.29  ? 71   MET N CB    1 
ATOM   8928  C  CG    . MET E  1  71  ? 43.092  -44.668 46.954  1.00 17.97  ? 71   MET N CG    1 
ATOM   8929  S  SD    . MET E  1  71  ? 43.699  -43.007 46.632  1.00 20.25  ? 71   MET N SD    1 
ATOM   8930  C  CE    . MET E  1  71  ? 42.301  -42.022 47.040  1.00 22.23  ? 71   MET N CE    1 
ATOM   8931  N  N     . GLU E  1  72  ? 44.325  -46.506 50.899  1.00 23.62  ? 72   GLU N N     1 
ATOM   8932  C  CA    . GLU E  1  72  ? 44.214  -47.220 52.166  1.00 27.23  ? 72   GLU N CA    1 
ATOM   8933  C  C     . GLU E  1  72  ? 45.213  -48.361 51.984  1.00 26.98  ? 72   GLU N C     1 
ATOM   8934  O  O     . GLU E  1  72  ? 45.710  -48.589 50.854  1.00 23.70  ? 72   GLU N O     1 
ATOM   8935  C  CB    . GLU E  1  72  ? 42.806  -47.787 52.353  1.00 25.60  ? 72   GLU N CB    1 
ATOM   8936  C  CG    . GLU E  1  72  ? 42.579  -49.147 51.675  1.00 29.91  ? 72   GLU N CG    1 
ATOM   8937  C  CD    . GLU E  1  72  ? 41.886  -49.045 50.310  1.00 36.61  ? 72   GLU N CD    1 
ATOM   8938  O  OE1   . GLU E  1  72  ? 40.723  -48.584 50.275  1.00 38.44  ? 72   GLU N OE1   1 
ATOM   8939  O  OE2   . GLU E  1  72  ? 42.488  -49.443 49.273  1.00 37.51  ? 72   GLU N OE2   1 
ATOM   8940  N  N     . ASP E  1  73  ? 45.521  -49.083 53.048  1.00 26.92  ? 73   ASP N N     1 
ATOM   8941  C  CA    . ASP E  1  73  ? 46.463  -50.192 52.912  1.00 29.33  ? 73   ASP N CA    1 
ATOM   8942  C  C     . ASP E  1  73  ? 45.948  -51.342 52.050  1.00 28.62  ? 73   ASP N C     1 
ATOM   8943  O  O     . ASP E  1  73  ? 44.785  -51.706 52.114  1.00 26.70  ? 73   ASP N O     1 
ATOM   8944  C  CB    . ASP E  1  73  ? 46.869  -50.714 54.266  1.00 39.00  ? 73   ASP N CB    1 
ATOM   8945  C  CG    . ASP E  1  73  ? 48.241  -50.213 54.665  1.00 51.74  ? 73   ASP N CG    1 
ATOM   8946  O  OD1   . ASP E  1  73  ? 48.412  -48.970 54.833  1.00 50.76  ? 73   ASP N OD1   1 
ATOM   8947  O  OD2   . ASP E  1  73  ? 49.151  -51.076 54.778  1.00 58.84  ? 73   ASP N OD2   1 
ATOM   8948  N  N     . ASP E  1  74  ? 46.834  -51.937 51.257  1.00 25.94  ? 74   ASP N N     1 
ATOM   8949  C  CA    . ASP E  1  74  ? 46.385  -52.984 50.347  1.00 28.12  ? 74   ASP N CA    1 
ATOM   8950  C  C     . ASP E  1  74  ? 47.349  -54.119 50.314  1.00 23.65  ? 74   ASP N C     1 
ATOM   8951  O  O     . ASP E  1  74  ? 48.405  -54.057 50.917  1.00 26.76  ? 74   ASP N O     1 
ATOM   8952  C  CB    . ASP E  1  74  ? 46.250  -52.430 48.914  1.00 18.69  ? 74   ASP N CB    1 
ATOM   8953  C  CG    . ASP E  1  74  ? 45.110  -53.087 48.118  1.00 24.96  ? 74   ASP N CG    1 
ATOM   8954  O  OD1   . ASP E  1  74  ? 44.652  -54.225 48.432  1.00 18.65  ? 74   ASP N OD1   1 
ATOM   8955  O  OD2   . ASP E  1  74  ? 44.686  -52.458 47.119  1.00 23.15  ? 74   ASP N OD2   1 
ATOM   8956  N  N     . ASN E  1  75  ? 46.985  -55.143 49.560  1.00 21.98  ? 75   ASN N N     1 
ATOM   8957  C  CA    . ASN E  1  75  ? 47.817  -56.303 49.412  1.00 22.38  ? 75   ASN N CA    1 
ATOM   8958  C  C     . ASN E  1  75  ? 47.464  -56.938 48.071  1.00 20.86  ? 75   ASN N C     1 
ATOM   8959  O  O     . ASN E  1  75  ? 46.295  -57.209 47.804  1.00 23.77  ? 75   ASN N O     1 
ATOM   8960  C  CB    . ASN E  1  75  ? 47.520  -57.262 50.553  1.00 19.84  ? 75   ASN N CB    1 
ATOM   8961  C  CG    . ASN E  1  75  ? 48.506  -58.397 50.623  1.00 22.58  ? 75   ASN N CG    1 
ATOM   8962  O  OD1   . ASN E  1  75  ? 48.877  -58.954 49.613  1.00 24.07  ? 75   ASN N OD1   1 
ATOM   8963  N  ND2   . ASN E  1  75  ? 48.908  -58.762 51.823  1.00 21.42  ? 75   ASN N ND2   1 
ATOM   8964  N  N     . TRP E  1  76  ? 48.468  -57.217 47.257  1.00 21.52  ? 76   TRP N N     1 
ATOM   8965  C  CA    . TRP E  1  76  ? 48.215  -57.800 45.955  1.00 20.94  ? 76   TRP N CA    1 
ATOM   8966  C  C     . TRP E  1  76  ? 47.551  -59.170 46.067  1.00 23.13  ? 76   TRP N C     1 
ATOM   8967  O  O     . TRP E  1  76  ? 46.811  -59.562 45.153  1.00 17.02  ? 76   TRP N O     1 
ATOM   8968  C  CB    . TRP E  1  76  ? 49.511  -57.895 45.105  1.00 19.28  ? 76   TRP N CB    1 
ATOM   8969  C  CG    . TRP E  1  76  ? 50.537  -58.904 45.552  1.00 21.66  ? 76   TRP N CG    1 
ATOM   8970  C  CD1   . TRP E  1  76  ? 51.658  -58.659 46.301  1.00 22.59  ? 76   TRP N CD1   1 
ATOM   8971  C  CD2   . TRP E  1  76  ? 50.550  -60.310 45.261  1.00 19.12  ? 76   TRP N CD2   1 
ATOM   8972  N  NE1   . TRP E  1  76  ? 52.359  -59.822 46.494  1.00 20.12  ? 76   TRP N NE1   1 
ATOM   8973  C  CE2   . TRP E  1  76  ? 51.708  -60.850 45.868  1.00 20.82  ? 76   TRP N CE2   1 
ATOM   8974  C  CE3   . TRP E  1  76  ? 49.702  -61.163 44.540  1.00 18.41  ? 76   TRP N CE3   1 
ATOM   8975  C  CZ2   . TRP E  1  76  ? 52.041  -62.213 45.783  1.00 20.85  ? 76   TRP N CZ2   1 
ATOM   8976  C  CZ3   . TRP E  1  76  ? 50.029  -62.524 44.452  1.00 20.29  ? 76   TRP N CZ3   1 
ATOM   8977  C  CH2   . TRP E  1  76  ? 51.200  -63.031 45.077  1.00 17.92  ? 76   TRP N CH2   1 
ATOM   8978  N  N     . ARG E  1  77  ? 47.775  -59.889 47.178  1.00 15.92  ? 77   ARG N N     1 
ATOM   8979  C  CA    . ARG E  1  77  ? 47.161  -61.200 47.292  1.00 16.25  ? 77   ARG N CA    1 
ATOM   8980  C  C     . ARG E  1  77  ? 45.636  -61.053 47.465  1.00 15.88  ? 77   ARG N C     1 
ATOM   8981  O  O     . ARG E  1  77  ? 44.882  -62.015 47.208  1.00 15.18  ? 77   ARG N O     1 
ATOM   8982  C  CB    . ARG E  1  77  ? 47.775  -62.015 48.443  1.00 13.49  ? 77   ARG N CB    1 
ATOM   8983  C  CG    . ARG E  1  77  ? 49.286  -62.246 48.311  1.00 19.22  ? 77   ARG N CG    1 
ATOM   8984  C  CD    . ARG E  1  77  ? 49.954  -62.712 49.641  1.00 22.59  ? 77   ARG N CD    1 
ATOM   8985  N  NE    . ARG E  1  77  ? 51.424  -62.662 49.554  1.00 23.11  ? 77   ARG N NE    1 
ATOM   8986  C  CZ    . ARG E  1  77  ? 52.136  -61.540 49.556  1.00 21.52  ? 77   ARG N CZ    1 
ATOM   8987  N  NH1   . ARG E  1  77  ? 51.517  -60.377 49.653  1.00 21.84  ? 77   ARG N NH1   1 
ATOM   8988  N  NH2   . ARG E  1  77  ? 53.467  -61.577 49.426  1.00 22.68  ? 77   ARG N NH2   1 
ATOM   8989  N  N     . TRP E  1  78  ? 45.181  -59.867 47.886  1.00 15.43  ? 78   TRP N N     1 
ATOM   8990  C  CA    . TRP E  1  78  ? 43.724  -59.646 48.039  1.00 17.92  ? 78   TRP N CA    1 
ATOM   8991  C  C     . TRP E  1  78  ? 43.136  -59.461 46.601  1.00 16.59  ? 78   TRP N C     1 
ATOM   8992  O  O     . TRP E  1  78  ? 41.994  -59.836 46.315  1.00 13.10  ? 78   TRP N O     1 
ATOM   8993  C  CB    . TRP E  1  78  ? 43.448  -58.380 48.869  1.00 20.48  ? 78   TRP N CB    1 
ATOM   8994  C  CG    . TRP E  1  78  ? 43.900  -58.492 50.347  1.00 20.44  ? 78   TRP N CG    1 
ATOM   8995  C  CD1   . TRP E  1  78  ? 44.212  -59.647 51.030  1.00 19.80  ? 78   TRP N CD1   1 
ATOM   8996  C  CD2   . TRP E  1  78  ? 44.102  -57.416 51.269  1.00 17.59  ? 78   TRP N CD2   1 
ATOM   8997  N  NE1   . TRP E  1  78  ? 44.597  -59.348 52.315  1.00 19.22  ? 78   TRP N NE1   1 
ATOM   8998  C  CE2   . TRP E  1  78  ? 44.545  -57.989 52.491  1.00 20.76  ? 78   TRP N CE2   1 
ATOM   8999  C  CE3   . TRP E  1  78  ? 43.958  -56.014 51.185  1.00 18.86  ? 78   TRP N CE3   1 
ATOM   9000  C  CZ2   . TRP E  1  78  ? 44.849  -57.211 53.624  1.00 19.22  ? 78   TRP N CZ2   1 
ATOM   9001  C  CZ3   . TRP E  1  78  ? 44.258  -55.235 52.313  1.00 24.12  ? 78   TRP N CZ3   1 
ATOM   9002  C  CH2   . TRP E  1  78  ? 44.700  -55.841 53.521  1.00 23.47  ? 78   TRP N CH2   1 
ATOM   9003  N  N     . HIS E  1  79  ? 43.923  -58.828 45.741  1.00 14.86  ? 79   HIS N N     1 
ATOM   9004  C  CA    . HIS E  1  79  ? 43.540  -58.581 44.346  1.00 16.47  ? 79   HIS N CA    1 
ATOM   9005  C  C     . HIS E  1  79  ? 43.546  -59.944 43.629  1.00 18.78  ? 79   HIS N C     1 
ATOM   9006  O  O     . HIS E  1  79  ? 42.681  -60.228 42.809  1.00 20.39  ? 79   HIS N O     1 
ATOM   9007  C  CB    . HIS E  1  79  ? 44.548  -57.630 43.748  1.00 16.01  ? 79   HIS N CB    1 
ATOM   9008  C  CG    . HIS E  1  79  ? 44.265  -57.246 42.333  1.00 10.75  ? 79   HIS N CG    1 
ATOM   9009  N  ND1   . HIS E  1  79  ? 45.219  -56.672 41.529  1.00 14.90  ? 79   HIS N ND1   1 
ATOM   9010  C  CD2   . HIS E  1  79  ? 43.155  -57.384 41.569  1.00 14.37  ? 79   HIS N CD2   1 
ATOM   9011  C  CE1   . HIS E  1  79  ? 44.719  -56.484 40.317  1.00 16.63  ? 79   HIS N CE1   1 
ATOM   9012  N  NE2   . HIS E  1  79  ? 43.466  -56.905 40.312  1.00 11.66  ? 79   HIS N NE2   1 
ATOM   9013  N  N     . PHE E  1  80  ? 44.518  -60.791 43.990  1.00 20.32  ? 80   PHE N N     1 
ATOM   9014  C  CA    . PHE E  1  80  ? 44.621  -62.166 43.489  1.00 20.33  ? 80   PHE N CA    1 
ATOM   9015  C  C     . PHE E  1  80  ? 43.316  -62.882 43.800  1.00 21.75  ? 80   PHE N C     1 
ATOM   9016  O  O     . PHE E  1  80  ? 42.688  -63.496 42.920  1.00 21.03  ? 80   PHE N O     1 
ATOM   9017  C  CB    . PHE E  1  80  ? 45.762  -62.915 44.196  1.00 19.58  ? 80   PHE N CB    1 
ATOM   9018  C  CG    . PHE E  1  80  ? 45.758  -64.434 43.961  1.00 18.90  ? 80   PHE N CG    1 
ATOM   9019  C  CD1   . PHE E  1  80  ? 46.219  -64.979 42.756  1.00 17.38  ? 80   PHE N CD1   1 
ATOM   9020  C  CD2   . PHE E  1  80  ? 45.300  -65.301 44.949  1.00 12.90  ? 80   PHE N CD2   1 
ATOM   9021  C  CE1   . PHE E  1  80  ? 46.219  -66.358 42.532  1.00 15.03  ? 80   PHE N CE1   1 
ATOM   9022  C  CE2   . PHE E  1  80  ? 45.296  -66.708 44.735  1.00 11.11  ? 80   PHE N CE2   1 
ATOM   9023  C  CZ    . PHE E  1  80  ? 45.755  -67.228 43.522  1.00 14.73  ? 80   PHE N CZ    1 
ATOM   9024  N  N     . TYR E  1  81  ? 42.930  -62.827 45.068  1.00 17.36  ? 81   TYR N N     1 
ATOM   9025  C  CA    . TYR E  1  81  ? 41.727  -63.469 45.515  1.00 16.42  ? 81   TYR N CA    1 
ATOM   9026  C  C     . TYR E  1  81  ? 40.474  -62.946 44.816  1.00 17.67  ? 81   TYR N C     1 
ATOM   9027  O  O     . TYR E  1  81  ? 39.617  -63.731 44.466  1.00 14.32  ? 81   TYR N O     1 
ATOM   9028  C  CB    . TYR E  1  81  ? 41.564  -63.274 47.030  1.00 19.31  ? 81   TYR N CB    1 
ATOM   9029  C  CG    . TYR E  1  81  ? 40.274  -63.818 47.586  1.00 19.78  ? 81   TYR N CG    1 
