data_2FC6
# 
_entry.id   2FC6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FC6         
RCSB  RCSB035704   
WWPDB D_1000035704 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002021110.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FC6 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dang, W.'                                               1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Shirouzu, M.'                                           5 
'Terada, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the zf-CCCH domain of target of EGR1, member 1 (Nuclear)' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dang, W.'     1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Shirouzu, M.' 5 
primary 'Terada, T.'   6 
primary 'Yokoyama, S.' 7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'target of EGR1, member 1' 5046.509 1 ? ? 'zf-CCCH domain, residues 8-44' ? 
2 non-polymer syn 'ZINC ION'                 65.409   1 ? ? ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        nuclear 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGCCLPPATHRPHPTSICDNFSAYGWCPLGPQCPQSHDISGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGCCLPPATHRPHPTSICDNFSAYGWCPLGPQCPQSHDISGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002021110.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  CYS n 
1 9  CYS n 
1 10 LEU n 
1 11 PRO n 
1 12 PRO n 
1 13 ALA n 
1 14 THR n 
1 15 HIS n 
1 16 ARG n 
1 17 PRO n 
1 18 HIS n 
1 19 PRO n 
1 20 THR n 
1 21 SER n 
1 22 ILE n 
1 23 CYS n 
1 24 ASP n 
1 25 ASN n 
1 26 PHE n 
1 27 SER n 
1 28 ALA n 
1 29 TYR n 
1 30 GLY n 
1 31 TRP n 
1 32 CYS n 
1 33 PRO n 
1 34 LEU n 
1 35 GLY n 
1 36 PRO n 
1 37 GLN n 
1 38 CYS n 
1 39 PRO n 
1 40 GLN n 
1 41 SER n 
1 42 HIS n 
1 43 ASP n 
1 44 ILE n 
1 45 SER n 
1 46 GLY n 
1 47 PRO n 
1 48 SER n 
1 49 SER n 
1 50 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TOE1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050302-22 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    CAI21722 
_struct_ref.pdbx_db_accession          56205992 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   CCLPPATHRPHPTSICDNFSAYGWCPLGPQCPQSHDI 
_struct_ref.pdbx_align_begin           285 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FC6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 44 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             56205992 
_struct_ref_seq.db_align_beg                  285 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  321 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       44 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FC6 GLY A 1  ? GB 56205992 ? ? 'CLONING ARTIFACT' 1  1  
1 2FC6 SER A 2  ? GB 56205992 ? ? 'CLONING ARTIFACT' 2  2  
1 2FC6 SER A 3  ? GB 56205992 ? ? 'CLONING ARTIFACT' 3  3  
1 2FC6 GLY A 4  ? GB 56205992 ? ? 'CLONING ARTIFACT' 4  4  
1 2FC6 SER A 5  ? GB 56205992 ? ? 'CLONING ARTIFACT' 5  5  
1 2FC6 SER A 6  ? GB 56205992 ? ? 'CLONING ARTIFACT' 6  6  
1 2FC6 GLY A 7  ? GB 56205992 ? ? 'CLONING ARTIFACT' 7  7  
1 2FC6 SER A 45 ? GB 56205992 ? ? 'CLONING ARTIFACT' 45 8  
1 2FC6 GLY A 46 ? GB 56205992 ? ? 'CLONING ARTIFACT' 46 9  
1 2FC6 PRO A 47 ? GB 56205992 ? ? 'CLONING ARTIFACT' 47 10 
1 2FC6 SER A 48 ? GB 56205992 ? ? 'CLONING ARTIFACT' 48 11 
1 2FC6 SER A 49 ? GB 56205992 ? ? 'CLONING ARTIFACT' 49 12 
1 2FC6 GLY A 50 ? GB 56205992 ? ? 'CLONING ARTIFACT' 50 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 
50uM ZnCl2+1mM IDA; 90%H2O, 10%D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2FC6 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2FC6 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy,target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2FC6 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker       1 
processing           NMRPipe 20031121 Delaglio,F.  2 
'data analysis'      NMRView 5.0.4    Johnson,B.A. 3 
'data analysis'      Kujira  0.9321   Kobayashi,N. 4 
'structure solution' CYANA   2.0.17   Guntert,P.   5 
refinement           CYANA   2.0.17   Guntert,P.   6 
# 
_exptl.entry_id          2FC6 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2FC6 
_struct.title                     'Solution structure of the zf-CCCH domain of target of EGR1, member 1 (Nuclear)' 
_struct.pdbx_descriptor           'target of EGR1, member 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FC6 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;structure genomics, zf-CCCH domain, Target of EGR1, member 1(Nuclear), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 25 ? ALA A 28 ? ASN A 25 ALA A 28 1 ? 4 
HELX_P HELX_P2 2 GLY A 35 ? GLN A 37 ? GLY A 35 GLN A 37 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 42 NE2 ? ? A ZN 201 A HIS 42 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 23 SG  ? ? A ZN 201 A CYS 23 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 32 SG  ? ? A ZN 201 A CYS 32 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 38 SG  ? ? A ZN 201 A CYS 38 1_555 ? ? ? ? ? ? ? 2.351 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? 
2 AC1 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 
3 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 
4 AC1 4 HIS A 42 ? HIS A 42 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FC6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FC6 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 34.148  -12.684 -25.127 1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 33.253  -13.127 -26.179 1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 33.130  -12.115 -27.300 1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 33.791  -11.076 -27.283 1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 35.094  -12.941 -25.150 1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? 33.624  -14.056 -26.586 1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? 32.274  -13.297 -25.755 1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? 32.284  -12.418 -28.279 1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? 32.081  -11.528 -29.417 1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? 31.254  -10.311 -29.015 1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? 30.386  -10.396 -28.147 1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? 31.388  -12.275 -30.558 1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? 32.192  -13.342 -31.032 1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? 31.786  -13.261 -28.237 1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? 33.051  -11.194 -29.754 1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? 30.451  -12.677 -30.205 1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? 31.202  -11.590 -31.373 1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? 32.367  -13.955 -30.315 1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? 31.531  -9.178  -29.653 1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? 30.816  -7.941  -29.359 1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? 30.964  -6.944  -30.504 1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? 32.075  -6.580  -30.886 1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? 31.335  -7.323  -28.060 1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? 32.737  -7.124  -28.114 1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? 32.235  -9.174  -30.335 1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? 29.771  -8.183  -29.240 1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? 30.855  -6.370  -27.900 1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? 31.109  -7.984  -27.235 1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? 33.155  -7.893  -28.509 1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? 29.833  -6.506  -31.049 1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? 29.856  -5.555  -32.145 1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? 28.950  -4.366  -31.900 1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? 29.379  -3.353  -31.348 1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? 28.975  -6.832  -30.704 1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? 30.868  -5.203  -32.279 1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? 29.538  -6.056  -33.048 1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? 27.692  -4.487  -32.313 1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? 26.724  -3.410  -32.141 1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? 26.863  -2.770  -30.763 1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? 26.856  -3.459  -29.743 1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? 25.301  -3.941  -32.328 1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? 24.869  -4.657  -31.184 1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? 27.410  -5.319  -32.747 1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? 26.922  -2.662  -32.894 1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? 24.630  -3.112  -32.494 1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? 25.276  -4.601  -33.183 1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? 25.274  -5.527  -31.179 1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? 26.990  -1.447  -30.742 1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? 27.135  -0.713  -29.491 1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? 25.770  -0.346  -28.915 1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? 25.550  0.784   -28.482 1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? 27.965  0.553   -29.711 1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? 29.349  0.252   -29.766 1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? 26.989  -0.954  -31.589 1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? 27.649  -1.352  -28.789 1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? 27.672  1.016   -30.641 1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? 27.791  1.241   -28.896 1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? 29.635  0.230   -30.682 1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? 24.856  -1.311  -28.915 1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? 23.524  -1.071  -28.391 1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? 22.749  -0.064  -29.216 1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? 23.213  1.056   -29.437 1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? 25.088  -2.194  -29.274 1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? 22.981  -2.005  -28.378 1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? 23.609  -0.702  -27.380 1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . CYS A 1 8  ? 21.567  -0.460  -29.675 1.00 0.00 ? 8   CYS A N    1  
ATOM   67    C  CA   . CYS A 1 8  ? 20.727  0.416   -30.483 1.00 0.00 ? 8   CYS A CA   1  
ATOM   68    C  C    . CYS A 1 8  ? 19.761  1.204   -29.605 1.00 0.00 ? 8   CYS A C    1  
ATOM   69    O  O    . CYS A 1 8  ? 18.551  1.199   -29.836 1.00 0.00 ? 8   CYS A O    1  
ATOM   70    C  CB   . CYS A 1 8  ? 19.948  -0.400  -31.515 1.00 0.00 ? 8   CYS A CB   1  
ATOM   71    S  SG   . CYS A 1 8  ? 19.344  0.568   -32.918 1.00 0.00 ? 8   CYS A SG   1  
ATOM   72    H  H    . CYS A 1 8  ? 21.252  -1.364  -29.465 1.00 0.00 ? 8   CYS A H    1  
ATOM   73    H  HA   . CYS A 1 8  ? 21.373  1.110   -30.998 1.00 0.00 ? 8   CYS A HA   1  
ATOM   74    H  HB2  . CYS A 1 8  ? 20.587  -1.178  -31.905 1.00 0.00 ? 8   CYS A HB2  1  
ATOM   75    H  HB3  . CYS A 1 8  ? 19.094  -0.853  -31.034 1.00 0.00 ? 8   CYS A HB3  1  
ATOM   76    H  HG   . CYS A 1 8  ? 18.384  -0.126  -33.510 1.00 0.00 ? 8   CYS A HG   1  
ATOM   77    N  N    . CYS A 1 9  ? 20.301  1.879   -28.596 1.00 0.00 ? 9   CYS A N    1  
ATOM   78    C  CA   . CYS A 1 9  ? 19.486  2.670   -27.681 1.00 0.00 ? 9   CYS A CA   1  
ATOM   79    C  C    . CYS A 1 9  ? 19.352  4.106   -28.176 1.00 0.00 ? 9   CYS A C    1  
ATOM   80    O  O    . CYS A 1 9  ? 20.161  4.577   -28.977 1.00 0.00 ? 9   CYS A O    1  
ATOM   81    C  CB   . CYS A 1 9  ? 20.097  2.656   -26.279 1.00 0.00 ? 9   CYS A CB   1  
ATOM   82    S  SG   . CYS A 1 9  ? 19.754  1.150   -25.340 1.00 0.00 ? 9   CYS A SG   1  
ATOM   83    H  H    . CYS A 1 9  ? 21.272  1.844   -28.463 1.00 0.00 ? 9   CYS A H    1  
ATOM   84    H  HA   . CYS A 1 9  ? 18.505  2.222   -27.642 1.00 0.00 ? 9   CYS A HA   1  
ATOM   85    H  HB2  . CYS A 1 9  ? 21.170  2.754   -26.361 1.00 0.00 ? 9   CYS A HB2  1  
ATOM   86    H  HB3  . CYS A 1 9  ? 19.708  3.492   -25.717 1.00 0.00 ? 9   CYS A HB3  1  
ATOM   87    H  HG   . CYS A 1 9  ? 18.519  1.234   -24.870 1.00 0.00 ? 9   CYS A HG   1  
ATOM   88    N  N    . LEU A 1 10 ? 18.325  4.798   -27.696 1.00 0.00 ? 10  LEU A N    1  
ATOM   89    C  CA   . LEU A 1 10 ? 18.082  6.181   -28.091 1.00 0.00 ? 10  LEU A CA   1  
ATOM   90    C  C    . LEU A 1 10 ? 19.212  7.089   -27.615 1.00 0.00 ? 10  LEU A C    1  
ATOM   91    O  O    . LEU A 1 10 ? 19.899  6.804   -26.634 1.00 0.00 ? 10  LEU A O    1  
ATOM   92    C  CB   . LEU A 1 10 ? 16.748  6.668   -27.523 1.00 0.00 ? 10  LEU A CB   1  
ATOM   93    C  CG   . LEU A 1 10 ? 15.491  6.068   -28.155 1.00 0.00 ? 10  LEU A CG   1  
ATOM   94    C  CD1  . LEU A 1 10 ? 15.281  6.623   -29.555 1.00 0.00 ? 10  LEU A CD1  1  
ATOM   95    C  CD2  . LEU A 1 10 ? 15.584  4.550   -28.188 1.00 0.00 ? 10  LEU A CD2  1  
ATOM   96    H  H    . LEU A 1 10 ? 17.714  4.370   -27.061 1.00 0.00 ? 10  LEU A H    1  
ATOM   97    H  HA   . LEU A 1 10 ? 18.039  6.215   -29.169 1.00 0.00 ? 10  LEU A HA   1  
ATOM   98    H  HB2  . LEU A 1 10 ? 16.732  6.435   -26.470 1.00 0.00 ? 10  LEU A HB2  1  
ATOM   99    H  HB3  . LEU A 1 10 ? 16.706  7.740   -27.653 1.00 0.00 ? 10  LEU A HB3  1  
ATOM   100   H  HG   . LEU A 1 10 ? 14.631  6.339   -27.557 1.00 0.00 ? 10  LEU A HG   1  
ATOM   101   H  HD11 . LEU A 1 10 ? 14.490  7.357   -29.537 1.00 0.00 ? 10  LEU A HD11 1  
ATOM   102   H  HD12 . LEU A 1 10 ? 15.010  5.819   -30.224 1.00 0.00 ? 10  LEU A HD12 1  
ATOM   103   H  HD13 . LEU A 1 10 ? 16.195  7.085   -29.900 1.00 0.00 ? 10  LEU A HD13 1  
ATOM   104   H  HD21 . LEU A 1 10 ? 14.653  4.141   -28.555 1.00 0.00 ? 10  LEU A HD21 1  
ATOM   105   H  HD22 . LEU A 1 10 ? 15.772  4.179   -27.191 1.00 0.00 ? 10  LEU A HD22 1  
ATOM   106   H  HD23 . LEU A 1 10 ? 16.390  4.253   -28.842 1.00 0.00 ? 10  LEU A HD23 1  
ATOM   107   N  N    . PRO A 1 11 ? 19.409  8.210   -28.325 1.00 0.00 ? 11  PRO A N    1  
ATOM   108   C  CA   . PRO A 1 11 ? 20.453  9.185   -27.992 1.00 0.00 ? 11  PRO A CA   1  
ATOM   109   C  C    . PRO A 1 11 ? 20.152  9.938   -26.700 1.00 0.00 ? 11  PRO A C    1  
ATOM   110   O  O    . PRO A 1 11 ? 19.029  9.931   -26.197 1.00 0.00 ? 11  PRO A O    1  
ATOM   111   C  CB   . PRO A 1 11 ? 20.437  10.143  -29.185 1.00 0.00 ? 11  PRO A CB   1  
ATOM   112   C  CG   . PRO A 1 11 ? 19.059  10.035  -29.740 1.00 0.00 ? 11  PRO A CG   1  
ATOM   113   C  CD   . PRO A 1 11 ? 18.628  8.614   -29.506 1.00 0.00 ? 11  PRO A CD   1  
ATOM   114   H  HA   . PRO A 1 11 ? 21.423  8.716   -27.916 1.00 0.00 ? 11  PRO A HA   1  
ATOM   115   H  HB2  . PRO A 1 11 ? 20.651  11.147  -28.847 1.00 0.00 ? 11  PRO A HB2  1  
ATOM   116   H  HB3  . PRO A 1 11 ? 21.178  9.835   -29.908 1.00 0.00 ? 11  PRO A HB3  1  
ATOM   117   H  HG2  . PRO A 1 11 ? 18.401  10.716  -29.222 1.00 0.00 ? 11  PRO A HG2  1  
ATOM   118   H  HG3  . PRO A 1 11 ? 19.070  10.254  -30.797 1.00 0.00 ? 11  PRO A HG3  1  
ATOM   119   H  HD2  . PRO A 1 11 ? 17.568  8.569   -29.301 1.00 0.00 ? 11  PRO A HD2  1  
ATOM   120   H  HD3  . PRO A 1 11 ? 18.875  7.999   -30.359 1.00 0.00 ? 11  PRO A HD3  1  
ATOM   121   N  N    . PRO A 1 12 ? 21.178  10.603  -26.150 1.00 0.00 ? 12  PRO A N    1  
ATOM   122   C  CA   . PRO A 1 12 ? 21.048  11.375  -24.910 1.00 0.00 ? 12  PRO A CA   1  
ATOM   123   C  C    . PRO A 1 12 ? 20.204  12.631  -25.096 1.00 0.00 ? 12  PRO A C    1  
ATOM   124   O  O    . PRO A 1 12 ? 20.037  13.420  -24.166 1.00 0.00 ? 12  PRO A O    1  
ATOM   125   C  CB   . PRO A 1 12 ? 22.493  11.746  -24.570 1.00 0.00 ? 12  PRO A CB   1  
ATOM   126   C  CG   . PRO A 1 12 ? 23.207  11.728  -25.877 1.00 0.00 ? 12  PRO A CG   1  
ATOM   127   C  CD   . PRO A 1 12 ? 22.545  10.654  -26.696 1.00 0.00 ? 12  PRO A CD   1  
ATOM   128   H  HA   . PRO A 1 12 ? 20.630  10.777  -24.113 1.00 0.00 ? 12  PRO A HA   1  
ATOM   129   H  HB2  . PRO A 1 12 ? 22.518  12.728  -24.118 1.00 0.00 ? 12  PRO A HB2  1  
ATOM   130   H  HB3  . PRO A 1 12 ? 22.904  11.018  -23.886 1.00 0.00 ? 12  PRO A HB3  1  
ATOM   131   H  HG2  . PRO A 1 12 ? 23.106  12.686  -26.363 1.00 0.00 ? 12  PRO A HG2  1  
ATOM   132   H  HG3  . PRO A 1 12 ? 24.249  11.492  -25.722 1.00 0.00 ? 12  PRO A HG3  1  
ATOM   133   H  HD2  . PRO A 1 12 ? 22.533  10.929  -27.740 1.00 0.00 ? 12  PRO A HD2  1  
ATOM   134   H  HD3  . PRO A 1 12 ? 23.050  9.710   -26.558 1.00 0.00 ? 12  PRO A HD3  1  
ATOM   135   N  N    . ALA A 1 13 ? 19.675  12.811  -26.302 1.00 0.00 ? 13  ALA A N    1  
ATOM   136   C  CA   . ALA A 1 13 ? 18.847  13.971  -26.608 1.00 0.00 ? 13  ALA A CA   1  
ATOM   137   C  C    . ALA A 1 13 ? 18.025  14.394  -25.395 1.00 0.00 ? 13  ALA A C    1  
ATOM   138   O  O    . ALA A 1 13 ? 17.903  15.583  -25.098 1.00 0.00 ? 13  ALA A O    1  
ATOM   139   C  CB   . ALA A 1 13 ? 17.935  13.671  -27.788 1.00 0.00 ? 13  ALA A CB   1  
ATOM   140   H  H    . ALA A 1 13 ? 19.845  12.147  -27.002 1.00 0.00 ? 13  ALA A H    1  
ATOM   141   H  HA   . ALA A 1 13 ? 19.502  14.784  -26.887 1.00 0.00 ? 13  ALA A HA   1  
ATOM   142   H  HB1  . ALA A 1 13 ? 18.246  14.258  -28.640 1.00 0.00 ? 13  ALA A HB1  1  
ATOM   143   H  HB2  . ALA A 1 13 ? 17.995  12.621  -28.032 1.00 0.00 ? 13  ALA A HB2  1  
ATOM   144   H  HB3  . ALA A 1 13 ? 16.918  13.923  -27.529 1.00 0.00 ? 13  ALA A HB3  1  
ATOM   145   N  N    . THR A 1 14 ? 17.461  13.413  -24.697 1.00 0.00 ? 14  THR A N    1  
ATOM   146   C  CA   . THR A 1 14 ? 16.649  13.683  -23.517 1.00 0.00 ? 14  THR A CA   1  
ATOM   147   C  C    . THR A 1 14 ? 16.497  12.435  -22.656 1.00 0.00 ? 14  THR A C    1  
ATOM   148   O  O    . THR A 1 14 ? 16.168  11.359  -23.157 1.00 0.00 ? 14  THR A O    1  
ATOM   149   C  CB   . THR A 1 14 ? 15.250  14.199  -23.905 1.00 0.00 ? 14  THR A CB   1  
ATOM   150   O  OG1  . THR A 1 14 ? 15.365  15.236  -24.886 1.00 0.00 ? 14  THR A OG1  1  
ATOM   151   C  CG2  . THR A 1 14 ? 14.511  14.728  -22.685 1.00 0.00 ? 14  THR A CG2  1  
ATOM   152   H  H    . THR A 1 14 ? 17.595  12.485  -24.983 1.00 0.00 ? 14  THR A H    1  
ATOM   153   H  HA   . THR A 1 14 ? 17.145  14.450  -22.939 1.00 0.00 ? 14  THR A HA   1  
ATOM   154   H  HB   . THR A 1 14 ? 14.684  13.379  -24.323 1.00 0.00 ? 14  THR A HB   1  
ATOM   155   H  HG1  . THR A 1 14 ? 15.800  15.998  -24.497 1.00 0.00 ? 14  THR A HG1  1  
ATOM   156   H  HG21 . THR A 1 14 ? 15.182  15.331  -22.091 1.00 0.00 ? 14  THR A HG21 1  
ATOM   157   H  HG22 . THR A 1 14 ? 14.153  13.899  -22.094 1.00 0.00 ? 14  THR A HG22 1  
ATOM   158   H  HG23 . THR A 1 14 ? 13.675  15.331  -23.005 1.00 0.00 ? 14  THR A HG23 1  
ATOM   159   N  N    . HIS A 1 15 ? 16.739  12.584  -21.357 1.00 0.00 ? 15  HIS A N    1  
ATOM   160   C  CA   . HIS A 1 15 ? 16.627  11.468  -20.426 1.00 0.00 ? 15  HIS A CA   1  
ATOM   161   C  C    . HIS A 1 15 ? 15.165  11.110  -20.179 1.00 0.00 ? 15  HIS A C    1  
ATOM   162   O  O    . HIS A 1 15 ? 14.355  11.970  -19.833 1.00 0.00 ? 15  HIS A O    1  
ATOM   163   C  CB   . HIS A 1 15 ? 17.311  11.811  -19.102 1.00 0.00 ? 15  HIS A CB   1  
ATOM   164   C  CG   . HIS A 1 15 ? 16.996  10.848  -17.998 1.00 0.00 ? 15  HIS A CG   1  
ATOM   165   N  ND1  . HIS A 1 15 ? 16.654  11.249  -16.724 1.00 0.00 ? 15  HIS A ND1  1  
ATOM   166   C  CD2  . HIS A 1 15 ? 16.973  9.495   -17.984 1.00 0.00 ? 15  HIS A CD2  1  
ATOM   167   C  CE1  . HIS A 1 15 ? 16.434  10.184  -15.974 1.00 0.00 ? 15  HIS A CE1  1  
ATOM   168   N  NE2  . HIS A 1 15 ? 16.621  9.107   -16.715 1.00 0.00 ? 15  HIS A NE2  1  
ATOM   169   H  H    . HIS A 1 15 ? 16.998  13.466  -21.018 1.00 0.00 ? 15  HIS A H    1  
ATOM   170   H  HA   . HIS A 1 15 ? 17.123  10.617  -20.867 1.00 0.00 ? 15  HIS A HA   1  
ATOM   171   H  HB2  . HIS A 1 15 ? 18.381  11.811  -19.246 1.00 0.00 ? 15  HIS A HB2  1  
ATOM   172   H  HB3  . HIS A 1 15 ? 16.995  12.794  -18.785 1.00 0.00 ? 15  HIS A HB3  1  
ATOM   173   H  HD1  . HIS A 1 15 ? 16.584  12.176  -16.416 1.00 0.00 ? 15  HIS A HD1  1  
ATOM   174   H  HD2  . HIS A 1 15 ? 17.190  8.840   -18.817 1.00 0.00 ? 15  HIS A HD2  1  
ATOM   175   H  HE1  . HIS A 1 15 ? 16.151  10.192  -14.932 1.00 0.00 ? 15  HIS A HE1  1  
ATOM   176   N  N    . ARG A 1 16 ? 14.834  9.836   -20.360 1.00 0.00 ? 16  ARG A N    1  
ATOM   177   C  CA   . ARG A 1 16 ? 13.469  9.365   -20.159 1.00 0.00 ? 16  ARG A CA   1  
ATOM   178   C  C    . ARG A 1 16 ? 12.995  9.660   -18.739 1.00 0.00 ? 16  ARG A C    1  
ATOM   179   O  O    . ARG A 1 16 ? 13.789  9.783   -17.807 1.00 0.00 ? 16  ARG A O    1  
ATOM   180   C  CB   . ARG A 1 16 ? 13.378  7.863   -20.436 1.00 0.00 ? 16  ARG A CB   1  
ATOM   181   C  CG   . ARG A 1 16 ? 13.194  7.525   -21.907 1.00 0.00 ? 16  ARG A CG   1  
ATOM   182   C  CD   . ARG A 1 16 ? 12.627  6.126   -22.090 1.00 0.00 ? 16  ARG A CD   1  
ATOM   183   N  NE   . ARG A 1 16 ? 13.008  5.545   -23.374 1.00 0.00 ? 16  ARG A NE   1  
ATOM   184   C  CZ   . ARG A 1 16 ? 14.197  5.001   -23.612 1.00 0.00 ? 16  ARG A CZ   1  
ATOM   185   N  NH1  . ARG A 1 16 ? 15.115  4.965   -22.656 1.00 0.00 ? 16  ARG A NH1  1  
ATOM   186   N  NH2  . ARG A 1 16 ? 14.469  4.493   -24.807 1.00 0.00 ? 16  ARG A NH2  1  
ATOM   187   H  H    . ARG A 1 16 ? 15.524  9.197   -20.637 1.00 0.00 ? 16  ARG A H    1  
ATOM   188   H  HA   . ARG A 1 16 ? 12.831  9.889   -20.855 1.00 0.00 ? 16  ARG A HA   1  
ATOM   189   H  HB2  . ARG A 1 16 ? 14.286  7.390   -20.093 1.00 0.00 ? 16  ARG A HB2  1  
ATOM   190   H  HB3  . ARG A 1 16 ? 12.541  7.458   -19.888 1.00 0.00 ? 16  ARG A HB3  1  
ATOM   191   H  HG2  . ARG A 1 16 ? 12.512  8.237   -22.348 1.00 0.00 ? 16  ARG A HG2  1  
ATOM   192   H  HG3  . ARG A 1 16 ? 14.151  7.585   -22.403 1.00 0.00 ? 16  ARG A HG3  1  
ATOM   193   H  HD2  . ARG A 1 16 ? 12.999  5.495   -21.296 1.00 0.00 ? 16  ARG A HD2  1  
ATOM   194   H  HD3  . ARG A 1 16 ? 11.550  6.177   -22.033 1.00 0.00 ? 16  ARG A HD3  1  
ATOM   195   H  HE   . ARG A 1 16 ? 12.345  5.561   -24.094 1.00 0.00 ? 16  ARG A HE   1  
ATOM   196   H  HH11 . ARG A 1 16 ? 14.913  5.346   -21.754 1.00 0.00 ? 16  ARG A HH11 1  
ATOM   197   H  HH12 . ARG A 1 16 ? 16.010  4.554   -22.837 1.00 0.00 ? 16  ARG A HH12 1  
ATOM   198   H  HH21 . ARG A 1 16 ? 13.779  4.519   -25.529 1.00 0.00 ? 16  ARG A HH21 1  
ATOM   199   H  HH22 . ARG A 1 16 ? 15.364  4.085   -24.985 1.00 0.00 ? 16  ARG A HH22 1  
ATOM   200   N  N    . PRO A 1 17 ? 11.670  9.779   -18.570 1.00 0.00 ? 17  PRO A N    1  
ATOM   201   C  CA   . PRO A 1 17 ? 11.061  10.062  -17.267 1.00 0.00 ? 17  PRO A CA   1  
ATOM   202   C  C    . PRO A 1 17 ? 11.177  8.884   -16.305 1.00 0.00 ? 17  PRO A C    1  
ATOM   203   O  O    . PRO A 1 17 ? 10.955  7.734   -16.685 1.00 0.00 ? 17  PRO A O    1  
ATOM   204   C  CB   . PRO A 1 17 ? 9.593   10.328  -17.611 1.00 0.00 ? 17  PRO A CB   1  
ATOM   205   C  CG   . PRO A 1 17 ? 9.363   9.589   -18.885 1.00 0.00 ? 17  PRO A CG   1  
ATOM   206   C  CD   . PRO A 1 17 ? 10.664  9.646   -19.637 1.00 0.00 ? 17  PRO A CD   1  
ATOM   207   H  HA   . PRO A 1 17 ? 11.490  10.942  -16.811 1.00 0.00 ? 17  PRO A HA   1  
ATOM   208   H  HB2  . PRO A 1 17 ? 8.961   9.955   -16.818 1.00 0.00 ? 17  PRO A HB2  1  
ATOM   209   H  HB3  . PRO A 1 17 ? 9.435   11.388  -17.737 1.00 0.00 ? 17  PRO A HB3  1  
ATOM   210   H  HG2  . PRO A 1 17 ? 9.097   8.565   -18.672 1.00 0.00 ? 17  PRO A HG2  1  
ATOM   211   H  HG3  . PRO A 1 17 ? 8.581   10.071  -19.452 1.00 0.00 ? 17  PRO A HG3  1  
ATOM   212   H  HD2  . PRO A 1 17 ? 10.815  8.736   -20.198 1.00 0.00 ? 17  PRO A HD2  1  
ATOM   213   H  HD3  . PRO A 1 17 ? 10.683  10.504  -20.293 1.00 0.00 ? 17  PRO A HD3  1  
ATOM   214   N  N    . HIS A 1 18 ? 11.526  9.179   -15.056 1.00 0.00 ? 18  HIS A N    1  
ATOM   215   C  CA   . HIS A 1 18 ? 11.670  8.143   -14.039 1.00 0.00 ? 18  HIS A CA   1  
ATOM   216   C  C    . HIS A 1 18 ? 10.408  8.036   -13.189 1.00 0.00 ? 18  HIS A C    1  
ATOM   217   O  O    . HIS A 1 18 ? 9.681   9.009   -12.989 1.00 0.00 ? 18  HIS A O    1  
ATOM   218   C  CB   . HIS A 1 18 ? 12.876  8.441   -13.146 1.00 0.00 ? 18  HIS A CB   1  
ATOM   219   C  CG   . HIS A 1 18 ? 12.727  9.691   -12.336 1.00 0.00 ? 18  HIS A CG   1  
ATOM   220   N  ND1  . HIS A 1 18 ? 13.489  10.821  -12.548 1.00 0.00 ? 18  HIS A ND1  1  
ATOM   221   C  CD2  . HIS A 1 18 ? 11.896  9.987   -11.309 1.00 0.00 ? 18  HIS A CD2  1  
ATOM   222   C  CE1  . HIS A 1 18 ? 13.135  11.756  -11.685 1.00 0.00 ? 18  HIS A CE1  1  
ATOM   223   N  NE2  . HIS A 1 18 ? 12.169  11.276  -10.922 1.00 0.00 ? 18  HIS A NE2  1  
ATOM   224   H  H    . HIS A 1 18 ? 11.689  10.114  -14.813 1.00 0.00 ? 18  HIS A H    1  
ATOM   225   H  HA   . HIS A 1 18 ? 11.831  7.203   -14.543 1.00 0.00 ? 18  HIS A HA   1  
ATOM   226   H  HB2  . HIS A 1 18 ? 13.020  7.618   -12.462 1.00 0.00 ? 18  HIS A HB2  1  
ATOM   227   H  HB3  . HIS A 1 18 ? 13.756  8.548   -13.765 1.00 0.00 ? 18  HIS A HB3  1  
ATOM   228   H  HD1  . HIS A 1 18 ? 14.187  10.921  -13.228 1.00 0.00 ? 18  HIS A HD1  1  
ATOM   229   H  HD2  . HIS A 1 18 ? 11.155  9.331   -10.873 1.00 0.00 ? 18  HIS A HD2  1  
ATOM   230   H  HE1  . HIS A 1 18 ? 13.560  12.746  -11.615 1.00 0.00 ? 18  HIS A HE1  1  
ATOM   231   N  N    . PRO A 1 19 ? 10.139  6.826   -12.678 1.00 0.00 ? 19  PRO A N    1  
ATOM   232   C  CA   . PRO A 1 19 ? 8.963   6.563   -11.842 1.00 0.00 ? 19  PRO A CA   1  
ATOM   233   C  C    . PRO A 1 19 ? 9.065   7.226   -10.473 1.00 0.00 ? 19  PRO A C    1  
ATOM   234   O  O    . PRO A 1 19 ? 10.159  7.548   -10.007 1.00 0.00 ? 19  PRO A O    1  
ATOM   235   C  CB   . PRO A 1 19 ? 8.963   5.039   -11.699 1.00 0.00 ? 19  PRO A CB   1  
ATOM   236   C  CG   . PRO A 1 19 ? 10.386  4.641   -11.891 1.00 0.00 ? 19  PRO A CG   1  
ATOM   237   C  CD   . PRO A 1 19 ? 10.961  5.621   -12.876 1.00 0.00 ? 19  PRO A CD   1  
ATOM   238   H  HA   . PRO A 1 19 ? 8.052   6.880   -12.328 1.00 0.00 ? 19  PRO A HA   1  
ATOM   239   H  HB2  . PRO A 1 19 ? 8.605   4.767   -10.716 1.00 0.00 ? 19  PRO A HB2  1  
ATOM   240   H  HB3  . PRO A 1 19 ? 8.326   4.603   -12.454 1.00 0.00 ? 19  PRO A HB3  1  
ATOM   241   H  HG2  . PRO A 1 19 ? 10.914  4.699   -10.952 1.00 0.00 ? 19  PRO A HG2  1  
ATOM   242   H  HG3  . PRO A 1 19 ? 10.436  3.638   -12.289 1.00 0.00 ? 19  PRO A HG3  1  
ATOM   243   H  HD2  . PRO A 1 19 ? 11.998  5.820   -12.649 1.00 0.00 ? 19  PRO A HD2  1  
ATOM   244   H  HD3  . PRO A 1 19 ? 10.859  5.246   -13.884 1.00 0.00 ? 19  PRO A HD3  1  
ATOM   245   N  N    . THR A 1 20 ? 7.919   7.429   -9.832  1.00 0.00 ? 20  THR A N    1  
ATOM   246   C  CA   . THR A 1 20 ? 7.879   8.055   -8.516  1.00 0.00 ? 20  THR A CA   1  
ATOM   247   C  C    . THR A 1 20 ? 8.024   7.017   -7.409  1.00 0.00 ? 20  THR A C    1  
ATOM   248   O  O    . THR A 1 20 ? 8.637   7.281   -6.375  1.00 0.00 ? 20  THR A O    1  
ATOM   249   C  CB   . THR A 1 20 ? 6.568   8.835   -8.304  1.00 0.00 ? 20  THR A CB   1  
ATOM   250   O  OG1  . THR A 1 20 ? 6.443   9.219   -6.931  1.00 0.00 ? 20  THR A OG1  1  
ATOM   251   C  CG2  . THR A 1 20 ? 5.367   7.995   -8.713  1.00 0.00 ? 20  THR A CG2  1  
ATOM   252   H  H    . THR A 1 20 ? 7.080   7.151   -10.255 1.00 0.00 ? 20  THR A H    1  
ATOM   253   H  HA   . THR A 1 20 ? 8.702   8.752   -8.454  1.00 0.00 ? 20  THR A HA   1  
ATOM   254   H  HB   . THR A 1 20 ? 6.592   9.724   -8.918  1.00 0.00 ? 20  THR A HB   1  
ATOM   255   H  HG1  . THR A 1 20 ? 5.771   9.901   -6.849  1.00 0.00 ? 20  THR A HG1  1  
ATOM   256   H  HG21 . THR A 1 20 ? 4.488   8.345   -8.191  1.00 0.00 ? 20  THR A HG21 1  
ATOM   257   H  HG22 . THR A 1 20 ? 5.547   6.961   -8.459  1.00 0.00 ? 20  THR A HG22 1  
ATOM   258   H  HG23 . THR A 1 20 ? 5.212   8.083   -9.777  1.00 0.00 ? 20  THR A HG23 1  
ATOM   259   N  N    . SER A 1 21 ? 7.458   5.836   -7.633  1.00 0.00 ? 21  SER A N    1  
ATOM   260   C  CA   . SER A 1 21 ? 7.522   4.759   -6.653  1.00 0.00 ? 21  SER A CA   1  
ATOM   261   C  C    . SER A 1 21 ? 6.920   3.475   -7.216  1.00 0.00 ? 21  SER A C    1  
ATOM   262   O  O    . SER A 1 21 ? 5.752   3.442   -7.604  1.00 0.00 ? 21  SER A O    1  
ATOM   263   C  CB   . SER A 1 21 ? 6.787   5.161   -5.373  1.00 0.00 ? 21  SER A CB   1  
ATOM   264   O  OG   . SER A 1 21 ? 7.234   4.397   -4.266  1.00 0.00 ? 21  SER A OG   1  
ATOM   265   H  H    . SER A 1 21 ? 6.983   5.686   -8.478  1.00 0.00 ? 21  SER A H    1  
ATOM   266   H  HA   . SER A 1 21 ? 8.562   4.583   -6.421  1.00 0.00 ? 21  SER A HA   1  
ATOM   267   H  HB2  . SER A 1 21 ? 6.968   6.206   -5.170  1.00 0.00 ? 21  SER A HB2  1  
ATOM   268   H  HB3  . SER A 1 21 ? 5.727   4.999   -5.503  1.00 0.00 ? 21  SER A HB3  1  
ATOM   269   H  HG   . SER A 1 21 ? 7.622   4.981   -3.610  1.00 0.00 ? 21  SER A HG   1  
ATOM   270   N  N    . ILE A 1 22 ? 7.726   2.419   -7.256  1.00 0.00 ? 22  ILE A N    1  
ATOM   271   C  CA   . ILE A 1 22 ? 7.273   1.132   -7.770  1.00 0.00 ? 22  ILE A CA   1  
ATOM   272   C  C    . ILE A 1 22 ? 6.618   0.302   -6.672  1.00 0.00 ? 22  ILE A C    1  
ATOM   273   O  O    . ILE A 1 22 ? 6.996   0.388   -5.503  1.00 0.00 ? 22  ILE A O    1  
ATOM   274   C  CB   . ILE A 1 22 ? 8.437   0.329   -8.380  1.00 0.00 ? 22  ILE A CB   1  
ATOM   275   C  CG1  . ILE A 1 22 ? 8.837   0.919   -9.734  1.00 0.00 ? 22  ILE A CG1  1  
ATOM   276   C  CG2  . ILE A 1 22 ? 8.051   -1.135  -8.527  1.00 0.00 ? 22  ILE A CG2  1  
ATOM   277   C  CD1  . ILE A 1 22 ? 9.663   2.182   -9.624  1.00 0.00 ? 22  ILE A CD1  1  
ATOM   278   H  H    . ILE A 1 22 ? 8.646   2.508   -6.932  1.00 0.00 ? 22  ILE A H    1  
ATOM   279   H  HA   . ILE A 1 22 ? 6.546   1.321   -8.547  1.00 0.00 ? 22  ILE A HA   1  
ATOM   280   H  HB   . ILE A 1 22 ? 9.278   0.389   -7.707  1.00 0.00 ? 22  ILE A HB   1  
ATOM   281   H  HG12 . ILE A 1 22 ? 9.418   0.191   -10.279 1.00 0.00 ? 22  ILE A HG12 1  
ATOM   282   H  HG13 . ILE A 1 22 ? 7.944   1.153   -10.295 1.00 0.00 ? 22  ILE A HG13 1  
ATOM   283   H  HG21 . ILE A 1 22 ? 7.015   -1.205  -8.827  1.00 0.00 ? 22  ILE A HG21 1  
ATOM   284   H  HG22 . ILE A 1 22 ? 8.674   -1.598  -9.278  1.00 0.00 ? 22  ILE A HG22 1  
ATOM   285   H  HG23 . ILE A 1 22 ? 8.188   -1.640  -7.583  1.00 0.00 ? 22  ILE A HG23 1  
ATOM   286   H  HD11 . ILE A 1 22 ? 10.671  1.929   -9.331  1.00 0.00 ? 22  ILE A HD11 1  
ATOM   287   H  HD12 . ILE A 1 22 ? 9.679   2.686   -10.578 1.00 0.00 ? 22  ILE A HD12 1  
ATOM   288   H  HD13 . ILE A 1 22 ? 9.225   2.833   -8.880  1.00 0.00 ? 22  ILE A HD13 1  
ATOM   289   N  N    . CYS A 1 23 ? 5.634   -0.505  -7.056  1.00 0.00 ? 23  CYS A N    1  
ATOM   290   C  CA   . CYS A 1 23 ? 4.926   -1.354  -6.106  1.00 0.00 ? 23  CYS A CA   1  
ATOM   291   C  C    . CYS A 1 23 ? 5.857   -2.413  -5.523  1.00 0.00 ? 23  CYS A C    1  
ATOM   292   O  O    . CYS A 1 23 ? 7.015   -2.524  -5.924  1.00 0.00 ? 23  CYS A O    1  
ATOM   293   C  CB   . CYS A 1 23 ? 3.730   -2.027  -6.783  1.00 0.00 ? 23  CYS A CB   1  
ATOM   294   S  SG   . CYS A 1 23 ? 2.384   -2.475  -5.642  1.00 0.00 ? 23  CYS A SG   1  
ATOM   295   H  H    . CYS A 1 23 ? 5.378   -0.530  -8.003  1.00 0.00 ? 23  CYS A H    1  
ATOM   296   H  HA   . CYS A 1 23 ? 4.567   -0.727  -5.304  1.00 0.00 ? 23  CYS A HA   1  
ATOM   297   H  HB2  . CYS A 1 23 ? 3.322   -1.355  -7.524  1.00 0.00 ? 23  CYS A HB2  1  
ATOM   298   H  HB3  . CYS A 1 23 ? 4.065   -2.931  -7.270  1.00 0.00 ? 23  CYS A HB3  1  
ATOM   299   N  N    . ASP A 1 24 ? 5.342   -3.188  -4.575  1.00 0.00 ? 24  ASP A N    1  
ATOM   300   C  CA   . ASP A 1 24 ? 6.126   -4.239  -3.937  1.00 0.00 ? 24  ASP A CA   1  
ATOM   301   C  C    . ASP A 1 24 ? 5.708   -5.615  -4.448  1.00 0.00 ? 24  ASP A C    1  
ATOM   302   O  O    . ASP A 1 24 ? 6.513   -6.543  -4.489  1.00 0.00 ? 24  ASP A O    1  
ATOM   303   C  CB   . ASP A 1 24 ? 5.965   -4.175  -2.418  1.00 0.00 ? 24  ASP A CB   1  
ATOM   304   C  CG   . ASP A 1 24 ? 6.667   -5.318  -1.712  1.00 0.00 ? 24  ASP A CG   1  
ATOM   305   O  OD1  . ASP A 1 24 ? 6.427   -6.485  -2.089  1.00 0.00 ? 24  ASP A OD1  1  
ATOM   306   O  OD2  . ASP A 1 24 ? 7.456   -5.047  -0.783  1.00 0.00 ? 24  ASP A OD2  1  
ATOM   307   H  H    . ASP A 1 24 ? 4.412   -3.050  -4.297  1.00 0.00 ? 24  ASP A H    1  
ATOM   308   H  HA   . ASP A 1 24 ? 7.164   -4.077  -4.187  1.00 0.00 ? 24  ASP A HA   1  
ATOM   309   H  HB2  . ASP A 1 24 ? 6.380   -3.245  -2.057  1.00 0.00 ? 24  ASP A HB2  1  
ATOM   310   H  HB3  . ASP A 1 24 ? 4.914   -4.214  -2.172  1.00 0.00 ? 24  ASP A HB3  1  
ATOM   311   N  N    . ASN A 1 25 ? 4.442   -5.737  -4.835  1.00 0.00 ? 25  ASN A N    1  
ATOM   312   C  CA   . ASN A 1 25 ? 3.916   -6.999  -5.341  1.00 0.00 ? 25  ASN A CA   1  
ATOM   313   C  C    . ASN A 1 25 ? 4.194   -7.145  -6.834  1.00 0.00 ? 25  ASN A C    1  
ATOM   314   O  O    . ASN A 1 25 ? 4.970   -8.005  -7.251  1.00 0.00 ? 25  ASN A O    1  
ATOM   315   C  CB   . ASN A 1 25 ? 2.411   -7.090  -5.080  1.00 0.00 ? 25  ASN A CB   1  
ATOM   316   C  CG   . ASN A 1 25 ? 2.096   -7.552  -3.670  1.00 0.00 ? 25  ASN A CG   1  
ATOM   317   O  OD1  . ASN A 1 25 ? 2.391   -8.687  -3.296  1.00 0.00 ? 25  ASN A OD1  1  
ATOM   318   N  ND2  . ASN A 1 25 ? 1.492   -6.671  -2.880  1.00 0.00 ? 25  ASN A ND2  1  
ATOM   319   H  H    . ASN A 1 25 ? 3.847   -4.960  -4.778  1.00 0.00 ? 25  ASN A H    1  
ATOM   320   H  HA   . ASN A 1 25 ? 4.413   -7.800  -4.814  1.00 0.00 ? 25  ASN A HA   1  
ATOM   321   H  HB2  . ASN A 1 25 ? 1.967   -6.116  -5.227  1.00 0.00 ? 25  ASN A HB2  1  
ATOM   322   H  HB3  . ASN A 1 25 ? 1.972   -7.790  -5.775  1.00 0.00 ? 25  ASN A HB3  1  
ATOM   323   H  HD21 . ASN A 1 25 ? 1.287   -5.785  -3.246  1.00 0.00 ? 25  ASN A HD21 1  
ATOM   324   H  HD22 . ASN A 1 25 ? 1.277   -6.943  -1.964  1.00 0.00 ? 25  ASN A HD22 1  
ATOM   325   N  N    . PHE A 1 26 ? 3.555   -6.298  -7.635  1.00 0.00 ? 26  PHE A N    1  
ATOM   326   C  CA   . PHE A 1 26 ? 3.733   -6.332  -9.081  1.00 0.00 ? 26  PHE A CA   1  
ATOM   327   C  C    . PHE A 1 26 ? 5.207   -6.195  -9.452  1.00 0.00 ? 26  PHE A C    1  
ATOM   328   O  O    . PHE A 1 26 ? 5.642   -6.672  -10.500 1.00 0.00 ? 26  PHE A O    1  
ATOM   329   C  CB   . PHE A 1 26 ? 2.923   -5.214  -9.742  1.00 0.00 ? 26  PHE A CB   1  
ATOM   330   C  CG   . PHE A 1 26 ? 2.453   -5.554  -11.128 1.00 0.00 ? 26  PHE A CG   1  
ATOM   331   C  CD1  . PHE A 1 26 ? 3.324   -5.495  -12.204 1.00 0.00 ? 26  PHE A CD1  1  
ATOM   332   C  CD2  . PHE A 1 26 ? 1.139   -5.933  -11.354 1.00 0.00 ? 26  PHE A CD2  1  
ATOM   333   C  CE1  . PHE A 1 26 ? 2.893   -5.806  -13.479 1.00 0.00 ? 26  PHE A CE1  1  
ATOM   334   C  CE2  . PHE A 1 26 ? 0.703   -6.246  -12.628 1.00 0.00 ? 26  PHE A CE2  1  
ATOM   335   C  CZ   . PHE A 1 26 ? 1.581   -6.183  -13.692 1.00 0.00 ? 26  PHE A CZ   1  
ATOM   336   H  H    . PHE A 1 26 ? 2.949   -5.635  -7.242  1.00 0.00 ? 26  PHE A H    1  
ATOM   337   H  HA   . PHE A 1 26 ? 3.372   -7.285  -9.437  1.00 0.00 ? 26  PHE A HA   1  
ATOM   338   H  HB2  . PHE A 1 26 ? 2.053   -5.005  -9.139  1.00 0.00 ? 26  PHE A HB2  1  
ATOM   339   H  HB3  . PHE A 1 26 ? 3.535   -4.327  -9.807  1.00 0.00 ? 26  PHE A HB3  1  
ATOM   340   H  HD1  . PHE A 1 26 ? 4.350   -5.201  -12.039 1.00 0.00 ? 26  PHE A HD1  1  
ATOM   341   H  HD2  . PHE A 1 26 ? 0.451   -5.982  -10.522 1.00 0.00 ? 26  PHE A HD2  1  
ATOM   342   H  HE1  . PHE A 1 26 ? 3.582   -5.757  -14.310 1.00 0.00 ? 26  PHE A HE1  1  
ATOM   343   H  HE2  . PHE A 1 26 ? -0.323  -6.540  -12.790 1.00 0.00 ? 26  PHE A HE2  1  
ATOM   344   H  HZ   . PHE A 1 26 ? 1.242   -6.427  -14.687 1.00 0.00 ? 26  PHE A HZ   1  
ATOM   345   N  N    . SER A 1 27 ? 5.971   -5.540  -8.583  1.00 0.00 ? 27  SER A N    1  
ATOM   346   C  CA   . SER A 1 27 ? 7.395   -5.336  -8.820  1.00 0.00 ? 27  SER A CA   1  
ATOM   347   C  C    . SER A 1 27 ? 8.082   -6.653  -9.167  1.00 0.00 ? 27  SER A C    1  
ATOM   348   O  O    . SER A 1 27 ? 8.587   -6.828  -10.276 1.00 0.00 ? 27  SER A O    1  
ATOM   349   C  CB   . SER A 1 27 ? 8.054   -4.713  -7.587  1.00 0.00 ? 27  SER A CB   1  
ATOM   350   O  OG   . SER A 1 27 ? 9.448   -4.969  -7.571  1.00 0.00 ? 27  SER A OG   1  
ATOM   351   H  H    . SER A 1 27 ? 5.565   -5.183  -7.765  1.00 0.00 ? 27  SER A H    1  
ATOM   352   H  HA   . SER A 1 27 ? 7.498   -4.658  -9.654  1.00 0.00 ? 27  SER A HA   1  
ATOM   353   H  HB2  . SER A 1 27 ? 7.896   -3.645  -7.599  1.00 0.00 ? 27  SER A HB2  1  
ATOM   354   H  HB3  . SER A 1 27 ? 7.612   -5.133  -6.695  1.00 0.00 ? 27  SER A HB3  1  
ATOM   355   H  HG   . SER A 1 27 ? 9.909   -4.261  -8.027  1.00 0.00 ? 27  SER A HG   1  
ATOM   356   N  N    . ALA A 1 28 ? 8.097   -7.575  -8.211  1.00 0.00 ? 28  ALA A N    1  
ATOM   357   C  CA   . ALA A 1 28 ? 8.720   -8.877  -8.416  1.00 0.00 ? 28  ALA A CA   1  
ATOM   358   C  C    . ALA A 1 28 ? 7.682   -9.930  -8.789  1.00 0.00 ? 28  ALA A C    1  
ATOM   359   O  O    . ALA A 1 28 ? 7.750   -10.531 -9.862  1.00 0.00 ? 28  ALA A O    1  
ATOM   360   C  CB   . ALA A 1 28 ? 9.478   -9.301  -7.167  1.00 0.00 ? 28  ALA A CB   1  
ATOM   361   H  H    . ALA A 1 28 ? 7.677   -7.377  -7.349  1.00 0.00 ? 28  ALA A H    1  
ATOM   362   H  HA   . ALA A 1 28 ? 9.430   -8.784  -9.225  1.00 0.00 ? 28  ALA A HA   1  
ATOM   363   H  HB1  . ALA A 1 28 ? 9.095   -8.761  -6.313  1.00 0.00 ? 28  ALA A HB1  1  
ATOM   364   H  HB2  . ALA A 1 28 ? 9.349   -10.362 -7.010  1.00 0.00 ? 28  ALA A HB2  1  
ATOM   365   H  HB3  . ALA A 1 28 ? 10.528  -9.080  -7.291  1.00 0.00 ? 28  ALA A HB3  1  
ATOM   366   N  N    . TYR A 1 29 ? 6.721   -10.149 -7.898  1.00 0.00 ? 29  TYR A N    1  
ATOM   367   C  CA   . TYR A 1 29 ? 5.671   -11.133 -8.133  1.00 0.00 ? 29  TYR A CA   1  
ATOM   368   C  C    . TYR A 1 29 ? 5.076   -10.972 -9.529  1.00 0.00 ? 29  TYR A C    1  
ATOM   369   O  O    . TYR A 1 29 ? 5.011   -11.926 -10.302 1.00 0.00 ? 29  TYR A O    1  
ATOM   370   C  CB   . TYR A 1 29 ? 4.570   -10.996 -7.079  1.00 0.00 ? 29  TYR A CB   1  
ATOM   371   C  CG   . TYR A 1 29 ? 5.072   -11.130 -5.659  1.00 0.00 ? 29  TYR A CG   1  
ATOM   372   C  CD1  . TYR A 1 29 ? 5.654   -10.054 -5.002  1.00 0.00 ? 29  TYR A CD1  1  
ATOM   373   C  CD2  . TYR A 1 29 ? 4.962   -12.334 -4.974  1.00 0.00 ? 29  TYR A CD2  1  
ATOM   374   C  CE1  . TYR A 1 29 ? 6.115   -10.172 -3.705  1.00 0.00 ? 29  TYR A CE1  1  
ATOM   375   C  CE2  . TYR A 1 29 ? 5.418   -12.461 -3.676  1.00 0.00 ? 29  TYR A CE2  1  
ATOM   376   C  CZ   . TYR A 1 29 ? 5.994   -11.378 -3.046  1.00 0.00 ? 29  TYR A CZ   1  
ATOM   377   O  OH   . TYR A 1 29 ? 6.450   -11.500 -1.753  1.00 0.00 ? 29  TYR A OH   1  
ATOM   378   H  H    . TYR A 1 29 ? 6.720   -9.640  -7.061  1.00 0.00 ? 29  TYR A H    1  
ATOM   379   H  HA   . TYR A 1 29 ? 6.112   -12.115 -8.053  1.00 0.00 ? 29  TYR A HA   1  
ATOM   380   H  HB2  . TYR A 1 29 ? 4.107   -10.026 -7.176  1.00 0.00 ? 29  TYR A HB2  1  
ATOM   381   H  HB3  . TYR A 1 29 ? 3.827   -11.762 -7.243  1.00 0.00 ? 29  TYR A HB3  1  
ATOM   382   H  HD1  . TYR A 1 29 ? 5.747   -9.110  -5.521  1.00 0.00 ? 29  TYR A HD1  1  
ATOM   383   H  HD2  . TYR A 1 29 ? 4.510   -13.181 -5.470  1.00 0.00 ? 29  TYR A HD2  1  
ATOM   384   H  HE1  . TYR A 1 29 ? 6.565   -9.324  -3.211  1.00 0.00 ? 29  TYR A HE1  1  
ATOM   385   H  HE2  . TYR A 1 29 ? 5.324   -13.406 -3.160  1.00 0.00 ? 29  TYR A HE2  1  
ATOM   386   H  HH   . TYR A 1 29 ? 6.798   -10.656 -1.456  1.00 0.00 ? 29  TYR A HH   1  
ATOM   387   N  N    . GLY A 1 30 ? 4.644   -9.754  -9.844  1.00 0.00 ? 30  GLY A N    1  
ATOM   388   C  CA   . GLY A 1 30 ? 4.061   -9.489  -11.146 1.00 0.00 ? 30  GLY A CA   1  
ATOM   389   C  C    . GLY A 1 30 ? 2.593   -9.118  -11.060 1.00 0.00 ? 30  GLY A C    1  
ATOM   390   O  O    . GLY A 1 30 ? 2.070   -8.423  -11.930 1.00 0.00 ? 30  GLY A O    1  
ATOM   391   H  H    . GLY A 1 30 ? 4.721   -9.031  -9.187  1.00 0.00 ? 30  GLY A H    1  
ATOM   392   H  HA2  . GLY A 1 30 ? 4.600   -8.677  -11.611 1.00 0.00 ? 30  GLY A HA2  1  
ATOM   393   H  HA3  . GLY A 1 30 ? 4.161   -10.372 -11.760 1.00 0.00 ? 30  GLY A HA3  1  
ATOM   394   N  N    . TRP A 1 31 ? 1.928   -9.584  -10.009 1.00 0.00 ? 31  TRP A N    1  
ATOM   395   C  CA   . TRP A 1 31 ? 0.512   -9.298  -9.813  1.00 0.00 ? 31  TRP A CA   1  
ATOM   396   C  C    . TRP A 1 31 ? 0.305   -8.345  -8.642  1.00 0.00 ? 31  TRP A C    1  
ATOM   397   O  O    . TRP A 1 31 ? 1.169   -8.215  -7.774  1.00 0.00 ? 31  TRP A O    1  
ATOM   398   C  CB   . TRP A 1 31 ? -0.263  -10.595 -9.574  1.00 0.00 ? 31  TRP A CB   1  
ATOM   399   C  CG   . TRP A 1 31 ? -0.369  -10.965 -8.125  1.00 0.00 ? 31  TRP A CG   1  
ATOM   400   C  CD1  . TRP A 1 31 ? 0.568   -11.617 -7.375  1.00 0.00 ? 31  TRP A CD1  1  
ATOM   401   C  CD2  . TRP A 1 31 ? -1.474  -10.706 -7.253  1.00 0.00 ? 31  TRP A CD2  1  
ATOM   402   N  NE1  . TRP A 1 31 ? 0.112   -11.779 -6.090  1.00 0.00 ? 31  TRP A NE1  1  
ATOM   403   C  CE2  . TRP A 1 31 ? -1.138  -11.229 -5.989  1.00 0.00 ? 31  TRP A CE2  1  
ATOM   404   C  CE3  . TRP A 1 31 ? -2.714  -10.083 -7.417  1.00 0.00 ? 31  TRP A CE3  1  
ATOM   405   C  CZ2  . TRP A 1 31 ? -1.999  -11.146 -4.897  1.00 0.00 ? 31  TRP A CZ2  1  
ATOM   406   C  CZ3  . TRP A 1 31 ? -3.567  -10.002 -6.333  1.00 0.00 ? 31  TRP A CZ3  1  
ATOM   407   C  CH2  . TRP A 1 31 ? -3.206  -10.530 -5.086  1.00 0.00 ? 31  TRP A CH2  1  
ATOM   408   H  H    . TRP A 1 31 ? 2.401   -10.133 -9.348  1.00 0.00 ? 31  TRP A H    1  
ATOM   409   H  HA   . TRP A 1 31 ? 0.142   -8.830  -10.713 1.00 0.00 ? 31  TRP A HA   1  
ATOM   410   H  HB2  . TRP A 1 31 ? -1.264  -10.487 -9.964  1.00 0.00 ? 31  TRP A HB2  1  
ATOM   411   H  HB3  . TRP A 1 31 ? 0.235   -11.404 -10.090 1.00 0.00 ? 31  TRP A HB3  1  
ATOM   412   H  HD1  . TRP A 1 31 ? 1.523   -11.952 -7.752  1.00 0.00 ? 31  TRP A HD1  1  
ATOM   413   H  HE1  . TRP A 1 31 ? 0.603   -12.217 -5.363  1.00 0.00 ? 31  TRP A HE1  1  
ATOM   414   H  HE3  . TRP A 1 31 ? -3.010  -9.669  -8.370  1.00 0.00 ? 31  TRP A HE3  1  
ATOM   415   H  HZ2  . TRP A 1 31 ? -1.735  -11.548 -3.930  1.00 0.00 ? 31  TRP A HZ2  1  
ATOM   416   H  HZ3  . TRP A 1 31 ? -4.530  -9.524  -6.440  1.00 0.00 ? 31  TRP A HZ3  1  
ATOM   417   H  HH2  . TRP A 1 31 ? -3.904  -10.444 -4.267  1.00 0.00 ? 31  TRP A HH2  1  
ATOM   418   N  N    . CYS A 1 32 ? -0.845  -7.679  -8.622  1.00 0.00 ? 32  CYS A N    1  
ATOM   419   C  CA   . CYS A 1 32 ? -1.165  -6.736  -7.557  1.00 0.00 ? 32  CYS A CA   1  
ATOM   420   C  C    . CYS A 1 32 ? -2.661  -6.744  -7.255  1.00 0.00 ? 32  CYS A C    1  
ATOM   421   O  O    . CYS A 1 32 ? -3.501  -6.730  -8.155  1.00 0.00 ? 32  CYS A O    1  
ATOM   422   C  CB   . CYS A 1 32 ? -0.719  -5.325  -7.945  1.00 0.00 ? 32  CYS A CB   1  
ATOM   423   S  SG   . CYS A 1 32 ? -0.973  -4.080  -6.639  1.00 0.00 ? 32  CYS A SG   1  
ATOM   424   H  H    . CYS A 1 32 ? -1.494  -7.824  -9.342  1.00 0.00 ? 32  CYS A H    1  
ATOM   425   H  HA   . CYS A 1 32 ? -0.630  -7.043  -6.671  1.00 0.00 ? 32  CYS A HA   1  
ATOM   426   H  HB2  . CYS A 1 32 ? 0.335   -5.341  -8.181  1.00 0.00 ? 32  CYS A HB2  1  
ATOM   427   H  HB3  . CYS A 1 32 ? -1.273  -5.007  -8.815  1.00 0.00 ? 32  CYS A HB3  1  
ATOM   428   N  N    . PRO A 1 33 ? -3.003  -6.768  -5.958  1.00 0.00 ? 33  PRO A N    1  
ATOM   429   C  CA   . PRO A 1 33 ? -4.397  -6.777  -5.507  1.00 0.00 ? 33  PRO A CA   1  
ATOM   430   C  C    . PRO A 1 33 ? -5.100  -5.450  -5.770  1.00 0.00 ? 33  PRO A C    1  
ATOM   431   O  O    . PRO A 1 33 ? -6.299  -5.310  -5.522  1.00 0.00 ? 33  PRO A O    1  
ATOM   432   C  CB   . PRO A 1 33 ? -4.282  -7.033  -4.002  1.00 0.00 ? 33  PRO A CB   1  
ATOM   433   C  CG   . PRO A 1 33 ? -2.928  -6.531  -3.636  1.00 0.00 ? 33  PRO A CG   1  
ATOM   434   C  CD   . PRO A 1 33 ? -2.054  -6.786  -4.832  1.00 0.00 ? 33  PRO A CD   1  
ATOM   435   H  HA   . PRO A 1 33 ? -4.958  -7.577  -5.968  1.00 0.00 ? 33  PRO A HA   1  
ATOM   436   H  HB2  . PRO A 1 33 ? -5.059  -6.491  -3.482  1.00 0.00 ? 33  PRO A HB2  1  
ATOM   437   H  HB3  . PRO A 1 33 ? -4.378  -8.090  -3.805  1.00 0.00 ? 33  PRO A HB3  1  
ATOM   438   H  HG2  . PRO A 1 33 ? -2.973  -5.474  -3.423  1.00 0.00 ? 33  PRO A HG2  1  
ATOM   439   H  HG3  . PRO A 1 33 ? -2.556  -7.072  -2.778  1.00 0.00 ? 33  PRO A HG3  1  
ATOM   440   H  HD2  . PRO A 1 33 ? -1.317  -6.003  -4.936  1.00 0.00 ? 33  PRO A HD2  1  
ATOM   441   H  HD3  . PRO A 1 33 ? -1.573  -7.750  -4.750  1.00 0.00 ? 33  PRO A HD3  1  
ATOM   442   N  N    . LEU A 1 34 ? -4.349  -4.477  -6.273  1.00 0.00 ? 34  LEU A N    1  
ATOM   443   C  CA   . LEU A 1 34 ? -4.900  -3.159  -6.570  1.00 0.00 ? 34  LEU A CA   1  
ATOM   444   C  C    . LEU A 1 34 ? -5.041  -2.954  -8.075  1.00 0.00 ? 34  LEU A C    1  
ATOM   445   O  O    . LEU A 1 34 ? -5.686  -2.009  -8.525  1.00 0.00 ? 34  LEU A O    1  
ATOM   446   C  CB   . LEU A 1 34 ? -4.011  -2.066  -5.975  1.00 0.00 ? 34  LEU A CB   1  
ATOM   447   C  CG   . LEU A 1 34 ? -4.181  -1.802  -4.479  1.00 0.00 ? 34  LEU A CG   1  
ATOM   448   C  CD1  . LEU A 1 34 ? -3.298  -0.645  -4.037  1.00 0.00 ? 34  LEU A CD1  1  
ATOM   449   C  CD2  . LEU A 1 34 ? -5.639  -1.519  -4.149  1.00 0.00 ? 34  LEU A CD2  1  
ATOM   450   H  H    . LEU A 1 34 ? -3.400  -4.647  -6.449  1.00 0.00 ? 34  LEU A H    1  
ATOM   451   H  HA   . LEU A 1 34 ? -5.879  -3.101  -6.118  1.00 0.00 ? 34  LEU A HA   1  
ATOM   452   H  HB2  . LEU A 1 34 ? -2.983  -2.347  -6.147  1.00 0.00 ? 34  LEU A HB2  1  
ATOM   453   H  HB3  . LEU A 1 34 ? -4.223  -1.146  -6.501  1.00 0.00 ? 34  LEU A HB3  1  
ATOM   454   H  HG   . LEU A 1 34 ? -3.877  -2.682  -3.928  1.00 0.00 ? 34  LEU A HG   1  
ATOM   455   H  HD11 . LEU A 1 34 ? -3.874  0.268   -4.043  1.00 0.00 ? 34  LEU A HD11 1  
ATOM   456   H  HD12 . LEU A 1 34 ? -2.464  -0.549  -4.717  1.00 0.00 ? 34  LEU A HD12 1  
ATOM   457   H  HD13 . LEU A 1 34 ? -2.930  -0.834  -3.040  1.00 0.00 ? 34  LEU A HD13 1  
ATOM   458   H  HD21 . LEU A 1 34 ? -6.086  -0.955  -4.954  1.00 0.00 ? 34  LEU A HD21 1  
ATOM   459   H  HD22 . LEU A 1 34 ? -5.697  -0.949  -3.234  1.00 0.00 ? 34  LEU A HD22 1  
ATOM   460   H  HD23 . LEU A 1 34 ? -6.168  -2.453  -4.027  1.00 0.00 ? 34  LEU A HD23 1  
ATOM   461   N  N    . GLY A 1 35 ? -4.433  -3.849  -8.848  1.00 0.00 ? 35  GLY A N    1  