ATOM   9030  C  CD1   . TYR E  1  81  ? 40.143  -65.178 47.929  1.00 18.17  ? 81   TYR N CD1   1 
ATOM   9031  C  CD2   . TYR E  1  81  ? 39.163  -62.989 47.733  1.00 17.84  ? 81   TYR N CD2   1 
ATOM   9032  C  CE1   . TYR E  1  81  ? 38.918  -65.698 48.395  1.00 16.74  ? 81   TYR N CE1   1 
ATOM   9033  C  CE2   . TYR E  1  81  ? 37.955  -63.495 48.199  1.00 20.87  ? 81   TYR N CE2   1 
ATOM   9034  C  CZ    . TYR E  1  81  ? 37.835  -64.854 48.517  1.00 23.75  ? 81   TYR N CZ    1 
ATOM   9035  O  OH    . TYR E  1  81  ? 36.579  -65.354 48.855  1.00 22.92  ? 81   TYR N OH    1 
ATOM   9036  N  N     . ASP E  1  82  ? 40.340  -61.620 44.668  1.00 17.59  ? 82   ASP N N     1 
ATOM   9037  C  CA    . ASP E  1  82  ? 39.138  -61.048 44.034  1.00 15.93  ? 82   ASP N CA    1 
ATOM   9038  C  C     . ASP E  1  82  ? 39.022  -61.533 42.589  1.00 13.12  ? 82   ASP N C     1 
ATOM   9039  O  O     . ASP E  1  82  ? 37.929  -61.797 42.108  1.00 17.98  ? 82   ASP N O     1 
ATOM   9040  C  CB    . ASP E  1  82  ? 39.169  -59.485 44.030  1.00 20.17  ? 82   ASP N CB    1 
ATOM   9041  C  CG    . ASP E  1  82  ? 39.050  -58.864 45.456  1.00 25.02  ? 82   ASP N CG    1 
ATOM   9042  O  OD1   . ASP E  1  82  ? 38.433  -59.491 46.330  1.00 20.55  ? 82   ASP N OD1   1 
ATOM   9043  O  OD2   . ASP E  1  82  ? 39.562  -57.737 45.698  1.00 25.04  ? 82   ASP N OD2   1 
ATOM   9044  N  N     . THR E  1  83  ? 40.157  -61.678 41.921  1.00 12.93  ? 83   THR N N     1 
ATOM   9045  C  CA    . THR E  1  83  ? 40.176  -62.081 40.514  1.00 17.58  ? 83   THR N CA    1 
ATOM   9046  C  C     . THR E  1  83  ? 39.850  -63.588 40.368  1.00 17.28  ? 83   THR N C     1 
ATOM   9047  O  O     . THR E  1  83  ? 39.138  -63.992 39.444  1.00 17.23  ? 83   THR N O     1 
ATOM   9048  C  CB    . THR E  1  83  ? 41.558  -61.737 39.879  1.00 12.62  ? 83   THR N CB    1 
ATOM   9049  O  OG1   . THR E  1  83  ? 41.840  -60.339 40.079  1.00 13.16  ? 83   THR N OG1   1 
ATOM   9050  C  CG2   . THR E  1  83  ? 41.541  -62.012 38.337  1.00 17.32  ? 83   THR N CG2   1 
ATOM   9051  N  N     . VAL E  1  84  ? 40.343  -64.406 41.299  1.00 18.53  ? 84   VAL N N     1 
ATOM   9052  C  CA    . VAL E  1  84  ? 40.080  -65.843 41.276  1.00 14.36  ? 84   VAL N CA    1 
ATOM   9053  C  C     . VAL E  1  84  ? 38.570  -66.058 41.500  1.00 20.63  ? 84   VAL N C     1 
ATOM   9054  O  O     . VAL E  1  84  ? 37.888  -66.766 40.744  1.00 22.85  ? 84   VAL N O     1 
ATOM   9055  C  CB    . VAL E  1  84  ? 40.908  -66.558 42.353  1.00 16.22  ? 84   VAL N CB    1 
ATOM   9056  C  CG1   . VAL E  1  84  ? 40.529  -68.042 42.431  1.00 15.59  ? 84   VAL N CG1   1 
ATOM   9057  C  CG2   . VAL E  1  84  ? 42.393  -66.474 42.009  1.00 17.48  ? 84   VAL N CG2   1 
ATOM   9058  N  N     . LYS E  1  85  ? 38.027  -65.407 42.514  1.00 16.72  ? 85   LYS N N     1 
ATOM   9059  C  CA    . LYS E  1  85  ? 36.603  -65.536 42.784  1.00 18.48  ? 85   LYS N CA    1 
ATOM   9060  C  C     . LYS E  1  85  ? 35.789  -64.918 41.652  1.00 17.88  ? 85   LYS N C     1 
ATOM   9061  O  O     . LYS E  1  85  ? 34.767  -65.454 41.218  1.00 17.44  ? 85   LYS N O     1 
ATOM   9062  C  CB    . LYS E  1  85  ? 36.241  -64.835 44.097  1.00 16.08  ? 85   LYS N CB    1 
ATOM   9063  C  CG    . LYS E  1  85  ? 34.736  -64.745 44.343  1.00 23.36  ? 85   LYS N CG    1 
ATOM   9064  C  CD    . LYS E  1  85  ? 34.396  -63.953 45.601  1.00 21.03  ? 85   LYS N CD    1 
ATOM   9065  C  CE    . LYS E  1  85  ? 32.877  -63.767 45.758  1.00 22.42  ? 85   LYS N CE    1 
ATOM   9066  N  NZ    . LYS E  1  85  ? 32.561  -63.059 47.045  1.00 27.47  ? 85   LYS N NZ    1 
ATOM   9067  N  N     . GLY E  1  86  ? 36.215  -63.753 41.192  1.00 20.67  ? 86   GLY N N     1 
ATOM   9068  C  CA    . GLY E  1  86  ? 35.453  -63.138 40.131  1.00 19.46  ? 86   GLY N CA    1 
ATOM   9069  C  C     . GLY E  1  86  ? 35.363  -64.042 38.902  1.00 20.05  ? 86   GLY N C     1 
ATOM   9070  O  O     . GLY E  1  86  ? 34.353  -64.036 38.221  1.00 19.59  ? 86   GLY N O     1 
ATOM   9071  N  N     . SER E  1  87  ? 36.408  -64.822 38.629  1.00 19.75  ? 87   SER N N     1 
ATOM   9072  C  CA    . SER E  1  87  ? 36.412  -65.699 37.448  1.00 20.65  ? 87   SER N CA    1 
ATOM   9073  C  C     . SER E  1  87  ? 35.564  -66.945 37.626  1.00 21.97  ? 87   SER N C     1 
ATOM   9074  O  O     . SER E  1  87  ? 35.410  -67.731 36.668  1.00 18.50  ? 87   SER N O     1 
ATOM   9075  C  CB    . SER E  1  87  ? 37.832  -66.126 37.078  1.00 23.29  ? 87   SER N CB    1 
ATOM   9076  O  OG    . SER E  1  87  ? 38.353  -67.064 38.020  1.00 26.46  ? 87   SER N OG    1 
ATOM   9077  N  N     . ASP E  1  88  ? 35.010  -67.114 38.832  1.00 19.14  ? 88   ASP N N     1 
ATOM   9078  C  CA    . ASP E  1  88  ? 34.157  -68.261 39.159  1.00 21.08  ? 88   ASP N CA    1 
ATOM   9079  C  C     . ASP E  1  88  ? 34.863  -69.594 38.963  1.00 22.56  ? 88   ASP N C     1 
ATOM   9080  O  O     . ASP E  1  88  ? 34.272  -70.572 38.489  1.00 23.63  ? 88   ASP N O     1 
ATOM   9081  C  CB    . ASP E  1  88  ? 32.845  -68.225 38.327  1.00 22.48  ? 88   ASP N CB    1 
ATOM   9082  C  CG    . ASP E  1  88  ? 31.637  -68.787 39.094  1.00 27.87  ? 88   ASP N CG    1 
ATOM   9083  O  OD1   . ASP E  1  88  ? 31.781  -69.163 40.295  1.00 28.64  ? 88   ASP N OD1   1 
ATOM   9084  O  OD2   . ASP E  1  88  ? 30.529  -68.839 38.507  1.00 28.25  ? 88   ASP N OD2   1 
ATOM   9085  N  N     . TRP E  1  89  ? 36.141  -69.599 39.341  1.00 21.64  ? 89   TRP N N     1 
ATOM   9086  C  CA    . TRP E  1  89  ? 37.047  -70.738 39.306  1.00 20.27  ? 89   TRP N CA    1 
ATOM   9087  C  C     . TRP E  1  89  ? 37.316  -71.379 37.965  1.00 21.70  ? 89   TRP N C     1 
ATOM   9088  O  O     . TRP E  1  89  ? 37.626  -72.561 37.865  1.00 19.77  ? 89   TRP N O     1 
ATOM   9089  C  CB    . TRP E  1  89  ? 36.674  -71.789 40.394  1.00 14.21  ? 89   TRP N CB    1 
ATOM   9090  C  CG    . TRP E  1  89  ? 36.987  -71.280 41.774  1.00 14.41  ? 89   TRP N CG    1 
ATOM   9091  C  CD1   . TRP E  1  89  ? 38.165  -71.386 42.422  1.00 15.76  ? 89   TRP N CD1   1 
ATOM   9092  C  CD2   . TRP E  1  89  ? 36.165  -70.409 42.577  1.00 17.58  ? 89   TRP N CD2   1 
ATOM   9093  N  NE1   . TRP E  1  89  ? 38.155  -70.623 43.561  1.00 20.49  ? 89   TRP N NE1   1 
ATOM   9094  C  CE2   . TRP E  1  89  ? 36.935  -70.013 43.682  1.00 15.54  ? 89   TRP N CE2   1 
ATOM   9095  C  CE3   . TRP E  1  89  ? 34.851  -69.921 42.455  1.00 15.94  ? 89   TRP N CE3   1 
ATOM   9096  C  CZ2   . TRP E  1  89  ? 36.446  -69.141 44.680  1.00 16.70  ? 89   TRP N CZ2   1 
ATOM   9097  C  CZ3   . TRP E  1  89  ? 34.358  -69.048 43.448  1.00 23.67  ? 89   TRP N CZ3   1 
ATOM   9098  C  CH2   . TRP E  1  89  ? 35.162  -68.671 44.546  1.00 19.42  ? 89   TRP N CH2   1 
ATOM   9099  N  N     . LEU E  1  90  ? 37.229  -70.577 36.919  1.00 24.61  ? 90   LEU N N     1 
ATOM   9100  C  CA    . LEU E  1  90  ? 37.571  -71.087 35.618  1.00 23.89  ? 90   LEU N CA    1 
ATOM   9101  C  C     . LEU E  1  90  ? 38.904  -70.452 35.271  1.00 22.39  ? 90   LEU N C     1 
ATOM   9102  O  O     . LEU E  1  90  ? 39.507  -70.765 34.234  1.00 24.34  ? 90   LEU N O     1 
ATOM   9103  C  CB    . LEU E  1  90  ? 36.555  -70.674 34.588  1.00 22.80  ? 90   LEU N CB    1 
ATOM   9104  C  CG    . LEU E  1  90  ? 36.677  -71.572 33.369  1.00 29.59  ? 90   LEU N CG    1 
ATOM   9105  C  CD1   . LEU E  1  90  ? 36.317  -73.021 33.754  1.00 26.93  ? 90   LEU N CD1   1 
ATOM   9106  C  CD2   . LEU E  1  90  ? 35.757  -71.051 32.296  1.00 25.45  ? 90   LEU N CD2   1 
ATOM   9107  N  N     . GLY E  1  91  ? 39.355  -69.547 36.134  1.00 18.59  ? 91   GLY N N     1 
ATOM   9108  C  CA    . GLY E  1  91  ? 40.616  -68.845 35.901  1.00 20.73  ? 91   GLY N CA    1 
ATOM   9109  C  C     . GLY E  1  91  ? 41.833  -69.656 36.299  1.00 21.07  ? 91   GLY N C     1 
ATOM   9110  O  O     . GLY E  1  91  ? 41.779  -70.409 37.272  1.00 23.00  ? 91   GLY N O     1 
ATOM   9111  N  N     . ASP E  1  92  ? 42.926  -69.529 35.557  1.00 20.44  ? 92   ASP N N     1 
ATOM   9112  C  CA    . ASP E  1  92  ? 44.125  -70.275 35.896  1.00 21.76  ? 92   ASP N CA    1 
ATOM   9113  C  C     . ASP E  1  92  ? 44.880  -69.455 36.942  1.00 22.56  ? 92   ASP N C     1 
ATOM   9114  O  O     . ASP E  1  92  ? 45.360  -68.328 36.694  1.00 20.33  ? 92   ASP N O     1 
ATOM   9115  C  CB    . ASP E  1  92  ? 44.989  -70.550 34.655  1.00 23.49  ? 92   ASP N CB    1 
ATOM   9116  C  CG    . ASP E  1  92  ? 44.214  -71.326 33.529  1.00 29.96  ? 92   ASP N CG    1 
ATOM   9117  O  OD1   . ASP E  1  92  ? 43.509  -72.331 33.803  1.00 27.47  ? 92   ASP N OD1   1 
ATOM   9118  O  OD2   . ASP E  1  92  ? 44.327  -70.929 32.349  1.00 33.21  ? 92   ASP N OD2   1 
ATOM   9119  N  N     . GLN E  1  93  ? 44.981  -70.046 38.125  1.00 19.75  ? 93   GLN N N     1 
ATOM   9120  C  CA    . GLN E  1  93  ? 45.599  -69.370 39.254  1.00 18.13  ? 93   GLN N CA    1 
ATOM   9121  C  C     . GLN E  1  93  ? 47.067  -69.063 39.102  1.00 20.35  ? 93   GLN N C     1 
ATOM   9122  O  O     . GLN E  1  93  ? 47.567  -68.108 39.722  1.00 20.25  ? 93   GLN N O     1 
ATOM   9123  C  CB    . GLN E  1  93  ? 45.268  -70.148 40.530  1.00 19.17  ? 93   GLN N CB    1 
ATOM   9124  C  CG    . GLN E  1  93  ? 43.768  -70.198 40.713  1.00 15.78  ? 93   GLN N CG    1 
ATOM   9125  C  CD    . GLN E  1  93  ? 43.331  -70.635 42.083  1.00 19.20  ? 93   GLN N CD    1 
ATOM   9126  O  OE1   . GLN E  1  93  ? 43.966  -70.314 43.072  1.00 16.84  ? 93   GLN N OE1   1 
ATOM   9127  N  NE2   . GLN E  1  93  ? 42.213  -71.333 42.150  1.00 19.98  ? 93   GLN N NE2   1 
ATOM   9128  N  N     . ASP E  1  94  ? 47.776  -69.812 38.258  1.00 14.45  ? 94   ASP N N     1 
ATOM   9129  C  CA    . ASP E  1  94  ? 49.164  -69.454 38.075  1.00 19.42  ? 94   ASP N CA    1 
ATOM   9130  C  C     . ASP E  1  94  ? 49.260  -68.106 37.315  1.00 21.44  ? 94   ASP N C     1 
ATOM   9131  O  O     . ASP E  1  94  ? 50.104  -67.234 37.623  1.00 24.11  ? 94   ASP N O     1 