ATOM   462   C  CA   . GLY A 1 35 ? -4.504  -3.750  -10.294 1.00 0.00 ? 35  GLY A CA   1  
ATOM   463   C  C    . GLY A 1 35 ? -3.935  -2.445  -10.814 1.00 0.00 ? 35  GLY A C    1  
ATOM   464   O  O    . GLY A 1 35 ? -2.968  -1.906  -10.276 1.00 0.00 ? 35  GLY A O    1  
ATOM   465   H  H    . GLY A 1 35 ? -3.932  -4.582  -8.433  1.00 0.00 ? 35  GLY A H    1  
ATOM   466   H  HA2  . GLY A 1 35 ? -3.951  -4.570  -10.728 1.00 0.00 ? 35  GLY A HA2  1  
ATOM   467   H  HA3  . GLY A 1 35 ? -5.538  -3.825  -10.598 1.00 0.00 ? 35  GLY A HA3  1  
ATOM   468   N  N    . PRO A 1 36 ? -4.542  -1.916  -11.888 1.00 0.00 ? 36  PRO A N    1  
ATOM   469   C  CA   . PRO A 1 36 ? -4.106  -0.660  -12.505 1.00 0.00 ? 36  PRO A CA   1  
ATOM   470   C  C    . PRO A 1 36 ? -4.396  0.550   -11.624 1.00 0.00 ? 36  PRO A C    1  
ATOM   471   O  O    . PRO A 1 36 ? -3.719  1.573   -11.718 1.00 0.00 ? 36  PRO A O    1  
ATOM   472   C  CB   . PRO A 1 36 ? -4.930  -0.594  -13.794 1.00 0.00 ? 36  PRO A CB   1  
ATOM   473   C  CG   . PRO A 1 36 ? -6.144  -1.408  -13.509 1.00 0.00 ? 36  PRO A CG   1  
ATOM   474   C  CD   . PRO A 1 36 ? -5.700  -2.505  -12.581 1.00 0.00 ? 36  PRO A CD   1  
ATOM   475   H  HA   . PRO A 1 36 ? -3.054  -0.683  -12.750 1.00 0.00 ? 36  PRO A HA   1  
ATOM   476   H  HB2  . PRO A 1 36 ? -5.184  0.435   -14.008 1.00 0.00 ? 36  PRO A HB2  1  
ATOM   477   H  HB3  . PRO A 1 36 ? -4.360  -1.008  -14.611 1.00 0.00 ? 36  PRO A HB3  1  
ATOM   478   H  HG2  . PRO A 1 36 ? -6.894  -0.795  -13.032 1.00 0.00 ? 36  PRO A HG2  1  
ATOM   479   H  HG3  . PRO A 1 36 ? -6.529  -1.827  -14.427 1.00 0.00 ? 36  PRO A HG3  1  
ATOM   480   H  HD2  . PRO A 1 36 ? -6.485  -2.749  -11.881 1.00 0.00 ? 36  PRO A HD2  1  
ATOM   481   H  HD3  . PRO A 1 36 ? -5.408  -3.379  -13.144 1.00 0.00 ? 36  PRO A HD3  1  
ATOM   482   N  N    . GLN A 1 37 ? -5.405  0.425   -10.769 1.00 0.00 ? 37  GLN A N    1  
ATOM   483   C  CA   . GLN A 1 37 ? -5.784  1.510   -9.871  1.00 0.00 ? 37  GLN A CA   1  
ATOM   484   C  C    . GLN A 1 37 ? -4.691  1.770   -8.840  1.00 0.00 ? 37  GLN A C    1  
ATOM   485   O  O    . GLN A 1 37 ? -4.570  2.876   -8.312  1.00 0.00 ? 37  GLN A O    1  
ATOM   486   C  CB   . GLN A 1 37 ? -7.100  1.180   -9.165  1.00 0.00 ? 37  GLN A CB   1  
ATOM   487   C  CG   . GLN A 1 37 ? -8.333  1.563   -9.966  1.00 0.00 ? 37  GLN A CG   1  
ATOM   488   C  CD   . GLN A 1 37 ? -8.146  1.362   -11.457 1.00 0.00 ? 37  GLN A CD   1  
ATOM   489   O  OE1  . GLN A 1 37 ? -7.538  2.190   -12.136 1.00 0.00 ? 37  GLN A OE1  1  
ATOM   490   N  NE2  . GLN A 1 37 ? -8.669  0.257   -11.976 1.00 0.00 ? 37  GLN A NE2  1  
ATOM   491   H  H    . GLN A 1 37 ? -5.907  -0.416  -10.741 1.00 0.00 ? 37  GLN A H    1  
ATOM   492   H  HA   . GLN A 1 37 ? -5.918  2.400   -10.466 1.00 0.00 ? 37  GLN A HA   1  
ATOM   493   H  HB2  . GLN A 1 37 ? -7.136  0.118   -8.974  1.00 0.00 ? 37  GLN A HB2  1  
ATOM   494   H  HB3  . GLN A 1 37 ? -7.131  1.708   -8.223  1.00 0.00 ? 37  GLN A HB3  1  
ATOM   495   H  HG2  . GLN A 1 37 ? -9.163  0.956   -9.638  1.00 0.00 ? 37  GLN A HG2  1  
ATOM   496   H  HG3  . GLN A 1 37 ? -8.556  2.604   -9.783  1.00 0.00 ? 37  GLN A HG3  1  
ATOM   497   H  HE21 . GLN A 1 37 ? -9.141  -0.357  -11.375 1.00 0.00 ? 37  GLN A HE21 1  
ATOM   498   H  HE22 . GLN A 1 37 ? -8.564  0.102   -12.937 1.00 0.00 ? 37  GLN A HE22 1  
ATOM   499   N  N    . CYS A 1 38 ? -3.896  0.743   -8.556  1.00 0.00 ? 38  CYS A N    1  
ATOM   500   C  CA   . CYS A 1 38 ? -2.813  0.859   -7.587  1.00 0.00 ? 38  CYS A CA   1  
ATOM   501   C  C    . CYS A 1 38 ? -2.089  2.194   -7.737  1.00 0.00 ? 38  CYS A C    1  
ATOM   502   O  O    . CYS A 1 38 ? -1.771  2.635   -8.842  1.00 0.00 ? 38  CYS A O    1  
ATOM   503   C  CB   . CYS A 1 38 ? -1.821  -0.293  -7.759  1.00 0.00 ? 38  CYS A CB   1  
ATOM   504   S  SG   . CYS A 1 38 ? -0.481  -0.312  -6.525  1.00 0.00 ? 38  CYS A SG   1  
ATOM   505   H  H    . CYS A 1 38 ? -4.041  -0.114  -9.009  1.00 0.00 ? 38  CYS A H    1  
ATOM   506   H  HA   . CYS A 1 38 ? -3.244  0.807   -6.599  1.00 0.00 ? 38  CYS A HA   1  
ATOM   507   H  HB2  . CYS A 1 38 ? -2.353  -1.230  -7.679  1.00 0.00 ? 38  CYS A HB2  1  
ATOM   508   H  HB3  . CYS A 1 38 ? -1.367  -0.225  -8.736  1.00 0.00 ? 38  CYS A HB3  1  
ATOM   509   N  N    . PRO A 1 39 ? -1.822  2.854   -6.600  1.00 0.00 ? 39  PRO A N    1  
ATOM   510   C  CA   . PRO A 1 39 ? -1.132  4.147   -6.579  1.00 0.00 ? 39  PRO A CA   1  
ATOM   511   C  C    . PRO A 1 39 ? 0.337   4.027   -6.969  1.00 0.00 ? 39  PRO A C    1  
ATOM   512   O  O    . PRO A 1 39 ? 0.960   5.005   -7.380  1.00 0.00 ? 39  PRO A O    1  
ATOM   513   C  CB   . PRO A 1 39 ? -1.263  4.594   -5.121  1.00 0.00 ? 39  PRO A CB   1  
ATOM   514   C  CG   . PRO A 1 39 ? -1.421  3.330   -4.349  1.00 0.00 ? 39  PRO A CG   1  
ATOM   515   C  CD   . PRO A 1 39 ? -2.172  2.387   -5.248  1.00 0.00 ? 39  PRO A CD   1  
ATOM   516   H  HA   . PRO A 1 39 ? -1.617  4.866   -7.223  1.00 0.00 ? 39  PRO A HA   1  
ATOM   517   H  HB2  . PRO A 1 39 ? -0.372  5.130   -4.825  1.00 0.00 ? 39  PRO A HB2  1  
ATOM   518   H  HB3  . PRO A 1 39 ? -2.127  5.233   -5.012  1.00 0.00 ? 39  PRO A HB3  1  
ATOM   519   H  HG2  . PRO A 1 39 ? -0.451  2.924   -4.107  1.00 0.00 ? 39  PRO A HG2  1  
ATOM   520   H  HG3  . PRO A 1 39 ? -1.986  3.518   -3.448  1.00 0.00 ? 39  PRO A HG3  1  
ATOM   521   H  HD2  . PRO A 1 39 ? -1.840  1.372   -5.092  1.00 0.00 ? 39  PRO A HD2  1  
ATOM   522   H  HD3  . PRO A 1 39 ? -3.235  2.469   -5.077  1.00 0.00 ? 39  PRO A HD3  1  
ATOM   523   N  N    . GLN A 1 40 ? 0.883   2.822   -6.838  1.00 0.00 ? 40  GLN A N    1  
ATOM   524   C  CA   . GLN A 1 40 ? 2.279   2.576   -7.178  1.00 0.00 ? 40  GLN A CA   1  
ATOM   525   C  C    . GLN A 1 40 ? 2.414   2.108   -8.623  1.00 0.00 ? 40  GLN A C    1  
ATOM   526   O  O    . GLN A 1 40 ? 1.515   1.464   -9.163  1.00 0.00 ? 40  GLN A O    1  
ATOM   527   C  CB   . GLN A 1 40 ? 2.880   1.534   -6.233  1.00 0.00 ? 40  GLN A CB   1  
ATOM   528   C  CG   . GLN A 1 40 ? 2.945   1.991   -4.785  1.00 0.00 ? 40  GLN A CG   1  
ATOM   529   C  CD   . GLN A 1 40 ? 3.574   0.955   -3.874  1.00 0.00 ? 40  GLN A CD   1  
ATOM   530   O  OE1  . GLN A 1 40 ? 2.963   -0.068  -3.564  1.00 0.00 ? 40  GLN A OE1  1  
ATOM   531   N  NE2  . GLN A 1 40 ? 4.801   1.216   -3.438  1.00 0.00 ? 40  GLN A NE2  1  
ATOM   532   H  H    . GLN A 1 40 ? 0.334   2.083   -6.505  1.00 0.00 ? 40  GLN A H    1  
ATOM   533   H  HA   . GLN A 1 40 ? 2.817   3.505   -7.063  1.00 0.00 ? 40  GLN A HA   1  
ATOM   534   H  HB2  . GLN A 1 40 ? 2.280   0.637   -6.278  1.00 0.00 ? 40  GLN A HB2  1  
ATOM   535   H  HB3  . GLN A 1 40 ? 3.883   1.304   -6.561  1.00 0.00 ? 40  GLN A HB3  1  
ATOM   536   H  HG2  . GLN A 1 40 ? 3.532   2.897   -4.733  1.00 0.00 ? 40  GLN A HG2  1  
ATOM   537   H  HG3  . GLN A 1 40 ? 1.942   2.193   -4.439  1.00 0.00 ? 40  GLN A HG3  1  
ATOM   538   H  HE21 . GLN A 1 40 ? 5.225   2.052   -3.725  1.00 0.00 ? 40  GLN A HE21 1  
ATOM   539   H  HE22 . GLN A 1 40 ? 5.230   0.564   -2.847  1.00 0.00 ? 40  GLN A HE22 1  
ATOM   540   N  N    . SER A 1 41 ? 3.543   2.435   -9.244  1.00 0.00 ? 41  SER A N    1  
ATOM   541   C  CA   . SER A 1 41 ? 3.793   2.051   -10.628 1.00 0.00 ? 41  SER A CA   1  
ATOM   542   C  C    . SER A 1 41 ? 4.129   0.567   -10.728 1.00 0.00 ? 41  SER A C    1  
ATOM   543   O  O    . SER A 1 41 ? 4.636   -0.032  -9.778  1.00 0.00 ? 41  SER A O    1  
ATOM   544   C  CB   . SER A 1 41 ? 4.935   2.885   -11.212 1.00 0.00 ? 41  SER A CB   1  
ATOM   545   O  OG   . SER A 1 41 ? 4.787   3.043   -12.613 1.00 0.00 ? 41  SER A OG   1  
ATOM   546   H  H    . SER A 1 41 ? 4.222   2.950   -8.760  1.00 0.00 ? 41  SER A H    1  
ATOM   547   H  HA   . SER A 1 41 ? 2.893   2.243   -11.193 1.00 0.00 ? 41  SER A HA   1  
ATOM   548   H  HB2  . SER A 1 41 ? 4.938   3.860   -10.751 1.00 0.00 ? 41  SER A HB2  1  
ATOM   549   H  HB3  . SER A 1 41 ? 5.875   2.390   -11.015 1.00 0.00 ? 41  SER A HB3  1  
ATOM   550   H  HG   . SER A 1 41 ? 5.542   3.522   -12.963 1.00 0.00 ? 41  SER A HG   1  
ATOM   551   N  N    . HIS A 1 42 ? 3.843   -0.022  -11.885 1.00 0.00 ? 42  HIS A N    1  
ATOM   552   C  CA   . HIS A 1 42 ? 4.115   -1.437  -12.110 1.00 0.00 ? 42  HIS A CA   1  
ATOM   553   C  C    . HIS A 1 42 ? 5.009   -1.631  -13.332 1.00 0.00 ? 42  HIS A C    1  
ATOM   554   O  O    . HIS A 1 42 ? 4.523   -1.872  -14.437 1.00 0.00 ? 42  HIS A O    1  
ATOM   555   C  CB   . HIS A 1 42 ? 2.807   -2.207  -12.294 1.00 0.00 ? 42  HIS A CB   1  
ATOM   556   C  CG   . HIS A 1 42 ? 2.000   -2.326  -11.038 1.00 0.00 ? 42  HIS A CG   1  
ATOM   557   N  ND1  . HIS A 1 42 ? 0.635   -2.521  -11.035 1.00 0.00 ? 42  HIS A ND1  1  
ATOM   558   C  CD2  . HIS A 1 42 ? 2.374   -2.278  -9.738  1.00 0.00 ? 42  HIS A CD2  1  
ATOM   559   C  CE1  . HIS A 1 42 ? 0.204   -2.586  -9.788  1.00 0.00 ? 42  HIS A CE1  1  
ATOM   560   N  NE2  . HIS A 1 42 ? 1.240   -2.442  -8.981  1.00 0.00 ? 42  HIS A NE2  1  
ATOM   561   H  H    . HIS A 1 42 ? 3.440   0.508   -12.604 1.00 0.00 ? 42  HIS A H    1  
ATOM   562   H  HA   . HIS A 1 42 ? 4.628   -1.819  -11.241 1.00 0.00 ? 42  HIS A HA   1  
ATOM   563   H  HB2  . HIS A 1 42 ? 2.200   -1.701  -13.031 1.00 0.00 ? 42  HIS A HB2  1  
ATOM   564   H  HB3  . HIS A 1 42 ? 3.030   -3.205  -12.642 1.00 0.00 ? 42  HIS A HB3  1  
ATOM   565   H  HD1  . HIS A 1 42 ? 0.067   -2.598  -11.829 1.00 0.00 ? 42  HIS A HD1  1  
ATOM   566   H  HD2  . HIS A 1 42 ? 3.379   -2.136  -9.364  1.00 0.00 ? 42  HIS A HD2  1  
ATOM   567   H  HE1  . HIS A 1 42 ? -0.820  -2.732  -9.480  1.00 0.00 ? 42  HIS A HE1  1  
ATOM   568   N  N    . ASP A 1 43 ? 6.317   -1.523  -13.125 1.00 0.00 ? 43  ASP A N    1  
ATOM   569   C  CA   . ASP A 1 43 ? 7.279   -1.687  -14.209 1.00 0.00 ? 43  ASP A CA   1  
ATOM   570   C  C    . ASP A 1 43 ? 7.977   -3.040  -14.116 1.00 0.00 ? 43  ASP A C    1  
ATOM   571   O  O    . ASP A 1 43 ? 8.658   -3.331  -13.132 1.00 0.00 ? 43  ASP A O    1  
ATOM   572   C  CB   . ASP A 1 43 ? 8.313   -0.561  -14.175 1.00 0.00 ? 43  ASP A CB   1  
ATOM   573   C  CG   . ASP A 1 43 ? 9.539   -0.877  -15.009 1.00 0.00 ? 43  ASP A CG   1  
ATOM   574   O  OD1  . ASP A 1 43 ? 9.375   -1.230  -16.195 1.00 0.00 ? 43  ASP A OD1  1  
ATOM   575   O  OD2  . ASP A 1 43 ? 10.664  -0.771  -14.475 1.00 0.00 ? 43  ASP A OD2  1  
ATOM   576   H  H    . ASP A 1 43 ? 6.643   -1.330  -12.221 1.00 0.00 ? 43  ASP A H    1  
ATOM   577   H  HA   . ASP A 1 43 ? 6.738   -1.638  -15.142 1.00 0.00 ? 43  ASP A HA   1  
ATOM   578   H  HB2  . ASP A 1 43 ? 7.864   0.344   -14.558 1.00 0.00 ? 43  ASP A HB2  1  
ATOM   579   H  HB3  . ASP A 1 43 ? 8.626   -0.399  -13.154 1.00 0.00 ? 43  ASP A HB3  1  
ATOM   580   N  N    . ILE A 1 44 ? 7.803   -3.862  -15.145 1.00 0.00 ? 44  ILE A N    1  
ATOM   581   C  CA   . ILE A 1 44 ? 8.417   -5.183  -15.179 1.00 0.00 ? 44  ILE A CA   1  
ATOM   582   C  C    . ILE A 1 44 ? 9.741   -5.155  -15.934 1.00 0.00 ? 44  ILE A C    1  
ATOM   583   O  O    . ILE A 1 44 ? 9.766   -5.170  -17.165 1.00 0.00 ? 44  ILE A O    1  
ATOM   584   C  CB   . ILE A 1 44 ? 7.486   -6.220  -15.836 1.00 0.00 ? 44  ILE A CB   1  
ATOM   585   C  CG1  . ILE A 1 44 ? 6.123   -6.225  -15.142 1.00 0.00 ? 44  ILE A CG1  1  
ATOM   586   C  CG2  . ILE A 1 44 ? 8.117   -7.603  -15.788 1.00 0.00 ? 44  ILE A CG2  1  
ATOM   587   C  CD1  . ILE A 1 44 ? 6.134   -6.911  -13.793 1.00 0.00 ? 44  ILE A CD1  1  
ATOM   588   H  H    . ILE A 1 44 ? 7.249   -3.572  -15.900 1.00 0.00 ? 44  ILE A H    1  
ATOM   589   H  HA   . ILE A 1 44 ? 8.602   -5.491  -14.160 1.00 0.00 ? 44  ILE A HA   1  
ATOM   590   H  HB   . ILE A 1 44 ? 7.354   -5.946  -16.871 1.00 0.00 ? 44  ILE A HB   1  
ATOM   591   H  HG12 . ILE A 1 44 ? 5.797   -5.208  -14.993 1.00 0.00 ? 44  ILE A HG12 1  
ATOM   592   H  HG13 . ILE A 1 44 ? 5.409   -6.739  -15.770 1.00 0.00 ? 44  ILE A HG13 1  
ATOM   593   H  HG21 . ILE A 1 44 ? 8.438   -7.887  -16.780 1.00 0.00 ? 44  ILE A HG21 1  
ATOM   594   H  HG22 . ILE A 1 44 ? 8.969   -7.587  -15.126 1.00 0.00 ? 44  ILE A HG22 1  
ATOM   595   H  HG23 . ILE A 1 44 ? 7.392   -8.317  -15.427 1.00 0.00 ? 44  ILE A HG23 1  
ATOM   596   H  HD11 . ILE A 1 44 ? 5.990   -7.973  -13.928 1.00 0.00 ? 44  ILE A HD11 1  
ATOM   597   H  HD12 . ILE A 1 44 ? 7.081   -6.733  -13.306 1.00 0.00 ? 44  ILE A HD12 1  
ATOM   598   H  HD13 . ILE A 1 44 ? 5.335   -6.515  -13.182 1.00 0.00 ? 44  ILE A HD13 1  
ATOM   599   N  N    . SER A 1 45 ? 10.841  -5.116  -15.189 1.00 0.00 ? 45  SER A N    1  
ATOM   600   C  CA   . SER A 1 45 ? 12.170  -5.084  -15.788 1.00 0.00 ? 45  SER A CA   1  
ATOM   601   C  C    . SER A 1 45 ? 12.649  -6.493  -16.121 1.00 0.00 ? 45  SER A C    1  
ATOM   602   O  O    . SER A 1 45 ? 12.912  -6.814  -17.280 1.00 0.00 ? 45  SER A O    1  
ATOM   603   C  CB   . SER A 1 45 ? 13.163  -4.406  -14.841 1.00 0.00 ? 45  SER A CB   1  
ATOM   604   O  OG   . SER A 1 45 ? 13.170  -3.002  -15.031 1.00 0.00 ? 45  SER A OG   1  
ATOM   605   H  H    . SER A 1 45 ? 10.756  -5.106  -14.212 1.00 0.00 ? 45  SER A H    1  
ATOM   606   H  HA   . SER A 1 45 ? 12.108  -4.511  -16.701 1.00 0.00 ? 45  SER A HA   1  
ATOM   607   H  HB2  . SER A 1 45 ? 12.885  -4.617  -13.820 1.00 0.00 ? 45  SER A HB2  1  
ATOM   608   H  HB3  . SER A 1 45 ? 14.155  -4.788  -15.031 1.00 0.00 ? 45  SER A HB3  1  
ATOM   609   H  HG   . SER A 1 45 ? 12.317  -2.719  -15.367 1.00 0.00 ? 45  SER A HG   1  
ATOM   610   N  N    . GLY A 1 46 ? 12.761  -7.332  -15.096 1.00 0.00 ? 46  GLY A N    1  
ATOM   611   C  CA   . GLY A 1 46 ? 13.209  -8.697  -15.300 1.00 0.00 ? 46  GLY A CA   1  
ATOM   612   C  C    . GLY A 1 46 ? 14.537  -8.979  -14.625 1.00 0.00 ? 46  GLY A C    1  
ATOM   613   O  O    . GLY A 1 46 ? 15.565  -9.155  -15.279 1.00 0.00 ? 46  GLY A O    1  
ATOM   614   H  H    . GLY A 1 46 ? 12.537  -7.021  -14.193 1.00 0.00 ? 46  GLY A H    1  
ATOM   615   H  HA2  . GLY A 1 46 ? 12.465  -9.372  -14.903 1.00 0.00 ? 46  GLY A HA2  1  
ATOM   616   H  HA3  . GLY A 1 46 ? 13.312  -8.876  -16.360 1.00 0.00 ? 46  GLY A HA3  1  
ATOM   617   N  N    . PRO A 1 47 ? 14.526  -9.023  -13.285 1.00 0.00 ? 47  PRO A N    1  
ATOM   618   C  CA   . PRO A 1 47 ? 15.731  -9.284  -12.492 1.00 0.00 ? 47  PRO A CA   1  
ATOM   619   C  C    . PRO A 1 47 ? 16.219  -10.721 -12.633 1.00 0.00 ? 47  PRO A C    1  
ATOM   620   O  O    . PRO A 1 47 ? 15.543  -11.560 -13.228 1.00 0.00 ? 47  PRO A O    1  
ATOM   621   C  CB   . PRO A 1 47 ? 15.277  -9.012  -11.055 1.00 0.00 ? 47  PRO A CB   1  
ATOM   622   C  CG   . PRO A 1 47 ? 13.805  -9.243  -11.074 1.00 0.00 ? 47  PRO A CG   1  
ATOM   623   C  CD   . PRO A 1 47 ? 13.337  -8.823  -12.440 1.00 0.00 ? 47  PRO A CD   1  
ATOM   624   H  HA   . PRO A 1 47 ? 16.532  -8.606  -12.752 1.00 0.00 ? 47  PRO A HA   1  
ATOM   625   H  HB2  . PRO A 1 47 ? 15.777  -9.694  -10.382 1.00 0.00 ? 47  PRO A HB2  1  
ATOM   626   H  HB3  . PRO A 1 47 ? 15.513  -7.993  -10.786 1.00 0.00 ? 47  PRO A HB3  1  
ATOM   627   H  HG2  . PRO A 1 47 ? 13.596  -10.289 -10.911 1.00 0.00 ? 47  PRO A HG2  1  
ATOM   628   H  HG3  . PRO A 1 47 ? 13.330  -8.641  -10.314 1.00 0.00 ? 47  PRO A HG3  1  
ATOM   629   H  HD2  . PRO A 1 47 ? 12.521  -9.449  -12.768 1.00 0.00 ? 47  PRO A HD2  1  
ATOM   630   H  HD3  . PRO A 1 47 ? 13.040  -7.785  -12.434 1.00 0.00 ? 47  PRO A HD3  1  
ATOM   631   N  N    . SER A 1 48 ? 17.396  -10.999 -12.082 1.00 0.00 ? 48  SER A N    1  
ATOM   632   C  CA   . SER A 1 48 ? 17.975  -12.336 -12.149 1.00 0.00 ? 48  SER A CA   1  
ATOM   633   C  C    . SER A 1 48 ? 18.207  -12.899 -10.751 1.00 0.00 ? 48  SER A C    1  
ATOM   634   O  O    . SER A 1 48 ? 18.356  -12.150 -9.785  1.00 0.00 ? 48  SER A O    1  
ATOM   635   C  CB   . SER A 1 48 ? 19.294  -12.304 -12.924 1.00 0.00 ? 48  SER A CB   1  
ATOM   636   O  OG   . SER A 1 48 ? 20.261  -11.514 -12.254 1.00 0.00 ? 48  SER A OG   1  
ATOM   637   H  H    . SER A 1 48 ? 17.888  -10.288 -11.621 1.00 0.00 ? 48  SER A H    1  
ATOM   638   H  HA   . SER A 1 48 ? 17.277  -12.974 -12.670 1.00 0.00 ? 48  SER A HA   1  
ATOM   639   H  HB2  . SER A 1 48 ? 19.675  -13.309 -13.023 1.00 0.00 ? 48  SER A HB2  1  
ATOM   640   H  HB3  . SER A 1 48 ? 19.122  -11.886 -13.905 1.00 0.00 ? 48  SER A HB3  1  
ATOM   641   H  HG   . SER A 1 48 ? 21.140  -11.773 -12.539 1.00 0.00 ? 48  SER A HG   1  
ATOM   642   N  N    . SER A 1 49 ? 18.237  -14.224 -10.650 1.00 0.00 ? 49  SER A N    1  
ATOM   643   C  CA   . SER A 1 49 ? 18.447  -14.889 -9.370  1.00 0.00 ? 49  SER A CA   1  
ATOM   644   C  C    . SER A 1 49 ? 19.803  -15.588 -9.336  1.00 0.00 ? 49  SER A C    1  
ATOM   645   O  O    . SER A 1 49 ? 20.158  -16.323 -10.257 1.00 0.00 ? 49  SER A O    1  
ATOM   646   C  CB   . SER A 1 49 ? 17.332  -15.903 -9.109  1.00 0.00 ? 49  SER A CB   1  
ATOM   647   O  OG   . SER A 1 49 ? 17.614  -16.688 -7.963  1.00 0.00 ? 49  SER A OG   1  
ATOM   648   H  H    . SER A 1 49 ? 18.113  -14.767 -11.457 1.00 0.00 ? 49  SER A H    1  
ATOM   649   H  HA   . SER A 1 49 ? 18.425  -14.135 -8.597  1.00 0.00 ? 49  SER A HA   1  
ATOM   650   H  HB2  . SER A 1 49 ? 16.402  -15.379 -8.952  1.00 0.00 ? 49  SER A HB2  1  
ATOM   651   H  HB3  . SER A 1 49 ? 17.237  -16.557 -9.964  1.00 0.00 ? 49  SER A HB3  1  
ATOM   652   H  HG   . SER A 1 49 ? 17.100  -17.498 -7.995  1.00 0.00 ? 49  SER A HG   1  
ATOM   653   N  N    . GLY A 1 50 ? 20.557  -15.352 -8.267  1.00 0.00 ? 50  GLY A N    1  
ATOM   654   C  CA   . GLY A 1 50 ? 21.866  -15.965 -8.132  1.00 0.00 ? 50  GLY A CA   1  
ATOM   655   C  C    . GLY A 1 50 ? 22.954  -14.950 -7.843  1.00 0.00 ? 50  GLY A C    1  
ATOM   656   O  O    . GLY A 1 50 ? 22.664  -13.755 -7.804  1.00 0.00 ? 50  GLY A O    1  
ATOM   657   H  H    . GLY A 1 50 ? 20.222  -14.757 -7.564  1.00 0.00 ? 50  GLY A H    1  
ATOM   658   H  HA2  . GLY A 1 50 ? 21.834  -16.683 -7.326  1.00 0.00 ? 50  GLY A HA2  1  
ATOM   659   H  HA3  . GLY A 1 50 ? 22.106  -16.480 -9.051  1.00 0.00 ? 50  GLY A HA3  1  
HETATM 660   ZN ZN   . ZN  B 2 .  ? 0.541   -2.362  -7.055  1.00 0.00 ? 201 ZN  A ZN   1  
ATOM   661   N  N    . GLY A 1 1  ? -12.031 -3.478  -24.308 1.00 0.00 ? 1   GLY A N    2  
ATOM   662   C  CA   . GLY A 1 1  ? -10.843 -4.304  -24.202 1.00 0.00 ? 1   GLY A CA   2  
ATOM   663   C  C    . GLY A 1 1  ? -9.565  -3.489  -24.223 1.00 0.00 ? 1   GLY A C    2  
ATOM   664   O  O    . GLY A 1 1  ? -9.604  -2.265  -24.349 1.00 0.00 ? 1   GLY A O    2  
ATOM   665   H  H1   . GLY A 1 1  ? -12.042 -2.585  -23.903 1.00 0.00 ? 1   GLY A H1   2  
ATOM   666   H  HA2  . GLY A 1 1  ? -10.887 -4.862  -23.279 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   667   H  HA3  . GLY A 1 1  ? -10.826 -4.998  -25.030 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   668   N  N    . SER A 1 2  ? -8.429  -4.168  -24.097 1.00 0.00 ? 2   SER A N    2  
ATOM   669   C  CA   . SER A 1 2  ? -7.134  -3.497  -24.096 1.00 0.00 ? 2   SER A CA   2  
ATOM   670   C  C    . SER A 1 2  ? -6.645  -3.260  -25.521 1.00 0.00 ? 2   SER A C    2  
ATOM   671   O  O    . SER A 1 2  ? -6.512  -4.197  -26.308 1.00 0.00 ? 2   SER A O    2  
ATOM   672   C  CB   . SER A 1 2  ? -6.107  -4.327  -23.323 1.00 0.00 ? 2   SER A CB   2  
ATOM   673   O  OG   . SER A 1 2  ? -4.801  -3.804  -23.489 1.00 0.00 ? 2   SER A OG   2  
ATOM   674   H  H    . SER A 1 2  ? -8.464  -5.142  -24.000 1.00 0.00 ? 2   SER A H    2  
ATOM   675   H  HA   . SER A 1 2  ? -7.256  -2.543  -23.606 1.00 0.00 ? 2   SER A HA   2  
ATOM   676   H  HB2  . SER A 1 2  ? -6.356  -4.316  -22.273 1.00 0.00 ? 2   SER A HB2  2  
ATOM   677   H  HB3  . SER A 1 2  ? -6.124  -5.345  -23.686 1.00 0.00 ? 2   SER A HB3  2  
ATOM   678   H  HG   . SER A 1 2  ? -4.271  -4.017  -22.717 1.00 0.00 ? 2   SER A HG   2  
ATOM   679   N  N    . SER A 1 3  ? -6.377  -1.999  -25.846 1.00 0.00 ? 3   SER A N    2  
ATOM   680   C  CA   . SER A 1 3  ? -5.905  -1.636  -27.177 1.00 0.00 ? 3   SER A CA   2  
ATOM   681   C  C    . SER A 1 3  ? -4.480  -1.097  -27.120 1.00 0.00 ? 3   SER A C    2  
ATOM   682   O  O    . SER A 1 3  ? -4.200  -0.122  -26.423 1.00 0.00 ? 3   SER A O    2  
ATOM   683   C  CB   . SER A 1 3  ? -6.833  -0.593  -27.803 1.00 0.00 ? 3   SER A CB   2  
ATOM   684   O  OG   . SER A 1 3  ? -6.436  -0.288  -29.129 1.00 0.00 ? 3   SER A OG   2  
ATOM   685   H  H    . SER A 1 3  ? -6.502  -1.296  -25.175 1.00 0.00 ? 3   SER A H    2  
ATOM   686   H  HA   . SER A 1 3  ? -5.916  -2.527  -27.787 1.00 0.00 ? 3   SER A HA   2  
ATOM   687   H  HB2  . SER A 1 3  ? -7.842  -0.977  -27.822 1.00 0.00 ? 3   SER A HB2  2  
ATOM   688   H  HB3  . SER A 1 3  ? -6.803  0.312   -27.213 1.00 0.00 ? 3   SER A HB3  2  
ATOM   689   H  HG   . SER A 1 3  ? -7.165  0.129   -29.594 1.00 0.00 ? 3   SER A HG   2  
ATOM   690   N  N    . GLY A 1 4  ? -3.580  -1.739  -27.860 1.00 0.00 ? 4   GLY A N    2  
ATOM   691   C  CA   . GLY A 1 4  ? -2.194  -1.310  -27.880 1.00 0.00 ? 4   GLY A CA   2  
ATOM   692   C  C    . GLY A 1 4  ? -1.291  -2.299  -28.591 1.00 0.00 ? 4   GLY A C    2  
ATOM   693   O  O    . GLY A 1 4  ? -1.151  -2.254  -29.813 1.00 0.00 ? 4   GLY A O    2  
ATOM   694   H  H    . GLY A 1 4  ? -3.861  -2.510  -28.396 1.00 0.00 ? 4   GLY A H    2  
ATOM   695   H  HA2  . GLY A 1 4  ? -2.131  -0.356  -28.381 1.00 0.00 ? 4   GLY A HA2  2  
ATOM   696   H  HA3  . GLY A 1 4  ? -1.850  -1.194  -26.862 1.00 0.00 ? 4   GLY A HA3  2  
ATOM   697   N  N    . SER A 1 5  ? -0.677  -3.194  -27.824 1.00 0.00 ? 5   SER A N    2  
ATOM   698   C  CA   . SER A 1 5  ? 0.221   -4.195  -28.388 1.00 0.00 ? 5   SER A CA   2  
ATOM   699   C  C    . SER A 1 5  ? -0.043  -5.568  -27.777 1.00 0.00 ? 5   SER A C    2  
ATOM   700   O  O    . SER A 1 5  ? 0.130   -5.769  -26.575 1.00 0.00 ? 5   SER A O    2  
ATOM   701   C  CB   . SER A 1 5  ? 1.679   -3.793  -28.154 1.00 0.00 ? 5   SER A CB   2  
ATOM   702   O  OG   . SER A 1 5  ? 2.533   -4.388  -29.115 1.00 0.00 ? 5   SER A OG   2  
ATOM   703   H  H    . SER A 1 5  ? -0.830  -3.179  -26.856 1.00 0.00 ? 5   SER A H    2  
ATOM   704   H  HA   . SER A 1 5  ? 0.037   -4.245  -29.450 1.00 0.00 ? 5   SER A HA   2  
ATOM   705   H  HB2  . SER A 1 5  ? 1.769   -2.719  -28.225 1.00 0.00 ? 5   SER A HB2  2  
ATOM   706   H  HB3  . SER A 1 5  ? 1.984   -4.115  -27.169 1.00 0.00 ? 5   SER A HB3  2  
ATOM   707   H  HG   . SER A 1 5  ? 3.424   -4.049  -29.005 1.00 0.00 ? 5   SER A HG   2  
ATOM   708   N  N    . SER A 1 6  ? -0.465  -6.510  -28.615 1.00 0.00 ? 6   SER A N    2  
ATOM   709   C  CA   . SER A 1 6  ? -0.758  -7.863  -28.158 1.00 0.00 ? 6   SER A CA   2  
ATOM   710   C  C    . SER A 1 6  ? 0.139   -8.879  -28.860 1.00 0.00 ? 6   SER A C    2  
ATOM   711   O  O    . SER A 1 6  ? 0.729   -9.749  -28.221 1.00 0.00 ? 6   SER A O    2  
ATOM   712   C  CB   . SER A 1 6  ? -2.228  -8.203  -28.411 1.00 0.00 ? 6   SER A CB   2  
ATOM   713   O  OG   . SER A 1 6  ? -2.599  -9.394  -27.739 1.00 0.00 ? 6   SER A OG   2  
ATOM   714   H  H    . SER A 1 6  ? -0.584  -6.288  -29.562 1.00 0.00 ? 6   SER A H    2  
ATOM   715   H  HA   . SER A 1 6  ? -0.566  -7.904  -27.096 1.00 0.00 ? 6   SER A HA   2  
ATOM   716   H  HB2  . SER A 1 6  ? -2.848  -7.394  -28.055 1.00 0.00 ? 6   SER A HB2  2  
ATOM   717   H  HB3  . SER A 1 6  ? -2.386  -8.338  -29.472 1.00 0.00 ? 6   SER A HB3  2  
ATOM   718   H  HG   . SER A 1 6  ? -3.338  -9.213  -27.153 1.00 0.00 ? 6   SER A HG   2  
ATOM   719   N  N    . GLY A 1 7  ? 0.235   -8.761  -30.181 1.00 0.00 ? 7   GLY A N    2  
ATOM   720   C  CA   . GLY A 1 7  ? 1.061   -9.675  -30.948 1.00 0.00 ? 7   GLY A CA   2  
ATOM   721   C  C    . GLY A 1 7  ? 1.049   -9.360  -32.431 1.00 0.00 ? 7   GLY A C    2  
ATOM   722   O  O    . GLY A 1 7  ? 0.307   -9.975  -33.197 1.00 0.00 ? 7   GLY A O    2  
ATOM   723   H  H    . GLY A 1 7  ? -0.258  -8.048  -30.637 1.00 0.00 ? 7   GLY A H    2  
ATOM   724   H  HA2  . GLY A 1 7  ? 2.077   -9.616  -30.586 1.00 0.00 ? 7   GLY A HA2  2  
ATOM   725   H  HA3  . GLY A 1 7  ? 0.695   -10.681 -30.803 1.00 0.00 ? 7   GLY A HA3  2  
ATOM   726   N  N    . CYS A 1 8  ? 1.872   -8.400  -32.837 1.00 0.00 ? 8   CYS A N    2  
ATOM   727   C  CA   . CYS A 1 8  ? 1.952   -8.003  -34.238 1.00 0.00 ? 8   CYS A CA   2  
ATOM   728   C  C    . CYS A 1 8  ? 3.386   -8.100  -34.750 1.00 0.00 ? 8   CYS A C    2  
ATOM   729   O  O    . CYS A 1 8  ? 3.666   -8.823  -35.707 1.00 0.00 ? 8   CYS A O    2  
ATOM   730   C  CB   . CYS A 1 8  ? 1.430   -6.576  -34.416 1.00 0.00 ? 8   CYS A CB   2  
ATOM   731   S  SG   . CYS A 1 8  ? -0.365  -6.423  -34.265 1.00 0.00 ? 8   CYS A SG   2  
ATOM   732   H  H    . CYS A 1 8  ? 2.440   -7.946  -32.179 1.00 0.00 ? 8   CYS A H    2  
ATOM   733   H  HA   . CYS A 1 8  ? 1.333   -8.677  -34.809 1.00 0.00 ? 8   CYS A HA   2  
ATOM   734   H  HB2  . CYS A 1 8  ? 1.878   -5.941  -33.665 1.00 0.00 ? 8   CYS A HB2  2  
ATOM   735   H  HB3  . CYS A 1 8  ? 1.711   -6.218  -35.395 1.00 0.00 ? 8   CYS A HB3  2  
ATOM   736   H  HG   . CYS A 1 8  ? -0.911  -7.532  -34.740 1.00 0.00 ? 8   CYS A HG   2  
ATOM   737   N  N    . CYS A 1 9  ? 4.289   -7.368  -34.107 1.00 0.00 ? 9   CYS A N    2  
ATOM   738   C  CA   . CYS A 1 9  ? 5.694   -7.370  -34.499 1.00 0.00 ? 9   CYS A CA   2  
ATOM   739   C  C    . CYS A 1 9  ? 6.556   -6.696  -33.436 1.00 0.00 ? 9   CYS A C    2  
ATOM   740   O  O    . CYS A 1 9  ? 6.042   -6.164  -32.451 1.00 0.00 ? 9   CYS A O    2  
ATOM   741   C  CB   . CYS A 1 9  ? 5.871   -6.660  -35.842 1.00 0.00 ? 9   CYS A CB   2  
ATOM   742   S  SG   . CYS A 1 9  ? 5.448   -4.902  -35.809 1.00 0.00 ? 9   CYS A SG   2  
ATOM   743   H  H    . CYS A 1 9  ? 4.005   -6.812  -33.352 1.00 0.00 ? 9   CYS A H    2  
ATOM   744   H  HA   . CYS A 1 9  ? 6.007   -8.398  -34.601 1.00 0.00 ? 9   CYS A HA   2  
ATOM   745   H  HB2  . CYS A 1 9  ? 6.903   -6.743  -36.151 1.00 0.00 ? 9   CYS A HB2  2  
ATOM   746   H  HB3  . CYS A 1 9  ? 5.242   -7.137  -36.579 1.00 0.00 ? 9   CYS A HB3  2  
ATOM   747   H  HG   . CYS A 1 9  ? 5.968   -4.378  -34.710 1.00 0.00 ? 9   CYS A HG   2  
ATOM   748   N  N    . LEU A 1 10 ? 7.868   -6.724  -33.641 1.00 0.00 ? 10  LEU A N    2  
ATOM   749   C  CA   . LEU A 1 10 ? 8.802   -6.117  -32.700 1.00 0.00 ? 10  LEU A CA   2  
ATOM   750   C  C    . LEU A 1 10 ? 8.363   -4.704  -32.331 1.00 0.00 ? 10  LEU A C    2  
ATOM   751   O  O    . LEU A 1 10 ? 7.875   -3.941  -33.166 1.00 0.00 ? 10  LEU A O    2  
ATOM   752   C  CB   . LEU A 1 10 ? 10.210  -6.087  -33.297 1.00 0.00 ? 10  LEU A CB   2  
ATOM   753   C  CG   . LEU A 1 10 ? 10.948  -7.425  -33.345 1.00 0.00 ? 10  LEU A CG   2  
ATOM   754   C  CD1  . LEU A 1 10 ? 11.267  -7.910  -31.939 1.00 0.00 ? 10  LEU A CD1  2  
ATOM   755   C  CD2  . LEU A 1 10 ? 10.124  -8.462  -34.094 1.00 0.00 ? 10  LEU A CD2  2  
ATOM   756   H  H    . LEU A 1 10 ? 8.218   -7.163  -34.444 1.00 0.00 ? 10  LEU A H    2  
ATOM   757   H  HA   . LEU A 1 10 ? 8.812   -6.723  -31.806 1.00 0.00 ? 10  LEU A HA   2  
ATOM   758   H  HB2  . LEU A 1 10 ? 10.133  -5.715  -34.307 1.00 0.00 ? 10  LEU A HB2  2  
ATOM   759   H  HB3  . LEU A 1 10 ? 10.804  -5.402  -32.707 1.00 0.00 ? 10  LEU A HB3  2  
ATOM   760   H  HG   . LEU A 1 10 ? 11.883  -7.295  -33.872 1.00 0.00 ? 10  LEU A HG   2  
ATOM   761   H  HD11 . LEU A 1 10 ? 11.052  -7.125  -31.230 1.00 0.00 ? 10  LEU A HD11 2  
ATOM   762   H  HD12 . LEU A 1 10 ? 12.313  -8.174  -31.878 1.00 0.00 ? 10  LEU A HD12 2  
ATOM   763   H  HD13 . LEU A 1 10 ? 10.664  -8.777  -31.712 1.00 0.00 ? 10  LEU A HD13 2  
ATOM   764   H  HD21 . LEU A 1 10 ? 10.690  -9.377  -34.181 1.00 0.00 ? 10  LEU A HD21 2  
ATOM   765   H  HD22 . LEU A 1 10 ? 9.889   -8.090  -35.081 1.00 0.00 ? 10  LEU A HD22 2  
ATOM   766   H  HD23 . LEU A 1 10 ? 9.209   -8.654  -33.554 1.00 0.00 ? 10  LEU A HD23 2  
ATOM   767   N  N    . PRO A 1 11 ? 8.541   -4.343  -31.051 1.00 0.00 ? 11  PRO A N    2  
ATOM   768   C  CA   . PRO A 1 11 ? 8.173   -3.019  -30.543 1.00 0.00 ? 11  PRO A CA   2  
ATOM   769   C  C    . PRO A 1 11 ? 9.080   -1.918  -31.082 1.00 0.00 ? 11  PRO A C    2  
ATOM   770   O  O    . PRO A 1 11 ? 10.207  -2.164  -31.513 1.00 0.00 ? 11  PRO A O    2  
ATOM   771   C  CB   . PRO A 1 11 ? 8.344   -3.159  -29.029 1.00 0.00 ? 11  PRO A CB   2  
ATOM   772   C  CG   . PRO A 1 11 ? 9.345   -4.249  -28.860 1.00 0.00 ? 11  PRO A CG   2  
ATOM   773   C  CD   . PRO A 1 11 ? 9.117   -5.201  -30.002 1.00 0.00 ? 11  PRO A CD   2  
ATOM   774   H  HA   . PRO A 1 11 ? 7.144   -2.779  -30.770 1.00 0.00 ? 11  PRO A HA   2  
ATOM   775   H  HB2  . PRO A 1 11 ? 8.701   -2.226  -28.616 1.00 0.00 ? 11  PRO A HB2  2  
ATOM   776   H  HB3  . PRO A 1 11 ? 7.398   -3.420  -28.579 1.00 0.00 ? 11  PRO A HB3  2  
ATOM   777   H  HG2  . PRO A 1 11 ? 10.344  -3.841  -28.906 1.00 0.00 ? 11  PRO A HG2  2  
ATOM   778   H  HG3  . PRO A 1 11 ? 9.186   -4.751  -27.917 1.00 0.00 ? 11  PRO A HG3  2  
ATOM   779   H  HD2  . PRO A 1 11 ? 10.053  -5.632  -30.327 1.00 0.00 ? 11  PRO A HD2  2  
ATOM   780   H  HD3  . PRO A 1 11 ? 8.422   -5.976  -29.714 1.00 0.00 ? 11  PRO A HD3  2  
ATOM   781   N  N    . PRO A 1 12 ? 8.580   -0.674  -31.059 1.00 0.00 ? 12  PRO A N    2  
ATOM   782   C  CA   . PRO A 1 12 ? 9.331   0.490   -31.541 1.00 0.00 ? 12  PRO A CA   2  
ATOM   783   C  C    . PRO A 1 12 ? 10.505  0.839   -30.632 1.00 0.00 ? 12  PRO A C    2  
ATOM   784   O  O    . PRO A 1 12 ? 10.583  0.373   -29.496 1.00 0.00 ? 12  PRO A O    2  
ATOM   785   C  CB   . PRO A 1 12 ? 8.291   1.613   -31.526 1.00 0.00 ? 12  PRO A CB   2  
ATOM   786   C  CG   . PRO A 1 12 ? 7.296   1.195   -30.499 1.00 0.00 ? 12  PRO A CG   2  
ATOM   787   C  CD   . PRO A 1 12 ? 7.245   -0.306  -30.560 1.00 0.00 ? 12  PRO A CD   2  
ATOM   788   H  HA   . PRO A 1 12 ? 9.689   0.342   -32.549 1.00 0.00 ? 12  PRO A HA   2  
ATOM   789   H  HB2  . PRO A 1 12 ? 8.768   2.546   -31.258 1.00 0.00 ? 12  PRO A HB2  2  
ATOM   790   H  HB3  . PRO A 1 12 ? 7.837   1.702   -32.502 1.00 0.00 ? 12  PRO A HB3  2  
ATOM   791   H  HG2  . PRO A 1 12 ? 7.618   1.521   -29.522 1.00 0.00 ? 12  PRO A HG2  2  
ATOM   792   H  HG3  . PRO A 1 12 ? 6.328   1.612   -30.735 1.00 0.00 ? 12  PRO A HG3  2  
ATOM   793   H  HD2  . PRO A 1 12 ? 7.074   -0.718  -29.576 1.00 0.00 ? 12  PRO A HD2  2  
ATOM   794   H  HD3  . PRO A 1 12 ? 6.475   -0.631  -31.245 1.00 0.00 ? 12  PRO A HD3  2  
ATOM   795   N  N    . ALA A 1 13 ? 11.416  1.662   -31.141 1.00 0.00 ? 13  ALA A N    2  
ATOM   796   C  CA   . ALA A 1 13 ? 12.584  2.076   -30.375 1.00 0.00 ? 13  ALA A CA   2  
ATOM   797   C  C    . ALA A 1 13 ? 12.311  3.367   -29.611 1.00 0.00 ? 13  ALA A C    2  
ATOM   798   O  O    . ALA A 1 13 ? 13.138  4.280   -29.598 1.00 0.00 ? 13  ALA A O    2  
ATOM   799   C  CB   . ALA A 1 13 ? 13.785  2.248   -31.294 1.00 0.00 ? 13  ALA A CB   2  
ATOM   800   H  H    . ALA A 1 13 ? 11.298  2.001   -32.053 1.00 0.00 ? 13  ALA A H    2  
ATOM   801   H  HA   . ALA A 1 13 ? 12.814  1.292   -29.667 1.00 0.00 ? 13  ALA A HA   2  
ATOM   802   H  HB1  . ALA A 1 13 ? 13.831  3.272   -31.635 1.00 0.00 ? 13  ALA A HB1  2  
ATOM   803   H  HB2  . ALA A 1 13 ? 14.688  2.006   -30.754 1.00 0.00 ? 13  ALA A HB2  2  
ATOM   804   H  HB3  . ALA A 1 13 ? 13.685  1.589   -32.143 1.00 0.00 ? 13  ALA A HB3  2  
ATOM   805   N  N    . THR A 1 14 ? 11.146  3.438   -28.975 1.00 0.00 ? 14  THR A N    2  
ATOM   806   C  CA   . THR A 1 14 ? 10.763  4.618   -28.210 1.00 0.00 ? 14  THR A CA   2  
ATOM   807   C  C    . THR A 1 14 ? 11.260  4.527   -26.772 1.00 0.00 ? 14  THR A C    2  
ATOM   808   O  O    . THR A 1 14 ? 11.499  3.435   -26.255 1.00 0.00 ? 14  THR A O    2  
ATOM   809   C  CB   . THR A 1 14 ? 9.235   4.811   -28.202 1.00 0.00 ? 14  THR A CB   2  
ATOM   810   O  OG1  . THR A 1 14 ? 8.900   6.047   -27.561 1.00 0.00 ? 14  THR A OG1  2  
ATOM   811   C  CG2  . THR A 1 14 ? 8.548   3.659   -27.483 1.00 0.00 ? 14  THR A CG2  2  
ATOM   812   H  H    . THR A 1 14 ? 10.530  2.678   -29.023 1.00 0.00 ? 14  THR A H    2  
ATOM   813   H  HA   . THR A 1 14 ? 11.211  5.481   -28.682 1.00 0.00 ? 14  THR A HA   2  
ATOM   814   H  HB   . THR A 1 14 ? 8.885   4.837   -29.224 1.00 0.00 ? 14  THR A HB   2  
ATOM   815   H  HG1  . THR A 1 14 ? 8.121   6.423   -27.978 1.00 0.00 ? 14  THR A HG1  2  
ATOM   816   H  HG21 . THR A 1 14 ? 8.211   2.933   -28.207 1.00 0.00 ? 14  THR A HG21 2  
ATOM   817   H  HG22 . THR A 1 14 ? 7.702   4.035   -26.927 1.00 0.00 ? 14  THR A HG22 2  
ATOM   818   H  HG23 . THR A 1 14 ? 9.246   3.192   -26.804 1.00 0.00 ? 14  THR A HG23 2  
ATOM   819   N  N    . HIS A 1 15 ? 11.415  5.681   -26.130 1.00 0.00 ? 15  HIS A N    2  
ATOM   820   C  CA   . HIS A 1 15 ? 11.883  5.730   -24.749 1.00 0.00 ? 15  HIS A CA   2  
ATOM   821   C  C    . HIS A 1 15 ? 10.756  6.145   -23.808 1.00 0.00 ? 15  HIS A C    2  
ATOM   822   O  O    . HIS A 1 15 ? 9.783   6.772   -24.228 1.00 0.00 ? 15  HIS A O    2  
ATOM   823   C  CB   . HIS A 1 15 ? 13.055  6.704   -24.621 1.00 0.00 ? 15  HIS A CB   2  
ATOM   824   C  CG   . HIS A 1 15 ? 14.042  6.604   -25.743 1.00 0.00 ? 15  HIS A CG   2  
ATOM   825   N  ND1  . HIS A 1 15 ? 14.929  5.557   -25.874 1.00 0.00 ? 15  HIS A ND1  2  
ATOM   826   C  CD2  . HIS A 1 15 ? 14.278  7.428   -26.791 1.00 0.00 ? 15  HIS A CD2  2  
ATOM   827   C  CE1  . HIS A 1 15 ? 15.669  5.742   -26.953 1.00 0.00 ? 15  HIS A CE1  2  
ATOM   828   N  NE2  . HIS A 1 15 ? 15.293  6.870   -27.527 1.00 0.00 ? 15  HIS A NE2  2  
ATOM   829   H  H    . HIS A 1 15 ? 11.208  6.518   -26.595 1.00 0.00 ? 15  HIS A H    2  
ATOM   830   H  HA   . HIS A 1 15 ? 12.217  4.741   -24.477 1.00 0.00 ? 15  HIS A HA   2  
ATOM   831   H  HB2  . HIS A 1 15 ? 12.675  7.714   -24.603 1.00 0.00 ? 15  HIS A HB2  2  
ATOM   832   H  HB3  . HIS A 1 15 ? 13.580  6.505   -23.698 1.00 0.00 ? 15  HIS A HB3  2  
ATOM   833   H  HD1  . HIS A 1 15 ? 15.006  4.792   -25.267 1.00 0.00 ? 15  HIS A HD1  2  
ATOM   834   H  HD2  . HIS A 1 15 ? 13.763  8.354   -27.007 1.00 0.00 ? 15  HIS A HD2  2  
ATOM   835   H  HE1  . HIS A 1 15 ? 16.448  5.083   -27.306 1.00 0.00 ? 15  HIS A HE1  2  
ATOM   836   N  N    . ARG A 1 16 ? 10.895  5.792   -22.535 1.00 0.00 ? 16  ARG A N    2  
ATOM   837   C  CA   . ARG A 1 16 ? 9.888   6.126   -21.535 1.00 0.00 ? 16  ARG A CA   2  
ATOM   838   C  C    . ARG A 1 16 ? 10.533  6.748   -20.300 1.00 0.00 ? 16  ARG A C    2  
ATOM   839   O  O    . ARG A 1 16 ? 11.636  6.381   -19.894 1.00 0.00 ? 16  ARG A O    2  
ATOM   840   C  CB   . ARG A 1 16 ? 9.100   4.876   -21.137 1.00 0.00 ? 16  ARG A CB   2  
ATOM   841   C  CG   . ARG A 1 16 ? 9.974   3.741   -20.629 1.00 0.00 ? 16  ARG A CG   2  
ATOM   842   C  CD   . ARG A 1 16 ? 10.191  3.835   -19.127 1.00 0.00 ? 16  ARG A CD   2  
ATOM   843   N  NE   . ARG A 1 16 ? 11.292  2.985   -18.679 1.00 0.00 ? 16  ARG A NE   2  
ATOM   844   C  CZ   . ARG A 1 16 ? 11.180  1.675   -18.493 1.00 0.00 ? 16  ARG A CZ   2  
ATOM   845   N  NH1  . ARG A 1 16 ? 10.022  1.067   -18.715 1.00 0.00 ? 16  ARG A NH1  2  
ATOM   846   N  NH2  . ARG A 1 16 ? 12.227  0.969   -18.084 1.00 0.00 ? 16  ARG A NH2  2  
ATOM   847   H  H    . ARG A 1 16 ? 11.693  5.294   -22.261 1.00 0.00 ? 16  ARG A H    2  
ATOM   848   H  HA   . ARG A 1 16 ? 9.211   6.843   -21.973 1.00 0.00 ? 16  ARG A HA   2  
ATOM   849   H  HB2  . ARG A 1 16 ? 8.400   5.139   -20.357 1.00 0.00 ? 16  ARG A HB2  2  
ATOM   850   H  HB3  . ARG A 1 16 ? 8.551   4.523   -21.997 1.00 0.00 ? 16  ARG A HB3  2  
ATOM   851   H  HG2  . ARG A 1 16 ? 9.493   2.801   -20.854 1.00 0.00 ? 16  ARG A HG2  2  
ATOM   852   H  HG3  . ARG A 1 16 ? 10.931  3.786   -21.126 1.00 0.00 ? 16  ARG A HG3  2  
ATOM   853   H  HD2  . ARG A 1 16 ? 10.414  4.860   -18.872 1.00 0.00 ? 16  ARG A HD2  2  
ATOM   854   H  HD3  . ARG A 1 16 ? 9.285   3.528   -18.626 1.00 0.00 ? 16  ARG A HD3  2  
ATOM   855   H  HE   . ARG A 1 16 ? 12.156  3.414   -18.509 1.00 0.00 ? 16  ARG A HE   2  
ATOM   856   H  HH11 . ARG A 1 16 ? 9.232   1.595   -19.024 1.00 0.00 ? 16  ARG A HH11 2  
ATOM   857   H  HH12 . ARG A 1 16 ? 9.941   0.080   -18.576 1.00 0.00 ? 16  ARG A HH12 2  
ATOM   858   H  HH21 . ARG A 1 16 ? 13.101  1.424   -17.916 1.00 0.00 ? 16  ARG A HH21 2  
ATOM   859   H  HH22 . ARG A 1 16 ? 12.141  -0.016  -17.944 1.00 0.00 ? 16  ARG A HH22 2  
ATOM   860   N  N    . PRO A 1 17 ? 9.831   7.713   -19.688 1.00 0.00 ? 17  PRO A N    2  
ATOM   861   C  CA   . PRO A 1 17 ? 10.316  8.407   -18.491 1.00 0.00 ? 17  PRO A CA   2  
ATOM   862   C  C    . PRO A 1 17 ? 10.330  7.504   -17.263 1.00 0.00 ? 17  PRO A C    2  
ATOM   863   O  O    . PRO A 1 17 ? 9.789   6.397   -17.288 1.00 0.00 ? 17  PRO A O    2  
ATOM   864   C  CB   . PRO A 1 17 ? 9.307   9.544   -18.307 1.00 0.00 ? 17  PRO A CB   2  
ATOM   865   C  CG   . PRO A 1 17 ? 8.062   9.055   -18.963 1.00 0.00 ? 17  PRO A CG   2  
ATOM   866   C  CD   . PRO A 1 17 ? 8.510   8.202   -20.117 1.00 0.00 ? 17  PRO A CD   2  
ATOM   867   H  HA   . PRO A 1 17 ? 11.302  8.820   -18.644 1.00 0.00 ? 17  PRO A HA   2  
ATOM   868   H  HB2  . PRO A 1 17 ? 9.154   9.725   -17.253 1.00 0.00 ? 17  PRO A HB2  2  
ATOM   869   H  HB3  . PRO A 1 17 ? 9.678   10.440  -18.782 1.00 0.00 ? 17  PRO A HB3  2  
ATOM   870   H  HG2  . PRO A 1 17 ? 7.485   8.469   -18.265 1.00 0.00 ? 17  PRO A HG2  2  
ATOM   871   H  HG3  . PRO A 1 17 ? 7.483   9.894   -19.321 1.00 0.00 ? 17  PRO A HG3  2  
ATOM   872   H  HD2  . PRO A 1 17 ? 7.825   7.380   -20.267 1.00 0.00 ? 17  PRO A HD2  2  
ATOM   873   H  HD3  . PRO A 1 17 ? 8.592   8.795   -21.016 1.00 0.00 ? 17  PRO A HD3  2  
ATOM   874   N  N    . HIS A 1 18 ? 10.951  7.981   -16.190 1.00 0.00 ? 18  HIS A N    2  
ATOM   875   C  CA   . HIS A 1 18 ? 11.035  7.216   -14.951 1.00 0.00 ? 18  HIS A CA   2  
ATOM   876   C  C    . HIS A 1 18 ? 9.844   7.516   -14.046 1.00 0.00 ? 18  HIS A C    2  
ATOM   877   O  O    . HIS A 1 18 ? 9.413   8.661   -13.905 1.00 0.00 ? 18  HIS A O    2  
ATOM   878   C  CB   . HIS A 1 18 ? 12.339  7.532   -14.218 1.00 0.00 ? 18  HIS A CB   2  
ATOM   879   C  CG   . HIS A 1 18 ? 12.479  6.818   -12.909 1.00 0.00 ? 18  HIS A CG   2  
ATOM   880   N  ND1  . HIS A 1 18 ? 12.981  5.538   -12.800 1.00 0.00 ? 18  HIS A ND1  2  
ATOM   881   C  CD2  . HIS A 1 18 ? 12.181  7.212   -11.649 1.00 0.00 ? 18  HIS A CD2  2  
ATOM   882   C  CE1  . HIS A 1 18 ? 12.984  5.175   -11.530 1.00 0.00 ? 18  HIS A CE1  2  
ATOM   883   N  NE2  . HIS A 1 18 ? 12.504  6.174   -10.810 1.00 0.00 ? 18  HIS A NE2  2  
ATOM   884   H  H    . HIS A 1 18 ? 11.363  8.869   -16.232 1.00 0.00 ? 18  HIS A H    2  
ATOM   885   H  HA   . HIS A 1 18 ? 11.021  6.168   -15.207 1.00 0.00 ? 18  HIS A HA   2  
ATOM   886   H  HB2  . HIS A 1 18 ? 13.173  7.246   -14.842 1.00 0.00 ? 18  HIS A HB2  2  
ATOM   887   H  HB3  . HIS A 1 18 ? 12.388  8.594   -14.025 1.00 0.00 ? 18  HIS A HB3  2  
ATOM   888   H  HD1  . HIS A 1 18 ? 13.287  4.978   -13.543 1.00 0.00 ? 18  HIS A HD1  2  
ATOM   889   H  HD2  . HIS A 1 18 ? 11.766  8.167   -11.357 1.00 0.00 ? 18  HIS A HD2  2  
ATOM   890   H  HE1  . HIS A 1 18 ? 13.321  4.225   -11.144 1.00 0.00 ? 18  HIS A HE1  2  
ATOM   891   N  N    . PRO A 1 19 ? 9.297   6.465   -13.417 1.00 0.00 ? 19  PRO A N    2  
ATOM   892   C  CA   . PRO A 1 19 ? 8.149   6.591   -12.515 1.00 0.00 ? 19  PRO A CA   2  
ATOM   893   C  C    . PRO A 1 19 ? 8.507   7.305   -11.217 1.00 0.00 ? 19  PRO A C    2  
ATOM   894   O  O    . PRO A 1 19 ? 9.667   7.647   -10.983 1.00 0.00 ? 19  PRO A O    2  
ATOM   895   C  CB   . PRO A 1 19 ? 7.756   5.138   -12.236 1.00 0.00 ? 19  PRO A CB   2  
ATOM   896   C  CG   . PRO A 1 19 ? 9.008   4.359   -12.448 1.00 0.00 ? 19  PRO A CG   2  
ATOM   897   C  CD   . PRO A 1 19 ? 9.759   5.072   -13.539 1.00 0.00 ? 19  PRO A CD   2  
ATOM   898   H  HA   . PRO A 1 19 ? 7.325   7.103   -12.991 1.00 0.00 ? 19  PRO A HA   2  
ATOM   899   H  HB2  . PRO A 1 19 ? 7.401   5.048   -11.219 1.00 0.00 ? 19  PRO A HB2  2  
ATOM   900   H  HB3  . PRO A 1 19 ? 6.981   4.832   -12.922 1.00 0.00 ? 19  PRO A HB3  2  
ATOM   901   H  HG2  . PRO A 1 19 ? 9.590   4.346   -11.539 1.00 0.00 ? 19  PRO A HG2  2  
ATOM   902   H  HG3  . PRO A 1 19 ? 8.767   3.353   -12.755 1.00 0.00 ? 19  PRO A HG3  2  
ATOM   903   H  HD2  . PRO A 1 19 ? 10.824  5.002   -13.372 1.00 0.00 ? 19  PRO A HD2  2  
ATOM   904   H  HD3  . PRO A 1 19 ? 9.499   4.663   -14.504 1.00 0.00 ? 19  PRO A HD3  2  
ATOM   905   N  N    . THR A 1 20 ? 7.504   7.527   -10.372 1.00 0.00 ? 20  THR A N    2  
ATOM   906   C  CA   . THR A 1 20 ? 7.713   8.201   -9.097  1.00 0.00 ? 20  THR A CA   2  
ATOM   907   C  C    . THR A 1 20 ? 7.914   7.195   -7.970  1.00 0.00 ? 20  THR A C    2  
ATOM   908   O  O    . THR A 1 20 ? 8.527   7.506   -6.949  1.00 0.00 ? 20  THR A O    2  
ATOM   909   C  CB   . THR A 1 20 ? 6.528   9.119   -8.746  1.00 0.00 ? 20  THR A CB   2  
ATOM   910   O  OG1  . THR A 1 20 ? 6.784   9.801   -7.513  1.00 0.00 ? 20  THR A OG1  2  
ATOM   911   C  CG2  . THR A 1 20 ? 5.239   8.318   -8.629  1.00 0.00 ? 20  THR A CG2  2  
ATOM   912   H  H    . THR A 1 20 ? 6.602   7.231   -10.615 1.00 0.00 ? 20  THR A H    2  
ATOM   913   H  HA   . THR A 1 20 ? 8.601   8.811   -9.184  1.00 0.00 ? 20  THR A HA   2  
ATOM   914   H  HB   . THR A 1 20 ? 6.410   9.849   -9.534  1.00 0.00 ? 20  THR A HB   2  
ATOM   915   H  HG1  . THR A 1 20 ? 6.546   9.232   -6.777  1.00 0.00 ? 20  THR A HG1  2  
ATOM   916   H  HG21 . THR A 1 20 ? 5.396   7.324   -9.022  1.00 0.00 ? 20  THR A HG21 2  
ATOM   917   H  HG22 . THR A 1 20 ? 4.459   8.808   -9.192  1.00 0.00 ? 20  THR A HG22 2  
ATOM   918   H  HG23 . THR A 1 20 ? 4.949   8.253   -7.592  1.00 0.00 ? 20  THR A HG23 2  
ATOM   919   N  N    . SER A 1 21 ? 7.395   5.986   -8.162  1.00 0.00 ? 21  SER A N    2  
ATOM   920   C  CA   . SER A 1 21 ? 7.515   4.935   -7.159  1.00 0.00 ? 21  SER A CA   2  
ATOM   921   C  C    . SER A 1 21 ? 6.963   3.614   -7.688  1.00 0.00 ? 21  SER A C    2  
ATOM   922   O  O    . SER A 1 21 ? 5.865   3.565   -8.243  1.00 0.00 ? 21  SER A O    2  
ATOM   923   C  CB   . SER A 1 21 ? 6.775   5.333   -5.881  1.00 0.00 ? 21  SER A CB   2  
ATOM   924   O  OG   . SER A 1 21 ? 7.551   6.226   -5.100  1.00 0.00 ? 21  SER A OG   2  
ATOM   925   H  H    . SER A 1 21 ? 6.917   5.799   -8.997  1.00 0.00 ? 21  SER A H    2  
ATOM   926   H  HA   . SER A 1 21 ? 8.563   4.809   -6.934  1.00 0.00 ? 21  SER A HA   2  
ATOM   927   H  HB2  . SER A 1 21 ? 5.846   5.817   -6.141  1.00 0.00 ? 21  SER A HB2  2  
ATOM   928   H  HB3  . SER A 1 21 ? 6.569   4.448   -5.296  1.00 0.00 ? 21  SER A HB3  2  
ATOM   929   H  HG   . SER A 1 21 ? 7.252   6.197   -4.188  1.00 0.00 ? 21  SER A HG   2  
ATOM   930   N  N    . ILE A 1 22 ? 7.734   2.546   -7.513  1.00 0.00 ? 22  ILE A N    2  
ATOM   931   C  CA   . ILE A 1 22 ? 7.323   1.225   -7.971  1.00 0.00 ? 22  ILE A CA   2  
ATOM   932   C  C    . ILE A 1 22 ? 6.658   0.436   -6.849  1.00 0.00 ? 22  ILE A C    2  
ATOM   933   O  O    . ILE A 1 22 ? 7.026   0.565   -5.681  1.00 0.00 ? 22  ILE A O    2  
ATOM   934   C  CB   . ILE A 1 22 ? 8.520   0.419   -8.510  1.00 0.00 ? 22  ILE A CB   2  
ATOM   935   C  CG1  . ILE A 1 22 ? 9.007   1.012   -9.834  1.00 0.00 ? 22  ILE A CG1  2  
ATOM   936   C  CG2  . ILE A 1 22 ? 8.137   -1.043  -8.687  1.00 0.00 ? 22  ILE A CG2  2  
ATOM   937   C  CD1  . ILE A 1 22 ? 9.702   2.346   -9.679  1.00 0.00 ? 22  ILE A CD1  2  
ATOM   938   H  H    . ILE A 1 22 ? 8.599   2.649   -7.064  1.00 0.00 ? 22  ILE A H    2  
ATOM   939   H  HA   . ILE A 1 22 ? 6.613   1.357   -8.774  1.00 0.00 ? 22  ILE A HA   2  
ATOM   940   H  HB   . ILE A 1 22 ? 9.317   0.472   -7.785  1.00 0.00 ? 22  ILE A HB   2  
ATOM   941   H  HG12 . ILE A 1 22 ? 9.703   0.327   -10.293 1.00 0.00 ? 22  ILE A HG12 2  
ATOM   942   H  HG13 . ILE A 1 22 ? 8.160   1.152   -10.490 1.00 0.00 ? 22  ILE A HG13 2  
ATOM   943   H  HG21 . ILE A 1 22 ? 8.428   -1.600  -7.809  1.00 0.00 ? 22  ILE A HG21 2  
ATOM   944   H  HG22 . ILE A 1 22 ? 7.069   -1.121  -8.824  1.00 0.00 ? 22  ILE A HG22 2  
ATOM   945   H  HG23 . ILE A 1 22 ? 8.642   -1.445  -9.552  1.00 0.00 ? 22  ILE A HG23 2  
ATOM   946   H  HD11 . ILE A 1 22 ? 10.134  2.640   -10.624 1.00 0.00 ? 22  ILE A HD11 2  
ATOM   947   H  HD12 . ILE A 1 22 ? 8.988   3.090   -9.362  1.00 0.00 ? 22  ILE A HD12 2  
ATOM   948   H  HD13 . ILE A 1 22 ? 10.485  2.260   -8.938  1.00 0.00 ? 22  ILE A HD13 2  
ATOM   949   N  N    . CYS A 1 23 ? 5.676   -0.383  -7.210  1.00 0.00 ? 23  CYS A N    2  
ATOM   950   C  CA   . CYS A 1 23 ? 4.958   -1.195  -6.235  1.00 0.00 ? 23  CYS A CA   2  
ATOM   951   C  C    . CYS A 1 23 ? 5.885   -2.230  -5.602  1.00 0.00 ? 23  CYS A C    2  
ATOM   952   O  O    . CYS A 1 23 ? 7.039   -2.374  -6.005  1.00 0.00 ? 23  CYS A O    2  
ATOM   953   C  CB   . CYS A 1 23 ? 3.771   -1.896  -6.898  1.00 0.00 ? 23  CYS A CB   2  
ATOM   954   S  SG   . CYS A 1 23 ? 2.429   -2.335  -5.747  1.00 0.00 ? 23  CYS A SG   2  
ATOM   955   H  H    . CYS A 1 23 ? 5.427   -0.443  -8.157  1.00 0.00 ? 23  CYS A H    2  
ATOM   956   H  HA   . CYS A 1 23 ? 4.592   -0.538  -5.462  1.00 0.00 ? 23  CYS A HA   2  
ATOM   957   H  HB2  . CYS A 1 23 ? 3.355   -1.244  -7.653  1.00 0.00 ? 23  CYS A HB2  2  
ATOM   958   H  HB3  . CYS A 1 23 ? 4.115   -2.806  -7.366  1.00 0.00 ? 23  CYS A HB3  2  
ATOM   959   N  N    . ASP A 1 24 ? 5.370   -2.948  -4.610  1.00 0.00 ? 24  ASP A N    2  
ATOM   960   C  CA   . ASP A 1 24 ? 6.149   -3.971  -3.922  1.00 0.00 ? 24  ASP A CA   2  
ATOM   961   C  C    . ASP A 1 24 ? 5.711   -5.368  -4.350  1.00 0.00 ? 24  ASP A C    2  
ATOM   962   O  O    . ASP A 1 24 ? 6.463   -6.332  -4.219  1.00 0.00 ? 24  ASP A O    2  
ATOM   963   C  CB   . ASP A 1 24 ? 6.006   -3.819  -2.407  1.00 0.00 ? 24  ASP A CB   2  
ATOM   964   C  CG   . ASP A 1 24 ? 7.090   -4.555  -1.646  1.00 0.00 ? 24  ASP A CG   2  
ATOM   965   O  OD1  . ASP A 1 24 ? 6.979   -5.791  -1.500  1.00 0.00 ? 24  ASP A OD1  2  
ATOM   966   O  OD2  . ASP A 1 24 ? 8.051   -3.896  -1.197  1.00 0.00 ? 24  ASP A OD2  2  
ATOM   967   H  H    . ASP A 1 24 ? 4.443   -2.787  -4.334  1.00 0.00 ? 24  ASP A H    2  
ATOM   968   H  HA   . ASP A 1 24 ? 7.186   -3.835  -4.191  1.00 0.00 ? 24  ASP A HA   2  
ATOM   969   H  HB2  . ASP A 1 24 ? 6.060   -2.771  -2.150  1.00 0.00 ? 24  ASP A HB2  2  
ATOM   970   H  HB3  . ASP A 1 24 ? 5.047   -4.211  -2.102  1.00 0.00 ? 24  ASP A HB3  2  
ATOM   971   N  N    . ASN A 1 25 ? 4.488   -5.468  -4.860  1.00 0.00 ? 25  ASN A N    2  
ATOM   972   C  CA   . ASN A 1 25 ? 3.948   -6.748  -5.305  1.00 0.00 ? 25  ASN A CA   2  
ATOM   973   C  C    . ASN A 1 25 ? 4.247   -6.980  -6.783  1.00 0.00 ? 25  ASN A C    2  
ATOM   974   O  O    . ASN A 1 25 ? 5.037   -7.855  -7.138  1.00 0.00 ? 25  ASN A O    2  
ATOM   975   C  CB   . ASN A 1 25 ? 2.438   -6.799  -5.065  1.00 0.00 ? 25  ASN A CB   2  
ATOM   976   C  CG   . ASN A 1 25 ? 2.092   -7.144  -3.629  1.00 0.00 ? 25  ASN A CG   2  
ATOM   977   O  OD1  . ASN A 1 25 ? 2.858   -6.859  -2.709  1.00 0.00 ? 25  ASN A OD1  2  
ATOM   978   N  ND2  . ASN A 1 25 ? 0.932   -7.760  -3.432  1.00 0.00 ? 25  ASN A ND2  2  
ATOM   979   H  H    . ASN A 1 25 ? 3.935   -4.663  -4.939  1.00 0.00 ? 25  ASN A H    2  
ATOM   980   H  HA   . ASN A 1 25 ? 4.422   -7.526  -4.727  1.00 0.00 ? 25  ASN A HA   2  
ATOM   981   H  HB2  . ASN A 1 25 ? 2.010   -5.834  -5.297  1.00 0.00 ? 25  ASN A HB2  2  
ATOM   982   H  HB3  . ASN A 1 25 ? 2.001   -7.546  -5.711  1.00 0.00 ? 25  ASN A HB3  2  
ATOM   983   H  HD21 . ASN A 1 25 ? 0.372   -7.955  -4.212  1.00 0.00 ? 25  ASN A HD21 2  
ATOM   984   H  HD22 . ASN A 1 25 ? 0.683   -7.994  -2.513  1.00 0.00 ? 25  ASN A HD22 2  
ATOM   985   N  N    . PHE A 1 26 ? 3.611   -6.190  -7.641  1.00 0.00 ? 26  PHE A N    2  
ATOM   986   C  CA   . PHE A 1 26 ? 3.809   -6.309  -9.081  1.00 0.00 ? 26  PHE A CA   2  
ATOM   987   C  C    . PHE A 1 26 ? 5.286   -6.183  -9.440  1.00 0.00 ? 26  PHE A C    2  
ATOM   988   O  O    . PHE A 1 26 ? 5.731   -6.685  -10.472 1.00 0.00 ? 26  PHE A O    2  
ATOM   989   C  CB   . PHE A 1 26 ? 3.001   -5.239  -9.819  1.00 0.00 ? 26  PHE A CB   2  
ATOM   990   C  CG   . PHE A 1 26 ? 2.556   -5.662  -11.189 1.00 0.00 ? 26  PHE A CG   2  
ATOM   991   C  CD1  . PHE A 1 26 ? 3.470   -5.776  -12.224 1.00 0.00 ? 26  PHE A CD1  2  
ATOM   992   C  CD2  . PHE A 1 26 ? 1.224   -5.946  -11.443 1.00 0.00 ? 26  PHE A CD2  2  
ATOM   993   C  CE1  . PHE A 1 26 ? 3.064   -6.164  -13.487 1.00 0.00 ? 26  PHE A CE1  2  
ATOM   994   C  CE2  . PHE A 1 26 ? 0.811   -6.335  -12.703 1.00 0.00 ? 26  PHE A CE2  2  
ATOM   995   C  CZ   . PHE A 1 26 ? 1.733   -6.445  -13.726 1.00 0.00 ? 26  PHE A CZ   2  
ATOM   996   H  H    . PHE A 1 26 ? 2.993   -5.510  -7.298  1.00 0.00 ? 26  PHE A H    2  
ATOM   997   H  HA   . PHE A 1 26 ? 3.459   -7.284  -9.383  1.00 0.00 ? 26  PHE A HA   2  
ATOM   998   H  HB2  . PHE A 1 26 ? 2.119   -5.003  -9.242  1.00 0.00 ? 26  PHE A HB2  2  
ATOM   999   H  HB3  . PHE A 1 26 ? 3.605   -4.350  -9.924  1.00 0.00 ? 26  PHE A HB3  2  
ATOM   1000  H  HD1  . PHE A 1 26 ? 4.512   -5.557  -12.038 1.00 0.00 ? 26  PHE A HD1  2  
ATOM   1001  H  HD2  . PHE A 1 26 ? 0.502   -5.860  -10.643 1.00 0.00 ? 26  PHE A HD2  2  
ATOM   1002  H  HE1  . PHE A 1 26 ? 3.786   -6.250  -14.285 1.00 0.00 ? 26  PHE A HE1  2  
ATOM   1003  H  HE2  . PHE A 1 26 ? -0.230  -6.555  -12.887 1.00 0.00 ? 26  PHE A HE2  2  
ATOM   1004  H  HZ   . PHE A 1 26 ? 1.412   -6.749  -14.712 1.00 0.00 ? 26  PHE A HZ   2  
ATOM   1005  N  N    . SER A 1 27 ? 6.043   -5.509  -8.579  1.00 0.00 ? 27  SER A N    2  
ATOM   1006  C  CA   . SER A 1 27 ? 7.470   -5.312  -8.807  1.00 0.00 ? 27  SER A CA   2  
ATOM   1007  C  C    . SER A 1 27 ? 8.168   -6.645  -9.058  1.00 0.00 ? 27  SER A C    2  
ATOM   1008  O  O    . SER A 1 27 ? 8.693   -6.888  -10.144 1.00 0.00 ? 27  SER A O    2  
ATOM   1009  C  CB   . SER A 1 27 ? 8.106   -4.608  -7.607  1.00 0.00 ? 27  SER A CB   2  
ATOM   1010  O  OG   . SER A 1 27 ? 9.512   -4.790  -7.596  1.00 0.00 ? 27  SER A OG   2  
ATOM   1011  H  H    . SER A 1 27 ? 5.630   -5.132  -7.774  1.00 0.00 ? 27  SER A H    2  
ATOM   1012  H  HA   . SER A 1 27 ? 7.584   -4.689  -9.681  1.00 0.00 ? 27  SER A HA   2  
ATOM   1013  H  HB2  . SER A 1 27 ? 7.892   -3.552  -7.657  1.00 0.00 ? 27  SER A HB2  2  
ATOM   1014  H  HB3  . SER A 1 27 ? 7.695   -5.016  -6.694  1.00 0.00 ? 27  SER A HB3  2  
ATOM   1015  H  HG   . SER A 1 27 ? 9.938   -4.014  -7.967  1.00 0.00 ? 27  SER A HG   2  
ATOM   1016  N  N    . ALA A 1 28 ? 8.169   -7.506  -8.045  1.00 0.00 ? 28  ALA A N    2  
ATOM   1017  C  CA   . ALA A 1 28 ? 8.801   -8.815  -8.155  1.00 0.00 ? 28  ALA A CA   2  
ATOM   1018  C  C    . ALA A 1 28 ? 7.777   -9.890  -8.505  1.00 0.00 ? 28  ALA A C    2  
ATOM   1019  O  O    . ALA A 1 28 ? 7.889   -10.557 -9.534  1.00 0.00 ? 28  ALA A O    2  
ATOM   1020  C  CB   . ALA A 1 28 ? 9.517   -9.166  -6.860  1.00 0.00 ? 28  ALA A CB   2  
ATOM   1021  H  H    . ALA A 1 28 ? 7.734   -7.254  -7.204  1.00 0.00 ? 28  ALA A H    2  
ATOM   1022  H  HA   . ALA A 1 28 ? 9.538   -8.764  -8.944  1.00 0.00 ? 28  ALA A HA   2  
ATOM   1023  H  HB1  . ALA A 1 28 ? 9.327   -8.398  -6.125  1.00 0.00 ? 28  ALA A HB1  2  
ATOM   1024  H  HB2  . ALA A 1 28 ? 9.153   -10.114 -6.493  1.00 0.00 ? 28  ALA A HB2  2  
ATOM   1025  H  HB3  . ALA A 1 28 ? 10.579  -9.234  -7.044  1.00 0.00 ? 28  ALA A HB3  2  
ATOM   1026  N  N    . TYR A 1 29 ? 6.781   -10.054 -7.641  1.00 0.00 ? 29  TYR A N    2  
ATOM   1027  C  CA   . TYR A 1 29 ? 5.739   -11.051 -7.857  1.00 0.00 ? 29  TYR A CA   2  
ATOM   1028  C  C    . TYR A 1 29 ? 5.162   -10.940 -9.265  1.00 0.00 ? 29  TYR A C    2  
ATOM   1029  O  O    . TYR A 1 29 ? 5.042   -11.934 -9.980  1.00 0.00 ? 29  TYR A O    2  
ATOM   1030  C  CB   . TYR A 1 29 ? 4.625   -10.888 -6.822  1.00 0.00 ? 29  TYR A CB   2  
ATOM   1031  C  CG   . TYR A 1 29 ? 5.113   -10.946 -5.392  1.00 0.00 ? 29  TYR A CG   2  
ATOM   1032  C  CD1  . TYR A 1 29 ? 5.663   -9.827  -4.779  1.00 0.00 ? 29  TYR A CD1  2  
ATOM   1033  C  CD2  . TYR A 1 29 ? 5.024   -12.120 -4.655  1.00 0.00 ? 29  TYR A CD2  2  
ATOM   1034  C  CE1  . TYR A 1 29 ? 6.111   -9.877  -3.473  1.00 0.00 ? 29  TYR A CE1  2  
ATOM   1035  C  CE2  . TYR A 1 29 ? 5.468   -12.178 -3.348  1.00 0.00 ? 29  TYR A CE2  2  
ATOM   1036  C  CZ   . TYR A 1 29 ? 6.012   -11.054 -2.762  1.00 0.00 ? 29  TYR A CZ   2  
ATOM   1037  O  OH   . TYR A 1 29 ? 6.455   -11.107 -1.460  1.00 0.00 ? 29  TYR A OH   2  
ATOM   1038  H  H    . TYR A 1 29 ? 6.746   -9.493  -6.839  1.00 0.00 ? 29  TYR A H    2  
ATOM   1039  H  HA   . TYR A 1 29 ? 6.186   -12.028 -7.740  1.00 0.00 ? 29  TYR A HA   2  
ATOM   1040  H  HB2  . TYR A 1 29 ? 4.144   -9.933  -6.969  1.00 0.00 ? 29  TYR A HB2  2  
ATOM   1041  H  HB3  . TYR A 1 29 ? 3.899   -11.676 -6.958  1.00 0.00 ? 29  TYR A HB3  2  
ATOM   1042  H  HD1  . TYR A 1 29 ? 5.739   -8.907  -5.339  1.00 0.00 ? 29  TYR A HD1  2  
ATOM   1043  H  HD2  . TYR A 1 29 ? 4.598   -12.999 -5.117  1.00 0.00 ? 29  TYR A HD2  2  
ATOM   1044  H  HE1  . TYR A 1 29 ? 6.536   -8.996  -3.014  1.00 0.00 ? 29  TYR A HE1  2  
ATOM   1045  H  HE2  . TYR A 1 29 ? 5.391   -13.100 -2.791  1.00 0.00 ? 29  TYR A HE2  2  
ATOM   1046  H  HH   . TYR A 1 29 ? 5.706   -11.036 -0.864  1.00 0.00 ? 29  TYR A HH   2  
ATOM   1047  N  N    . GLY A 1 30 ? 4.806   -9.720  -9.657  1.00 0.00 ? 30  GLY A N    2  
ATOM   1048  C  CA   . GLY A 1 30 ? 4.245   -9.499  -10.977 1.00 0.00 ? 30  GLY A CA   2  
ATOM   1049  C  C    . GLY A 1 30 ? 2.774   -9.136  -10.929 1.00 0.00 ? 30  GLY A C    2  
ATOM   1050  O  O    . GLY A 1 30 ? 2.263   -8.472  -11.830 1.00 0.00 ? 30  GLY A O    2  
ATOM   1051  H  H    . GLY A 1 30 ? 4.924   -8.964  -9.044  1.00 0.00 ? 30  GLY A H    2  
ATOM   1052  H  HA2  . GLY A 1 30 ? 4.788   -8.698  -11.457 1.00 0.00 ? 30  GLY A HA2  2  
ATOM   1053  H  HA3  . GLY A 1 30 ? 4.363   -10.400 -11.561 1.00 0.00 ? 30  GLY A HA3  2  
ATOM   1054  N  N    . TRP A 1 31 ? 2.093   -9.575  -9.877  1.00 0.00 ? 31  TRP A N    2  
ATOM   1055  C  CA   . TRP A 1 31 ? 0.671   -9.294  -9.717  1.00 0.00 ? 31  TRP A CA   2  
ATOM   1056  C  C    . TRP A 1 31 ? 0.436   -8.308  -8.578  1.00 0.00 ? 31  TRP A C    2  
ATOM   1057  O  O    . TRP A 1 31 ? 1.284   -8.143  -7.701  1.00 0.00 ? 31  TRP A O    2  
ATOM   1058  C  CB   . TRP A 1 31 ? -0.100  -10.589 -9.453  1.00 0.00 ? 31  TRP A CB   2  
ATOM   1059  C  CG   . TRP A 1 31 ? -0.227  -10.918 -7.997  1.00 0.00 ? 31  TRP A CG   2  
ATOM   1060  C  CD1  . TRP A 1 31 ? 0.698   -11.550 -7.215  1.00 0.00 ? 31  TRP A CD1  2  
ATOM   1061  C  CD2  . TRP A 1 31 ? -1.346  -10.635 -7.149  1.00 0.00 ? 31  TRP A CD2  2  
ATOM   1062  N  NE1  . TRP A 1 31 ? 0.222   -11.676 -5.933  1.00 0.00 ? 31  TRP A NE1  2  
ATOM   1063  C  CE2  . TRP A 1 31 ? -1.029  -11.122 -5.866  1.00 0.00 ? 31  TRP A CE2  2  
ATOM   1064  C  CE3  . TRP A 1 31 ? -2.582  -10.015 -7.348  1.00 0.00 ? 31  TRP A CE3  2  
ATOM   1065  C  CZ2  . TRP A 1 31 ? -1.906  -11.008 -4.790  1.00 0.00 ? 31  TRP A CZ2  2  
ATOM   1066  C  CZ3  . TRP A 1 31 ? -3.451  -9.904  -6.279  1.00 0.00 ? 31  TRP A CZ3  2  
ATOM   1067  C  CH2  . TRP A 1 31 ? -3.110  -10.398 -5.013  1.00 0.00 ? 31  TRP A CH2  2  
ATOM   1068  H  H    . TRP A 1 31 ? 2.556   -10.100 -9.192  1.00 0.00 ? 31  TRP A H    2  
ATOM   1069  H  HA   . TRP A 1 31 ? 0.315   -8.855  -10.637 1.00 0.00 ? 31  TRP A HA   2  
ATOM   1070  H  HB2  . TRP A 1 31 ? -1.095  -10.498 -9.863  1.00 0.00 ? 31  TRP A HB2  2  
ATOM   1071  H  HB3  . TRP A 1 31 ? 0.412   -11.408 -9.938  1.00 0.00 ? 31  TRP A HB3  2  
ATOM   1072  H  HD1  . TRP A 1 31 ? 1.657   -11.896 -7.568  1.00 0.00 ? 31  TRP A HD1  2  
ATOM   1073  H  HE1  . TRP A 1 31 ? 0.702   -12.094 -5.187  1.00 0.00 ? 31  TRP A HE1  2  
ATOM   1074  H  HE3  . TRP A 1 31 ? -2.863  -9.628  -8.316  1.00 0.00 ? 31  TRP A HE3  2  
ATOM   1075  H  HZ2  . TRP A 1 31 ? -1.657  -11.383 -3.808  1.00 0.00 ? 31  TRP A HZ2  2  
ATOM   1076  H  HZ3  . TRP A 1 31 ? -4.412  -9.428  -6.414  1.00 0.00 ? 31  TRP A HZ3  2  
ATOM   1077  H  HH2  . TRP A 1 31 ? -3.819  -10.289 -4.208  1.00 0.00 ? 31  TRP A HH2  2  
ATOM   1078  N  N    . CYS A 1 32 ? -0.721  -7.654  -8.596  1.00 0.00 ? 32  CYS A N    2  
ATOM   1079  C  CA   . CYS A 1 32 ? -1.068  -6.683  -7.565  1.00 0.00 ? 32  CYS A CA   2  
ATOM   1080  C  C    . CYS A 1 32 ? -2.568  -6.701  -7.284  1.00 0.00 ? 32  CYS A C    2  
ATOM   1081  O  O    . CYS A 1 32 ? -3.395  -6.723  -8.196  1.00 0.00 ? 32  CYS A O    2  
ATOM   1082  C  CB   . CYS A 1 32 ? -0.634  -5.279  -7.990  1.00 0.00 ? 32  CYS A CB   2  
ATOM   1083  S  SG   . CYS A 1 32 ? -0.904  -4.001  -6.721  1.00 0.00 ? 32  CYS A SG   2  
ATOM   1084  H  H    . CYS A 1 32 ? -1.358  -7.828  -9.322  1.00 0.00 ? 32  CYS A H    2  
ATOM   1085  H  HA   . CYS A 1 32 ? -0.542  -6.955  -6.663  1.00 0.00 ? 32  CYS A HA   2  
ATOM   1086  H  HB2  . CYS A 1 32 ? 0.421   -5.292  -8.223  1.00 0.00 ? 32  CYS A HB2  2  
ATOM   1087  H  HB3  . CYS A 1 32 ? -1.188  -4.991  -8.871  1.00 0.00 ? 32  CYS A HB3  2  
ATOM   1088  N  N    . PRO A 1 33 ? -2.928  -6.690  -5.992  1.00 0.00 ? 33  PRO A N    2  
ATOM   1089  C  CA   . PRO A 1 33 ? -4.329  -6.703  -5.561  1.00 0.00 ? 33  PRO A CA   2  
ATOM   1090  C  C    . PRO A 1 33 ? -5.043  -5.393  -5.872  1.00 0.00 ? 33  PRO A C    2  
ATOM   1091  O  O    . PRO A 1 33 ? -6.229  -5.235  -5.577  1.00 0.00 ? 33  PRO A O    2  
ATOM   1092  C  CB   . PRO A 1 33 ? -4.232  -6.913  -4.047  1.00 0.00 ? 33  PRO A CB   2  
ATOM   1093  C  CG   . PRO A 1 33 ? -2.889  -6.384  -3.677  1.00 0.00 ? 33  PRO A CG   2  
ATOM   1094  C  CD   . PRO A 1 33 ? -1.995  -6.664  -4.853  1.00 0.00 ? 33  PRO A CD   2  
ATOM   1095  H  HA   . PRO A 1 33 ? -4.873  -7.523  -6.005  1.00 0.00 ? 33  PRO A HA   2  
ATOM   1096  H  HB2  . PRO A 1 33 ? -5.023  -6.366  -3.554  1.00 0.00 ? 33  PRO A HB2  2  
ATOM   1097  H  HB3  . PRO A 1 33 ? -4.318  -7.965  -3.820  1.00 0.00 ? 33  PRO A HB3  2  
ATOM   1098  H  HG2  . PRO A 1 33 ? -2.950  -5.322  -3.496  1.00 0.00 ? 33  PRO A HG2  2  
ATOM   1099  H  HG3  . PRO A 1 33 ? -2.523  -6.895  -2.799  1.00 0.00 ? 33  PRO A HG3  2  
ATOM   1100  H  HD2  . PRO A 1 33 ? -1.266  -5.875  -4.969  1.00 0.00 ? 33  PRO A HD2  2  
ATOM   1101  H  HD3  . PRO A 1 33 ? -1.504  -7.618  -4.735  1.00 0.00 ? 33  PRO A HD3  2  
ATOM   1102  N  N    . LEU A 1 34 ? -4.317  -4.455  -6.470  1.00 0.00 ? 34  LEU A N    2  
ATOM   1103  C  CA   . LEU A 1 34 ? -4.882  -3.157  -6.822  1.00 0.00 ? 34  LEU A CA   2  
ATOM   1104  C  C    . LEU A 1 34 ? -4.981  -2.999  -8.336  1.00 0.00 ? 34  LEU A C    2  
ATOM   1105  O  O    . LEU A 1 34 ? -5.604  -2.062  -8.833  1.00 0.00 ? 34  LEU A O    2  
ATOM   1106  C  CB   . LEU A 1 34 ? -4.029  -2.031  -6.235  1.00 0.00 ? 34  LEU A CB   2  
ATOM   1107  C  CG   . LEU A 1 34 ? -4.270  -1.705  -4.761  1.00 0.00 ? 34  LEU A CG   2  
ATOM   1108  C  CD1  . LEU A 1 34 ? -3.440  -0.503  -4.337  1.00 0.00 ? 34  LEU A CD1  2  
ATOM   1109  C  CD2  . LEU A 1 34 ? -5.749  -1.451  -4.506  1.00 0.00 ? 34  LEU A CD2  2  
ATOM   1110  H  H    . LEU A 1 34 ? -3.378  -4.639  -6.679  1.00 0.00 ? 34  LEU A H    2  
ATOM   1111  H  HA   . LEU A 1 34 ? -5.875  -3.103  -6.400  1.00 0.00 ? 34  LEU A HA   2  
ATOM   1112  H  HB2  . LEU A 1 34 ? -2.992  -2.309  -6.346  1.00 0.00 ? 34  LEU A HB2  2  
ATOM   1113  H  HB3  . LEU A 1 34 ? -4.224  -1.137  -6.809  1.00 0.00 ? 34  LEU A HB3  2  
ATOM   1114  H  HG   . LEU A 1 34 ? -3.966  -2.549  -4.157  1.00 0.00 ? 34  LEU A HG   2  
ATOM   1115  H  HD11 . LEU A 1 34 ? -2.675  -0.316  -5.076  1.00 0.00 ? 34  LEU A HD11 2  
ATOM   1116  H  HD12 . LEU A 1 34 ? -2.977  -0.704  -3.382  1.00 0.00 ? 34  LEU A HD12 2  
ATOM   1117  H  HD13 . LEU A 1 34 ? -4.079  0.364   -4.252  1.00 0.00 ? 34  LEU A HD13 2  
ATOM   1118  H  HD21 . LEU A 1 34 ? -6.253  -2.392  -4.344  1.00 0.00 ? 34  LEU A HD21 2  
ATOM   1119  H  HD22 . LEU A 1 34 ? -6.181  -0.954  -5.362  1.00 0.00 ? 34  LEU A HD22 2  
ATOM   1120  H  HD23 . LEU A 1 34 ? -5.861  -0.827  -3.632  1.00 0.00 ? 34  LEU A HD23 2  
ATOM   1121  N  N    . GLY A 1 35 ? -4.364  -3.925  -9.064  1.00 0.00 ? 35  GLY A N    2  
ATOM   1122  C  CA   . GLY A 1 35 ? -4.397  -3.871  -10.514 1.00 0.00 ? 35  GLY A CA   2  
ATOM   1123  C  C    . GLY A 1 35 ? -3.823  -2.579  -11.059 1.00 0.00 ? 35  GLY A C    2  
ATOM   1124  O  O    . GLY A 1 35 ? -2.889  -2.004  -10.499 1.00 0.00 ? 35  GLY A O    2  
ATOM   1125  H  H    . GLY A 1 35 ? -3.882  -4.650  -8.613  1.00 0.00 ? 35  GLY A H    2  
ATOM   1126  H  HA2  . GLY A 1 35 ? -3.827  -4.701  -10.907 1.00 0.00 ? 35  GLY A HA2  2  
ATOM   1127  H  HA3  . GLY A 1 35 ? -5.422  -3.964  -10.843 1.00 0.00 ? 35  GLY A HA3  2  
ATOM   1128  N  N    . PRO A 1 36 ? -4.385  -2.104  -12.181 1.00 0.00 ? 36  PRO A N    2  
ATOM   1129  C  CA   . PRO A 1 36 ? -3.938  -0.867  -12.827 1.00 0.00 ? 36  PRO A CA   2  
ATOM   1130  C  C    . PRO A 1 36 ? -4.286  0.373   -12.010 1.00 0.00 ? 36  PRO A C    2  
ATOM   1131  O  O    . PRO A 1 36 ? -3.651  1.418   -12.151 1.00 0.00 ? 36  PRO A O    2  
ATOM   1132  C  CB   . PRO A 1 36 ? -4.702  -0.864  -14.154 1.00 0.00 ? 36  PRO A CB   2  
ATOM   1133  C  CG   . PRO A 1 36 ? -5.917  -1.685  -13.893 1.00 0.00 ? 36  PRO A CG   2  
ATOM   1134  C  CD   . PRO A 1 36 ? -5.501  -2.737  -12.903 1.00 0.00 ? 36  PRO A CD   2  
ATOM   1135  H  HA   . PRO A 1 36 ? -2.876  -0.882  -13.022 1.00 0.00 ? 36  PRO A HA   2  
ATOM   1136  H  HB2  . PRO A 1 36 ? -4.960  0.151   -14.422 1.00 0.00 ? 36  PRO A HB2  2  
ATOM   1137  H  HB3  . PRO A 1 36 ? -4.088  -1.302  -14.927 1.00 0.00 ? 36  PRO A HB3  2  
ATOM   1138  H  HG2  . PRO A 1 36 ? -6.697  -1.066  -13.477 1.00 0.00 ? 36  PRO A HG2  2  
ATOM   1139  H  HG3  . PRO A 1 36 ? -6.252  -2.147  -14.811 1.00 0.00 ? 36  PRO A HG3  2  
ATOM   1140  H  HD2  . PRO A 1 36 ? -6.315  -2.966  -12.230 1.00 0.00 ? 36  PRO A HD2  2  
ATOM   1141  H  HD3  . PRO A 1 36 ? -5.171  -3.629  -13.415 1.00 0.00 ? 36  PRO A HD3  2  
ATOM   1142  N  N    . GLN A 1 37 ? -5.298  0.249   -11.157 1.00 0.00 ? 37  GLN A N    2  
ATOM   1143  C  CA   . GLN A 1 37 ? -5.729  1.361   -10.318 1.00 0.00 ? 37  GLN A CA   2  
ATOM   1144  C  C    . GLN A 1 37 ? -4.680  1.682   -9.259  1.00 0.00 ? 37  GLN A C    2  
ATOM   1145  O  O    . GLN A 1 37 ? -4.614  2.804   -8.755  1.00 0.00 ? 37  GLN A O    2  
ATOM   1146  C  CB   . GLN A 1 37 ? -7.064  1.033   -9.648  1.00 0.00 ? 37  GLN A CB   2  
ATOM   1147  C  CG   . GLN A 1 37 ? -8.273  1.334   -10.519 1.00 0.00 ? 37  GLN A CG   2  
ATOM   1148  C  CD   . GLN A 1 37 ? -9.567  1.373   -9.730  1.00 0.00 ? 37  GLN A CD   2  
ATOM   1149  O  OE1  . GLN A 1 37 ? -10.319 0.399   -9.700  1.00 0.00 ? 37  GLN A OE1  2  
ATOM   1150  N  NE2  . GLN A 1 37 ? -9.833  2.503   -9.085  1.00 0.00 ? 37  GLN A NE2  2  
ATOM   1151  H  H    . GLN A 1 37 ? -5.765  -0.609  -11.091 1.00 0.00 ? 37  GLN A H    2  
ATOM   1152  H  HA   . GLN A 1 37 ? -5.858  2.224   -10.953 1.00 0.00 ? 37  GLN A HA   2  
ATOM   1153  H  HB2  . GLN A 1 37 ? -7.080  -0.017  -9.398  1.00 0.00 ? 37  GLN A HB2  2  
ATOM   1154  H  HB3  . GLN A 1 37 ? -7.150  1.612   -8.740  1.00 0.00 ? 37  GLN A HB3  2  
ATOM   1155  H  HG2  . GLN A 1 37 ? -8.129  2.294   -10.993 1.00 0.00 ? 37  GLN A HG2  2  
ATOM   1156  H  HG3  . GLN A 1 37 ? -8.353  0.569   -11.277 1.00 0.00 ? 37  GLN A HG3  2  
ATOM   1157  H  HE21 . GLN A 1 37 ? -9.188  3.239   -9.156  1.00 0.00 ? 37  GLN A HE21 2  
ATOM   1158  H  HE22 . GLN A 1 37 ? -10.663 2.556   -8.568  1.00 0.00 ? 37  GLN A HE22 2  
ATOM   1159  N  N    . CYS A 1 38 ? -3.861  0.691   -8.924  1.00 0.00 ? 38  CYS A N    2  
ATOM   1160  C  CA   . CYS A 1 38 ? -2.815  0.867   -7.924  1.00 0.00 ? 38  CYS A CA   2  
ATOM   1161  C  C    . CYS A 1 38 ? -2.100  2.201   -8.114  1.00 0.00 ? 38  CYS A C    2  
ATOM   1162  O  O    . CYS A 1 38 ? -1.748  2.592   -9.227  1.00 0.00 ? 38  CYS A O    2  
ATOM   1163  C  CB   . CYS A 1 38 ? -1.807  -0.281  -8.003  1.00 0.00 ? 38  CYS A CB   2  
ATOM   1164  S  SG   . CYS A 1 38 ? -0.503  -0.214  -6.733  1.00 0.00 ? 38  CYS A SG   2  
ATOM   1165  H  H    . CYS A 1 38 ? -3.963  -0.182  -9.361  1.00 0.00 ? 38  CYS A H    2  
ATOM   1166  H  HA   . CYS A 1 38 ? -3.282  0.858   -6.951  1.00 0.00 ? 38  CYS A HA   2  
ATOM   1167  H  HB2  . CYS A 1 38 ? -2.331  -1.219  -7.885  1.00 0.00 ? 38  CYS A HB2  2  
ATOM   1168  H  HB3  . CYS A 1 38 ? -1.326  -0.262  -8.970  1.00 0.00 ? 38  CYS A HB3  2  
ATOM   1169  N  N    . PRO A 1 39 ? -1.879  2.918   -7.002  1.00 0.00 ? 39  PRO A N    2  
ATOM   1170  C  CA   . PRO A 1 39 ? -1.203  4.218   -7.020  1.00 0.00 ? 39  PRO A CA   2  
ATOM   1171  C  C    . PRO A 1 39 ? 0.280   4.096   -7.354  1.00 0.00 ? 39  PRO A C    2  
ATOM   1172  O  O    . PRO A 1 39 ? 0.916   5.069   -7.760  1.00 0.00 ? 39  PRO A O    2  
ATOM   1173  C  CB   . PRO A 1 39 ? -1.388  4.734   -5.591  1.00 0.00 ? 39  PRO A CB   2  
ATOM   1174  C  CG   . PRO A 1 39 ? -1.561  3.506   -4.764  1.00 0.00 ? 39  PRO A CG   2  
ATOM   1175  C  CD   . PRO A 1 39 ? -2.271  2.513   -5.642  1.00 0.00 ? 39  PRO A CD   2  
ATOM   1176  H  HA   . PRO A 1 39 ? -1.672  4.900   -7.714  1.00 0.00 ? 39  PRO A HA   2  
ATOM   1177  H  HB2  . PRO A 1 39 ? -0.513  5.293   -5.291  1.00 0.00 ? 39  PRO A HB2  2  
ATOM   1178  H  HB3  . PRO A 1 39 ? -2.261  5.367   -5.543  1.00 0.00 ? 39  PRO A HB3  2  
ATOM   1179  H  HG2  . PRO A 1 39 ? -0.595  3.123   -4.470  1.00 0.00 ? 39  PRO A HG2  2  
ATOM   1180  H  HG3  . PRO A 1 39 ? -2.159  3.731   -3.894  1.00 0.00 ? 39  PRO A HG3  2  
ATOM   1181  H  HD2  . PRO A 1 39 ? -1.935  1.510   -5.425  1.00 0.00 ? 39  PRO A HD2  2  
ATOM   1182  H  HD3  . PRO A 1 39 ? -3.340  2.591   -5.511  1.00 0.00 ? 39  PRO A HD3  2  
ATOM   1183  N  N    . GLN A 1 40 ? 0.824   2.896   -7.181  1.00 0.00 ? 40  GLN A N    2  
ATOM   1184  C  CA   . GLN A 1 40 ? 2.233   2.649   -7.464  1.00 0.00 ? 40  GLN A CA   2  
ATOM   1185  C  C    . GLN A 1 40 ? 2.428   2.210   -8.911  1.00 0.00 ? 40  GLN A C    2  
ATOM   1186  O  O    . GLN A 1 40 ? 1.474   1.826   -9.588  1.00 0.00 ? 40  GLN A O    2  
ATOM   1187  C  CB   . GLN A 1 40 ? 2.786   1.582   -6.516  1.00 0.00 ? 40  GLN A CB   2  
ATOM   1188  C  CG   . GLN A 1 40 ? 3.095   2.107   -5.124  1.00 0.00 ? 40  GLN A CG   2  
ATOM   1189  C  CD   . GLN A 1 40 ? 4.486   2.701   -5.020  1.00 0.00 ? 40  GLN A CD   2  
ATOM   1190  O  OE1  . GLN A 1 40 ? 5.162   2.910   -6.028  1.00 0.00 ? 40  GLN A OE1  2  
ATOM   1191  N  NE2  . GLN A 1 40 ? 4.922   2.977   -3.796  1.00 0.00 ? 40  GLN A NE2  2  
ATOM   1192  H  H    . GLN A 1 40 ? 0.266   2.161   -6.854  1.00 0.00 ? 40  GLN A H    2  
ATOM   1193  H  HA   . GLN A 1 40 ? 2.770   3.571   -7.305  1.00 0.00 ? 40  GLN A HA   2  
ATOM   1194  H  HB2  . GLN A 1 40 ? 2.061   0.788   -6.426  1.00 0.00 ? 40  GLN A HB2  2  
ATOM   1195  H  HB3  . GLN A 1 40 ? 3.697   1.182   -6.937  1.00 0.00 ? 40  GLN A HB3  2  
ATOM   1196  H  HG2  . GLN A 1 40 ? 2.375   2.872   -4.873  1.00 0.00 ? 40  GLN A HG2  2  
ATOM   1197  H  HG3  . GLN A 1 40 ? 3.014   1.292   -4.420  1.00 0.00 ? 40  GLN A HG3  2  
ATOM   1198  H  HE21 . GLN A 1 40 ? 4.330   2.783   -3.039  1.00 0.00 ? 40  GLN A HE21 2  
ATOM   1199  H  HE22 . GLN A 1 40 ? 5.818   3.361   -3.700  1.00 0.00 ? 40  GLN A HE22 2  
ATOM   1200  N  N    . SER A 1 41 ? 3.671   2.270   -9.380  1.00 0.00 ? 41  SER A N    2  
ATOM   1201  C  CA   . SER A 1 41 ? 3.990   1.883   -10.749 1.00 0.00 ? 41  SER A CA   2  
ATOM   1202  C  C    . SER A 1 41 ? 4.337   0.399   -10.828 1.00 0.00 ? 41  SER A C    2  
ATOM   1203  O  O    . SER A 1 41 ? 4.904   -0.168  -9.893  1.00 0.00 ? 41  SER A O    2  
ATOM   1204  C  CB   . SER A 1 41 ? 5.157   2.719   -11.279 1.00 0.00 ? 41  SER A CB   2  
ATOM   1205  O  OG   . SER A 1 41 ? 5.073   2.880   -12.684 1.00 0.00 ? 41  SER A OG   2  
ATOM   1206  H  H    . SER A 1 41 ? 4.389   2.585   -8.792  1.00 0.00 ? 41  SER A H    2  
ATOM   1207  H  HA   . SER A 1 41 ? 3.119   2.070   -11.359 1.00 0.00 ? 41  SER A HA   2  
ATOM   1208  H  HB2  . SER A 1 41 ? 5.138   3.694   -10.816 1.00 0.00 ? 41  SER A HB2  2  
ATOM   1209  H  HB3  . SER A 1 41 ? 6.088   2.225   -11.040 1.00 0.00 ? 41  SER A HB3  2  
ATOM   1210  H  HG   . SER A 1 41 ? 5.174   3.808   -12.907 1.00 0.00 ? 41  SER A HG   2  
ATOM   1211  N  N    . HIS A 1 42 ? 3.991   -0.225  -11.949 1.00 0.00 ? 42  HIS A N    2  
ATOM   1212  C  CA   . HIS A 1 42 ? 4.265   -1.643  -12.151 1.00 0.00 ? 42  HIS A CA   2  
ATOM   1213  C  C    . HIS A 1 42 ? 5.157   -1.855  -13.371 1.00 0.00 ? 42  HIS A C    2  
ATOM   1214  O  O    . HIS A 1 42 ? 4.688   -2.276  -14.429 1.00 0.00 ? 42  HIS A O    2  
ATOM   1215  C  CB   . HIS A 1 42 ? 2.958   -2.418  -12.320 1.00 0.00 ? 42  HIS A CB   2  
ATOM   1216  C  CG   . HIS A 1 42 ? 2.089   -2.399  -11.100 1.00 0.00 ? 42  HIS A CG   2  
ATOM   1217  N  ND1  . HIS A 1 42 ? 0.713   -2.459  -11.155 1.00 0.00 ? 42  HIS A ND1  2  
ATOM   1218  C  CD2  . HIS A 1 42 ? 2.409   -2.329  -9.786  1.00 0.00 ? 42  HIS A CD2  2  
ATOM   1219  C  CE1  . HIS A 1 42 ? 0.223   -2.425  -9.928  1.00 0.00 ? 42  HIS A CE1  2  
ATOM   1220  N  NE2  . HIS A 1 42 ? 1.232   -2.346  -9.079  1.00 0.00 ? 42  HIS A NE2  2  
ATOM   1221  H  H    . HIS A 1 42 ? 3.541   0.281   -12.658 1.00 0.00 ? 42  HIS A H    2  
ATOM   1222  H  HA   . HIS A 1 42 ? 4.780   -2.009  -11.276 1.00 0.00 ? 42  HIS A HA   2  
ATOM   1223  H  HB2  . HIS A 1 42 ? 2.394   -1.987  -13.134 1.00 0.00 ? 42  HIS A HB2  2  
ATOM   1224  H  HB3  . HIS A 1 42 ? 3.185   -3.449  -12.551 1.00 0.00 ? 42  HIS A HB3  2  
ATOM   1225  H  HD1  . HIS A 1 42 ? 0.175   -2.516  -11.971 1.00 0.00 ? 42  HIS A HD1  2  
ATOM   1226  H  HD2  . HIS A 1 42 ? 3.405   -2.270  -9.371  1.00 0.00 ? 42  HIS A HD2  2  
ATOM   1227  H  HE1  . HIS A 1 42 ? -0.823  -2.456  -9.664  1.00 0.00 ? 42  HIS A HE1  2  
ATOM   1228  N  N    . ASP A 1 43 ? 6.443   -1.561  -13.216 1.00 0.00 ? 43  ASP A N    2  
ATOM   1229  C  CA   . ASP A 1 43 ? 7.401   -1.721  -14.304 1.00 0.00 ? 43  ASP A CA   2  
ATOM   1230  C  C    . ASP A 1 43 ? 8.349   -2.883  -14.028 1.00 0.00 ? 43  ASP A C    2  
ATOM   1231  O  O    . ASP A 1 43 ? 9.148   -2.836  -13.092 1.00 0.00 ? 43  ASP A O    2  
ATOM   1232  C  CB   . ASP A 1 43 ? 8.199   -0.431  -14.502 1.00 0.00 ? 43  ASP A CB   2  
ATOM   1233  C  CG   . ASP A 1 43 ? 8.423   0.316   -13.202 1.00 0.00 ? 43  ASP A CG   2  
ATOM   1234  O  OD1  . ASP A 1 43 ? 9.379   -0.030  -12.477 1.00 0.00 ? 43  ASP A OD1  2  
ATOM   1235  O  OD2  . ASP A 1 43 ? 7.644   1.247   -12.910 1.00 0.00 ? 43  ASP A OD2  2  
ATOM   1236  H  H    . ASP A 1 43 ? 6.756   -1.230  -12.348 1.00 0.00 ? 43  ASP A H    2  
ATOM   1237  H  HA   . ASP A 1 43 ? 6.846   -1.932  -15.206 1.00 0.00 ? 43  ASP A HA   2  
ATOM   1238  H  HB2  . ASP A 1 43 ? 9.162   -0.673  -14.927 1.00 0.00 ? 43  ASP A HB2  2  
ATOM   1239  H  HB3  . ASP A 1 43 ? 7.663   0.216   -15.181 1.00 0.00 ? 43  ASP A HB3  2  
ATOM   1240  N  N    . ILE A 1 44 ? 8.254   -3.925  -14.847 1.00 0.00 ? 44  ILE A N    2  
ATOM   1241  C  CA   . ILE A 1 44 ? 9.103   -5.099  -14.690 1.00 0.00 ? 44  ILE A CA   2  
ATOM   1242  C  C    . ILE A 1 44 ? 10.100  -5.214  -15.839 1.00 0.00 ? 44  ILE A C    2  
ATOM   1243  O  O    . ILE A 1 44 ? 9.770   -5.715  -16.913 1.00 0.00 ? 44  ILE A O    2  
ATOM   1244  C  CB   . ILE A 1 44 ? 8.269   -6.392  -14.619 1.00 0.00 ? 44  ILE A CB   2  
ATOM   1245  C  CG1  . ILE A 1 44 ? 7.359   -6.370  -13.389 1.00 0.00 ? 44  ILE A CG1  2  
ATOM   1246  C  CG2  . ILE A 1 44 ? 9.181   -7.609  -14.588 1.00 0.00 ? 44  ILE A CG2  2  
ATOM   1247  C  CD1  . ILE A 1 44 ? 6.180   -7.313  -13.493 1.00 0.00 ? 44  ILE A CD1  2  
ATOM   1248  H  H    . ILE A 1 44 ? 7.598   -3.903  -15.574 1.00 0.00 ? 44  ILE A H    2  
ATOM   1249  H  HA   . ILE A 1 44 ? 9.648   -4.994  -13.763 1.00 0.00 ? 44  ILE A HA   2  
ATOM   1250  H  HB   . ILE A 1 44 ? 7.660   -6.451  -15.508 1.00 0.00 ? 44  ILE A HB   2  
ATOM   1251  H  HG12 . ILE A 1 44 ? 7.932   -6.650  -12.520 1.00 0.00 ? 44  ILE A HG12 2  
ATOM   1252  H  HG13 . ILE A 1 44 ? 6.973   -5.369  -13.254 1.00 0.00 ? 44  ILE A HG13 2  
ATOM   1253  H  HG21 . ILE A 1 44 ? 9.934   -7.476  -13.825 1.00 0.00 ? 44  ILE A HG21 2  
ATOM   1254  H  HG22 . ILE A 1 44 ? 8.597   -8.490  -14.365 1.00 0.00 ? 44  ILE A HG22 2  
ATOM   1255  H  HG23 . ILE A 1 44 ? 9.658   -7.727  -15.549 1.00 0.00 ? 44  ILE A HG23 2  
ATOM   1256  H  HD11 . ILE A 1 44 ? 5.607   -7.077  -14.377 1.00 0.00 ? 44  ILE A HD11 2  
ATOM   1257  H  HD12 . ILE A 1 44 ? 6.537   -8.330  -13.554 1.00 0.00 ? 44  ILE A HD12 2  
ATOM   1258  H  HD13 . ILE A 1 44 ? 5.554   -7.203  -12.619 1.00 0.00 ? 44  ILE A HD13 2  
ATOM   1259  N  N    . SER A 1 45 ? 11.322  -4.746  -15.603 1.00 0.00 ? 45  SER A N    2  
ATOM   1260  C  CA   . SER A 1 45 ? 12.368  -4.794  -16.618 1.00 0.00 ? 45  SER A CA   2  
ATOM   1261  C  C    . SER A 1 45 ? 13.411  -5.853  -16.274 1.00 0.00 ? 45  SER A C    2  
ATOM   1262  O  O    . SER A 1 45 ? 13.444  -6.368  -15.157 1.00 0.00 ? 45  SER A O    2  
ATOM   1263  C  CB   . SER A 1 45 ? 13.038  -3.426  -16.755 1.00 0.00 ? 45  SER A CB   2  
ATOM   1264  O  OG   . SER A 1 45 ? 13.820  -3.357  -17.935 1.00 0.00 ? 45  SER A OG   2  
ATOM   1265  H  H    . SER A 1 45 ? 11.524  -4.358  -14.726 1.00 0.00 ? 45  SER A H    2  
ATOM   1266  H  HA   . SER A 1 45 ? 11.905  -5.054  -17.559 1.00 0.00 ? 45  SER A HA   2  
ATOM   1267  H  HB2  . SER A 1 45 ? 12.280  -2.659  -16.794 1.00 0.00 ? 45  SER A HB2  2  
ATOM   1268  H  HB3  . SER A 1 45 ? 13.679  -3.256  -15.902 1.00 0.00 ? 45  SER A HB3  2  
ATOM   1269  H  HG   . SER A 1 45 ? 13.598  -2.558  -18.420 1.00 0.00 ? 45  SER A HG   2  
ATOM   1270  N  N    . GLY A 1 46 ? 14.263  -6.172  -17.243 1.00 0.00 ? 46  GLY A N    2  
ATOM   1271  C  CA   . GLY A 1 46 ? 15.297  -7.167  -17.024 1.00 0.00 ? 46  GLY A CA   2  
ATOM   1272  C  C    . GLY A 1 46 ? 16.559  -6.572  -16.433 1.00 0.00 ? 46  GLY A C    2  
ATOM   1273  O  O    . GLY A 1 46 ? 16.685  -6.412  -15.219 1.00 0.00 ? 46  GLY A O    2  
ATOM   1274  H  H    . GLY A 1 46 ? 14.190  -5.728  -18.114 1.00 0.00 ? 46  GLY A H    2  
ATOM   1275  H  HA2  . GLY A 1 46 ? 14.917  -7.922  -16.352 1.00 0.00 ? 46  GLY A HA2  2  
ATOM   1276  H  HA3  . GLY A 1 46 ? 15.540  -7.631  -17.969 1.00 0.00 ? 46  GLY A HA3  2  
ATOM   1277  N  N    . PRO A 1 47 ? 17.523  -6.234  -17.302 1.00 0.00 ? 47  PRO A N    2  
ATOM   1278  C  CA   . PRO A 1 47 ? 18.799  -5.649  -16.882 1.00 0.00 ? 47  PRO A CA   2  
ATOM   1279  C  C    . PRO A 1 47 ? 18.640  -4.227  -16.356 1.00 0.00 ? 47  PRO A C    2  
ATOM   1280  O  O    . PRO A 1 47 ? 19.167  -3.884  -15.298 1.00 0.00 ? 47  PRO A O    2  
ATOM   1281  C  CB   . PRO A 1 47 ? 19.632  -5.654  -18.166 1.00 0.00 ? 47  PRO A CB   2  
ATOM   1282  C  CG   . PRO A 1 47 ? 18.630  -5.628  -19.268 1.00 0.00 ? 47  PRO A CG   2  
ATOM   1283  C  CD   . PRO A 1 47 ? 17.440  -6.397  -18.764 1.00 0.00 ? 47  PRO A CD   2  
ATOM   1284  H  HA   . PRO A 1 47 ? 19.286  -6.257  -16.132 1.00 0.00 ? 47  PRO A HA   2  
ATOM   1285  H  HB2  . PRO A 1 47 ? 20.268  -4.781  -18.189 1.00 0.00 ? 47  PRO A HB2  2  
ATOM   1286  H  HB3  . PRO A 1 47 ? 20.236  -6.548  -18.204 1.00 0.00 ? 47  PRO A HB3  2  
ATOM   1287  H  HG2  . PRO A 1 47 ? 18.351  -4.608  -19.487 1.00 0.00 ? 47  PRO A HG2  2  
ATOM   1288  H  HG3  . PRO A 1 47 ? 19.038  -6.104  -20.147 1.00 0.00 ? 47  PRO A HG3  2  
ATOM   1289  H  HD2  . PRO A 1 47 ? 16.525  -5.972  -19.148 1.00 0.00 ? 47  PRO A HD2  2  
ATOM   1290  H  HD3  . PRO A 1 47 ? 17.519  -7.438  -19.040 1.00 0.00 ? 47  PRO A HD3  2  
ATOM   1291  N  N    . SER A 1 48 ? 17.909  -3.404  -17.101 1.00 0.00 ? 48  SER A N    2  
ATOM   1292  C  CA   . SER A 1 48 ? 17.683  -2.017  -16.711 1.00 0.00 ? 48  SER A CA   2  
ATOM   1293  C  C    . SER A 1 48 ? 16.426  -1.891  -15.856 1.00 0.00 ? 48  SER A C    2  
ATOM   1294  O  O    . SER A 1 48 ? 15.329  -1.679  -16.372 1.00 0.00 ? 48  SER A O    2  
ATOM   1295  C  CB   . SER A 1 48 ? 17.561  -1.130  -17.951 1.00 0.00 ? 48  SER A CB   2  
ATOM   1296  O  OG   . SER A 1 48 ? 16.557  -1.613  -18.827 1.00 0.00 ? 48  SER A OG   2  
ATOM   1297  H  H    . SER A 1 48 ? 17.515  -3.737  -17.934 1.00 0.00 ? 48  SER A H    2  
ATOM   1298  H  HA   . SER A 1 48 ? 18.533  -1.694  -16.130 1.00 0.00 ? 48  SER A HA   2  
ATOM   1299  H  HB2  . SER A 1 48 ? 17.304  -0.126  -17.649 1.00 0.00 ? 48  SER A HB2  2  
ATOM   1300  H  HB3  . SER A 1 48 ? 18.505  -1.118  -18.476 1.00 0.00 ? 48  SER A HB3  2  
ATOM   1301  H  HG   . SER A 1 48 ? 15.707  -1.599  -18.380 1.00 0.00 ? 48  SER A HG   2  
ATOM   1302  N  N    . SER A 1 49 ? 16.594  -2.025  -14.544 1.00 0.00 ? 49  SER A N    2  
ATOM   1303  C  CA   . SER A 1 49 ? 15.473  -1.930  -13.616 1.00 0.00 ? 49  SER A CA   2  
ATOM   1304  C  C    . SER A 1 49 ? 15.537  -0.632  -12.817 1.00 0.00 ? 49  SER A C    2  
ATOM   1305  O  O    . SER A 1 49 ? 16.615  -0.084  -12.588 1.00 0.00 ? 49  SER A O    2  
ATOM   1306  C  CB   . SER A 1 49 ? 15.469  -3.128  -12.664 1.00 0.00 ? 49  SER A CB   2  
ATOM   1307  O  OG   . SER A 1 49 ? 16.579  -3.084  -11.785 1.00 0.00 ? 49  SER A OG   2  
ATOM   1308  H  H    . SER A 1 49 ? 17.493  -2.193  -14.193 1.00 0.00 ? 49  SER A H    2  
ATOM   1309  H  HA   . SER A 1 49 ? 14.562  -1.938  -14.195 1.00 0.00 ? 49  SER A HA   2  
ATOM   1310  H  HB2  . SER A 1 49 ? 14.562  -3.117  -12.080 1.00 0.00 ? 49  SER A HB2  2  
ATOM   1311  H  HB3  . SER A 1 49 ? 15.517  -4.041  -13.240 1.00 0.00 ? 49  SER A HB3  2  
ATOM   1312  H  HG   . SER A 1 49 ? 17.313  -3.568  -12.170 1.00 0.00 ? 49  SER A HG   2  
ATOM   1313  N  N    . GLY A 1 50 ? 14.374  -0.145  -12.396 1.00 0.00 ? 50  GLY A N    2  
ATOM   1314  C  CA   . GLY A 1 50 ? 14.319  1.085   -11.628 1.00 0.00 ? 50  GLY A CA   2  
ATOM   1315  C  C    . GLY A 1 50 ? 13.602  2.198   -12.366 1.00 0.00 ? 50  GLY A C    2  
ATOM   1316  O  O    . GLY A 1 50 ? 13.276  2.025   -13.539 1.00 0.00 ? 50  GLY A O    2  
ATOM   1317  H  H    . GLY A 1 50 ? 13.546  -0.625  -12.609 1.00 0.00 ? 50  GLY A H    2  
ATOM   1318  H  HA2  . GLY A 1 50 ? 13.804  0.893   -10.698 1.00 0.00 ? 50  GLY A HA2  2  
ATOM   1319  H  HA3  . GLY A 1 50 ? 15.327  1.405   -11.409 1.00 0.00 ? 50  GLY A HA3  2  
HETATM 1320  ZN ZN   . ZN  B 2 .  ? 0.580   -2.259  -7.138  1.00 0.00 ? 201 ZN  A ZN   2  
ATOM   1321  N  N    . GLY A 1 1  ? 7.059   37.703  -20.014 1.00 0.00 ? 1   GLY A N    3  
ATOM   1322  C  CA   . GLY A 1 1  ? 7.248   38.875  -19.180 1.00 0.00 ? 1   GLY A CA   3  
ATOM   1323  C  C    . GLY A 1 1  ? 7.154   38.556  -17.701 1.00 0.00 ? 1   GLY A C    3  
ATOM   1324  O  O    . GLY A 1 1  ? 6.067   38.566  -17.125 1.00 0.00 ? 1   GLY A O    3  
ATOM   1325  H  H1   . GLY A 1 1  ? 6.153   37.399  -20.230 1.00 0.00 ? 1   GLY A H1   3  
ATOM   1326  H  HA2  . GLY A 1 1  ? 8.220   39.298  -19.385 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   1327  H  HA3  . GLY A 1 1  ? 6.491   39.605  -19.427 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   1328  N  N    . SER A 1 2  ? 8.297   38.270  -17.085 1.00 0.00 ? 2   SER A N    3  
ATOM   1329  C  CA   . SER A 1 2  ? 8.339   37.940  -15.665 1.00 0.00 ? 2   SER A CA   3  
ATOM   1330  C  C    . SER A 1 2  ? 9.605   38.491  -15.017 1.00 0.00 ? 2   SER A C    3  
ATOM   1331  O  O    . SER A 1 2  ? 10.617  38.702  -15.685 1.00 0.00 ? 2   SER A O    3  
ATOM   1332  C  CB   . SER A 1 2  ? 8.270   36.424  -15.470 1.00 0.00 ? 2   SER A CB   3  
ATOM   1333  O  OG   . SER A 1 2  ? 7.024   35.910  -15.907 1.00 0.00 ? 2   SER A OG   3  
ATOM   1334  H  H    . SER A 1 2  ? 9.132   38.278  -17.599 1.00 0.00 ? 2   SER A H    3  
ATOM   1335  H  HA   . SER A 1 2  ? 7.480   38.395  -15.194 1.00 0.00 ? 2   SER A HA   3  
ATOM   1336  H  HB2  . SER A 1 2  ? 9.059   35.955  -16.038 1.00 0.00 ? 2   SER A HB2  3  
ATOM   1337  H  HB3  . SER A 1 2  ? 8.394   36.194  -14.422 1.00 0.00 ? 2   SER A HB3  3  
ATOM   1338  H  HG   . SER A 1 2  ? 6.482   35.692  -15.145 1.00 0.00 ? 2   SER A HG   3  
ATOM   1339  N  N    . SER A 1 3  ? 9.540   38.722  -13.709 1.00 0.00 ? 3   SER A N    3  
ATOM   1340  C  CA   . SER A 1 3  ? 10.679  39.252  -12.969 1.00 0.00 ? 3   SER A CA   3  
ATOM   1341  C  C    . SER A 1 3  ? 11.629  38.131  -12.558 1.00 0.00 ? 3   SER A C    3  
ATOM   1342  O  O    . SER A 1 3  ? 11.268  36.955  -12.584 1.00 0.00 ? 3   SER A O    3  
ATOM   1343  C  CB   . SER A 1 3  ? 10.201  40.011  -11.730 1.00 0.00 ? 3   SER A CB   3  
ATOM   1344  O  OG   . SER A 1 3  ? 9.616   41.252  -12.087 1.00 0.00 ? 3   SER A OG   3  
ATOM   1345  H  H    . SER A 1 3  ? 8.705   38.534  -13.232 1.00 0.00 ? 3   SER A H    3  
ATOM   1346  H  HA   . SER A 1 3  ? 11.207  39.935  -13.618 1.00 0.00 ? 3   SER A HA   3  
ATOM   1347  H  HB2  . SER A 1 3  ? 9.466   39.418  -11.209 1.00 0.00 ? 3   SER A HB2  3  
ATOM   1348  H  HB3  . SER A 1 3  ? 11.042  40.197  -11.078 1.00 0.00 ? 3   SER A HB3  3  
ATOM   1349  H  HG   . SER A 1 3  ? 9.244   41.667  -11.305 1.00 0.00 ? 3   SER A HG   3  
ATOM   1350  N  N    . GLY A 1 4  ? 12.847  38.505  -12.177 1.00 0.00 ? 4   GLY A N    3  
ATOM   1351  C  CA   . GLY A 1 4  ? 13.830  37.521  -11.765 1.00 0.00 ? 4   GLY A CA   3  
ATOM   1352  C  C    . GLY A 1 4  ? 14.900  37.296  -12.815 1.00 0.00 ? 4   GLY A C    3  
ATOM   1353  O  O    . GLY A 1 4  ? 14.618  37.316  -14.013 1.00 0.00 ? 4   GLY A O    3  
ATOM   1354  H  H    . GLY A 1 4  ? 13.079  39.458  -12.176 1.00 0.00 ? 4   GLY A H    3  
ATOM   1355  H  HA2  . GLY A 1 4  ? 14.301  37.858  -10.853 1.00 0.00 ? 4   GLY A HA2  3  
ATOM   1356  H  HA3  . GLY A 1 4  ? 13.327  36.585  -11.574 1.00 0.00 ? 4   GLY A HA3  3  
ATOM   1357  N  N    . SER A 1 5  ? 16.133  37.083  -12.366 1.00 0.00 ? 5   SER A N    3  
ATOM   1358  C  CA   . SER A 1 5  ? 17.250  36.859  -13.276 1.00 0.00 ? 5   SER A CA   3  
ATOM   1359  C  C    . SER A 1 5  ? 16.878  35.846  -14.354 1.00 0.00 ? 5   SER A C    3  
ATOM   1360  O  O    . SER A 1 5  ? 17.017  36.113  -15.547 1.00 0.00 ? 5   SER A O    3  
ATOM   1361  C  CB   . SER A 1 5  ? 18.476  36.369  -12.502 1.00 0.00 ? 5   SER A CB   3  
ATOM   1362  O  OG   . SER A 1 5  ? 18.158  35.242  -11.703 1.00 0.00 ? 5   SER A OG   3  
ATOM   1363  H  H    . SER A 1 5  ? 16.295  37.079  -11.399 1.00 0.00 ? 5   SER A H    3  
ATOM   1364  H  HA   . SER A 1 5  ? 17.486  37.800  -13.749 1.00 0.00 ? 5   SER A HA   3  
ATOM   1365  H  HB2  . SER A 1 5  ? 19.252  36.094  -13.199 1.00 0.00 ? 5   SER A HB2  3  
ATOM   1366  H  HB3  . SER A 1 5  ? 18.832  37.162  -11.859 1.00 0.00 ? 5   SER A HB3  3  
ATOM   1367  H  HG   . SER A 1 5  ? 18.954  34.733  -11.537 1.00 0.00 ? 5   SER A HG   3  
ATOM   1368  N  N    . SER A 1 6  ? 16.404  34.681  -13.924 1.00 0.00 ? 6   SER A N    3  
ATOM   1369  C  CA   . SER A 1 6  ? 16.015  33.625  -14.851 1.00 0.00 ? 6   SER A CA   3  
ATOM   1370  C  C    . SER A 1 6  ? 14.667  33.937  -15.495 1.00 0.00 ? 6   SER A C    3  
ATOM   1371  O  O    . SER A 1 6  ? 13.623  33.853  -14.849 1.00 0.00 ? 6   SER A O    3  
ATOM   1372  C  CB   . SER A 1 6  ? 15.947  32.279  -14.126 1.00 0.00 ? 6   SER A CB   3  
ATOM   1373  O  OG   . SER A 1 6  ? 17.210  31.925  -13.590 1.00 0.00 ? 6   SER A OG   3  
ATOM   1374  H  H    . SER A 1 6  ? 16.316  34.527  -12.960 1.00 0.00 ? 6   SER A H    3  
ATOM   1375  H  HA   . SER A 1 6  ? 16.766  33.570  -15.625 1.00 0.00 ? 6   SER A HA   3  
ATOM   1376  H  HB2  . SER A 1 6  ? 15.232  32.343  -13.320 1.00 0.00 ? 6   SER A HB2  3  
ATOM   1377  H  HB3  . SER A 1 6  ? 15.637  31.513  -14.823 1.00 0.00 ? 6   SER A HB3  3  
ATOM   1378  H  HG   . SER A 1 6  ? 17.170  31.951  -12.631 1.00 0.00 ? 6   SER A HG   3  
ATOM   1379  N  N    . GLY A 1 7  ? 14.698  34.296  -16.775 1.00 0.00 ? 7   GLY A N    3  
ATOM   1380  C  CA   . GLY A 1 7  ? 13.474  34.616  -17.486 1.00 0.00 ? 7   GLY A CA   3  
ATOM   1381  C  C    . GLY A 1 7  ? 13.419  33.979  -18.860 1.00 0.00 ? 7   GLY A C    3  
ATOM   1382  O  O    . GLY A 1 7  ? 12.391  33.428  -19.256 1.00 0.00 ? 7   GLY A O    3  
ATOM   1383  H  H    . GLY A 1 7  ? 15.560  34.345  -17.240 1.00 0.00 ? 7   GLY A H    3  
ATOM   1384  H  HA2  . GLY A 1 7  ? 12.632  34.268  -16.905 1.00 0.00 ? 7   GLY A HA2  3  
ATOM   1385  H  HA3  . GLY A 1 7  ? 13.404  35.688  -17.596 1.00 0.00 ? 7   GLY A HA3  3  
ATOM   1386  N  N    . CYS A 1 8  ? 14.526  34.056  -19.591 1.00 0.00 ? 8   CYS A N    3  
ATOM   1387  C  CA   . CYS A 1 8  ? 14.599  33.484  -20.931 1.00 0.00 ? 8   CYS A CA   3  
ATOM   1388  C  C    . CYS A 1 8  ? 15.257  32.109  -20.900 1.00 0.00 ? 8   CYS A C    3  
ATOM   1389  O  O    . CYS A 1 8  ? 14.814  31.183  -21.581 1.00 0.00 ? 8   CYS A O    3  
ATOM   1390  C  CB   . CYS A 1 8  ? 15.376  34.414  -21.863 1.00 0.00 ? 8   CYS A CB   3  
ATOM   1391  S  SG   . CYS A 1 8  ? 17.055  34.786  -21.302 1.00 0.00 ? 8   CYS A SG   3  
ATOM   1392  H  H    . CYS A 1 8  ? 15.313  34.508  -19.221 1.00 0.00 ? 8   CYS A H    3  
ATOM   1393  H  HA   . CYS A 1 8  ? 13.590  33.379  -21.301 1.00 0.00 ? 8   CYS A HA   3  
ATOM   1394  H  HB2  . CYS A 1 8  ? 15.450  33.955  -22.838 1.00 0.00 ? 8   CYS A HB2  3  
ATOM   1395  H  HB3  . CYS A 1 8  ? 14.844  35.349  -21.952 1.00 0.00 ? 8   CYS A HB3  3  
ATOM   1396  H  HG   . CYS A 1 8  ? 17.594  35.636  -22.163 1.00 0.00 ? 8   CYS A HG   3  
ATOM   1397  N  N    . CYS A 1 9  ? 16.316  31.983  -20.108 1.00 0.00 ? 9   CYS A N    3  
ATOM   1398  C  CA   . CYS A 1 9  ? 17.037  30.721  -19.991 1.00 0.00 ? 9   CYS A CA   3  
ATOM   1399  C  C    . CYS A 1 9  ? 16.123  29.619  -19.464 1.00 0.00 ? 9   CYS A C    3  
ATOM   1400  O  O    . CYS A 1 9  ? 15.192  29.882  -18.701 1.00 0.00 ? 9   CYS A O    3  
ATOM   1401  C  CB   . CYS A 1 9  ? 18.245  30.883  -19.066 1.00 0.00 ? 9   CYS A CB   3  
ATOM   1402  S  SG   . CYS A 1 9  ? 19.606  31.828  -19.790 1.00 0.00 ? 9   CYS A SG   3  
ATOM   1403  H  H    . CYS A 1 9  ? 16.621  32.757  -19.590 1.00 0.00 ? 9   CYS A H    3  
ATOM   1404  H  HA   . CYS A 1 9  ? 17.383  30.444  -20.975 1.00 0.00 ? 9   CYS A HA   3  
ATOM   1405  H  HB2  . CYS A 1 9  ? 17.933  31.393  -18.167 1.00 0.00 ? 9   CYS A HB2  3  
ATOM   1406  H  HB3  . CYS A 1 9  ? 18.623  29.906  -18.806 1.00 0.00 ? 9   CYS A HB3  3  
ATOM   1407  H  HG   . CYS A 1 9  ? 19.244  32.198  -21.009 1.00 0.00 ? 9   CYS A HG   3  
ATOM   1408  N  N    . LEU A 1 10 ? 16.393  28.386  -19.877 1.00 0.00 ? 10  LEU A N    3  
ATOM   1409  C  CA   . LEU A 1 10 ? 15.594  27.243  -19.449 1.00 0.00 ? 10  LEU A CA   3  
ATOM   1410  C  C    . LEU A 1 10 ? 15.206  27.371  -17.979 1.00 0.00 ? 10  LEU A C    3  
ATOM   1411  O  O    . LEU A 1 10 ? 15.924  27.958  -17.170 1.00 0.00 ? 10  LEU A O    3  
ATOM   1412  C  CB   . LEU A 1 10 ? 16.367  25.942  -19.673 1.00 0.00 ? 10  LEU A CB   3  
ATOM   1413  C  CG   . LEU A 1 10 ? 17.782  25.895  -19.096 1.00 0.00 ? 10  LEU A CG   3  
ATOM   1414  C  CD1  . LEU A 1 10 ? 17.739  25.654  -17.595 1.00 0.00 ? 10  LEU A CD1  3  
ATOM   1415  C  CD2  . LEU A 1 10 ? 18.604  24.817  -19.788 1.00 0.00 ? 10  LEU A CD2  3  
ATOM   1416  H  H    . LEU A 1 10 ? 17.147  28.239  -20.485 1.00 0.00 ? 10  LEU A H    3  
ATOM   1417  H  HA   . LEU A 1 10 ? 14.694  27.225  -20.046 1.00 0.00 ? 10  LEU A HA   3  
ATOM   1418  H  HB2  . LEU A 1 10 ? 15.800  25.140  -19.225 1.00 0.00 ? 10  LEU A HB2  3  
ATOM   1419  H  HB3  . LEU A 1 10 ? 16.437  25.780  -20.739 1.00 0.00 ? 10  LEU A HB3  3  
ATOM   1420  H  HG   . LEU A 1 10 ? 18.266  26.847  -19.267 1.00 0.00 ? 10  LEU A HG   3  
ATOM   1421  H  HD11 . LEU A 1 10 ? 16.719  25.486  -17.286 1.00 0.00 ? 10  LEU A HD11 3  
ATOM   1422  H  HD12 . LEU A 1 10 ? 18.134  26.517  -17.081 1.00 0.00 ? 10  LEU A HD12 3  
ATOM   1423  H  HD13 . LEU A 1 10 ? 18.337  24.787  -17.353 1.00 0.00 ? 10  LEU A HD13 3  
ATOM   1424  H  HD21 . LEU A 1 10 ? 18.646  23.939  -19.160 1.00 0.00 ? 10  LEU A HD21 3  
ATOM   1425  H  HD22 . LEU A 1 10 ? 19.605  25.184  -19.961 1.00 0.00 ? 10  LEU A HD22 3  
ATOM   1426  H  HD23 . LEU A 1 10 ? 18.144  24.564  -20.732 1.00 0.00 ? 10  LEU A HD23 3  
ATOM   1427  N  N    . PRO A 1 11 ? 14.042  26.806  -17.623 1.00 0.00 ? 11  PRO A N    3  
ATOM   1428  C  CA   . PRO A 1 11 ? 13.534  26.841  -16.248 1.00 0.00 ? 11  PRO A CA   3  
ATOM   1429  C  C    . PRO A 1 11 ? 14.357  25.973  -15.303 1.00 0.00 ? 11  PRO A C    3  
ATOM   1430  O  O    . PRO A 1 11 ? 15.101  25.087  -15.725 1.00 0.00 ? 11  PRO A O    3  
ATOM   1431  C  CB   . PRO A 1 11 ? 12.113  26.287  -16.382 1.00 0.00 ? 11  PRO A CB   3  
ATOM   1432  C  CG   . PRO A 1 11 ? 12.152  25.434  -17.603 1.00 0.00 ? 11  PRO A CG   3  
ATOM   1433  C  CD   . PRO A 1 11 ? 13.134  26.089  -18.534 1.00 0.00 ? 11  PRO A CD   3  
ATOM   1434  H  HA   . PRO A 1 11 ? 13.494  27.850  -15.865 1.00 0.00 ? 11  PRO A HA   3  
ATOM   1435  H  HB2  . PRO A 1 11 ? 11.865  25.708  -15.503 1.00 0.00 ? 11  PRO A HB2  3  
ATOM   1436  H  HB3  . PRO A 1 11 ? 11.414  27.102  -16.492 1.00 0.00 ? 11  PRO A HB3  3  
ATOM   1437  H  HG2  . PRO A 1 11 ? 12.484  24.440  -17.346 1.00 0.00 ? 11  PRO A HG2  3  
ATOM   1438  H  HG3  . PRO A 1 11 ? 11.173  25.399  -18.057 1.00 0.00 ? 11  PRO A HG3  3  
ATOM   1439  H  HD2  . PRO A 1 11 ? 13.669  25.344  -19.103 1.00 0.00 ? 11  PRO A HD2  3  
ATOM   1440  H  HD3  . PRO A 1 11 ? 12.628  26.779  -19.193 1.00 0.00 ? 11  PRO A HD3  3  
ATOM   1441  N  N    . PRO A 1 12 ? 14.223  26.230  -13.994 1.00 0.00 ? 12  PRO A N    3  
ATOM   1442  C  CA   . PRO A 1 12 ? 14.947  25.482  -12.961 1.00 0.00 ? 12  PRO A CA   3  
ATOM   1443  C  C    . PRO A 1 12 ? 14.449  24.047  -12.830 1.00 0.00 ? 12  PRO A C    3  
ATOM   1444  O  O    . PRO A 1 12 ? 13.482  23.653  -13.481 1.00 0.00 ? 12  PRO A O    3  
ATOM   1445  C  CB   . PRO A 1 12 ? 14.654  26.269  -11.682 1.00 0.00 ? 12  PRO A CB   3  
ATOM   1446  C  CG   . PRO A 1 12 ? 13.361  26.959  -11.949 1.00 0.00 ? 12  PRO A CG   3  
ATOM   1447  C  CD   . PRO A 1 12 ? 13.354  27.271  -13.420 1.00 0.00 ? 12  PRO A CD   3  
ATOM   1448  H  HA   . PRO A 1 12 ? 16.011  25.477  -13.147 1.00 0.00 ? 12  PRO A HA   3  
ATOM   1449  H  HB2  . PRO A 1 12 ? 14.573  25.586  -10.847 1.00 0.00 ? 12  PRO A HB2  3  
ATOM   1450  H  HB3  . PRO A 1 12 ? 15.448  26.977  -11.500 1.00 0.00 ? 12  PRO A HB3  3  
ATOM   1451  H  HG2  . PRO A 1 12 ? 12.538  26.306  -11.701 1.00 0.00 ? 12  PRO A HG2  3  
ATOM   1452  H  HG3  . PRO A 1 12 ? 13.305  27.870  -11.372 1.00 0.00 ? 12  PRO A HG3  3  
ATOM   1453  H  HD2  . PRO A 1 12 ? 12.353  27.200  -13.817 1.00 0.00 ? 12  PRO A HD2  3  
ATOM   1454  H  HD3  . PRO A 1 12 ? 13.763  28.255  -13.598 1.00 0.00 ? 12  PRO A HD3  3  
ATOM   1455  N  N    . ALA A 1 13 ? 15.116  23.269  -11.983 1.00 0.00 ? 13  ALA A N    3  
ATOM   1456  C  CA   . ALA A 1 13 ? 14.740  21.878  -11.765 1.00 0.00 ? 13  ALA A CA   3  
ATOM   1457  C  C    . ALA A 1 13 ? 13.943  21.721  -10.474 1.00 0.00 ? 13  ALA A C    3  
ATOM   1458  O  O    . ALA A 1 13 ? 14.399  22.114  -9.399  1.00 0.00 ? 13  ALA A O    3  
ATOM   1459  C  CB   . ALA A 1 13 ? 15.978  20.995  -11.734 1.00 0.00 ? 13  ALA A CB   3  
ATOM   1460  H  H    . ALA A 1 13 ? 15.879  23.641  -11.492 1.00 0.00 ? 13  ALA A H    3  
ATOM   1461  H  HA   . ALA A 1 13 ? 14.125  21.564  -12.596 1.00 0.00 ? 13  ALA A HA   3  
ATOM   1462  H  HB1  . ALA A 1 13 ? 16.213  20.670  -12.737 1.00 0.00 ? 13  ALA A HB1  3  
ATOM   1463  H  HB2  . ALA A 1 13 ? 16.810  21.555  -11.333 1.00 0.00 ? 13  ALA A HB2  3  
ATOM   1464  H  HB3  . ALA A 1 13 ? 15.790  20.133  -11.111 1.00 0.00 ? 13  ALA A HB3  3  
ATOM   1465  N  N    . THR A 1 14 ? 12.750  21.145  -10.586 1.00 0.00 ? 14  THR A N    3  
ATOM   1466  C  CA   . THR A 1 14 ? 11.890  20.938  -9.428  1.00 0.00 ? 14  THR A CA   3  
ATOM   1467  C  C    . THR A 1 14 ? 11.541  19.464  -9.259  1.00 0.00 ? 14  THR A C    3  
ATOM   1468  O  O    . THR A 1 14 ? 11.648  18.912  -8.163  1.00 0.00 ? 14  THR A O    3  
ATOM   1469  C  CB   . THR A 1 14 ? 10.587  21.752  -9.544  1.00 0.00 ? 14  THR A CB   3  
ATOM   1470  O  OG1  . THR A 1 14 ? 9.954   21.487  -10.800 1.00 0.00 ? 14  THR A OG1  3  
ATOM   1471  C  CG2  . THR A 1 14 ? 10.867  23.242  -9.415  1.00 0.00 ? 14  THR A CG2  3  
ATOM   1472  H  H    . THR A 1 14 ? 12.443  20.854  -11.469 1.00 0.00 ? 14  THR A H    3  
ATOM   1473  H  HA   . THR A 1 14 ? 12.423  21.275  -8.551  1.00 0.00 ? 14  THR A HA   3  
ATOM   1474  H  HB   . THR A 1 14 ? 9.923   21.455  -8.745  1.00 0.00 ? 14  THR A HB   3  
ATOM   1475  H  HG1  . THR A 1 14 ? 9.575   20.605  -10.788 1.00 0.00 ? 14  THR A HG1  3  
ATOM   1476  H  HG21 . THR A 1 14 ? 9.946   23.793  -9.537  1.00 0.00 ? 14  THR A HG21 3  
ATOM   1477  H  HG22 . THR A 1 14 ? 11.570  23.543  -10.177 1.00 0.00 ? 14  THR A HG22 3  
ATOM   1478  H  HG23 . THR A 1 14 ? 11.282  23.447  -8.440  1.00 0.00 ? 14  THR A HG23 3  
ATOM   1479  N  N    . HIS A 1 15 ? 11.124  18.830  -10.351 1.00 0.00 ? 15  HIS A N    3  
ATOM   1480  C  CA   . HIS A 1 15 ? 10.760  17.418  -10.323 1.00 0.00 ? 15  HIS A CA   3  
ATOM   1481  C  C    . HIS A 1 15 ? 11.758  16.584  -11.122 1.00 0.00 ? 15  HIS A C    3  
ATOM   1482  O  O    . HIS A 1 15 ? 12.561  17.122  -11.884 1.00 0.00 ? 15  HIS A O    3  
ATOM   1483  C  CB   . HIS A 1 15 ? 9.351   17.221  -10.881 1.00 0.00 ? 15  HIS A CB   3  