ATOM   9132  C  CB    . ASP E  1  94  ? 49.930  -70.563 37.324  1.00 21.59  ? 94   ASP N CB    1 
ATOM   9133  C  CG    . ASP E  1  94  ? 49.304  -70.950 35.981  1.00 30.43  ? 94   ASP N CG    1 
ATOM   9134  O  OD1   . ASP E  1  94  ? 48.145  -70.577 35.640  1.00 32.49  ? 94   ASP N OD1   1 
ATOM   9135  O  OD2   . ASP E  1  94  ? 50.004  -71.670 35.248  1.00 31.74  ? 94   ASP N OD2   1 
ATOM   9136  N  N     . ALA E  1  95  ? 48.386  -67.896 36.342  1.00 18.22  ? 95   ALA N N     1 
ATOM   9137  C  CA    . ALA E  1  95  ? 48.453  -66.639 35.597  1.00 16.97  ? 95   ALA N CA    1 
ATOM   9138  C  C     . ALA E  1  95  ? 47.898  -65.479 36.415  1.00 9.63   ? 95   ALA N C     1 
ATOM   9139  O  O     . ALA E  1  95  ? 48.401  -64.352 36.359  1.00 17.72  ? 95   ALA N O     1 
ATOM   9140  C  CB    . ALA E  1  95  ? 47.699  -66.785 34.247  1.00 12.42  ? 95   ALA N CB    1 
ATOM   9141  N  N     . ILE E  1  96  ? 46.851  -65.738 37.172  1.00 14.66  ? 96   ILE N N     1 
ATOM   9142  C  CA    . ILE E  1  96  ? 46.272  -64.690 37.993  1.00 13.37  ? 96   ILE N CA    1 
ATOM   9143  C  C     . ILE E  1  96  ? 47.303  -64.217 39.027  1.00 13.68  ? 96   ILE N C     1 
ATOM   9144  O  O     . ILE E  1  96  ? 47.441  -63.015 39.363  1.00 12.35  ? 96   ILE N O     1 
ATOM   9145  C  CB    . ILE E  1  96  ? 45.010  -65.192 38.714  1.00 13.17  ? 96   ILE N CB    1 
ATOM   9146  C  CG1   . ILE E  1  96  ? 43.864  -65.374 37.689  1.00 14.14  ? 96   ILE N CG1   1 
ATOM   9147  C  CG2   . ILE E  1  96  ? 44.632  -64.125 39.795  1.00 10.82  ? 96   ILE N CG2   1 
ATOM   9148  C  CD1   . ILE E  1  96  ? 42.684  -66.248 38.147  1.00 13.38  ? 96   ILE N CD1   1 
ATOM   9149  N  N     . HIS E  1  97  ? 48.052  -65.183 39.519  1.00 15.42  ? 97   HIS N N     1 
ATOM   9150  C  CA    . HIS E  1  97  ? 49.106  -64.895 40.486  1.00 18.88  ? 97   HIS N CA    1 
ATOM   9151  C  C     . HIS E  1  97  ? 50.133  -63.953 39.828  1.00 17.93  ? 97   HIS N C     1 
ATOM   9152  O  O     . HIS E  1  97  ? 50.477  -62.886 40.368  1.00 19.67  ? 97   HIS N O     1 
ATOM   9153  C  CB    . HIS E  1  97  ? 49.727  -66.234 40.922  1.00 17.48  ? 97   HIS N CB    1 
ATOM   9154  C  CG    . HIS E  1  97  ? 50.910  -66.112 41.826  1.00 21.94  ? 97   HIS N CG    1 
ATOM   9155  N  ND1   . HIS E  1  97  ? 51.375  -67.171 42.576  1.00 24.23  ? 97   HIS N ND1   1 
ATOM   9156  C  CD2   . HIS E  1  97  ? 51.719  -65.066 42.109  1.00 19.16  ? 97   HIS N CD2   1 
ATOM   9157  C  CE1   . HIS E  1  97  ? 52.420  -66.780 43.280  1.00 22.55  ? 97   HIS N CE1   1 
ATOM   9158  N  NE2   . HIS E  1  97  ? 52.648  -65.506 43.014  1.00 22.90  ? 97   HIS N NE2   1 
ATOM   9159  N  N     . TYR E  1  98  ? 50.610  -64.327 38.651  1.00 17.74  ? 98   TYR N N     1 
ATOM   9160  C  CA    . TYR E  1  98  ? 51.593  -63.488 37.964  1.00 16.75  ? 98   TYR N CA    1 
ATOM   9161  C  C     . TYR E  1  98  ? 51.021  -62.079 37.724  1.00 18.78  ? 98   TYR N C     1 
ATOM   9162  O  O     . TYR E  1  98  ? 51.672  -61.076 37.992  1.00 24.37  ? 98   TYR N O     1 
ATOM   9163  C  CB    . TYR E  1  98  ? 51.984  -64.141 36.618  1.00 21.64  ? 98   TYR N CB    1 
ATOM   9164  C  CG    . TYR E  1  98  ? 53.092  -63.419 35.877  1.00 17.88  ? 98   TYR N CG    1 
ATOM   9165  C  CD1   . TYR E  1  98  ? 52.790  -62.541 34.851  1.00 12.94  ? 98   TYR N CD1   1 
ATOM   9166  C  CD2   . TYR E  1  98  ? 54.444  -63.537 36.282  1.00 19.06  ? 98   TYR N CD2   1 
ATOM   9167  C  CE1   . TYR E  1  98  ? 53.763  -61.791 34.248  1.00 14.09  ? 98   TYR N CE1   1 
ATOM   9168  C  CE2   . TYR E  1  98  ? 55.446  -62.782 35.673  1.00 15.82  ? 98   TYR N CE2   1 
ATOM   9169  C  CZ    . TYR E  1  98  ? 55.092  -61.905 34.662  1.00 19.24  ? 98   TYR N CZ    1 
ATOM   9170  O  OH    . TYR E  1  98  ? 56.003  -61.049 34.114  1.00 15.97  ? 98   TYR N OH    1 
ATOM   9171  N  N     . MET E  1  99  ? 49.792  -61.995 37.226  1.00 18.58  ? 99   MET N N     1 
ATOM   9172  C  CA    . MET E  1  99  ? 49.218  -60.685 36.922  1.00 16.58  ? 99   MET N CA    1 
ATOM   9173  C  C     . MET E  1  99  ? 49.020  -59.752 38.118  1.00 16.68  ? 99   MET N C     1 
ATOM   9174  O  O     . MET E  1  99  ? 49.419  -58.581 38.067  1.00 15.10  ? 99   MET N O     1 
ATOM   9175  C  CB    . MET E  1  99  ? 47.876  -60.825 36.184  1.00 17.59  ? 99   MET N CB    1 
ATOM   9176  C  CG    . MET E  1  99  ? 47.393  -59.498 35.583  1.00 15.73  ? 99   MET N CG    1 
ATOM   9177  S  SD    . MET E  1  99  ? 45.704  -59.544 34.884  1.00 19.10  ? 99   MET N SD    1 
ATOM   9178  C  CE    . MET E  1  99  ? 44.709  -59.942 36.307  1.00 15.51  ? 99   MET N CE    1 
ATOM   9179  N  N     . THR E  1  100 ? 48.390  -60.243 39.186  1.00 18.37  ? 100  THR N N     1 
ATOM   9180  C  CA    . THR E  1  100 ? 48.168  -59.372 40.330  1.00 17.93  ? 100  THR N CA    1 
ATOM   9181  C  C     . THR E  1  100 ? 49.486  -59.025 41.022  1.00 21.40  ? 100  THR N C     1 
ATOM   9182  O  O     . THR E  1  100 ? 49.695  -57.871 41.409  1.00 19.72  ? 100  THR N O     1 
ATOM   9183  C  CB    . THR E  1  100 ? 47.148  -59.970 41.310  1.00 19.61  ? 100  THR N CB    1 
ATOM   9184  O  OG1   . THR E  1  100 ? 47.553  -61.290 41.700  1.00 13.94  ? 100  THR N OG1   1 
ATOM   9185  C  CG2   . THR E  1  100 ? 45.753  -60.072 40.593  1.00 19.28  ? 100  THR N CG2   1 
ATOM   9186  N  N     . GLU E  1  101 ? 50.394  -59.983 41.161  1.00 19.53  ? 101  GLU N N     1 
ATOM   9187  C  CA    . GLU E  1  101 ? 51.665  -59.638 41.807  1.00 22.35  ? 101  GLU N CA    1 
ATOM   9188  C  C     . GLU E  1  101 ? 52.483  -58.610 41.005  1.00 22.31  ? 101  GLU N C     1 
ATOM   9189  O  O     . GLU E  1  101 ? 53.165  -57.749 41.566  1.00 23.67  ? 101  GLU N O     1 
ATOM   9190  C  CB    . GLU E  1  101 ? 52.504  -60.893 42.056  1.00 21.22  ? 101  GLU N CB    1 
ATOM   9191  C  CG    . GLU E  1  101 ? 53.733  -60.622 42.916  1.00 30.94  ? 101  GLU N CG    1 
ATOM   9192  C  CD    . GLU E  1  101 ? 54.577  -61.882 43.185  1.00 35.20  ? 101  GLU N CD    1 
ATOM   9193  O  OE1   . GLU E  1  101 ? 54.615  -62.813 42.344  1.00 35.15  ? 101  GLU N OE1   1 
ATOM   9194  O  OE2   . GLU E  1  101 ? 55.220  -61.932 44.246  1.00 38.66  ? 101  GLU N OE2   1 
ATOM   9195  N  N     . GLN E  1  102 ? 52.423  -58.698 39.688  1.00 18.47  ? 102  GLN N N     1 
ATOM   9196  C  CA    . GLN E  1  102 ? 53.155  -57.775 38.854  1.00 15.37  ? 102  GLN N CA    1 
ATOM   9197  C  C     . GLN E  1  102 ? 52.460  -56.414 38.707  1.00 18.26  ? 102  GLN N C     1 
ATOM   9198  O  O     . GLN E  1  102 ? 53.057  -55.447 38.224  1.00 20.70  ? 102  GLN N O     1 
ATOM   9199  C  CB    . GLN E  1  102 ? 53.349  -58.400 37.456  1.00 20.16  ? 102  GLN N CB    1 
ATOM   9200  C  CG    . GLN E  1  102 ? 54.250  -59.627 37.447  1.00 22.57  ? 102  GLN N CG    1 
ATOM   9201  C  CD    . GLN E  1  102 ? 55.613  -59.307 38.073  1.00 22.66  ? 102  GLN N CD    1 
ATOM   9202  O  OE1   . GLN E  1  102 ? 56.278  -58.347 37.676  1.00 29.00  ? 102  GLN N OE1   1 
ATOM   9203  N  NE2   . GLN E  1  102 ? 56.012  -60.095 39.067  1.00 27.76  ? 102  GLN N NE2   1 
ATOM   9204  N  N     . ALA E  1  103 ? 51.204  -56.324 39.120  1.00 18.59  ? 103  ALA N N     1 
ATOM   9205  C  CA    . ALA E  1  103 ? 50.437  -55.081 38.932  1.00 19.46  ? 103  ALA N CA    1 
ATOM   9206  C  C     . ALA E  1  103 ? 51.018  -53.793 39.462  1.00 16.59  ? 103  ALA N C     1 
ATOM   9207  O  O     . ALA E  1  103 ? 51.011  -52.769 38.756  1.00 16.96  ? 103  ALA N O     1 
ATOM   9208  C  CB    . ALA E  1  103 ? 49.011  -55.248 39.470  1.00 14.00  ? 103  ALA N CB    1 
ATOM   9209  N  N     . PRO E  1  104 ? 51.488  -53.790 40.717  1.00 18.55  ? 104  PRO N N     1 
ATOM   9210  C  CA    . PRO E  1  104 ? 52.034  -52.506 41.154  1.00 19.51  ? 104  PRO N CA    1 
ATOM   9211  C  C     . PRO E  1  104 ? 53.179  -52.036 40.257  1.00 17.81  ? 104  PRO N C     1 
ATOM   9212  O  O     . PRO E  1  104 ? 53.249  -50.859 39.885  1.00 20.12  ? 104  PRO N O     1 
ATOM   9213  C  CB    . PRO E  1  104 ? 52.496  -52.803 42.588  1.00 20.05  ? 104  PRO N CB    1 
ATOM   9214  C  CG    . PRO E  1  104 ? 51.504  -53.843 43.049  1.00 19.40  ? 104  PRO N CG    1 
ATOM   9215  C  CD    . PRO E  1  104 ? 51.429  -54.753 41.841  1.00 15.09  ? 104  PRO N CD    1 
ATOM   9216  N  N     . ALA E  1  105 ? 54.080  -52.951 39.924  1.00 15.14  ? 105  ALA N N     1 
ATOM   9217  C  CA    . ALA E  1  105 ? 55.238  -52.611 39.080  1.00 19.24  ? 105  ALA N CA    1 
ATOM   9218  C  C     . ALA E  1  105 ? 54.791  -52.093 37.729  1.00 17.06  ? 105  ALA N C     1 
ATOM   9219  O  O     . ALA E  1  105 ? 55.348  -51.145 37.192  1.00 18.12  ? 105  ALA N O     1 
ATOM   9220  C  CB    . ALA E  1  105 ? 56.138  -53.862 38.855  1.00 20.73  ? 105  ALA N CB    1 
ATOM   9221  N  N     . ALA E  1  106 ? 53.768  -52.722 37.180  1.00 18.56  ? 106  ALA N N     1 
ATOM   9222  C  CA    . ALA E  1  106 ? 53.275  -52.338 35.864  1.00 16.58  ? 106  ALA N CA    1 
ATOM   9223  C  C     . ALA E  1  106 ? 52.684  -50.928 35.821  1.00 16.12  ? 106  ALA N C     1 
ATOM   9224  O  O     . ALA E  1  106 ? 52.877  -50.182 34.846  1.00 18.06  ? 106  ALA N O     1 
ATOM   9225  C  CB    . ALA E  1  106 ? 52.243  -53.353 35.412  1.00 16.52  ? 106  ALA N CB    1 
ATOM   9226  N  N     . VAL E  1  107 ? 51.962  -50.535 36.866  1.00 19.58  ? 107  VAL N N     1 
ATOM   9227  C  CA    . VAL E  1  107 ? 51.350  -49.200 36.869  1.00 16.39  ? 107  VAL N CA    1 
ATOM   9228  C  C     . VAL E  1  107 ? 52.436  -48.164 37.094  1.00 15.27  ? 107  VAL N C     1 
ATOM   9229  O  O     . VAL E  1  107 ? 52.455  -47.113 36.455  1.00 21.88  ? 107  VAL N O     1 
ATOM   9230  C  CB    . VAL E  1  107 ? 50.239  -49.094 37.936  1.00 12.80  ? 107  VAL N CB    1 
ATOM   9231  C  CG1   . VAL E  1  107 ? 49.649  -47.700 37.955  1.00 15.49  ? 107  VAL N CG1   1 
ATOM   9232  C  CG2   . VAL E  1  107 ? 49.121  -50.061 37.584  1.00 10.92  ? 107  VAL N CG2   1 
ATOM   9233  N  N     . ILE E  1  108 ? 53.359  -48.447 37.996  1.00 18.04  ? 108  ILE N N     1 
ATOM   9234  C  CA    . ILE E  1  108 ? 54.466  -47.491 38.218  1.00 16.98  ? 108  ILE N CA    1 