ATOM   1484  C  CG   . HIS A 1 15 ? 9.268   17.376  -12.368 1.00 0.00 ? 15  HIS A CG   3  
ATOM   1485  N  ND1  . HIS A 1 15 ? 9.438   16.325  -13.245 1.00 0.00 ? 15  HIS A ND1  3  
ATOM   1486  C  CD2  . HIS A 1 15 ? 9.031   18.467  -13.133 1.00 0.00 ? 15  HIS A CD2  3  
ATOM   1487  C  CE1  . HIS A 1 15 ? 9.310   16.764  -14.484 1.00 0.00 ? 15  HIS A CE1  3  
ATOM   1488  N  NE2  . HIS A 1 15 ? 9.063   18.060  -14.444 1.00 0.00 ? 15  HIS A NE2  3  
ATOM   1489  H  H    . HIS A 1 15 ? 11.059  19.324  -11.194 1.00 0.00 ? 15  HIS A H    3  
ATOM   1490  H  HA   . HIS A 1 15 ? 10.780  17.091  -9.294  1.00 0.00 ? 15  HIS A HA   3  
ATOM   1491  H  HB2  . HIS A 1 15 ? 9.007   16.228  -10.632 1.00 0.00 ? 15  HIS A HB2  3  
ATOM   1492  H  HB3  . HIS A 1 15 ? 8.688   17.948  -10.434 1.00 0.00 ? 15  HIS A HB3  3  
ATOM   1493  H  HD1  . HIS A 1 15 ? 9.626   15.396  -12.996 1.00 0.00 ? 15  HIS A HD1  3  
ATOM   1494  H  HD2  . HIS A 1 15 ? 8.851   19.472  -12.778 1.00 0.00 ? 15  HIS A HD2  3  
ATOM   1495  H  HE1  . HIS A 1 15 ? 9.393   16.165  -15.379 1.00 0.00 ? 15  HIS A HE1  3  
ATOM   1496  N  N    . ARG A 1 16 ? 11.700  15.269  -10.942 1.00 0.00 ? 16  ARG A N    3  
ATOM   1497  C  CA   . ARG A 1 16 ? 12.599  14.361  -11.645 1.00 0.00 ? 16  ARG A CA   3  
ATOM   1498  C  C    . ARG A 1 16 ? 11.853  13.585  -12.726 1.00 0.00 ? 16  ARG A C    3  
ATOM   1499  O  O    . ARG A 1 16 ? 10.689  13.215  -12.568 1.00 0.00 ? 16  ARG A O    3  
ATOM   1500  C  CB   . ARG A 1 16 ? 13.249  13.388  -10.660 1.00 0.00 ? 16  ARG A CB   3  
ATOM   1501  C  CG   . ARG A 1 16 ? 14.025  14.074  -9.548  1.00 0.00 ? 16  ARG A CG   3  
ATOM   1502  C  CD   . ARG A 1 16 ? 14.731  13.065  -8.656  1.00 0.00 ? 16  ARG A CD   3  
ATOM   1503  N  NE   . ARG A 1 16 ? 15.828  12.395  -9.350  1.00 0.00 ? 16  ARG A NE   3  
ATOM   1504  C  CZ   . ARG A 1 16 ? 17.042  12.918  -9.483  1.00 0.00 ? 16  ARG A CZ   3  
ATOM   1505  N  NH1  . ARG A 1 16 ? 17.313  14.111  -8.972  1.00 0.00 ? 16  ARG A NH1  3  
ATOM   1506  N  NH2  . ARG A 1 16 ? 17.987  12.247  -10.128 1.00 0.00 ? 16  ARG A NH2  3  
ATOM   1507  H  H    . ARG A 1 16 ? 11.038  14.899  -10.322 1.00 0.00 ? 16  ARG A H    3  
ATOM   1508  H  HA   . ARG A 1 16 ? 13.371  14.955  -12.112 1.00 0.00 ? 16  ARG A HA   3  
ATOM   1509  H  HB2  . ARG A 1 16 ? 12.477  12.782  -10.208 1.00 0.00 ? 16  ARG A HB2  3  
ATOM   1510  H  HB3  . ARG A 1 16 ? 13.928  12.747  -11.201 1.00 0.00 ? 16  ARG A HB3  3  
ATOM   1511  H  HG2  . ARG A 1 16 ? 14.764  14.728  -9.987  1.00 0.00 ? 16  ARG A HG2  3  
ATOM   1512  H  HG3  . ARG A 1 16 ? 13.339  14.654  -8.948  1.00 0.00 ? 16  ARG A HG3  3  
ATOM   1513  H  HD2  . ARG A 1 16 ? 15.125  13.581  -7.793  1.00 0.00 ? 16  ARG A HD2  3  
ATOM   1514  H  HD3  . ARG A 1 16 ? 14.014  12.324  -8.336  1.00 0.00 ? 16  ARG A HD3  3  
ATOM   1515  H  HE   . ARG A 1 16 ? 15.649  11.512  -9.735  1.00 0.00 ? 16  ARG A HE   3  
ATOM   1516  H  HH11 . ARG A 1 16 ? 16.602  14.619  -8.485  1.00 0.00 ? 16  ARG A HH11 3  
ATOM   1517  H  HH12 . ARG A 1 16 ? 18.228  14.502  -9.073  1.00 0.00 ? 16  ARG A HH12 3  
ATOM   1518  H  HH21 . ARG A 1 16 ? 17.787  11.347  -10.514 1.00 0.00 ? 16  ARG A HH21 3  
ATOM   1519  H  HH22 . ARG A 1 16 ? 18.900  12.641  -10.228 1.00 0.00 ? 16  ARG A HH22 3  
ATOM   1520  N  N    . PRO A 1 17 ? 12.537  13.333  -13.852 1.00 0.00 ? 17  PRO A N    3  
ATOM   1521  C  CA   . PRO A 1 17 ? 11.958  12.598  -14.981 1.00 0.00 ? 17  PRO A CA   3  
ATOM   1522  C  C    . PRO A 1 17 ? 11.743  11.122  -14.664 1.00 0.00 ? 17  PRO A C    3  
ATOM   1523  O  O    . PRO A 1 17 ? 11.193  10.377  -15.475 1.00 0.00 ? 17  PRO A O    3  
ATOM   1524  C  CB   . PRO A 1 17 ? 13.007  12.761  -16.085 1.00 0.00 ? 17  PRO A CB   3  
ATOM   1525  C  CG   . PRO A 1 17 ? 14.288  12.990  -15.359 1.00 0.00 ? 17  PRO A CG   3  
ATOM   1526  C  CD   . PRO A 1 17 ? 13.927  13.744  -14.109 1.00 0.00 ? 17  PRO A CD   3  
ATOM   1527  H  HA   . PRO A 1 17 ? 11.024  13.036  -15.303 1.00 0.00 ? 17  PRO A HA   3  
ATOM   1528  H  HB2  . PRO A 1 17 ? 13.045  11.862  -16.684 1.00 0.00 ? 17  PRO A HB2  3  
ATOM   1529  H  HB3  . PRO A 1 17 ? 12.750  13.605  -16.708 1.00 0.00 ? 17  PRO A HB3  3  
ATOM   1530  H  HG2  . PRO A 1 17 ? 14.741  12.043  -15.108 1.00 0.00 ? 17  PRO A HG2  3  
ATOM   1531  H  HG3  . PRO A 1 17 ? 14.956  13.577  -15.971 1.00 0.00 ? 17  PRO A HG3  3  
ATOM   1532  H  HD2  . PRO A 1 17 ? 14.572  13.453  -13.294 1.00 0.00 ? 17  PRO A HD2  3  
ATOM   1533  H  HD3  . PRO A 1 17 ? 13.988  14.809  -14.280 1.00 0.00 ? 17  PRO A HD3  3  
ATOM   1534  N  N    . HIS A 1 18 ? 12.181  10.707  -13.480 1.00 0.00 ? 18  HIS A N    3  
ATOM   1535  C  CA   . HIS A 1 18 ? 12.035  9.319   -13.056 1.00 0.00 ? 18  HIS A CA   3  
ATOM   1536  C  C    . HIS A 1 18 ? 10.570  8.981   -12.795 1.00 0.00 ? 18  HIS A C    3  
ATOM   1537  O  O    . HIS A 1 18 ? 9.742   9.856   -12.539 1.00 0.00 ? 18  HIS A O    3  
ATOM   1538  C  CB   . HIS A 1 18 ? 12.862  9.059   -11.796 1.00 0.00 ? 18  HIS A CB   3  
ATOM   1539  C  CG   . HIS A 1 18 ? 14.297  8.735   -12.078 1.00 0.00 ? 18  HIS A CG   3  
ATOM   1540  N  ND1  . HIS A 1 18 ? 14.695  7.919   -13.116 1.00 0.00 ? 18  HIS A ND1  3  
ATOM   1541  C  CD2  . HIS A 1 18 ? 15.432  9.124   -11.452 1.00 0.00 ? 18  HIS A CD2  3  
ATOM   1542  C  CE1  . HIS A 1 18 ? 16.012  7.819   -13.115 1.00 0.00 ? 18  HIS A CE1  3  
ATOM   1543  N  NE2  . HIS A 1 18 ? 16.484  8.541   -12.115 1.00 0.00 ? 18  HIS A NE2  3  
ATOM   1544  H  H    . HIS A 1 18 ? 12.611  11.348  -12.877 1.00 0.00 ? 18  HIS A H    3  
ATOM   1545  H  HA   . HIS A 1 18 ? 12.401  8.688   -13.852 1.00 0.00 ? 18  HIS A HA   3  
ATOM   1546  H  HB2  . HIS A 1 18 ? 12.838  9.939   -11.170 1.00 0.00 ? 18  HIS A HB2  3  
ATOM   1547  H  HB3  . HIS A 1 18 ? 12.433  8.227   -11.257 1.00 0.00 ? 18  HIS A HB3  3  
ATOM   1548  H  HD1  . HIS A 1 18 ? 14.100  7.478   -13.758 1.00 0.00 ? 18  HIS A HD1  3  
ATOM   1549  H  HD2  . HIS A 1 18 ? 15.499  9.772   -10.589 1.00 0.00 ? 18  HIS A HD2  3  
ATOM   1550  H  HE1  . HIS A 1 18 ? 16.603  7.245   -13.813 1.00 0.00 ? 18  HIS A HE1  3  
ATOM   1551  N  N    . PRO A 1 19 ? 10.241  7.683   -12.861 1.00 0.00 ? 19  PRO A N    3  
ATOM   1552  C  CA   . PRO A 1 19 ? 8.875   7.200   -12.636 1.00 0.00 ? 19  PRO A CA   3  
ATOM   1553  C  C    . PRO A 1 19 ? 8.446   7.335   -11.179 1.00 0.00 ? 19  PRO A C    3  
ATOM   1554  O  O    . PRO A 1 19 ? 9.237   7.728   -10.321 1.00 0.00 ? 19  PRO A O    3  
ATOM   1555  C  CB   . PRO A 1 19 ? 8.949   5.725   -13.037 1.00 0.00 ? 19  PRO A CB   3  
ATOM   1556  C  CG   . PRO A 1 19 ? 10.378  5.351   -12.843 1.00 0.00 ? 19  PRO A CG   3  
ATOM   1557  C  CD   . PRO A 1 19 ? 11.176  6.586   -13.162 1.00 0.00 ? 19  PRO A CD   3  
ATOM   1558  H  HA   . PRO A 1 19 ? 8.164   7.711   -13.268 1.00 0.00 ? 19  PRO A HA   3  
ATOM   1559  H  HB2  . PRO A 1 19 ? 8.298   5.143   -12.400 1.00 0.00 ? 19  PRO A HB2  3  
ATOM   1560  H  HB3  . PRO A 1 19 ? 8.648   5.612   -14.068 1.00 0.00 ? 19  PRO A HB3  3  
ATOM   1561  H  HG2  . PRO A 1 19 ? 10.544  5.051   -11.820 1.00 0.00 ? 19  PRO A HG2  3  
ATOM   1562  H  HG3  . PRO A 1 19 ? 10.643  4.550   -13.518 1.00 0.00 ? 19  PRO A HG3  3  
ATOM   1563  H  HD2  . PRO A 1 19 ? 12.051  6.642   -12.532 1.00 0.00 ? 19  PRO A HD2  3  
ATOM   1564  H  HD3  . PRO A 1 19 ? 11.458  6.594   -14.204 1.00 0.00 ? 19  PRO A HD3  3  
ATOM   1565  N  N    . THR A 1 20 ? 7.187   7.007   -10.905 1.00 0.00 ? 20  THR A N    3  
ATOM   1566  C  CA   . THR A 1 20 ? 6.652   7.093   -9.552  1.00 0.00 ? 20  THR A CA   3  
ATOM   1567  C  C    . THR A 1 20 ? 7.007   5.852   -8.741  1.00 0.00 ? 20  THR A C    3  
ATOM   1568  O  O    . THR A 1 20 ? 7.270   4.788   -9.300  1.00 0.00 ? 20  THR A O    3  
ATOM   1569  C  CB   . THR A 1 20 ? 5.121   7.264   -9.562  1.00 0.00 ? 20  THR A CB   3  
ATOM   1570  O  OG1  . THR A 1 20 ? 4.633   7.391   -8.222  1.00 0.00 ? 20  THR A OG1  3  
ATOM   1571  C  CG2  . THR A 1 20 ? 4.449   6.081   -10.243 1.00 0.00 ? 20  THR A CG2  3  
ATOM   1572  H  H    . THR A 1 20 ? 6.604   6.702   -11.631 1.00 0.00 ? 20  THR A H    3  
ATOM   1573  H  HA   . THR A 1 20 ? 7.087   7.960   -9.075  1.00 0.00 ? 20  THR A HA   3  
ATOM   1574  H  HB   . THR A 1 20 ? 4.878   8.162   -10.113 1.00 0.00 ? 20  THR A HB   3  
ATOM   1575  H  HG1  . THR A 1 20 ? 3.730   7.067   -8.179  1.00 0.00 ? 20  THR A HG1  3  
ATOM   1576  H  HG21 . THR A 1 20 ? 3.550   6.414   -10.739 1.00 0.00 ? 20  THR A HG21 3  
ATOM   1577  H  HG22 . THR A 1 20 ? 4.197   5.336   -9.503  1.00 0.00 ? 20  THR A HG22 3  
ATOM   1578  H  HG23 . THR A 1 20 ? 5.123   5.653   -10.969 1.00 0.00 ? 20  THR A HG23 3  
ATOM   1579  N  N    . SER A 1 21 ? 7.013   5.996   -7.419  1.00 0.00 ? 21  SER A N    3  
ATOM   1580  C  CA   . SER A 1 21 ? 7.340   4.887   -6.531  1.00 0.00 ? 21  SER A CA   3  
ATOM   1581  C  C    . SER A 1 21 ? 6.790   3.573   -7.078  1.00 0.00 ? 21  SER A C    3  
ATOM   1582  O  O    . SER A 1 21 ? 5.598   3.458   -7.365  1.00 0.00 ? 21  SER A O    3  
ATOM   1583  C  CB   . SER A 1 21 ? 6.779   5.145   -5.131  1.00 0.00 ? 21  SER A CB   3  
ATOM   1584  O  OG   . SER A 1 21 ? 7.189   6.410   -4.642  1.00 0.00 ? 21  SER A OG   3  
ATOM   1585  H  H    . SER A 1 21 ? 6.795   6.870   -7.033  1.00 0.00 ? 21  SER A H    3  
ATOM   1586  H  HA   . SER A 1 21 ? 8.416   4.816   -6.471  1.00 0.00 ? 21  SER A HA   3  
ATOM   1587  H  HB2  . SER A 1 21 ? 5.700   5.119   -5.168  1.00 0.00 ? 21  SER A HB2  3  
ATOM   1588  H  HB3  . SER A 1 21 ? 7.134   4.379   -4.457  1.00 0.00 ? 21  SER A HB3  3  
ATOM   1589  H  HG   . SER A 1 21 ? 6.770   6.577   -3.795  1.00 0.00 ? 21  SER A HG   3  
ATOM   1590  N  N    . ILE A 1 22 ? 7.667   2.585   -7.218  1.00 0.00 ? 22  ILE A N    3  
ATOM   1591  C  CA   . ILE A 1 22 ? 7.270   1.279   -7.729  1.00 0.00 ? 22  ILE A CA   3  
ATOM   1592  C  C    . ILE A 1 22 ? 6.607   0.441   -6.640  1.00 0.00 ? 22  ILE A C    3  
ATOM   1593  O  O    . ILE A 1 22 ? 6.989   0.508   -5.472  1.00 0.00 ? 22  ILE A O    3  
ATOM   1594  C  CB   . ILE A 1 22 ? 8.475   0.505   -8.294  1.00 0.00 ? 22  ILE A CB   3  
ATOM   1595  C  CG1  . ILE A 1 22 ? 8.916   1.109   -9.629  1.00 0.00 ? 22  ILE A CG1  3  
ATOM   1596  C  CG2  . ILE A 1 22 ? 8.129   -0.967  -8.462  1.00 0.00 ? 22  ILE A CG2  3  
ATOM   1597  C  CD1  . ILE A 1 22 ? 9.550   2.476   -9.493  1.00 0.00 ? 22  ILE A CD1  3  
ATOM   1598  H  H    . ILE A 1 22 ? 8.603   2.737   -6.971  1.00 0.00 ? 22  ILE A H    3  
ATOM   1599  H  HA   . ILE A 1 22 ? 6.561   1.436   -8.529  1.00 0.00 ? 22  ILE A HA   3  
ATOM   1600  H  HB   . ILE A 1 22 ? 9.287   0.581   -7.587  1.00 0.00 ? 22  ILE A HB   3  
ATOM   1601  H  HG12 . ILE A 1 22 ? 9.637   0.455   -10.093 1.00 0.00 ? 22  ILE A HG12 3  
ATOM   1602  H  HG13 . ILE A 1 22 ? 8.055   1.205   -10.274 1.00 0.00 ? 22  ILE A HG13 3  
ATOM   1603  H  HG21 . ILE A 1 22 ? 8.110   -1.445  -7.493  1.00 0.00 ? 22  ILE A HG21 3  
ATOM   1604  H  HG22 . ILE A 1 22 ? 7.158   -1.057  -8.926  1.00 0.00 ? 22  ILE A HG22 3  
ATOM   1605  H  HG23 . ILE A 1 22 ? 8.872   -1.443  -9.083  1.00 0.00 ? 22  ILE A HG23 3  
ATOM   1606  H  HD11 . ILE A 1 22 ? 9.839   2.838   -10.469 1.00 0.00 ? 22  ILE A HD11 3  
ATOM   1607  H  HD12 . ILE A 1 22 ? 8.843   3.159   -9.049  1.00 0.00 ? 22  ILE A HD12 3  
ATOM   1608  H  HD13 . ILE A 1 22 ? 10.426  2.406   -8.864  1.00 0.00 ? 22  ILE A HD13 3  
ATOM   1609  N  N    . CYS A 1 23 ? 5.614   -0.350  -7.032  1.00 0.00 ? 23  CYS A N    3  
ATOM   1610  C  CA   . CYS A 1 23 ? 4.898   -1.203  -6.092  1.00 0.00 ? 23  CYS A CA   3  
ATOM   1611  C  C    . CYS A 1 23 ? 5.842   -2.216  -5.450  1.00 0.00 ? 23  CYS A C    3  
ATOM   1612  O  O    . CYS A 1 23 ? 7.036   -2.245  -5.750  1.00 0.00 ? 23  CYS A O    3  
ATOM   1613  C  CB   . CYS A 1 23 ? 3.755   -1.932  -6.800  1.00 0.00 ? 23  CYS A CB   3  
ATOM   1614  S  SG   . CYS A 1 23 ? 2.340   -2.322  -5.721  1.00 0.00 ? 23  CYS A SG   3  
ATOM   1615  H  H    . CYS A 1 23 ? 5.355   -0.360  -7.979  1.00 0.00 ? 23  CYS A H    3  
ATOM   1616  H  HA   . CYS A 1 23 ? 4.487   -0.573  -5.318  1.00 0.00 ? 23  CYS A HA   3  
ATOM   1617  H  HB2  . CYS A 1 23 ? 3.390   -1.314  -7.608  1.00 0.00 ? 23  CYS A HB2  3  
ATOM   1618  H  HB3  . CYS A 1 23 ? 4.126   -2.862  -7.204  1.00 0.00 ? 23  CYS A HB3  3  
ATOM   1619  N  N    . ASP A 1 24 ? 5.298   -3.046  -4.566  1.00 0.00 ? 24  ASP A N    3  
ATOM   1620  C  CA   . ASP A 1 24 ? 6.090   -4.062  -3.883  1.00 0.00 ? 24  ASP A CA   3  
ATOM   1621  C  C    . ASP A 1 24 ? 5.689   -5.461  -4.339  1.00 0.00 ? 24  ASP A C    3  
ATOM   1622  O  O    . ASP A 1 24 ? 6.472   -6.405  -4.240  1.00 0.00 ? 24  ASP A O    3  
ATOM   1623  C  CB   . ASP A 1 24 ? 5.920   -3.938  -2.368  1.00 0.00 ? 24  ASP A CB   3  
ATOM   1624  C  CG   . ASP A 1 24 ? 6.883   -4.823  -1.603  1.00 0.00 ? 24  ASP A CG   3  
ATOM   1625  O  OD1  . ASP A 1 24 ? 6.581   -6.023  -1.434  1.00 0.00 ? 24  ASP A OD1  3  
ATOM   1626  O  OD2  . ASP A 1 24 ? 7.941   -4.316  -1.174  1.00 0.00 ? 24  ASP A OD2  3  
ATOM   1627  H  H    . ASP A 1 24 ? 4.340   -2.974  -4.370  1.00 0.00 ? 24  ASP A H    3  
ATOM   1628  H  HA   . ASP A 1 24 ? 7.127   -3.898  -4.134  1.00 0.00 ? 24  ASP A HA   3  
ATOM   1629  H  HB2  . ASP A 1 24 ? 6.093   -2.912  -2.076  1.00 0.00 ? 24  ASP A HB2  3  
ATOM   1630  H  HB3  . ASP A 1 24 ? 4.911   -4.219  -2.101  1.00 0.00 ? 24  ASP A HB3  3  
ATOM   1631  N  N    . ASN A 1 25 ? 4.463   -5.587  -4.839  1.00 0.00 ? 25  ASN A N    3  
ATOM   1632  C  CA   . ASN A 1 25 ? 3.958   -6.872  -5.309  1.00 0.00 ? 25  ASN A CA   3  
ATOM   1633  C  C    . ASN A 1 25 ? 4.268   -7.070  -6.789  1.00 0.00 ? 25  ASN A C    3  
ATOM   1634  O  O    . ASN A 1 25 ? 5.074   -7.926  -7.156  1.00 0.00 ? 25  ASN A O    3  
ATOM   1635  C  CB   . ASN A 1 25 ? 2.448   -6.965  -5.076  1.00 0.00 ? 25  ASN A CB   3  
ATOM   1636  C  CG   . ASN A 1 25 ? 2.106   -7.341  -3.647  1.00 0.00 ? 25  ASN A CG   3  
ATOM   1637  O  OD1  . ASN A 1 25 ? 2.993   -7.536  -2.815  1.00 0.00 ? 25  ASN A OD1  3  
ATOM   1638  N  ND2  . ASN A 1 25 ? 0.815   -7.445  -3.356  1.00 0.00 ? 25  ASN A ND2  3  
ATOM   1639  H  H    . ASN A 1 25 ? 3.885   -4.798  -4.892  1.00 0.00 ? 25  ASN A H    3  
ATOM   1640  H  HA   . ASN A 1 25 ? 4.449   -7.649  -4.742  1.00 0.00 ? 25  ASN A HA   3  
ATOM   1641  H  HB2  . ASN A 1 25 ? 1.997   -6.009  -5.294  1.00 0.00 ? 25  ASN A HB2  3  
ATOM   1642  H  HB3  . ASN A 1 25 ? 2.034   -7.713  -5.735  1.00 0.00 ? 25  ASN A HB3  3  
ATOM   1643  H  HD21 . ASN A 1 25 ? 0.164   -7.275  -4.069  1.00 0.00 ? 25  ASN A HD21 3  
ATOM   1644  H  HD22 . ASN A 1 25 ? 0.565   -7.686  -2.439  1.00 0.00 ? 25  ASN A HD22 3  
ATOM   1645  N  N    . PHE A 1 26 ? 3.625   -6.272  -7.635  1.00 0.00 ? 26  PHE A N    3  
ATOM   1646  C  CA   . PHE A 1 26 ? 3.832   -6.359  -9.076  1.00 0.00 ? 26  PHE A CA   3  
ATOM   1647  C  C    . PHE A 1 26 ? 5.309   -6.203  -9.424  1.00 0.00 ? 26  PHE A C    3  
ATOM   1648  O  O    . PHE A 1 26 ? 5.776   -6.712  -10.443 1.00 0.00 ? 26  PHE A O    3  
ATOM   1649  C  CB   . PHE A 1 26 ? 3.010   -5.288  -9.796  1.00 0.00 ? 26  PHE A CB   3  
ATOM   1650  C  CG   . PHE A 1 26 ? 2.575   -5.693  -11.175 1.00 0.00 ? 26  PHE A CG   3  
ATOM   1651  C  CD1  . PHE A 1 26 ? 3.493   -5.772  -12.211 1.00 0.00 ? 26  PHE A CD1  3  
ATOM   1652  C  CD2  . PHE A 1 26 ? 1.249   -5.997  -11.437 1.00 0.00 ? 26  PHE A CD2  3  
ATOM   1653  C  CE1  . PHE A 1 26 ? 3.094   -6.144  -13.481 1.00 0.00 ? 26  PHE A CE1  3  
ATOM   1654  C  CE2  . PHE A 1 26 ? 0.845   -6.370  -12.705 1.00 0.00 ? 26  PHE A CE2  3  
ATOM   1655  C  CZ   . PHE A 1 26 ? 1.769   -6.444  -13.728 1.00 0.00 ? 26  PHE A CZ   3  
ATOM   1656  H  H    . PHE A 1 26 ? 2.995   -5.609  -7.281  1.00 0.00 ? 26  PHE A H    3  
ATOM   1657  H  HA   . PHE A 1 26 ? 3.500   -7.334  -9.399  1.00 0.00 ? 26  PHE A HA   3  
ATOM   1658  H  HB2  . PHE A 1 26 ? 2.124   -5.075  -9.218  1.00 0.00 ? 26  PHE A HB2  3  
ATOM   1659  H  HB3  . PHE A 1 26 ? 3.602   -4.390  -9.884  1.00 0.00 ? 26  PHE A HB3  3  
ATOM   1660  H  HD1  . PHE A 1 26 ? 4.530   -5.538  -12.019 1.00 0.00 ? 26  PHE A HD1  3  
ATOM   1661  H  HD2  . PHE A 1 26 ? 0.524   -5.939  -10.636 1.00 0.00 ? 26  PHE A HD2  3  
ATOM   1662  H  HE1  . PHE A 1 26 ? 3.819   -6.202  -14.279 1.00 0.00 ? 26  PHE A HE1  3  
ATOM   1663  H  HE2  . PHE A 1 26 ? -0.193  -6.604  -12.894 1.00 0.00 ? 26  PHE A HE2  3  
ATOM   1664  H  HZ   . PHE A 1 26 ? 1.455   -6.735  -14.720 1.00 0.00 ? 26  PHE A HZ   3  
ATOM   1665  N  N    . SER A 1 27 ? 6.040   -5.494  -8.569  1.00 0.00 ? 27  SER A N    3  
ATOM   1666  C  CA   . SER A 1 27 ? 7.464   -5.265  -8.787  1.00 0.00 ? 27  SER A CA   3  
ATOM   1667  C  C    . SER A 1 27 ? 8.189   -6.579  -9.065  1.00 0.00 ? 27  SER A C    3  
ATOM   1668  O  O    . SER A 1 27 ? 8.721   -6.789  -10.154 1.00 0.00 ? 27  SER A O    3  
ATOM   1669  C  CB   . SER A 1 27 ? 8.084   -4.575  -7.571  1.00 0.00 ? 27  SER A CB   3  
ATOM   1670  O  OG   . SER A 1 27 ? 9.498   -4.575  -7.650  1.00 0.00 ? 27  SER A OG   3  
ATOM   1671  H  H    . SER A 1 27 ? 5.611   -5.113  -7.774  1.00 0.00 ? 27  SER A H    3  
ATOM   1672  H  HA   . SER A 1 27 ? 7.568   -4.621  -9.648  1.00 0.00 ? 27  SER A HA   3  
ATOM   1673  H  HB2  . SER A 1 27 ? 7.738   -3.554  -7.525  1.00 0.00 ? 27  SER A HB2  3  
ATOM   1674  H  HB3  . SER A 1 27 ? 7.785   -5.097  -6.673  1.00 0.00 ? 27  SER A HB3  3  
ATOM   1675  H  HG   . SER A 1 27 ? 9.814   -5.478  -7.739  1.00 0.00 ? 27  SER A HG   3  
ATOM   1676  N  N    . ALA A 1 28 ? 8.204   -7.460  -8.070  1.00 0.00 ? 28  ALA A N    3  
ATOM   1677  C  CA   . ALA A 1 28 ? 8.861   -8.754  -8.207  1.00 0.00 ? 28  ALA A CA   3  
ATOM   1678  C  C    . ALA A 1 28 ? 7.858   -9.843  -8.575  1.00 0.00 ? 28  ALA A C    3  
ATOM   1679  O  O    . ALA A 1 28 ? 7.990   -10.498 -9.609  1.00 0.00 ? 28  ALA A O    3  
ATOM   1680  C  CB   . ALA A 1 28 ? 9.587   -9.116  -6.919  1.00 0.00 ? 28  ALA A CB   3  
ATOM   1681  H  H    . ALA A 1 28 ? 7.762   -7.235  -7.225  1.00 0.00 ? 28  ALA A H    3  
ATOM   1682  H  HA   . ALA A 1 28 ? 9.596   -8.674  -8.995  1.00 0.00 ? 28  ALA A HA   3  
ATOM   1683  H  HB1  . ALA A 1 28 ? 9.385   -10.148 -6.671  1.00 0.00 ? 28  ALA A HB1  3  
ATOM   1684  H  HB2  . ALA A 1 28 ? 10.649  -8.979  -7.055  1.00 0.00 ? 28  ALA A HB2  3  
ATOM   1685  H  HB3  . ALA A 1 28 ? 9.240   -8.479  -6.120  1.00 0.00 ? 28  ALA A HB3  3  
ATOM   1686  N  N    . TYR A 1 29 ? 6.857   -10.031 -7.722  1.00 0.00 ? 29  TYR A N    3  
ATOM   1687  C  CA   . TYR A 1 29 ? 5.834   -11.043 -7.956  1.00 0.00 ? 29  TYR A CA   3  
ATOM   1688  C  C    . TYR A 1 29 ? 5.258   -10.920 -9.364  1.00 0.00 ? 29  TYR A C    3  
ATOM   1689  O  O    . TYR A 1 29 ? 5.259   -11.880 -10.133 1.00 0.00 ? 29  TYR A O    3  
ATOM   1690  C  CB   . TYR A 1 29 ? 4.714   -10.914 -6.922  1.00 0.00 ? 29  TYR A CB   3  
ATOM   1691  C  CG   . TYR A 1 29 ? 5.195   -11.013 -5.492  1.00 0.00 ? 29  TYR A CG   3  
ATOM   1692  C  CD1  . TYR A 1 29 ? 5.740   -9.912  -4.844  1.00 0.00 ? 29  TYR A CD1  3  
ATOM   1693  C  CD2  . TYR A 1 29 ? 5.104   -12.208 -4.789  1.00 0.00 ? 29  TYR A CD2  3  
ATOM   1694  C  CE1  . TYR A 1 29 ? 6.182   -9.998  -3.538  1.00 0.00 ? 29  TYR A CE1  3  
ATOM   1695  C  CE2  . TYR A 1 29 ? 5.542   -12.304 -3.483  1.00 0.00 ? 29  TYR A CE2  3  
ATOM   1696  C  CZ   . TYR A 1 29 ? 6.081   -11.196 -2.862  1.00 0.00 ? 29  TYR A CZ   3  
ATOM   1697  O  OH   . TYR A 1 29 ? 6.519   -11.286 -1.560  1.00 0.00 ? 29  TYR A OH   3  
ATOM   1698  H  H    . TYR A 1 29 ? 6.806   -9.478  -6.915  1.00 0.00 ? 29  TYR A H    3  
ATOM   1699  H  HA   . TYR A 1 29 ? 6.297   -12.013 -7.852  1.00 0.00 ? 29  TYR A HA   3  
ATOM   1700  H  HB2  . TYR A 1 29 ? 4.230   -9.958  -7.043  1.00 0.00 ? 29  TYR A HB2  3  
ATOM   1701  H  HB3  . TYR A 1 29 ? 3.991   -11.701 -7.085  1.00 0.00 ? 29  TYR A HB3  3  
ATOM   1702  H  HD1  . TYR A 1 29 ? 5.818   -8.975  -5.377  1.00 0.00 ? 29  TYR A HD1  3  
ATOM   1703  H  HD2  . TYR A 1 29 ? 4.682   -13.074 -5.278  1.00 0.00 ? 29  TYR A HD2  3  
ATOM   1704  H  HE1  . TYR A 1 29 ? 6.604   -9.131  -3.052  1.00 0.00 ? 29  TYR A HE1  3  
ATOM   1705  H  HE2  . TYR A 1 29 ? 5.463   -13.241 -2.952  1.00 0.00 ? 29  TYR A HE2  3  
ATOM   1706  H  HH   . TYR A 1 29 ? 5.821   -10.995 -0.967  1.00 0.00 ? 29  TYR A HH   3  
ATOM   1707  N  N    . GLY A 1 30 ? 4.767   -9.729  -9.694  1.00 0.00 ? 30  GLY A N    3  
ATOM   1708  C  CA   . GLY A 1 30 ? 4.196   -9.501  -11.008 1.00 0.00 ? 30  GLY A CA   3  
ATOM   1709  C  C    . GLY A 1 30 ? 2.724   -9.146  -10.946 1.00 0.00 ? 30  GLY A C    3  
ATOM   1710  O  O    . GLY A 1 30 ? 2.208   -8.454  -11.824 1.00 0.00 ? 30  GLY A O    3  
ATOM   1711  H  H    . GLY A 1 30 ? 4.793   -9.000  -9.039  1.00 0.00 ? 30  GLY A H    3  
ATOM   1712  H  HA2  . GLY A 1 30 ? 4.731   -8.694  -11.486 1.00 0.00 ? 30  GLY A HA2  3  
ATOM   1713  H  HA3  . GLY A 1 30 ? 4.313   -10.397 -11.600 1.00 0.00 ? 30  GLY A HA3  3  
ATOM   1714  N  N    . TRP A 1 31 ? 2.045   -9.621  -9.908  1.00 0.00 ? 31  TRP A N    3  
ATOM   1715  C  CA   . TRP A 1 31 ? 0.622   -9.351  -9.736  1.00 0.00 ? 31  TRP A CA   3  
ATOM   1716  C  C    . TRP A 1 31 ? 0.390   -8.357  -8.604  1.00 0.00 ? 31  TRP A C    3  
ATOM   1717  O  O    . TRP A 1 31 ? 1.237   -8.191  -7.726  1.00 0.00 ? 31  TRP A O    3  
ATOM   1718  C  CB   . TRP A 1 31 ? -0.134  -10.650 -9.455  1.00 0.00 ? 31  TRP A CB   3  
ATOM   1719  C  CG   . TRP A 1 31 ? -0.262  -10.958 -7.993  1.00 0.00 ? 31  TRP A CG   3  
ATOM   1720  C  CD1  . TRP A 1 31 ? 0.660   -11.583 -7.204  1.00 0.00 ? 31  TRP A CD1  3  
ATOM   1721  C  CD2  . TRP A 1 31 ? -1.378  -10.657 -7.149  1.00 0.00 ? 31  TRP A CD2  3  
ATOM   1722  N  NE1  . TRP A 1 31 ? 0.185   -11.688 -5.919  1.00 0.00 ? 31  TRP A NE1  3  
ATOM   1723  C  CE2  . TRP A 1 31 ? -1.063  -11.127 -5.859  1.00 0.00 ? 31  TRP A CE2  3  
ATOM   1724  C  CE3  . TRP A 1 31 ? -2.612  -10.034 -7.356  1.00 0.00 ? 31  TRP A CE3  3  
ATOM   1725  C  CZ2  . TRP A 1 31 ? -1.938  -10.994 -4.784  1.00 0.00 ? 31  TRP A CZ2  3  
ATOM   1726  C  CZ3  . TRP A 1 31 ? -3.479  -9.903  -6.288  1.00 0.00 ? 31  TRP A CZ3  3  
ATOM   1727  C  CH2  . TRP A 1 31 ? -3.139  -10.380 -5.015  1.00 0.00 ? 31  TRP A CH2  3  
ATOM   1728  H  H    . TRP A 1 31 ? 2.512   -10.167 -9.240  1.00 0.00 ? 31  TRP A H    3  
ATOM   1729  H  HA   . TRP A 1 31 ? 0.254   -8.922  -10.657 1.00 0.00 ? 31  TRP A HA   3  
ATOM   1730  H  HB2  . TRP A 1 31 ? -1.129  -10.577 -9.868  1.00 0.00 ? 31  TRP A HB2  3  
ATOM   1731  H  HB3  . TRP A 1 31 ? 0.388   -11.471 -9.925  1.00 0.00 ? 31  TRP A HB3  3  
ATOM   1732  H  HD1  . TRP A 1 31 ? 1.618   -11.938 -7.552  1.00 0.00 ? 31  TRP A HD1  3  
ATOM   1733  H  HE1  . TRP A 1 31 ? 0.663   -12.097 -5.167  1.00 0.00 ? 31  TRP A HE1  3  
ATOM   1734  H  HE3  . TRP A 1 31 ? -2.892  -9.660  -8.329  1.00 0.00 ? 31  TRP A HE3  3  
ATOM   1735  H  HZ2  . TRP A 1 31 ? -1.690  -11.356 -3.797  1.00 0.00 ? 31  TRP A HZ2  3  
ATOM   1736  H  HZ3  . TRP A 1 31 ? -4.438  -9.425  -6.429  1.00 0.00 ? 31  TRP A HZ3  3  
ATOM   1737  H  HH2  . TRP A 1 31 ? -3.848  -10.256 -4.211  1.00 0.00 ? 31  TRP A HH2  3  
ATOM   1738  N  N    . CYS A 1 32 ? -0.763  -7.697  -8.629  1.00 0.00 ? 32  CYS A N    3  
ATOM   1739  C  CA   . CYS A 1 32 ? -1.108  -6.719  -7.604  1.00 0.00 ? 32  CYS A CA   3  
ATOM   1740  C  C    . CYS A 1 32 ? -2.609  -6.724  -7.330  1.00 0.00 ? 32  CYS A C    3  
ATOM   1741  O  O    . CYS A 1 32 ? -3.432  -6.746  -8.245  1.00 0.00 ? 32  CYS A O    3  
ATOM   1742  C  CB   . CYS A 1 32 ? -0.662  -5.320  -8.035  1.00 0.00 ? 32  CYS A CB   3  
ATOM   1743  S  SG   . CYS A 1 32 ? -0.946  -4.030  -6.780  1.00 0.00 ? 32  CYS A SG   3  
ATOM   1744  H  H    . CYS A 1 32 ? -1.399  -7.872  -9.355  1.00 0.00 ? 32  CYS A H    3  
ATOM   1745  H  HA   . CYS A 1 32 ? -0.587  -6.990  -6.698  1.00 0.00 ? 32  CYS A HA   3  
ATOM   1746  H  HB2  . CYS A 1 32 ? 0.397   -5.338  -8.251  1.00 0.00 ? 32  CYS A HB2  3  
ATOM   1747  H  HB3  . CYS A 1 32 ? -1.201  -5.037  -8.926  1.00 0.00 ? 32  CYS A HB3  3  
ATOM   1748  N  N    . PRO A 1 33 ? -2.974  -6.702  -6.039  1.00 0.00 ? 33  PRO A N    3  
ATOM   1749  C  CA   . PRO A 1 33 ? -4.377  -6.703  -5.614  1.00 0.00 ? 33  PRO A CA   3  
ATOM   1750  C  C    . PRO A 1 33 ? -5.081  -5.390  -5.937  1.00 0.00 ? 33  PRO A C    3  
ATOM   1751  O  O    . PRO A 1 33 ? -6.275  -5.233  -5.676  1.00 0.00 ? 33  PRO A O    3  
ATOM   1752  C  CB   . PRO A 1 33 ? -4.288  -6.903  -4.099  1.00 0.00 ? 33  PRO A CB   3  
ATOM   1753  C  CG   . PRO A 1 33 ? -2.943  -6.381  -3.726  1.00 0.00 ? 33  PRO A CG   3  
ATOM   1754  C  CD   . PRO A 1 33 ? -2.046  -6.675  -4.896  1.00 0.00 ? 33  PRO A CD   3  
ATOM   1755  H  HA   . PRO A 1 33 ? -4.925  -7.522  -6.055  1.00 0.00 ? 33  PRO A HA   3  
ATOM   1756  H  HB2  . PRO A 1 33 ? -5.077  -6.348  -3.613  1.00 0.00 ? 33  PRO A HB2  3  
ATOM   1757  H  HB3  . PRO A 1 33 ? -4.382  -7.953  -3.865  1.00 0.00 ? 33  PRO A HB3  3  
ATOM   1758  H  HG2  . PRO A 1 33 ? -2.998  -5.317  -3.552  1.00 0.00 ? 33  PRO A HG2  3  
ATOM   1759  H  HG3  . PRO A 1 33 ? -2.585  -6.889  -2.843  1.00 0.00 ? 33  PRO A HG3  3  
ATOM   1760  H  HD2  . PRO A 1 33 ? -1.312  -5.892  -5.015  1.00 0.00 ? 33  PRO A HD2  3  
ATOM   1761  H  HD3  . PRO A 1 33 ? -1.562  -7.632  -4.770  1.00 0.00 ? 33  PRO A HD3  3  
ATOM   1762  N  N    . LEU A 1 34 ? -4.336  -4.449  -6.506  1.00 0.00 ? 34  LEU A N    3  
ATOM   1763  C  CA   . LEU A 1 34 ? -4.890  -3.148  -6.866  1.00 0.00 ? 34  LEU A CA   3  
ATOM   1764  C  C    . LEU A 1 34 ? -5.011  -3.007  -8.380  1.00 0.00 ? 34  LEU A C    3  
ATOM   1765  O  O    . LEU A 1 34 ? -5.773  -2.179  -8.878  1.00 0.00 ? 34  LEU A O    3  
ATOM   1766  C  CB   . LEU A 1 34 ? -4.014  -2.026  -6.306  1.00 0.00 ? 34  LEU A CB   3  
ATOM   1767  C  CG   . LEU A 1 34 ? -4.216  -1.690  -4.828  1.00 0.00 ? 34  LEU A CG   3  
ATOM   1768  C  CD1  . LEU A 1 34 ? -3.352  -0.504  -4.427  1.00 0.00 ? 34  LEU A CD1  3  
ATOM   1769  C  CD2  . LEU A 1 34 ? -5.683  -1.404  -4.542  1.00 0.00 ? 34  LEU A CD2  3  
ATOM   1770  H  H    . LEU A 1 34 ? -3.392  -4.632  -6.689  1.00 0.00 ? 34  LEU A H    3  
ATOM   1771  H  HA   . LEU A 1 34 ? -5.876  -3.075  -6.430  1.00 0.00 ? 34  LEU A HA   3  
ATOM   1772  H  HB2  . LEU A 1 34 ? -2.983  -2.314  -6.441  1.00 0.00 ? 34  LEU A HB2  3  
ATOM   1773  H  HB3  . LEU A 1 34 ? -4.215  -1.133  -6.880  1.00 0.00 ? 34  LEU A HB3  3  
ATOM   1774  H  HG   . LEU A 1 34 ? -3.916  -2.538  -4.228  1.00 0.00 ? 34  LEU A HG   3  
ATOM   1775  H  HD11 . LEU A 1 34 ? -3.551  -0.245  -3.399  1.00 0.00 ? 34  LEU A HD11 3  
ATOM   1776  H  HD12 . LEU A 1 34 ? -3.581  0.339   -5.062  1.00 0.00 ? 34  LEU A HD12 3  
ATOM   1777  H  HD13 . LEU A 1 34 ? -2.309  -0.765  -4.539  1.00 0.00 ? 34  LEU A HD13 3  
ATOM   1778  H  HD21 . LEU A 1 34 ? -6.115  -0.873  -5.377  1.00 0.00 ? 34  LEU A HD21 3  
ATOM   1779  H  HD22 . LEU A 1 34 ? -5.765  -0.799  -3.650  1.00 0.00 ? 34  LEU A HD22 3  
ATOM   1780  H  HD23 . LEU A 1 34 ? -6.209  -2.335  -4.396  1.00 0.00 ? 34  LEU A HD23 3  
ATOM   1781  N  N    . GLY A 1 35 ? -4.255  -3.824  -9.107  1.00 0.00 ? 35  GLY A N    3  
ATOM   1782  C  CA   . GLY A 1 35 ? -4.294  -3.776  -10.557 1.00 0.00 ? 35  GLY A CA   3  
ATOM   1783  C  C    . GLY A 1 35 ? -3.742  -2.477  -11.109 1.00 0.00 ? 35  GLY A C    3  
ATOM   1784  O  O    . GLY A 1 35 ? -2.779  -1.915  -10.586 1.00 0.00 ? 35  GLY A O    3  
ATOM   1785  H  H    . GLY A 1 35 ? -3.666  -4.464  -8.656  1.00 0.00 ? 35  GLY A H    3  
ATOM   1786  H  HA2  . GLY A 1 35 ? -3.713  -4.598  -10.949 1.00 0.00 ? 35  GLY A HA2  3  
ATOM   1787  H  HA3  . GLY A 1 35 ? -5.318  -3.885  -10.882 1.00 0.00 ? 35  GLY A HA3  3  
ATOM   1788  N  N    . PRO A 1 36 ? -4.357  -1.981  -12.193 1.00 0.00 ? 36  PRO A N    3  
ATOM   1789  C  CA   . PRO A 1 36 ? -3.937  -0.735  -12.841 1.00 0.00 ? 36  PRO A CA   3  
ATOM   1790  C  C    . PRO A 1 36 ? -4.239  0.492   -11.987 1.00 0.00 ? 36  PRO A C    3  
ATOM   1791  O  O    . PRO A 1 36 ? -3.532  1.497   -12.059 1.00 0.00 ? 36  PRO A O    3  
ATOM   1792  C  CB   . PRO A 1 36 ? -4.766  -0.707  -14.128 1.00 0.00 ? 36  PRO A CB   3  
ATOM   1793  C  CG   . PRO A 1 36 ? -5.970  -1.528  -13.820 1.00 0.00 ? 36  PRO A CG   3  
ATOM   1794  C  CD   . PRO A 1 36 ? -5.511  -2.598  -12.869 1.00 0.00 ? 36  PRO A CD   3  
ATOM   1795  H  HA   . PRO A 1 36 ? -2.886  -0.751  -13.088 1.00 0.00 ? 36  PRO A HA   3  
ATOM   1796  H  HB2  . PRO A 1 36 ? -5.032  0.313   -14.366 1.00 0.00 ? 36  PRO A HB2  3  
ATOM   1797  H  HB3  . PRO A 1 36 ? -4.193  -1.134  -14.937 1.00 0.00 ? 36  PRO A HB3  3  
ATOM   1798  H  HG2  . PRO A 1 36 ? -6.725  -0.912  -13.356 1.00 0.00 ? 36  PRO A HG2  3  
ATOM   1799  H  HG3  . PRO A 1 36 ? -6.352  -1.973  -14.727 1.00 0.00 ? 36  PRO A HG3  3  
ATOM   1800  H  HD2  . PRO A 1 36 ? -6.291  -2.834  -12.161 1.00 0.00 ? 36  PRO A HD2  3  
ATOM   1801  H  HD3  . PRO A 1 36 ? -5.211  -3.482  -13.412 1.00 0.00 ? 36  PRO A HD3  3  
ATOM   1802  N  N    . GLN A 1 37 ? -5.291  0.403   -11.180 1.00 0.00 ? 37  GLN A N    3  
ATOM   1803  C  CA   . GLN A 1 37 ? -5.685  1.507   -10.313 1.00 0.00 ? 37  GLN A CA   3  
ATOM   1804  C  C    . GLN A 1 37 ? -4.615  1.782   -9.262  1.00 0.00 ? 37  GLN A C    3  
ATOM   1805  O  O    . GLN A 1 37 ? -4.508  2.894   -8.745  1.00 0.00 ? 37  GLN A O    3  
ATOM   1806  C  CB   . GLN A 1 37 ? -7.019  1.197   -9.632  1.00 0.00 ? 37  GLN A CB   3  
ATOM   1807  C  CG   . GLN A 1 37 ? -8.231  1.537   -10.484 1.00 0.00 ? 37  GLN A CG   3  
ATOM   1808  C  CD   . GLN A 1 37 ? -9.508  0.914   -9.957  1.00 0.00 ? 37  GLN A CD   3  
ATOM   1809  O  OE1  . GLN A 1 37 ? -9.801  -0.251  -10.227 1.00 0.00 ? 37  GLN A OE1  3  
ATOM   1810  N  NE2  . GLN A 1 37 ? -10.277 1.689   -9.200  1.00 0.00 ? 37  GLN A NE2  3  
ATOM   1811  H  H    . GLN A 1 37 ? -5.815  -0.425  -11.169 1.00 0.00 ? 37  GLN A H    3  
ATOM   1812  H  HA   . GLN A 1 37 ? -5.801  2.386   -10.929 1.00 0.00 ? 37  GLN A HA   3  
ATOM   1813  H  HB2  . GLN A 1 37 ? -7.054  0.144   -9.398  1.00 0.00 ? 37  GLN A HB2  3  
ATOM   1814  H  HB3  . GLN A 1 37 ? -7.081  1.764   -8.714  1.00 0.00 ? 37  GLN A HB3  3  
ATOM   1815  H  HG2  . GLN A 1 37 ? -8.353  2.610   -10.502 1.00 0.00 ? 37  GLN A HG2  3  
ATOM   1816  H  HG3  . GLN A 1 37 ? -8.060  1.179   -11.488 1.00 0.00 ? 37  GLN A HG3  3  
ATOM   1817  H  HE21 . GLN A 1 37 ? -9.980  2.607   -9.028  1.00 0.00 ? 37  GLN A HE21 3  
ATOM   1818  H  HE22 . GLN A 1 37 ? -11.109 1.312   -8.847  1.00 0.00 ? 37  GLN A HE22 3  
ATOM   1819  N  N    . CYS A 1 38 ? -3.824  0.761   -8.949  1.00 0.00 ? 38  CYS A N    3  
ATOM   1820  C  CA   . CYS A 1 38 ? -2.762  0.891   -7.958  1.00 0.00 ? 38  CYS A CA   3  
ATOM   1821  C  C    . CYS A 1 38 ? -2.032  2.221   -8.116  1.00 0.00 ? 38  CYS A C    3  
ATOM   1822  O  O    . CYS A 1 38 ? -1.697  2.647   -9.222  1.00 0.00 ? 38  CYS A O    3  
ATOM   1823  C  CB   . CYS A 1 38 ? -1.770  -0.267  -8.088  1.00 0.00 ? 38  CYS A CB   3  
ATOM   1824  S  SG   . CYS A 1 38 ? -0.412  -0.222  -6.875  1.00 0.00 ? 38  CYS A SG   3  
ATOM   1825  H  H    . CYS A 1 38 ? -3.958  -0.103  -9.395  1.00 0.00 ? 38  CYS A H    3  
ATOM   1826  H  HA   . CYS A 1 38 ? -3.215  0.857   -6.979  1.00 0.00 ? 38  CYS A HA   3  
ATOM   1827  H  HB2  . CYS A 1 38 ? -2.298  -1.200  -7.954  1.00 0.00 ? 38  CYS A HB2  3  
ATOM   1828  H  HB3  . CYS A 1 38 ? -1.331  -0.246  -9.075  1.00 0.00 ? 38  CYS A HB3  3  
ATOM   1829  N  N    . PRO A 1 39 ? -1.777  2.894   -6.984  1.00 0.00 ? 39  PRO A N    3  
ATOM   1830  C  CA   . PRO A 1 39 ? -1.083  4.185   -6.969  1.00 0.00 ? 39  PRO A CA   3  
ATOM   1831  C  C    . PRO A 1 39 ? 0.390   4.055   -7.338  1.00 0.00 ? 39  PRO A C    3  
ATOM   1832  O  O    . PRO A 1 39 ? 1.011   5.014   -7.797  1.00 0.00 ? 39  PRO A O    3  
ATOM   1833  C  CB   . PRO A 1 39 ? -1.232  4.652   -5.519  1.00 0.00 ? 39  PRO A CB   3  
ATOM   1834  C  CG   . PRO A 1 39 ? -1.405  3.398   -4.734  1.00 0.00 ? 39  PRO A CG   3  
ATOM   1835  C  CD   . PRO A 1 39 ? -2.147  2.446   -5.631  1.00 0.00 ? 39  PRO A CD   3  
ATOM   1836  H  HA   . PRO A 1 39 ? -1.557  4.898   -7.629  1.00 0.00 ? 39  PRO A HA   3  
ATOM   1837  H  HB2  . PRO A 1 39 ? -0.343  5.188   -5.218  1.00 0.00 ? 39  PRO A HB2  3  
ATOM   1838  H  HB3  . PRO A 1 39 ? -2.095  5.295   -5.430  1.00 0.00 ? 39  PRO A HB3  3  
ATOM   1839  H  HG2  . PRO A 1 39 ? -0.440  2.991   -4.473  1.00 0.00 ? 39  PRO A HG2  3  
ATOM   1840  H  HG3  . PRO A 1 39 ? -1.981  3.599   -3.843  1.00 0.00 ? 39  PRO A HG3  3  
ATOM   1841  H  HD2  . PRO A 1 39 ? -1.821  1.432   -5.458  1.00 0.00 ? 39  PRO A HD2  3  
ATOM   1842  H  HD3  . PRO A 1 39 ? -3.213  2.534   -5.474  1.00 0.00 ? 39  PRO A HD3  3  
ATOM   1843  N  N    . GLN A 1 40 ? 0.944   2.864   -7.136  1.00 0.00 ? 40  GLN A N    3  
ATOM   1844  C  CA   . GLN A 1 40 ? 2.345   2.610   -7.448  1.00 0.00 ? 40  GLN A CA   3  
ATOM   1845  C  C    . GLN A 1 40 ? 2.495   2.039   -8.854  1.00 0.00 ? 40  GLN A C    3  
ATOM   1846  O  O    . GLN A 1 40 ? 1.611   1.339   -9.348  1.00 0.00 ? 40  GLN A O    3  
ATOM   1847  C  CB   . GLN A 1 40 ? 2.951   1.646   -6.426  1.00 0.00 ? 40  GLN A CB   3  
ATOM   1848  C  CG   . GLN A 1 40 ? 2.833   2.129   -4.990  1.00 0.00 ? 40  GLN A CG   3  
ATOM   1849  C  CD   . GLN A 1 40 ? 3.538   1.216   -4.007  1.00 0.00 ? 40  GLN A CD   3  
ATOM   1850  O  OE1  . GLN A 1 40 ? 2.965   0.236   -3.531  1.00 0.00 ? 40  GLN A OE1  3  
ATOM   1851  N  NE2  . GLN A 1 40 ? 4.790   1.533   -3.698  1.00 0.00 ? 40  GLN A NE2  3  
ATOM   1852  H  H    . GLN A 1 40 ? 0.397   2.139   -6.768  1.00 0.00 ? 40  GLN A H    3  
ATOM   1853  H  HA   . GLN A 1 40 ? 2.872   3.551   -7.397  1.00 0.00 ? 40  GLN A HA   3  
ATOM   1854  H  HB2  . GLN A 1 40 ? 2.448   0.694   -6.506  1.00 0.00 ? 40  GLN A HB2  3  
ATOM   1855  H  HB3  . GLN A 1 40 ? 3.998   1.511   -6.653  1.00 0.00 ? 40  GLN A HB3  3  
ATOM   1856  H  HG2  . GLN A 1 40 ? 3.269   3.115   -4.918  1.00 0.00 ? 40  GLN A HG2  3  
ATOM   1857  H  HG3  . GLN A 1 40 ? 1.787   2.180   -4.726  1.00 0.00 ? 40  GLN A HG3  3  
ATOM   1858  H  HE21 . GLN A 1 40 ? 5.182   2.329   -4.115  1.00 0.00 ? 40  GLN A HE21 3  
ATOM   1859  H  HE22 . GLN A 1 40 ? 5.270   0.961   -3.064  1.00 0.00 ? 40  GLN A HE22 3  
ATOM   1860  N  N    . SER A 1 41 ? 3.619   2.343   -9.495  1.00 0.00 ? 41  SER A N    3  
ATOM   1861  C  CA   . SER A 1 41 ? 3.883   1.864   -10.846 1.00 0.00 ? 41  SER A CA   3  
ATOM   1862  C  C    . SER A 1 41 ? 4.215   0.375   -10.839 1.00 0.00 ? 41  SER A C    3  
ATOM   1863  O  O    . SER A 1 41 ? 4.643   -0.173  -9.823  1.00 0.00 ? 41  SER A O    3  
ATOM   1864  C  CB   . SER A 1 41 ? 5.034   2.652   -11.474 1.00 0.00 ? 41  SER A CB   3  
ATOM   1865  O  OG   . SER A 1 41 ? 4.908   2.703   -12.885 1.00 0.00 ? 41  SER A OG   3  
ATOM   1866  H  H    . SER A 1 41 ? 4.286   2.906   -9.048  1.00 0.00 ? 41  SER A H    3  
ATOM   1867  H  HA   . SER A 1 41 ? 2.990   2.019   -11.433 1.00 0.00 ? 41  SER A HA   3  
ATOM   1868  H  HB2  . SER A 1 41 ? 5.030   3.660   -11.088 1.00 0.00 ? 41  SER A HB2  3  
ATOM   1869  H  HB3  . SER A 1 41 ? 5.971   2.175   -11.226 1.00 0.00 ? 41  SER A HB3  3  
ATOM   1870  H  HG   . SER A 1 41 ? 3.985   2.826   -13.119 1.00 0.00 ? 41  SER A HG   3  
ATOM   1871  N  N    . HIS A 1 42 ? 4.015   -0.275  -11.981 1.00 0.00 ? 42  HIS A N    3  
ATOM   1872  C  CA   . HIS A 1 42 ? 4.294   -1.701  -12.108 1.00 0.00 ? 42  HIS A CA   3  
ATOM   1873  C  C    . HIS A 1 42 ? 5.300   -1.961  -13.226 1.00 0.00 ? 42  HIS A C    3  
ATOM   1874  O  O    . HIS A 1 42 ? 4.921   -2.228  -14.366 1.00 0.00 ? 42  HIS A O    3  
ATOM   1875  C  CB   . HIS A 1 42 ? 3.002   -2.472  -12.380 1.00 0.00 ? 42  HIS A CB   3  
ATOM   1876  C  CG   . HIS A 1 42 ? 2.089   -2.549  -11.195 1.00 0.00 ? 42  HIS A CG   3  
ATOM   1877  N  ND1  . HIS A 1 42 ? 0.742   -2.825  -11.299 1.00 0.00 ? 42  HIS A ND1  3  
ATOM   1878  C  CD2  . HIS A 1 42 ? 2.338   -2.385  -9.875  1.00 0.00 ? 42  HIS A CD2  3  
ATOM   1879  C  CE1  . HIS A 1 42 ? 0.201   -2.826  -10.094 1.00 0.00 ? 42  HIS A CE1  3  
ATOM   1880  N  NE2  . HIS A 1 42 ? 1.148   -2.562  -9.212  1.00 0.00 ? 42  HIS A NE2  3  
ATOM   1881  H  H    . HIS A 1 42 ? 3.673   0.216   -12.757 1.00 0.00 ? 42  HIS A H    3  
ATOM   1882  H  HA   . HIS A 1 42 ? 4.716   -2.041  -11.175 1.00 0.00 ? 42  HIS A HA   3  
ATOM   1883  H  HB2  . HIS A 1 42 ? 2.464   -1.989  -13.182 1.00 0.00 ? 42  HIS A HB2  3  
ATOM   1884  H  HB3  . HIS A 1 42 ? 3.248   -3.482  -12.676 1.00 0.00 ? 42  HIS A HB3  3  
ATOM   1885  H  HD1  . HIS A 1 42 ? 0.256   -2.993  -12.132 1.00 0.00 ? 42  HIS A HD1  3  
ATOM   1886  H  HD2  . HIS A 1 42 ? 3.294   -2.157  -9.425  1.00 0.00 ? 42  HIS A HD2  3  
ATOM   1887  H  HE1  . HIS A 1 42 ? -0.838  -3.011  -9.868  1.00 0.00 ? 42  HIS A HE1  3  
ATOM   1888  N  N    . ASP A 1 43 ? 6.583   -1.880  -12.890 1.00 0.00 ? 43  ASP A N    3  
ATOM   1889  C  CA   . ASP A 1 43 ? 7.644   -2.107  -13.865 1.00 0.00 ? 43  ASP A CA   3  
ATOM   1890  C  C    . ASP A 1 43 ? 8.243   -3.500  -13.702 1.00 0.00 ? 43  ASP A C    3  
ATOM   1891  O  O    . ASP A 1 43 ? 8.678   -3.875  -12.613 1.00 0.00 ? 43  ASP A O    3  
ATOM   1892  C  CB   . ASP A 1 43 ? 8.737   -1.047  -13.717 1.00 0.00 ? 43  ASP A CB   3  
ATOM   1893  C  CG   . ASP A 1 43 ? 9.512   -0.831  -15.002 1.00 0.00 ? 43  ASP A CG   3  
ATOM   1894  O  OD1  . ASP A 1 43 ? 10.285  -1.734  -15.387 1.00 0.00 ? 43  ASP A OD1  3  
ATOM   1895  O  OD2  . ASP A 1 43 ? 9.346   0.239   -15.622 1.00 0.00 ? 43  ASP A OD2  3  
ATOM   1896  H  H    . ASP A 1 43 ? 6.822   -1.664  -11.965 1.00 0.00 ? 43  ASP A H    3  
ATOM   1897  H  HA   . ASP A 1 43 ? 7.211   -2.028  -14.851 1.00 0.00 ? 43  ASP A HA   3  
ATOM   1898  H  HB2  . ASP A 1 43 ? 8.283   -0.109  -13.430 1.00 0.00 ? 43  ASP A HB2  3  
ATOM   1899  H  HB3  . ASP A 1 43 ? 9.428   -1.358  -12.948 1.00 0.00 ? 43  ASP A HB3  3  
ATOM   1900  N  N    . ILE A 1 44 ? 8.262   -4.262  -14.790 1.00 0.00 ? 44  ILE A N    3  
ATOM   1901  C  CA   . ILE A 1 44 ? 8.808   -5.613  -14.767 1.00 0.00 ? 44  ILE A CA   3  
ATOM   1902  C  C    . ILE A 1 44 ? 10.264  -5.626  -15.221 1.00 0.00 ? 44  ILE A C    3  
ATOM   1903  O  O    . ILE A 1 44 ? 10.551  -5.653  -16.418 1.00 0.00 ? 44  ILE A O    3  
ATOM   1904  C  CB   . ILE A 1 44 ? 7.994   -6.564  -15.664 1.00 0.00 ? 44  ILE A CB   3  
ATOM   1905  C  CG1  . ILE A 1 44 ? 6.522   -6.558  -15.248 1.00 0.00 ? 44  ILE A CG1  3  
ATOM   1906  C  CG2  . ILE A 1 44 ? 8.564   -7.973  -15.596 1.00 0.00 ? 44  ILE A CG2  3  
ATOM   1907  C  CD1  . ILE A 1 44 ? 6.268   -7.227  -13.914 1.00 0.00 ? 44  ILE A CD1  3  
ATOM   1908  H  H    . ILE A 1 44 ? 7.901   -3.906  -15.629 1.00 0.00 ? 44  ILE A H    3  
ATOM   1909  H  HA   . ILE A 1 44 ? 8.756   -5.976  -13.751 1.00 0.00 ? 44  ILE A HA   3  
ATOM   1910  H  HB   . ILE A 1 44 ? 8.074   -6.219  -16.683 1.00 0.00 ? 44  ILE A HB   3  
ATOM   1911  H  HG12 . ILE A 1 44 ? 6.178   -5.539  -15.177 1.00 0.00 ? 44  ILE A HG12 3  
ATOM   1912  H  HG13 . ILE A 1 44 ? 5.942   -7.079  -15.996 1.00 0.00 ? 44  ILE A HG13 3  
ATOM   1913  H  HG21 . ILE A 1 44 ? 8.864   -8.288  -16.584 1.00 0.00 ? 44  ILE A HG21 3  
ATOM   1914  H  HG22 . ILE A 1 44 ? 9.421   -7.983  -14.940 1.00 0.00 ? 44  ILE A HG22 3  
ATOM   1915  H  HG23 . ILE A 1 44 ? 7.812   -8.648  -15.216 1.00 0.00 ? 44  ILE A HG23 3  
ATOM   1916  H  HD11 . ILE A 1 44 ? 5.643   -6.591  -13.306 1.00 0.00 ? 44  ILE A HD11 3  
ATOM   1917  H  HD12 . ILE A 1 44 ? 5.774   -8.173  -14.074 1.00 0.00 ? 44  ILE A HD12 3  
ATOM   1918  H  HD13 . ILE A 1 44 ? 7.210   -7.392  -13.410 1.00 0.00 ? 44  ILE A HD13 3  
ATOM   1919  N  N    . SER A 1 45 ? 11.179  -5.607  -14.257 1.00 0.00 ? 45  SER A N    3  
ATOM   1920  C  CA   . SER A 1 45 ? 12.605  -5.614  -14.557 1.00 0.00 ? 45  SER A CA   3  
ATOM   1921  C  C    . SER A 1 45 ? 12.896  -6.455  -15.796 1.00 0.00 ? 45  SER A C    3  
ATOM   1922  O  O    . SER A 1 45 ? 12.176  -7.407  -16.096 1.00 0.00 ? 45  SER A O    3  
ATOM   1923  C  CB   . SER A 1 45 ? 13.396  -6.153  -13.364 1.00 0.00 ? 45  SER A CB   3  
ATOM   1924  O  OG   . SER A 1 45 ? 13.264  -5.302  -12.238 1.00 0.00 ? 45  SER A OG   3  
ATOM   1925  H  H    . SER A 1 45 ? 10.886  -5.585  -13.321 1.00 0.00 ? 45  SER A H    3  
ATOM   1926  H  HA   . SER A 1 45 ? 12.909  -4.596  -14.749 1.00 0.00 ? 45  SER A HA   3  
ATOM   1927  H  HB2  . SER A 1 45 ? 13.028  -7.134  -13.104 1.00 0.00 ? 45  SER A HB2  3  
ATOM   1928  H  HB3  . SER A 1 45 ? 14.442  -6.220  -13.629 1.00 0.00 ? 45  SER A HB3  3  
ATOM   1929  H  HG   . SER A 1 45 ? 13.347  -5.820  -11.434 1.00 0.00 ? 45  SER A HG   3  
ATOM   1930  N  N    . GLY A 1 46 ? 13.957  -6.097  -16.512 1.00 0.00 ? 46  GLY A N    3  
ATOM   1931  C  CA   . GLY A 1 46 ? 14.325  -6.828  -17.711 1.00 0.00 ? 46  GLY A CA   3  
ATOM   1932  C  C    . GLY A 1 46 ? 15.373  -6.104  -18.532 1.00 0.00 ? 46  GLY A C    3  
ATOM   1933  O  O    . GLY A 1 46 ? 15.118  -5.663  -19.653 1.00 0.00 ? 46  GLY A O    3  
ATOM   1934  H  H    . GLY A 1 46 ? 14.495  -5.329  -16.225 1.00 0.00 ? 46  GLY A H    3  
ATOM   1935  H  HA2  . GLY A 1 46 ? 14.711  -7.795  -17.425 1.00 0.00 ? 46  GLY A HA2  3  
ATOM   1936  H  HA3  . GLY A 1 46 ? 13.443  -6.969  -18.318 1.00 0.00 ? 46  GLY A HA3  3  
ATOM   1937  N  N    . PRO A 1 47 ? 16.584  -5.973  -17.971 1.00 0.00 ? 47  PRO A N    3  
ATOM   1938  C  CA   . PRO A 1 47 ? 17.698  -5.297  -18.642 1.00 0.00 ? 47  PRO A CA   3  
ATOM   1939  C  C    . PRO A 1 47 ? 18.228  -6.092  -19.830 1.00 0.00 ? 47  PRO A C    3  
ATOM   1940  O  O    . PRO A 1 47 ? 19.052  -5.599  -20.601 1.00 0.00 ? 47  PRO A O    3  
ATOM   1941  C  CB   . PRO A 1 47 ? 18.764  -5.198  -17.547 1.00 0.00 ? 47  PRO A CB   3  
ATOM   1942  C  CG   . PRO A 1 47 ? 18.454  -6.318  -16.615 1.00 0.00 ? 47  PRO A CG   3  
ATOM   1943  C  CD   . PRO A 1 47 ? 16.959  -6.474  -16.638 1.00 0.00 ? 47  PRO A CD   3  
ATOM   1944  H  HA   . PRO A 1 47 ? 17.422  -4.305  -18.968 1.00 0.00 ? 47  PRO A HA   3  
ATOM   1945  H  HB2  . PRO A 1 47 ? 19.746  -5.308  -17.986 1.00 0.00 ? 47  PRO A HB2  3  
ATOM   1946  H  HB3  . PRO A 1 47 ? 18.690  -4.241  -17.053 1.00 0.00 ? 47  PRO A HB3  3  
ATOM   1947  H  HG2  . PRO A 1 47 ? 18.931  -7.223  -16.957 1.00 0.00 ? 47  PRO A HG2  3  
ATOM   1948  H  HG3  . PRO A 1 47 ? 18.789  -6.069  -15.618 1.00 0.00 ? 47  PRO A HG3  3  
ATOM   1949  H  HD2  . PRO A 1 47 ? 16.686  -7.513  -16.526 1.00 0.00 ? 47  PRO A HD2  3  
ATOM   1950  H  HD3  . PRO A 1 47 ? 16.505  -5.878  -15.861 1.00 0.00 ? 47  PRO A HD3  3  
ATOM   1951  N  N    . SER A 1 48 ? 17.750  -7.324  -19.972 1.00 0.00 ? 48  SER A N    3  
ATOM   1952  C  CA   . SER A 1 48 ? 18.178  -8.188  -21.066 1.00 0.00 ? 48  SER A CA   3  
ATOM   1953  C  C    . SER A 1 48 ? 17.933  -7.520  -22.415 1.00 0.00 ? 48  SER A C    3  
ATOM   1954  O  O    . SER A 1 48 ? 16.918  -7.765  -23.067 1.00 0.00 ? 48  SER A O    3  
ATOM   1955  C  CB   . SER A 1 48 ? 17.438  -9.526  -21.006 1.00 0.00 ? 48  SER A CB   3  
ATOM   1956  O  OG   . SER A 1 48 ? 16.036  -9.339  -21.089 1.00 0.00 ? 48  SER A OG   3  
ATOM   1957  H  H    . SER A 1 48 ? 17.095  -7.660  -19.325 1.00 0.00 ? 48  SER A H    3  
ATOM   1958  H  HA   . SER A 1 48 ? 19.237  -8.367  -20.952 1.00 0.00 ? 48  SER A HA   3  
ATOM   1959  H  HB2  . SER A 1 48 ? 17.756  -10.148 -21.829 1.00 0.00 ? 48  SER A HB2  3  
ATOM   1960  H  HB3  . SER A 1 48 ? 17.669  -10.020 -20.072 1.00 0.00 ? 48  SER A HB3  3  
ATOM   1961  H  HG   . SER A 1 48 ? 15.830  -8.408  -20.973 1.00 0.00 ? 48  SER A HG   3  
ATOM   1962  N  N    . SER A 1 49 ? 18.871  -6.673  -22.828 1.00 0.00 ? 49  SER A N    3  
ATOM   1963  C  CA   . SER A 1 49 ? 18.757  -5.965  -24.097 1.00 0.00 ? 49  SER A CA   3  
ATOM   1964  C  C    . SER A 1 49 ? 17.301  -5.620  -24.398 1.00 0.00 ? 49  SER A C    3  
ATOM   1965  O  O    . SER A 1 49 ? 16.813  -5.849  -25.503 1.00 0.00 ? 49  SER A O    3  
ATOM   1966  C  CB   . SER A 1 49 ? 19.337  -6.811  -25.232 1.00 0.00 ? 49  SER A CB   3  
ATOM   1967  O  OG   . SER A 1 49 ? 18.555  -7.972  -25.453 1.00 0.00 ? 49  SER A OG   3  
ATOM   1968  H  H    . SER A 1 49 ? 19.657  -6.519  -22.263 1.00 0.00 ? 49  SER A H    3  
ATOM   1969  H  HA   . SER A 1 49 ? 19.322  -5.048  -24.018 1.00 0.00 ? 49  SER A HA   3  
ATOM   1970  H  HB2  . SER A 1 49 ? 19.357  -6.227  -26.139 1.00 0.00 ? 49  SER A HB2  3  
ATOM   1971  H  HB3  . SER A 1 49 ? 20.342  -7.112  -24.974 1.00 0.00 ? 49  SER A HB3  3  
ATOM   1972  H  HG   . SER A 1 49 ? 18.670  -8.268  -26.359 1.00 0.00 ? 49  SER A HG   3  
ATOM   1973  N  N    . GLY A 1 50 ? 16.613  -5.067  -23.404 1.00 0.00 ? 50  GLY A N    3  
ATOM   1974  C  CA   . GLY A 1 50 ? 15.220  -4.699  -23.580 1.00 0.00 ? 50  GLY A CA   3  
ATOM   1975  C  C    . GLY A 1 50 ? 14.281  -5.587  -22.788 1.00 0.00 ? 50  GLY A C    3  
ATOM   1976  O  O    . GLY A 1 50 ? 13.267  -6.022  -23.331 1.00 0.00 ? 50  GLY A O    3  
ATOM   1977  H  H    . GLY A 1 50 ? 17.054  -4.907  -22.543 1.00 0.00 ? 50  GLY A H    3  
ATOM   1978  H  HA2  . GLY A 1 50 ? 15.086  -3.676  -23.262 1.00 0.00 ? 50  GLY A HA2  3  
ATOM   1979  H  HA3  . GLY A 1 50 ? 14.970  -4.775  -24.628 1.00 0.00 ? 50  GLY A HA3  3  
HETATM 1980  ZN ZN   . ZN  B 2 .  ? 0.577   -2.315  -7.273  1.00 0.00 ? 201 ZN  A ZN   3  
ATOM   1981  N  N    . GLY A 1 1  ? 41.018  37.174  -12.375 1.00 0.00 ? 1   GLY A N    4  
ATOM   1982  C  CA   . GLY A 1 1  ? 40.881  37.569  -13.765 1.00 0.00 ? 1   GLY A CA   4  
ATOM   1983  C  C    . GLY A 1 1  ? 39.485  37.325  -14.302 1.00 0.00 ? 1   GLY A C    4  
ATOM   1984  O  O    . GLY A 1 1  ? 38.749  36.488  -13.779 1.00 0.00 ? 1   GLY A O    4  
ATOM   1985  H  H1   . GLY A 1 1  ? 40.230  37.159  -11.792 1.00 0.00 ? 1   GLY A H1   4  
ATOM   1986  H  HA2  . GLY A 1 1  ? 41.112  38.620  -13.853 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   1987  H  HA3  . GLY A 1 1  ? 41.586  37.005  -14.358 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   1988  N  N    . SER A 1 2  ? 39.118  38.059  -15.347 1.00 0.00 ? 2   SER A N    4  
ATOM   1989  C  CA   . SER A 1 2  ? 37.799  37.923  -15.952 1.00 0.00 ? 2   SER A CA   4  
ATOM   1990  C  C    . SER A 1 2  ? 37.874  37.118  -17.246 1.00 0.00 ? 2   SER A C    4  
ATOM   1991  O  O    . SER A 1 2  ? 37.148  36.142  -17.426 1.00 0.00 ? 2   SER A O    4  
ATOM   1992  C  CB   . SER A 1 2  ? 37.197  39.302  -16.230 1.00 0.00 ? 2   SER A CB   4  
ATOM   1993  O  OG   . SER A 1 2  ? 35.945  39.189  -16.884 1.00 0.00 ? 2   SER A OG   4  
ATOM   1994  H  H    . SER A 1 2  ? 39.750  38.710  -15.719 1.00 0.00 ? 2   SER A H    4  
ATOM   1995  H  HA   . SER A 1 2  ? 37.166  37.398  -15.252 1.00 0.00 ? 2   SER A HA   4  
ATOM   1996  H  HB2  . SER A 1 2  ? 37.056  39.825  -15.297 1.00 0.00 ? 2   SER A HB2  4  
ATOM   1997  H  HB3  . SER A 1 2  ? 37.870  39.865  -16.861 1.00 0.00 ? 2   SER A HB3  4  
ATOM   1998  H  HG   . SER A 1 2  ? 35.539  38.350  -16.657 1.00 0.00 ? 2   SER A HG   4  
ATOM   1999  N  N    . SER A 1 3  ? 38.760  37.537  -18.145 1.00 0.00 ? 3   SER A N    4  
ATOM   2000  C  CA   . SER A 1 3  ? 38.929  36.859  -19.424 1.00 0.00 ? 3   SER A CA   4  
ATOM   2001  C  C    . SER A 1 3  ? 40.407  36.619  -19.721 1.00 0.00 ? 3   SER A C    4  
ATOM   2002  O  O    . SER A 1 3  ? 41.178  37.562  -19.894 1.00 0.00 ? 3   SER A O    4  
ATOM   2003  C  CB   . SER A 1 3  ? 38.299  37.682  -20.549 1.00 0.00 ? 3   SER A CB   4  
ATOM   2004  O  OG   . SER A 1 3  ? 36.934  37.344  -20.725 1.00 0.00 ? 3   SER A OG   4  
ATOM   2005  H  H    . SER A 1 3  ? 39.311  38.322  -17.943 1.00 0.00 ? 3   SER A H    4  
ATOM   2006  H  HA   . SER A 1 3  ? 38.427  35.905  -19.363 1.00 0.00 ? 3   SER A HA   4  
ATOM   2007  H  HB2  . SER A 1 3  ? 38.369  38.731  -20.307 1.00 0.00 ? 3   SER A HB2  4  
ATOM   2008  H  HB3  . SER A 1 3  ? 38.827  37.489  -21.472 1.00 0.00 ? 3   SER A HB3  4  
ATOM   2009  H  HG   . SER A 1 3  ? 36.402  37.810  -20.075 1.00 0.00 ? 3   SER A HG   4  
ATOM   2010  N  N    . GLY A 1 4  ? 40.794  35.348  -19.777 1.00 0.00 ? 4   GLY A N    4  
ATOM   2011  C  CA   . GLY A 1 4  ? 42.177  35.006  -20.053 1.00 0.00 ? 4   GLY A CA   4  
ATOM   2012  C  C    . GLY A 1 4  ? 42.357  33.537  -20.380 1.00 0.00 ? 4   GLY A C    4  
ATOM   2013  O  O    . GLY A 1 4  ? 42.658  32.731  -19.500 1.00 0.00 ? 4   GLY A O    4  
ATOM   2014  H  H    . GLY A 1 4  ? 40.135  34.638  -19.631 1.00 0.00 ? 4   GLY A H    4  
ATOM   2015  H  HA2  . GLY A 1 4  ? 42.523  35.596  -20.889 1.00 0.00 ? 4   GLY A HA2  4  
ATOM   2016  H  HA3  . GLY A 1 4  ? 42.775  35.245  -19.185 1.00 0.00 ? 4   GLY A HA3  4  
ATOM   2017  N  N    . SER A 1 5  ? 42.171  33.188  -21.649 1.00 0.00 ? 5   SER A N    4  
ATOM   2018  C  CA   . SER A 1 5  ? 42.309  31.804  -22.089 1.00 0.00 ? 5   SER A CA   4  
ATOM   2019  C  C    . SER A 1 5  ? 41.312  30.903  -21.367 1.00 0.00 ? 5   SER A C    4  
ATOM   2020  O  O    . SER A 1 5  ? 41.664  29.822  -20.894 1.00 0.00 ? 5   SER A O    4  
ATOM   2021  C  CB   . SER A 1 5  ? 43.734  31.308  -21.841 1.00 0.00 ? 5   SER A CB   4  
ATOM   2022  O  OG   . SER A 1 5  ? 44.689  32.244  -22.312 1.00 0.00 ? 5   SER A OG   4  
ATOM   2023  H  H    . SER A 1 5  ? 41.932  33.877  -22.304 1.00 0.00 ? 5   SER A H    4  
ATOM   2024  H  HA   . SER A 1 5  ? 42.104  31.772  -23.149 1.00 0.00 ? 5   SER A HA   4  
ATOM   2025  H  HB2  . SER A 1 5  ? 43.883  31.162  -20.782 1.00 0.00 ? 5   SER A HB2  4  
ATOM   2026  H  HB3  . SER A 1 5  ? 43.881  30.371  -22.359 1.00 0.00 ? 5   SER A HB3  4  
ATOM   2027  H  HG   . SER A 1 5  ? 45.523  32.107  -21.856 1.00 0.00 ? 5   SER A HG   4  
ATOM   2028  N  N    . SER A 1 6  ? 40.064  31.355  -21.287 1.00 0.00 ? 6   SER A N    4  
ATOM   2029  C  CA   . SER A 1 6  ? 39.016  30.592  -20.620 1.00 0.00 ? 6   SER A CA   4  
ATOM   2030  C  C    . SER A 1 6  ? 38.233  29.752  -21.625 1.00 0.00 ? 6   SER A C    4  
ATOM   2031  O  O    . SER A 1 6  ? 38.114  30.114  -22.794 1.00 0.00 ? 6   SER A O    4  
ATOM   2032  C  CB   . SER A 1 6  ? 38.067  31.533  -19.875 1.00 0.00 ? 6   SER A CB   4  
ATOM   2033  O  OG   . SER A 1 6  ? 38.781  32.398  -19.010 1.00 0.00 ? 6   SER A OG   4  
ATOM   2034  H  H    . SER A 1 6  ? 39.845  32.224  -21.684 1.00 0.00 ? 6   SER A H    4  
ATOM   2035  H  HA   . SER A 1 6  ? 39.488  29.933  -19.908 1.00 0.00 ? 6   SER A HA   4  
ATOM   2036  H  HB2  . SER A 1 6  ? 37.520  32.129  -20.590 1.00 0.00 ? 6   SER A HB2  4  
ATOM   2037  H  HB3  . SER A 1 6  ? 37.373  30.948  -19.289 1.00 0.00 ? 6   SER A HB3  4  
ATOM   2038  H  HG   . SER A 1 6  ? 38.881  31.981  -18.151 1.00 0.00 ? 6   SER A HG   4  
ATOM   2039  N  N    . GLY A 1 7  ? 37.700  28.627  -21.158 1.00 0.00 ? 7   GLY A N    4  
ATOM   2040  C  CA   . GLY A 1 7  ? 36.935  27.752  -22.027 1.00 0.00 ? 7   GLY A CA   4  
ATOM   2041  C  C    . GLY A 1 7  ? 35.455  27.762  -21.702 1.00 0.00 ? 7   GLY A C    4  
ATOM   2042  O  O    . GLY A 1 7  ? 34.991  28.585  -20.911 1.00 0.00 ? 7   GLY A O    4  
ATOM   2043  H  H    . GLY A 1 7  ? 37.828  28.389  -20.215 1.00 0.00 ? 7   GLY A H    4  
ATOM   2044  H  HA2  . GLY A 1 7  ? 37.071  28.070  -23.050 1.00 0.00 ? 7   GLY A HA2  4  
ATOM   2045  H  HA3  . GLY A 1 7  ? 37.308  26.743  -21.921 1.00 0.00 ? 7   GLY A HA3  4  
ATOM   2046  N  N    . CYS A 1 8  ? 34.710  26.848  -22.315 1.00 0.00 ? 8   CYS A N    4  
ATOM   2047  C  CA   . CYS A 1 8  ? 33.272  26.757  -22.088 1.00 0.00 ? 8   CYS A CA   4  
ATOM   2048  C  C    . CYS A 1 8  ? 32.940  25.587  -21.167 1.00 0.00 ? 8   CYS A C    4  
ATOM   2049  O  O    . CYS A 1 8  ? 33.356  24.454  -21.411 1.00 0.00 ? 8   CYS A O    4  
ATOM   2050  C  CB   . CYS A 1 8  ? 32.535  26.599  -23.419 1.00 0.00 ? 8   CYS A CB   4  
ATOM   2051  S  SG   . CYS A 1 8  ? 32.547  28.084  -24.450 1.00 0.00 ? 8   CYS A SG   4  
ATOM   2052  H  H    . CYS A 1 8  ? 35.137  26.220  -22.934 1.00 0.00 ? 8   CYS A H    4  
ATOM   2053  H  HA   . CYS A 1 8  ? 32.953  27.673  -21.616 1.00 0.00 ? 8   CYS A HA   4  
ATOM   2054  H  HB2  . CYS A 1 8  ? 32.995  25.803  -23.985 1.00 0.00 ? 8   CYS A HB2  4  
ATOM   2055  H  HB3  . CYS A 1 8  ? 31.504  26.342  -23.222 1.00 0.00 ? 8   CYS A HB3  4  
ATOM   2056  H  HG   . CYS A 1 8  ? 33.230  27.811  -25.551 1.00 0.00 ? 8   CYS A HG   4  
ATOM   2057  N  N    . CYS A 1 9  ? 32.190  25.870  -20.108 1.00 0.00 ? 9   CYS A N    4  
ATOM   2058  C  CA   . CYS A 1 9  ? 31.804  24.842  -19.148 1.00 0.00 ? 9   CYS A CA   4  
ATOM   2059  C  C    . CYS A 1 9  ? 30.392  24.339  -19.429 1.00 0.00 ? 9   CYS A C    4  
ATOM   2060  O  O    . CYS A 1 9  ? 29.452  25.127  -19.547 1.00 0.00 ? 9   CYS A O    4  
ATOM   2061  C  CB   . CYS A 1 9  ? 31.889  25.389  -17.722 1.00 0.00 ? 9   CYS A CB   4  
ATOM   2062  S  SG   . CYS A 1 9  ? 30.644  26.642  -17.336 1.00 0.00 ? 9   CYS A SG   4  
ATOM   2063  H  H    . CYS A 1 9  ? 31.889  26.792  -19.967 1.00 0.00 ? 9   CYS A H    4  
ATOM   2064  H  HA   . CYS A 1 9  ? 32.493  24.018  -19.251 1.00 0.00 ? 9   CYS A HA   4  
ATOM   2065  H  HB2  . CYS A 1 9  ? 31.761  24.574  -17.024 1.00 0.00 ? 9   CYS A HB2  4  
ATOM   2066  H  HB3  . CYS A 1 9  ? 32.862  25.833  -17.573 1.00 0.00 ? 9   CYS A HB3  4  
ATOM   2067  H  HG   . CYS A 1 9  ? 29.901  26.186  -16.339 1.00 0.00 ? 9   CYS A HG   4  
ATOM   2068  N  N    . LEU A 1 10 ? 30.249  23.022  -19.537 1.00 0.00 ? 10  LEU A N    4  
ATOM   2069  C  CA   . LEU A 1 10 ? 28.951  22.413  -19.806 1.00 0.00 ? 10  LEU A CA   4  
ATOM   2070  C  C    . LEU A 1 10 ? 28.064  22.451  -18.566 1.00 0.00 ? 10  LEU A C    4  
ATOM   2071  O  O    . LEU A 1 10 ? 28.541  22.440  -17.431 1.00 0.00 ? 10  LEU A O    4  
ATOM   2072  C  CB   . LEU A 1 10 ? 29.132  20.968  -20.274 1.00 0.00 ? 10  LEU A CB   4  
ATOM   2073  C  CG   . LEU A 1 10 ? 29.904  20.047  -19.328 1.00 0.00 ? 10  LEU A CG   4  
ATOM   2074  C  CD1  . LEU A 1 10 ? 29.464  18.603  -19.512 1.00 0.00 ? 10  LEU A CD1  4  
ATOM   2075  C  CD2  . LEU A 1 10 ? 31.402  20.184  -19.556 1.00 0.00 ? 10  LEU A CD2  4  
ATOM   2076  H  H    . LEU A 1 10 ? 31.034  22.446  -19.433 1.00 0.00 ? 10  LEU A H    4  
ATOM   2077  H  HA   . LEU A 1 10 ? 28.475  22.980  -20.592 1.00 0.00 ? 10  LEU A HA   4  
ATOM   2078  H  HB2  . LEU A 1 10 ? 28.151  20.543  -20.421 1.00 0.00 ? 10  LEU A HB2  4  
ATOM   2079  H  HB3  . LEU A 1 10 ? 29.658  20.990  -21.218 1.00 0.00 ? 10  LEU A HB3  4  
ATOM   2080  H  HG   . LEU A 1 10 ? 29.693  20.333  -18.307 1.00 0.00 ? 10  LEU A HG   4  
ATOM   2081  H  HD11 . LEU A 1 10 ? 29.993  18.169  -20.347 1.00 0.00 ? 10  LEU A HD11 4  
ATOM   2082  H  HD12 . LEU A 1 10 ? 28.402  18.572  -19.703 1.00 0.00 ? 10  LEU A HD12 4  
ATOM   2083  H  HD13 . LEU A 1 10 ? 29.685  18.043  -18.615 1.00 0.00 ? 10  LEU A HD13 4  
ATOM   2084  H  HD21 . LEU A 1 10 ? 31.835  20.769  -18.758 1.00 0.00 ? 10  LEU A HD21 4  
ATOM   2085  H  HD22 . LEU A 1 10 ? 31.579  20.677  -20.501 1.00 0.00 ? 10  LEU A HD22 4  
ATOM   2086  H  HD23 . LEU A 1 10 ? 31.855  19.204  -19.570 1.00 0.00 ? 10  LEU A HD23 4  
ATOM   2087  N  N    . PRO A 1 11 ? 26.742  22.494  -18.785 1.00 0.00 ? 11  PRO A N    4  
ATOM   2088  C  CA   . PRO A 1 11 ? 25.760  22.531  -17.698 1.00 0.00 ? 11  PRO A CA   4  
ATOM   2089  C  C    . PRO A 1 11 ? 25.689  21.213  -16.935 1.00 0.00 ? 11  PRO A C    4  
ATOM   2090  O  O    . PRO A 1 11 ? 25.872  20.132  -17.497 1.00 0.00 ? 11  PRO A O    4  
ATOM   2091  C  CB   . PRO A 1 11 ? 24.438  22.802  -18.422 1.00 0.00 ? 11  PRO A CB   4  
ATOM   2092  C  CG   . PRO A 1 11 ? 24.649  22.282  -19.802 1.00 0.00 ? 11  PRO A CG   4  
ATOM   2093  C  CD   . PRO A 1 11 ? 26.103  22.509  -20.112 1.00 0.00 ? 11  PRO A CD   4  
ATOM   2094  H  HA   . PRO A 1 11 ? 25.964  23.335  -17.006 1.00 0.00 ? 11  PRO A HA   4  
ATOM   2095  H  HB2  . PRO A 1 11 ? 23.636  22.278  -17.920 1.00 0.00 ? 11  PRO A HB2  4  
ATOM   2096  H  HB3  . PRO A 1 11 ? 24.237  23.862  -18.426 1.00 0.00 ? 11  PRO A HB3  4  
ATOM   2097  H  HG2  . PRO A 1 11 ? 24.419  21.228  -19.837 1.00 0.00 ? 11  PRO A HG2  4  
ATOM   2098  H  HG3  . PRO A 1 11 ? 24.028  22.826  -20.498 1.00 0.00 ? 11  PRO A HG3  4  
ATOM   2099  H  HD2  . PRO A 1 11 ? 26.485  21.713  -20.733 1.00 0.00 ? 11  PRO A HD2  4  
ATOM   2100  H  HD3  . PRO A 1 11 ? 26.241  23.466  -20.595 1.00 0.00 ? 11  PRO A HD3  4  
ATOM   2101  N  N    . PRO A 1 12 ? 25.418  21.300  -15.624 1.00 0.00 ? 12  PRO A N    4  
ATOM   2102  C  CA   . PRO A 1 12 ? 25.316  20.123  -14.757 1.00 0.00 ? 12  PRO A CA   4  
ATOM   2103  C  C    . PRO A 1 12 ? 24.077  19.287  -15.058 1.00 0.00 ? 12  PRO A C    4  
ATOM   2104  O  O    . PRO A 1 12 ? 22.951  19.715  -14.804 1.00 0.00 ? 12  PRO A O    4  
ATOM   2105  C  CB   . PRO A 1 12 ? 25.227  20.724  -13.352 1.00 0.00 ? 12  PRO A CB   4  
ATOM   2106  C  CG   . PRO A 1 12 ? 24.665  22.088  -13.559 1.00 0.00 ? 12  PRO A CG   4  
ATOM   2107  C  CD   . PRO A 1 12 ? 25.189  22.555  -14.889 1.00 0.00 ? 12  PRO A CD   4  
ATOM   2108  H  HA   . PRO A 1 12 ? 26.195  19.500  -14.829 1.00 0.00 ? 12  PRO A HA   4  
ATOM   2109  H  HB2  . PRO A 1 12 ? 24.577  20.117  -12.738 1.00 0.00 ? 12  PRO A HB2  4  
ATOM   2110  H  HB3  . PRO A 1 12 ? 26.212  20.766  -12.911 1.00 0.00 ? 12  PRO A HB3  4  
ATOM   2111  H  HG2  . PRO A 1 12 ? 23.587  22.042  -13.575 1.00 0.00 ? 12  PRO A HG2  4  
ATOM   2112  H  HG3  . PRO A 1 12 ? 25.002  22.747  -12.772 1.00 0.00 ? 12  PRO A HG3  4  
ATOM   2113  H  HD2  . PRO A 1 12 ? 24.454  23.167  -15.390 1.00 0.00 ? 12  PRO A HD2  4  
ATOM   2114  H  HD3  . PRO A 1 12 ? 26.113  23.100  -14.760 1.00 0.00 ? 12  PRO A HD3  4  
ATOM   2115  N  N    . ALA A 1 13 ? 24.292  18.092  -15.599 1.00 0.00 ? 13  ALA A N    4  
ATOM   2116  C  CA   . ALA A 1 13 ? 23.192  17.195  -15.932 1.00 0.00 ? 13  ALA A CA   4  
ATOM   2117  C  C    . ALA A 1 13 ? 23.450  15.789  -15.400 1.00 0.00 ? 13  ALA A C    4  
ATOM   2118  O  O    . ALA A 1 13 ? 23.173  14.798  -16.076 1.00 0.00 ? 13  ALA A O    4  
ATOM   2119  C  CB   . ALA A 1 13 ? 22.976  17.161  -17.438 1.00 0.00 ? 13  ALA A CB   4  
ATOM   2120  H  H    . ALA A 1 13 ? 25.212  17.807  -15.778 1.00 0.00 ? 13  ALA A H    4  
ATOM   2121  H  HA   . ALA A 1 13 ? 22.294  17.583  -15.473 1.00 0.00 ? 13  ALA A HA   4  
ATOM   2122  H  HB1  . ALA A 1 13 ? 22.871  18.170  -17.808 1.00 0.00 ? 13  ALA A HB1  4  
ATOM   2123  H  HB2  . ALA A 1 13 ? 23.824  16.689  -17.912 1.00 0.00 ? 13  ALA A HB2  4  
ATOM   2124  H  HB3  . ALA A 1 13 ? 22.080  16.600  -17.660 1.00 0.00 ? 13  ALA A HB3  4  
ATOM   2125  N  N    . THR A 1 14 ? 23.983  15.710  -14.185 1.00 0.00 ? 14  THR A N    4  
ATOM   2126  C  CA   . THR A 1 14 ? 24.281  14.426  -13.563 1.00 0.00 ? 14  THR A CA   4  
ATOM   2127  C  C    . THR A 1 14 ? 23.042  13.837  -12.898 1.00 0.00 ? 14  THR A C    4  
ATOM   2128  O  O    . THR A 1 14 ? 23.123  13.256  -11.815 1.00 0.00 ? 14  THR A O    4  
ATOM   2129  C  CB   . THR A 1 14 ? 25.401  14.555  -12.514 1.00 0.00 ? 14  THR A CB   4  
ATOM   2130  O  OG1  . THR A 1 14 ? 26.477  15.340  -13.040 1.00 0.00 ? 14  THR A OG1  4  
ATOM   2131  C  CG2  . THR A 1 14 ? 25.919  13.185  -12.104 1.00 0.00 ? 14  THR A CG2  4  
ATOM   2132  H  H    . THR A 1 14 ? 24.182  16.536  -13.696 1.00 0.00 ? 14  THR A H    4  
ATOM   2133  H  HA   . THR A 1 14 ? 24.617  13.751  -14.337 1.00 0.00 ? 14  THR A HA   4  
ATOM   2134  H  HB   . THR A 1 14 ? 24.999  15.048  -11.640 1.00 0.00 ? 14  THR A HB   4  
ATOM   2135  H  HG1  . THR A 1 14 ? 26.594  16.126  -12.500 1.00 0.00 ? 14  THR A HG1  4  
ATOM   2136  H  HG21 . THR A 1 14 ? 26.235  13.214  -11.071 1.00 0.00 ? 14  THR A HG21 4  
ATOM   2137  H  HG22 . THR A 1 14 ? 26.756  12.915  -12.729 1.00 0.00 ? 14  THR A HG22 4  
ATOM   2138  H  HG23 . THR A 1 14 ? 25.133  12.454  -12.218 1.00 0.00 ? 14  THR A HG23 4  
ATOM   2139  N  N    . HIS A 1 15 ? 21.895  13.989  -13.553 1.00 0.00 ? 15  HIS A N    4  
ATOM   2140  C  CA   . HIS A 1 15 ? 20.638  13.471  -13.024 1.00 0.00 ? 15  HIS A CA   4  
ATOM   2141  C  C    . HIS A 1 15 ? 19.898  12.658  -14.082 1.00 0.00 ? 15  HIS A C    4  
ATOM   2142  O  O    . HIS A 1 15 ? 20.307  12.614  -15.243 1.00 0.00 ? 15  HIS A O    4  
ATOM   2143  C  CB   . HIS A 1 15 ? 19.754  14.619  -12.535 1.00 0.00 ? 15  HIS A CB   4  
ATOM   2144  C  CG   . HIS A 1 15 ? 19.994  14.992  -11.105 1.00 0.00 ? 15  HIS A CG   4  
ATOM   2145  N  ND1  . HIS A 1 15 ? 20.815  16.034  -10.727 1.00 0.00 ? 15  HIS A ND1  4  
ATOM   2146  C  CD2  . HIS A 1 15 ? 19.514  14.458  -9.958  1.00 0.00 ? 15  HIS A CD2  4  
ATOM   2147  C  CE1  . HIS A 1 15 ? 20.831  16.123  -9.409  1.00 0.00 ? 15  HIS A CE1  4  
ATOM   2148  N  NE2  . HIS A 1 15 ? 20.050  15.178  -8.918  1.00 0.00 ? 15  HIS A NE2  4  
ATOM   2149  H  H    . HIS A 1 15 ? 21.894  14.462  -14.411 1.00 0.00 ? 15  HIS A H    4  
ATOM   2150  H  HA   . HIS A 1 15 ? 20.870  12.827  -12.190 1.00 0.00 ? 15  HIS A HA   4  
ATOM   2151  H  HB2  . HIS A 1 15 ? 19.942  15.492  -13.142 1.00 0.00 ? 15  HIS A HB2  4  
ATOM   2152  H  HB3  . HIS A 1 15 ? 18.717  14.333  -12.635 1.00 0.00 ? 15  HIS A HB3  4  
ATOM   2153  H  HD1  . HIS A 1 15 ? 21.313  16.620  -11.334 1.00 0.00 ? 15  HIS A HD1  4  
ATOM   2154  H  HD2  . HIS A 1 15 ? 18.837  13.620  -9.875  1.00 0.00 ? 15  HIS A HD2  4  
ATOM   2155  H  HE1  . HIS A 1 15 ? 21.388  16.845  -8.831  1.00 0.00 ? 15  HIS A HE1  4  
ATOM   2156  N  N    . ARG A 1 16 ? 18.809  12.016  -13.673 1.00 0.00 ? 16  ARG A N    4  
ATOM   2157  C  CA   . ARG A 1 16 ? 18.014  11.203  -14.585 1.00 0.00 ? 16  ARG A CA   4  
ATOM   2158  C  C    . ARG A 1 16 ? 16.565  11.116  -14.114 1.00 0.00 ? 16  ARG A C    4  
ATOM   2159  O  O    . ARG A 1 16 ? 16.281  10.985  -12.923 1.00 0.00 ? 16  ARG A O    4  
ATOM   2160  C  CB   . ARG A 1 16 ? 18.609  9.798   -14.701 1.00 0.00 ? 16  ARG A CB   4  
ATOM   2161  C  CG   . ARG A 1 16 ? 18.241  9.085   -15.992 1.00 0.00 ? 16  ARG A CG   4  
ATOM   2162  C  CD   . ARG A 1 16 ? 19.055  7.814   -16.178 1.00 0.00 ? 16  ARG A CD   4  
ATOM   2163  N  NE   . ARG A 1 16 ? 20.410  8.095   -16.645 1.00 0.00 ? 16  ARG A NE   4  
ATOM   2164  C  CZ   . ARG A 1 16 ? 20.688  8.555   -17.859 1.00 0.00 ? 16  ARG A CZ   4  
ATOM   2165  N  NH1  . ARG A 1 16 ? 19.710  8.785   -18.725 1.00 0.00 ? 16  ARG A NH1  4  
ATOM   2166  N  NH2  . ARG A 1 16 ? 21.947  8.787   -18.210 1.00 0.00 ? 16  ARG A NH2  4  
ATOM   2167  H  H    . ARG A 1 16 ? 18.534  12.089  -12.735 1.00 0.00 ? 16  ARG A H    4  
ATOM   2168  H  HA   . ARG A 1 16 ? 18.037  11.675  -15.556 1.00 0.00 ? 16  ARG A HA   4  
ATOM   2169  H  HB2  . ARG A 1 16 ? 19.685  9.870   -14.650 1.00 0.00 ? 16  ARG A HB2  4  
ATOM   2170  H  HB3  . ARG A 1 16 ? 18.256  9.202   -13.873 1.00 0.00 ? 16  ARG A HB3  4  
ATOM   2171  H  HG2  . ARG A 1 16 ? 17.192  8.827   -15.963 1.00 0.00 ? 16  ARG A HG2  4  
ATOM   2172  H  HG3  . ARG A 1 16 ? 18.428  9.748   -16.824 1.00 0.00 ? 16  ARG A HG3  4  
ATOM   2173  H  HD2  . ARG A 1 16 ? 19.110  7.296   -15.232 1.00 0.00 ? 16  ARG A HD2  4  
ATOM   2174  H  HD3  . ARG A 1 16 ? 18.557  7.187   -16.903 1.00 0.00 ? 16  ARG A HD3  4  
ATOM   2175  H  HE   . ARG A 1 16 ? 21.147  7.933   -16.021 1.00 0.00 ? 16  ARG A HE   4  
ATOM   2176  H  HH11 . ARG A 1 16 ? 18.761  8.612   -18.463 1.00 0.00 ? 16  ARG A HH11 4  
ATOM   2177  H  HH12 . ARG A 1 16 ? 19.923  9.133   -19.639 1.00 0.00 ? 16  ARG A HH12 4  
ATOM   2178  H  HH21 . ARG A 1 16 ? 22.686  8.615   -17.560 1.00 0.00 ? 16  ARG A HH21 4  
ATOM   2179  H  HH22 . ARG A 1 16 ? 22.155  9.133   -19.124 1.00 0.00 ? 16  ARG A HH22 4  
ATOM   2180  N  N    . PRO A 1 17 ? 15.626  11.191  -15.069 1.00 0.00 ? 17  PRO A N    4  
ATOM   2181  C  CA   . PRO A 1 17 ? 14.192  11.123  -14.775 1.00 0.00 ? 17  PRO A CA   4  
ATOM   2182  C  C    . PRO A 1 17 ? 13.758  9.733   -14.321 1.00 0.00 ? 17  PRO A C    4  
ATOM   2183  O  O    . PRO A 1 17 ? 13.791  8.777   -15.096 1.00 0.00 ? 17  PRO A O    4  
ATOM   2184  C  CB   . PRO A 1 17 ? 13.539  11.475  -16.114 1.00 0.00 ? 17  PRO A CB   4  
ATOM   2185  C  CG   . PRO A 1 17 ? 14.551  11.099  -17.140 1.00 0.00 ? 17  PRO A CG   4  
ATOM   2186  C  CD   . PRO A 1 17 ? 15.893  11.347  -16.508 1.00 0.00 ? 17  PRO A CD   4  
ATOM   2187  H  HA   . PRO A 1 17 ? 13.904  11.850  -14.030 1.00 0.00 ? 17  PRO A HA   4  
ATOM   2188  H  HB2  . PRO A 1 17 ? 12.626  10.909  -16.232 1.00 0.00 ? 17  PRO A HB2  4  
ATOM   2189  H  HB3  . PRO A 1 17 ? 13.320  12.532  -16.145 1.00 0.00 ? 17  PRO A HB3  4  
ATOM   2190  H  HG2  . PRO A 1 17 ? 14.444  10.056  -17.396 1.00 0.00 ? 17  PRO A HG2  4  
ATOM   2191  H  HG3  . PRO A 1 17 ? 14.431  11.716  -18.018 1.00 0.00 ? 17  PRO A HG3  4  
ATOM   2192  H  HD2  . PRO A 1 17 ? 16.612  10.616  -16.849 1.00 0.00 ? 17  PRO A HD2  4  
ATOM   2193  H  HD3  . PRO A 1 17 ? 16.236  12.347  -16.730 1.00 0.00 ? 17  PRO A HD3  4  
ATOM   2194  N  N    . HIS A 1 18 ? 13.351  9.628   -13.060 1.00 0.00 ? 18  HIS A N    4  
ATOM   2195  C  CA   . HIS A 1 18 ? 12.910  8.355   -12.502 1.00 0.00 ? 18  HIS A CA   4  
ATOM   2196  C  C    . HIS A 1 18 ? 11.387  8.296   -12.421 1.00 0.00 ? 18  HIS A C    4  
ATOM   2197  O  O    . HIS A 1 18 ? 10.717  9.292   -12.149 1.00 0.00 ? 18  HIS A O    4  
ATOM   2198  C  CB   . HIS A 1 18 ? 13.514  8.145   -11.114 1.00 0.00 ? 18  HIS A CB   4  
ATOM   2199  C  CG   . HIS A 1 18 ? 13.455  9.363   -10.244 1.00 0.00 ? 18  HIS A CG   4  
ATOM   2200  N  ND1  . HIS A 1 18 ? 14.572  9.934   -9.672  1.00 0.00 ? 18  HIS A ND1  4  
ATOM   2201  C  CD2  . HIS A 1 18 ? 12.404  10.120  -9.851  1.00 0.00 ? 18  HIS A CD2  4  
ATOM   2202  C  CE1  . HIS A 1 18 ? 14.211  10.989  -8.964  1.00 0.00 ? 18  HIS A CE1  4  
ATOM   2203  N  NE2  . HIS A 1 18 ? 12.900  11.124  -9.056  1.00 0.00 ? 18  HIS A NE2  4  
ATOM   2204  H  H    . HIS A 1 18 ? 13.348  10.426  -12.491 1.00 0.00 ? 18  HIS A H    4  
ATOM   2205  H  HA   . HIS A 1 18 ? 13.254  7.569   -13.158 1.00 0.00 ? 18  HIS A HA   4  
ATOM   2206  H  HB2  . HIS A 1 18 ? 12.979  7.353   -10.611 1.00 0.00 ? 18  HIS A HB2  4  
ATOM   2207  H  HB3  . HIS A 1 18 ? 14.552  7.861   -11.219 1.00 0.00 ? 18  HIS A HB3  4  
ATOM   2208  H  HD1  . HIS A 1 18 ? 15.493  9.613   -9.769  1.00 0.00 ? 18  HIS A HD1  4  
ATOM   2209  H  HD2  . HIS A 1 18 ? 11.367  9.964   -10.114 1.00 0.00 ? 18  HIS A HD2  4  
ATOM   2210  H  HE1  . HIS A 1 18 ? 14.874  11.632  -8.404  1.00 0.00 ? 18  HIS A HE1  4  
ATOM   2211  N  N    . PRO A 1 19 ? 10.827  7.102   -12.665 1.00 0.00 ? 19  PRO A N    4  
ATOM   2212  C  CA   . PRO A 1 19 ? 9.378   6.885   -12.626 1.00 0.00 ? 19  PRO A CA   4  
ATOM   2213  C  C    . PRO A 1 19 ? 8.817   6.969   -11.210 1.00 0.00 ? 19  PRO A C    4  
ATOM   2214  O  O    . PRO A 1 19 ? 9.568   7.029   -10.236 1.00 0.00 ? 19  PRO A O    4  
ATOM   2215  C  CB   . PRO A 1 19 ? 9.217   5.467   -13.182 1.00 0.00 ? 19  PRO A CB   4  
ATOM   2216  C  CG   . PRO A 1 19 ? 10.517  4.798   -12.897 1.00 0.00 ? 19  PRO A CG   4  
ATOM   2217  C  CD   . PRO A 1 19 ? 11.565  5.872   -12.997 1.00 0.00 ? 19  PRO A CD   4  
ATOM   2218  H  HA   . PRO A 1 19 ? 8.855   7.584   -13.261 1.00 0.00 ? 19  PRO A HA   4  
ATOM   2219  H  HB2  . PRO A 1 19 ? 8.398   4.972   -12.679 1.00 0.00 ? 19  PRO A HB2  4  
ATOM   2220  H  HB3  . PRO A 1 19 ? 9.020   5.513   -14.242 1.00 0.00 ? 19  PRO A HB3  4  
ATOM   2221  H  HG2  . PRO A 1 19 ? 10.503  4.378   -11.902 1.00 0.00 ? 19  PRO A HG2  4  
ATOM   2222  H  HG3  . PRO A 1 19 ? 10.700  4.026   -13.629 1.00 0.00 ? 19  PRO A HG3  4  
ATOM   2223  H  HD2  . PRO A 1 19 ? 12.357  5.693   -12.284 1.00 0.00 ? 19  PRO A HD2  4  
ATOM   2224  H  HD3  . PRO A 1 19 ? 11.962  5.919   -14.000 1.00 0.00 ? 19  PRO A HD3  4  
ATOM   2225  N  N    . THR A 1 20 ? 7.492   6.972   -11.103 1.00 0.00 ? 20  THR A N    4  
ATOM   2226  C  CA   . THR A 1 20 ? 6.831   7.050   -9.806  1.00 0.00 ? 20  THR A CA   4  
ATOM   2227  C  C    . THR A 1 20 ? 7.144   5.825   -8.955  1.00 0.00 ? 20  THR A C    4  
ATOM   2228  O  O    . THR A 1 20 ? 7.393   4.739   -9.480  1.00 0.00 ? 20  THR A O    4  
ATOM   2229  C  CB   . THR A 1 20 ? 5.303   7.176   -9.962  1.00 0.00 ? 20  THR A CB   4  
ATOM   2230  O  OG1  . THR A 1 20 ? 4.673   7.112   -8.677  1.00 0.00 ? 20  THR A OG1  4  
ATOM   2231  C  CG2  . THR A 1 20 ? 4.757   6.073   -10.856 1.00 0.00 ? 20  THR A CG2  4  
ATOM   2232  H  H    . THR A 1 20 ? 6.947   6.922   -11.916 1.00 0.00 ? 20  THR A H    4  
ATOM   2233  H  HA   . THR A 1 20 ? 7.194   7.932   -9.299  1.00 0.00 ? 20  THR A HA   4  
ATOM   2234  H  HB   . THR A 1 20 ? 5.081   8.131   -10.416 1.00 0.00 ? 20  THR A HB   4  
ATOM   2235  H  HG1  . THR A 1 20 ? 3.732   7.275   -8.774  1.00 0.00 ? 20  THR A HG1  4  
ATOM   2236  H  HG21 . THR A 1 20 ? 4.007   6.482   -11.516 1.00 0.00 ? 20  THR A HG21 4  
ATOM   2237  H  HG22 . THR A 1 20 ? 4.316   5.300   -10.244 1.00 0.00 ? 20  THR A HG22 4  
ATOM   2238  H  HG23 . THR A 1 20 ? 5.561   5.654   -11.441 1.00 0.00 ? 20  THR A HG23 4  
ATOM   2239  N  N    . SER A 1 21 ? 7.129   6.005   -7.638  1.00 0.00 ? 21  SER A N    4  
ATOM   2240  C  CA   . SER A 1 21 ? 7.415   4.914   -6.714  1.00 0.00 ? 21  SER A CA   4  
ATOM   2241  C  C    . SER A 1 21 ? 6.871   3.593   -7.249  1.00 0.00 ? 21  SER A C    4  
ATOM   2242  O  O    . SER A 1 21 ? 5.696   3.491   -7.603  1.00 0.00 ? 21  SER A O    4  
ATOM   2243  C  CB   . SER A 1 21 ? 6.810   5.210   -5.340  1.00 0.00 ? 21  SER A CB   4  
ATOM   2244  O  OG   . SER A 1 21 ? 7.588   6.161   -4.634  1.00 0.00 ? 21  SER A OG   4  
ATOM   2245  H  H    . SER A 1 21 ? 6.923   6.894   -7.281  1.00 0.00 ? 21  SER A H    4  
ATOM   2246  H  HA   . SER A 1 21 ? 8.488   4.835   -6.616  1.00 0.00 ? 21  SER A HA   4  
ATOM   2247  H  HB2  . SER A 1 21 ? 5.812   5.601   -5.466  1.00 0.00 ? 21  SER A HB2  4  
ATOM   2248  H  HB3  . SER A 1 21 ? 6.769   4.296   -4.764  1.00 0.00 ? 21  SER A HB3  4  
ATOM   2249  H  HG   . SER A 1 21 ? 7.718   5.861   -3.732  1.00 0.00 ? 21  SER A HG   4  
ATOM   2250  N  N    . ILE A 1 22 ? 7.734   2.584   -7.304  1.00 0.00 ? 22  ILE A N    4  
ATOM   2251  C  CA   . ILE A 1 22 ? 7.341   1.269   -7.794  1.00 0.00 ? 22  ILE A CA   4  
ATOM   2252  C  C    . ILE A 1 22 ? 6.709   0.435   -6.684  1.00 0.00 ? 22  ILE A C    4  
ATOM   2253  O  O    . ILE A 1 22 ? 7.126   0.503   -5.527  1.00 0.00 ? 22  ILE A O    4  
ATOM   2254  C  CB   . ILE A 1 22 ? 8.543   0.502   -8.375  1.00 0.00 ? 22  ILE A CB   4  
ATOM   2255  C  CG1  . ILE A 1 22 ? 8.938   1.084   -9.734  1.00 0.00 ? 22  ILE A CG1  4  
ATOM   2256  C  CG2  . ILE A 1 22 ? 8.216   -0.978  -8.501  1.00 0.00 ? 22  ILE A CG2  4  
ATOM   2257  C  CD1  . ILE A 1 22 ? 9.599   2.441   -9.641  1.00 0.00 ? 22  ILE A CD1  4  
ATOM   2258  H  H    . ILE A 1 22 ? 8.657   2.728   -7.007  1.00 0.00 ? 22  ILE A H    4  
ATOM   2259  H  HA   . ILE A 1 22 ? 6.615   1.410   -8.581  1.00 0.00 ? 22  ILE A HA   4  
ATOM   2260  H  HB   . ILE A 1 22 ? 9.373   0.606   -7.692  1.00 0.00 ? 22  ILE A HB   4  
ATOM   2261  H  HG12 . ILE A 1 22 ? 9.628   0.412   -10.220 1.00 0.00 ? 22  ILE A HG12 4  
ATOM   2262  H  HG13 . ILE A 1 22 ? 8.052   1.186   -10.344 1.00 0.00 ? 22  ILE A HG13 4  
ATOM   2263  H  HG21 . ILE A 1 22 ? 8.454   -1.480  -7.575  1.00 0.00 ? 22  ILE A HG21 4  
ATOM   2264  H  HG22 . ILE A 1 22 ? 7.165   -1.098  -8.715  1.00 0.00 ? 22  ILE A HG22 4  
ATOM   2265  H  HG23 . ILE A 1 22 ? 8.798   -1.409  -9.303  1.00 0.00 ? 22  ILE A HG23 4  
ATOM   2266  H  HD11 . ILE A 1 22 ? 8.931   3.135   -9.154  1.00 0.00 ? 22  ILE A HD11 4  
ATOM   2267  H  HD12 . ILE A 1 22 ? 10.512  2.359   -9.072  1.00 0.00 ? 22  ILE A HD12 4  
ATOM   2268  H  HD13 . ILE A 1 22 ? 9.826   2.799   -10.636 1.00 0.00 ? 22  ILE A HD13 4  
ATOM   2269  N  N    . CYS A 1 23 ? 5.702   -0.353  -7.044  1.00 0.00 ? 23  CYS A N    4  
ATOM   2270  C  CA   . CYS A 1 23 ? 5.012   -1.202  -6.080  1.00 0.00 ? 23  CYS A CA   4  
ATOM   2271  C  C    . CYS A 1 23 ? 5.961   -2.248  -5.500  1.00 0.00 ? 23  CYS A C    4  
ATOM   2272  O  O    . CYS A 1 23 ? 7.133   -2.311  -5.870  1.00 0.00 ? 23  CYS A O    4  
ATOM   2273  C  CB   . CYS A 1 23 ? 3.818   -1.893  -6.740  1.00 0.00 ? 23  CYS A CB   4  
ATOM   2274  S  SG   . CYS A 1 23 ? 2.450   -2.266  -5.597  1.00 0.00 ? 23  CYS A SG   4  
ATOM   2275  H  H    . CYS A 1 23 ? 5.415   -0.364  -7.982  1.00 0.00 ? 23  CYS A H    4  
ATOM   2276  H  HA   . CYS A 1 23 ? 4.656   -0.573  -5.279  1.00 0.00 ? 23  CYS A HA   4  
ATOM   2277  H  HB2  . CYS A 1 23 ? 3.428   -1.254  -7.520  1.00 0.00 ? 23  CYS A HB2  4  
ATOM   2278  H  HB3  . CYS A 1 23 ? 4.146   -2.825  -7.177  1.00 0.00 ? 23  CYS A HB3  4  
ATOM   2279  N  N    . ASP A 1 24 ? 5.445   -3.065  -4.588  1.00 0.00 ? 24  ASP A N    4  
ATOM   2280  C  CA   . ASP A 1 24 ? 6.245   -4.108  -3.957  1.00 0.00 ? 24  ASP A CA   4  
ATOM   2281  C  C    . ASP A 1 24 ? 5.818   -5.489  -4.444  1.00 0.00 ? 24  ASP A C    4  
ATOM   2282  O  O    . ASP A 1 24 ? 6.626   -6.415  -4.500  1.00 0.00 ? 24  ASP A O    4  
ATOM   2283  C  CB   . ASP A 1 24 ? 6.116   -4.028  -2.435  1.00 0.00 ? 24  ASP A CB   4  
ATOM   2284  C  CG   . ASP A 1 24 ? 6.516   -2.671  -1.891  1.00 0.00 ? 24  ASP A CG   4  
ATOM   2285  O  OD1  . ASP A 1 24 ? 7.724   -2.356  -1.909  1.00 0.00 ? 24  ASP A OD1  4  
ATOM   2286  O  OD2  . ASP A 1 24 ? 5.620   -1.923  -1.447  1.00 0.00 ? 24  ASP A OD2  4  
ATOM   2287  H  H    . ASP A 1 24 ? 4.504   -2.964  -4.334  1.00 0.00 ? 24  ASP A H    4  
ATOM   2288  H  HA   . ASP A 1 24 ? 7.276   -3.947  -4.231  1.00 0.00 ? 24  ASP A HA   4  
ATOM   2289  H  HB2  . ASP A 1 24 ? 5.090   -4.219  -2.156  1.00 0.00 ? 24  ASP A HB2  4  
ATOM   2290  H  HB3  . ASP A 1 24 ? 6.752   -4.777  -1.987  1.00 0.00 ? 24  ASP A HB3  4  
ATOM   2291  N  N    . ASN A 1 25 ? 4.542   -5.620  -4.794  1.00 0.00 ? 25  ASN A N    4  
ATOM   2292  C  CA   . ASN A 1 25 ? 4.008   -6.888  -5.275  1.00 0.00 ? 25  ASN A CA   4  
ATOM   2293  C  C    . ASN A 1 25 ? 4.283   -7.065  -6.765  1.00 0.00 ? 25  ASN A C    4  
ATOM   2294  O  O    . ASN A 1 25 ? 5.106   -7.890  -7.162  1.00 0.00 ? 25  ASN A O    4  
ATOM   2295  C  CB   . ASN A 1 25 ? 2.503   -6.964  -5.010  1.00 0.00 ? 25  ASN A CB   4  
ATOM   2296  C  CG   . ASN A 1 25 ? 2.185   -7.240  -3.553  1.00 0.00 ? 25  ASN A CG   4  
ATOM   2297  O  OD1  . ASN A 1 25 ? 3.030   -7.057  -2.677  1.00 0.00 ? 25  ASN A OD1  4  
ATOM   2298  N  ND2  . ASN A 1 25 ? 0.961   -7.682  -3.288  1.00 0.00 ? 25  ASN A ND2  4  
ATOM   2299  H  H    . ASN A 1 25 ? 3.946   -4.845  -4.727  1.00 0.00 ? 25  ASN A H    4  
ATOM   2300  H  HA   . ASN A 1 25 ? 4.500   -7.682  -4.733  1.00 0.00 ? 25  ASN A HA   4  
ATOM   2301  H  HB2  . ASN A 1 25 ? 2.047   -6.025  -5.286  1.00 0.00 ? 25  ASN A HB2  4  
ATOM   2302  H  HB3  . ASN A 1 25 ? 2.077   -7.756  -5.609  1.00 0.00 ? 25  ASN A HB3  4  
ATOM   2303  H  HD21 . ASN A 1 25 ? 0.340   -7.804  -4.036  1.00 0.00 ? 25  ASN A HD21 4  
ATOM   2304  H  HD22 . ASN A 1 25 ? 0.729   -7.868  -2.354  1.00 0.00 ? 25  ASN A HD22 4  
ATOM   2305  N  N    . PHE A 1 26 ? 3.588   -6.285  -7.586  1.00 0.00 ? 26  PHE A N    4  
ATOM   2306  C  CA   . PHE A 1 26 ? 3.757   -6.354  -9.033  1.00 0.00 ? 26  PHE A CA   4  
ATOM   2307  C  C    . PHE A 1 26 ? 5.230   -6.242  -9.415  1.00 0.00 ? 26  PHE A C    4  
ATOM   2308  O  O    . PHE A 1 26 ? 5.678   -6.851  -10.386 1.00 0.00 ? 26  PHE A O    4  
ATOM   2309  C  CB   . PHE A 1 26 ? 2.955   -5.244  -9.715  1.00 0.00 ? 26  PHE A CB   4  
ATOM   2310  C  CG   . PHE A 1 26 ? 2.449   -5.621  -11.078 1.00 0.00 ? 26  PHE A CG   4  
ATOM   2311  C  CD1  . PHE A 1 26 ? 3.332   -5.946  -12.095 1.00 0.00 ? 26  PHE A CD1  4  
ATOM   2312  C  CD2  . PHE A 1 26 ? 1.089   -5.651  -11.342 1.00 0.00 ? 26  PHE A CD2  4  
ATOM   2313  C  CE1  . PHE A 1 26 ? 2.869   -6.292  -13.350 1.00 0.00 ? 26  PHE A CE1  4  
ATOM   2314  C  CE2  . PHE A 1 26 ? 0.619   -5.997  -12.595 1.00 0.00 ? 26  PHE A CE2  4  
ATOM   2315  C  CZ   . PHE A 1 26 ? 1.511   -6.319  -13.600 1.00 0.00 ? 26  PHE A CZ   4  
ATOM   2316  H  H    . PHE A 1 26 ? 2.946   -5.646  -7.210  1.00 0.00 ? 26  PHE A H    4  
ATOM   2317  H  HA   . PHE A 1 26 ? 3.383   -7.311  -9.363  1.00 0.00 ? 26  PHE A HA   4  
ATOM   2318  H  HB2  . PHE A 1 26 ? 2.102   -4.996  -9.102  1.00 0.00 ? 26  PHE A HB2  4  
ATOM   2319  H  HB3  . PHE A 1 26 ? 3.582   -4.371  -9.822  1.00 0.00 ? 26  PHE A HB3  4  
ATOM   2320  H  HD1  . PHE A 1 26 ? 4.395   -5.926  -11.900 1.00 0.00 ? 26  PHE A HD1  4  
ATOM   2321  H  HD2  . PHE A 1 26 ? 0.391   -5.399  -10.556 1.00 0.00 ? 26  PHE A HD2  4  
ATOM   2322  H  HE1  . PHE A 1 26 ? 3.567   -6.544  -14.134 1.00 0.00 ? 26  PHE A HE1  4  
ATOM   2323  H  HE2  . PHE A 1 26 ? -0.443  -6.017  -12.788 1.00 0.00 ? 26  PHE A HE2  4  
ATOM   2324  H  HZ   . PHE A 1 26 ? 1.146   -6.589  -14.580 1.00 0.00 ? 26  PHE A HZ   4  
ATOM   2325  N  N    . SER A 1 27 ? 5.977   -5.460  -8.643  1.00 0.00 ? 27  SER A N    4  
ATOM   2326  C  CA   . SER A 1 27 ? 7.398   -5.263  -8.902  1.00 0.00 ? 27  SER A CA   4  
ATOM   2327  C  C    . SER A 1 27 ? 8.080   -6.590  -9.224  1.00 0.00 ? 27  SER A C    4  
ATOM   2328  O  O    . SER A 1 27 ? 8.569   -6.795  -10.335 1.00 0.00 ? 27  SER A O    4  
ATOM   2329  C  CB   . SER A 1 27 ? 8.073   -4.611  -7.694  1.00 0.00 ? 27  SER A CB   4  
ATOM   2330  O  OG   . SER A 1 27 ? 9.484   -4.635  -7.823  1.00 0.00 ? 27  SER A OG   4  
ATOM   2331  H  H    . SER A 1 27 ? 5.561   -5.001  -7.883  1.00 0.00 ? 27  SER A H    4  
ATOM   2332  H  HA   . SER A 1 27 ? 7.493   -4.607  -9.754  1.00 0.00 ? 27  SER A HA   4  
ATOM   2333  H  HB2  . SER A 1 27 ? 7.749   -3.584  -7.615  1.00 0.00 ? 27  SER A HB2  4  
ATOM   2334  H  HB3  . SER A 1 27 ? 7.796   -5.146  -6.798  1.00 0.00 ? 27  SER A HB3  4  
ATOM   2335  H  HG   . SER A 1 27 ? 9.797   -3.768  -8.090  1.00 0.00 ? 27  SER A HG   4  
ATOM   2336  N  N    . ALA A 1 28 ? 8.108   -7.487  -8.244  1.00 0.00 ? 28  ALA A N    4  
ATOM   2337  C  CA   . ALA A 1 28 ? 8.727   -8.794  -8.422  1.00 0.00 ? 28  ALA A CA   4  
ATOM   2338  C  C    . ALA A 1 28 ? 7.682   -9.858  -8.739  1.00 0.00 ? 28  ALA A C    4  
ATOM   2339  O  O    . ALA A 1 28 ? 7.778   -10.555 -9.750  1.00 0.00 ? 28  ALA A O    4  
ATOM   2340  C  CB   . ALA A 1 28 ? 9.515   -9.179  -7.179  1.00 0.00 ? 28  ALA A CB   4  
ATOM   2341  H  H    . ALA A 1 28 ? 7.701   -7.264  -7.381  1.00 0.00 ? 28  ALA A H    4  
ATOM   2342  H  HA   . ALA A 1 28 ? 9.419   -8.726  -9.250  1.00 0.00 ? 28  ALA A HA   4  
ATOM   2343  H  HB1  . ALA A 1 28 ? 9.264   -10.191 -6.894  1.00 0.00 ? 28  ALA A HB1  4  
ATOM   2344  H  HB2  . ALA A 1 28 ? 10.572  -9.115  -7.388  1.00 0.00 ? 28  ALA A HB2  4  
ATOM   2345  H  HB3  . ALA A 1 28 ? 9.266   -8.506  -6.372  1.00 0.00 ? 28  ALA A HB3  4  
ATOM   2346  N  N    . TYR A 1 29 ? 6.685   -9.979  -7.870  1.00 0.00 ? 29  TYR A N    4  
ATOM   2347  C  CA   . TYR A 1 29 ? 5.623   -10.961 -8.055  1.00 0.00 ? 29  TYR A CA   4  
ATOM   2348  C  C    . TYR A 1 29 ? 4.961   -10.795 -9.420  1.00 0.00 ? 29  TYR A C    4  
ATOM   2349  O  O    . TYR A 1 29 ? 4.733   -11.770 -10.135 1.00 0.00 ? 29  TYR A O    4  
ATOM   2350  C  CB   . TYR A 1 29 ? 4.576   -10.826 -6.949  1.00 0.00 ? 29  TYR A CB   4  
ATOM   2351  C  CG   . TYR A 1 29 ? 5.143   -10.988 -5.556  1.00 0.00 ? 29  TYR A CG   4  
ATOM   2352  C  CD1  . TYR A 1 29 ? 5.772   -9.928  -4.913  1.00 0.00 ? 29  TYR A CD1  4  
ATOM   2353  C  CD2  . TYR A 1 29 ? 5.048   -12.199 -4.883  1.00 0.00 ? 29  TYR A CD2  4  
ATOM   2354  C  CE1  . TYR A 1 29 ? 6.292   -10.072 -3.642  1.00 0.00 ? 29  TYR A CE1  4  
ATOM   2355  C  CE2  . TYR A 1 29 ? 5.564   -12.352 -3.610  1.00 0.00 ? 29  TYR A CE2  4  
ATOM   2356  C  CZ   . TYR A 1 29 ? 6.185   -11.285 -2.994  1.00 0.00 ? 29  TYR A CZ   4  
ATOM   2357  O  OH   . TYR A 1 29 ? 6.700   -11.431 -1.727  1.00 0.00 ? 29  TYR A OH   4  
ATOM   2358  H  H    . TYR A 1 29 ? 6.663   -9.395  -7.083  1.00 0.00 ? 29  TYR A H    4  
ATOM   2359  H  HA   . TYR A 1 29 ? 6.067   -11.944 -8.000  1.00 0.00 ? 29  TYR A HA   4  
ATOM   2360  H  HB2  . TYR A 1 29 ? 4.121   -9.850  -7.010  1.00 0.00 ? 29  TYR A HB2  4  
ATOM   2361  H  HB3  . TYR A 1 29 ? 3.817   -11.582 -7.088  1.00 0.00 ? 29  TYR A HB3  4  
ATOM   2362  H  HD1  . TYR A 1 29 ? 5.853   -8.979  -5.424  1.00 0.00 ? 29  TYR A HD1  4  
ATOM   2363  H  HD2  . TYR A 1 29 ? 4.562   -13.033 -5.368  1.00 0.00 ? 29  TYR A HD2  4  
ATOM   2364  H  HE1  . TYR A 1 29 ? 6.777   -9.237  -3.159  1.00 0.00 ? 29  TYR A HE1  4  
ATOM   2365  H  HE2  . TYR A 1 29 ? 5.481   -13.301 -3.103  1.00 0.00 ? 29  TYR A HE2  4  
ATOM   2366  H  HH   . TYR A 1 29 ? 7.583   -11.055 -1.695  1.00 0.00 ? 29  TYR A HH   4  
ATOM   2367  N  N    . GLY A 1 30 ? 4.655   -9.551  -9.775  1.00 0.00 ? 30  GLY A N    4  
ATOM   2368  C  CA   . GLY A 1 30 ? 4.023   -9.279  -11.053 1.00 0.00 ? 30  GLY A CA   4  
ATOM   2369  C  C    . GLY A 1 30 ? 2.558   -8.917  -10.909 1.00 0.00 ? 30  GLY A C    4  
ATOM   2370  O  O    . GLY A 1 30 ? 2.016   -8.164  -11.718 1.00 0.00 ? 30  GLY A O    4  
ATOM   2371  H  H    . GLY A 1 30 ? 4.860   -8.812  -9.165  1.00 0.00 ? 30  GLY A H    4  
ATOM   2372  H  HA2  . GLY A 1 30 ? 4.540   -8.460  -11.531 1.00 0.00 ? 30  GLY A HA2  4  
ATOM   2373  H  HA3  . GLY A 1 30 ? 4.106   -10.156 -11.677 1.00 0.00 ? 30  GLY A HA3  4  
ATOM   2374  N  N    . TRP A 1 31 ? 1.916   -9.457  -9.880  1.00 0.00 ? 31  TRP A N    4  
ATOM   2375  C  CA   . TRP A 1 31 ? 0.503   -9.188  -9.634  1.00 0.00 ? 31  TRP A CA   4  
ATOM   2376  C  C    . TRP A 1 31 ? 0.328   -8.202  -8.485  1.00 0.00 ? 31  TRP A C    4  
ATOM   2377  O  O    . TRP A 1 31 ? 1.213   -8.054  -7.640  1.00 0.00 ? 31  TRP A O    4  
ATOM   2378  C  CB   . TRP A 1 31 ? -0.238  -10.489 -9.324  1.00 0.00 ? 31  TRP A CB   4  
ATOM   2379  C  CG   . TRP A 1 31 ? -0.306  -10.799 -7.859  1.00 0.00 ? 31  TRP A CG   4  
ATOM   2380  C  CD1  . TRP A 1 31 ? 0.644   -11.434 -7.111  1.00 0.00 ? 31  TRP A CD1  4  
ATOM   2381  C  CD2  . TRP A 1 31 ? -1.382  -10.489 -6.966  1.00 0.00 ? 31  TRP A CD2  4  
ATOM   2382  N  NE1  . TRP A 1 31 ? 0.223   -11.538 -5.807  1.00 0.00 ? 31  TRP A NE1  4  
ATOM   2383  C  CE2  . TRP A 1 31 ? -1.016  -10.965 -5.692  1.00 0.00 ? 31  TRP A CE2  4  
ATOM   2384  C  CE3  . TRP A 1 31 ? -2.617  -9.854  -7.119  1.00 0.00 ? 31  TRP A CE3  4  
ATOM   2385  C  CZ2  . TRP A 1 31 ? -1.842  -10.826 -4.580  1.00 0.00 ? 31  TRP A CZ2  4  
ATOM   2386  C  CZ3  . TRP A 1 31 ? -3.437  -9.718  -6.014  1.00 0.00 ? 31  TRP A CZ3  4  
ATOM   2387  C  CH2  . TRP A 1 31 ? -3.046  -10.201 -4.758  1.00 0.00 ? 31  TRP A CH2  4  
ATOM   2388  H  H    . TRP A 1 31 ? 2.402   -10.050 -9.269  1.00 0.00 ? 31  TRP A H    4  
ATOM   2389  H  HA   . TRP A 1 31 ? 0.089   -8.753  -10.532 1.00 0.00 ? 31  TRP A HA   4  
ATOM   2390  H  HB2  . TRP A 1 31 ? -1.249  -10.418 -9.696  1.00 0.00 ? 31  TRP A HB2  4  
ATOM   2391  H  HB3  . TRP A 1 31 ? 0.266   -11.308 -9.816  1.00 0.00 ? 31  TRP A HB3  4  
ATOM   2392  H  HD1  . TRP A 1 31 ? 1.582   -11.798 -7.501  1.00 0.00 ? 31  TRP A HD1  4  
ATOM   2393  H  HE1  . TRP A 1 31 ? 0.730   -11.953 -5.077  1.00 0.00 ? 31  TRP A HE1  4  
ATOM   2394  H  HE3  . TRP A 1 31 ? -2.936  -9.475  -8.079  1.00 0.00 ? 31  TRP A HE3  4  
ATOM   2395  H  HZ2  . TRP A 1 31 ? -1.556  -11.193 -3.605  1.00 0.00 ? 31  TRP A HZ2  4  
ATOM   2396  H  HZ3  . TRP A 1 31 ? -4.395  -9.230  -6.113  1.00 0.00 ? 31  TRP A HZ3  4  
ATOM   2397  H  HH2  . TRP A 1 31 ? -3.718  -10.072 -3.924  1.00 0.00 ? 31  TRP A HH2  4  
ATOM   2398  N  N    . CYS A 1 32 ? -0.817  -7.529  -8.457  1.00 0.00 ? 32  CYS A N    4  
ATOM   2399  C  CA   . CYS A 1 32 ? -1.108  -6.556  -7.410  1.00 0.00 ? 32  CYS A CA   4  
ATOM   2400  C  C    . CYS A 1 32 ? -2.596  -6.548  -7.074  1.00 0.00 ? 32  CYS A C    4  
ATOM   2401  O  O    . CYS A 1 32 ? -3.457  -6.557  -7.954  1.00 0.00 ? 32  CYS A O    4  
ATOM   2402  C  CB   . CYS A 1 32 ? -0.665  -5.159  -7.847  1.00 0.00 ? 32  CYS A CB   4  
ATOM   2403  S  SG   . CYS A 1 32 ? -0.913  -3.871  -6.582  1.00 0.00 ? 32  CYS A SG   4  
ATOM   2404  H  H    . CYS A 1 32 ? -1.484  -7.690  -9.158  1.00 0.00 ? 32  CYS A H    4  
ATOM   2405  H  HA   . CYS A 1 32 ? -0.554  -6.841  -6.529  1.00 0.00 ? 32  CYS A HA   4  
ATOM   2406  H  HB2  . CYS A 1 32 ? 0.388   -5.182  -8.088  1.00 0.00 ? 32  CYS A HB2  4  
ATOM   2407  H  HB3  . CYS A 1 32 ? -1.223  -4.870  -8.725  1.00 0.00 ? 32  CYS A HB3  4  
ATOM   2408  N  N    . PRO A 1 33 ? -2.908  -6.530  -5.770  1.00 0.00 ? 33  PRO A N    4  
ATOM   2409  C  CA   . PRO A 1 33 ? -4.292  -6.519  -5.287  1.00 0.00 ? 33  PRO A CA   4  
ATOM   2410  C  C    . PRO A 1 33 ? -4.996  -5.197  -5.573  1.00 0.00 ? 33  PRO A C    4  
ATOM   2411  O  O    . PRO A 1 33 ? -6.174  -5.028  -5.256  1.00 0.00 ? 33  PRO A O    4  
ATOM   2412  C  CB   . PRO A 1 33 ? -4.143  -6.729  -3.778  1.00 0.00 ? 33  PRO A CB   4  
ATOM   2413  C  CG   . PRO A 1 33 ? -2.779  -6.223  -3.458  1.00 0.00 ? 33  PRO A CG   4  
ATOM   2414  C  CD   . PRO A 1 33 ? -1.933  -6.518  -4.666  1.00 0.00 ? 33  PRO A CD   4  
ATOM   2415  H  HA   . PRO A 1 33 ? -4.866  -7.330  -5.709  1.00 0.00 ? 33  PRO A HA   4  
ATOM   2416  H  HB2  . PRO A 1 33 ? -4.906  -6.168  -3.256  1.00 0.00 ? 33  PRO A HB2  4  
ATOM   2417  H  HB3  . PRO A 1 33 ? -4.238  -7.779  -3.545  1.00 0.00 ? 33  PRO A HB3  4  
ATOM   2418  H  HG2  . PRO A 1 33 ? -2.815  -5.159  -3.277  1.00 0.00 ? 33  PRO A HG2  4  
ATOM   2419  H  HG3  . PRO A 1 33 ? -2.389  -6.739  -2.593  1.00 0.00 ? 33  PRO A HG3  4  
ATOM   2420  H  HD2  . PRO A 1 33 ? -1.197  -5.742  -4.810  1.00 0.00 ? 33  PRO A HD2  4  
ATOM   2421  H  HD3  . PRO A 1 33 ? -1.455  -7.481  -4.565  1.00 0.00 ? 33  PRO A HD3  4  
ATOM   2422  N  N    . LEU A 1 34 ? -4.267  -4.263  -6.175  1.00 0.00 ? 34  LEU A N    4  
ATOM   2423  C  CA   . LEU A 1 34 ? -4.823  -2.955  -6.505  1.00 0.00 ? 34  LEU A CA   4  
ATOM   2424  C  C    . LEU A 1 34 ? -4.984  -2.797  -8.013  1.00 0.00 ? 34  LEU A C    4  
ATOM   2425  O  O    . LEU A 1 34 ? -5.640  -1.869  -8.484  1.00 0.00 ? 34  LEU A O    4  
ATOM   2426  C  CB   . LEU A 1 34 ? -3.924  -1.845  -5.957  1.00 0.00 ? 34  LEU A CB   4  
ATOM   2427  C  CG   . LEU A 1 34 ? -4.104  -1.504  -4.477  1.00 0.00 ? 34  LEU A CG   4  
ATOM   2428  C  CD1  . LEU A 1 34 ? -3.245  -0.308  -4.097  1.00 0.00 ? 34  LEU A CD1  4  
ATOM   2429  C  CD2  . LEU A 1 34 ? -5.568  -1.232  -4.167  1.00 0.00 ? 34  LEU A CD2  4  
ATOM   2430  H  H    . LEU A 1 34 ? -3.335  -4.456  -6.402  1.00 0.00 ? 34  LEU A H    4  
ATOM   2431  H  HA   . LEU A 1 34 ? -5.795  -2.881  -6.041  1.00 0.00 ? 34  LEU A HA   4  
ATOM   2432  H  HB2  . LEU A 1 34 ? -2.899  -2.146  -6.105  1.00 0.00 ? 34  LEU A HB2  4  
ATOM   2433  H  HB3  . LEU A 1 34 ? -4.120  -0.949  -6.530  1.00 0.00 ? 34  LEU A HB3  4  
ATOM   2434  H  HG   . LEU A 1 34 ? -3.785  -2.347  -3.879  1.00 0.00 ? 34  LEU A HG   4  
ATOM   2435  H  HD11 . LEU A 1 34 ? -2.204  -0.546  -4.259  1.00 0.00 ? 34  LEU A HD11 4  
ATOM   2436  H  HD12 . LEU A 1 34 ? -3.402  -0.070  -3.055  1.00 0.00 ? 34  LEU A HD12 4  
ATOM   2437  H  HD13 . LEU A 1 34 ? -3.520  0.541   -4.705  1.00 0.00 ? 34  LEU A HD13 4  
ATOM   2438  H  HD21 . LEU A 1 34 ? -5.640  -0.627  -3.275  1.00 0.00 ? 34  LEU A HD21 4  
ATOM   2439  H  HD22 . LEU A 1 34 ? -6.083  -2.169  -4.008  1.00 0.00 ? 34  LEU A HD22 4  
ATOM   2440  H  HD23 . LEU A 1 34 ? -6.020  -0.708  -4.996  1.00 0.00 ? 34  LEU A HD23 4  
ATOM   2441  N  N    . GLY A 1 35 ? -4.381  -3.712  -8.767  1.00 0.00 ? 35  GLY A N    4  
ATOM   2442  C  CA   . GLY A 1 35 ? -4.471  -3.657  -10.214 1.00 0.00 ? 35  GLY A CA   4  
ATOM   2443  C  C    . GLY A 1 35 ? -3.897  -2.375  -10.783 1.00 0.00 ? 35  GLY A C    4  
ATOM   2444  O  O    . GLY A 1 35 ? -2.919  -1.828  -10.274 1.00 0.00 ? 35  GLY A O    4  
ATOM   2445  H  H    . GLY A 1 35 ? -3.871  -4.429  -8.337  1.00 0.00 ? 35  GLY A H    4  
ATOM   2446  H  HA2  . GLY A 1 35 ? -3.933  -4.496  -10.630 1.00 0.00 ? 35  GLY A HA2  4  
ATOM   2447  H  HA3  . GLY A 1 35 ? -5.510  -3.731  -10.502 1.00 0.00 ? 35  GLY A HA3  4  
ATOM   2448  N  N    . PRO A 1 36 ? -4.511  -1.876  -11.866 1.00 0.00 ? 36  PRO A N    4  
ATOM   2449  C  CA   . PRO A 1 36 ? -4.071  -0.645  -12.529 1.00 0.00 ? 36  PRO A CA   4  
ATOM   2450  C  C    . PRO A 1 36 ? -4.340  0.596   -11.685 1.00 0.00 ? 36  PRO A C    4  
ATOM   2451  O  O    . PRO A 1 36 ? -3.648  1.606   -11.812 1.00 0.00 ? 36  PRO A O    4  
ATOM   2452  C  CB   . PRO A 1 36 ? -4.910  -0.612  -13.809 1.00 0.00 ? 36  PRO A CB   4  
ATOM   2453  C  CG   . PRO A 1 36 ? -6.128  -1.405  -13.484 1.00 0.00 ? 36  PRO A CG   4  
ATOM   2454  C  CD   . PRO A 1 36 ? -5.683  -2.475  -12.527 1.00 0.00 ? 36  PRO A CD   4  
ATOM   2455  H  HA   . PRO A 1 36 ? -3.023  -0.685  -12.785 1.00 0.00 ? 36  PRO A HA   4  
ATOM   2456  H  HB2  . PRO A 1 36 ? -5.157  0.411   -14.055 1.00 0.00 ? 36  PRO A HB2  4  
ATOM   2457  H  HB3  . PRO A 1 36 ? -4.354  -1.058  -14.620 1.00 0.00 ? 36  PRO A HB3  4  
ATOM   2458  H  HG2  . PRO A 1 36 ? -6.867  -0.770  -13.019 1.00 0.00 ? 36  PRO A HG2  4  
ATOM   2459  H  HG3  . PRO A 1 36 ? -6.527  -1.850  -14.384 1.00 0.00 ? 36  PRO A HG3  4  
ATOM   2460  H  HD2  . PRO A 1 36 ? -6.462  -2.689  -11.810 1.00 0.00 ? 36  PRO A HD2  4  
ATOM   2461  H  HD3  . PRO A 1 36 ? -5.406  -3.371  -13.064 1.00 0.00 ? 36  PRO A HD3  4  
ATOM   2462  N  N    . GLN A 1 37 ? -5.348  0.512   -10.822 1.00 0.00 ? 37  GLN A N    4  
ATOM   2463  C  CA   . GLN A 1 37 ? -5.707  1.630   -9.957  1.00 0.00 ? 37  GLN A CA   4  
ATOM   2464  C  C    . GLN A 1 37 ? -4.600  1.914   -8.947  1.00 0.00 ? 37  GLN A C    4  
ATOM   2465  O  O    . GLN A 1 37 ? -4.473  3.032   -8.447  1.00 0.00 ? 37  GLN A O    4  
ATOM   2466  C  CB   . GLN A 1 37 ? -7.017  1.335   -9.225  1.00 0.00 ? 37  GLN A CB   4  
ATOM   2467  C  CG   . GLN A 1 37 ? -8.257  1.675   -10.037 1.00 0.00 ? 37  GLN A CG   4  
ATOM   2468  C  CD   . GLN A 1 37 ? -8.162  1.200   -11.474 1.00 0.00 ? 37  GLN A CD   4  
ATOM   2469  O  OE1  . GLN A 1 37 ? -7.496  1.821   -12.302 1.00 0.00 ? 37  GLN A OE1  4  
ATOM   2470  N  NE2  . GLN A 1 37 ? -8.830  0.093   -11.777 1.00 0.00 ? 37  GLN A NE2  4  
ATOM   2471  H  H    . GLN A 1 37 ? -5.862  -0.319  -10.767 1.00 0.00 ? 37  GLN A H    4  
ATOM   2472  H  HA   . GLN A 1 37 ? -5.841  2.501   -10.580 1.00 0.00 ? 37  GLN A HA   4  
ATOM   2473  H  HB2  . GLN A 1 37 ? -7.051  0.284   -8.980  1.00 0.00 ? 37  GLN A HB2  4  
ATOM   2474  H  HB3  . GLN A 1 37 ? -7.043  1.911   -8.312  1.00 0.00 ? 37  GLN A HB3  4  
ATOM   2475  H  HG2  . GLN A 1 37 ? -9.114  1.207   -9.575  1.00 0.00 ? 37  GLN A HG2  4  
ATOM   2476  H  HG3  . GLN A 1 37 ? -8.390  2.747   -10.035 1.00 0.00 ? 37  GLN A HG3  4  
ATOM   2477  H  HE21 . GLN A 1 37 ? -9.341  -0.348  -11.065 1.00 0.00 ? 37  GLN A HE21 4  
ATOM   2478  H  HE22 . GLN A 1 37 ? -8.787  -0.236  -12.698 1.00 0.00 ? 37  GLN A HE22 4  
ATOM   2479  N  N    . CYS A 1 38 ? -3.800  0.895   -8.651  1.00 0.00 ? 38  CYS A N    4  
ATOM   2480  C  CA   . CYS A 1 38 ? -2.704  1.034   -7.700  1.00 0.00 ? 38  CYS A CA   4  
ATOM   2481  C  C    . CYS A 1 38 ? -1.963  2.350   -7.913  1.00 0.00 ? 38  CYS A C    4  
ATOM   2482  O  O    . CYS A 1 38 ? -1.660  2.746   -9.039  1.00 0.00 ? 38  CYS A O    4  
ATOM   2483  C  CB   . CYS A 1 38 ? -1.732  -0.140  -7.835  1.00 0.00 ? 38  CYS A CB   4  
ATOM   2484  S  SG   . CYS A 1 38 ? -0.331  -0.083  -6.673  1.00 0.00 ? 38  CYS A SG   4  
ATOM   2485  H  H    . CYS A 1 38 ? -3.952  0.027   -9.082  1.00 0.00 ? 38  CYS A H    4  
ATOM   2486  H  HA   . CYS A 1 38 ? -3.124  1.028   -6.705  1.00 0.00 ? 38  CYS A HA   4  
ATOM   2487  H  HB2  . CYS A 1 38 ? -2.266  -1.062  -7.659  1.00 0.00 ? 38  CYS A HB2  4  
ATOM   2488  H  HB3  . CYS A 1 38 ? -1.329  -0.149  -8.837  1.00 0.00 ? 38  CYS A HB3  4  
ATOM   2489  N  N    . PRO A 1 39 ? -1.662  3.046   -6.806  1.00 0.00 ? 39  PRO A N    4  
ATOM   2490  C  CA   . PRO A 1 39 ? -0.952  4.327   -6.845  1.00 0.00 ? 39  PRO A CA   4  
ATOM   2491  C  C    . PRO A 1 39 ? 0.507   4.169   -7.260  1.00 0.00 ? 39  PRO A C    4  
ATOM   2492  O  O    . PRO A 1 39 ? 1.101   5.083   -7.833  1.00 0.00 ? 39  PRO A O    4  
ATOM   2493  C  CB   . PRO A 1 39 ? -1.045  4.829   -5.402  1.00 0.00 ? 39  PRO A CB   4  
ATOM   2494  C  CG   . PRO A 1 39 ? -1.208  3.596   -4.582  1.00 0.00 ? 39  PRO A CG   4  
ATOM   2495  C  CD   . PRO A 1 39 ? -1.992  2.634   -5.431  1.00 0.00 ? 39  PRO A CD   4  
ATOM   2496  H  HA   . PRO A 1 39 ? -1.438  5.031   -7.505  1.00 0.00 ? 39  PRO A HA   4  
ATOM   2497  H  HB2  . PRO A 1 39 ? -0.140  5.360   -5.144  1.00 0.00 ? 39  PRO A HB2  4  
ATOM   2498  H  HB3  . PRO A 1 39 ? -1.896  5.486   -5.300  1.00 0.00 ? 39  PRO A HB3  4  
ATOM   2499  H  HG2  . PRO A 1 39 ? -0.239  3.183   -4.345  1.00 0.00 ? 39  PRO A HG2  4  
ATOM   2500  H  HG3  . PRO A 1 39 ? -1.751  3.826   -3.678  1.00 0.00 ? 39  PRO A HG3  4  
ATOM   2501  H  HD2  . PRO A 1 39 ? -1.672  1.619   -5.245  1.00 0.00 ? 39  PRO A HD2  4  
ATOM   2502  H  HD3  . PRO A 1 39 ? -3.050  2.739   -5.242  1.00 0.00 ? 39  PRO A HD3  4  
ATOM   2503  N  N    . GLN A 1 40 ? 1.078   3.005   -6.969  1.00 0.00 ? 40  GLN A N    4  
ATOM   2504  C  CA   . GLN A 1 40 ? 2.468   2.729   -7.312  1.00 0.00 ? 40  GLN A CA   4  
ATOM   2505  C  C    . GLN A 1 40 ? 2.588   2.263   -8.760  1.00 0.00 ? 40  GLN A C    4  
ATOM   2506  O  O    . GLN A 1 40 ? 1.585   2.002   -9.424  1.00 0.00 ? 40  GLN A O    4  