ATOM   9235  C  C     . ILE E  1  108 ? 55.210  -47.254 36.879  1.00 14.98  ? 108  ILE N C     1 
ATOM   9236  O  O     . ILE E  1  108 ? 55.557  -46.108 36.503  1.00 14.18  ? 108  ILE N O     1 
ATOM   9237  C  CB    . ILE E  1  108 ? 55.418  -48.042 39.280  1.00 16.08  ? 108  ILE N CB    1 
ATOM   9238  C  CG1   . ILE E  1  108 ? 54.767  -47.876 40.667  1.00 16.05  ? 108  ILE N CG1   1 
ATOM   9239  C  CG2   . ILE E  1  108 ? 56.756  -47.321 39.209  1.00 19.71  ? 108  ILE N CG2   1 
ATOM   9240  C  CD1   . ILE E  1  108 ? 55.400  -48.730 41.775  1.00 16.54  ? 108  ILE N CD1   1 
ATOM   9241  N  N     . GLU E  1  109 ? 55.473  -48.332 36.143  1.00 14.72  ? 109  GLU N N     1 
ATOM   9242  C  CA    . GLU E  1  109 ? 56.149  -48.166 34.840  1.00 15.08  ? 109  GLU N CA    1 
ATOM   9243  C  C     . GLU E  1  109 ? 55.398  -47.165 33.942  1.00 13.66  ? 109  GLU N C     1 
ATOM   9244  O  O     . GLU E  1  109 ? 55.990  -46.234 33.397  1.00 17.08  ? 109  GLU N O     1 
ATOM   9245  C  CB    . GLU E  1  109 ? 56.262  -49.522 34.140  1.00 18.61  ? 109  GLU N CB    1 
ATOM   9246  C  CG    . GLU E  1  109 ? 56.837  -49.511 32.692  1.00 24.39  ? 109  GLU N CG    1 
ATOM   9247  C  CD    . GLU E  1  109 ? 56.905  -50.936 32.126  1.00 26.87  ? 109  GLU N CD    1 
ATOM   9248  O  OE1   . GLU E  1  109 ? 55.871  -51.467 31.676  1.00 23.50  ? 109  GLU N OE1   1 
ATOM   9249  O  OE2   . GLU E  1  109 ? 57.987  -51.561 32.171  1.00 31.27  ? 109  GLU N OE2   1 
ATOM   9250  N  N     . LEU E  1  110 ? 54.076  -47.316 33.819  1.00 19.14  ? 110  LEU N N     1 
ATOM   9251  C  CA    . LEU E  1  110 ? 53.283  -46.424 32.963  1.00 14.00  ? 110  LEU N CA    1 
ATOM   9252  C  C     . LEU E  1  110 ? 53.329  -44.994 33.429  1.00 14.45  ? 110  LEU N C     1 
ATOM   9253  O  O     . LEU E  1  110 ? 53.421  -44.059 32.628  1.00 15.92  ? 110  LEU N O     1 
ATOM   9254  C  CB    . LEU E  1  110 ? 51.826  -46.890 32.924  1.00 19.51  ? 110  LEU N CB    1 
ATOM   9255  C  CG    . LEU E  1  110 ? 51.511  -48.181 32.176  1.00 19.37  ? 110  LEU N CG    1 
ATOM   9256  C  CD1   . LEU E  1  110 ? 50.061  -48.586 32.506  1.00 19.66  ? 110  LEU N CD1   1 
ATOM   9257  C  CD2   . LEU E  1  110 ? 51.667  -47.923 30.658  1.00 19.20  ? 110  LEU N CD2   1 
ATOM   9258  N  N     . GLU E  1  111 ? 53.234  -44.794 34.733  1.00 13.17  ? 111  GLU N N     1 
ATOM   9259  C  CA    . GLU E  1  111 ? 53.316  -43.425 35.253  1.00 11.95  ? 111  GLU N CA    1 
ATOM   9260  C  C     . GLU E  1  111 ? 54.714  -42.882 34.991  1.00 11.97  ? 111  GLU N C     1 
ATOM   9261  O  O     . GLU E  1  111 ? 54.894  -41.713 34.632  1.00 12.95  ? 111  GLU N O     1 
ATOM   9262  C  CB    . GLU E  1  111 ? 53.025  -43.410 36.768  1.00 15.89  ? 111  GLU N CB    1 
ATOM   9263  C  CG    . GLU E  1  111 ? 52.855  -41.994 37.377  1.00 19.37  ? 111  GLU N CG    1 
ATOM   9264  C  CD    . GLU E  1  111 ? 54.188  -41.282 37.619  1.00 20.17  ? 111  GLU N CD    1 
ATOM   9265  O  OE1   . GLU E  1  111 ? 55.184  -41.981 37.885  1.00 23.16  ? 111  GLU N OE1   1 
ATOM   9266  O  OE2   . GLU E  1  111 ? 54.226  -40.027 37.570  1.00 20.32  ? 111  GLU N OE2   1 
ATOM   9267  N  N     . ASN E  1  112 ? 55.734  -43.704 35.184  1.00 11.97  ? 112  ASN N N     1 
ATOM   9268  C  CA    . ASN E  1  112 ? 57.071  -43.168 34.911  1.00 19.75  ? 112  ASN N CA    1 
ATOM   9269  C  C     . ASN E  1  112 ? 57.260  -42.894 33.402  1.00 20.81  ? 112  ASN N C     1 
ATOM   9270  O  O     . ASN E  1  112 ? 58.230  -42.269 33.019  1.00 22.10  ? 112  ASN N O     1 
ATOM   9271  C  CB    . ASN E  1  112 ? 58.158  -44.128 35.404  1.00 19.24  ? 112  ASN N CB    1 
ATOM   9272  C  CG    . ASN E  1  112 ? 58.326  -44.124 36.935  1.00 23.10  ? 112  ASN N CG    1 
ATOM   9273  O  OD1   . ASN E  1  112 ? 57.546  -43.492 37.687  1.00 23.88  ? 112  ASN N OD1   1 
ATOM   9274  N  ND2   . ASN E  1  112 ? 59.362  -44.839 37.403  1.00 18.15  ? 112  ASN N ND2   1 
ATOM   9275  N  N     . TYR E  1  113 ? 56.347  -43.381 32.551  1.00 22.76  ? 113  TYR N N     1 
ATOM   9276  C  CA    . TYR E  1  113 ? 56.427  -43.107 31.112  1.00 21.87  ? 113  TYR N CA    1 
ATOM   9277  C  C     . TYR E  1  113 ? 55.728  -41.748 30.920  1.00 23.30  ? 113  TYR N C     1 
ATOM   9278  O  O     . TYR E  1  113 ? 55.761  -41.155 29.853  1.00 22.97  ? 113  TYR N O     1 
ATOM   9279  C  CB    . TYR E  1  113 ? 55.661  -44.151 30.276  1.00 20.95  ? 113  TYR N CB    1 
ATOM   9280  C  CG    . TYR E  1  113 ? 56.260  -45.547 30.139  1.00 17.94  ? 113  TYR N CG    1 
ATOM   9281  C  CD1   . TYR E  1  113 ? 55.453  -46.620 29.754  1.00 21.84  ? 113  TYR N CD1   1 
ATOM   9282  C  CD2   . TYR E  1  113 ? 57.622  -45.794 30.340  1.00 20.35  ? 113  TYR N CD2   1 
ATOM   9283  C  CE1   . TYR E  1  113 ? 55.973  -47.901 29.573  1.00 21.79  ? 113  TYR N CE1   1 
ATOM   9284  C  CE2   . TYR E  1  113 ? 58.163  -47.107 30.151  1.00 15.86  ? 113  TYR N CE2   1 
ATOM   9285  C  CZ    . TYR E  1  113 ? 57.333  -48.133 29.770  1.00 20.93  ? 113  TYR N CZ    1 
ATOM   9286  O  OH    . TYR E  1  113 ? 57.819  -49.407 29.559  1.00 23.31  ? 113  TYR N OH    1 
ATOM   9287  N  N     . GLY E  1  114 ? 55.069  -41.249 31.952  1.00 20.54  ? 114  GLY N N     1 
ATOM   9288  C  CA    . GLY E  1  114 ? 54.405  -39.962 31.770  1.00 20.61  ? 114  GLY N CA    1 
ATOM   9289  C  C     . GLY E  1  114 ? 52.871  -40.022 31.732  1.00 18.45  ? 114  GLY N C     1 
ATOM   9290  O  O     . GLY E  1  114 ? 52.230  -39.000 31.518  1.00 16.31  ? 114  GLY N O     1 
ATOM   9291  N  N     . MET E  1  115 ? 52.287  -41.200 31.915  1.00 14.53  ? 115  MET N N     1 
ATOM   9292  C  CA    . MET E  1  115 ? 50.828  -41.300 31.923  1.00 18.62  ? 115  MET N CA    1 
ATOM   9293  C  C     . MET E  1  115 ? 50.346  -40.315 32.999  1.00 17.67  ? 115  MET N C     1 
ATOM   9294  O  O     . MET E  1  115 ? 50.708  -40.444 34.176  1.00 20.25  ? 115  MET N O     1 
ATOM   9295  C  CB    . MET E  1  115 ? 50.380  -42.712 32.283  1.00 12.80  ? 115  MET N CB    1 
ATOM   9296  C  CG    . MET E  1  115 ? 48.980  -43.039 31.793  1.00 17.18  ? 115  MET N CG    1 
ATOM   9297  S  SD    . MET E  1  115 ? 48.636  -44.807 31.990  1.00 25.16  ? 115  MET N SD    1 
ATOM   9298  C  CE    . MET E  1  115 ? 46.841  -44.761 32.385  1.00 17.74  ? 115  MET N CE    1 
ATOM   9299  N  N     . PRO E  1  116 ? 49.503  -39.345 32.612  1.00 18.92  ? 116  PRO N N     1 
ATOM   9300  C  CA    . PRO E  1  116 ? 48.969  -38.312 33.510  1.00 17.56  ? 116  PRO N CA    1 
ATOM   9301  C  C     . PRO E  1  116 ? 47.896  -38.723 34.487  1.00 18.79  ? 116  PRO N C     1 
ATOM   9302  O  O     . PRO E  1  116 ? 46.804  -38.179 34.490  1.00 18.33  ? 116  PRO N O     1 
ATOM   9303  C  CB    . PRO E  1  116 ? 48.490  -37.232 32.538  1.00 24.00  ? 116  PRO N CB    1 
ATOM   9304  C  CG    . PRO E  1  116 ? 47.965  -38.034 31.387  1.00 16.88  ? 116  PRO N CG    1 
ATOM   9305  C  CD    . PRO E  1  116 ? 48.987  -39.173 31.237  1.00 14.02  ? 116  PRO N CD    1 
ATOM   9306  N  N     . PHE E  1  117 ? 48.202  -39.720 35.299  1.00 16.06  ? 117  PHE N N     1 
ATOM   9307  C  CA    . PHE E  1  117 ? 47.270  -40.144 36.334  1.00 18.19  ? 117  PHE N CA    1 
ATOM   9308  C  C     . PHE E  1  117 ? 46.754  -38.958 37.171  1.00 17.37  ? 117  PHE N C     1 
ATOM   9309  O  O     . PHE E  1  117 ? 47.438  -37.926 37.317  1.00 21.14  ? 117  PHE N O     1 
ATOM   9310  C  CB    . PHE E  1  117 ? 47.956  -41.155 37.239  1.00 16.11  ? 117  PHE N CB    1 
ATOM   9311  C  CG    . PHE E  1  117 ? 48.115  -42.540 36.618  1.00 19.78  ? 117  PHE N CG    1 
ATOM   9312  C  CD1   . PHE E  1  117 ? 47.009  -43.394 36.482  1.00 22.34  ? 117  PHE N CD1   1 
ATOM   9313  C  CD2   . PHE E  1  117 ? 49.367  -43.004 36.218  1.00 21.57  ? 117  PHE N CD2   1 
ATOM   9314  C  CE1   . PHE E  1  117 ? 47.151  -44.695 35.968  1.00 19.32  ? 117  PHE N CE1   1 
ATOM   9315  C  CE2   . PHE E  1  117 ? 49.532  -44.312 35.689  1.00 21.46  ? 117  PHE N CE2   1 
ATOM   9316  C  CZ    . PHE E  1  117 ? 48.431  -45.159 35.568  1.00 19.70  ? 117  PHE N CZ    1 
ATOM   9317  N  N     . SER E  1  118 ? 45.512  -39.079 37.639  1.00 17.09  ? 118  SER N N     1 
ATOM   9318  C  CA    . SER E  1  118 ? 44.890  -38.085 38.513  1.00 18.71  ? 118  SER N CA    1 
ATOM   9319  C  C     . SER E  1  118 ? 45.656  -38.254 39.817  1.00 19.56  ? 118  SER N C     1 
ATOM   9320  O  O     . SER E  1  118 ? 46.218  -39.333 40.078  1.00 18.05  ? 118  SER N O     1 
ATOM   9321  C  CB    . SER E  1  118 ? 43.417  -38.403 38.757  1.00 20.94  ? 118  SER N CB    1 
ATOM   9322  O  OG    . SER E  1  118 ? 42.704  -38.297 37.547  1.00 19.67  ? 118  SER N OG    1 
ATOM   9323  N  N     . ARG E  1  119 ? 45.653  -37.225 40.655  1.00 20.53  ? 119  ARG N N     1 
ATOM   9324  C  CA    . ARG E  1  119 ? 46.472  -37.268 41.872  1.00 17.79  ? 119  ARG N CA    1 
ATOM   9325  C  C     . ARG E  1  119 ? 45.786  -37.120 43.218  1.00 18.68  ? 119  ARG N C     1 
ATOM   9326  O  O     . ARG E  1  119 ? 44.706  -36.537 43.323  1.00 19.33  ? 119  ARG N O     1 
ATOM   9327  C  CB    . ARG E  1  119 ? 47.546  -36.185 41.735  1.00 20.39  ? 119  ARG N CB    1 
ATOM   9328  C  CG    . ARG E  1  119 ? 48.437  -36.393 40.528  1.00 18.31  ? 119  ARG N CG    1 
ATOM   9329  C  CD    . ARG E  1  119 ? 49.384  -37.594 40.744  1.00 17.63  ? 119  ARG N CD    1 
ATOM   9330  N  NE    . ARG E  1  119 ? 50.121  -37.880 39.513  1.00 26.73  ? 119  ARG N NE    1 
ATOM   9331  C  CZ    . ARG E  1  119 ? 51.290  -38.526 39.440  1.00 25.11  ? 119  ARG N CZ    1 
ATOM   9332  N  NH1   . ARG E  1  119 ? 51.913  -38.983 40.525  1.00 23.49  ? 119  ARG N NH1   1 
ATOM   9333  N  NH2   . ARG E  1  119 ? 51.844  -38.714 38.258  1.00 18.57  ? 119  ARG N NH2   1 
ATOM   9334  N  N     . THR E  1  120 ? 46.413  -37.661 44.251  1.00 19.85  ? 120  THR N N     1 
ATOM   9335  C  CA    . THR E  1  120 ? 45.898  -37.523 45.610  1.00 21.55  ? 120  THR N CA    1 
ATOM   9336  C  C     . THR E  1  120 ? 46.617  -36.299 46.242  1.00 24.15  ? 120  THR N C     1 