ATOM   2507  C  CB   . GLN A 1 40 ? 3.046   1.669   -6.373  1.00 0.00 ? 40  GLN A CB   4  
ATOM   2508  C  CG   . GLN A 1 40 ? 3.005   2.067   -4.907  1.00 0.00 ? 40  GLN A CG   4  
ATOM   2509  C  CD   . GLN A 1 40 ? 4.122   3.020   -4.529  1.00 0.00 ? 40  GLN A CD   4  
ATOM   2510  O  OE1  . GLN A 1 40 ? 4.071   4.210   -4.842  1.00 0.00 ? 40  GLN A OE1  4  
ATOM   2511  N  NE2  . GLN A 1 40 ? 5.140   2.501   -3.853  1.00 0.00 ? 40  GLN A NE2  4  
ATOM   2512  H  H    . GLN A 1 40 ? 0.552   2.316   -6.512  1.00 0.00 ? 40  GLN A H    4  
ATOM   2513  H  HA   . GLN A 1 40 ? 3.026   3.644   -7.194  1.00 0.00 ? 40  GLN A HA   4  
ATOM   2514  H  HB2  . GLN A 1 40 ? 2.484   0.754   -6.492  1.00 0.00 ? 40  GLN A HB2  4  
ATOM   2515  H  HB3  . GLN A 1 40 ? 4.075   1.487   -6.645  1.00 0.00 ? 40  GLN A HB3  4  
ATOM   2516  H  HG2  . GLN A 1 40 ? 2.059   2.548   -4.704  1.00 0.00 ? 40  GLN A HG2  4  
ATOM   2517  H  HG3  . GLN A 1 40 ? 3.091   1.176   -4.303  1.00 0.00 ? 40  GLN A HG3  4  
ATOM   2518  H  HE21 . GLN A 1 40 ? 5.113   1.544   -3.640  1.00 0.00 ? 40  GLN A HE21 4  
ATOM   2519  H  HE22 . GLN A 1 40 ? 5.876   3.094   -3.597  1.00 0.00 ? 40  GLN A HE22 4  
ATOM   2520  N  N    . SER A 1 41 ? 3.823   2.161   -9.242  1.00 0.00 ? 41  SER A N    4  
ATOM   2521  C  CA   . SER A 1 41 ? 4.075   1.731   -10.613 1.00 0.00 ? 41  SER A CA   4  
ATOM   2522  C  C    . SER A 1 41 ? 4.388   0.239   -10.665 1.00 0.00 ? 41  SER A C    4  
ATOM   2523  O  O    . SER A 1 41 ? 4.911   -0.331  -9.707  1.00 0.00 ? 41  SER A O    4  
ATOM   2524  C  CB   . SER A 1 41 ? 5.233   2.529   -11.215 1.00 0.00 ? 41  SER A CB   4  
ATOM   2525  O  OG   . SER A 1 41 ? 5.093   2.649   -12.620 1.00 0.00 ? 41  SER A OG   4  
ATOM   2526  H  H    . SER A 1 41 ? 4.582   2.384   -8.663  1.00 0.00 ? 41  SER A H    4  
ATOM   2527  H  HA   . SER A 1 41 ? 3.181   1.920   -11.189 1.00 0.00 ? 41  SER A HA   4  
ATOM   2528  H  HB2  . SER A 1 41 ? 5.250   3.517   -10.781 1.00 0.00 ? 41  SER A HB2  4  
ATOM   2529  H  HB3  . SER A 1 41 ? 6.164   2.024   -11.000 1.00 0.00 ? 41  SER A HB3  4  
ATOM   2530  H  HG   . SER A 1 41 ? 4.565   1.920   -12.953 1.00 0.00 ? 41  SER A HG   4  
ATOM   2531  N  N    . HIS A 1 42 ? 4.064   -0.388  -11.791 1.00 0.00 ? 42  HIS A N    4  
ATOM   2532  C  CA   . HIS A 1 42 ? 4.311   -1.814  -11.970 1.00 0.00 ? 42  HIS A CA   4  
ATOM   2533  C  C    . HIS A 1 42 ? 5.267   -2.059  -13.134 1.00 0.00 ? 42  HIS A C    4  
ATOM   2534  O  O    . HIS A 1 42 ? 4.866   -2.557  -14.185 1.00 0.00 ? 42  HIS A O    4  
ATOM   2535  C  CB   . HIS A 1 42 ? 2.995   -2.555  -12.212 1.00 0.00 ? 42  HIS A CB   4  
ATOM   2536  C  CG   . HIS A 1 42 ? 2.077   -2.546  -11.029 1.00 0.00 ? 42  HIS A CG   4  
ATOM   2537  N  ND1  . HIS A 1 42 ? 0.713   -2.719  -11.134 1.00 0.00 ? 42  HIS A ND1  4  
ATOM   2538  C  CD2  . HIS A 1 42 ? 2.334   -2.385  -9.710  1.00 0.00 ? 42  HIS A CD2  4  
ATOM   2539  C  CE1  . HIS A 1 42 ? 0.170   -2.663  -9.931  1.00 0.00 ? 42  HIS A CE1  4  
ATOM   2540  N  NE2  . HIS A 1 42 ? 1.132   -2.462  -9.049  1.00 0.00 ? 42  HIS A NE2  4  
ATOM   2541  H  H    . HIS A 1 42 ? 3.650   0.120   -12.519 1.00 0.00 ? 42  HIS A H    4  
ATOM   2542  H  HA   . HIS A 1 42 ? 4.763   -2.189  -11.064 1.00 0.00 ? 42  HIS A HA   4  
ATOM   2543  H  HB2  . HIS A 1 42 ? 2.476   -2.092  -13.038 1.00 0.00 ? 42  HIS A HB2  4  
ATOM   2544  H  HB3  . HIS A 1 42 ? 3.209   -3.585  -12.459 1.00 0.00 ? 42  HIS A HB3  4  
ATOM   2545  H  HD1  . HIS A 1 42 ? 0.216   -2.860  -11.967 1.00 0.00 ? 42  HIS A HD1  4  
ATOM   2546  H  HD2  . HIS A 1 42 ? 3.303   -2.226  -9.260  1.00 0.00 ? 42  HIS A HD2  4  
ATOM   2547  H  HE1  . HIS A 1 42 ? -0.881  -2.766  -9.706  1.00 0.00 ? 42  HIS A HE1  4  
ATOM   2548  N  N    . ASP A 1 43 ? 6.532   -1.704  -12.938 1.00 0.00 ? 43  ASP A N    4  
ATOM   2549  C  CA   . ASP A 1 43 ? 7.546   -1.884  -13.970 1.00 0.00 ? 43  ASP A CA   4  
ATOM   2550  C  C    . ASP A 1 43 ? 8.412   -3.105  -13.674 1.00 0.00 ? 43  ASP A C    4  
ATOM   2551  O  O    . ASP A 1 43 ? 9.110   -3.152  -12.661 1.00 0.00 ? 43  ASP A O    4  
ATOM   2552  C  CB   . ASP A 1 43 ? 8.422   -0.636  -14.079 1.00 0.00 ? 43  ASP A CB   4  
ATOM   2553  C  CG   . ASP A 1 43 ? 9.786   -0.935  -14.669 1.00 0.00 ? 43  ASP A CG   4  
ATOM   2554  O  OD1  . ASP A 1 43 ? 9.849   -1.303  -15.860 1.00 0.00 ? 43  ASP A OD1  4  
ATOM   2555  O  OD2  . ASP A 1 43 ? 10.791  -0.803  -13.938 1.00 0.00 ? 43  ASP A OD2  4  
ATOM   2556  H  H    . ASP A 1 43 ? 6.791   -1.311  -12.077 1.00 0.00 ? 43  ASP A H    4  
ATOM   2557  H  HA   . ASP A 1 43 ? 7.038   -2.039  -14.910 1.00 0.00 ? 43  ASP A HA   4  
ATOM   2558  H  HB2  . ASP A 1 43 ? 7.929   0.089   -14.710 1.00 0.00 ? 43  ASP A HB2  4  
ATOM   2559  H  HB3  . ASP A 1 43 ? 8.560   -0.214  -13.094 1.00 0.00 ? 43  ASP A HB3  4  
ATOM   2560  N  N    . ILE A 1 44 ? 8.361   -4.090  -14.564 1.00 0.00 ? 44  ILE A N    4  
ATOM   2561  C  CA   . ILE A 1 44 ? 9.140   -5.311  -14.397 1.00 0.00 ? 44  ILE A CA   4  
ATOM   2562  C  C    . ILE A 1 44 ? 10.358  -5.314  -15.315 1.00 0.00 ? 44  ILE A C    4  
ATOM   2563  O  O    . ILE A 1 44 ? 10.233  -5.481  -16.528 1.00 0.00 ? 44  ILE A O    4  
ATOM   2564  C  CB   . ILE A 1 44 ? 8.292   -6.564  -14.683 1.00 0.00 ? 44  ILE A CB   4  
ATOM   2565  C  CG1  . ILE A 1 44 ? 7.034   -6.565  -13.812 1.00 0.00 ? 44  ILE A CG1  4  
ATOM   2566  C  CG2  . ILE A 1 44 ? 9.111   -7.824  -14.443 1.00 0.00 ? 44  ILE A CG2  4  
ATOM   2567  C  CD1  . ILE A 1 44 ? 5.860   -5.851  -14.445 1.00 0.00 ? 44  ILE A CD1  4  
ATOM   2568  H  H    . ILE A 1 44 ? 7.786   -3.994  -15.351 1.00 0.00 ? 44  ILE A H    4  
ATOM   2569  H  HA   . ILE A 1 44 ? 9.476   -5.354  -13.371 1.00 0.00 ? 44  ILE A HA   4  
ATOM   2570  H  HB   . ILE A 1 44 ? 8.002   -6.545  -15.723 1.00 0.00 ? 44  ILE A HB   4  
ATOM   2571  H  HG12 . ILE A 1 44 ? 6.738   -7.584  -13.620 1.00 0.00 ? 44  ILE A HG12 4  
ATOM   2572  H  HG13 . ILE A 1 44 ? 7.255   -6.076  -12.874 1.00 0.00 ? 44  ILE A HG13 4  
ATOM   2573  H  HG21 . ILE A 1 44 ? 9.066   -8.454  -15.318 1.00 0.00 ? 44  ILE A HG21 4  
ATOM   2574  H  HG22 . ILE A 1 44 ? 10.138  -7.553  -14.247 1.00 0.00 ? 44  ILE A HG22 4  
ATOM   2575  H  HG23 . ILE A 1 44 ? 8.711   -8.357  -13.594 1.00 0.00 ? 44  ILE A HG23 4  
ATOM   2576  H  HD11 . ILE A 1 44 ? 6.219   -5.018  -15.031 1.00 0.00 ? 44  ILE A HD11 4  
ATOM   2577  H  HD12 . ILE A 1 44 ? 5.323   -6.537  -15.082 1.00 0.00 ? 44  ILE A HD12 4  
ATOM   2578  H  HD13 . ILE A 1 44 ? 5.201   -5.487  -13.670 1.00 0.00 ? 44  ILE A HD13 4  
ATOM   2579  N  N    . SER A 1 45 ? 11.536  -5.131  -14.727 1.00 0.00 ? 45  SER A N    4  
ATOM   2580  C  CA   . SER A 1 45 ? 12.777  -5.112  -15.492 1.00 0.00 ? 45  SER A CA   4  
ATOM   2581  C  C    . SER A 1 45 ? 13.841  -5.977  -14.823 1.00 0.00 ? 45  SER A C    4  
ATOM   2582  O  O    . SER A 1 45 ? 13.575  -6.651  -13.829 1.00 0.00 ? 45  SER A O    4  
ATOM   2583  C  CB   . SER A 1 45 ? 13.288  -3.677  -15.638 1.00 0.00 ? 45  SER A CB   4  
ATOM   2584  O  OG   . SER A 1 45 ? 13.721  -3.161  -14.392 1.00 0.00 ? 45  SER A OG   4  
ATOM   2585  H  H    . SER A 1 45 ? 11.570  -5.004  -13.756 1.00 0.00 ? 45  SER A H    4  
ATOM   2586  H  HA   . SER A 1 45 ? 12.569  -5.512  -16.473 1.00 0.00 ? 45  SER A HA   4  
ATOM   2587  H  HB2  . SER A 1 45 ? 14.118  -3.662  -16.328 1.00 0.00 ? 45  SER A HB2  4  
ATOM   2588  H  HB3  . SER A 1 45 ? 12.493  -3.052  -16.017 1.00 0.00 ? 45  SER A HB3  4  
ATOM   2589  H  HG   . SER A 1 45 ? 14.429  -3.709  -14.046 1.00 0.00 ? 45  SER A HG   4  
ATOM   2590  N  N    . GLY A 1 46 ? 15.049  -5.953  -15.378 1.00 0.00 ? 46  GLY A N    4  
ATOM   2591  C  CA   . GLY A 1 46 ? 16.136  -6.739  -14.823 1.00 0.00 ? 46  GLY A CA   4  
ATOM   2592  C  C    . GLY A 1 46 ? 17.236  -5.875  -14.238 1.00 0.00 ? 46  GLY A C    4  
ATOM   2593  O  O    . GLY A 1 46 ? 17.022  -4.716  -13.882 1.00 0.00 ? 46  GLY A O    4  
ATOM   2594  H  H    . GLY A 1 46 ? 15.204  -5.397  -16.170 1.00 0.00 ? 46  GLY A H    4  
ATOM   2595  H  HA2  . GLY A 1 46 ? 15.744  -7.378  -14.047 1.00 0.00 ? 46  GLY A HA2  4  
ATOM   2596  H  HA3  . GLY A 1 46 ? 16.556  -7.354  -15.606 1.00 0.00 ? 46  GLY A HA3  4  
ATOM   2597  N  N    . PRO A 1 47 ? 18.446  -6.444  -14.131 1.00 0.00 ? 47  PRO A N    4  
ATOM   2598  C  CA   . PRO A 1 47 ? 19.608  -5.736  -13.584 1.00 0.00 ? 47  PRO A CA   4  
ATOM   2599  C  C    . PRO A 1 47 ? 20.101  -4.630  -14.510 1.00 0.00 ? 47  PRO A C    4  
ATOM   2600  O  O    . PRO A 1 47 ? 20.219  -4.826  -15.720 1.00 0.00 ? 47  PRO A O    4  
ATOM   2601  C  CB   . PRO A 1 47 ? 20.664  -6.836  -13.454 1.00 0.00 ? 47  PRO A CB   4  
ATOM   2602  C  CG   . PRO A 1 47 ? 20.276  -7.856  -14.468 1.00 0.00 ? 47  PRO A CG   4  
ATOM   2603  C  CD   . PRO A 1 47 ? 18.774  -7.821  -14.536 1.00 0.00 ? 47  PRO A CD   4  
ATOM   2604  H  HA   . PRO A 1 47 ? 19.396  -5.321  -12.610 1.00 0.00 ? 47  PRO A HA   4  
ATOM   2605  H  HB2  . PRO A 1 47 ? 21.642  -6.425  -13.661 1.00 0.00 ? 47  PRO A HB2  4  
ATOM   2606  H  HB3  . PRO A 1 47 ? 20.643  -7.245  -12.455 1.00 0.00 ? 47  PRO A HB3  4  
ATOM   2607  H  HG2  . PRO A 1 47 ? 20.701  -7.602  -15.427 1.00 0.00 ? 47  PRO A HG2  4  
ATOM   2608  H  HG3  . PRO A 1 47 ? 20.613  -8.833  -14.153 1.00 0.00 ? 47  PRO A HG3  4  
ATOM   2609  H  HD2  . PRO A 1 47 ? 18.437  -8.017  -15.543 1.00 0.00 ? 47  PRO A HD2  4  
ATOM   2610  H  HD3  . PRO A 1 47 ? 18.348  -8.536  -13.848 1.00 0.00 ? 47  PRO A HD3  4  
ATOM   2611  N  N    . SER A 1 48 ? 20.390  -3.467  -13.934 1.00 0.00 ? 48  SER A N    4  
ATOM   2612  C  CA   . SER A 1 48 ? 20.868  -2.328  -14.709 1.00 0.00 ? 48  SER A CA   4  
ATOM   2613  C  C    . SER A 1 48 ? 22.235  -1.869  -14.212 1.00 0.00 ? 48  SER A C    4  
ATOM   2614  O  O    . SER A 1 48 ? 22.394  -1.504  -13.047 1.00 0.00 ? 48  SER A O    4  
ATOM   2615  C  CB   . SER A 1 48 ? 19.868  -1.173  -14.627 1.00 0.00 ? 48  SER A CB   4  
ATOM   2616  O  OG   . SER A 1 48 ? 19.645  -0.786  -13.282 1.00 0.00 ? 48  SER A OG   4  
ATOM   2617  H  H    . SER A 1 48 ? 20.275  -3.373  -12.965 1.00 0.00 ? 48  SER A H    4  
ATOM   2618  H  HA   . SER A 1 48 ? 20.959  -2.642  -15.738 1.00 0.00 ? 48  SER A HA   4  
ATOM   2619  H  HB2  . SER A 1 48 ? 20.256  -0.326  -15.173 1.00 0.00 ? 48  SER A HB2  4  
ATOM   2620  H  HB3  . SER A 1 48 ? 18.929  -1.482  -15.062 1.00 0.00 ? 48  SER A HB3  4  
ATOM   2621  H  HG   . SER A 1 48 ? 18.778  -1.089  -13.002 1.00 0.00 ? 48  SER A HG   4  
ATOM   2622  N  N    . SER A 1 49 ? 23.220  -1.890  -15.105 1.00 0.00 ? 49  SER A N    4  
ATOM   2623  C  CA   . SER A 1 49 ? 24.576  -1.480  -14.757 1.00 0.00 ? 49  SER A CA   4  
ATOM   2624  C  C    . SER A 1 49 ? 24.966  -0.207  -15.502 1.00 0.00 ? 49  SER A C    4  
ATOM   2625  O  O    . SER A 1 49 ? 24.398  0.114   -16.546 1.00 0.00 ? 49  SER A O    4  
ATOM   2626  C  CB   . SER A 1 49 ? 25.568  -2.598  -15.081 1.00 0.00 ? 49  SER A CB   4  
ATOM   2627  O  OG   . SER A 1 49 ? 25.460  -3.001  -16.435 1.00 0.00 ? 49  SER A OG   4  
ATOM   2628  H  H    . SER A 1 49 ? 23.031  -2.191  -16.018 1.00 0.00 ? 49  SER A H    4  
ATOM   2629  H  HA   . SER A 1 49 ? 24.601  -1.284  -13.696 1.00 0.00 ? 49  SER A HA   4  
ATOM   2630  H  HB2  . SER A 1 49 ? 26.573  -2.247  -14.902 1.00 0.00 ? 49  SER A HB2  4  
ATOM   2631  H  HB3  . SER A 1 49 ? 25.366  -3.450  -14.447 1.00 0.00 ? 49  SER A HB3  4  
ATOM   2632  H  HG   . SER A 1 49 ? 26.284  -2.816  -16.891 1.00 0.00 ? 49  SER A HG   4  
ATOM   2633  N  N    . GLY A 1 50 ? 25.940  0.515   -14.958 1.00 0.00 ? 50  GLY A N    4  
ATOM   2634  C  CA   . GLY A 1 50 ? 26.391  1.745   -15.583 1.00 0.00 ? 50  GLY A CA   4  
ATOM   2635  C  C    . GLY A 1 50 ? 27.450  1.504   -16.640 1.00 0.00 ? 50  GLY A C    4  
ATOM   2636  O  O    . GLY A 1 50 ? 28.622  1.367   -16.293 1.00 0.00 ? 50  GLY A O    4  
ATOM   2637  H  H    . GLY A 1 50 ? 26.357  0.210   -14.125 1.00 0.00 ? 50  GLY A H    4  
ATOM   2638  H  HA2  . GLY A 1 50 ? 25.544  2.234   -16.042 1.00 0.00 ? 50  GLY A HA2  4  
ATOM   2639  H  HA3  . GLY A 1 50 ? 26.799  2.394   -14.822 1.00 0.00 ? 50  GLY A HA3  4  
HETATM 2640  ZN ZN   . ZN  B 2 .  ? 0.631   -2.189  -7.079  1.00 0.00 ? 201 ZN  A ZN   4  
ATOM   2641  N  N    . GLY A 1 1  ? 12.723  31.829  -12.310 1.00 0.00 ? 1   GLY A N    5  
ATOM   2642  C  CA   . GLY A 1 1  ? 12.337  32.218  -10.966 1.00 0.00 ? 1   GLY A CA   5  
ATOM   2643  C  C    . GLY A 1 1  ? 11.839  31.045  -10.144 1.00 0.00 ? 1   GLY A C    5  
ATOM   2644  O  O    . GLY A 1 1  ? 10.661  30.981  -9.793  1.00 0.00 ? 1   GLY A O    5  
ATOM   2645  H  H1   . GLY A 1 1  ? 12.278  31.072  -12.746 1.00 0.00 ? 1   GLY A H1   5  
ATOM   2646  H  HA2  . GLY A 1 1  ? 13.191  32.655  -10.471 1.00 0.00 ? 1   GLY A HA2  5  
ATOM   2647  H  HA3  . GLY A 1 1  ? 11.552  32.957  -11.029 1.00 0.00 ? 1   GLY A HA3  5  
ATOM   2648  N  N    . SER A 1 2  ? 12.738  30.115  -9.838  1.00 0.00 ? 2   SER A N    5  
ATOM   2649  C  CA   . SER A 1 2  ? 12.382  28.936  -9.057  1.00 0.00 ? 2   SER A CA   5  
ATOM   2650  C  C    . SER A 1 2  ? 11.634  29.331  -7.788  1.00 0.00 ? 2   SER A C    5  
ATOM   2651  O  O    . SER A 1 2  ? 12.125  30.125  -6.986  1.00 0.00 ? 2   SER A O    5  
ATOM   2652  C  CB   . SER A 1 2  ? 13.637  28.140  -8.696  1.00 0.00 ? 2   SER A CB   5  
ATOM   2653  O  OG   . SER A 1 2  ? 14.285  27.653  -9.859  1.00 0.00 ? 2   SER A OG   5  
ATOM   2654  H  H    . SER A 1 2  ? 13.662  30.223  -10.148 1.00 0.00 ? 2   SER A H    5  
ATOM   2655  H  HA   . SER A 1 2  ? 11.737  28.319  -9.664  1.00 0.00 ? 2   SER A HA   5  
ATOM   2656  H  HB2  . SER A 1 2  ? 14.322  28.777  -8.157  1.00 0.00 ? 2   SER A HB2  5  
ATOM   2657  H  HB3  . SER A 1 2  ? 13.361  27.300  -8.074  1.00 0.00 ? 2   SER A HB3  5  
ATOM   2658  H  HG   . SER A 1 2  ? 15.162  27.339  -9.629  1.00 0.00 ? 2   SER A HG   5  
ATOM   2659  N  N    . SER A 1 3  ? 10.441  28.770  -7.613  1.00 0.00 ? 3   SER A N    5  
ATOM   2660  C  CA   . SER A 1 3  ? 9.622   29.066  -6.443  1.00 0.00 ? 3   SER A CA   5  
ATOM   2661  C  C    . SER A 1 3  ? 9.367   27.804  -5.625  1.00 0.00 ? 3   SER A C    5  
ATOM   2662  O  O    . SER A 1 3  ? 8.696   26.879  -6.082  1.00 0.00 ? 3   SER A O    5  
ATOM   2663  C  CB   . SER A 1 3  ? 8.291   29.688  -6.871  1.00 0.00 ? 3   SER A CB   5  
ATOM   2664  O  OG   . SER A 1 3  ? 8.428   31.080  -7.098  1.00 0.00 ? 3   SER A OG   5  
ATOM   2665  H  H    . SER A 1 3  ? 10.104  28.145  -8.288  1.00 0.00 ? 3   SER A H    5  
ATOM   2666  H  HA   . SER A 1 3  ? 10.160  29.775  -5.832  1.00 0.00 ? 3   SER A HA   5  
ATOM   2667  H  HB2  . SER A 1 3  ? 7.953   29.218  -7.782  1.00 0.00 ? 3   SER A HB2  5  
ATOM   2668  H  HB3  . SER A 1 3  ? 7.558   29.532  -6.092  1.00 0.00 ? 3   SER A HB3  5  
ATOM   2669  H  HG   . SER A 1 3  ? 8.660   31.233  -8.016  1.00 0.00 ? 3   SER A HG   5  
ATOM   2670  N  N    . GLY A 1 4  ? 9.908   27.773  -4.411  1.00 0.00 ? 4   GLY A N    5  
ATOM   2671  C  CA   . GLY A 1 4  ? 9.729   26.621  -3.548  1.00 0.00 ? 4   GLY A CA   5  
ATOM   2672  C  C    . GLY A 1 4  ? 11.025  26.176  -2.898  1.00 0.00 ? 4   GLY A C    5  
ATOM   2673  O  O    . GLY A 1 4  ? 11.377  26.644  -1.816  1.00 0.00 ? 4   GLY A O    5  
ATOM   2674  H  H    . GLY A 1 4  ? 10.434  28.540  -4.099  1.00 0.00 ? 4   GLY A H    5  
ATOM   2675  H  HA2  . GLY A 1 4  ? 9.018   26.871  -2.775  1.00 0.00 ? 4   GLY A HA2  5  
ATOM   2676  H  HA3  . GLY A 1 4  ? 9.336   25.804  -4.135  1.00 0.00 ? 4   GLY A HA3  5  
ATOM   2677  N  N    . SER A 1 5  ? 11.735  25.268  -3.560  1.00 0.00 ? 5   SER A N    5  
ATOM   2678  C  CA   . SER A 1 5  ? 12.997  24.756  -3.038  1.00 0.00 ? 5   SER A CA   5  
ATOM   2679  C  C    . SER A 1 5  ? 13.925  25.900  -2.640  1.00 0.00 ? 5   SER A C    5  
ATOM   2680  O  O    . SER A 1 5  ? 14.062  26.883  -3.367  1.00 0.00 ? 5   SER A O    5  
ATOM   2681  C  CB   . SER A 1 5  ? 13.681  23.867  -4.078  1.00 0.00 ? 5   SER A CB   5  
ATOM   2682  O  OG   . SER A 1 5  ? 14.149  24.633  -5.174  1.00 0.00 ? 5   SER A OG   5  
ATOM   2683  H  H    . SER A 1 5  ? 11.402  24.933  -4.419  1.00 0.00 ? 5   SER A H    5  
ATOM   2684  H  HA   . SER A 1 5  ? 12.777  24.165  -2.161  1.00 0.00 ? 5   SER A HA   5  
ATOM   2685  H  HB2  . SER A 1 5  ? 14.519  23.363  -3.622  1.00 0.00 ? 5   SER A HB2  5  
ATOM   2686  H  HB3  . SER A 1 5  ? 12.974  23.134  -4.442  1.00 0.00 ? 5   SER A HB3  5  
ATOM   2687  H  HG   . SER A 1 5  ? 14.939  25.113  -4.916  1.00 0.00 ? 5   SER A HG   5  
ATOM   2688  N  N    . SER A 1 6  ? 14.560  25.762  -1.481  1.00 0.00 ? 6   SER A N    5  
ATOM   2689  C  CA   . SER A 1 6  ? 15.473  26.785  -0.984  1.00 0.00 ? 6   SER A CA   5  
ATOM   2690  C  C    . SER A 1 6  ? 16.880  26.220  -0.812  1.00 0.00 ? 6   SER A C    5  
ATOM   2691  O  O    . SER A 1 6  ? 17.085  25.239  -0.099  1.00 0.00 ? 6   SER A O    5  
ATOM   2692  C  CB   . SER A 1 6  ? 14.970  27.344  0.349   1.00 0.00 ? 6   SER A CB   5  
ATOM   2693  O  OG   . SER A 1 6  ? 13.661  27.870  0.219   1.00 0.00 ? 6   SER A OG   5  
ATOM   2694  H  H    . SER A 1 6  ? 14.410  24.955  -0.946  1.00 0.00 ? 6   SER A H    5  
ATOM   2695  H  HA   . SER A 1 6  ? 15.504  27.583  -1.710  1.00 0.00 ? 6   SER A HA   5  
ATOM   2696  H  HB2  . SER A 1 6  ? 14.956  26.554  1.085   1.00 0.00 ? 6   SER A HB2  5  
ATOM   2697  H  HB3  . SER A 1 6  ? 15.631  28.132  0.678   1.00 0.00 ? 6   SER A HB3  5  
ATOM   2698  H  HG   . SER A 1 6  ? 13.153  27.666  1.008   1.00 0.00 ? 6   SER A HG   5  
ATOM   2699  N  N    . GLY A 1 7  ? 17.848  26.849  -1.473  1.00 0.00 ? 7   GLY A N    5  
ATOM   2700  C  CA   . GLY A 1 7  ? 19.224  26.396  -1.382  1.00 0.00 ? 7   GLY A CA   5  
ATOM   2701  C  C    . GLY A 1 7  ? 19.341  24.885  -1.420  1.00 0.00 ? 7   GLY A C    5  
ATOM   2702  O  O    . GLY A 1 7  ? 19.829  24.270  -0.472  1.00 0.00 ? 7   GLY A O    5  
ATOM   2703  H  H    . GLY A 1 7  ? 17.626  27.626  -2.027  1.00 0.00 ? 7   GLY A H    5  
ATOM   2704  H  HA2  . GLY A 1 7  ? 19.783  26.812  -2.206  1.00 0.00 ? 7   GLY A HA2  5  
ATOM   2705  H  HA3  . GLY A 1 7  ? 19.648  26.755  -0.455  1.00 0.00 ? 7   GLY A HA3  5  
ATOM   2706  N  N    . CYS A 1 8  ? 18.891  24.287  -2.517  1.00 0.00 ? 8   CYS A N    5  
ATOM   2707  C  CA   . CYS A 1 8  ? 18.945  22.838  -2.675  1.00 0.00 ? 8   CYS A CA   5  
ATOM   2708  C  C    . CYS A 1 8  ? 19.197  22.458  -4.130  1.00 0.00 ? 8   CYS A C    5  
ATOM   2709  O  O    . CYS A 1 8  ? 18.321  22.612  -4.983  1.00 0.00 ? 8   CYS A O    5  
ATOM   2710  C  CB   . CYS A 1 8  ? 17.642  22.202  -2.187  1.00 0.00 ? 8   CYS A CB   5  
ATOM   2711  S  SG   . CYS A 1 8  ? 17.388  22.317  -0.401  1.00 0.00 ? 8   CYS A SG   5  
ATOM   2712  H  H    . CYS A 1 8  ? 18.512  24.832  -3.239  1.00 0.00 ? 8   CYS A H    5  
ATOM   2713  H  HA   . CYS A 1 8  ? 19.762  22.470  -2.073  1.00 0.00 ? 8   CYS A HA   5  
ATOM   2714  H  HB2  . CYS A 1 8  ? 16.809  22.692  -2.669  1.00 0.00 ? 8   CYS A HB2  5  
ATOM   2715  H  HB3  . CYS A 1 8  ? 17.639  21.156  -2.455  1.00 0.00 ? 8   CYS A HB3  5  
ATOM   2716  H  HG   . CYS A 1 8  ? 16.596  21.320  -0.036  1.00 0.00 ? 8   CYS A HG   5  
ATOM   2717  N  N    . CYS A 1 9  ? 20.398  21.963  -4.408  1.00 0.00 ? 9   CYS A N    5  
ATOM   2718  C  CA   . CYS A 1 9  ? 20.766  21.563  -5.761  1.00 0.00 ? 9   CYS A CA   5  
ATOM   2719  C  C    . CYS A 1 9  ? 20.331  20.129  -6.042  1.00 0.00 ? 9   CYS A C    5  
ATOM   2720  O  O    . CYS A 1 9  ? 20.318  19.286  -5.144  1.00 0.00 ? 9   CYS A O    5  
ATOM   2721  C  CB   . CYS A 1 9  ? 22.276  21.700  -5.962  1.00 0.00 ? 9   CYS A CB   5  
ATOM   2722  S  SG   . CYS A 1 9  ? 22.766  22.038  -7.669  1.00 0.00 ? 9   CYS A SG   5  
ATOM   2723  H  H    . CYS A 1 9  ? 21.053  21.864  -3.685  1.00 0.00 ? 9   CYS A H    5  
ATOM   2724  H  HA   . CYS A 1 9  ? 20.259  22.222  -6.450  1.00 0.00 ? 9   CYS A HA   5  
ATOM   2725  H  HB2  . CYS A 1 9  ? 22.642  22.511  -5.350  1.00 0.00 ? 9   CYS A HB2  5  
ATOM   2726  H  HB3  . CYS A 1 9  ? 22.756  20.782  -5.657  1.00 0.00 ? 9   CYS A HB3  5  
ATOM   2727  H  HG   . CYS A 1 9  ? 23.283  20.928  -8.174  1.00 0.00 ? 9   CYS A HG   5  
ATOM   2728  N  N    . LEU A 1 10 ? 19.974  19.859  -7.293  1.00 0.00 ? 10  LEU A N    5  
ATOM   2729  C  CA   . LEU A 1 10 ? 19.536  18.526  -7.692  1.00 0.00 ? 10  LEU A CA   5  
ATOM   2730  C  C    . LEU A 1 10 ? 19.470  18.407  -9.211  1.00 0.00 ? 10  LEU A C    5  
ATOM   2731  O  O    . LEU A 1 10 ? 19.113  19.350  -9.918  1.00 0.00 ? 10  LEU A O    5  
ATOM   2732  C  CB   . LEU A 1 10 ? 18.167  18.214  -7.085  1.00 0.00 ? 10  LEU A CB   5  
ATOM   2733  C  CG   . LEU A 1 10 ? 16.963  18.845  -7.785  1.00 0.00 ? 10  LEU A CG   5  
ATOM   2734  C  CD1  . LEU A 1 10 ? 15.669  18.216  -7.293  1.00 0.00 ? 10  LEU A CD1  5  
ATOM   2735  C  CD2  . LEU A 1 10 ? 16.945  20.351  -7.562  1.00 0.00 ? 10  LEU A CD2  5  
ATOM   2736  H  H    . LEU A 1 10 ? 20.005  20.571  -7.964  1.00 0.00 ? 10  LEU A H    5  
ATOM   2737  H  HA   . LEU A 1 10 ? 20.257  17.814  -7.318  1.00 0.00 ? 10  LEU A HA   5  
ATOM   2738  H  HB2  . LEU A 1 10 ? 18.034  17.143  -7.101  1.00 0.00 ? 10  LEU A HB2  5  
ATOM   2739  H  HB3  . LEU A 1 10 ? 18.174  18.559  -6.061  1.00 0.00 ? 10  LEU A HB3  5  
ATOM   2740  H  HG   . LEU A 1 10 ? 17.037  18.665  -8.849  1.00 0.00 ? 10  LEU A HG   5  
ATOM   2741  H  HD11 . LEU A 1 10 ? 15.827  17.165  -7.108  1.00 0.00 ? 10  LEU A HD11 5  
ATOM   2742  H  HD12 . LEU A 1 10 ? 14.901  18.338  -8.043  1.00 0.00 ? 10  LEU A HD12 5  
ATOM   2743  H  HD13 . LEU A 1 10 ? 15.358  18.701  -6.378  1.00 0.00 ? 10  LEU A HD13 5  
ATOM   2744  H  HD21 . LEU A 1 10 ? 17.400  20.578  -6.609  1.00 0.00 ? 10  LEU A HD21 5  
ATOM   2745  H  HD22 . LEU A 1 10 ? 15.924  20.703  -7.566  1.00 0.00 ? 10  LEU A HD22 5  
ATOM   2746  H  HD23 . LEU A 1 10 ? 17.498  20.838  -8.351  1.00 0.00 ? 10  LEU A HD23 5  
ATOM   2747  N  N    . PRO A 1 11 ? 19.821  17.220  -9.728  1.00 0.00 ? 11  PRO A N    5  
ATOM   2748  C  CA   . PRO A 1 11 ? 19.807  16.948  -11.169 1.00 0.00 ? 11  PRO A CA   5  
ATOM   2749  C  C    . PRO A 1 11 ? 18.392  16.887  -11.734 1.00 0.00 ? 11  PRO A C    5  
ATOM   2750  O  O    . PRO A 1 11 ? 17.407  16.820  -10.999 1.00 0.00 ? 11  PRO A O    5  
ATOM   2751  C  CB   . PRO A 1 11 ? 20.486  15.581  -11.278 1.00 0.00 ? 11  PRO A CB   5  
ATOM   2752  C  CG   . PRO A 1 11 ? 20.256  14.936  -9.955  1.00 0.00 ? 11  PRO A CG   5  
ATOM   2753  C  CD   . PRO A 1 11 ? 20.256  16.051  -8.946  1.00 0.00 ? 11  PRO A CD   5  
ATOM   2754  H  HA   . PRO A 1 11 ? 20.381  17.682  -11.716 1.00 0.00 ? 11  PRO A HA   5  
ATOM   2755  H  HB2  . PRO A 1 11 ? 20.033  15.014  -12.079 1.00 0.00 ? 11  PRO A HB2  5  
ATOM   2756  H  HB3  . PRO A 1 11 ? 21.540  15.713  -11.475 1.00 0.00 ? 11  PRO A HB3  5  
ATOM   2757  H  HG2  . PRO A 1 11 ? 19.303  14.430  -9.954  1.00 0.00 ? 11  PRO A HG2  5  
ATOM   2758  H  HG3  . PRO A 1 11 ? 21.053  14.239  -9.743  1.00 0.00 ? 11  PRO A HG3  5  
ATOM   2759  H  HD2  . PRO A 1 11 ? 19.559  15.839  -8.149  1.00 0.00 ? 11  PRO A HD2  5  
ATOM   2760  H  HD3  . PRO A 1 11 ? 21.250  16.201  -8.550  1.00 0.00 ? 11  PRO A HD3  5  
ATOM   2761  N  N    . PRO A 1 12 ? 18.286  16.910  -13.071 1.00 0.00 ? 12  PRO A N    5  
ATOM   2762  C  CA   . PRO A 1 12 ? 16.996  16.857  -13.764 1.00 0.00 ? 12  PRO A CA   5  
ATOM   2763  C  C    . PRO A 1 12 ? 16.325  15.493  -13.636 1.00 0.00 ? 12  PRO A C    5  
ATOM   2764  O  O    . PRO A 1 12 ? 15.147  15.400  -13.294 1.00 0.00 ? 12  PRO A O    5  
ATOM   2765  C  CB   . PRO A 1 12 ? 17.365  17.137  -15.223 1.00 0.00 ? 12  PRO A CB   5  
ATOM   2766  C  CG   . PRO A 1 12 ? 18.786  16.707  -15.343 1.00 0.00 ? 12  PRO A CG   5  
ATOM   2767  C  CD   . PRO A 1 12 ? 19.419  16.989  -14.009 1.00 0.00 ? 12  PRO A CD   5  
ATOM   2768  H  HA   . PRO A 1 12 ? 16.322  17.623  -13.408 1.00 0.00 ? 12  PRO A HA   5  
ATOM   2769  H  HB2  . PRO A 1 12 ? 16.721  16.564  -15.876 1.00 0.00 ? 12  PRO A HB2  5  
ATOM   2770  H  HB3  . PRO A 1 12 ? 17.253  18.190  -15.430 1.00 0.00 ? 12  PRO A HB3  5  
ATOM   2771  H  HG2  . PRO A 1 12 ? 18.833  15.651  -15.565 1.00 0.00 ? 12  PRO A HG2  5  
ATOM   2772  H  HG3  . PRO A 1 12 ? 19.277  17.276  -16.118 1.00 0.00 ? 12  PRO A HG3  5  
ATOM   2773  H  HD2  . PRO A 1 12 ? 20.163  16.242  -13.778 1.00 0.00 ? 12  PRO A HD2  5  
ATOM   2774  H  HD3  . PRO A 1 12 ? 19.857  17.976  -14.000 1.00 0.00 ? 12  PRO A HD3  5  
ATOM   2775  N  N    . ALA A 1 13 ? 17.084  14.438  -13.913 1.00 0.00 ? 13  ALA A N    5  
ATOM   2776  C  CA   . ALA A 1 13 ? 16.563  13.079  -13.827 1.00 0.00 ? 13  ALA A CA   5  
ATOM   2777  C  C    . ALA A 1 13 ? 17.429  12.216  -12.917 1.00 0.00 ? 13  ALA A C    5  
ATOM   2778  O  O    . ALA A 1 13 ? 18.623  12.039  -13.163 1.00 0.00 ? 13  ALA A O    5  
ATOM   2779  C  CB   . ALA A 1 13 ? 16.471  12.460  -15.214 1.00 0.00 ? 13  ALA A CB   5  
ATOM   2780  H  H    . ALA A 1 13 ? 18.016  14.576  -14.181 1.00 0.00 ? 13  ALA A H    5  
ATOM   2781  H  HA   . ALA A 1 13 ? 15.565  13.130  -13.416 1.00 0.00 ? 13  ALA A HA   5  
ATOM   2782  H  HB1  . ALA A 1 13 ? 17.284  12.825  -15.825 1.00 0.00 ? 13  ALA A HB1  5  
ATOM   2783  H  HB2  . ALA A 1 13 ? 16.535  11.385  -15.133 1.00 0.00 ? 13  ALA A HB2  5  
ATOM   2784  H  HB3  . ALA A 1 13 ? 15.530  12.732  -15.668 1.00 0.00 ? 13  ALA A HB3  5  
ATOM   2785  N  N    . THR A 1 14 ? 16.822  11.680  -11.863 1.00 0.00 ? 14  THR A N    5  
ATOM   2786  C  CA   . THR A 1 14 ? 17.538  10.837  -10.914 1.00 0.00 ? 14  THR A CA   5  
ATOM   2787  C  C    . THR A 1 14 ? 17.697  9.418   -11.450 1.00 0.00 ? 14  THR A C    5  
ATOM   2788  O  O    . THR A 1 14 ? 17.082  8.480   -10.942 1.00 0.00 ? 14  THR A O    5  
ATOM   2789  C  CB   . THR A 1 14 ? 16.816  10.782  -9.554  1.00 0.00 ? 14  THR A CB   5  
ATOM   2790  O  OG1  . THR A 1 14 ? 16.623  12.107  -9.048  1.00 0.00 ? 14  THR A OG1  5  
ATOM   2791  C  CG2  . THR A 1 14 ? 17.613  9.962   -8.551  1.00 0.00 ? 14  THR A CG2  5  
ATOM   2792  H  H    . THR A 1 14 ? 15.868  11.858  -11.720 1.00 0.00 ? 14  THR A H    5  
ATOM   2793  H  HA   . THR A 1 14 ? 18.518  11.265  -10.761 1.00 0.00 ? 14  THR A HA   5  
ATOM   2794  H  HB   . THR A 1 14 ? 15.852  10.314  -9.694  1.00 0.00 ? 14  THR A HB   5  
ATOM   2795  H  HG1  . THR A 1 14 ? 15.685  12.269  -8.923  1.00 0.00 ? 14  THR A HG1  5  
ATOM   2796  H  HG21 . THR A 1 14 ? 17.242  10.152  -7.555  1.00 0.00 ? 14  THR A HG21 5  
ATOM   2797  H  HG22 . THR A 1 14 ? 18.655  10.239  -8.607  1.00 0.00 ? 14  THR A HG22 5  
ATOM   2798  H  HG23 . THR A 1 14 ? 17.507  8.912   -8.780  1.00 0.00 ? 14  THR A HG23 5  
ATOM   2799  N  N    . HIS A 1 15 ? 18.525  9.269   -12.479 1.00 0.00 ? 15  HIS A N    5  
ATOM   2800  C  CA   . HIS A 1 15 ? 18.765  7.963   -13.083 1.00 0.00 ? 15  HIS A CA   5  
ATOM   2801  C  C    . HIS A 1 15 ? 17.469  7.165   -13.187 1.00 0.00 ? 15  HIS A C    5  
ATOM   2802  O  O    . HIS A 1 15 ? 17.483  5.934   -13.176 1.00 0.00 ? 15  HIS A O    5  
ATOM   2803  C  CB   . HIS A 1 15 ? 19.794  7.181   -12.266 1.00 0.00 ? 15  HIS A CB   5  
ATOM   2804  C  CG   . HIS A 1 15 ? 19.297  6.766   -10.916 1.00 0.00 ? 15  HIS A CG   5  
ATOM   2805  N  ND1  . HIS A 1 15 ? 18.830  5.497   -10.643 1.00 0.00 ? 15  HIS A ND1  5  
ATOM   2806  C  CD2  . HIS A 1 15 ? 19.198  7.459   -9.757  1.00 0.00 ? 15  HIS A CD2  5  
ATOM   2807  C  CE1  . HIS A 1 15 ? 18.463  5.429   -9.376  1.00 0.00 ? 15  HIS A CE1  5  
ATOM   2808  N  NE2  . HIS A 1 15 ? 18.676  6.605   -8.816  1.00 0.00 ? 15  HIS A NE2  5  
ATOM   2809  H  H    . HIS A 1 15 ? 18.986  10.054  -12.839 1.00 0.00 ? 15  HIS A H    5  
ATOM   2810  H  HA   . HIS A 1 15 ? 19.154  8.124   -14.077 1.00 0.00 ? 15  HIS A HA   5  
ATOM   2811  H  HB2  . HIS A 1 15 ? 20.070  6.288   -12.807 1.00 0.00 ? 15  HIS A HB2  5  
ATOM   2812  H  HB3  . HIS A 1 15 ? 20.672  7.795   -12.123 1.00 0.00 ? 15  HIS A HB3  5  
ATOM   2813  H  HD1  . HIS A 1 15 ? 18.774  4.758   -11.284 1.00 0.00 ? 15  HIS A HD1  5  
ATOM   2814  H  HD2  . HIS A 1 15 ? 19.476  8.491   -9.601  1.00 0.00 ? 15  HIS A HD2  5  
ATOM   2815  H  HE1  . HIS A 1 15 ? 18.057  4.559   -8.882  1.00 0.00 ? 15  HIS A HE1  5  
ATOM   2816  N  N    . ARG A 1 16 ? 16.349  7.875   -13.286 1.00 0.00 ? 16  ARG A N    5  
ATOM   2817  C  CA   . ARG A 1 16 ? 15.045  7.233   -13.390 1.00 0.00 ? 16  ARG A CA   5  
ATOM   2818  C  C    . ARG A 1 16 ? 14.179  7.927   -14.438 1.00 0.00 ? 16  ARG A C    5  
ATOM   2819  O  O    . ARG A 1 16 ? 14.205  9.148   -14.590 1.00 0.00 ? 16  ARG A O    5  
ATOM   2820  C  CB   . ARG A 1 16 ? 14.335  7.251   -12.035 1.00 0.00 ? 16  ARG A CB   5  
ATOM   2821  C  CG   . ARG A 1 16 ? 14.917  6.270   -11.030 1.00 0.00 ? 16  ARG A CG   5  
ATOM   2822  C  CD   . ARG A 1 16 ? 14.348  6.495   -9.638  1.00 0.00 ? 16  ARG A CD   5  
ATOM   2823  N  NE   . ARG A 1 16 ? 12.917  6.212   -9.579  1.00 0.00 ? 16  ARG A NE   5  
ATOM   2824  C  CZ   . ARG A 1 16 ? 12.135  6.580   -8.570  1.00 0.00 ? 16  ARG A CZ   5  
ATOM   2825  N  NH1  . ARG A 1 16 ? 12.644  7.243   -7.541  1.00 0.00 ? 16  ARG A NH1  5  
ATOM   2826  N  NH2  . ARG A 1 16 ? 10.842  6.285   -8.590  1.00 0.00 ? 16  ARG A NH2  5  
ATOM   2827  H  H    . ARG A 1 16 ? 16.402  8.854   -13.289 1.00 0.00 ? 16  ARG A H    5  
ATOM   2828  H  HA   . ARG A 1 16 ? 15.202  6.208   -13.691 1.00 0.00 ? 16  ARG A HA   5  
ATOM   2829  H  HB2  . ARG A 1 16 ? 14.405  8.244   -11.617 1.00 0.00 ? 16  ARG A HB2  5  
ATOM   2830  H  HB3  . ARG A 1 16 ? 13.295  7.004   -12.184 1.00 0.00 ? 16  ARG A HB3  5  
ATOM   2831  H  HG2  . ARG A 1 16 ? 14.682  5.264   -11.344 1.00 0.00 ? 16  ARG A HG2  5  
ATOM   2832  H  HG3  . ARG A 1 16 ? 15.989  6.398   -10.996 1.00 0.00 ? 16  ARG A HG3  5  
ATOM   2833  H  HD2  . ARG A 1 16 ? 14.862  5.847   -8.944  1.00 0.00 ? 16  ARG A HD2  5  
ATOM   2834  H  HD3  . ARG A 1 16 ? 14.514  7.525   -9.358  1.00 0.00 ? 16  ARG A HD3  5  
ATOM   2835  H  HE   . ARG A 1 16 ? 12.520  5.722   -10.329 1.00 0.00 ? 16  ARG A HE   5  
ATOM   2836  H  HH11 . ARG A 1 16 ? 13.618  7.468   -7.524  1.00 0.00 ? 16  ARG A HH11 5  
ATOM   2837  H  HH12 . ARG A 1 16 ? 12.053  7.520   -6.783  1.00 0.00 ? 16  ARG A HH12 5  
ATOM   2838  H  HH21 . ARG A 1 16 ? 10.454  5.785   -9.364  1.00 0.00 ? 16  ARG A HH21 5  
ATOM   2839  H  HH22 . ARG A 1 16 ? 10.254  6.562   -7.830  1.00 0.00 ? 16  ARG A HH22 5  
ATOM   2840  N  N    . PRO A 1 17 ? 13.394  7.130   -15.179 1.00 0.00 ? 17  PRO A N    5  
ATOM   2841  C  CA   . PRO A 1 17 ? 12.506  7.646   -16.225 1.00 0.00 ? 17  PRO A CA   5  
ATOM   2842  C  C    . PRO A 1 17 ? 11.333  8.434   -15.654 1.00 0.00 ? 17  PRO A C    5  
ATOM   2843  O  O    . PRO A 1 17 ? 11.067  9.561   -16.073 1.00 0.00 ? 17  PRO A O    5  
ATOM   2844  C  CB   . PRO A 1 17 ? 12.009  6.378   -16.924 1.00 0.00 ? 17  PRO A CB   5  
ATOM   2845  C  CG   . PRO A 1 17 ? 12.118  5.309   -15.892 1.00 0.00 ? 17  PRO A CG   5  
ATOM   2846  C  CD   . PRO A 1 17 ? 13.313  5.666   -15.051 1.00 0.00 ? 17  PRO A CD   5  
ATOM   2847  H  HA   . PRO A 1 17 ? 13.042  8.262   -16.932 1.00 0.00 ? 17  PRO A HA   5  
ATOM   2848  H  HB2  . PRO A 1 17 ? 10.985  6.518   -17.242 1.00 0.00 ? 17  PRO A HB2  5  
ATOM   2849  H  HB3  . PRO A 1 17 ? 12.632  6.166   -17.780 1.00 0.00 ? 17  PRO A HB3  5  
ATOM   2850  H  HG2  . PRO A 1 17 ? 11.225  5.290   -15.286 1.00 0.00 ? 17  PRO A HG2  5  
ATOM   2851  H  HG3  . PRO A 1 17 ? 12.269  4.352   -16.370 1.00 0.00 ? 17  PRO A HG3  5  
ATOM   2852  H  HD2  . PRO A 1 17 ? 13.151  5.376   -14.024 1.00 0.00 ? 17  PRO A HD2  5  
ATOM   2853  H  HD3  . PRO A 1 17 ? 14.203  5.195   -15.442 1.00 0.00 ? 17  PRO A HD3  5  
ATOM   2854  N  N    . HIS A 1 18 ? 10.635  7.836   -14.694 1.00 0.00 ? 18  HIS A N    5  
ATOM   2855  C  CA   . HIS A 1 18 ? 9.490   8.484   -14.064 1.00 0.00 ? 18  HIS A CA   5  
ATOM   2856  C  C    . HIS A 1 18 ? 9.699   8.610   -12.557 1.00 0.00 ? 18  HIS A C    5  
ATOM   2857  O  O    . HIS A 1 18 ? 10.321  7.761   -11.919 1.00 0.00 ? 18  HIS A O    5  
ATOM   2858  C  CB   . HIS A 1 18 ? 8.211   7.696   -14.349 1.00 0.00 ? 18  HIS A CB   5  
ATOM   2859  C  CG   . HIS A 1 18 ? 7.921   7.534   -15.809 1.00 0.00 ? 18  HIS A CG   5  
ATOM   2860  N  ND1  . HIS A 1 18 ? 7.001   8.308   -16.484 1.00 0.00 ? 18  HIS A ND1  5  
ATOM   2861  C  CD2  . HIS A 1 18 ? 8.437   6.680   -16.724 1.00 0.00 ? 18  HIS A CD2  5  
ATOM   2862  C  CE1  . HIS A 1 18 ? 6.963   7.936   -17.752 1.00 0.00 ? 18  HIS A CE1  5  
ATOM   2863  N  NE2  . HIS A 1 18 ? 7.825   6.950   -17.923 1.00 0.00 ? 18  HIS A NE2  5  
ATOM   2864  H  H    . HIS A 1 18 ? 10.897  6.938   -14.402 1.00 0.00 ? 18  HIS A H    5  
ATOM   2865  H  HA   . HIS A 1 18 ? 9.395   9.473   -14.485 1.00 0.00 ? 18  HIS A HA   5  
ATOM   2866  H  HB2  . HIS A 1 18 ? 8.299   6.710   -13.917 1.00 0.00 ? 18  HIS A HB2  5  
ATOM   2867  H  HB3  . HIS A 1 18 ? 7.373   8.208   -13.898 1.00 0.00 ? 18  HIS A HB3  5  
ATOM   2868  H  HD1  . HIS A 1 18 ? 6.457   9.022   -16.093 1.00 0.00 ? 18  HIS A HD1  5  
ATOM   2869  H  HD2  . HIS A 1 18 ? 9.190   5.925   -16.546 1.00 0.00 ? 18  HIS A HD2  5  
ATOM   2870  H  HE1  . HIS A 1 18 ? 6.334   8.365   -18.517 1.00 0.00 ? 18  HIS A HE1  5  
ATOM   2871  N  N    . PRO A 1 19 ? 9.168   9.695   -11.975 1.00 0.00 ? 19  PRO A N    5  
ATOM   2872  C  CA   . PRO A 1 19 ? 9.283   9.958   -10.537 1.00 0.00 ? 19  PRO A CA   5  
ATOM   2873  C  C    . PRO A 1 19 ? 8.458   8.985   -9.702  1.00 0.00 ? 19  PRO A C    5  
ATOM   2874  O  O    . PRO A 1 19 ? 8.847   8.616   -8.594  1.00 0.00 ? 19  PRO A O    5  
ATOM   2875  C  CB   . PRO A 1 19 ? 8.739   11.382  -10.393 1.00 0.00 ? 19  PRO A CB   5  
ATOM   2876  C  CG   . PRO A 1 19 ? 7.821   11.556  -11.553 1.00 0.00 ? 19  PRO A CG   5  
ATOM   2877  C  CD   . PRO A 1 19 ? 8.413   10.749  -12.675 1.00 0.00 ? 19  PRO A CD   5  
ATOM   2878  H  HA   . PRO A 1 19 ? 10.312  9.929   -10.210 1.00 0.00 ? 19  PRO A HA   5  
ATOM   2879  H  HB2  . PRO A 1 19 ? 8.212   11.475  -9.454  1.00 0.00 ? 19  PRO A HB2  5  
ATOM   2880  H  HB3  . PRO A 1 19 ? 9.555   12.088  -10.425 1.00 0.00 ? 19  PRO A HB3  5  
ATOM   2881  H  HG2  . PRO A 1 19 ? 6.838   11.187  -11.303 1.00 0.00 ? 19  PRO A HG2  5  
ATOM   2882  H  HG3  . PRO A 1 19 ? 7.772   12.600  -11.828 1.00 0.00 ? 19  PRO A HG3  5  
ATOM   2883  H  HD2  . PRO A 1 19 ? 7.632   10.322  -13.286 1.00 0.00 ? 19  PRO A HD2  5  
ATOM   2884  H  HD3  . PRO A 1 19 ? 9.072   11.360  -13.274 1.00 0.00 ? 19  PRO A HD3  5  
ATOM   2885  N  N    . THR A 1 20 ? 7.314   8.572   -10.240 1.00 0.00 ? 20  THR A N    5  
ATOM   2886  C  CA   . THR A 1 20 ? 6.434   7.642   -9.545  1.00 0.00 ? 20  THR A CA   5  
ATOM   2887  C  C    . THR A 1 20 ? 7.233   6.560   -8.828  1.00 0.00 ? 20  THR A C    5  
ATOM   2888  O  O    . THR A 1 20 ? 8.398   6.321   -9.146  1.00 0.00 ? 20  THR A O    5  
ATOM   2889  C  CB   . THR A 1 20 ? 5.442   6.974   -10.515 1.00 0.00 ? 20  THR A CB   5  
ATOM   2890  O  OG1  . THR A 1 20 ? 6.151   6.388   -11.613 1.00 0.00 ? 20  THR A OG1  5  
ATOM   2891  C  CG2  . THR A 1 20 ? 4.433   7.984   -11.039 1.00 0.00 ? 20  THR A CG2  5  
ATOM   2892  H  H    . THR A 1 20 ? 7.058   8.902   -11.127 1.00 0.00 ? 20  THR A H    5  
ATOM   2893  H  HA   . THR A 1 20 ? 5.868   8.202   -8.814  1.00 0.00 ? 20  THR A HA   5  
ATOM   2894  H  HB   . THR A 1 20 ? 4.910   6.197   -9.985  1.00 0.00 ? 20  THR A HB   5  
ATOM   2895  H  HG1  . THR A 1 20 ? 6.605   7.076   -12.105 1.00 0.00 ? 20  THR A HG1  5  
ATOM   2896  H  HG21 . THR A 1 20 ? 3.522   7.914   -10.463 1.00 0.00 ? 20  THR A HG21 5  
ATOM   2897  H  HG22 . THR A 1 20 ? 4.221   7.777   -12.077 1.00 0.00 ? 20  THR A HG22 5  
ATOM   2898  H  HG23 . THR A 1 20 ? 4.840   8.980   -10.947 1.00 0.00 ? 20  THR A HG23 5  
ATOM   2899  N  N    . SER A 1 21 ? 6.600   5.907   -7.858  1.00 0.00 ? 21  SER A N    5  
ATOM   2900  C  CA   . SER A 1 21 ? 7.254   4.852   -7.094  1.00 0.00 ? 21  SER A CA   5  
ATOM   2901  C  C    . SER A 1 21 ? 6.751   3.477   -7.526  1.00 0.00 ? 21  SER A C    5  
ATOM   2902  O  O    . SER A 1 21 ? 5.547   3.260   -7.663  1.00 0.00 ? 21  SER A O    5  
ATOM   2903  C  CB   . SER A 1 21 ? 7.008   5.050   -5.597  1.00 0.00 ? 21  SER A CB   5  
ATOM   2904  O  OG   . SER A 1 21 ? 7.633   4.029   -4.838  1.00 0.00 ? 21  SER A OG   5  
ATOM   2905  H  H    . SER A 1 21 ? 5.671   6.143   -7.651  1.00 0.00 ? 21  SER A H    5  
ATOM   2906  H  HA   . SER A 1 21 ? 8.314   4.911   -7.287  1.00 0.00 ? 21  SER A HA   5  
ATOM   2907  H  HB2  . SER A 1 21 ? 7.408   6.005   -5.292  1.00 0.00 ? 21  SER A HB2  5  
ATOM   2908  H  HB3  . SER A 1 21 ? 5.945   5.027   -5.403  1.00 0.00 ? 21  SER A HB3  5  
ATOM   2909  H  HG   . SER A 1 21 ? 8.423   4.379   -4.420  1.00 0.00 ? 21  SER A HG   5  
ATOM   2910  N  N    . ILE A 1 22 ? 7.683   2.554   -7.737  1.00 0.00 ? 22  ILE A N    5  
ATOM   2911  C  CA   . ILE A 1 22 ? 7.335   1.200   -8.152  1.00 0.00 ? 22  ILE A CA   5  
ATOM   2912  C  C    . ILE A 1 22 ? 6.687   0.425   -7.011  1.00 0.00 ? 22  ILE A C    5  
ATOM   2913  O  O    . ILE A 1 22 ? 7.082   0.558   -5.852  1.00 0.00 ? 22  ILE A O    5  
ATOM   2914  C  CB   . ILE A 1 22 ? 8.573   0.427   -8.645  1.00 0.00 ? 22  ILE A CB   5  
ATOM   2915  C  CG1  . ILE A 1 22 ? 9.010   0.944   -10.018 1.00 0.00 ? 22  ILE A CG1  5  
ATOM   2916  C  CG2  . ILE A 1 22 ? 8.277   -1.064  -8.705  1.00 0.00 ? 22  ILE A CG2  5  
ATOM   2917  C  CD1  . ILE A 1 22 ? 9.708   2.285   -9.964  1.00 0.00 ? 22  ILE A CD1  5  
ATOM   2918  H  H    . ILE A 1 22 ? 8.625   2.788   -7.611  1.00 0.00 ? 22  ILE A H    5  
ATOM   2919  H  HA   . ILE A 1 22 ? 6.632   1.273   -8.969  1.00 0.00 ? 22  ILE A HA   5  
ATOM   2920  H  HB   . ILE A 1 22 ? 9.372   0.583   -7.938  1.00 0.00 ? 22  ILE A HB   5  
ATOM   2921  H  HG12 . ILE A 1 22 ? 9.690   0.234   -10.462 1.00 0.00 ? 22  ILE A HG12 5  
ATOM   2922  H  HG13 . ILE A 1 22 ? 8.140   1.047   -10.649 1.00 0.00 ? 22  ILE A HG13 5  
ATOM   2923  H  HG21 . ILE A 1 22 ? 9.010   -1.552  -9.329  1.00 0.00 ? 22  ILE A HG21 5  
ATOM   2924  H  HG22 . ILE A 1 22 ? 8.320   -1.479  -7.709  1.00 0.00 ? 22  ILE A HG22 5  
ATOM   2925  H  HG23 . ILE A 1 22 ? 7.292   -1.220  -9.117  1.00 0.00 ? 22  ILE A HG23 5  
ATOM   2926  H  HD11 . ILE A 1 22 ? 10.044  2.476   -8.955  1.00 0.00 ? 22  ILE A HD11 5  
ATOM   2927  H  HD12 . ILE A 1 22 ? 10.556  2.277   -10.632 1.00 0.00 ? 22  ILE A HD12 5  
ATOM   2928  H  HD13 . ILE A 1 22 ? 9.020   3.061   -10.266 1.00 0.00 ? 22  ILE A HD13 5  
ATOM   2929  N  N    . CYS A 1 23 ? 5.690   -0.388  -7.346  1.00 0.00 ? 23  CYS A N    5  
ATOM   2930  C  CA   . CYS A 1 23 ? 4.986   -1.187  -6.350  1.00 0.00 ? 23  CYS A CA   5  
ATOM   2931  C  C    . CYS A 1 23 ? 5.923   -2.208  -5.712  1.00 0.00 ? 23  CYS A C    5  
ATOM   2932  O  O    . CYS A 1 23 ? 7.083   -2.333  -6.105  1.00 0.00 ? 23  CYS A O    5  
ATOM   2933  C  CB   . CYS A 1 23 ? 3.794   -1.902  -6.989  1.00 0.00 ? 23  CYS A CB   5  
ATOM   2934  S  SG   . CYS A 1 23 ? 2.436   -2.264  -5.830  1.00 0.00 ? 23  CYS A SG   5  
ATOM   2935  H  H    . CYS A 1 23 ? 5.420   -0.451  -8.287  1.00 0.00 ? 23  CYS A H    5  
ATOM   2936  H  HA   . CYS A 1 23 ? 4.625   -0.519  -5.583  1.00 0.00 ? 23  CYS A HA   5  
ATOM   2937  H  HB2  . CYS A 1 23 ? 3.394   -1.282  -7.779  1.00 0.00 ? 23  CYS A HB2  5  
ATOM   2938  H  HB3  . CYS A 1 23 ? 4.128   -2.839  -7.408  1.00 0.00 ? 23  CYS A HB3  5  
ATOM   2939  N  N    . ASP A 1 24 ? 5.411   -2.937  -4.726  1.00 0.00 ? 24  ASP A N    5  
ATOM   2940  C  CA   . ASP A 1 24 ? 6.201   -3.948  -4.033  1.00 0.00 ? 24  ASP A CA   5  
ATOM   2941  C  C    . ASP A 1 24 ? 5.775   -5.352  -4.453  1.00 0.00 ? 24  ASP A C    5  
ATOM   2942  O  O    . ASP A 1 24 ? 6.569   -6.290  -4.413  1.00 0.00 ? 24  ASP A O    5  
ATOM   2943  C  CB   . ASP A 1 24 ? 6.057   -3.790  -2.519  1.00 0.00 ? 24  ASP A CB   5  
ATOM   2944  C  CG   . ASP A 1 24 ? 6.725   -4.915  -1.753  1.00 0.00 ? 24  ASP A CG   5  
ATOM   2945  O  OD1  . ASP A 1 24 ? 7.972   -4.930  -1.688  1.00 0.00 ? 24  ASP A OD1  5  
ATOM   2946  O  OD2  . ASP A 1 24 ? 6.000   -5.781  -1.219  1.00 0.00 ? 24  ASP A OD2  5  
ATOM   2947  H  H    . ASP A 1 24 ? 4.480   -2.791  -4.457  1.00 0.00 ? 24  ASP A H    5  
ATOM   2948  H  HA   . ASP A 1 24 ? 7.236   -3.804  -4.304  1.00 0.00 ? 24  ASP A HA   5  
ATOM   2949  H  HB2  . ASP A 1 24 ? 6.509   -2.856  -2.216  1.00 0.00 ? 24  ASP A HB2  5  
ATOM   2950  H  HB3  . ASP A 1 24 ? 5.008   -3.777  -2.263  1.00 0.00 ? 24  ASP A HB3  5  
ATOM   2951  N  N    . ASN A 1 25 ? 4.515   -5.487  -4.855  1.00 0.00 ? 25  ASN A N    5  
ATOM   2952  C  CA   . ASN A 1 25 ? 3.983   -6.776  -5.281  1.00 0.00 ? 25  ASN A CA   5  
ATOM   2953  C  C    . ASN A 1 25 ? 4.263   -7.018  -6.761  1.00 0.00 ? 25  ASN A C    5  
ATOM   2954  O  O    . ASN A 1 25 ? 5.034   -7.909  -7.120  1.00 0.00 ? 25  ASN A O    5  
ATOM   2955  C  CB   . ASN A 1 25 ? 2.477   -6.841  -5.018  1.00 0.00 ? 25  ASN A CB   5  
ATOM   2956  C  CG   . ASN A 1 25 ? 2.155   -7.282  -3.603  1.00 0.00 ? 25  ASN A CG   5  
ATOM   2957  O  OD1  . ASN A 1 25 ? 2.981   -7.153  -2.699  1.00 0.00 ? 25  ASN A OD1  5  
ATOM   2958  N  ND2  . ASN A 1 25 ? 0.951   -7.805  -3.406  1.00 0.00 ? 25  ASN A ND2  5  
ATOM   2959  H  H    . ASN A 1 25 ? 3.930   -4.701  -4.865  1.00 0.00 ? 25  ASN A H    5  
ATOM   2960  H  HA   . ASN A 1 25 ? 4.474   -7.544  -4.703  1.00 0.00 ? 25  ASN A HA   5  
ATOM   2961  H  HB2  . ASN A 1 25 ? 2.047   -5.862  -5.176  1.00 0.00 ? 25  ASN A HB2  5  
ATOM   2962  H  HB3  . ASN A 1 25 ? 2.027   -7.542  -5.705  1.00 0.00 ? 25  ASN A HB3  5  
ATOM   2963  H  HD21 . ASN A 1 25 ? 0.346   -7.877  -4.173  1.00 0.00 ? 25  ASN A HD21 5  
ATOM   2964  H  HD22 . ASN A 1 25 ? 0.717   -8.097  -2.501  1.00 0.00 ? 25  ASN A HD22 5  
ATOM   2965  N  N    . PHE A 1 26 ? 3.633   -6.219  -7.615  1.00 0.00 ? 26  PHE A N    5  
ATOM   2966  C  CA   . PHE A 1 26 ? 3.814   -6.346  -9.057  1.00 0.00 ? 26  PHE A CA   5  
ATOM   2967  C  C    . PHE A 1 26 ? 5.289   -6.238  -9.431  1.00 0.00 ? 26  PHE A C    5  
ATOM   2968  O  O    . PHE A 1 26 ? 5.723   -6.777  -10.449 1.00 0.00 ? 26  PHE A O    5  
ATOM   2969  C  CB   . PHE A 1 26 ? 3.010   -5.271  -9.790  1.00 0.00 ? 26  PHE A CB   5  
ATOM   2970  C  CG   . PHE A 1 26 ? 2.532   -5.701  -11.147 1.00 0.00 ? 26  PHE A CG   5  
ATOM   2971  C  CD1  . PHE A 1 26 ? 3.408   -5.759  -12.219 1.00 0.00 ? 26  PHE A CD1  5  
ATOM   2972  C  CD2  . PHE A 1 26 ? 1.206   -6.048  -11.352 1.00 0.00 ? 26  PHE A CD2  5  
ATOM   2973  C  CE1  . PHE A 1 26 ? 2.971   -6.154  -13.469 1.00 0.00 ? 26  PHE A CE1  5  
ATOM   2974  C  CE2  . PHE A 1 26 ? 0.763   -6.444  -12.600 1.00 0.00 ? 26  PHE A CE2  5  
ATOM   2975  C  CZ   . PHE A 1 26 ? 1.647   -6.498  -13.659 1.00 0.00 ? 26  PHE A CZ   5  
ATOM   2976  H  H    . PHE A 1 26 ? 3.031   -5.527  -7.268  1.00 0.00 ? 26  PHE A H    5  
ATOM   2977  H  HA   . PHE A 1 26 ? 3.451   -7.319  -9.351  1.00 0.00 ? 26  PHE A HA   5  
ATOM   2978  H  HB2  . PHE A 1 26 ? 2.143   -5.014  -9.200  1.00 0.00 ? 26  PHE A HB2  5  
ATOM   2979  H  HB3  . PHE A 1 26 ? 3.627   -4.394  -9.916  1.00 0.00 ? 26  PHE A HB3  5  
ATOM   2980  H  HD1  . PHE A 1 26 ? 4.445   -5.492  -12.071 1.00 0.00 ? 26  PHE A HD1  5  
ATOM   2981  H  HD2  . PHE A 1 26 ? 0.513   -6.006  -10.523 1.00 0.00 ? 26  PHE A HD2  5  
ATOM   2982  H  HE1  . PHE A 1 26 ? 3.664   -6.196  -14.296 1.00 0.00 ? 26  PHE A HE1  5  
ATOM   2983  H  HE2  . PHE A 1 26 ? -0.273  -6.712  -12.745 1.00 0.00 ? 26  PHE A HE2  5  
ATOM   2984  H  HZ   . PHE A 1 26 ? 1.303   -6.806  -14.635 1.00 0.00 ? 26  PHE A HZ   5  
ATOM   2985  N  N    . SER A 1 27 ? 6.054   -5.537  -8.601  1.00 0.00 ? 27  SER A N    5  
ATOM   2986  C  CA   . SER A 1 27 ? 7.480   -5.353  -8.847  1.00 0.00 ? 27  SER A CA   5  
ATOM   2987  C  C    . SER A 1 27 ? 8.164   -6.693  -9.101  1.00 0.00 ? 27  SER A C    5  
ATOM   2988  O  O    . SER A 1 27 ? 8.673   -6.944  -10.193 1.00 0.00 ? 27  SER A O    5  
ATOM   2989  C  CB   . SER A 1 27 ? 8.137   -4.650  -7.657  1.00 0.00 ? 27  SER A CB   5  
ATOM   2990  O  OG   . SER A 1 27 ? 9.543   -4.827  -7.674  1.00 0.00 ? 27  SER A OG   5  
ATOM   2991  H  H    . SER A 1 27 ? 5.649   -5.131  -7.806  1.00 0.00 ? 27  SER A H    5  
ATOM   2992  H  HA   . SER A 1 27 ? 7.588   -4.734  -9.725  1.00 0.00 ? 27  SER A HA   5  
ATOM   2993  H  HB2  . SER A 1 27 ? 7.919   -3.594  -7.702  1.00 0.00 ? 27  SER A HB2  5  
ATOM   2994  H  HB3  . SER A 1 27 ? 7.745   -5.060  -6.738  1.00 0.00 ? 27  SER A HB3  5  
ATOM   2995  H  HG   . SER A 1 27 ? 9.963   -4.028  -8.000  1.00 0.00 ? 27  SER A HG   5  
ATOM   2996  N  N    . ALA A 1 28 ? 8.172   -7.549  -8.085  1.00 0.00 ? 28  ALA A N    5  
ATOM   2997  C  CA   . ALA A 1 28 ? 8.792   -8.863  -8.198  1.00 0.00 ? 28  ALA A CA   5  
ATOM   2998  C  C    . ALA A 1 28 ? 7.754   -9.933  -8.518  1.00 0.00 ? 28  ALA A C    5  
ATOM   2999  O  O    . ALA A 1 28 ? 7.833   -10.600 -9.550  1.00 0.00 ? 28  ALA A O    5  
ATOM   3000  C  CB   . ALA A 1 28 ? 9.533   -9.210  -6.915  1.00 0.00 ? 28  ALA A CB   5  
ATOM   3001  H  H    . ALA A 1 28 ? 7.751   -7.290  -7.239  1.00 0.00 ? 28  ALA A H    5  
ATOM   3002  H  HA   . ALA A 1 28 ? 9.513   -8.824  -9.002  1.00 0.00 ? 28  ALA A HA   5  
ATOM   3003  H  HB1  . ALA A 1 28 ? 9.298   -10.225 -6.628  1.00 0.00 ? 28  ALA A HB1  5  
ATOM   3004  H  HB2  . ALA A 1 28 ? 10.596  -9.118  -7.077  1.00 0.00 ? 28  ALA A HB2  5  
ATOM   3005  H  HB3  . ALA A 1 28 ? 9.228   -8.534  -6.130  1.00 0.00 ? 28  ALA A HB3  5  
ATOM   3006  N  N    . TYR A 1 29 ? 6.782   -10.093 -7.626  1.00 0.00 ? 29  TYR A N    5  
ATOM   3007  C  CA   . TYR A 1 29 ? 5.730   -11.085 -7.812  1.00 0.00 ? 29  TYR A CA   5  
ATOM   3008  C  C    . TYR A 1 29 ? 5.146   -11.003 -9.219  1.00 0.00 ? 29  TYR A C    5  
ATOM   3009  O  O    . TYR A 1 29 ? 5.078   -12.002 -9.934  1.00 0.00 ? 29  TYR A O    5  
ATOM   3010  C  CB   . TYR A 1 29 ? 4.622   -10.885 -6.776  1.00 0.00 ? 29  TYR A CB   5  
ATOM   3011  C  CG   . TYR A 1 29 ? 5.113   -10.937 -5.347  1.00 0.00 ? 29  TYR A CG   5  
ATOM   3012  C  CD1  . TYR A 1 29 ? 5.694   -9.824  -4.750  1.00 0.00 ? 29  TYR A CD1  5  
ATOM   3013  C  CD2  . TYR A 1 29 ? 4.996   -12.098 -4.593  1.00 0.00 ? 29  TYR A CD2  5  
ATOM   3014  C  CE1  . TYR A 1 29 ? 6.144   -9.868  -3.445  1.00 0.00 ? 29  TYR A CE1  5  
ATOM   3015  C  CE2  . TYR A 1 29 ? 5.443   -12.150 -3.287  1.00 0.00 ? 29  TYR A CE2  5  
ATOM   3016  C  CZ   . TYR A 1 29 ? 6.016   -11.033 -2.717  1.00 0.00 ? 29  TYR A CZ   5  
ATOM   3017  O  OH   . TYR A 1 29 ? 6.463   -11.079 -1.416  1.00 0.00 ? 29  TYR A OH   5  