ATOM   9337  O  O     . THR E  1  120 ? 47.477  -35.673 45.623  1.00 19.26  ? 120  THR N O     1 
ATOM   9338  C  CB    . THR E  1  120 ? 46.245  -38.722 46.487  1.00 18.39  ? 120  THR N CB    1 
ATOM   9339  O  OG1   . THR E  1  120 ? 47.665  -38.771 46.635  1.00 20.65  ? 120  THR N OG1   1 
ATOM   9340  C  CG2   . THR E  1  120 ? 45.773  -39.995 45.879  1.00 18.77  ? 120  THR N CG2   1 
ATOM   9341  N  N     . GLU E  1  121 ? 46.244  -35.988 47.479  1.00 28.86  ? 121  GLU N N     1 
ATOM   9342  C  CA    . GLU E  1  121 ? 46.810  -34.874 48.231  1.00 32.46  ? 121  GLU N CA    1 
ATOM   9343  C  C     . GLU E  1  121 ? 48.289  -35.096 48.496  1.00 32.08  ? 121  GLU N C     1 
ATOM   9344  O  O     . GLU E  1  121 ? 49.000  -34.132 48.757  1.00 33.06  ? 121  GLU N O     1 
ATOM   9345  C  CB    . GLU E  1  121 ? 46.104  -34.719 49.576  1.00 39.09  ? 121  GLU N CB    1 
ATOM   9346  C  CG    . GLU E  1  121 ? 44.604  -34.608 49.483  1.00 50.21  ? 121  GLU N CG    1 
ATOM   9347  C  CD    . GLU E  1  121 ? 44.147  -33.202 49.254  1.00 57.83  ? 121  GLU N CD    1 
ATOM   9348  O  OE1   . GLU E  1  121 ? 44.573  -32.602 48.239  1.00 63.36  ? 121  GLU N OE1   1 
ATOM   9349  O  OE2   . GLU E  1  121 ? 43.362  -32.702 50.095  1.00 61.24  ? 121  GLU N OE2   1 
ATOM   9350  N  N     . GLU E  1  122 ? 48.747  -36.350 48.462  1.00 29.45  ? 122  GLU N N     1 
ATOM   9351  C  CA    . GLU E  1  122 ? 50.173  -36.633 48.668  1.00 29.31  ? 122  GLU N CA    1 
ATOM   9352  C  C     . GLU E  1  122 ? 50.930  -36.607 47.357  1.00 25.27  ? 122  GLU N C     1 
ATOM   9353  O  O     . GLU E  1  122 ? 52.138  -36.772 47.348  1.00 25.14  ? 122  GLU N O     1 
ATOM   9354  C  CB    . GLU E  1  122 ? 50.401  -37.995 49.315  1.00 34.12  ? 122  GLU N CB    1 
ATOM   9355  C  CG    . GLU E  1  122 ? 49.896  -38.080 50.746  1.00 42.25  ? 122  GLU N CG    1 
ATOM   9356  C  CD    . GLU E  1  122 ? 50.035  -39.469 51.344  1.00 45.20  ? 122  GLU N CD    1 
ATOM   9357  O  OE1   . GLU E  1  122 ? 50.001  -39.574 52.604  1.00 51.29  ? 122  GLU N OE1   1 
ATOM   9358  O  OE2   . GLU E  1  122 ? 50.167  -40.447 50.560  1.00 43.31  ? 122  GLU N OE2   1 
ATOM   9359  N  N     . GLY E  1  123 ? 50.229  -36.411 46.247  1.00 20.27  ? 123  GLY N N     1 
ATOM   9360  C  CA    . GLY E  1  123 ? 50.921  -36.359 44.970  1.00 20.52  ? 123  GLY N CA    1 
ATOM   9361  C  C     . GLY E  1  123 ? 51.076  -37.725 44.319  1.00 19.97  ? 123  GLY N C     1 
ATOM   9362  O  O     . GLY E  1  123 ? 51.751  -37.859 43.296  1.00 21.47  ? 123  GLY N O     1 
ATOM   9363  N  N     . LYS E  1  124 ? 50.445  -38.729 44.910  1.00 19.55  ? 124  LYS N N     1 
ATOM   9364  C  CA    . LYS E  1  124 ? 50.488  -40.102 44.375  1.00 22.50  ? 124  LYS N CA    1 
ATOM   9365  C  C     . LYS E  1  124 ? 49.318  -40.359 43.444  1.00 18.50  ? 124  LYS N C     1 
ATOM   9366  O  O     . LYS E  1  124 ? 48.450  -39.500 43.294  1.00 18.60  ? 124  LYS N O     1 
ATOM   9367  C  CB    . LYS E  1  124 ? 50.451  -41.113 45.516  1.00 20.51  ? 124  LYS N CB    1 
ATOM   9368  C  CG    . LYS E  1  124 ? 51.655  -40.983 46.414  1.00 30.67  ? 124  LYS N CG    1 
ATOM   9369  C  CD    . LYS E  1  124 ? 51.588  -41.902 47.630  1.00 38.26  ? 124  LYS N CD    1 
ATOM   9370  C  CE    . LYS E  1  124 ? 52.977  -41.982 48.307  1.00 38.45  ? 124  LYS N CE    1 
ATOM   9371  N  NZ    . LYS E  1  124 ? 53.203  -43.237 49.112  1.00 44.68  ? 124  LYS N NZ    1 
ATOM   9372  N  N     . ILE E  1  125 ? 49.288  -41.556 42.846  1.00 18.06  ? 125  ILE N N     1 
ATOM   9373  C  CA    . ILE E  1  125 ? 48.238  -41.929 41.910  1.00 18.67  ? 125  ILE N CA    1 
ATOM   9374  C  C     . ILE E  1  125 ? 46.885  -42.155 42.600  1.00 16.61  ? 125  ILE N C     1 
ATOM   9375  O  O     . ILE E  1  125 ? 46.766  -42.931 43.522  1.00 16.31  ? 125  ILE N O     1 
ATOM   9376  C  CB    . ILE E  1  125 ? 48.659  -43.206 41.129  1.00 20.13  ? 125  ILE N CB    1 
ATOM   9377  C  CG1   . ILE E  1  125 ? 49.844  -42.884 40.221  1.00 15.35  ? 125  ILE N CG1   1 
ATOM   9378  C  CG2   . ILE E  1  125 ? 47.516  -43.750 40.360  1.00 14.92  ? 125  ILE N CG2   1 
ATOM   9379  C  CD1   . ILE E  1  125 ? 50.546  -44.153 39.720  1.00 19.33  ? 125  ILE N CD1   1 
ATOM   9380  N  N     . TYR E  1  126 ? 45.874  -41.431 42.140  1.00 18.00  ? 126  TYR N N     1 
ATOM   9381  C  CA    . TYR E  1  126 ? 44.510  -41.551 42.665  1.00 11.02  ? 126  TYR N CA    1 
ATOM   9382  C  C     . TYR E  1  126 ? 43.907  -42.902 42.241  1.00 16.25  ? 126  TYR N C     1 
ATOM   9383  O  O     . TYR E  1  126 ? 43.952  -43.259 41.052  1.00 13.07  ? 126  TYR N O     1 
ATOM   9384  C  CB    . TYR E  1  126 ? 43.656  -40.428 42.071  1.00 15.39  ? 126  TYR N CB    1 
ATOM   9385  C  CG    . TYR E  1  126 ? 42.166  -40.546 42.382  1.00 17.88  ? 126  TYR N CG    1 
ATOM   9386  C  CD1   . TYR E  1  126 ? 41.678  -40.364 43.682  1.00 14.02  ? 126  TYR N CD1   1 
ATOM   9387  C  CD2   . TYR E  1  126 ? 41.260  -40.905 41.379  1.00 19.30  ? 126  TYR N CD2   1 
ATOM   9388  C  CE1   . TYR E  1  126 ? 40.288  -40.559 43.977  1.00 19.72  ? 126  TYR N CE1   1 
ATOM   9389  C  CE2   . TYR E  1  126 ? 39.908  -41.098 41.648  1.00 19.76  ? 126  TYR N CE2   1 
ATOM   9390  C  CZ    . TYR E  1  126 ? 39.415  -40.933 42.946  1.00 15.18  ? 126  TYR N CZ    1 
ATOM   9391  O  OH    . TYR E  1  126 ? 38.054  -41.184 43.186  1.00 20.88  ? 126  TYR N OH    1 
ATOM   9392  N  N     . GLN E  1  127 ? 43.358  -43.641 43.192  1.00 13.79  ? 127  GLN N N     1 
ATOM   9393  C  CA    . GLN E  1  127 ? 42.712  -44.921 42.905  1.00 19.07  ? 127  GLN N CA    1 
ATOM   9394  C  C     . GLN E  1  127 ? 41.209  -44.868 43.302  1.00 22.56  ? 127  GLN N C     1 
ATOM   9395  O  O     . GLN E  1  127 ? 40.873  -44.326 44.367  1.00 22.42  ? 127  GLN N O     1 
ATOM   9396  C  CB    . GLN E  1  127 ? 43.387  -46.028 43.704  1.00 14.90  ? 127  GLN N CB    1 
ATOM   9397  C  CG    . GLN E  1  127 ? 44.859  -46.254 43.380  1.00 18.85  ? 127  GLN N CG    1 
ATOM   9398  C  CD    . GLN E  1  127 ? 45.535  -47.199 44.366  1.00 19.36  ? 127  GLN N CD    1 
ATOM   9399  O  OE1   . GLN E  1  127 ? 45.872  -46.812 45.484  1.00 12.24  ? 127  GLN N OE1   1 
ATOM   9400  N  NE2   . GLN E  1  127 ? 45.727  -48.458 43.945  1.00 18.32  ? 127  GLN N NE2   1 
ATOM   9401  N  N     . ARG E  1  128 ? 40.317  -45.445 42.486  1.00 16.20  ? 128  ARG N N     1 
ATOM   9402  C  CA    . ARG E  1  128 ? 38.889  -45.470 42.826  1.00 15.77  ? 128  ARG N CA    1 
ATOM   9403  C  C     . ARG E  1  128 ? 38.362  -46.877 43.122  1.00 17.30  ? 128  ARG N C     1 
ATOM   9404  O  O     . ARG E  1  128 ? 39.058  -47.895 42.942  1.00 12.79  ? 128  ARG N O     1 
ATOM   9405  C  CB    . ARG E  1  128 ? 38.051  -44.817 41.700  1.00 14.72  ? 128  ARG N CB    1 
ATOM   9406  C  CG    . ARG E  1  128 ? 38.239  -45.483 40.323  1.00 21.33  ? 128  ARG N CG    1 
ATOM   9407  C  CD    . ARG E  1  128 ? 37.245  -45.031 39.263  1.00 16.24  ? 128  ARG N CD    1 
ATOM   9408  N  NE    . ARG E  1  128 ? 37.075  -43.573 39.173  1.00 17.24  ? 128  ARG N NE    1 
ATOM   9409  C  CZ    . ARG E  1  128 ? 37.256  -42.868 38.062  1.00 19.48  ? 128  ARG N CZ    1 
ATOM   9410  N  NH1   . ARG E  1  128 ? 37.621  -43.478 36.929  1.00 19.45  ? 128  ARG N NH1   1 
ATOM   9411  N  NH2   . ARG E  1  128 ? 37.103  -41.553 38.083  1.00 20.97  ? 128  ARG N NH2   1 
ATOM   9412  N  N     . ALA E  1  129 ? 37.145  -46.930 43.664  1.00 17.94  ? 129  ALA N N     1 
ATOM   9413  C  CA    . ALA E  1  129 ? 36.486  -48.207 43.926  1.00 15.88  ? 129  ALA N CA    1 
ATOM   9414  C  C     . ALA E  1  129 ? 36.037  -48.705 42.572  1.00 20.78  ? 129  ALA N C     1 
ATOM   9415  O  O     . ALA E  1  129 ? 35.828  -47.905 41.659  1.00 15.26  ? 129  ALA N O     1 
ATOM   9416  C  CB    . ALA E  1  129 ? 35.278  -48.017 44.773  1.00 15.12  ? 129  ALA N CB    1 
ATOM   9417  N  N     . PHE E  1  130 ? 35.874  -50.019 42.448  1.00 20.59  ? 130  PHE N N     1 
ATOM   9418  C  CA    . PHE E  1  130 ? 35.423  -50.622 41.205  1.00 21.72  ? 130  PHE N CA    1 
ATOM   9419  C  C     . PHE E  1  130 ? 34.702  -51.924 41.569  1.00 21.90  ? 130  PHE N C     1 
ATOM   9420  O  O     . PHE E  1  130 ? 34.847  -52.437 42.677  1.00 20.88  ? 130  PHE N O     1 
ATOM   9421  C  CB    . PHE E  1  130 ? 36.609  -50.900 40.274  1.00 21.34  ? 130  PHE N CB    1 
ATOM   9422  C  CG    . PHE E  1  130 ? 36.399  -50.417 38.887  1.00 18.81  ? 130  PHE N CG    1 
ATOM   9423  C  CD1   . PHE E  1  130 ? 36.392  -49.043 38.605  1.00 22.53  ? 130  PHE N CD1   1 
ATOM   9424  C  CD2   . PHE E  1  130 ? 36.211  -51.325 37.839  1.00 16.20  ? 130  PHE N CD2   1 
ATOM   9425  C  CE1   . PHE E  1  130 ? 36.202  -48.567 37.301  1.00 18.32  ? 130  PHE N CE1   1 
ATOM   9426  C  CE2   . PHE E  1  130 ? 36.021  -50.871 36.529  1.00 17.75  ? 130  PHE N CE2   1 
ATOM   9427  C  CZ    . PHE E  1  130 ? 36.013  -49.492 36.251  1.00 21.55  ? 130  PHE N CZ    1 
ATOM   9428  N  N     . GLY E  1  131 ? 33.924  -52.440 40.629  1.00 13.95  ? 131  GLY N N     1 
ATOM   9429  C  CA    . GLY E  1  131 ? 33.138  -53.623 40.890  1.00 15.01  ? 131  GLY N CA    1 
ATOM   9430  C  C     . GLY E  1  131 ? 33.828  -54.924 41.209  1.00 16.39  ? 131  GLY N C     1 
ATOM   9431  O  O     . GLY E  1  131 ? 34.714  -55.338 40.501  1.00 16.20  ? 131  GLY N O     1 
ATOM   9432  N  N     . GLY E  1  132 ? 33.402  -55.557 42.304  1.00 22.44  ? 132  GLY N N     1 
ATOM   9433  C  CA    . GLY E  1  132 ? 33.943  -56.842 42.712  1.00 20.03  ? 132  GLY N CA    1 
ATOM   9434  C  C     . GLY E  1  132 ? 35.299  -56.893 43.394  1.00 23.47  ? 132  GLY N C     1 
ATOM   9435  O  O     . GLY E  1  132 ? 35.903  -57.956 43.431  1.00 21.88  ? 132  GLY N O     1 
ATOM   9436  N  N     . GLN E  1  133 ? 35.785  -55.773 43.930  1.00 24.65  ? 133  GLN N N     1 
ATOM   9437  C  CA    . GLN E  1  133 ? 37.080  -55.762 44.616  1.00 21.81  ? 133  GLN N CA    1 
ATOM   9438  C  C     . GLN E  1  133 ? 36.928  -55.413 46.105  1.00 22.11  ? 133  GLN N C     1 
ATOM   9439  O  O     . GLN E  1  133 ? 36.274  -54.429 46.473  1.00 16.04  ? 133  GLN N O     1 
ATOM   9440  C  CB    . GLN E  1  133 ? 38.000  -54.764 43.944  1.00 26.35  ? 133  GLN N CB    1 
ATOM   9441  C  CG    . GLN E  1  133 ? 38.337  -55.121 42.538  1.00 24.36  ? 133  GLN N CG    1 
ATOM   9442  C  CD    . GLN E  1  133 ? 39.475  -54.312 42.064  1.00 27.92  ? 133  GLN N CD    1 
ATOM   9443  O  OE1   . GLN E  1  133 ? 40.637  -54.681 42.255  1.00 28.04  ? 133  GLN N OE1   1 
ATOM   9444  N  NE2   . GLN E  1  133 ? 39.169  -53.167 41.463  1.00 30.16  ? 133  GLN N NE2   1 
ATOM   9445  N  N     . SER E  1  134 ? 37.585  -56.210 46.938  1.00 20.97  ? 134  SER N N     1 
ATOM   9446  C  CA    . SER E  1  134 ? 37.536  -56.083 48.382  1.00 20.16  ? 134  SER N CA    1 
ATOM   9447  C  C     . SER E  1  134 ? 38.912  -56.161 49.028  1.00 22.83  ? 134  SER N C     1 
ATOM   9448  O  O     . SER E  1  134 ? 39.912  -56.512 48.377  1.00 19.74  ? 134  SER N O     1 
ATOM   9449  C  CB    . SER E  1  134 ? 36.760  -57.252 48.947  1.00 22.16  ? 134  SER N CB    1 
ATOM   9450  O  OG    . SER E  1  134 ? 37.541  -58.424 48.737  1.00 27.39  ? 134  SER N OG    1 
ATOM   9451  N  N     . LEU E  1  135 ? 38.922  -55.874 50.330  1.00 20.47  ? 135  LEU N N     1 
ATOM   9452  C  CA    . LEU E  1  135 ? 40.139  -55.947 51.159  1.00 22.59  ? 135  LEU N CA    1 
ATOM   9453  C  C     . LEU E  1  135 ? 39.997  -57.196 52.035  1.00 19.79  ? 135  LEU N C     1 
ATOM   9454  O  O     . LEU E  1  135 ? 38.894  -57.707 52.247  1.00 21.25  ? 135  LEU N O     1 
ATOM   9455  C  CB    . LEU E  1  135 ? 40.251  -54.709 52.059  1.00 19.94  ? 135  LEU N CB    1 
ATOM   9456  C  CG    . LEU E  1  135 ? 40.149  -53.339 51.356  1.00 16.06  ? 135  LEU N CG    1 
ATOM   9457  C  CD1   . LEU E  1  135 ? 39.965  -52.284 52.427  1.00 20.62  ? 135  LEU N CD1   1 
ATOM   9458  C  CD2   . LEU E  1  135 ? 41.419  -53.026 50.539  1.00 19.79  ? 135  LEU N CD2   1 
ATOM   9459  N  N     . GLN E  1  136 ? 41.118  -57.712 52.515  1.00 20.99  ? 136  GLN N N     1 
ATOM   9460  C  CA    . GLN E  1  136 ? 41.104  -58.872 53.404  1.00 20.06  ? 136  GLN N CA    1 
ATOM   9461  C  C     . GLN E  1  136 ? 40.448  -60.114 52.875  1.00 22.14  ? 136  GLN N C     1 
ATOM   9462  O  O     . GLN E  1  136 ? 39.617  -60.716 53.568  1.00 23.08  ? 136  GLN N O     1 
ATOM   9463  C  CB    . GLN E  1  136 ? 40.437  -58.484 54.717  1.00 19.22  ? 136  GLN N CB    1 
ATOM   9464  C  CG    . GLN E  1  136 ? 41.120  -57.314 55.371  1.00 21.39  ? 136  GLN N CG    1 
ATOM   9465  C  CD    . GLN E  1  136 ? 42.408  -57.729 56.103  1.00 25.78  ? 136  GLN N CD    1 
ATOM   9466  O  OE1   . GLN E  1  136 ? 42.768  -58.908 56.154  1.00 24.14  ? 136  GLN N OE1   1 
ATOM   9467  N  NE2   . GLN E  1  136 ? 43.097  -56.742 56.683  1.00 31.47  ? 136  GLN N NE2   1 
ATOM   9468  N  N     . PHE E  1  137 ? 40.809  -60.510 51.652  1.00 22.83  ? 137  PHE N N     1 
ATOM   9469  C  CA    . PHE E  1  137 ? 40.258  -61.734 51.048  1.00 19.57  ? 137  PHE N CA    1 
ATOM   9470  C  C     . PHE E  1  137 ? 38.746  -61.820 51.072  1.00 19.85  ? 137  PHE N C     1 
ATOM   9471  O  O     . PHE E  1  137 ? 38.159  -62.867 51.426  1.00 19.91  ? 137  PHE N O     1 
ATOM   9472  C  CB    . PHE E  1  137 ? 40.843  -62.976 51.724  1.00 22.29  ? 137  PHE N CB    1 
ATOM   9473  C  CG    . PHE E  1  137 ? 42.344  -63.102 51.575  1.00 24.46  ? 137  PHE N CG    1 
ATOM   9474  C  CD1   . PHE E  1  137 ? 43.194  -62.733 52.609  1.00 22.95  ? 137  PHE N CD1   1 
ATOM   9475  C  CD2   . PHE E  1  137 ? 42.907  -63.566 50.371  1.00 23.94  ? 137  PHE N CD2   1 
ATOM   9476  C  CE1   . PHE E  1  137 ? 44.610  -62.820 52.454  1.00 21.51  ? 137  PHE N CE1   1 
ATOM   9477  C  CE2   . PHE E  1  137 ? 44.293  -63.658 50.207  1.00 23.45  ? 137  PHE N CE2   1 
ATOM   9478  C  CZ    . PHE E  1  137 ? 45.142  -63.289 51.240  1.00 28.17  ? 137  PHE N CZ    1 
ATOM   9479  N  N     . GLY E  1  138 ? 38.122  -60.707 50.709  1.00 17.35  ? 138  GLY N N     1 
ATOM   9480  C  CA    . GLY E  1  138 ? 36.678  -60.643 50.665  1.00 16.93  ? 138  GLY N CA    1 
ATOM   9481  C  C     . GLY E  1  138 ? 35.960  -60.378 51.973  1.00 20.51  ? 138  GLY N C     1 
ATOM   9482  O  O     . GLY E  1  138 ? 34.726  -60.300 51.995  1.00 23.00  ? 138  GLY N O     1 
ATOM   9483  N  N     . LYS E  1  139 ? 36.697  -60.208 53.057  1.00 21.44  ? 139  LYS N N     1 
ATOM   9484  C  CA    . LYS E  1  139 ? 36.050  -60.016 54.337  1.00 21.74  ? 139  LYS N CA    1 
ATOM   9485  C  C     . LYS E  1  139 ? 36.080  -58.567 54.807  1.00 24.84  ? 139  LYS N C     1 
ATOM   9486  O  O     . LYS E  1  139 ? 35.302  -58.185 55.677  1.00 30.26  ? 139  LYS N O     1 
ATOM   9487  C  CB    . LYS E  1  139 ? 36.740  -60.897 55.399  1.00 23.97  ? 139  LYS N CB    1 
ATOM   9488  C  CG    . LYS E  1  139 ? 36.851  -62.380 55.066  1.00 26.79  ? 139  LYS N CG    1 
ATOM   9489  C  CD    . LYS E  1  139 ? 37.690  -63.169 56.111  1.00 25.74  ? 139  LYS N CD    1 
ATOM   9490  C  CE    . LYS E  1  139 ? 39.200  -62.965 55.908  1.00 35.82  ? 139  LYS N CE    1 
ATOM   9491  N  NZ    . LYS E  1  139 ? 40.034  -63.586 56.977  1.00 41.78  ? 139  LYS N NZ    1 
ATOM   9492  N  N     . GLY E  1  140 ? 36.947  -57.747 54.216  1.00 28.08  ? 140  GLY N N     1 
ATOM   9493  C  CA    . GLY E  1  140 ? 37.080  -56.381 54.705  1.00 31.94  ? 140  GLY N CA    1 
ATOM   9494  C  C     . GLY E  1  140 ? 36.530  -55.134 54.039  1.00 34.38  ? 140  GLY N C     1 
ATOM   9495  O  O     . GLY E  1  140 ? 37.057  -54.042 54.261  1.00 39.41  ? 140  GLY N O     1 
ATOM   9496  N  N     . GLY E  1  141 ? 35.476  -55.247 53.255  1.00 30.52  ? 141  GLY N N     1 
ATOM   9497  C  CA    . GLY E  1  141 ? 34.964  -54.044 52.624  1.00 29.26  ? 141  GLY N CA    1 
ATOM   9498  C  C     . GLY E  1  141 ? 35.612  -53.721 51.284  1.00 22.85  ? 141  GLY N C     1 
ATOM   9499  O  O     . GLY E  1  141 ? 36.576  -54.362 50.870  1.00 25.15  ? 141  GLY N O     1 
ATOM   9500  N  N     . GLN E  1  142 ? 35.096  -52.681 50.652  1.00 22.07  ? 142  GLN N N     1 
ATOM   9501  C  CA    . GLN E  1  142 ? 35.507  -52.205 49.336  1.00 22.31  ? 142  GLN N CA    1 
ATOM   9502  C  C     . GLN E  1  142 ? 36.955  -51.716 49.166  1.00 21.28  ? 142  GLN N C     1 
ATOM   9503  O  O     . GLN E  1  142 ? 37.430  -50.852 49.897  1.00 23.63  ? 142  GLN N O     1 
ATOM   9504  C  CB    . GLN E  1  142 ? 34.553  -51.072 48.928  1.00 24.75  ? 142  GLN N CB    1 
ATOM   9505  C  CG    . GLN E  1  142 ? 34.812  -50.454 47.556  1.00 26.66  ? 142  GLN N CG    1 
ATOM   9506  C  CD    . GLN E  1  142 ? 34.605  -51.462 46.442  1.00 32.67  ? 142  GLN N CD    1 
ATOM   9507  O  OE1   . GLN E  1  142 ? 33.526  -52.041 46.313  1.00 28.17  ? 142  GLN N OE1   1 
ATOM   9508  N  NE2   . GLN E  1  142 ? 35.646  -51.690 45.639  1.00 32.37  ? 142  GLN N NE2   1 
ATOM   9509  N  N     . ALA E  1  143 ? 37.655  -52.265 48.187  1.00 16.97  ? 143  ALA N N     1 
ATOM   9510  C  CA    . ALA E  1  143 ? 39.001  -51.792 47.911  1.00 16.70  ? 143  ALA N CA    1 
ATOM   9511  C  C     . ALA E  1  143 ? 38.898  -50.581 46.959  1.00 20.01  ? 143  ALA N C     1 
ATOM   9512  O  O     . ALA E  1  143 ? 37.868  -50.380 46.276  1.00 18.79  ? 143  ALA N O     1 
ATOM   9513  C  CB    . ALA E  1  143 ? 39.801  -52.881 47.291  1.00 15.18  ? 143  ALA N CB    1 
ATOM   9514  N  N     . HIS E  1  144 ? 39.943  -49.758 46.957  1.00 15.93  ? 144  HIS N N     1 
ATOM   9515  C  CA    . HIS E  1  144 ? 40.031  -48.582 46.086  1.00 17.57  ? 144  HIS N CA    1 
ATOM   9516  C  C     . HIS E  1  144 ? 41.397  -48.741 45.428  1.00 18.53  ? 144  HIS N C     1 
ATOM   9517  O  O     . HIS E  1  144 ? 42.382  -48.138 45.870  1.00 21.68  ? 144  HIS N O     1 
ATOM   9518  C  CB    . HIS E  1  144 ? 40.011  -47.303 46.944  1.00 17.21  ? 144  HIS N CB    1 
ATOM   9519  C  CG    . HIS E  1  144 ? 38.805  -47.214 47.816  1.00 17.44  ? 144  HIS N CG    1 
ATOM   9520  N  ND1   . HIS E  1  144 ? 37.642  -46.588 47.416  1.00 25.36  ? 144  HIS N ND1   1 
ATOM   9521  C  CD2   . HIS E  1  144 ? 38.522  -47.810 48.992  1.00 17.24  ? 144  HIS N CD2   1 
ATOM   9522  C  CE1   . HIS E  1  144 ? 36.697  -46.811 48.308  1.00 18.27  ? 144  HIS N CE1   1 
ATOM   9523  N  NE2   . HIS E  1  144 ? 37.206  -47.550 49.274  1.00 19.44  ? 144  HIS N NE2   1 
ATOM   9524  N  N     . ARG E  1  145 ? 41.467  -49.584 44.403  1.00 17.54  ? 145  ARG N N     1 
ATOM   9525  C  CA    . ARG E  1  145 ? 42.742  -49.845 43.760  1.00 17.76  ? 145  ARG N CA    1 
ATOM   9526  C  C     . ARG E  1  145 ? 42.745  -49.664 42.223  1.00 18.90  ? 145  ARG N C     1 
ATOM   9527  O  O     . ARG E  1  145 ? 43.700  -50.042 41.526  1.00 17.04  ? 145  ARG N O     1 
ATOM   9528  C  CB    . ARG E  1  145 ? 43.235  -51.255 44.172  1.00 12.96  ? 145  ARG N CB    1 
ATOM   9529  C  CG    . ARG E  1  145 ? 42.531  -52.418 43.542  1.00 16.33  ? 145  ARG N CG    1 
ATOM   9530  C  CD    . ARG E  1  145 ? 43.236  -53.766 43.804  1.00 18.32  ? 145  ARG N CD    1 
ATOM   9531  N  NE    . ARG E  1  145 ? 43.134  -54.251 45.182  1.00 17.41  ? 145  ARG N NE    1 
ATOM   9532  C  CZ    . ARG E  1  145 ? 42.224  -55.102 45.637  1.00 16.89  ? 145  ARG N CZ    1 
ATOM   9533  N  NH1   . ARG E  1  145 ? 41.287  -55.611 44.834  1.00 15.08  ? 145  ARG N NH1   1 
ATOM   9534  N  NH2   . ARG E  1  145 ? 42.248  -55.451 46.916  1.00 17.18  ? 145  ARG N NH2   1 
ATOM   9535  N  N     . CYS E  1  146 ? 41.686  -49.058 41.710  1.00 19.20  ? 146  CYS N N     1 
ATOM   9536  C  CA    . CYS E  1  146 ? 41.556  -48.793 40.274  1.00 12.99  ? 146  CYS N CA    1 
ATOM   9537  C  C     . CYS E  1  146 ? 42.206  -47.465 39.956  1.00 16.23  ? 146  CYS N C     1 
ATOM   9538  O  O     . CYS E  1  146 ? 41.578  -46.411 40.131  1.00 18.21  ? 146  CYS N O     1 
ATOM   9539  C  CB    . CYS E  1  146 ? 40.067  -48.708 39.896  1.00 16.96  ? 146  CYS N CB    1 
ATOM   9540  S  SG    . CYS E  1  146 ? 39.818  -48.384 38.139  1.00 19.89  ? 146  CYS N SG    1 
ATOM   9541  N  N     . CYS E  1  147 ? 43.454  -47.484 39.479  1.00 16.63  ? 147  CYS N N     1 