ATOM   3018  H  H    . TYR A 1 29 ? 6.773   -9.532  -6.823  1.00 0.00 ? 29  TYR A H    5  
ATOM   3019  H  HA   . TYR A 1 29 ? 6.167   -12.063 -7.672  1.00 0.00 ? 29  TYR A HA   5  
ATOM   3020  H  HB2  . TYR A 1 29 ? 4.162   -9.922  -6.933  1.00 0.00 ? 29  TYR A HB2  5  
ATOM   3021  H  HB3  . TYR A 1 29 ? 3.879   -11.658 -6.900  1.00 0.00 ? 29  TYR A HB3  5  
ATOM   3022  H  HD1  . TYR A 1 29 ? 5.792   -8.913  -5.322  1.00 0.00 ? 29  TYR A HD1  5  
ATOM   3023  H  HD2  . TYR A 1 29 ? 4.546   -12.972 -5.042  1.00 0.00 ? 29  TYR A HD2  5  
ATOM   3024  H  HE1  . TYR A 1 29 ? 6.593   -8.993  -2.998  1.00 0.00 ? 29  TYR A HE1  5  
ATOM   3025  H  HE2  . TYR A 1 29 ? 5.343   -13.062 -2.717  1.00 0.00 ? 29  TYR A HE2  5  
ATOM   3026  H  HH   . TYR A 1 29 ? 6.807   -11.955 -1.228  1.00 0.00 ? 29  TYR A HH   5  
ATOM   3027  N  N    . GLY A 1 30 ? 4.727   -9.804  -9.610  1.00 0.00 ? 30  GLY A N    5  
ATOM   3028  C  CA   . GLY A 1 30 ? 4.155   -9.612  -10.930 1.00 0.00 ? 30  GLY A CA   5  
ATOM   3029  C  C    . GLY A 1 30 ? 2.688   -9.235  -10.876 1.00 0.00 ? 30  GLY A C    5  
ATOM   3030  O  O    . GLY A 1 30 ? 2.174   -8.585  -11.787 1.00 0.00 ? 30  GLY A O    5  
ATOM   3031  H  H    . GLY A 1 30 ? 4.806   -9.043  -8.997  1.00 0.00 ? 30  GLY A H    5  
ATOM   3032  H  HA2  . GLY A 1 30 ? 4.699   -8.828  -11.435 1.00 0.00 ? 30  GLY A HA2  5  
ATOM   3033  H  HA3  . GLY A 1 30 ? 4.259   -10.528 -11.491 1.00 0.00 ? 30  GLY A HA3  5  
ATOM   3034  N  N    . TRP A 1 31 ? 2.012   -9.645  -9.809  1.00 0.00 ? 31  TRP A N    5  
ATOM   3035  C  CA   . TRP A 1 31 ? 0.594   -9.348  -9.642  1.00 0.00 ? 31  TRP A CA   5  
ATOM   3036  C  C    . TRP A 1 31 ? 0.379   -8.328  -8.529  1.00 0.00 ? 31  TRP A C    5  
ATOM   3037  O  O    . TRP A 1 31 ? 1.233   -8.153  -7.661  1.00 0.00 ? 31  TRP A O    5  
ATOM   3038  C  CB   . TRP A 1 31 ? -0.184  -10.629 -9.335  1.00 0.00 ? 31  TRP A CB   5  
ATOM   3039  C  CG   . TRP A 1 31 ? -0.306  -10.912 -7.868  1.00 0.00 ? 31  TRP A CG   5  
ATOM   3040  C  CD1  . TRP A 1 31 ? 0.615   -11.534 -7.075  1.00 0.00 ? 31  TRP A CD1  5  
ATOM   3041  C  CD2  . TRP A 1 31 ? -1.413  -10.586 -7.021  1.00 0.00 ? 31  TRP A CD2  5  
ATOM   3042  N  NE1  . TRP A 1 31 ? 0.147   -11.614 -5.785  1.00 0.00 ? 31  TRP A NE1  5  
ATOM   3043  C  CE2  . TRP A 1 31 ? -1.095  -11.039 -5.726  1.00 0.00 ? 31  TRP A CE2  5  
ATOM   3044  C  CE3  . TRP A 1 31 ? -2.642  -9.954  -7.231  1.00 0.00 ? 31  TRP A CE3  5  
ATOM   3045  C  CZ2  . TRP A 1 31 ? -1.961  -10.880 -4.648  1.00 0.00 ? 31  TRP A CZ2  5  
ATOM   3046  C  CZ3  . TRP A 1 31 ? -3.501  -9.797  -6.160  1.00 0.00 ? 31  TRP A CZ3  5  
ATOM   3047  C  CH2  . TRP A 1 31 ? -3.158  -10.257 -4.882  1.00 0.00 ? 31  TRP A CH2  5  
ATOM   3048  H  H    . TRP A 1 31 ? 2.477   -10.160 -9.117  1.00 0.00 ? 31  TRP A H    5  
ATOM   3049  H  HA   . TRP A 1 31 ? 0.231   -8.932  -10.571 1.00 0.00 ? 31  TRP A HA   5  
ATOM   3050  H  HB2  . TRP A 1 31 ? -1.181  -10.544 -9.742  1.00 0.00 ? 31  TRP A HB2  5  
ATOM   3051  H  HB3  . TRP A 1 31 ? 0.319   -11.466 -9.797  1.00 0.00 ? 31  TRP A HB3  5  
ATOM   3052  H  HD1  . TRP A 1 31 ? 1.567   -11.904 -7.423  1.00 0.00 ? 31  TRP A HD1  5  
ATOM   3053  H  HE1  . TRP A 1 31 ? 0.626   -12.016 -5.030  1.00 0.00 ? 31  TRP A HE1  5  
ATOM   3054  H  HE3  . TRP A 1 31 ? -2.925  -9.592  -8.208  1.00 0.00 ? 31  TRP A HE3  5  
ATOM   3055  H  HZ2  . TRP A 1 31 ? -1.711  -11.228 -3.657  1.00 0.00 ? 31  TRP A HZ2  5  
ATOM   3056  H  HZ3  . TRP A 1 31 ? -4.455  -9.311  -6.302  1.00 0.00 ? 31  TRP A HZ3  5  
ATOM   3057  H  HH2  . TRP A 1 31 ? -3.859  -10.114 -4.075  1.00 0.00 ? 31  TRP A HH2  5  
ATOM   3058  N  N    . CYS A 1 32 ? -0.768  -7.658  -8.560  1.00 0.00 ? 32  CYS A N    5  
ATOM   3059  C  CA   . CYS A 1 32 ? -1.096  -6.655  -7.554  1.00 0.00 ? 32  CYS A CA   5  
ATOM   3060  C  C    . CYS A 1 32 ? -2.595  -6.640  -7.269  1.00 0.00 ? 32  CYS A C    5  
ATOM   3061  O  O    . CYS A 1 32 ? -3.425  -6.672  -8.178  1.00 0.00 ? 32  CYS A O    5  
ATOM   3062  C  CB   . CYS A 1 32 ? -0.640  -5.270  -8.017  1.00 0.00 ? 32  CYS A CB   5  
ATOM   3063  S  SG   . CYS A 1 32 ? -0.892  -3.953  -6.784  1.00 0.00 ? 32  CYS A SG   5  
ATOM   3064  H  H    . CYS A 1 32 ? -1.411  -7.842  -9.279  1.00 0.00 ? 32  CYS A H    5  
ATOM   3065  H  HA   . CYS A 1 32 ? -0.572  -6.912  -6.646  1.00 0.00 ? 32  CYS A HA   5  
ATOM   3066  H  HB2  . CYS A 1 32 ? 0.415   -5.305  -8.247  1.00 0.00 ? 32  CYS A HB2  5  
ATOM   3067  H  HB3  . CYS A 1 32 ? -1.188  -4.997  -8.907  1.00 0.00 ? 32  CYS A HB3  5  
ATOM   3068  N  N    . PRO A 1 33 ? -2.951  -6.589  -5.977  1.00 0.00 ? 33  PRO A N    5  
ATOM   3069  C  CA   . PRO A 1 33 ? -4.351  -6.567  -5.542  1.00 0.00 ? 33  PRO A CA   5  
ATOM   3070  C  C    . PRO A 1 33 ? -5.045  -5.254  -5.886  1.00 0.00 ? 33  PRO A C    5  
ATOM   3071  O  O    . PRO A 1 33 ? -6.252  -5.107  -5.689  1.00 0.00 ? 33  PRO A O    5  
ATOM   3072  C  CB   . PRO A 1 33 ? -4.253  -6.738  -4.024  1.00 0.00 ? 33  PRO A CB   5  
ATOM   3073  C  CG   . PRO A 1 33 ? -2.901  -6.222  -3.671  1.00 0.00 ? 33  PRO A CG   5  
ATOM   3074  C  CD   . PRO A 1 33 ? -2.015  -6.548  -4.841  1.00 0.00 ? 33  PRO A CD   5  
ATOM   3075  H  HA   . PRO A 1 33 ? -4.910  -7.390  -5.964  1.00 0.00 ? 33  PRO A HA   5  
ATOM   3076  H  HB2  . PRO A 1 33 ? -5.033  -6.165  -3.544  1.00 0.00 ? 33  PRO A HB2  5  
ATOM   3077  H  HB3  . PRO A 1 33 ? -4.356  -7.782  -3.769  1.00 0.00 ? 33  PRO A HB3  5  
ATOM   3078  H  HG2  . PRO A 1 33 ? -2.944  -5.155  -3.518  1.00 0.00 ? 33  PRO A HG2  5  
ATOM   3079  H  HG3  . PRO A 1 33 ? -2.541  -6.716  -2.780  1.00 0.00 ? 33  PRO A HG3  5  
ATOM   3080  H  HD2  . PRO A 1 33 ? -1.274  -5.774  -4.980  1.00 0.00 ? 33  PRO A HD2  5  
ATOM   3081  H  HD3  . PRO A 1 33 ? -1.539  -7.507  -4.700  1.00 0.00 ? 33  PRO A HD3  5  
ATOM   3082  N  N    . LEU A 1 34 ? -4.276  -4.301  -6.402  1.00 0.00 ? 34  LEU A N    5  
ATOM   3083  C  CA   . LEU A 1 34 ? -4.817  -2.999  -6.775  1.00 0.00 ? 34  LEU A CA   5  
ATOM   3084  C  C    . LEU A 1 34 ? -4.935  -2.872  -8.290  1.00 0.00 ? 34  LEU A C    5  
ATOM   3085  O  O    . LEU A 1 34 ? -5.686  -2.039  -8.796  1.00 0.00 ? 34  LEU A O    5  
ATOM   3086  C  CB   . LEU A 1 34 ? -3.930  -1.880  -6.225  1.00 0.00 ? 34  LEU A CB   5  
ATOM   3087  C  CG   . LEU A 1 34 ? -4.062  -1.592  -4.729  1.00 0.00 ? 34  LEU A CG   5  
ATOM   3088  C  CD1  . LEU A 1 34 ? -3.106  -0.485  -4.312  1.00 0.00 ? 34  LEU A CD1  5  
ATOM   3089  C  CD2  . LEU A 1 34 ? -5.496  -1.219  -4.382  1.00 0.00 ? 34  LEU A CD2  5  
ATOM   3090  H  H    . LEU A 1 34 ? -3.321  -4.477  -6.535  1.00 0.00 ? 34  LEU A H    5  
ATOM   3091  H  HA   . LEU A 1 34 ? -5.802  -2.913  -6.340  1.00 0.00 ? 34  LEU A HA   5  
ATOM   3092  H  HB2  . LEU A 1 34 ? -2.903  -2.146  -6.421  1.00 0.00 ? 34  LEU A HB2  5  
ATOM   3093  H  HB3  . LEU A 1 34 ? -4.174  -0.973  -6.761  1.00 0.00 ? 34  LEU A HB3  5  
ATOM   3094  H  HG   . LEU A 1 34 ? -3.803  -2.483  -4.174  1.00 0.00 ? 34  LEU A HG   5  
ATOM   3095  H  HD11 . LEU A 1 34 ? -3.403  0.441   -4.780  1.00 0.00 ? 34  LEU A HD11 5  
ATOM   3096  H  HD12 . LEU A 1 34 ? -2.103  -0.740  -4.622  1.00 0.00 ? 34  LEU A HD12 5  
ATOM   3097  H  HD13 . LEU A 1 34 ? -3.133  -0.372  -3.238  1.00 0.00 ? 34  LEU A HD13 5  
ATOM   3098  H  HD21 . LEU A 1 34 ? -6.058  -2.116  -4.165  1.00 0.00 ? 34  LEU A HD21 5  
ATOM   3099  H  HD22 . LEU A 1 34 ? -5.947  -0.706  -5.219  1.00 0.00 ? 34  LEU A HD22 5  
ATOM   3100  H  HD23 . LEU A 1 34 ? -5.501  -0.573  -3.518  1.00 0.00 ? 34  LEU A HD23 5  
ATOM   3101  N  N    . GLY A 1 35 ? -4.190  -3.706  -9.009  1.00 0.00 ? 35  GLY A N    5  
ATOM   3102  C  CA   . GLY A 1 35 ? -4.228  -3.672  -10.459 1.00 0.00 ? 35  GLY A CA   5  
ATOM   3103  C  C    . GLY A 1 35 ? -3.689  -2.372  -11.023 1.00 0.00 ? 35  GLY A C    5  
ATOM   3104  O  O    . GLY A 1 35 ? -2.711  -1.813  -10.526 1.00 0.00 ? 35  GLY A O    5  
ATOM   3105  H  H    . GLY A 1 35 ? -3.610  -4.349  -8.550  1.00 0.00 ? 35  GLY A H    5  
ATOM   3106  H  HA2  . GLY A 1 35 ? -3.638  -4.491  -10.843 1.00 0.00 ? 35  GLY A HA2  5  
ATOM   3107  H  HA3  . GLY A 1 35 ? -5.250  -3.795  -10.784 1.00 0.00 ? 35  GLY A HA3  5  
ATOM   3108  N  N    . PRO A 1 36 ? -4.334  -1.872  -12.087 1.00 0.00 ? 36  PRO A N    5  
ATOM   3109  C  CA   . PRO A 1 36 ? -3.931  -0.624  -12.743 1.00 0.00 ? 36  PRO A CA   5  
ATOM   3110  C  C    . PRO A 1 36 ? -4.205  0.601   -11.878 1.00 0.00 ? 36  PRO A C    5  
ATOM   3111  O  O    . PRO A 1 36 ? -3.460  1.579   -11.917 1.00 0.00 ? 36  PRO A O    5  
ATOM   3112  C  CB   . PRO A 1 36 ? -4.795  -0.592  -14.006 1.00 0.00 ? 36  PRO A CB   5  
ATOM   3113  C  CG   . PRO A 1 36 ? -5.992  -1.412  -13.667 1.00 0.00 ? 36  PRO A CG   5  
ATOM   3114  C  CD   . PRO A 1 36 ? -5.507  -2.485  -12.732 1.00 0.00 ? 36  PRO A CD   5  
ATOM   3115  H  HA   . PRO A 1 36 ? -2.887  -0.641  -13.020 1.00 0.00 ? 36  PRO A HA   5  
ATOM   3116  H  HB2  . PRO A 1 36 ? -5.066  0.430   -14.233 1.00 0.00 ? 36  PRO A HB2  5  
ATOM   3117  H  HB3  . PRO A 1 36 ? -4.247  -1.017  -14.833 1.00 0.00 ? 36  PRO A HB3  5  
ATOM   3118  H  HG2  . PRO A 1 36 ? -6.733  -0.796  -13.179 1.00 0.00 ? 36  PRO A HG2  5  
ATOM   3119  H  HG3  . PRO A 1 36 ? -6.400  -1.853  -14.564 1.00 0.00 ? 36  PRO A HG3  5  
ATOM   3120  H  HD2  . PRO A 1 36 ? -6.268  -2.722  -12.003 1.00 0.00 ? 36  PRO A HD2  5  
ATOM   3121  H  HD3  . PRO A 1 36 ? -5.224  -3.368  -13.286 1.00 0.00 ? 36  PRO A HD3  5  
ATOM   3122  N  N    . GLN A 1 37 ? -5.279  0.539   -11.097 1.00 0.00 ? 37  GLN A N    5  
ATOM   3123  C  CA   . GLN A 1 37 ? -5.652  1.645   -10.222 1.00 0.00 ? 37  GLN A CA   5  
ATOM   3124  C  C    . GLN A 1 37 ? -4.557  1.920   -9.197  1.00 0.00 ? 37  GLN A C    5  
ATOM   3125  O  O    . GLN A 1 37 ? -4.426  3.038   -8.698  1.00 0.00 ? 37  GLN A O    5  
ATOM   3126  C  CB   . GLN A 1 37 ? -6.969  1.337   -9.509  1.00 0.00 ? 37  GLN A CB   5  
ATOM   3127  C  CG   . GLN A 1 37 ? -8.201  1.730   -10.309 1.00 0.00 ? 37  GLN A CG   5  
ATOM   3128  C  CD   . GLN A 1 37 ? -9.489  1.247   -9.673  1.00 0.00 ? 37  GLN A CD   5  
ATOM   3129  O  OE1  . GLN A 1 37 ? -9.703  1.416   -8.472  1.00 0.00 ? 37  GLN A OE1  5  
ATOM   3130  N  NE2  . GLN A 1 37 ? -10.356 0.642   -10.477 1.00 0.00 ? 37  GLN A NE2  5  
ATOM   3131  H  H    . GLN A 1 37 ? -5.834  -0.268  -11.110 1.00 0.00 ? 37  GLN A H    5  
ATOM   3132  H  HA   . GLN A 1 37 ? -5.782  2.523   -10.836 1.00 0.00 ? 37  GLN A HA   5  
ATOM   3133  H  HB2  . GLN A 1 37 ? -7.019  0.277   -9.310  1.00 0.00 ? 37  GLN A HB2  5  
ATOM   3134  H  HB3  . GLN A 1 37 ? -6.991  1.873   -8.571  1.00 0.00 ? 37  GLN A HB3  5  
ATOM   3135  H  HG2  . GLN A 1 37 ? -8.237  2.807   -10.385 1.00 0.00 ? 37  GLN A HG2  5  
ATOM   3136  H  HG3  . GLN A 1 37 ? -8.122  1.303   -11.298 1.00 0.00 ? 37  GLN A HG3  5  
ATOM   3137  H  HE21 . GLN A 1 37 ? -10.117 0.542   -11.422 1.00 0.00 ? 37  GLN A HE21 5  
ATOM   3138  H  HE22 . GLN A 1 37 ? -11.196 0.319   -10.092 1.00 0.00 ? 37  GLN A HE22 5  
ATOM   3139  N  N    . CYS A 1 38 ? -3.773  0.893   -8.886  1.00 0.00 ? 38  CYS A N    5  
ATOM   3140  C  CA   . CYS A 1 38 ? -2.689  1.023   -7.919  1.00 0.00 ? 38  CYS A CA   5  
ATOM   3141  C  C    . CYS A 1 38 ? -1.951  2.346   -8.104  1.00 0.00 ? 38  CYS A C    5  
ATOM   3142  O  O    . CYS A 1 38 ? -1.623  2.752   -9.219  1.00 0.00 ? 38  CYS A O    5  
ATOM   3143  C  CB   . CYS A 1 38 ? -1.710  -0.144  -8.059  1.00 0.00 ? 38  CYS A CB   5  
ATOM   3144  S  SG   . CYS A 1 38 ? -0.393  -0.165  -6.801  1.00 0.00 ? 38  CYS A SG   5  
ATOM   3145  H  H    . CYS A 1 38 ? -3.927  0.026   -9.317  1.00 0.00 ? 38  CYS A H    5  
ATOM   3146  H  HA   . CYS A 1 38 ? -3.122  1.001   -6.930  1.00 0.00 ? 38  CYS A HA   5  
ATOM   3147  H  HB2  . CYS A 1 38 ? -2.255  -1.073  -7.978  1.00 0.00 ? 38  CYS A HB2  5  
ATOM   3148  H  HB3  . CYS A 1 38 ? -1.238  -0.094  -9.029  1.00 0.00 ? 38  CYS A HB3  5  
ATOM   3149  N  N    . PRO A 1 39 ? -1.683  3.034   -6.984  1.00 0.00 ? 39  PRO A N    5  
ATOM   3150  C  CA   . PRO A 1 39 ? -0.980  4.321   -6.996  1.00 0.00 ? 39  PRO A CA   5  
ATOM   3151  C  C    . PRO A 1 39 ? 0.490   4.175   -7.376  1.00 0.00 ? 39  PRO A C    5  
ATOM   3152  O  O    . PRO A 1 39 ? 1.142   5.148   -7.753  1.00 0.00 ? 39  PRO A O    5  
ATOM   3153  C  CB   . PRO A 1 39 ? -1.113  4.811   -5.552  1.00 0.00 ? 39  PRO A CB   5  
ATOM   3154  C  CG   . PRO A 1 39 ? -1.287  3.570   -4.746  1.00 0.00 ? 39  PRO A CG   5  
ATOM   3155  C  CD   . PRO A 1 39 ? -2.044  2.610   -5.621  1.00 0.00 ? 39  PRO A CD   5  
ATOM   3156  H  HA   . PRO A 1 39 ? -1.454  5.026   -7.662  1.00 0.00 ? 39  PRO A HA   5  
ATOM   3157  H  HB2  . PRO A 1 39 ? -0.218  5.346   -5.267  1.00 0.00 ? 39  PRO A HB2  5  
ATOM   3158  H  HB3  . PRO A 1 39 ? -1.970  5.461   -5.466  1.00 0.00 ? 39  PRO A HB3  5  
ATOM   3159  H  HG2  . PRO A 1 39 ? -0.322  3.161   -4.487  1.00 0.00 ? 39  PRO A HG2  5  
ATOM   3160  H  HG3  . PRO A 1 39 ? -1.855  3.790   -3.853  1.00 0.00 ? 39  PRO A HG3  5  
ATOM   3161  H  HD2  . PRO A 1 39 ? -1.723  1.596   -5.435  1.00 0.00 ? 39  PRO A HD2  5  
ATOM   3162  H  HD3  . PRO A 1 39 ? -3.107  2.707   -5.457  1.00 0.00 ? 39  PRO A HD3  5  
ATOM   3163  N  N    . GLN A 1 40 ? 1.004   2.954   -7.274  1.00 0.00 ? 40  GLN A N    5  
ATOM   3164  C  CA   . GLN A 1 40 ? 2.398   2.682   -7.607  1.00 0.00 ? 40  GLN A CA   5  
ATOM   3165  C  C    . GLN A 1 40 ? 2.522   2.141   -9.028  1.00 0.00 ? 40  GLN A C    5  
ATOM   3166  O  O    . GLN A 1 40 ? 1.590   1.536   -9.556  1.00 0.00 ? 40  GLN A O    5  
ATOM   3167  C  CB   . GLN A 1 40 ? 2.996   1.683   -6.615  1.00 0.00 ? 40  GLN A CB   5  
ATOM   3168  C  CG   . GLN A 1 40 ? 3.007   2.184   -5.180  1.00 0.00 ? 40  GLN A CG   5  
ATOM   3169  C  CD   . GLN A 1 40 ? 3.426   1.114   -4.191  1.00 0.00 ? 40  GLN A CD   5  
ATOM   3170  O  OE1  . GLN A 1 40 ? 2.716   0.129   -3.987  1.00 0.00 ? 40  GLN A OE1  5  
ATOM   3171  N  NE2  . GLN A 1 40 ? 4.585   1.302   -3.571  1.00 0.00 ? 40  GLN A NE2  5  
ATOM   3172  H  H    . GLN A 1 40 ? 0.434   2.219   -6.968  1.00 0.00 ? 40  GLN A H    5  
ATOM   3173  H  HA   . GLN A 1 40 ? 2.942   3.612   -7.541  1.00 0.00 ? 40  GLN A HA   5  
ATOM   3174  H  HB2  . GLN A 1 40 ? 2.421   0.770   -6.651  1.00 0.00 ? 40  GLN A HB2  5  
ATOM   3175  H  HB3  . GLN A 1 40 ? 4.014   1.470   -6.906  1.00 0.00 ? 40  GLN A HB3  5  
ATOM   3176  H  HG2  . GLN A 1 40 ? 3.698   3.011   -5.106  1.00 0.00 ? 40  GLN A HG2  5  
ATOM   3177  H  HG3  . GLN A 1 40 ? 2.014   2.523   -4.923  1.00 0.00 ? 40  GLN A HG3  5  
ATOM   3178  H  HE21 . GLN A 1 40 ? 5.097   2.111   -3.783  1.00 0.00 ? 40  GLN A HE21 5  
ATOM   3179  H  HE22 . GLN A 1 40 ? 4.880   0.627   -2.926  1.00 0.00 ? 40  GLN A HE22 5  
ATOM   3180  N  N    . SER A 1 41 ? 3.680   2.365   -9.642  1.00 0.00 ? 41  SER A N    5  
ATOM   3181  C  CA   . SER A 1 41 ? 3.925   1.904   -11.003 1.00 0.00 ? 41  SER A CA   5  
ATOM   3182  C  C    . SER A 1 41 ? 4.275   0.418   -11.019 1.00 0.00 ? 41  SER A C    5  
ATOM   3183  O  O    . SER A 1 41 ? 4.789   -0.121  -10.039 1.00 0.00 ? 41  SER A O    5  
ATOM   3184  C  CB   . SER A 1 41 ? 5.056   2.712   -11.642 1.00 0.00 ? 41  SER A CB   5  
ATOM   3185  O  OG   . SER A 1 41 ? 4.884   2.809   -13.045 1.00 0.00 ? 41  SER A OG   5  
ATOM   3186  H  H    . SER A 1 41 ? 4.385   2.853   -9.167  1.00 0.00 ? 41  SER A H    5  
ATOM   3187  H  HA   . SER A 1 41 ? 3.020   2.055   -11.572 1.00 0.00 ? 41  SER A HA   5  
ATOM   3188  H  HB2  . SER A 1 41 ? 5.065   3.707   -11.223 1.00 0.00 ? 41  SER A HB2  5  
ATOM   3189  H  HB3  . SER A 1 41 ? 6.000   2.227   -11.439 1.00 0.00 ? 41  SER A HB3  5  
ATOM   3190  H  HG   . SER A 1 41 ? 4.383   2.053   -13.359 1.00 0.00 ? 41  SER A HG   5  
ATOM   3191  N  N    . HIS A 1 42 ? 3.992   -0.237  -12.140 1.00 0.00 ? 42  HIS A N    5  
ATOM   3192  C  CA   . HIS A 1 42 ? 4.276   -1.661  -12.286 1.00 0.00 ? 42  HIS A CA   5  
ATOM   3193  C  C    . HIS A 1 42 ? 5.201   -1.911  -13.473 1.00 0.00 ? 42  HIS A C    5  
ATOM   3194  O  O    . HIS A 1 42 ? 4.752   -2.297  -14.552 1.00 0.00 ? 42  HIS A O    5  
ATOM   3195  C  CB   . HIS A 1 42 ? 2.976   -2.446  -12.462 1.00 0.00 ? 42  HIS A CB   5  
ATOM   3196  C  CG   . HIS A 1 42 ? 2.111   -2.456  -11.240 1.00 0.00 ? 42  HIS A CG   5  
ATOM   3197  N  ND1  . HIS A 1 42 ? 0.738   -2.567  -11.291 1.00 0.00 ? 42  HIS A ND1  5  
ATOM   3198  C  CD2  . HIS A 1 42 ? 2.432   -2.369  -9.928  1.00 0.00 ? 42  HIS A CD2  5  
ATOM   3199  C  CE1  . HIS A 1 42 ? 0.251   -2.546  -10.063 1.00 0.00 ? 42  HIS A CE1  5  
ATOM   3200  N  NE2  . HIS A 1 42 ? 1.258   -2.427  -9.217  1.00 0.00 ? 42  HIS A NE2  5  
ATOM   3201  H  H    . HIS A 1 42 ? 3.582   0.247   -12.887 1.00 0.00 ? 42  HIS A H    5  
ATOM   3202  H  HA   . HIS A 1 42 ? 4.768   -1.994  -11.385 1.00 0.00 ? 42  HIS A HA   5  
ATOM   3203  H  HB2  . HIS A 1 42 ? 2.406   -2.009  -13.268 1.00 0.00 ? 42  HIS A HB2  5  
ATOM   3204  H  HB3  . HIS A 1 42 ? 3.213   -3.471  -12.710 1.00 0.00 ? 42  HIS A HB3  5  
ATOM   3205  H  HD1  . HIS A 1 42 ? 0.200   -2.647  -12.105 1.00 0.00 ? 42  HIS A HD1  5  
ATOM   3206  H  HD2  . HIS A 1 42 ? 3.426   -2.272  -9.515  1.00 0.00 ? 42  HIS A HD2  5  
ATOM   3207  H  HE1  . HIS A 1 42 ? -0.793  -2.615  -9.795  1.00 0.00 ? 42  HIS A HE1  5  
ATOM   3208  N  N    . ASP A 1 43 ? 6.494   -1.689  -13.266 1.00 0.00 ? 43  ASP A N    5  
ATOM   3209  C  CA   . ASP A 1 43 ? 7.483   -1.891  -14.318 1.00 0.00 ? 43  ASP A CA   5  
ATOM   3210  C  C    . ASP A 1 43 ? 8.368   -3.094  -14.010 1.00 0.00 ? 43  ASP A C    5  
ATOM   3211  O  O    . ASP A 1 43 ? 9.122   -3.089  -13.036 1.00 0.00 ? 43  ASP A O    5  
ATOM   3212  C  CB   . ASP A 1 43 ? 8.345   -0.638  -14.485 1.00 0.00 ? 43  ASP A CB   5  
ATOM   3213  C  CG   . ASP A 1 43 ? 9.433   -0.818  -15.526 1.00 0.00 ? 43  ASP A CG   5  
ATOM   3214  O  OD1  . ASP A 1 43 ? 9.960   -1.944  -15.644 1.00 0.00 ? 43  ASP A OD1  5  
ATOM   3215  O  OD2  . ASP A 1 43 ? 9.756   0.167   -16.222 1.00 0.00 ? 43  ASP A OD2  5  
ATOM   3216  H  H    . ASP A 1 43 ? 6.791   -1.382  -12.383 1.00 0.00 ? 43  ASP A H    5  
ATOM   3217  H  HA   . ASP A 1 43 ? 6.953   -2.077  -15.240 1.00 0.00 ? 43  ASP A HA   5  
ATOM   3218  H  HB2  . ASP A 1 43 ? 7.716   0.186   -14.788 1.00 0.00 ? 43  ASP A HB2  5  
ATOM   3219  H  HB3  . ASP A 1 43 ? 8.811   -0.401  -13.540 1.00 0.00 ? 43  ASP A HB3  5  
ATOM   3220  N  N    . ILE A 1 44 ? 8.269   -4.124  -14.843 1.00 0.00 ? 44  ILE A N    5  
ATOM   3221  C  CA   . ILE A 1 44 ? 9.060   -5.334  -14.659 1.00 0.00 ? 44  ILE A CA   5  
ATOM   3222  C  C    . ILE A 1 44 ? 10.058  -5.517  -15.797 1.00 0.00 ? 44  ILE A C    5  
ATOM   3223  O  O    . ILE A 1 44 ? 9.719   -6.047  -16.855 1.00 0.00 ? 44  ILE A O    5  
ATOM   3224  C  CB   . ILE A 1 44 ? 8.164   -6.584  -14.571 1.00 0.00 ? 44  ILE A CB   5  
ATOM   3225  C  CG1  . ILE A 1 44 ? 7.187   -6.457  -13.400 1.00 0.00 ? 44  ILE A CG1  5  
ATOM   3226  C  CG2  . ILE A 1 44 ? 9.016   -7.836  -14.422 1.00 0.00 ? 44  ILE A CG2  5  
ATOM   3227  C  CD1  . ILE A 1 44 ? 5.976   -7.354  -13.524 1.00 0.00 ? 44  ILE A CD1  5  
ATOM   3228  H  H    . ILE A 1 44 ? 7.650   -4.068  -15.601 1.00 0.00 ? 44  ILE A H    5  
ATOM   3229  H  HA   . ILE A 1 44 ? 9.603   -5.239  -13.730 1.00 0.00 ? 44  ILE A HA   5  
ATOM   3230  H  HB   . ILE A 1 44 ? 7.606   -6.665  -15.490 1.00 0.00 ? 44  ILE A HB   5  
ATOM   3231  H  HG12 . ILE A 1 44 ? 7.696   -6.712  -12.485 1.00 0.00 ? 44  ILE A HG12 5  
ATOM   3232  H  HG13 . ILE A 1 44 ? 6.839   -5.435  -13.342 1.00 0.00 ? 44  ILE A HG13 5  
ATOM   3233  H  HG21 . ILE A 1 44 ? 10.057  -7.581  -14.553 1.00 0.00 ? 44  ILE A HG21 5  
ATOM   3234  H  HG22 . ILE A 1 44 ? 8.870   -8.256  -13.438 1.00 0.00 ? 44  ILE A HG22 5  
ATOM   3235  H  HG23 . ILE A 1 44 ? 8.726   -8.560  -15.169 1.00 0.00 ? 44  ILE A HG23 5  
ATOM   3236  H  HD11 . ILE A 1 44 ? 6.294   -8.386  -13.561 1.00 0.00 ? 44  ILE A HD11 5  
ATOM   3237  H  HD12 . ILE A 1 44 ? 5.328   -7.206  -12.673 1.00 0.00 ? 44  ILE A HD12 5  
ATOM   3238  H  HD13 . ILE A 1 44 ? 5.439   -7.111  -14.431 1.00 0.00 ? 44  ILE A HD13 5  
ATOM   3239  N  N    . SER A 1 45 ? 11.292  -5.078  -15.571 1.00 0.00 ? 45  SER A N    5  
ATOM   3240  C  CA   . SER A 1 45 ? 12.340  -5.191  -16.578 1.00 0.00 ? 45  SER A CA   5  
ATOM   3241  C  C    . SER A 1 45 ? 12.559  -6.648  -16.973 1.00 0.00 ? 45  SER A C    5  
ATOM   3242  O  O    . SER A 1 45 ? 13.072  -7.446  -16.190 1.00 0.00 ? 45  SER A O    5  
ATOM   3243  C  CB   . SER A 1 45 ? 13.647  -4.591  -16.055 1.00 0.00 ? 45  SER A CB   5  
ATOM   3244  O  OG   . SER A 1 45 ? 14.021  -5.181  -14.822 1.00 0.00 ? 45  SER A OG   5  
ATOM   3245  H  H    . SER A 1 45 ? 11.501  -4.665  -14.707 1.00 0.00 ? 45  SER A H    5  
ATOM   3246  H  HA   . SER A 1 45 ? 12.024  -4.638  -17.450 1.00 0.00 ? 45  SER A HA   5  
ATOM   3247  H  HB2  . SER A 1 45 ? 14.432  -4.762  -16.775 1.00 0.00 ? 45  SER A HB2  5  
ATOM   3248  H  HB3  . SER A 1 45 ? 13.518  -3.529  -15.908 1.00 0.00 ? 45  SER A HB3  5  
ATOM   3249  H  HG   . SER A 1 45 ? 13.256  -5.227  -14.244 1.00 0.00 ? 45  SER A HG   5  
ATOM   3250  N  N    . GLY A 1 46 ? 12.165  -6.989  -18.197 1.00 0.00 ? 46  GLY A N    5  
ATOM   3251  C  CA   . GLY A 1 46 ? 12.325  -8.349  -18.676 1.00 0.00 ? 46  GLY A CA   5  
ATOM   3252  C  C    . GLY A 1 46 ? 12.056  -8.476  -20.162 1.00 0.00 ? 46  GLY A C    5  
ATOM   3253  O  O    . GLY A 1 46 ? 12.088  -7.495  -20.906 1.00 0.00 ? 46  GLY A O    5  
ATOM   3254  H  H    . GLY A 1 46 ? 11.762  -6.311  -18.779 1.00 0.00 ? 46  GLY A H    5  
ATOM   3255  H  HA2  . GLY A 1 46 ? 13.335  -8.674  -18.474 1.00 0.00 ? 46  GLY A HA2  5  
ATOM   3256  H  HA3  . GLY A 1 46 ? 11.638  -8.990  -18.142 1.00 0.00 ? 46  GLY A HA3  5  
ATOM   3257  N  N    . PRO A 1 47 ? 11.786  -9.709  -20.616 1.00 0.00 ? 47  PRO A N    5  
ATOM   3258  C  CA   . PRO A 1 47 ? 11.507  -9.990  -22.027 1.00 0.00 ? 47  PRO A CA   5  
ATOM   3259  C  C    . PRO A 1 47 ? 10.164  -9.424  -22.476 1.00 0.00 ? 47  PRO A C    5  
ATOM   3260  O  O    . PRO A 1 47 ? 9.142   -10.109 -22.423 1.00 0.00 ? 47  PRO A O    5  
ATOM   3261  C  CB   . PRO A 1 47 ? 11.491  -11.519 -22.088 1.00 0.00 ? 47  PRO A CB   5  
ATOM   3262  C  CG   . PRO A 1 47 ? 11.132  -11.949 -20.708 1.00 0.00 ? 47  PRO A CG   5  
ATOM   3263  C  CD   . PRO A 1 47 ? 11.732  -10.924 -19.786 1.00 0.00 ? 47  PRO A CD   5  
ATOM   3264  H  HA   . PRO A 1 47 ? 12.289  -9.611  -22.670 1.00 0.00 ? 47  PRO A HA   5  
ATOM   3265  H  HB2  . PRO A 1 47 ? 10.753  -11.845 -22.809 1.00 0.00 ? 47  PRO A HB2  5  
ATOM   3266  H  HB3  . PRO A 1 47 ? 12.466  -11.882 -22.374 1.00 0.00 ? 47  PRO A HB3  5  
ATOM   3267  H  HG2  . PRO A 1 47 ? 10.059  -11.971 -20.597 1.00 0.00 ? 47  PRO A HG2  5  
ATOM   3268  H  HG3  . PRO A 1 47 ? 11.552  -12.924 -20.507 1.00 0.00 ? 47  PRO A HG3  5  
ATOM   3269  H  HD2  . PRO A 1 47 ? 11.098  -10.774 -18.924 1.00 0.00 ? 47  PRO A HD2  5  
ATOM   3270  H  HD3  . PRO A 1 47 ? 12.723  -11.225 -19.480 1.00 0.00 ? 47  PRO A HD3  5  
ATOM   3271  N  N    . SER A 1 48 ? 10.173  -8.171  -22.919 1.00 0.00 ? 48  SER A N    5  
ATOM   3272  C  CA   . SER A 1 48 ? 8.954   -7.512  -23.374 1.00 0.00 ? 48  SER A CA   5  
ATOM   3273  C  C    . SER A 1 48 ? 9.280   -6.222  -24.120 1.00 0.00 ? 48  SER A C    5  
ATOM   3274  O  O    . SER A 1 48 ? 10.393  -5.704  -24.030 1.00 0.00 ? 48  SER A O    5  
ATOM   3275  C  CB   . SER A 1 48 ? 8.038   -7.211  -22.187 1.00 0.00 ? 48  SER A CB   5  
ATOM   3276  O  OG   . SER A 1 48 ? 7.175   -8.303  -21.918 1.00 0.00 ? 48  SER A OG   5  
ATOM   3277  H  H    . SER A 1 48 ? 11.019  -7.677  -22.937 1.00 0.00 ? 48  SER A H    5  
ATOM   3278  H  HA   . SER A 1 48 ? 8.446   -8.185  -24.049 1.00 0.00 ? 48  SER A HA   5  
ATOM   3279  H  HB2  . SER A 1 48 ? 8.639   -7.019  -21.311 1.00 0.00 ? 48  SER A HB2  5  
ATOM   3280  H  HB3  . SER A 1 48 ? 7.438   -6.341  -22.410 1.00 0.00 ? 48  SER A HB3  5  
ATOM   3281  H  HG   . SER A 1 48 ? 7.580   -9.116  -22.230 1.00 0.00 ? 48  SER A HG   5  
ATOM   3282  N  N    . SER A 1 49 ? 8.300   -5.708  -24.857 1.00 0.00 ? 49  SER A N    5  
ATOM   3283  C  CA   . SER A 1 49 ? 8.482   -4.480  -25.622 1.00 0.00 ? 49  SER A CA   5  
ATOM   3284  C  C    . SER A 1 49 ? 9.097   -3.386  -24.754 1.00 0.00 ? 49  SER A C    5  
ATOM   3285  O  O    . SER A 1 49 ? 8.833   -3.307  -23.555 1.00 0.00 ? 49  SER A O    5  
ATOM   3286  C  CB   . SER A 1 49 ? 7.144   -4.005  -26.190 1.00 0.00 ? 49  SER A CB   5  
ATOM   3287  O  OG   . SER A 1 49 ? 6.275   -3.575  -25.156 1.00 0.00 ? 49  SER A OG   5  
ATOM   3288  H  H    . SER A 1 49 ? 7.435   -6.168  -24.888 1.00 0.00 ? 49  SER A H    5  
ATOM   3289  H  HA   . SER A 1 49 ? 9.154   -4.695  -26.439 1.00 0.00 ? 49  SER A HA   5  
ATOM   3290  H  HB2  . SER A 1 49 ? 7.315   -3.181  -26.866 1.00 0.00 ? 49  SER A HB2  5  
ATOM   3291  H  HB3  . SER A 1 49 ? 6.674   -4.818  -26.725 1.00 0.00 ? 49  SER A HB3  5  
ATOM   3292  H  HG   . SER A 1 49 ? 5.493   -3.174  -25.542 1.00 0.00 ? 49  SER A HG   5  
ATOM   3293  N  N    . GLY A 1 50 ? 9.919   -2.542  -25.371 1.00 0.00 ? 50  GLY A N    5  
ATOM   3294  C  CA   . GLY A 1 50 ? 10.559  -1.463  -24.641 1.00 0.00 ? 50  GLY A CA   5  
ATOM   3295  C  C    . GLY A 1 50 ? 9.721   -0.201  -24.620 1.00 0.00 ? 50  GLY A C    5  
ATOM   3296  O  O    . GLY A 1 50 ? 9.599   0.455   -25.653 1.00 0.00 ? 50  GLY A O    5  
ATOM   3297  H  H    . GLY A 1 50 ? 10.092  -2.653  -26.329 1.00 0.00 ? 50  GLY A H    5  
ATOM   3298  H  HA2  . GLY A 1 50 ? 10.734  -1.785  -23.625 1.00 0.00 ? 50  GLY A HA2  5  
ATOM   3299  H  HA3  . GLY A 1 50 ? 11.509  -1.243  -25.107 1.00 0.00 ? 50  GLY A HA3  5  
HETATM 3300  ZN ZN   . ZN  B 2 .  ? 0.606   -2.238  -7.282  1.00 0.00 ? 201 ZN  A ZN   5  
ATOM   3301  N  N    . GLY A 1 1  ? -9.851  20.328  -9.492  1.00 0.00 ? 1   GLY A N    6  
ATOM   3302  C  CA   . GLY A 1 1  ? -10.634 19.810  -8.386  1.00 0.00 ? 1   GLY A CA   6  
ATOM   3303  C  C    . GLY A 1 1  ? -11.213 18.440  -8.676  1.00 0.00 ? 1   GLY A C    6  
ATOM   3304  O  O    . GLY A 1 1  ? -10.481 17.454  -8.759  1.00 0.00 ? 1   GLY A O    6  
ATOM   3305  H  H1   . GLY A 1 1  ? -8.885  20.460  -9.387  1.00 0.00 ? 1   GLY A H1   6  
ATOM   3306  H  HA2  . GLY A 1 1  ? -10.003 19.745  -7.512  1.00 0.00 ? 1   GLY A HA2  6  
ATOM   3307  H  HA3  . GLY A 1 1  ? -11.444 20.495  -8.182  1.00 0.00 ? 1   GLY A HA3  6  
ATOM   3308  N  N    . SER A 1 2  ? -12.532 18.377  -8.829  1.00 0.00 ? 2   SER A N    6  
ATOM   3309  C  CA   . SER A 1 2  ? -13.210 17.116  -9.107  1.00 0.00 ? 2   SER A CA   6  
ATOM   3310  C  C    . SER A 1 2  ? -13.528 16.986  -10.593 1.00 0.00 ? 2   SER A C    6  
ATOM   3311  O  O    . SER A 1 2  ? -13.051 16.070  -11.263 1.00 0.00 ? 2   SER A O    6  
ATOM   3312  C  CB   . SER A 1 2  ? -14.497 17.013  -8.287  1.00 0.00 ? 2   SER A CB   6  
ATOM   3313  O  OG   . SER A 1 2  ? -14.968 15.678  -8.241  1.00 0.00 ? 2   SER A OG   6  
ATOM   3314  H  H    . SER A 1 2  ? -13.062 19.198  -8.751  1.00 0.00 ? 2   SER A H    6  
ATOM   3315  H  HA   . SER A 1 2  ? -12.546 16.313  -8.821  1.00 0.00 ? 2   SER A HA   6  
ATOM   3316  H  HB2  . SER A 1 2  ? -14.307 17.349  -7.279  1.00 0.00 ? 2   SER A HB2  6  
ATOM   3317  H  HB3  . SER A 1 2  ? -15.257 17.636  -8.736  1.00 0.00 ? 2   SER A HB3  6  
ATOM   3318  H  HG   . SER A 1 2  ? -14.769 15.297  -7.383  1.00 0.00 ? 2   SER A HG   6  
ATOM   3319  N  N    . SER A 1 3  ? -14.338 17.908  -11.101 1.00 0.00 ? 3   SER A N    6  
ATOM   3320  C  CA   . SER A 1 3  ? -14.725 17.896  -12.507 1.00 0.00 ? 3   SER A CA   6  
ATOM   3321  C  C    . SER A 1 3  ? -13.510 18.106  -13.406 1.00 0.00 ? 3   SER A C    6  
ATOM   3322  O  O    . SER A 1 3  ? -13.302 17.370  -14.370 1.00 0.00 ? 3   SER A O    6  
ATOM   3323  C  CB   . SER A 1 3  ? -15.769 18.980  -12.781 1.00 0.00 ? 3   SER A CB   6  
ATOM   3324  O  OG   . SER A 1 3  ? -17.022 18.635  -12.215 1.00 0.00 ? 3   SER A OG   6  
ATOM   3325  H  H    . SER A 1 3  ? -14.687 18.613  -10.515 1.00 0.00 ? 3   SER A H    6  
ATOM   3326  H  HA   . SER A 1 3  ? -15.156 16.930  -12.724 1.00 0.00 ? 3   SER A HA   6  
ATOM   3327  H  HB2  . SER A 1 3  ? -15.438 19.912  -12.350 1.00 0.00 ? 3   SER A HB2  6  
ATOM   3328  H  HB3  . SER A 1 3  ? -15.889 19.099  -13.848 1.00 0.00 ? 3   SER A HB3  6  
ATOM   3329  H  HG   . SER A 1 3  ? -16.910 18.441  -11.282 1.00 0.00 ? 3   SER A HG   6  
ATOM   3330  N  N    . GLY A 1 4  ? -12.710 19.117  -13.083 1.00 0.00 ? 4   GLY A N    6  
ATOM   3331  C  CA   . GLY A 1 4  ? -11.526 19.407  -13.870 1.00 0.00 ? 4   GLY A CA   6  
ATOM   3332  C  C    . GLY A 1 4  ? -10.368 18.486  -13.537 1.00 0.00 ? 4   GLY A C    6  
ATOM   3333  O  O    . GLY A 1 4  ? -9.382  18.911  -12.935 1.00 0.00 ? 4   GLY A O    6  
ATOM   3334  H  H    . GLY A 1 4  ? -12.925 19.671  -12.303 1.00 0.00 ? 4   GLY A H    6  
ATOM   3335  H  HA2  . GLY A 1 4  ? -11.768 19.300  -14.917 1.00 0.00 ? 4   GLY A HA2  6  
ATOM   3336  H  HA3  . GLY A 1 4  ? -11.224 20.427  -13.683 1.00 0.00 ? 4   GLY A HA3  6  
ATOM   3337  N  N    . SER A 1 5  ? -10.489 17.222  -13.928 1.00 0.00 ? 5   SER A N    6  
ATOM   3338  C  CA   . SER A 1 5  ? -9.447  16.237  -13.663 1.00 0.00 ? 5   SER A CA   6  
ATOM   3339  C  C    . SER A 1 5  ? -8.878  15.683  -14.966 1.00 0.00 ? 5   SER A C    6  
ATOM   3340  O  O    . SER A 1 5  ? -8.632  14.483  -15.088 1.00 0.00 ? 5   SER A O    6  
ATOM   3341  C  CB   . SER A 1 5  ? -10.000 15.095  -12.808 1.00 0.00 ? 5   SER A CB   6  
ATOM   3342  O  OG   . SER A 1 5  ? -8.971  14.199  -12.426 1.00 0.00 ? 5   SER A OG   6  
ATOM   3343  H  H    . SER A 1 5  ? -11.300 16.944  -14.404 1.00 0.00 ? 5   SER A H    6  
ATOM   3344  H  HA   . SER A 1 5  ? -8.655  16.730  -13.120 1.00 0.00 ? 5   SER A HA   6  
ATOM   3345  H  HB2  . SER A 1 5  ? -10.455 15.502  -11.918 1.00 0.00 ? 5   SER A HB2  6  
ATOM   3346  H  HB3  . SER A 1 5  ? -10.742 14.552  -13.376 1.00 0.00 ? 5   SER A HB3  6  
ATOM   3347  H  HG   . SER A 1 5  ? -9.311  13.301  -12.428 1.00 0.00 ? 5   SER A HG   6  
ATOM   3348  N  N    . SER A 1 6  ? -8.673  16.566  -15.937 1.00 0.00 ? 6   SER A N    6  
ATOM   3349  C  CA   . SER A 1 6  ? -8.137  16.167  -17.233 1.00 0.00 ? 6   SER A CA   6  
ATOM   3350  C  C    . SER A 1 6  ? -6.904  16.991  -17.589 1.00 0.00 ? 6   SER A C    6  
ATOM   3351  O  O    . SER A 1 6  ? -6.620  18.009  -16.959 1.00 0.00 ? 6   SER A O    6  
ATOM   3352  C  CB   . SER A 1 6  ? -9.202  16.326  -18.320 1.00 0.00 ? 6   SER A CB   6  
ATOM   3353  O  OG   . SER A 1 6  ? -9.371  17.688  -18.673 1.00 0.00 ? 6   SER A OG   6  
ATOM   3354  H  H    . SER A 1 6  ? -8.889  17.509  -15.779 1.00 0.00 ? 6   SER A H    6  
ATOM   3355  H  HA   . SER A 1 6  ? -7.854  15.127  -17.168 1.00 0.00 ? 6   SER A HA   6  
ATOM   3356  H  HB2  . SER A 1 6  ? -8.902  15.774  -19.198 1.00 0.00 ? 6   SER A HB2  6  
ATOM   3357  H  HB3  . SER A 1 6  ? -10.144 15.940  -17.957 1.00 0.00 ? 6   SER A HB3  6  
ATOM   3358  H  HG   . SER A 1 6  ? -8.757  17.916  -19.374 1.00 0.00 ? 6   SER A HG   6  
ATOM   3359  N  N    . GLY A 1 7  ? -6.173  16.543  -18.606 1.00 0.00 ? 7   GLY A N    6  
ATOM   3360  C  CA   . GLY A 1 7  ? -4.979  17.251  -19.029 1.00 0.00 ? 7   GLY A CA   6  
ATOM   3361  C  C    . GLY A 1 7  ? -5.107  17.821  -20.428 1.00 0.00 ? 7   GLY A C    6  
ATOM   3362  O  O    . GLY A 1 7  ? -5.870  17.307  -21.247 1.00 0.00 ? 7   GLY A O    6  
ATOM   3363  H  H    . GLY A 1 7  ? -6.447  15.726  -19.072 1.00 0.00 ? 7   GLY A H    6  
ATOM   3364  H  HA2  . GLY A 1 7  ? -4.788  18.058  -18.338 1.00 0.00 ? 7   GLY A HA2  6  
ATOM   3365  H  HA3  . GLY A 1 7  ? -4.143  16.567  -19.008 1.00 0.00 ? 7   GLY A HA3  6  
ATOM   3366  N  N    . CYS A 1 8  ? -4.363  18.886  -20.701 1.00 0.00 ? 8   CYS A N    6  
ATOM   3367  C  CA   . CYS A 1 8  ? -4.399  19.529  -22.010 1.00 0.00 ? 8   CYS A CA   6  
ATOM   3368  C  C    . CYS A 1 8  ? -3.077  19.337  -22.747 1.00 0.00 ? 8   CYS A C    6  
ATOM   3369  O  O    . CYS A 1 8  ? -2.513  20.288  -23.289 1.00 0.00 ? 8   CYS A O    6  
ATOM   3370  C  CB   . CYS A 1 8  ? -4.701  21.021  -21.861 1.00 0.00 ? 8   CYS A CB   6  
ATOM   3371  S  SG   . CYS A 1 8  ? -6.465  21.418  -21.841 1.00 0.00 ? 8   CYS A SG   6  
ATOM   3372  H  H    . CYS A 1 8  ? -3.775  19.250  -20.007 1.00 0.00 ? 8   CYS A H    6  
ATOM   3373  H  HA   . CYS A 1 8  ? -5.187  19.066  -22.584 1.00 0.00 ? 8   CYS A HA   6  
ATOM   3374  H  HB2  . CYS A 1 8  ? -4.275  21.376  -20.934 1.00 0.00 ? 8   CYS A HB2  6  
ATOM   3375  H  HB3  . CYS A 1 8  ? -4.251  21.556  -22.684 1.00 0.00 ? 8   CYS A HB3  6  
ATOM   3376  H  HG   . CYS A 1 8  ? -7.131  20.339  -22.224 1.00 0.00 ? 8   CYS A HG   6  
ATOM   3377  N  N    . CYS A 1 9  ? -2.589  18.102  -22.762 1.00 0.00 ? 9   CYS A N    6  
ATOM   3378  C  CA   . CYS A 1 9  ? -1.332  17.785  -23.430 1.00 0.00 ? 9   CYS A CA   6  
ATOM   3379  C  C    . CYS A 1 9  ? -0.170  18.538  -22.789 1.00 0.00 ? 9   CYS A C    6  
ATOM   3380  O  O    . CYS A 1 9  ? 0.613   19.195  -23.477 1.00 0.00 ? 9   CYS A O    6  
ATOM   3381  C  CB   . CYS A 1 9  ? -1.420  18.129  -24.917 1.00 0.00 ? 9   CYS A CB   6  
ATOM   3382  S  SG   . CYS A 1 9  ? -2.584  17.103  -25.845 1.00 0.00 ? 9   CYS A SG   6  
ATOM   3383  H  H    . CYS A 1 9  ? -3.084  17.385  -22.312 1.00 0.00 ? 9   CYS A H    6  
ATOM   3384  H  HA   . CYS A 1 9  ? -1.159  16.725  -23.324 1.00 0.00 ? 9   CYS A HA   6  
ATOM   3385  H  HB2  . CYS A 1 9  ? -1.733  19.158  -25.023 1.00 0.00 ? 9   CYS A HB2  6  
ATOM   3386  H  HB3  . CYS A 1 9  ? -0.444  18.009  -25.365 1.00 0.00 ? 9   CYS A HB3  6  
ATOM   3387  H  HG   . CYS A 1 9  ? -1.920  16.060  -26.320 1.00 0.00 ? 9   CYS A HG   6  
ATOM   3388  N  N    . LEU A 1 10 ? -0.065  18.439  -21.469 1.00 0.00 ? 10  LEU A N    6  
ATOM   3389  C  CA   . LEU A 1 10 ? 1.000   19.113  -20.733 1.00 0.00 ? 10  LEU A CA   6  
ATOM   3390  C  C    . LEU A 1 10 ? 2.371   18.666  -21.230 1.00 0.00 ? 10  LEU A C    6  
ATOM   3391  O  O    . LEU A 1 10 ? 2.560   17.531  -21.669 1.00 0.00 ? 10  LEU A O    6  
ATOM   3392  C  CB   . LEU A 1 10 ? 0.870   18.830  -19.236 1.00 0.00 ? 10  LEU A CB   6  
ATOM   3393  C  CG   . LEU A 1 10 ? -0.263  19.556  -18.511 1.00 0.00 ? 10  LEU A CG   6  
ATOM   3394  C  CD1  . LEU A 1 10 ? -0.103  21.063  -18.645 1.00 0.00 ? 10  LEU A CD1  6  
ATOM   3395  C  CD2  . LEU A 1 10 ? -1.614  19.111  -19.052 1.00 0.00 ? 10  LEU A CD2  6  
ATOM   3396  H  H    . LEU A 1 10 ? -0.719  17.902  -20.975 1.00 0.00 ? 10  LEU A H    6  
ATOM   3397  H  HA   . LEU A 1 10 ? 0.898   20.175  -20.901 1.00 0.00 ? 10  LEU A HA   6  
ATOM   3398  H  HB2  . LEU A 1 10 ? 0.715   17.769  -19.112 1.00 0.00 ? 10  LEU A HB2  6  
ATOM   3399  H  HB3  . LEU A 1 10 ? 1.801   19.113  -18.765 1.00 0.00 ? 10  LEU A HB3  6  
ATOM   3400  H  HG   . LEU A 1 10 ? -0.225  19.310  -17.459 1.00 0.00 ? 10  LEU A HG   6  
ATOM   3401  H  HD11 . LEU A 1 10 ? -0.192  21.343  -19.684 1.00 0.00 ? 10  LEU A HD11 6  
ATOM   3402  H  HD12 . LEU A 1 10 ? 0.868   21.356  -18.274 1.00 0.00 ? 10  LEU A HD12 6  
ATOM   3403  H  HD13 . LEU A 1 10 ? -0.872  21.559  -18.071 1.00 0.00 ? 10  LEU A HD13 6  
ATOM   3404  H  HD21 . LEU A 1 10 ? -1.816  19.624  -19.980 1.00 0.00 ? 10  LEU A HD21 6  
ATOM   3405  H  HD22 . LEU A 1 10 ? -2.385  19.349  -18.334 1.00 0.00 ? 10  LEU A HD22 6  
ATOM   3406  H  HD23 . LEU A 1 10 ? -1.599  18.045  -19.225 1.00 0.00 ? 10  LEU A HD23 6  
ATOM   3407  N  N    . PRO A 1 11 ? 3.352   19.577  -21.159 1.00 0.00 ? 11  PRO A N    6  
ATOM   3408  C  CA   . PRO A 1 11 ? 4.724   19.299  -21.595 1.00 0.00 ? 11  PRO A CA   6  
ATOM   3409  C  C    . PRO A 1 11 ? 5.437   18.316  -20.673 1.00 0.00 ? 11  PRO A C    6  
ATOM   3410  O  O    . PRO A 1 11 ? 5.187   18.264  -19.468 1.00 0.00 ? 11  PRO A O    6  
ATOM   3411  C  CB   . PRO A 1 11 ? 5.400   20.672  -21.538 1.00 0.00 ? 11  PRO A CB   6  
ATOM   3412  C  CG   . PRO A 1 11 ? 4.616   21.438  -20.529 1.00 0.00 ? 11  PRO A CG   6  
ATOM   3413  C  CD   . PRO A 1 11 ? 3.199   20.950  -20.647 1.00 0.00 ? 11  PRO A CD   6  
ATOM   3414  H  HA   . PRO A 1 11 ? 4.751   18.925  -22.608 1.00 0.00 ? 11  PRO A HA   6  
ATOM   3415  H  HB2  . PRO A 1 11 ? 6.431   20.556  -21.233 1.00 0.00 ? 11  PRO A HB2  6  
ATOM   3416  H  HB3  . PRO A 1 11 ? 5.356   21.139  -22.510 1.00 0.00 ? 11  PRO A HB3  6  
ATOM   3417  H  HG2  . PRO A 1 11 ? 4.999   21.241  -19.539 1.00 0.00 ? 11  PRO A HG2  6  
ATOM   3418  H  HG3  . PRO A 1 11 ? 4.667   22.494  -20.749 1.00 0.00 ? 11  PRO A HG3  6  
ATOM   3419  H  HD2  . PRO A 1 11 ? 2.718   20.949  -19.681 1.00 0.00 ? 11  PRO A HD2  6  
ATOM   3420  H  HD3  . PRO A 1 11 ? 2.646   21.561  -21.346 1.00 0.00 ? 11  PRO A HD3  6  
ATOM   3421  N  N    . PRO A 1 12 ? 6.348   17.517  -21.248 1.00 0.00 ? 12  PRO A N    6  
ATOM   3422  C  CA   . PRO A 1 12 ? 7.116   16.521  -20.496 1.00 0.00 ? 12  PRO A CA   6  
ATOM   3423  C  C    . PRO A 1 12 ? 8.130   17.162  -19.554 1.00 0.00 ? 12  PRO A C    6  
ATOM   3424  O  O    . PRO A 1 12 ? 9.090   17.794  -19.997 1.00 0.00 ? 12  PRO A O    6  
ATOM   3425  C  CB   . PRO A 1 12 ? 7.832   15.724  -21.589 1.00 0.00 ? 12  PRO A CB   6  
ATOM   3426  C  CG   . PRO A 1 12 ? 7.929   16.665  -22.741 1.00 0.00 ? 12  PRO A CG   6  
ATOM   3427  C  CD   . PRO A 1 12 ? 6.698   17.525  -22.679 1.00 0.00 ? 12  PRO A CD   6  
ATOM   3428  H  HA   . PRO A 1 12 ? 6.470   15.864  -19.933 1.00 0.00 ? 12  PRO A HA   6  
ATOM   3429  H  HB2  . PRO A 1 12 ? 8.809   15.424  -21.239 1.00 0.00 ? 12  PRO A HB2  6  
ATOM   3430  H  HB3  . PRO A 1 12 ? 7.250   14.851  -21.842 1.00 0.00 ? 12  PRO A HB3  6  
ATOM   3431  H  HG2  . PRO A 1 12 ? 8.816   17.272  -22.644 1.00 0.00 ? 12  PRO A HG2  6  
ATOM   3432  H  HG3  . PRO A 1 12 ? 7.952   16.109  -23.667 1.00 0.00 ? 12  PRO A HG3  6  
ATOM   3433  H  HD2  . PRO A 1 12 ? 6.919   18.526  -23.016 1.00 0.00 ? 12  PRO A HD2  6  
ATOM   3434  H  HD3  . PRO A 1 12 ? 5.905   17.092  -23.271 1.00 0.00 ? 12  PRO A HD3  6  
ATOM   3435  N  N    . ALA A 1 13 ? 7.912   16.996  -18.254 1.00 0.00 ? 13  ALA A N    6  
ATOM   3436  C  CA   . ALA A 1 13 ? 8.808   17.556  -17.250 1.00 0.00 ? 13  ALA A CA   6  
ATOM   3437  C  C    . ALA A 1 13 ? 9.585   16.457  -16.533 1.00 0.00 ? 13  ALA A C    6  
ATOM   3438  O  O    . ALA A 1 13 ? 9.200   15.288  -16.564 1.00 0.00 ? 13  ALA A O    6  
ATOM   3439  C  CB   . ALA A 1 13 ? 8.023   18.390  -16.249 1.00 0.00 ? 13  ALA A CB   6  
ATOM   3440  H  H    . ALA A 1 13 ? 7.130   16.482  -17.963 1.00 0.00 ? 13  ALA A H    6  
ATOM   3441  H  HA   . ALA A 1 13 ? 9.508   18.208  -17.754 1.00 0.00 ? 13  ALA A HA   6  
ATOM   3442  H  HB1  . ALA A 1 13 ? 8.113   19.436  -16.504 1.00 0.00 ? 13  ALA A HB1  6  
ATOM   3443  H  HB2  . ALA A 1 13 ? 6.984   18.101  -16.276 1.00 0.00 ? 13  ALA A HB2  6  
ATOM   3444  H  HB3  . ALA A 1 13 ? 8.418   18.227  -15.257 1.00 0.00 ? 13  ALA A HB3  6  
ATOM   3445  N  N    . THR A 1 14 ? 10.682  16.840  -15.888 1.00 0.00 ? 14  THR A N    6  
ATOM   3446  C  CA   . THR A 1 14 ? 11.515  15.886  -15.164 1.00 0.00 ? 14  THR A CA   6  
ATOM   3447  C  C    . THR A 1 14 ? 11.830  16.387  -13.759 1.00 0.00 ? 14  THR A C    6  
ATOM   3448  O  O    . THR A 1 14 ? 12.812  17.101  -13.550 1.00 0.00 ? 14  THR A O    6  
ATOM   3449  C  CB   . THR A 1 14 ? 12.835  15.615  -15.909 1.00 0.00 ? 14  THR A CB   6  
ATOM   3450  O  OG1  . THR A 1 14 ? 13.502  16.851  -16.190 1.00 0.00 ? 14  THR A OG1  6  
ATOM   3451  C  CG2  . THR A 1 14 ? 12.580  14.864  -17.207 1.00 0.00 ? 14  THR A CG2  6  
ATOM   3452  H  H    . THR A 1 14 ? 10.938  17.786  -15.900 1.00 0.00 ? 14  THR A H    6  
ATOM   3453  H  HA   . THR A 1 14 ? 10.970  14.956  -15.090 1.00 0.00 ? 14  THR A HA   6  
ATOM   3454  H  HB   . THR A 1 14 ? 13.469  15.009  -15.278 1.00 0.00 ? 14  THR A HB   6  
ATOM   3455  H  HG1  . THR A 1 14 ? 14.078  16.738  -16.950 1.00 0.00 ? 14  THR A HG1  6  
ATOM   3456  H  HG21 . THR A 1 14 ? 13.509  14.753  -17.747 1.00 0.00 ? 14  THR A HG21 6  
ATOM   3457  H  HG22 . THR A 1 14 ? 11.877  15.418  -17.811 1.00 0.00 ? 14  THR A HG22 6  
ATOM   3458  H  HG23 . THR A 1 14 ? 12.175  13.889  -16.984 1.00 0.00 ? 14  THR A HG23 6  
ATOM   3459  N  N    . HIS A 1 15 ? 10.992  16.009  -12.799 1.00 0.00 ? 15  HIS A N    6  
ATOM   3460  C  CA   . HIS A 1 15 ? 11.183  16.420  -11.413 1.00 0.00 ? 15  HIS A CA   6  
ATOM   3461  C  C    . HIS A 1 15 ? 12.372  15.694  -10.790 1.00 0.00 ? 15  HIS A C    6  
ATOM   3462  O  O    . HIS A 1 15 ? 13.152  16.286  -10.044 1.00 0.00 ? 15  HIS A O    6  
ATOM   3463  C  CB   . HIS A 1 15 ? 9.919   16.144  -10.598 1.00 0.00 ? 15  HIS A CB   6  
ATOM   3464  C  CG   . HIS A 1 15 ? 10.010  16.606  -9.176  1.00 0.00 ? 15  HIS A CG   6  
ATOM   3465  N  ND1  . HIS A 1 15 ? 10.353  15.771  -8.134  1.00 0.00 ? 15  HIS A ND1  6  
ATOM   3466  C  CD2  . HIS A 1 15 ? 9.802   17.825  -8.627  1.00 0.00 ? 15  HIS A CD2  6  
ATOM   3467  C  CE1  . HIS A 1 15 ? 10.350  16.456  -7.004  1.00 0.00 ? 15  HIS A CE1  6  
ATOM   3468  N  NE2  . HIS A 1 15 ? 10.019  17.706  -7.276  1.00 0.00 ? 15  HIS A NE2  6  
ATOM   3469  H  H    . HIS A 1 15 ? 10.228  15.440  -13.028 1.00 0.00 ? 15  HIS A H    6  
ATOM   3470  H  HA   . HIS A 1 15 ? 11.382  17.481  -11.405 1.00 0.00 ? 15  HIS A HA   6  
ATOM   3471  H  HB2  . HIS A 1 15 ? 9.084   16.651  -11.059 1.00 0.00 ? 15  HIS A HB2  6  
ATOM   3472  H  HB3  . HIS A 1 15 ? 9.728   15.080  -10.591 1.00 0.00 ? 15  HIS A HB3  6  
ATOM   3473  H  HD1  . HIS A 1 15 ? 10.565  14.818  -8.210  1.00 0.00 ? 15  HIS A HD1  6  
ATOM   3474  H  HD2  . HIS A 1 15 ? 9.517   18.726  -9.152  1.00 0.00 ? 15  HIS A HD2  6  
ATOM   3475  H  HE1  . HIS A 1 15 ? 10.579  16.063  -6.026  1.00 0.00 ? 15  HIS A HE1  6  
ATOM   3476  N  N    . ARG A 1 16 ? 12.503  14.408  -11.101 1.00 0.00 ? 16  ARG A N    6  
ATOM   3477  C  CA   . ARG A 1 16 ? 13.596  13.602  -10.570 1.00 0.00 ? 16  ARG A CA   6  
ATOM   3478  C  C    . ARG A 1 16 ? 14.032  12.545  -11.581 1.00 0.00 ? 16  ARG A C    6  
ATOM   3479  O  O    . ARG A 1 16 ? 13.243  12.070  -12.399 1.00 0.00 ? 16  ARG A O    6  
ATOM   3480  C  CB   . ARG A 1 16 ? 13.173  12.929  -9.263  1.00 0.00 ? 16  ARG A CB   6  
ATOM   3481  C  CG   . ARG A 1 16 ? 11.876  12.145  -9.373  1.00 0.00 ? 16  ARG A CG   6  
ATOM   3482  C  CD   . ARG A 1 16 ? 11.185  12.017  -8.024  1.00 0.00 ? 16  ARG A CD   6  
ATOM   3483  N  NE   . ARG A 1 16 ? 10.081  11.062  -8.063  1.00 0.00 ? 16  ARG A NE   6  
ATOM   3484  C  CZ   . ARG A 1 16 ? 9.235   10.876  -7.056  1.00 0.00 ? 16  ARG A CZ   6  
ATOM   3485  N  NH1  . ARG A 1 16 ? 9.366   11.577  -5.938  1.00 0.00 ? 16  ARG A NH1  6  
ATOM   3486  N  NH2  . ARG A 1 16 ? 8.255   9.989   -7.166  1.00 0.00 ? 16  ARG A NH2  6  
ATOM   3487  H  H    . ARG A 1 16 ? 11.850  13.992  -11.701 1.00 0.00 ? 16  ARG A H    6  
ATOM   3488  H  HA   . ARG A 1 16 ? 14.429  14.259  -10.373 1.00 0.00 ? 16  ARG A HA   6  
ATOM   3489  H  HB2  . ARG A 1 16 ? 13.953  12.249  -8.952  1.00 0.00 ? 16  ARG A HB2  6  
ATOM   3490  H  HB3  . ARG A 1 16 ? 13.046  13.688  -8.506  1.00 0.00 ? 16  ARG A HB3  6  
ATOM   3491  H  HG2  . ARG A 1 16 ? 11.214  12.656  -10.057 1.00 0.00 ? 16  ARG A HG2  6  
ATOM   3492  H  HG3  . ARG A 1 16 ? 12.094  11.157  -9.751  1.00 0.00 ? 16  ARG A HG3  6  
ATOM   3493  H  HD2  . ARG A 1 16 ? 11.909  11.687  -7.294  1.00 0.00 ? 16  ARG A HD2  6  
ATOM   3494  H  HD3  . ARG A 1 16 ? 10.802  12.985  -7.739  1.00 0.00 ? 16  ARG A HD3  6  
ATOM   3495  H  HE   . ARG A 1 16 ? 9.966   10.534  -8.880  1.00 0.00 ? 16  ARG A HE   6  
ATOM   3496  H  HH11 . ARG A 1 16 ? 10.103  12.247  -5.852  1.00 0.00 ? 16  ARG A HH11 6  
ATOM   3497  H  HH12 . ARG A 1 16 ? 8.726   11.436  -5.182  1.00 0.00 ? 16  ARG A HH12 6  
ATOM   3498  H  HH21 . ARG A 1 16 ? 8.153   9.459   -8.008  1.00 0.00 ? 16  ARG A HH21 6  
ATOM   3499  H  HH22 . ARG A 1 16 ? 7.619   9.849   -6.408  1.00 0.00 ? 16  ARG A HH22 6  
ATOM   3500  N  N    . PRO A 1 17 ? 15.318  12.167  -11.525 1.00 0.00 ? 17  PRO A N    6  
ATOM   3501  C  CA   . PRO A 1 17 ? 15.888  11.163  -12.428 1.00 0.00 ? 17  PRO A CA   6  
ATOM   3502  C  C    . PRO A 1 17 ? 15.362  9.760   -12.141 1.00 0.00 ? 17  PRO A C    6  
ATOM   3503  O  O    . PRO A 1 17 ? 15.748  8.795   -12.801 1.00 0.00 ? 17  PRO A O    6  
ATOM   3504  C  CB   . PRO A 1 17 ? 17.389  11.240  -12.142 1.00 0.00 ? 17  PRO A CB   6  
ATOM   3505  C  CG   . PRO A 1 17 ? 17.483  11.761  -10.749 1.00 0.00 ? 17  PRO A CG   6  
ATOM   3506  C  CD   . PRO A 1 17 ? 16.314  12.691  -10.576 1.00 0.00 ? 17  PRO A CD   6  
ATOM   3507  H  HA   . PRO A 1 17 ? 15.704  11.410  -13.464 1.00 0.00 ? 17  PRO A HA   6  
ATOM   3508  H  HB2  . PRO A 1 17 ? 17.825  10.254  -12.225 1.00 0.00 ? 17  PRO A HB2  6  
ATOM   3509  H  HB3  . PRO A 1 17 ? 17.860  11.908  -12.846 1.00 0.00 ? 17  PRO A HB3  6  
ATOM   3510  H  HG2  . PRO A 1 17 ? 17.420  10.945  -10.046 1.00 0.00 ? 17  PRO A HG2  6  
ATOM   3511  H  HG3  . PRO A 1 17 ? 18.411  12.299  -10.621 1.00 0.00 ? 17  PRO A HG3  6  
ATOM   3512  H  HD2  . PRO A 1 17 ? 15.943  12.646  -9.563  1.00 0.00 ? 17  PRO A HD2  6  
ATOM   3513  H  HD3  . PRO A 1 17 ? 16.595  13.702  -10.832 1.00 0.00 ? 17  PRO A HD3  6  
ATOM   3514  N  N    . HIS A 1 18 ? 14.477  9.655   -11.154 1.00 0.00 ? 18  HIS A N    6  
ATOM   3515  C  CA   . HIS A 1 18 ? 13.897  8.370   -10.781 1.00 0.00 ? 18  HIS A CA   6  
ATOM   3516  C  C    . HIS A 1 18 ? 12.405  8.335   -11.097 1.00 0.00 ? 18  HIS A C    6  
ATOM   3517  O  O    . HIS A 1 18 ? 11.693  9.330   -10.956 1.00 0.00 ? 18  HIS A O    6  
ATOM   3518  C  CB   . HIS A 1 18 ? 14.123  8.097   -9.294  1.00 0.00 ? 18  HIS A CB   6  
ATOM   3519  C  CG   . HIS A 1 18 ? 15.539  8.304   -8.855  1.00 0.00 ? 18  HIS A CG   6  
ATOM   3520  N  ND1  . HIS A 1 18 ? 16.592  7.551   -9.330  1.00 0.00 ? 18  HIS A ND1  6  
ATOM   3521  C  CD2  . HIS A 1 18 ? 16.075  9.187   -7.980  1.00 0.00 ? 18  HIS A CD2  6  
ATOM   3522  C  CE1  . HIS A 1 18 ? 17.714  7.960   -8.765  1.00 0.00 ? 18  HIS A CE1  6  
ATOM   3523  N  NE2  . HIS A 1 18 ? 17.428  8.953   -7.942  1.00 0.00 ? 18  HIS A NE2  6  
ATOM   3524  H  H    . HIS A 1 18 ? 14.209  10.461  -10.666 1.00 0.00 ? 18  HIS A H    6  
ATOM   3525  H  HA   . HIS A 1 18 ? 14.392  7.603   -11.358 1.00 0.00 ? 18  HIS A HA   6  
ATOM   3526  H  HB2  . HIS A 1 18 ? 13.496  8.760   -8.715  1.00 0.00 ? 18  HIS A HB2  6  
ATOM   3527  H  HB3  . HIS A 1 18 ? 13.853  7.074   -9.077  1.00 0.00 ? 18  HIS A HB3  6  
ATOM   3528  H  HD1  . HIS A 1 18 ? 16.526  6.824   -9.983  1.00 0.00 ? 18  HIS A HD1  6  
ATOM   3529  H  HD2  . HIS A 1 18 ? 15.539  9.937   -7.415  1.00 0.00 ? 18  HIS A HD2  6  