ATOM   9542  C  CA    . CYS E  1  147 ? 44.168  -46.250 39.140  1.00 13.27  ? 147  CYS N CA    1 
ATOM   9543  C  C     . CYS E  1  147 ? 43.591  -45.632 37.868  1.00 17.82  ? 147  CYS N C     1 
ATOM   9544  O  O     . CYS E  1  147 ? 43.319  -46.348 36.894  1.00 18.79  ? 147  CYS N O     1 
ATOM   9545  C  CB    . CYS E  1  147 ? 45.672  -46.536 38.914  1.00 15.21  ? 147  CYS N CB    1 
ATOM   9546  S  SG    . CYS E  1  147 ? 46.366  -47.646 40.148  1.00 20.47  ? 147  CYS N SG    1 
ATOM   9547  N  N     . CYS E  1  148 ? 43.483  -44.304 37.821  1.00 13.90  ? 148  CYS N N     1 
ATOM   9548  C  CA    . CYS E  1  148 ? 42.866  -43.730 36.663  1.00 16.29  ? 148  CYS N CA    1 
ATOM   9549  C  C     . CYS E  1  148 ? 43.315  -42.359 36.271  1.00 18.63  ? 148  CYS N C     1 
ATOM   9550  O  O     . CYS E  1  148 ? 43.962  -41.647 37.051  1.00 19.01  ? 148  CYS N O     1 
ATOM   9551  C  CB    . CYS E  1  148 ? 41.349  -43.694 36.904  1.00 13.41  ? 148  CYS N CB    1 
ATOM   9552  S  SG    . CYS E  1  148 ? 40.885  -42.842 38.435  1.00 21.64  ? 148  CYS N SG    1 
ATOM   9553  N  N     . VAL E  1  149 ? 42.949  -41.999 35.043  1.00 13.32  ? 149  VAL N N     1 
ATOM   9554  C  CA    . VAL E  1  149 ? 43.190  -40.648 34.497  1.00 14.95  ? 149  VAL N CA    1 
ATOM   9555  C  C     . VAL E  1  149 ? 41.742  -40.166 34.290  1.00 16.43  ? 149  VAL N C     1 
ATOM   9556  O  O     . VAL E  1  149 ? 41.198  -40.255 33.175  1.00 16.16  ? 149  VAL N O     1 
ATOM   9557  C  CB    . VAL E  1  149 ? 43.839  -40.641 33.096  1.00 10.77  ? 149  VAL N CB    1 
ATOM   9558  C  CG1   . VAL E  1  149 ? 43.920  -39.203 32.605  1.00 8.91   ? 149  VAL N CG1   1 
ATOM   9559  C  CG2   . VAL E  1  149 ? 45.275  -41.360 33.124  1.00 9.64   ? 149  VAL N CG2   1 
ATOM   9560  N  N     . ALA E  1  150 ? 41.136  -39.670 35.357  1.00 15.87  ? 150  ALA N N     1 
ATOM   9561  C  CA    . ALA E  1  150 ? 39.731  -39.257 35.357  1.00 18.28  ? 150  ALA N CA    1 
ATOM   9562  C  C     . ALA E  1  150 ? 38.994  -40.444 34.758  1.00 17.38  ? 150  ALA N C     1 
ATOM   9563  O  O     . ALA E  1  150 ? 39.160  -41.544 35.249  1.00 20.90  ? 150  ALA N O     1 
ATOM   9564  C  CB    . ALA E  1  150 ? 39.527  -37.953 34.515  1.00 16.24  ? 150  ALA N CB    1 
ATOM   9565  N  N     . ASP E  1  151 ? 38.188  -40.243 33.711  1.00 21.36  ? 151  ASP N N     1 
ATOM   9566  C  CA    . ASP E  1  151 ? 37.508  -41.363 33.059  1.00 22.26  ? 151  ASP N CA    1 
ATOM   9567  C  C     . ASP E  1  151 ? 37.959  -41.555 31.599  1.00 20.06  ? 151  ASP N C     1 
ATOM   9568  O  O     . ASP E  1  151 ? 37.183  -41.983 30.737  1.00 19.06  ? 151  ASP N O     1 
ATOM   9569  C  CB    . ASP E  1  151 ? 35.991  -41.202 33.123  1.00 26.06  ? 151  ASP N CB    1 
ATOM   9570  C  CG    . ASP E  1  151 ? 35.516  -39.874 32.559  1.00 33.95  ? 151  ASP N CG    1 
ATOM   9571  O  OD1   . ASP E  1  151 ? 36.367  -38.944 32.414  1.00 34.01  ? 151  ASP N OD1   1 
ATOM   9572  O  OD2   . ASP E  1  151 ? 34.289  -39.763 32.282  1.00 27.98  ? 151  ASP N OD2   1 
ATOM   9573  N  N     . ARG E  1  152 ? 39.228  -41.262 31.344  1.00 18.89  ? 152  ARG N N     1 
ATOM   9574  C  CA    . ARG E  1  152 ? 39.837  -41.444 30.017  1.00 18.55  ? 152  ARG N CA    1 
ATOM   9575  C  C     . ARG E  1  152 ? 41.142  -42.208 30.185  1.00 16.45  ? 152  ARG N C     1 
ATOM   9576  O  O     . ARG E  1  152 ? 42.139  -41.863 29.527  1.00 14.00  ? 152  ARG N O     1 
ATOM   9577  C  CB    . ARG E  1  152 ? 40.233  -40.110 29.415  1.00 20.54  ? 152  ARG N CB    1 
ATOM   9578  C  CG    . ARG E  1  152 ? 39.291  -39.000 29.615  1.00 23.23  ? 152  ARG N CG    1 
ATOM   9579  C  CD    . ARG E  1  152 ? 39.781  -37.800 28.867  1.00 25.71  ? 152  ARG N CD    1 
ATOM   9580  N  NE    . ARG E  1  152 ? 38.649  -36.913 28.617  1.00 30.12  ? 152  ARG N NE    1 
ATOM   9581  C  CZ    . ARG E  1  152 ? 38.326  -35.883 29.378  1.00 25.14  ? 152  ARG N CZ    1 
ATOM   9582  N  NH1   . ARG E  1  152 ? 39.059  -35.602 30.451  1.00 31.42  ? 152  ARG N NH1   1 
ATOM   9583  N  NH2   . ARG E  1  152 ? 37.261  -35.159 29.080  1.00 21.40  ? 152  ARG N NH2   1 
ATOM   9584  N  N     . THR E  1  153 ? 41.170  -43.200 31.074  1.00 17.86  ? 153  THR N N     1 
ATOM   9585  C  CA    . THR E  1  153 ? 42.405  -43.933 31.346  1.00 14.79  ? 153  THR N CA    1 
ATOM   9586  C  C     . THR E  1  153 ? 42.972  -44.647 30.102  1.00 13.35  ? 153  THR N C     1 
ATOM   9587  O  O     . THR E  1  153 ? 44.185  -44.646 29.866  1.00 16.76  ? 153  THR N O     1 
ATOM   9588  C  CB    . THR E  1  153 ? 42.170  -44.946 32.482  1.00 14.01  ? 153  THR N CB    1 
ATOM   9589  O  OG1   . THR E  1  153 ? 41.590  -44.273 33.602  1.00 17.38  ? 153  THR N OG1   1 
ATOM   9590  C  CG2   . THR E  1  153 ? 43.492  -45.560 32.945  1.00 14.50  ? 153  THR N CG2   1 
ATOM   9591  N  N     . GLY E  1  154 ? 42.089  -45.238 29.294  1.00 16.44  ? 154  GLY N N     1 
ATOM   9592  C  CA    . GLY E  1  154 ? 42.519  -45.944 28.101  1.00 10.20  ? 154  GLY N CA    1 
ATOM   9593  C  C     . GLY E  1  154 ? 43.169  -44.987 27.143  1.00 13.25  ? 154  GLY N C     1 
ATOM   9594  O  O     . GLY E  1  154 ? 44.270  -45.241 26.618  1.00 16.30  ? 154  GLY N O     1 
ATOM   9595  N  N     . HIS E  1  155 ? 42.512  -43.863 26.914  1.00 13.83  ? 155  HIS N N     1 
ATOM   9596  C  CA    . HIS E  1  155 ? 43.076  -42.839 26.021  1.00 14.29  ? 155  HIS N CA    1 
ATOM   9597  C  C     . HIS E  1  155 ? 44.498  -42.460 26.501  1.00 14.84  ? 155  HIS N C     1 
ATOM   9598  O  O     . HIS E  1  155 ? 45.433  -42.367 25.708  1.00 12.98  ? 155  HIS N O     1 
ATOM   9599  C  CB    . HIS E  1  155 ? 42.164  -41.597 26.029  1.00 15.61  ? 155  HIS N CB    1 
ATOM   9600  C  CG    . HIS E  1  155 ? 42.766  -40.375 25.394  1.00 14.74  ? 155  HIS N CG    1 
ATOM   9601  N  ND1   . HIS E  1  155 ? 43.463  -39.426 26.118  1.00 18.28  ? 155  HIS N ND1   1 
ATOM   9602  C  CD2   . HIS E  1  155 ? 42.739  -39.924 24.110  1.00 12.68  ? 155  HIS N CD2   1 
ATOM   9603  C  CE1   . HIS E  1  155 ? 43.835  -38.441 25.313  1.00 13.99  ? 155  HIS N CE1   1 
ATOM   9604  N  NE2   . HIS E  1  155 ? 43.407  -38.719 24.089  1.00 19.23  ? 155  HIS N NE2   1 
ATOM   9605  N  N     . SER E  1  156 ? 44.677  -42.244 27.806  1.00 15.99  ? 156  SER N N     1 
ATOM   9606  C  CA    . SER E  1  156 ? 46.011  -41.852 28.259  1.00 15.17  ? 156  SER N CA    1 
ATOM   9607  C  C     . SER E  1  156 ? 47.009  -42.997 28.218  1.00 15.00  ? 156  SER N C     1 
ATOM   9608  O  O     . SER E  1  156 ? 48.182  -42.788 27.891  1.00 16.79  ? 156  SER N O     1 
ATOM   9609  C  CB    . SER E  1  156 ? 45.963  -41.261 29.670  1.00 17.56  ? 156  SER N CB    1 
ATOM   9610  O  OG    . SER E  1  156 ? 45.545  -39.923 29.584  1.00 21.83  ? 156  SER N OG    1 
ATOM   9611  N  N     . LEU E  1  157 ? 46.556  -44.206 28.553  1.00 14.55  ? 157  LEU N N     1 
ATOM   9612  C  CA    . LEU E  1  157 ? 47.439  -45.354 28.517  1.00 10.53  ? 157  LEU N CA    1 
ATOM   9613  C  C     . LEU E  1  157 ? 47.949  -45.564 27.082  1.00 13.76  ? 157  LEU N C     1 
ATOM   9614  O  O     . LEU E  1  157 ? 49.166  -45.671 26.847  1.00 15.78  ? 157  LEU N O     1 
ATOM   9615  C  CB    . LEU E  1  157 ? 46.707  -46.603 29.020  1.00 12.64  ? 157  LEU N CB    1 
ATOM   9616  C  CG    . LEU E  1  157 ? 47.527  -47.927 29.082  1.00 15.35  ? 157  LEU N CG    1 
ATOM   9617  C  CD1   . LEU E  1  157 ? 47.069  -48.774 30.254  1.00 21.14  ? 157  LEU N CD1   1 
ATOM   9618  C  CD2   . LEU E  1  157 ? 47.324  -48.719 27.802  1.00 21.76  ? 157  LEU N CD2   1 
ATOM   9619  N  N     . LEU E  1  158 ? 47.052  -45.558 26.103  1.00 11.72  ? 158  LEU N N     1 
ATOM   9620  C  CA    . LEU E  1  158 ? 47.476  -45.767 24.724  1.00 10.21  ? 158  LEU N CA    1 
ATOM   9621  C  C     . LEU E  1  158 ? 48.349  -44.650 24.165  1.00 14.64  ? 158  LEU N C     1 
ATOM   9622  O  O     . LEU E  1  158 ? 49.334  -44.915 23.519  1.00 15.39  ? 158  LEU N O     1 
ATOM   9623  C  CB    . LEU E  1  158 ? 46.273  -45.983 23.818  1.00 17.49  ? 158  LEU N CB    1 
ATOM   9624  C  CG    . LEU E  1  158 ? 46.548  -46.538 22.407  1.00 14.36  ? 158  LEU N CG    1 
ATOM   9625  C  CD1   . LEU E  1  158 ? 47.188  -47.935 22.476  1.00 16.07  ? 158  LEU N CD1   1 
ATOM   9626  C  CD2   . LEU E  1  158 ? 45.207  -46.623 21.684  1.00 19.20  ? 158  LEU N CD2   1 
ATOM   9627  N  N     . HIS E  1  159 ? 47.998  -43.397 24.396  1.00 15.54  ? 159  HIS N N     1 
ATOM   9628  C  CA    . HIS E  1  159 ? 48.818  -42.333 23.881  1.00 16.04  ? 159  HIS N CA    1 
ATOM   9629  C  C     . HIS E  1  159 ? 50.179  -42.317 24.567  1.00 18.37  ? 159  HIS N C     1 
ATOM   9630  O  O     . HIS E  1  159 ? 51.169  -41.967 23.945  1.00 13.68  ? 159  HIS N O     1 
ATOM   9631  C  CB    . HIS E  1  159 ? 48.116  -40.989 24.047  1.00 18.73  ? 159  HIS N CB    1 
ATOM   9632  C  CG    . HIS E  1  159 ? 47.083  -40.727 22.998  1.00 12.35  ? 159  HIS N CG    1 
ATOM   9633  N  ND1   . HIS E  1  159 ? 47.414  -40.294 21.737  1.00 13.70  ? 159  HIS N ND1   1 
ATOM   9634  C  CD2   . HIS E  1  159 ? 45.735  -40.902 22.999  1.00 15.03  ? 159  HIS N CD2   1 
ATOM   9635  C  CE1   . HIS E  1  159 ? 46.321  -40.212 20.998  1.00 18.21  ? 159  HIS N CE1   1 
ATOM   9636  N  NE2   . HIS E  1  159 ? 45.285  -40.575 21.739  1.00 16.99  ? 159  HIS N NE2   1 
ATOM   9637  N  N     . THR E  1  160 ? 50.231  -42.713 25.831  1.00 14.42  ? 160  THR N N     1 
ATOM   9638  C  CA    . THR E  1  160 ? 51.514  -42.759 26.526  1.00 15.98  ? 160  THR N CA    1 
ATOM   9639  C  C     . THR E  1  160 ? 52.409  -43.862 25.975  1.00 12.68  ? 160  THR N C     1 
ATOM   9640  O  O     . THR E  1  160 ? 53.607  -43.656 25.755  1.00 17.49  ? 160  THR N O     1 
ATOM   9641  C  CB    . THR E  1  160 ? 51.273  -43.002 28.076  1.00 18.92  ? 160  THR N CB    1 
ATOM   9642  O  OG1   . THR E  1  160 ? 50.520  -41.898 28.610  1.00 15.09  ? 160  THR N OG1   1 
ATOM   9643  C  CG2   . THR E  1  160 ? 52.599  -43.113 28.832  1.00 19.63  ? 160  THR N CG2   1 
ATOM   9644  N  N     . LEU E  1  161 ? 51.840  -45.048 25.798  1.00 12.25  ? 161  LEU N N     1 
ATOM   9645  C  CA    . LEU E  1  161 ? 52.574  -46.188 25.252  1.00 15.99  ? 161  LEU N CA    1 
ATOM   9646  C  C     . LEU E  1  161 ? 52.992  -45.895 23.792  1.00 15.03  ? 161  LEU N C     1 
ATOM   9647  O  O     . LEU E  1  161 ? 54.087  -46.260 23.367  1.00 15.62  ? 161  LEU N O     1 
ATOM   9648  C  CB    . LEU E  1  161 ? 51.724  -47.483 25.283  1.00 16.17  ? 161  LEU N CB    1 
ATOM   9649  C  CG    . LEU E  1  161 ? 51.492  -48.234 26.601  1.00 22.09  ? 161  LEU N CG    1 
ATOM   9650  C  CD1   . LEU E  1  161 ? 50.652  -49.466 26.329  1.00 20.51  ? 161  LEU N CD1   1 
ATOM   9651  C  CD2   . LEU E  1  161 ? 52.829  -48.665 27.215  1.00 17.36  ? 161  LEU N CD2   1 
ATOM   9652  N  N     . TYR E  1  162 ? 52.144  -45.234 23.029  1.00 15.02  ? 162  TYR N N     1 
ATOM   9653  C  CA    . TYR E  1  162 ? 52.515  -44.929 21.634  1.00 16.18  ? 162  TYR N CA    1 
ATOM   9654  C  C     . TYR E  1  162 ? 53.703  -43.962 21.599  1.00 19.15  ? 162  TYR N C     1 
ATOM   9655  O  O     . TYR E  1  162 ? 54.627  -44.117 20.771  1.00 14.13  ? 162  TYR N O     1 
ATOM   9656  C  CB    . TYR E  1  162 ? 51.343  -44.293 20.890  1.00 11.97  ? 162  TYR N CB    1 
ATOM   9657  C  CG    . TYR E  1  162 ? 51.713  -43.878 19.477  1.00 14.19  ? 162  TYR N CG    1 
ATOM   9658  C  CD1   . TYR E  1  162 ? 52.059  -44.820 18.532  1.00 17.97  ? 162  TYR N CD1   1 
ATOM   9659  C  CD2   . TYR E  1  162 ? 51.805  -42.537 19.125  1.00 14.74  ? 162  TYR N CD2   1 
ATOM   9660  C  CE1   . TYR E  1  162 ? 52.494  -44.447 17.259  1.00 19.52  ? 162  TYR N CE1   1 
ATOM   9661  C  CE2   . TYR E  1  162 ? 52.240  -42.157 17.871  1.00 21.47  ? 162  TYR N CE2   1 
ATOM   9662  C  CZ    . TYR E  1  162 ? 52.588  -43.118 16.936  1.00 21.19  ? 162  TYR N CZ    1 
ATOM   9663  O  OH    . TYR E  1  162 ? 53.087  -42.765 15.695  1.00 21.73  ? 162  TYR N OH    1 
ATOM   9664  N  N     . GLY E  1  163 ? 53.672  -42.957 22.488  1.00 18.59  ? 163  GLY N N     1 
ATOM   9665  C  CA    . GLY E  1  163 ? 54.789  -42.014 22.537  1.00 21.93  ? 163  GLY N CA    1 
ATOM   9666  C  C     . GLY E  1  163 ? 56.068  -42.735 22.949  1.00 18.97  ? 163  GLY N C     1 
ATOM   9667  O  O     . GLY E  1  163 ? 57.121  -42.512 22.397  1.00 23.11  ? 163  GLY N O     1 
ATOM   9668  N  N     . ARG E  1  164 ? 55.979  -43.618 23.927  1.00 22.18  ? 164  ARG N N     1 
ATOM   9669  C  CA    . ARG E  1  164 ? 57.146  -44.366 24.361  1.00 22.84  ? 164  ARG N CA    1 
ATOM   9670  C  C     . ARG E  1  164 ? 57.743  -45.219 23.209  1.00 24.90  ? 164  ARG N C     1 
ATOM   9671  O  O     . ARG E  1  164 ? 58.962  -45.256 23.024  1.00 25.10  ? 164  ARG N O     1 
ATOM   9672  C  CB    . ARG E  1  164 ? 56.746  -45.274 25.528  1.00 27.50  ? 164  ARG N CB    1 
ATOM   9673  C  CG    . ARG E  1  164 ? 57.906  -46.014 26.184  1.00 27.81  ? 164  ARG N CG    1 
ATOM   9674  C  CD    . ARG E  1  164 ? 58.850  -45.075 26.922  1.00 32.86  ? 164  ARG N CD    1 
ATOM   9675  N  NE    . ARG E  1  164 ? 59.956  -45.866 27.449  1.00 36.75  ? 164  ARG N NE    1 
ATOM   9676  C  CZ    . ARG E  1  164 ? 60.782  -45.472 28.407  1.00 41.22  ? 164  ARG N CZ    1 
ATOM   9677  N  NH1   . ARG E  1  164 ? 60.661  -44.276 28.967  1.00 38.43  ? 164  ARG N NH1   1 
ATOM   9678  N  NH2   . ARG E  1  164 ? 61.708  -46.310 28.844  1.00 49.22  ? 164  ARG N NH2   1 
ATOM   9679  N  N     . SER E  1  165 ? 56.882  -45.897 22.445  1.00 18.79  ? 165  SER N N     1 
ATOM   9680  C  CA    . SER E  1  165 ? 57.331  -46.750 21.339  1.00 20.93  ? 165  SER N CA    1 
ATOM   9681  C  C     . SER E  1  165 ? 58.135  -45.915 20.328  1.00 22.65  ? 165  SER N C     1 
ATOM   9682  O  O     . SER E  1  165 ? 58.957  -46.430 19.579  1.00 21.74  ? 165  SER N O     1 
ATOM   9683  C  CB    . SER E  1  165 ? 56.114  -47.353 20.638  1.00 19.88  ? 165  SER N CB    1 
ATOM   9684  O  OG    . SER E  1  165 ? 55.497  -46.326 19.878  1.00 15.64  ? 165  SER N OG    1 
ATOM   9685  N  N     . LEU E  1  166 ? 57.882  -44.612 20.299  1.00 22.89  ? 166  LEU N N     1 
ATOM   9686  C  CA    . LEU E  1  166 ? 58.607  -43.765 19.387  1.00 24.98  ? 166  LEU N CA    1 
ATOM   9687  C  C     . LEU E  1  166 ? 60.094  -43.671 19.739  1.00 27.27  ? 166  LEU N C     1 
ATOM   9688  O  O     . LEU E  1  166 ? 60.857  -43.132 18.950  1.00 26.62  ? 166  LEU N O     1 
ATOM   9689  C  CB    . LEU E  1  166 ? 58.018  -42.356 19.371  1.00 23.03  ? 166  LEU N CB    1 
ATOM   9690  C  CG    . LEU E  1  166 ? 56.594  -42.258 18.827  1.00 24.81  ? 166  LEU N CG    1 
ATOM   9691  C  CD1   . LEU E  1  166 ? 56.158  -40.777 18.864  1.00 20.23  ? 166  LEU N CD1   1 
ATOM   9692  C  CD2   . LEU E  1  166 ? 56.527  -42.813 17.438  1.00 16.49  ? 166  LEU N CD2   1 
ATOM   9693  N  N     . ARG E  1  167 ? 60.495  -44.180 20.904  1.00 24.00  ? 167  ARG N N     1 
ATOM   9694  C  CA    . ARG E  1  167 ? 61.907  -44.120 21.333  1.00 26.15  ? 167  ARG N CA    1 
ATOM   9695  C  C     . ARG E  1  167 ? 62.741  -45.326 20.890  1.00 27.32  ? 167  ARG N C     1 
ATOM   9696  O  O     . ARG E  1  167 ? 63.950  -45.362 21.098  1.00 31.98  ? 167  ARG N O     1 
ATOM   9697  C  CB    . ARG E  1  167 ? 61.993  -44.028 22.867  1.00 23.56  ? 167  ARG N CB    1 
ATOM   9698  C  CG    . ARG E  1  167 ? 61.179  -42.910 23.493  1.00 31.79  ? 167  ARG N CG    1 
ATOM   9699  C  CD    . ARG E  1  167 ? 61.471  -42.751 24.972  1.00 34.60  ? 167  ARG N CD    1 
ATOM   9700  N  NE    . ARG E  1  167 ? 62.765  -42.110 25.219  1.00 39.91  ? 167  ARG N NE    1 
ATOM   9701  C  CZ    . ARG E  1  167 ? 63.087  -41.500 26.363  1.00 40.68  ? 167  ARG N CZ    1 
ATOM   9702  N  NH1   . ARG E  1  167 ? 62.209  -41.457 27.352  1.00 41.53  ? 167  ARG N NH1   1 
ATOM   9703  N  NH2   . ARG E  1  167 ? 64.272  -40.912 26.518  1.00 42.54  ? 167  ARG N NH2   1 
ATOM   9704  N  N     . TYR E  1  168 ? 62.093  -46.324 20.312  1.00 27.64  ? 168  TYR N N     1 
ATOM   9705  C  CA    . TYR E  1  168 ? 62.772  -47.528 19.877  1.00 27.41  ? 168  TYR N CA    1 
ATOM   9706  C  C     . TYR E  1  168 ? 62.759  -47.686 18.359  1.00 28.35  ? 168  TYR N C     1 
ATOM   9707  O  O     . TYR E  1  168 ? 62.044  -46.979 17.677  1.00 24.86  ? 168  TYR N O     1 
ATOM   9708  C  CB    . TYR E  1  168 ? 62.116  -48.737 20.526  1.00 32.23  ? 168  TYR N CB    1 
ATOM   9709  C  CG    . TYR E  1  168 ? 62.117  -48.658 22.029  1.00 36.47  ? 168  TYR N CG    1 
ATOM   9710  C  CD1   . TYR E  1  168 ? 61.065  -48.028 22.723  1.00 37.12  ? 168  TYR N CD1   1 
ATOM   9711  C  CD2   . TYR E  1  168 ? 63.194  -49.163 22.768  1.00 34.94  ? 168  TYR N CD2   1 
ATOM   9712  C  CE1   . TYR E  1  168 ? 61.099  -47.912 24.137  1.00 38.38  ? 168  TYR N CE1   1 
ATOM   9713  C  CE2   . TYR E  1  168 ? 63.240  -49.044 24.160  1.00 38.32  ? 168  TYR N CE2   1 
ATOM   9714  C  CZ    . TYR E  1  168 ? 62.194  -48.423 24.840  1.00 39.18  ? 168  TYR N CZ    1 
ATOM   9715  O  OH    . TYR E  1  168 ? 62.246  -48.327 26.216  1.00 39.95  ? 168  TYR N OH    1 
ATOM   9716  N  N     . ASP E  1  169 ? 63.553  -48.615 17.837  1.00 27.76  ? 169  ASP N N     1 
ATOM   9717  C  CA    . ASP E  1  169 ? 63.608  -48.817 16.395  1.00 30.59  ? 169  ASP N CA    1 
ATOM   9718  C  C     . ASP E  1  169 ? 62.615  -49.864 15.881  1.00 27.90  ? 169  ASP N C     1 
ATOM   9719  O  O     . ASP E  1  169 ? 62.831  -50.487 14.848  1.00 28.87  ? 169  ASP N O     1 
ATOM   9720  C  CB    . ASP E  1  169 ? 65.030  -49.199 15.962  1.00 36.87  ? 169  ASP N CB    1 
ATOM   9721  C  CG    . ASP E  1  169 ? 65.449  -50.578 16.456  1.00 45.64  ? 169  ASP N CG    1 
ATOM   9722  O  OD1   . ASP E  1  169 ? 65.201  -50.901 17.632  1.00 51.48  ? 169  ASP N OD1   1 
ATOM   9723  O  OD2   . ASP E  1  169 ? 66.043  -51.346 15.668  1.00 56.12  ? 169  ASP N OD2   1 
ATOM   9724  N  N     . THR E  1  170 ? 61.533  -50.068 16.609  1.00 28.12  ? 170  THR N N     1 
ATOM   9725  C  CA    . THR E  1  170 ? 60.518  -51.012 16.161  1.00 26.25  ? 170  THR N CA    1 
ATOM   9726  C  C     . THR E  1  170 ? 60.066  -50.558 14.764  1.00 24.98  ? 170  THR N C     1 
ATOM   9727  O  O     . THR E  1  170 ? 59.896  -49.366 14.517  1.00 20.17  ? 170  THR N O     1 
ATOM   9728  C  CB    . THR E  1  170 ? 59.312  -50.976 17.081  1.00 27.02  ? 170  THR N CB    1 
ATOM   9729  O  OG1   . THR E  1  170 ? 59.757  -51.057 18.435  1.00 23.93  ? 170  THR N OG1   1 
ATOM   9730  C  CG2   . THR E  1  170 ? 58.371  -52.164 16.782  1.00 21.77  ? 170  THR N CG2   1 
ATOM   9731  N  N     . SER E  1  171 ? 59.911  -51.494 13.835  1.00 24.73  ? 171  SER N N     1 
ATOM   9732  C  CA    . SER E  1  171 ? 59.434  -51.114 12.501  1.00 20.03  ? 171  SER N CA    1 
ATOM   9733  C  C     . SER E  1  171 ? 57.900  -51.276 12.467  1.00 19.92  ? 171  SER N C     1 
ATOM   9734  O  O     . SER E  1  171 ? 57.396  -52.389 12.641  1.00 19.56  ? 171  SER N O     1 
ATOM   9735  C  CB    . SER E  1  171 ? 60.069  -52.020 11.445  1.00 24.66  ? 171  SER N CB    1 
ATOM   9736  O  OG    . SER E  1  171 ? 61.486  -51.927 11.469  1.00 27.38  ? 171  SER N OG    1 
ATOM   9737  N  N     . TYR E  1  172 ? 57.162  -50.181 12.273  1.00 20.95  ? 172  TYR N N     1 
ATOM   9738  C  CA    . TYR E  1  172 ? 55.696  -50.244 12.190  1.00 22.45  ? 172  TYR N CA    1 
ATOM   9739  C  C     . TYR E  1  172 ? 55.144  -50.335 10.756  1.00 22.27  ? 172  TYR N C     1 
ATOM   9740  O  O     . TYR E  1  172 ? 55.579  -49.616 9.868   1.00 25.58  ? 172  TYR N O     1 
ATOM   9741  C  CB    . TYR E  1  172 ? 55.047  -49.038 12.884  1.00 24.52  ? 172  TYR N CB    1 
ATOM   9742  C  CG    . TYR E  1  172 ? 55.143  -49.147 14.386  1.00 34.03  ? 172  TYR N CG    1 
ATOM   9743  C  CD1   . TYR E  1  172 ? 56.347  -48.857 15.037  1.00 32.97  ? 172  TYR N CD1   1 
ATOM   9744  C  CD2   . TYR E  1  172 ? 54.096  -49.691 15.143  1.00 32.43  ? 172  TYR N CD2   1 
ATOM   9745  C  CE1   . TYR E  1  172 ? 56.519  -49.115 16.403  1.00 39.19  ? 172  TYR N CE1   1 
ATOM   9746  C