ATOM   3530  H  HE1  . HIS A 1 18 ? 18.698  7.554   -8.946  1.00 0.00 ? 18  HIS A HE1  6  
ATOM   3531  N  N    . PRO A 1 19 ? 11.919  7.164   -11.535 1.00 0.00 ? 19  PRO A N    6  
ATOM   3532  C  CA   . PRO A 1 19 ? 10.507  6.972   -11.879 1.00 0.00 ? 19  PRO A CA   6  
ATOM   3533  C  C    . PRO A 1 19 ? 9.602   7.001   -10.653 1.00 0.00 ? 19  PRO A C    6  
ATOM   3534  O  O    . PRO A 1 19 ? 10.078  7.016   -9.517  1.00 0.00 ? 19  PRO A O    6  
ATOM   3535  C  CB   . PRO A 1 19 ? 10.486  5.586   -12.528 1.00 0.00 ? 19  PRO A CB   6  
ATOM   3536  C  CG   . PRO A 1 19 ? 11.665  4.880   -11.952 1.00 0.00 ? 19  PRO A CG   6  
ATOM   3537  C  CD   . PRO A 1 19 ? 12.711  5.937   -11.726 1.00 0.00 ? 19  PRO A CD   6  
ATOM   3538  H  HA   . PRO A 1 19 ? 10.169  7.710   -12.592 1.00 0.00 ? 19  PRO A HA   6  
ATOM   3539  H  HB2  . PRO A 1 19 ? 9.562   5.083   -12.277 1.00 0.00 ? 19  PRO A HB2  6  
ATOM   3540  H  HB3  . PRO A 1 19 ? 10.569  5.684   -13.599 1.00 0.00 ? 19  PRO A HB3  6  
ATOM   3541  H  HG2  . PRO A 1 19 ? 11.394  4.415   -11.017 1.00 0.00 ? 19  PRO A HG2  6  
ATOM   3542  H  HG3  . PRO A 1 19 ? 12.026  4.140   -12.650 1.00 0.00 ? 19  PRO A HG3  6  
ATOM   3543  H  HD2  . PRO A 1 19 ? 13.292  5.711   -10.845 1.00 0.00 ? 19  PRO A HD2  6  
ATOM   3544  H  HD3  . PRO A 1 19 ? 13.352  6.024   -12.591 1.00 0.00 ? 19  PRO A HD3  6  
ATOM   3545  N  N    . THR A 1 20 ? 8.294   7.008   -10.888 1.00 0.00 ? 20  THR A N    6  
ATOM   3546  C  CA   . THR A 1 20 ? 7.322   7.036   -9.803  1.00 0.00 ? 20  THR A CA   6  
ATOM   3547  C  C    . THR A 1 20 ? 7.476   5.821   -8.895  1.00 0.00 ? 20  THR A C    6  
ATOM   3548  O  O    . THR A 1 20 ? 7.899   4.753   -9.338  1.00 0.00 ? 20  THR A O    6  
ATOM   3549  C  CB   . THR A 1 20 ? 5.879   7.079   -10.341 1.00 0.00 ? 20  THR A CB   6  
ATOM   3550  O  OG1  . THR A 1 20 ? 4.948   7.011   -9.255  1.00 0.00 ? 20  THR A OG1  6  
ATOM   3551  C  CG2  . THR A 1 20 ? 5.626   5.930   -11.305 1.00 0.00 ? 20  THR A CG2  6  
ATOM   3552  H  H    . THR A 1 20 ? 7.976   6.995   -11.815 1.00 0.00 ? 20  THR A H    6  
ATOM   3553  H  HA   . THR A 1 20 ? 7.494   7.931   -9.223  1.00 0.00 ? 20  THR A HA   6  
ATOM   3554  H  HB   . THR A 1 20 ? 5.736   8.011   -10.870 1.00 0.00 ? 20  THR A HB   6  
ATOM   3555  H  HG1  . THR A 1 20 ? 5.159   6.256   -8.700  1.00 0.00 ? 20  THR A HG1  6  
ATOM   3556  H  HG21 . THR A 1 20 ? 5.629   6.303   -12.319 1.00 0.00 ? 20  THR A HG21 6  
ATOM   3557  H  HG22 . THR A 1 20 ? 4.668   5.483   -11.088 1.00 0.00 ? 20  THR A HG22 6  
ATOM   3558  H  HG23 . THR A 1 20 ? 6.403   5.189   -11.193 1.00 0.00 ? 20  THR A HG23 6  
ATOM   3559  N  N    . SER A 1 21 ? 7.131   5.991   -7.623  1.00 0.00 ? 21  SER A N    6  
ATOM   3560  C  CA   . SER A 1 21 ? 7.235   4.908   -6.652  1.00 0.00 ? 21  SER A CA   6  
ATOM   3561  C  C    . SER A 1 21 ? 6.656   3.614   -7.217  1.00 0.00 ? 21  SER A C    6  
ATOM   3562  O  O    . SER A 1 21 ? 5.481   3.553   -7.580  1.00 0.00 ? 21  SER A O    6  
ATOM   3563  C  CB   . SER A 1 21 ? 6.508   5.283   -5.359  1.00 0.00 ? 21  SER A CB   6  
ATOM   3564  O  OG   . SER A 1 21 ? 6.508   4.202   -4.442  1.00 0.00 ? 21  SER A OG   6  
ATOM   3565  H  H    . SER A 1 21 ? 6.801   6.866   -7.330  1.00 0.00 ? 21  SER A H    6  
ATOM   3566  H  HA   . SER A 1 21 ? 8.282   4.756   -6.435  1.00 0.00 ? 21  SER A HA   6  
ATOM   3567  H  HB2  . SER A 1 21 ? 7.003   6.126   -4.902  1.00 0.00 ? 21  SER A HB2  6  
ATOM   3568  H  HB3  . SER A 1 21 ? 5.486   5.546   -5.587  1.00 0.00 ? 21  SER A HB3  6  
ATOM   3569  H  HG   . SER A 1 21 ? 7.399   4.059   -4.115  1.00 0.00 ? 21  SER A HG   6  
ATOM   3570  N  N    . ILE A 1 22 ? 7.490   2.582   -7.287  1.00 0.00 ? 22  ILE A N    6  
ATOM   3571  C  CA   . ILE A 1 22 ? 7.062   1.289   -7.806  1.00 0.00 ? 22  ILE A CA   6  
ATOM   3572  C  C    . ILE A 1 22 ? 6.421   0.442   -6.712  1.00 0.00 ? 22  ILE A C    6  
ATOM   3573  O  O    . ILE A 1 22 ? 6.795   0.532   -5.543  1.00 0.00 ? 22  ILE A O    6  
ATOM   3574  C  CB   . ILE A 1 22 ? 8.242   0.510   -8.418  1.00 0.00 ? 22  ILE A CB   6  
ATOM   3575  C  CG1  . ILE A 1 22 ? 8.620   1.100   -9.779  1.00 0.00 ? 22  ILE A CG1  6  
ATOM   3576  C  CG2  . ILE A 1 22 ? 7.890   -0.964  -8.553  1.00 0.00 ? 22  ILE A CG2  6  
ATOM   3577  C  CD1  . ILE A 1 22 ? 9.419   2.380   -9.681  1.00 0.00 ? 22  ILE A CD1  6  
ATOM   3578  H  H    . ILE A 1 22 ? 8.415   2.693   -6.982  1.00 0.00 ? 22  ILE A H    6  
ATOM   3579  H  HA   . ILE A 1 22 ? 6.333   1.467   -8.583  1.00 0.00 ? 22  ILE A HA   6  
ATOM   3580  H  HB   . ILE A 1 22 ? 9.085   0.594   -7.751  1.00 0.00 ? 22  ILE A HB   6  
ATOM   3581  H  HG12 . ILE A 1 22 ? 9.211   0.381   -10.324 1.00 0.00 ? 22  ILE A HG12 6  
ATOM   3582  H  HG13 . ILE A 1 22 ? 7.717   1.312   -10.334 1.00 0.00 ? 22  ILE A HG13 6  
ATOM   3583  H  HG21 . ILE A 1 22 ? 8.097   -1.470  -7.622  1.00 0.00 ? 22  ILE A HG21 6  
ATOM   3584  H  HG22 . ILE A 1 22 ? 6.841   -1.063  -8.790  1.00 0.00 ? 22  ILE A HG22 6  
ATOM   3585  H  HG23 . ILE A 1 22 ? 8.480   -1.405  -9.342  1.00 0.00 ? 22  ILE A HG23 6  
ATOM   3586  H  HD11 . ILE A 1 22 ? 9.116   2.928   -8.801  1.00 0.00 ? 22  ILE A HD11 6  
ATOM   3587  H  HD12 . ILE A 1 22 ? 10.471  2.144   -9.616  1.00 0.00 ? 22  ILE A HD12 6  
ATOM   3588  H  HD13 . ILE A 1 22 ? 9.240   2.984   -10.560 1.00 0.00 ? 22  ILE A HD13 6  
ATOM   3589  N  N    . CYS A 1 23 ? 5.454   -0.382  -7.100  1.00 0.00 ? 23  CYS A N    6  
ATOM   3590  C  CA   . CYS A 1 23 ? 4.760   -1.247  -6.154  1.00 0.00 ? 23  CYS A CA   6  
ATOM   3591  C  C    . CYS A 1 23 ? 5.719   -2.267  -5.546  1.00 0.00 ? 23  CYS A C    6  
ATOM   3592  O  O    . CYS A 1 23 ? 6.877   -2.367  -5.954  1.00 0.00 ? 23  CYS A O    6  
ATOM   3593  C  CB   . CYS A 1 23 ? 3.602   -1.969  -6.845  1.00 0.00 ? 23  CYS A CB   6  
ATOM   3594  S  SG   . CYS A 1 23 ? 2.266   -2.481  -5.717  1.00 0.00 ? 23  CYS A SG   6  
ATOM   3595  H  H    . CYS A 1 23 ? 5.200   -0.409  -8.047  1.00 0.00 ? 23  CYS A H    6  
ATOM   3596  H  HA   . CYS A 1 23 ? 4.367   -0.627  -5.364  1.00 0.00 ? 23  CYS A HA   6  
ATOM   3597  H  HB2  . CYS A 1 23 ? 3.170   -1.313  -7.587  1.00 0.00 ? 23  CYS A HB2  6  
ATOM   3598  H  HB3  . CYS A 1 23 ? 3.979   -2.856  -7.332  1.00 0.00 ? 23  CYS A HB3  6  
ATOM   3599  N  N    . ASP A 1 24 ? 5.229   -3.023  -4.569  1.00 0.00 ? 24  ASP A N    6  
ATOM   3600  C  CA   . ASP A 1 24 ? 6.041   -4.036  -3.906  1.00 0.00 ? 24  ASP A CA   6  
ATOM   3601  C  C    . ASP A 1 24 ? 5.640   -5.436  -4.360  1.00 0.00 ? 24  ASP A C    6  
ATOM   3602  O  O    . ASP A 1 24 ? 6.422   -6.380  -4.255  1.00 0.00 ? 24  ASP A O    6  
ATOM   3603  C  CB   . ASP A 1 24 ? 5.900   -3.919  -2.387  1.00 0.00 ? 24  ASP A CB   6  
ATOM   3604  C  CG   . ASP A 1 24 ? 6.468   -2.619  -1.852  1.00 0.00 ? 24  ASP A CG   6  
ATOM   3605  O  OD1  . ASP A 1 24 ? 7.676   -2.371  -2.054  1.00 0.00 ? 24  ASP A OD1  6  
ATOM   3606  O  OD2  . ASP A 1 24 ? 5.705   -1.850  -1.232  1.00 0.00 ? 24  ASP A OD2  6  
ATOM   3607  H  H    . ASP A 1 24 ? 4.298   -2.896  -4.288  1.00 0.00 ? 24  ASP A H    6  
ATOM   3608  H  HA   . ASP A 1 24 ? 7.072   -3.865  -4.177  1.00 0.00 ? 24  ASP A HA   6  
ATOM   3609  H  HB2  . ASP A 1 24 ? 4.854   -3.968  -2.124  1.00 0.00 ? 24  ASP A HB2  6  
ATOM   3610  H  HB3  . ASP A 1 24 ? 6.424   -4.740  -1.919  1.00 0.00 ? 24  ASP A HB3  6  
ATOM   3611  N  N    . ASN A 1 25 ? 4.416   -5.562  -4.862  1.00 0.00 ? 25  ASN A N    6  
ATOM   3612  C  CA   . ASN A 1 25 ? 3.911   -6.848  -5.330  1.00 0.00 ? 25  ASN A CA   6  
ATOM   3613  C  C    . ASN A 1 25 ? 4.234   -7.054  -6.807  1.00 0.00 ? 25  ASN A C    6  
ATOM   3614  O  O    . ASN A 1 25 ? 5.064   -7.891  -7.161  1.00 0.00 ? 25  ASN A O    6  
ATOM   3615  C  CB   . ASN A 1 25 ? 2.399   -6.935  -5.110  1.00 0.00 ? 25  ASN A CB   6  
ATOM   3616  C  CG   . ASN A 1 25 ? 2.044   -7.322  -3.688  1.00 0.00 ? 25  ASN A CG   6  
ATOM   3617  O  OD1  . ASN A 1 25 ? 2.866   -7.878  -2.960  1.00 0.00 ? 25  ASN A OD1  6  
ATOM   3618  N  ND2  . ASN A 1 25 ? 0.813   -7.027  -3.285  1.00 0.00 ? 25  ASN A ND2  6  
ATOM   3619  H  H    . ASN A 1 25 ? 3.839   -4.772  -4.919  1.00 0.00 ? 25  ASN A H    6  
ATOM   3620  H  HA   . ASN A 1 25 ? 4.395   -7.623  -4.756  1.00 0.00 ? 25  ASN A HA   6  
ATOM   3621  H  HB2  . ASN A 1 25 ? 1.954   -5.975  -5.324  1.00 0.00 ? 25  ASN A HB2  6  
ATOM   3622  H  HB3  . ASN A 1 25 ? 1.986   -7.676  -5.779  1.00 0.00 ? 25  ASN A HB3  6  
ATOM   3623  H  HD21 . ASN A 1 25 ? 0.211   -6.584  -3.919  1.00 0.00 ? 25  ASN A HD21 6  
ATOM   3624  H  HD22 . ASN A 1 25 ? 0.556   -7.265  -2.370  1.00 0.00 ? 25  ASN A HD22 6  
ATOM   3625  N  N    . PHE A 1 26 ? 3.572   -6.285  -7.665  1.00 0.00 ? 26  PHE A N    6  
ATOM   3626  C  CA   . PHE A 1 26 ? 3.788   -6.383  -9.104  1.00 0.00 ? 26  PHE A CA   6  
ATOM   3627  C  C    . PHE A 1 26 ? 5.264   -6.203  -9.446  1.00 0.00 ? 26  PHE A C    6  
ATOM   3628  O  O    . PHE A 1 26 ? 5.744   -6.710  -10.460 1.00 0.00 ? 26  PHE A O    6  
ATOM   3629  C  CB   . PHE A 1 26 ? 2.952   -5.334  -9.839  1.00 0.00 ? 26  PHE A CB   6  
ATOM   3630  C  CG   . PHE A 1 26 ? 2.525   -5.764  -11.214 1.00 0.00 ? 26  PHE A CG   6  
ATOM   3631  C  CD1  . PHE A 1 26 ? 3.445   -5.841  -12.247 1.00 0.00 ? 26  PHE A CD1  6  
ATOM   3632  C  CD2  . PHE A 1 26 ? 1.204   -6.090  -11.473 1.00 0.00 ? 26  PHE A CD2  6  
ATOM   3633  C  CE1  . PHE A 1 26 ? 3.055   -6.236  -13.512 1.00 0.00 ? 26  PHE A CE1  6  
ATOM   3634  C  CE2  . PHE A 1 26 ? 0.807   -6.486  -12.737 1.00 0.00 ? 26  PHE A CE2  6  
ATOM   3635  C  CZ   . PHE A 1 26 ? 1.735   -6.559  -13.758 1.00 0.00 ? 26  PHE A CZ   6  
ATOM   3636  H  H    . PHE A 1 26 ? 2.922   -5.635  -7.322  1.00 0.00 ? 26  PHE A H    6  
ATOM   3637  H  HA   . PHE A 1 26 ? 3.475   -7.366  -9.419  1.00 0.00 ? 26  PHE A HA   6  
ATOM   3638  H  HB2  . PHE A 1 26 ? 2.061   -5.127  -9.266  1.00 0.00 ? 26  PHE A HB2  6  
ATOM   3639  H  HB3  . PHE A 1 26 ? 3.530   -4.427  -9.938  1.00 0.00 ? 26  PHE A HB3  6  
ATOM   3640  H  HD1  . PHE A 1 26 ? 4.478   -5.590  -12.056 1.00 0.00 ? 26  PHE A HD1  6  
ATOM   3641  H  HD2  . PHE A 1 26 ? 0.477   -6.033  -10.675 1.00 0.00 ? 26  PHE A HD2  6  
ATOM   3642  H  HE1  . PHE A 1 26 ? 3.782   -6.293  -14.309 1.00 0.00 ? 26  PHE A HE1  6  
ATOM   3643  H  HE2  . PHE A 1 26 ? -0.226  -6.738  -12.925 1.00 0.00 ? 26  PHE A HE2  6  
ATOM   3644  H  HZ   . PHE A 1 26 ? 1.427   -6.867  -14.746 1.00 0.00 ? 26  PHE A HZ   6  
ATOM   3645  N  N    . SER A 1 27 ? 5.979   -5.477  -8.592  1.00 0.00 ? 27  SER A N    6  
ATOM   3646  C  CA   . SER A 1 27 ? 7.400   -5.226  -8.805  1.00 0.00 ? 27  SER A CA   6  
ATOM   3647  C  C    . SER A 1 27 ? 8.144   -6.527  -9.091  1.00 0.00 ? 27  SER A C    6  
ATOM   3648  O  O    . SER A 1 27 ? 8.683   -6.720  -10.180 1.00 0.00 ? 27  SER A O    6  
ATOM   3649  C  CB   . SER A 1 27 ? 8.006   -4.536  -7.581  1.00 0.00 ? 27  SER A CB   6  
ATOM   3650  O  OG   . SER A 1 27 ? 9.411   -4.715  -7.539  1.00 0.00 ? 27  SER A OG   6  
ATOM   3651  H  H    . SER A 1 27 ? 5.540   -5.099  -7.802  1.00 0.00 ? 27  SER A H    6  
ATOM   3652  H  HA   . SER A 1 27 ? 7.497   -4.574  -9.660  1.00 0.00 ? 27  SER A HA   6  
ATOM   3653  H  HB2  . SER A 1 27 ? 7.792   -3.479  -7.624  1.00 0.00 ? 27  SER A HB2  6  
ATOM   3654  H  HB3  . SER A 1 27 ? 7.575   -4.956  -6.684  1.00 0.00 ? 27  SER A HB3  6  
ATOM   3655  H  HG   . SER A 1 27 ? 9.612   -5.647  -7.421  1.00 0.00 ? 27  SER A HG   6  
ATOM   3656  N  N    . ALA A 1 28 ? 8.170   -7.416  -8.103  1.00 0.00 ? 28  ALA A N    6  
ATOM   3657  C  CA   . ALA A 1 28 ? 8.847   -8.699  -8.248  1.00 0.00 ? 28  ALA A CA   6  
ATOM   3658  C  C    . ALA A 1 28 ? 7.855   -9.807  -8.586  1.00 0.00 ? 28  ALA A C    6  
ATOM   3659  O  O    . ALA A 1 28 ? 7.983   -10.475 -9.612  1.00 0.00 ? 28  ALA A O    6  
ATOM   3660  C  CB   . ALA A 1 28 ? 9.609   -9.040  -6.976  1.00 0.00 ? 28  ALA A CB   6  
ATOM   3661  H  H    . ALA A 1 28 ? 7.723   -7.204  -7.258  1.00 0.00 ? 28  ALA A H    6  
ATOM   3662  H  HA   . ALA A 1 28 ? 9.561   -8.611  -9.054  1.00 0.00 ? 28  ALA A HA   6  
ATOM   3663  H  HB1  . ALA A 1 28 ? 9.702   -10.113 -6.890  1.00 0.00 ? 28  ALA A HB1  6  
ATOM   3664  H  HB2  . ALA A 1 28 ? 10.592  -8.595  -7.015  1.00 0.00 ? 28  ALA A HB2  6  
ATOM   3665  H  HB3  . ALA A 1 28 ? 9.073   -8.656  -6.121  1.00 0.00 ? 28  ALA A HB3  6  
ATOM   3666  N  N    . TYR A 1 29 ? 6.868   -9.997  -7.717  1.00 0.00 ? 29  TYR A N    6  
ATOM   3667  C  CA   . TYR A 1 29 ? 5.857   -11.026 -7.923  1.00 0.00 ? 29  TYR A CA   6  
ATOM   3668  C  C    . TYR A 1 29 ? 5.277   -10.947 -9.332  1.00 0.00 ? 29  TYR A C    6  
ATOM   3669  O  O    . TYR A 1 29 ? 5.258   -11.936 -10.064 1.00 0.00 ? 29  TYR A O    6  
ATOM   3670  C  CB   . TYR A 1 29 ? 4.737   -10.884 -6.891  1.00 0.00 ? 29  TYR A CB   6  
ATOM   3671  C  CG   . TYR A 1 29 ? 5.220   -10.959 -5.460  1.00 0.00 ? 29  TYR A CG   6  
ATOM   3672  C  CD1  . TYR A 1 29 ? 5.762   -9.846  -4.829  1.00 0.00 ? 29  TYR A CD1  6  
ATOM   3673  C  CD2  . TYR A 1 29 ? 5.132   -12.143 -4.738  1.00 0.00 ? 29  TYR A CD2  6  
ATOM   3674  C  CE1  . TYR A 1 29 ? 6.205   -9.911  -3.522  1.00 0.00 ? 29  TYR A CE1  6  
ATOM   3675  C  CE2  . TYR A 1 29 ? 5.571   -12.217 -3.430  1.00 0.00 ? 29  TYR A CE2  6  
ATOM   3676  C  CZ   . TYR A 1 29 ? 6.107   -11.098 -2.827  1.00 0.00 ? 29  TYR A CZ   6  
ATOM   3677  O  OH   . TYR A 1 29 ? 6.546   -11.166 -1.524  1.00 0.00 ? 29  TYR A OH   6  
ATOM   3678  H  H    . TYR A 1 29 ? 6.820   -9.432  -6.918  1.00 0.00 ? 29  TYR A H    6  
ATOM   3679  H  HA   . TYR A 1 29 ? 6.331   -11.988 -7.795  1.00 0.00 ? 29  TYR A HA   6  
ATOM   3680  H  HB2  . TYR A 1 29 ? 4.251   -9.930  -7.026  1.00 0.00 ? 29  TYR A HB2  6  
ATOM   3681  H  HB3  . TYR A 1 29 ? 4.016   -11.675 -7.040  1.00 0.00 ? 29  TYR A HB3  6  
ATOM   3682  H  HD1  . TYR A 1 29 ? 5.836   -8.918  -5.376  1.00 0.00 ? 29  TYR A HD1  6  
ATOM   3683  H  HD2  . TYR A 1 29 ? 4.712   -13.018 -5.213  1.00 0.00 ? 29  TYR A HD2  6  
ATOM   3684  H  HE1  . TYR A 1 29 ? 6.624   -9.035  -3.049  1.00 0.00 ? 29  TYR A HE1  6  
ATOM   3685  H  HE2  . TYR A 1 29 ? 5.495   -13.146 -2.885  1.00 0.00 ? 29  TYR A HE2  6  
ATOM   3686  H  HH   . TYR A 1 29 ? 7.505   -11.135 -1.508  1.00 0.00 ? 29  TYR A HH   6  
ATOM   3687  N  N    . GLY A 1 30 ? 4.806   -9.761  -9.706  1.00 0.00 ? 30  GLY A N    6  
ATOM   3688  C  CA   . GLY A 1 30 ? 4.233   -9.573  -11.026 1.00 0.00 ? 30  GLY A CA   6  
ATOM   3689  C  C    . GLY A 1 30 ? 2.754   -9.246  -10.974 1.00 0.00 ? 30  GLY A C    6  
ATOM   3690  O  O    . GLY A 1 30 ? 2.226   -8.586  -11.869 1.00 0.00 ? 30  GLY A O    6  
ATOM   3691  H  H    . GLY A 1 30 ? 4.848   -9.008  -9.080  1.00 0.00 ? 30  GLY A H    6  
ATOM   3692  H  HA2  . GLY A 1 30 ? 4.753   -8.766  -11.520 1.00 0.00 ? 30  GLY A HA2  6  
ATOM   3693  H  HA3  . GLY A 1 30 ? 4.369   -10.479 -11.597 1.00 0.00 ? 30  GLY A HA3  6  
ATOM   3694  N  N    . TRP A 1 31 ? 2.083   -9.708  -9.925  1.00 0.00 ? 31  TRP A N    6  
ATOM   3695  C  CA   . TRP A 1 31 ? 0.655   -9.462  -9.762  1.00 0.00 ? 31  TRP A CA   6  
ATOM   3696  C  C    . TRP A 1 31 ? 0.400   -8.468  -8.635  1.00 0.00 ? 31  TRP A C    6  
ATOM   3697  O  O    . TRP A 1 31 ? 1.242   -8.280  -7.756  1.00 0.00 ? 31  TRP A O    6  
ATOM   3698  C  CB   . TRP A 1 31 ? -0.080  -10.773 -9.478  1.00 0.00 ? 31  TRP A CB   6  
ATOM   3699  C  CG   . TRP A 1 31 ? -0.204  -11.080 -8.016  1.00 0.00 ? 31  TRP A CG   6  
ATOM   3700  C  CD1  . TRP A 1 31 ? 0.734   -11.674 -7.221  1.00 0.00 ? 31  TRP A CD1  6  
ATOM   3701  C  CD2  . TRP A 1 31 ? -1.332  -10.810 -7.177  1.00 0.00 ? 31  TRP A CD2  6  
ATOM   3702  N  NE1  . TRP A 1 31 ? 0.257   -11.790 -5.937  1.00 0.00 ? 31  TRP A NE1  6  
ATOM   3703  C  CE2  . TRP A 1 31 ? -1.008  -11.266 -5.884  1.00 0.00 ? 31  TRP A CE2  6  
ATOM   3704  C  CE3  . TRP A 1 31 ? -2.583  -10.225 -7.390  1.00 0.00 ? 31  TRP A CE3  6  
ATOM   3705  C  CZ2  . TRP A 1 31 ? -1.891  -11.156 -4.813  1.00 0.00 ? 31  TRP A CZ2  6  
ATOM   3706  C  CZ3  . TRP A 1 31 ? -3.458  -10.117 -6.326  1.00 0.00 ? 31  TRP A CZ3  6  
ATOM   3707  C  CH2  . TRP A 1 31 ? -3.108  -10.579 -5.051  1.00 0.00 ? 31  TRP A CH2  6  
ATOM   3708  H  H    . TRP A 1 31 ? 2.560   -10.228 -9.244  1.00 0.00 ? 31  TRP A H    6  
ATOM   3709  H  HA   . TRP A 1 31 ? 0.284   -9.045  -10.686 1.00 0.00 ? 31  TRP A HA   6  
ATOM   3710  H  HB2  . TRP A 1 31 ? -1.075  -10.718 -9.892  1.00 0.00 ? 31  TRP A HB2  6  
ATOM   3711  H  HB3  . TRP A 1 31 ? 0.456   -11.586 -9.946  1.00 0.00 ? 31  TRP A HB3  6  
ATOM   3712  H  HD1  . TRP A 1 31 ? 1.703   -12.002 -7.565  1.00 0.00 ? 31  TRP A HD1  6  
ATOM   3713  H  HE1  . TRP A 1 31 ? 0.744   -12.182 -5.183  1.00 0.00 ? 31  TRP A HE1  6  
ATOM   3714  H  HE3  . TRP A 1 31 ? -2.871  -9.862  -8.366  1.00 0.00 ? 31  TRP A HE3  6  
ATOM   3715  H  HZ2  . TRP A 1 31 ? -1.636  -11.507 -3.823  1.00 0.00 ? 31  TRP A HZ2  6  
ATOM   3716  H  HZ3  . TRP A 1 31 ? -4.430  -9.668  -6.472  1.00 0.00 ? 31  TRP A HZ3  6  
ATOM   3717  H  HH2  . TRP A 1 31 ? -3.823  -10.474 -4.249  1.00 0.00 ? 31  TRP A HH2  6  
ATOM   3718  N  N    . CYS A 1 32 ? -0.767  -7.833  -8.665  1.00 0.00 ? 32  CYS A N    6  
ATOM   3719  C  CA   . CYS A 1 32 ? -1.134  -6.857  -7.646  1.00 0.00 ? 32  CYS A CA   6  
ATOM   3720  C  C    . CYS A 1 32 ? -2.635  -6.893  -7.373  1.00 0.00 ? 32  CYS A C    6  
ATOM   3721  O  O    . CYS A 1 32 ? -3.457  -6.936  -8.289  1.00 0.00 ? 32  CYS A O    6  
ATOM   3722  C  CB   . CYS A 1 32 ? -0.718  -5.451  -8.084  1.00 0.00 ? 32  CYS A CB   6  
ATOM   3723  S  SG   . CYS A 1 32 ? -1.015  -4.163  -6.829  1.00 0.00 ? 32  CYS A SG   6  
ATOM   3724  H  H    . CYS A 1 32 ? -1.398  -8.025  -9.391  1.00 0.00 ? 32  CYS A H    6  
ATOM   3725  H  HA   . CYS A 1 32 ? -0.609  -7.112  -6.738  1.00 0.00 ? 32  CYS A HA   6  
ATOM   3726  H  HB2  . CYS A 1 32 ? 0.338   -5.450  -8.310  1.00 0.00 ? 32  CYS A HB2  6  
ATOM   3727  H  HB3  . CYS A 1 32 ? -1.271  -5.180  -8.971  1.00 0.00 ? 32  CYS A HB3  6  
ATOM   3728  N  N    . PRO A 1 33 ? -3.002  -6.875  -6.083  1.00 0.00 ? 33  PRO A N    6  
ATOM   3729  C  CA   . PRO A 1 33 ? -4.405  -6.904  -5.659  1.00 0.00 ? 33  PRO A CA   6  
ATOM   3730  C  C    . PRO A 1 33 ? -5.137  -5.608  -5.987  1.00 0.00 ? 33  PRO A C    6  
ATOM   3731  O  O    . PRO A 1 33 ? -6.331  -5.471  -5.716  1.00 0.00 ? 33  PRO A O    6  
ATOM   3732  C  CB   . PRO A 1 33 ? -4.313  -7.098  -4.143  1.00 0.00 ? 33  PRO A CB   6  
ATOM   3733  C  CG   . PRO A 1 33 ? -2.981  -6.546  -3.771  1.00 0.00 ? 33  PRO A CG   6  
ATOM   3734  C  CD   . PRO A 1 33 ? -2.076  -6.824  -4.939  1.00 0.00 ? 33  PRO A CD   6  
ATOM   3735  H  HA   . PRO A 1 33 ? -4.935  -7.737  -6.098  1.00 0.00 ? 33  PRO A HA   6  
ATOM   3736  H  HB2  . PRO A 1 33 ? -5.115  -6.557  -3.660  1.00 0.00 ? 33  PRO A HB2  6  
ATOM   3737  H  HB3  . PRO A 1 33 ? -4.386  -8.148  -3.906  1.00 0.00 ? 33  PRO A HB3  6  
ATOM   3738  H  HG2  . PRO A 1 33 ? -3.058  -5.483  -3.601  1.00 0.00 ? 33  PRO A HG2  6  
ATOM   3739  H  HG3  . PRO A 1 33 ? -2.612  -7.043  -2.886  1.00 0.00 ? 33  PRO A HG3  6  
ATOM   3740  H  HD2  . PRO A 1 33 ? -1.359  -6.025  -5.059  1.00 0.00 ? 33  PRO A HD2  6  
ATOM   3741  H  HD3  . PRO A 1 33 ? -1.572  -7.770  -4.809  1.00 0.00 ? 33  PRO A HD3  6  
ATOM   3742  N  N    . LEU A 1 34 ? -4.416  -4.658  -6.573  1.00 0.00 ? 34  LEU A N    6  
ATOM   3743  C  CA   . LEU A 1 34 ? -4.997  -3.372  -6.939  1.00 0.00 ? 34  LEU A CA   6  
ATOM   3744  C  C    . LEU A 1 34 ? -5.037  -3.203  -8.454  1.00 0.00 ? 34  LEU A C    6  
ATOM   3745  O  O    . LEU A 1 34 ? -5.772  -2.367  -8.978  1.00 0.00 ? 34  LEU A O    6  
ATOM   3746  C  CB   . LEU A 1 34 ? -4.198  -2.230  -6.308  1.00 0.00 ? 34  LEU A CB   6  
ATOM   3747  C  CG   . LEU A 1 34 ? -4.420  -2.002  -4.813  1.00 0.00 ? 34  LEU A CG   6  
ATOM   3748  C  CD1  . LEU A 1 34 ? -3.513  -0.893  -4.302  1.00 0.00 ? 34  LEU A CD1  6  
ATOM   3749  C  CD2  . LEU A 1 34 ? -5.879  -1.670  -4.535  1.00 0.00 ? 34  LEU A CD2  6  
ATOM   3750  H  H    . LEU A 1 34 ? -3.470  -4.826  -6.764  1.00 0.00 ? 34  LEU A H    6  
ATOM   3751  H  HA   . LEU A 1 34 ? -6.008  -3.345  -6.560  1.00 0.00 ? 34  LEU A HA   6  
ATOM   3752  H  HB2  . LEU A 1 34 ? -3.150  -2.438  -6.458  1.00 0.00 ? 34  LEU A HB2  6  
ATOM   3753  H  HB3  . LEU A 1 34 ? -4.460  -1.318  -6.826  1.00 0.00 ? 34  LEU A HB3  6  
ATOM   3754  H  HG   . LEU A 1 34 ? -4.174  -2.907  -4.276  1.00 0.00 ? 34  LEU A HG   6  
ATOM   3755  H  HD11 . LEU A 1 34 ? -2.893  -1.274  -3.505  1.00 0.00 ? 34  LEU A HD11 6  
ATOM   3756  H  HD12 . LEU A 1 34 ? -4.116  -0.077  -3.930  1.00 0.00 ? 34  LEU A HD12 6  
ATOM   3757  H  HD13 . LEU A 1 34 ? -2.887  -0.539  -5.108  1.00 0.00 ? 34  LEU A HD13 6  
ATOM   3758  H  HD21 . LEU A 1 34 ? -6.429  -2.584  -4.363  1.00 0.00 ? 34  LEU A HD21 6  
ATOM   3759  H  HD22 . LEU A 1 34 ? -6.299  -1.152  -5.385  1.00 0.00 ? 34  LEU A HD22 6  
ATOM   3760  H  HD23 . LEU A 1 34 ? -5.945  -1.040  -3.660  1.00 0.00 ? 34  LEU A HD23 6  
ATOM   3761  N  N    . GLY A 1 35 ? -4.241  -4.006  -9.155  1.00 0.00 ? 35  GLY A N    6  
ATOM   3762  C  CA   . GLY A 1 35 ? -4.201  -3.931  -10.604 1.00 0.00 ? 35  GLY A CA   6  
ATOM   3763  C  C    . GLY A 1 35 ? -3.671  -2.601  -11.102 1.00 0.00 ? 35  GLY A C    6  
ATOM   3764  O  O    . GLY A 1 35 ? -2.737  -2.030  -10.537 1.00 0.00 ? 35  GLY A O    6  
ATOM   3765  H  H    . GLY A 1 35 ? -3.675  -4.653  -8.684  1.00 0.00 ? 35  GLY A H    6  
ATOM   3766  H  HA2  . GLY A 1 35 ? -3.568  -4.722  -10.977 1.00 0.00 ? 35  GLY A HA2  6  
ATOM   3767  H  HA3  . GLY A 1 35 ? -5.201  -4.073  -10.987 1.00 0.00 ? 35  GLY A HA3  6  
ATOM   3768  N  N    . PRO A 1 36 ? -4.272  -2.088  -12.185 1.00 0.00 ? 36  PRO A N    6  
ATOM   3769  C  CA   . PRO A 1 36 ? -3.870  -0.812  -12.783 1.00 0.00 ? 36  PRO A CA   6  
ATOM   3770  C  C    . PRO A 1 36 ? -4.226  0.380   -11.901 1.00 0.00 ? 36  PRO A C    6  
ATOM   3771  O  O    . PRO A 1 36 ? -3.499  1.372   -11.861 1.00 0.00 ? 36  PRO A O    6  
ATOM   3772  C  CB   . PRO A 1 36 ? -4.667  -0.766  -14.090 1.00 0.00 ? 36  PRO A CB   6  
ATOM   3773  C  CG   . PRO A 1 36 ? -5.856  -1.628  -13.839 1.00 0.00 ? 36  PRO A CG   6  
ATOM   3774  C  CD   . PRO A 1 36 ? -5.391  -2.714  -12.909 1.00 0.00 ? 36  PRO A CD   6  
ATOM   3775  H  HA   . PRO A 1 36 ? -2.813  -0.792  -13.004 1.00 0.00 ? 36  PRO A HA   6  
ATOM   3776  H  HB2  . PRO A 1 36 ? -4.955  0.254   -14.303 1.00 0.00 ? 36  PRO A HB2  6  
ATOM   3777  H  HB3  . PRO A 1 36 ? -4.064  -1.152  -14.897 1.00 0.00 ? 36  PRO A HB3  6  
ATOM   3778  H  HG2  . PRO A 1 36 ? -6.639  -1.047  -13.375 1.00 0.00 ? 36  PRO A HG2  6  
ATOM   3779  H  HG3  . PRO A 1 36 ? -6.203  -2.053  -14.768 1.00 0.00 ? 36  PRO A HG3  6  
ATOM   3780  H  HD2  . PRO A 1 36 ? -6.183  -2.993  -12.229 1.00 0.00 ? 36  PRO A HD2  6  
ATOM   3781  H  HD3  . PRO A 1 36 ? -5.054  -3.573  -13.471 1.00 0.00 ? 36  PRO A HD3  6  
ATOM   3782  N  N    . GLN A 1 37 ? -5.347  0.274   -11.195 1.00 0.00 ? 37  GLN A N    6  
ATOM   3783  C  CA   . GLN A 1 37 ? -5.798  1.344   -10.313 1.00 0.00 ? 37  GLN A CA   6  
ATOM   3784  C  C    . GLN A 1 37 ? -4.768  1.622   -9.223  1.00 0.00 ? 37  GLN A C    6  
ATOM   3785  O  O    . GLN A 1 37 ? -4.700  2.728   -8.686  1.00 0.00 ? 37  GLN A O    6  
ATOM   3786  C  CB   . GLN A 1 37 ? -7.142  0.980   -9.681  1.00 0.00 ? 37  GLN A CB   6  
ATOM   3787  C  CG   . GLN A 1 37 ? -8.341  1.370   -10.530 1.00 0.00 ? 37  GLN A CG   6  
ATOM   3788  C  CD   . GLN A 1 37 ? -9.627  1.435   -9.731  1.00 0.00 ? 37  GLN A CD   6  
ATOM   3789  O  OE1  . GLN A 1 37 ? -10.503 0.581   -9.871  1.00 0.00 ? 37  GLN A OE1  6  
ATOM   3790  N  NE2  . GLN A 1 37 ? -9.748  2.452   -8.885  1.00 0.00 ? 37  GLN A NE2  6  
ATOM   3791  H  H    . GLN A 1 37 ? -5.884  -0.542  -11.270 1.00 0.00 ? 37  GLN A H    6  
ATOM   3792  H  HA   . GLN A 1 37 ? -5.922  2.235   -10.910 1.00 0.00 ? 37  GLN A HA   6  
ATOM   3793  H  HB2  . GLN A 1 37 ? -7.174  -0.087  -9.520  1.00 0.00 ? 37  GLN A HB2  6  
ATOM   3794  H  HB3  . GLN A 1 37 ? -7.226  1.482   -8.728  1.00 0.00 ? 37  GLN A HB3  6  
ATOM   3795  H  HG2  . GLN A 1 37 ? -8.157  2.341   -10.966 1.00 0.00 ? 37  GLN A HG2  6  
ATOM   3796  H  HG3  . GLN A 1 37 ? -8.460  0.641   -11.318 1.00 0.00 ? 37  GLN A HG3  6  
ATOM   3797  H  HE21 . GLN A 1 37 ? -9.010  3.095   -8.827  1.00 0.00 ? 37  GLN A HE21 6  
ATOM   3798  H  HE22 . GLN A 1 37 ? -10.569 2.519   -8.357  1.00 0.00 ? 37  GLN A HE22 6  
ATOM   3799  N  N    . CYS A 1 38 ? -3.969  0.611   -8.901  1.00 0.00 ? 38  CYS A N    6  
ATOM   3800  C  CA   . CYS A 1 38 ? -2.942  0.745   -7.874  1.00 0.00 ? 38  CYS A CA   6  
ATOM   3801  C  C    . CYS A 1 38 ? -2.225  2.087   -7.993  1.00 0.00 ? 38  CYS A C    6  
ATOM   3802  O  O    . CYS A 1 38 ? -1.844  2.520   -9.081  1.00 0.00 ? 38  CYS A O    6  
ATOM   3803  C  CB   . CYS A 1 38 ? -1.930  -0.398  -7.983  1.00 0.00 ? 38  CYS A CB   6  
ATOM   3804  S  SG   . CYS A 1 38 ? -0.706  -0.438  -6.634  1.00 0.00 ? 38  CYS A SG   6  
ATOM   3805  H  H    . CYS A 1 38 ? -4.071  -0.247  -9.364  1.00 0.00 ? 38  CYS A H    6  
ATOM   3806  H  HA   . CYS A 1 38 ? -3.427  0.694   -6.911  1.00 0.00 ? 38  CYS A HA   6  
ATOM   3807  H  HB2  . CYS A 1 38 ? -2.460  -1.339  -7.974  1.00 0.00 ? 38  CYS A HB2  6  
ATOM   3808  H  HB3  . CYS A 1 38 ? -1.391  -0.303  -8.914  1.00 0.00 ? 38  CYS A HB3  6  
ATOM   3809  N  N    . PRO A 1 39 ? -2.038  2.761   -6.849  1.00 0.00 ? 39  PRO A N    6  
ATOM   3810  C  CA   . PRO A 1 39 ? -1.365  4.062   -6.798  1.00 0.00 ? 39  PRO A CA   6  
ATOM   3811  C  C    . PRO A 1 39 ? 0.127   3.956   -7.095  1.00 0.00 ? 39  PRO A C    6  
ATOM   3812  O  O    . PRO A 1 39 ? 0.810   4.967   -7.255  1.00 0.00 ? 39  PRO A O    6  
ATOM   3813  C  CB   . PRO A 1 39 ? -1.592  4.523   -5.356  1.00 0.00 ? 39  PRO A CB   6  
ATOM   3814  C  CG   . PRO A 1 39 ? -1.784  3.264   -4.582  1.00 0.00 ? 39  PRO A CG   6  
ATOM   3815  C  CD   . PRO A 1 39 ? -2.467  2.304   -5.517  1.00 0.00 ? 39  PRO A CD   6  
ATOM   3816  H  HA   . PRO A 1 39 ? -1.817  4.769   -7.479  1.00 0.00 ? 39  PRO A HA   6  
ATOM   3817  H  HB2  . PRO A 1 39 ? -0.728  5.072   -5.011  1.00 0.00 ? 39  PRO A HB2  6  
ATOM   3818  H  HB3  . PRO A 1 39 ? -2.468  5.152   -5.309  1.00 0.00 ? 39  PRO A HB3  6  
ATOM   3819  H  HG2  . PRO A 1 39 ? -0.826  2.872   -4.276  1.00 0.00 ? 39  PRO A HG2  6  
ATOM   3820  H  HG3  . PRO A 1 39 ? -2.407  3.455   -3.721  1.00 0.00 ? 39  PRO A HG3  6  
ATOM   3821  H  HD2  . PRO A 1 39 ? -2.133  1.294   -5.329  1.00 0.00 ? 39  PRO A HD2  6  
ATOM   3822  H  HD3  . PRO A 1 39 ? -3.539  2.374   -5.413  1.00 0.00 ? 39  PRO A HD3  6  
ATOM   3823  N  N    . GLN A 1 40 ? 0.625   2.726   -7.167  1.00 0.00 ? 40  GLN A N    6  
ATOM   3824  C  CA   . GLN A 1 40 ? 2.037   2.489   -7.445  1.00 0.00 ? 40  GLN A CA   6  
ATOM   3825  C  C    . GLN A 1 40 ? 2.234   1.986   -8.871  1.00 0.00 ? 40  GLN A C    6  
ATOM   3826  O  O    . GLN A 1 40 ? 1.315   1.438   -9.479  1.00 0.00 ? 40  GLN A O    6  
ATOM   3827  C  CB   . GLN A 1 40 ? 2.611   1.479   -6.450  1.00 0.00 ? 40  GLN A CB   6  
ATOM   3828  C  CG   . GLN A 1 40 ? 2.637   1.983   -5.017  1.00 0.00 ? 40  GLN A CG   6  
ATOM   3829  C  CD   . GLN A 1 40 ? 2.877   0.874   -4.012  1.00 0.00 ? 40  GLN A CD   6  
ATOM   3830  O  OE1  . GLN A 1 40 ? 2.036   -0.008  -3.831  1.00 0.00 ? 40  GLN A OE1  6  
ATOM   3831  N  NE2  . GLN A 1 40 ? 4.028   0.912   -3.352  1.00 0.00 ? 40  GLN A NE2  6  
ATOM   3832  H  H    . GLN A 1 40 ? 0.030   1.961   -7.030  1.00 0.00 ? 40  GLN A H    6  
ATOM   3833  H  HA   . GLN A 1 40 ? 2.558   3.428   -7.332  1.00 0.00 ? 40  GLN A HA   6  
ATOM   3834  H  HB2  . GLN A 1 40 ? 2.013   0.580   -6.483  1.00 0.00 ? 40  GLN A HB2  6  
ATOM   3835  H  HB3  . GLN A 1 40 ? 3.623   1.239   -6.743  1.00 0.00 ? 40  GLN A HB3  6  
ATOM   3836  H  HG2  . GLN A 1 40 ? 3.427   2.713   -4.919  1.00 0.00 ? 40  GLN A HG2  6  
ATOM   3837  H  HG3  . GLN A 1 40 ? 1.688   2.450   -4.796  1.00 0.00 ? 40  GLN A HG3  6  
ATOM   3838  H  HE21 . GLN A 1 40 ? 4.650   1.645   -3.547  1.00 0.00 ? 40  GLN A HE21 6  
ATOM   3839  H  HE22 . GLN A 1 40 ? 4.209   0.208   -2.696  1.00 0.00 ? 40  GLN A HE22 6  
ATOM   3840  N  N    . SER A 1 41 ? 3.439   2.177   -9.399  1.00 0.00 ? 41  SER A N    6  
ATOM   3841  C  CA   . SER A 1 41 ? 3.756   1.745   -10.755 1.00 0.00 ? 41  SER A CA   6  
ATOM   3842  C  C    . SER A 1 41 ? 4.063   0.251   -10.793 1.00 0.00 ? 41  SER A C    6  
ATOM   3843  O  O    . SER A 1 41 ? 4.461   -0.338  -9.788  1.00 0.00 ? 41  SER A O    6  
ATOM   3844  C  CB   . SER A 1 41 ? 4.948   2.536   -11.299 1.00 0.00 ? 41  SER A CB   6  
ATOM   3845  O  OG   . SER A 1 41 ? 4.866   2.678   -12.707 1.00 0.00 ? 41  SER A OG   6  
ATOM   3846  H  H    . SER A 1 41 ? 4.130   2.620   -8.864  1.00 0.00 ? 41  SER A H    6  
ATOM   3847  H  HA   . SER A 1 41 ? 2.893   1.940   -11.375 1.00 0.00 ? 41  SER A HA   6  
ATOM   3848  H  HB2  . SER A 1 41 ? 4.960   3.518   -10.851 1.00 0.00 ? 41  SER A HB2  6  
ATOM   3849  H  HB3  . SER A 1 41 ? 5.863   2.017   -11.054 1.00 0.00 ? 41  SER A HB3  6  
ATOM   3850  H  HG   . SER A 1 41 ? 4.727   3.602   -12.928 1.00 0.00 ? 41  SER A HG   6  
ATOM   3851  N  N    . HIS A 1 42 ? 3.875   -0.356  -11.960 1.00 0.00 ? 42  HIS A N    6  
ATOM   3852  C  CA   . HIS A 1 42 ? 4.131   -1.781  -12.131 1.00 0.00 ? 42  HIS A CA   6  
ATOM   3853  C  C    . HIS A 1 42 ? 5.067   -2.028  -13.311 1.00 0.00 ? 42  HIS A C    6  
ATOM   3854  O  O    . HIS A 1 42 ? 4.623   -2.372  -14.406 1.00 0.00 ? 42  HIS A O    6  
ATOM   3855  C  CB   . HIS A 1 42 ? 2.818   -2.536  -12.340 1.00 0.00 ? 42  HIS A CB   6  
ATOM   3856  C  CG   . HIS A 1 42 ? 1.948   -2.572  -11.121 1.00 0.00 ? 42  HIS A CG   6  
ATOM   3857  N  ND1  . HIS A 1 42 ? 0.596   -2.841  -11.170 1.00 0.00 ? 42  HIS A ND1  6  
ATOM   3858  C  CD2  . HIS A 1 42 ? 2.243   -2.372  -9.816  1.00 0.00 ? 42  HIS A CD2  6  
ATOM   3859  C  CE1  . HIS A 1 42 ? 0.098   -2.804  -9.947  1.00 0.00 ? 42  HIS A CE1  6  
ATOM   3860  N  NE2  . HIS A 1 42 ? 1.077   -2.522  -9.107  1.00 0.00 ? 42  HIS A NE2  6  
ATOM   3861  H  H    . HIS A 1 42 ? 3.556   0.167   -12.725 1.00 0.00 ? 42  HIS A H    6  
ATOM   3862  H  HA   . HIS A 1 42 ? 4.605   -2.143  -11.231 1.00 0.00 ? 42  HIS A HA   6  
ATOM   3863  H  HB2  . HIS A 1 42 ? 2.260   -2.061  -13.132 1.00 0.00 ? 42  HIS A HB2  6  
ATOM   3864  H  HB3  . HIS A 1 42 ? 3.038   -3.556  -12.622 1.00 0.00 ? 42  HIS A HB3  6  
ATOM   3865  H  HD1  . HIS A 1 42 ? 0.079   -3.030  -11.980 1.00 0.00 ? 42  HIS A HD1  6  
ATOM   3866  H  HD2  . HIS A 1 42 ? 3.216   -2.138  -9.407  1.00 0.00 ? 42  HIS A HD2  6  
ATOM   3867  H  HE1  . HIS A 1 42 ? -0.934  -2.975  -9.679  1.00 0.00 ? 42  HIS A HE1  6  
ATOM   3868  N  N    . ASP A 1 43 ? 6.363   -1.848  -13.080 1.00 0.00 ? 43  ASP A N    6  
ATOM   3869  C  CA   . ASP A 1 43 ? 7.361   -2.051  -14.123 1.00 0.00 ? 43  ASP A CA   6  
ATOM   3870  C  C    . ASP A 1 43 ? 8.015   -3.422  -13.990 1.00 0.00 ? 43  ASP A C    6  
ATOM   3871  O  O    . ASP A 1 43 ? 8.689   -3.705  -12.998 1.00 0.00 ? 43  ASP A O    6  
ATOM   3872  C  CB   . ASP A 1 43 ? 8.426   -0.955  -14.060 1.00 0.00 ? 43  ASP A CB   6  
ATOM   3873  C  CG   . ASP A 1 43 ? 9.585   -1.219  -15.001 1.00 0.00 ? 43  ASP A CG   6  
ATOM   3874  O  OD1  . ASP A 1 43 ? 10.479  -2.011  -14.634 1.00 0.00 ? 43  ASP A OD1  6  
ATOM   3875  O  OD2  . ASP A 1 43 ? 9.598   -0.635  -16.104 1.00 0.00 ? 43  ASP A OD2  6  
ATOM   3876  H  H    . ASP A 1 43 ? 6.655   -1.573  -12.185 1.00 0.00 ? 43  ASP A H    6  
ATOM   3877  H  HA   . ASP A 1 43 ? 6.859   -1.997  -15.077 1.00 0.00 ? 43  ASP A HA   6  
ATOM   3878  H  HB2  . ASP A 1 43 ? 7.977   -0.010  -14.329 1.00 0.00 ? 43  ASP A HB2  6  
ATOM   3879  H  HB3  . ASP A 1 43 ? 8.810   -0.893  -13.053 1.00 0.00 ? 43  ASP A HB3  6  
ATOM   3880  N  N    . ILE A 1 44 ? 7.812   -4.270  -14.993 1.00 0.00 ? 44  ILE A N    6  
ATOM   3881  C  CA   . ILE A 1 44 ? 8.382   -5.611  -14.987 1.00 0.00 ? 44  ILE A CA   6  
ATOM   3882  C  C    . ILE A 1 44 ? 9.687   -5.657  -15.775 1.00 0.00 ? 44  ILE A C    6  
ATOM   3883  O  O    . ILE A 1 44 ? 9.679   -5.782  -17.000 1.00 0.00 ? 44  ILE A O    6  
ATOM   3884  C  CB   . ILE A 1 44 ? 7.402   -6.642  -15.576 1.00 0.00 ? 44  ILE A CB   6  
ATOM   3885  C  CG1  . ILE A 1 44 ? 6.110   -6.676  -14.757 1.00 0.00 ? 44  ILE A CG1  6  
ATOM   3886  C  CG2  . ILE A 1 44 ? 8.045   -8.020  -15.618 1.00 0.00 ? 44  ILE A CG2  6  
ATOM   3887  C  CD1  . ILE A 1 44 ? 6.291   -7.243  -13.367 1.00 0.00 ? 44  ILE A CD1  6  
ATOM   3888  H  H    . ILE A 1 44 ? 7.266   -3.986  -15.755 1.00 0.00 ? 44  ILE A H    6  
ATOM   3889  H  HA   . ILE A 1 44 ? 8.585   -5.882  -13.960 1.00 0.00 ? 44  ILE A HA   6  
ATOM   3890  H  HB   . ILE A 1 44 ? 7.171   -6.348  -16.588 1.00 0.00 ? 44  ILE A HB   6  
ATOM   3891  H  HG12 . ILE A 1 44 ? 5.727   -5.673  -14.658 1.00 0.00 ? 44  ILE A HG12 6  
ATOM   3892  H  HG13 . ILE A 1 44 ? 5.382   -7.285  -15.273 1.00 0.00 ? 44  ILE A HG13 6  
ATOM   3893  H  HG21 . ILE A 1 44 ? 7.355   -8.726  -16.057 1.00 0.00 ? 44  ILE A HG21 6  
ATOM   3894  H  HG22 . ILE A 1 44 ? 8.944   -7.979  -16.214 1.00 0.00 ? 44  ILE A HG22 6  
ATOM   3895  H  HG23 . ILE A 1 44 ? 8.292   -8.334  -14.615 1.00 0.00 ? 44  ILE A HG23 6  
ATOM   3896  H  HD11 . ILE A 1 44 ? 7.018   -6.654  -12.829 1.00 0.00 ? 44  ILE A HD11 6  
ATOM   3897  H  HD12 . ILE A 1 44 ? 5.347   -7.219  -12.842 1.00 0.00 ? 44  ILE A HD12 6  
ATOM   3898  H  HD13 . ILE A 1 44 ? 6.637   -8.265  -13.437 1.00 0.00 ? 44  ILE A HD13 6  
ATOM   3899  N  N    . SER A 1 45 ? 10.805  -5.558  -15.065 1.00 0.00 ? 45  SER A N    6  
ATOM   3900  C  CA   . SER A 1 45 ? 12.119  -5.586  -15.698 1.00 0.00 ? 45  SER A CA   6  
ATOM   3901  C  C    . SER A 1 45 ? 12.652  -7.013  -15.779 1.00 0.00 ? 45  SER A C    6  
ATOM   3902  O  O    . SER A 1 45 ? 13.093  -7.580  -14.780 1.00 0.00 ? 45  SER A O    6  
ATOM   3903  C  CB   . SER A 1 45 ? 13.101  -4.705  -14.924 1.00 0.00 ? 45  SER A CB   6  
ATOM   3904  O  OG   . SER A 1 45 ? 14.386  -4.727  -15.522 1.00 0.00 ? 45  SER A OG   6  
ATOM   3905  H  H    . SER A 1 45 ? 10.746  -5.460  -14.091 1.00 0.00 ? 45  SER A H    6  
ATOM   3906  H  HA   . SER A 1 45 ? 12.012  -5.197  -16.700 1.00 0.00 ? 45  SER A HA   6  
ATOM   3907  H  HB2  . SER A 1 45 ? 12.739  -3.688  -14.916 1.00 0.00 ? 45  SER A HB2  6  
ATOM   3908  H  HB3  . SER A 1 45 ? 13.182  -5.067  -13.910 1.00 0.00 ? 45  SER A HB3  6  
ATOM   3909  H  HG   . SER A 1 45 ? 14.484  -5.530  -16.039 1.00 0.00 ? 45  SER A HG   6  
ATOM   3910  N  N    . GLY A 1 46 ? 12.608  -7.588  -16.977 1.00 0.00 ? 46  GLY A N    6  
ATOM   3911  C  CA   . GLY A 1 46 ? 13.089  -8.944  -17.167 1.00 0.00 ? 46  GLY A CA   6  
ATOM   3912  C  C    . GLY A 1 46 ? 13.277  -9.293  -18.630 1.00 0.00 ? 46  GLY A C    6  
ATOM   3913  O  O    . GLY A 1 46 ? 13.185  -8.438  -19.511 1.00 0.00 ? 46  GLY A O    6  
ATOM   3914  H  H    . GLY A 1 46 ? 12.246  -7.088  -17.738 1.00 0.00 ? 46  GLY A H    6  
ATOM   3915  H  HA2  . GLY A 1 46 ? 14.035  -9.053  -16.658 1.00 0.00 ? 46  GLY A HA2  6  
ATOM   3916  H  HA3  . GLY A 1 46 ? 12.377  -9.631  -16.734 1.00 0.00 ? 46  GLY A HA3  6  
ATOM   3917  N  N    . PRO A 1 47 ? 13.547  -10.577 -18.906 1.00 0.00 ? 47  PRO A N    6  
ATOM   3918  C  CA   . PRO A 1 47 ? 13.755  -11.066 -20.273 1.00 0.00 ? 47  PRO A CA   6  
ATOM   3919  C  C    . PRO A 1 47 ? 12.469  -11.059 -21.092 1.00 0.00 ? 47  PRO A C    6  
ATOM   3920  O  O    . PRO A 1 47 ? 11.378  -10.884 -20.551 1.00 0.00 ? 47  PRO A O    6  
ATOM   3921  C  CB   . PRO A 1 47 ? 14.248  -12.500 -20.065 1.00 0.00 ? 47  PRO A CB   6  
ATOM   3922  C  CG   . PRO A 1 47 ? 13.699  -12.902 -18.740 1.00 0.00 ? 47  PRO A CG   6  
ATOM   3923  C  CD   . PRO A 1 47 ? 13.671  -11.651 -17.906 1.00 0.00 ? 47  PRO A CD   6  
ATOM   3924  H  HA   . PRO A 1 47 ? 14.512  -10.494 -20.788 1.00 0.00 ? 47  PRO A HA   6  
ATOM   3925  H  HB2  . PRO A 1 47 ? 13.872  -13.132 -20.857 1.00 0.00 ? 47  PRO A HB2  6  
ATOM   3926  H  HB3  . PRO A 1 47 ? 15.328  -12.517 -20.065 1.00 0.00 ? 47  PRO A HB3  6  
ATOM   3927  H  HG2  . PRO A 1 47 ? 12.700  -13.294 -18.860 1.00 0.00 ? 47  PRO A HG2  6  
ATOM   3928  H  HG3  . PRO A 1 47 ? 14.341  -13.641 -18.285 1.00 0.00 ? 47  PRO A HG3  6  
ATOM   3929  H  HD2  . PRO A 1 47 ? 12.820  -11.659 -17.241 1.00 0.00 ? 47  PRO A HD2  6  
ATOM   3930  H  HD3  . PRO A 1 47 ? 14.589  -11.551 -17.346 1.00 0.00 ? 47  PRO A HD3  6  
ATOM   3931  N  N    . SER A 1 48 ? 12.606  -11.252 -22.400 1.00 0.00 ? 48  SER A N    6  
ATOM   3932  C  CA   . SER A 1 48 ? 11.454  -11.264 -23.295 1.00 0.00 ? 48  SER A CA   6  
ATOM   3933  C  C    . SER A 1 48 ? 11.416  -12.552 -24.113 1.00 0.00 ? 48  SER A C    6  
ATOM   3934  O  O    . SER A 1 48 ? 10.363  -13.171 -24.266 1.00 0.00 ? 48  SER A O    6  
ATOM   3935  C  CB   . SER A 1 48 ? 11.496  -10.054 -24.231 1.00 0.00 ? 48  SER A CB   6  
ATOM   3936  O  OG   . SER A 1 48 ? 12.555  -10.168 -25.166 1.00 0.00 ? 48  SER A OG   6  
ATOM   3937  H  H    . SER A 1 48 ? 13.503  -11.386 -22.772 1.00 0.00 ? 48  SER A H    6  
ATOM   3938  H  HA   . SER A 1 48 ? 10.563  -11.209 -22.689 1.00 0.00 ? 48  SER A HA   6  
ATOM   3939  H  HB2  . SER A 1 48 ? 10.563  -9.986  -24.769 1.00 0.00 ? 48  SER A HB2  6  
ATOM   3940  H  HB3  . SER A 1 48 ? 11.642  -9.157  -23.647 1.00 0.00 ? 48  SER A HB3  6  
ATOM   3941  H  HG   . SER A 1 48 ? 12.467  -9.485  -25.834 1.00 0.00 ? 48  SER A HG   6  
ATOM   3942  N  N    . SER A 1 49 ? 12.572  -12.949 -24.635 1.00 0.00 ? 49  SER A N    6  
ATOM   3943  C  CA   . SER A 1 49 ? 12.671  -14.160 -25.441 1.00 0.00 ? 49  SER A CA   6  
ATOM   3944  C  C    . SER A 1 49 ? 12.935  -15.378 -24.560 1.00 0.00 ? 49  SER A C    6  
ATOM   3945  O  O    . SER A 1 49 ? 13.492  -15.260 -23.469 1.00 0.00 ? 49  SER A O    6  
ATOM   3946  C  CB   . SER A 1 49 ? 13.783  -14.018 -26.481 1.00 0.00 ? 49  SER A CB   6  
ATOM   3947  O  OG   . SER A 1 49 ? 13.655  -14.991 -27.502 1.00 0.00 ? 49  SER A OG   6  
ATOM   3948  H  H    . SER A 1 49 ? 13.377  -12.412 -24.477 1.00 0.00 ? 49  SER A H    6  
ATOM   3949  H  HA   . SER A 1 49 ? 11.729  -14.297 -25.950 1.00 0.00 ? 49  SER A HA   6  
ATOM   3950  H  HB2  . SER A 1 49 ? 13.731  -13.036 -26.927 1.00 0.00 ? 49  SER A HB2  6  
ATOM   3951  H  HB3  . SER A 1 49 ? 14.742  -14.143 -25.998 1.00 0.00 ? 49  SER A HB3  6  
ATOM   3952  H  HG   . SER A 1 49 ? 14.257  -14.784 -28.220 1.00 0.00 ? 49  SER A HG   6  
ATOM   3953  N  N    . GLY A 1 50 ? 12.531  -16.549 -25.043 1.00 0.00 ? 50  GLY A N    6  
ATOM   3954  C  CA   . GLY A 1 50 ? 12.733  -17.772 -24.288 1.00 0.00 ? 50  GLY A CA   6  
ATOM   3955  C  C    . GLY A 1 50 ? 14.172  -18.247 -24.326 1.00 0.00 ? 50  GLY A C    6  
ATOM   3956  O  O    . GLY A 1 50 ? 14.953  -17.727 -25.122 1.00 0.00 ? 50  GLY A O    6  
ATOM   3957  H  H    . GLY A 1 50 ? 12.093  -16.583 -25.919 1.00 0.00 ? 50  GLY A H    6  
ATOM   3958  H  HA2  . GLY A 1 50 ? 12.449  -17.599 -23.261 1.00 0.00 ? 50  GLY A HA2  6  
ATOM   3959  H  HA3  . GLY A 1 50 ? 12.100  -18.544 -24.701 1.00 0.00 ? 50  GLY A HA3  6  
HETATM 3960  ZN ZN   . ZN  B 2 .  ? 0.431   -2.426  -7.163  1.00 0.00 ? 201 ZN  A ZN   6  
ATOM   3961  N  N    . GLY A 1 1  ? -4.932  33.030  -16.429 1.00 0.00 ? 1   GLY A N    7  
ATOM   3962  C  CA   . GLY A 1 1  ? -4.527  34.400  -16.682 1.00 0.00 ? 1   GLY A CA   7  
ATOM   3963  C  C    . GLY A 1 1  ? -5.631  35.222  -17.317 1.00 0.00 ? 1   GLY A C    7  
ATOM   3964  O  O    . GLY A 1 1  ? -6.715  34.710  -17.594 1.00 0.00 ? 1   GLY A O    7  
ATOM   3965  H  H1   . GLY A 1 1  ? -5.156  32.440  -17.179 1.00 0.00 ? 1   GLY A H1   7  
ATOM   3966  H  HA2  . GLY A 1 1  ? -4.243  34.859  -15.747 1.00 0.00 ? 1   GLY A HA2  7  
ATOM   3967  H  HA3  . GLY A 1 1  ? -3.673  34.395  -17.343 1.00 0.00 ? 1   GLY A HA3  7  
ATOM   3968  N  N    . SER A 1 2  ? -5.356  36.502  -17.547 1.00 0.00 ? 2   SER A N    7  
ATOM   3969  C  CA   . SER A 1 2  ? -6.337  37.399  -18.148 1.00 0.00 ? 2   SER A CA   7  
ATOM   3970  C  C    . SER A 1 2  ? -5.981  37.697  -19.602 1.00 0.00 ? 2   SER A C    7  
ATOM   3971  O  O    . SER A 1 2  ? -4.944  37.259  -20.101 1.00 0.00 ? 2   SER A O    7  
ATOM   3972  C  CB   . SER A 1 2  ? -6.421  38.703  -17.354 1.00 0.00 ? 2   SER A CB   7  
ATOM   3973  O  OG   . SER A 1 2  ? -5.199  39.417  -17.414 1.00 0.00 ? 2   SER A OG   7  
ATOM   3974  H  H    . SER A 1 2  ? -4.474  36.853  -17.304 1.00 0.00 ? 2   SER A H    7  
ATOM   3975  H  HA   . SER A 1 2  ? -7.297  36.907  -18.119 1.00 0.00 ? 2   SER A HA   7  
ATOM   3976  H  HB2  . SER A 1 2  ? -7.205  39.322  -17.764 1.00 0.00 ? 2   SER A HB2  7  
ATOM   3977  H  HB3  . SER A 1 2  ? -6.643  38.478  -16.320 1.00 0.00 ? 2   SER A HB3  7  
ATOM   3978  H  HG   . SER A 1 2  ? -4.476  38.836  -17.166 1.00 0.00 ? 2   SER A HG   7  
ATOM   3979  N  N    . SER A 1 3  ? -6.848  38.447  -20.275 1.00 0.00 ? 3   SER A N    7  
ATOM   3980  C  CA   . SER A 1 3  ? -6.628  38.802  -21.672 1.00 0.00 ? 3   SER A CA   7  
ATOM   3981  C  C    . SER A 1 3  ? -5.286  39.507  -21.849 1.00 0.00 ? 3   SER A C    7  
ATOM   3982  O  O    . SER A 1 3  ? -5.018  40.525  -21.212 1.00 0.00 ? 3   SER A O    7  
ATOM   3983  C  CB   . SER A 1 3  ? -7.759  39.700  -22.176 1.00 0.00 ? 3   SER A CB   7  
ATOM   3984  O  OG   . SER A 1 3  ? -7.754  40.950  -21.509 1.00 0.00 ? 3   SER A OG   7  
ATOM   3985  H  H    . SER A 1 3  ? -7.656  38.767  -19.821 1.00 0.00 ? 3   SER A H    7  
ATOM   3986  H  HA   . SER A 1 3  ? -6.620  37.889  -22.249 1.00 0.00 ? 3   SER A HA   7  
ATOM   3987  H  HB2  . SER A 1 3  ? -7.636  39.871  -23.235 1.00 0.00 ? 3   SER A HB2  7  
ATOM   3988  H  HB3  . SER A 1 3  ? -8.707  39.214  -21.998 1.00 0.00 ? 3   SER A HB3  7  
ATOM   3989  H  HG   . SER A 1 3  ? -8.262  40.882  -20.697 1.00 0.00 ? 3   SER A HG   7  
ATOM   3990  N  N    . GLY A 1 4  ? -4.446  38.956  -22.720 1.00 0.00 ? 4   GLY A N    7  
ATOM   3991  C  CA   . GLY A 1 4  ? -3.142  39.544  -22.966 1.00 0.00 ? 4   GLY A CA   7  
ATOM   3992  C  C    . GLY A 1 4  ? -2.080  39.015  -22.022 1.00 0.00 ? 4   GLY A C    7  
ATOM   3993  O  O    . GLY A 1 4  ? -1.615  39.731  -21.136 1.00 0.00 ? 4   GLY A O    7  
ATOM   3994  H  H    . GLY A 1 4  ? -4.713  38.144  -23.199 1.00 0.00 ? 4   GLY A H    7  
ATOM   3995  H  HA2  . GLY A 1 4  ? -2.847  39.327  -23.981 1.00 0.00 ? 4   GLY A HA2  7  
ATOM   3996  H  HA3  . GLY A 1 4  ? -3.214  40.615  -22.843 1.00 0.00 ? 4   GLY A HA3  7  
ATOM   3997  N  N    . SER A 1 5  ? -1.696  37.757  -22.212 1.00 0.00 ? 5   SER A N    7  
ATOM   3998  C  CA   . SER A 1 5  ? -0.686  37.130  -21.367 1.00 0.00 ? 5   SER A CA   7  
ATOM   3999  C  C    . SER A 1 5  ? 0.718   37.501  -21.833 1.00 0.00 ? 5   SER A C    7  
ATOM   4000  O  O    . SER A 1 5  ? 1.101   37.222  -22.969 1.00 0.00 ? 5   SER A O    7  
ATOM   4001  C  CB   . SER A 1 5  ? -0.854  35.610  -21.377 1.00 0.00 ? 5   SER A CB   7  
ATOM   4002  O  OG   . SER A 1 5  ? 0.289   34.966  -20.842 1.00 0.00 ? 5   SER A OG   7  
ATOM   4003  H  H    . SER A 1 5  ? -2.104  37.237  -22.936 1.00 0.00 ? 5   SER A H    7  
ATOM   4004  H  HA   . SER A 1 5  ? -0.826  37.492  -20.359 1.00 0.00 ? 5   SER A HA   7  
ATOM   4005  H  HB2  . SER A 1 5  ? -1.715  35.341  -20.783 1.00 0.00 ? 5   SER A HB2  7  
ATOM   4006  H  HB3  . SER A 1 5  ? -0.999  35.273  -22.394 1.00 0.00 ? 5   SER A HB3  7  
ATOM   4007  H  HG   . SER A 1 5  ? 0.505   35.354  -19.990 1.00 0.00 ? 5   SER A HG   7  
ATOM   4008  N  N    . SER A 1 6  ? 1.481   38.133  -20.947 1.00 0.00 ? 6   SER A N    7  
ATOM   4009  C  CA   . SER A 1 6  ? 2.842   38.547  -21.267 1.00 0.00 ? 6   SER A CA   7  
ATOM   4010  C  C    . SER A 1 6  ? 3.861   37.670  -20.545 1.00 0.00 ? 6   SER A C    7  
ATOM   4011  O  O    . SER A 1 6  ? 4.385   38.043  -19.496 1.00 0.00 ? 6   SER A O    7  
ATOM   4012  C  CB   . SER A 1 6  ? 3.055   40.014  -20.888 1.00 0.00 ? 6   SER A CB   7  
ATOM   4013  O  OG   . SER A 1 6  ? 2.418   40.877  -21.814 1.00 0.00 ? 6   SER A OG   7  
ATOM   4014  H  H    . SER A 1 6  ? 1.119   38.328  -20.057 1.00 0.00 ? 6   SER A H    7  
ATOM   4015  H  HA   . SER A 1 6  ? 2.980   38.436  -22.332 1.00 0.00 ? 6   SER A HA   7  
ATOM   4016  H  HB2  . SER A 1 6  ? 2.643   40.192  -19.906 1.00 0.00 ? 6   SER A HB2  7  
ATOM   4017  H  HB3  . SER A 1 6  ? 4.113   40.231  -20.880 1.00 0.00 ? 6   SER A HB3  7  
ATOM   4018  H  HG   . SER A 1 6  ? 2.730   41.775  -21.681 1.00 0.00 ? 6   SER A HG   7  
ATOM   4019  N  N    . GLY A 1 7  ? 4.136   36.501  -21.115 1.00 0.00 ? 7   GLY A N    7  
ATOM   4020  C  CA   . GLY A 1 7  ? 5.090   35.588  -20.513 1.00 0.00 ? 7   GLY A CA   7  
ATOM   4021  C  C    . GLY A 1 7  ? 4.852   34.148  -20.920 1.00 0.00 ? 7   GLY A C    7  
ATOM   4022  O  O    . GLY A 1 7  ? 4.976   33.236  -20.102 1.00 0.00 ? 7   GLY A O    7  
ATOM   4023  H  H    . GLY A 1 7  ? 3.688   36.256  -21.951 1.00 0.00 ? 7   GLY A H    7  
ATOM   4024  H  HA2  . GLY A 1 7  ? 6.087   35.876  -20.814 1.00 0.00 ? 7   GLY A HA2  7  
ATOM   4025  H  HA3  . GLY A 1 7  ? 5.014   35.664  -19.438 1.00 0.00 ? 7   GLY A HA3  7  
ATOM   4026  N  N    . CYS A 1 8  ? 4.506   33.942  -22.186 1.00 0.00 ? 8   CYS A N    7  
ATOM   4027  C  CA   . CYS A 1 8  ? 4.246   32.602  -22.699 1.00 0.00 ? 8   CYS A CA   7  
ATOM   4028  C  C    . CYS A 1 8  ? 5.408   31.665  -22.386 1.00 0.00 ? 8   CYS A C    7  
ATOM   4029  O  O    . CYS A 1 8  ? 6.556   31.948  -22.730 1.00 0.00 ? 8   CYS A O    7  
ATOM   4030  C  CB   . CYS A 1 8  ? 4.006   32.650  -24.209 1.00 0.00 ? 8   CYS A CB   7  
ATOM   4031  S  SG   . CYS A 1 8  ? 2.373   33.268  -24.678 1.00 0.00 ? 8   CYS A SG   7  
ATOM   4032  H  H    . CYS A 1 8  ? 4.422   34.710  -22.790 1.00 0.00 ? 8   CYS A H    7  
ATOM   4033  H  HA   . CYS A 1 8  ? 3.357   32.228  -22.214 1.00 0.00 ? 8   CYS A HA   7  
ATOM   4034  H  HB2  . CYS A 1 8  ? 4.744   33.295  -24.663 1.00 0.00 ? 8   CYS A HB2  7  
ATOM   4035  H  HB3  . CYS A 1 8  ? 4.111   31.654  -24.614 1.00 0.00 ? 8   CYS A HB3  7  
ATOM   4036  H  HG   . CYS A 1 8  ? 2.370   33.461  -25.988 1.00 0.00 ? 8   CYS A HG   7  
ATOM   4037  N  N    . CYS A 1 9  ? 5.102   30.551  -21.730 1.00 0.00 ? 9   CYS A N    7  
ATOM   4038  C  CA   . CYS A 1 9  ? 6.122   29.573  -21.368 1.00 0.00 ? 9   CYS A CA   7  
ATOM   4039  C  C    . CYS A 1 9  ? 6.093   28.380  -22.318 1.00 0.00 ? 9   CYS A C    7  
ATOM   4040  O  O    . CYS A 1 9  ? 5.067   27.716  -22.467 1.00 0.00 ? 9   CYS A O    7  
ATOM   4041  C  CB   . CYS A 1 9  ? 5.914   29.099  -19.929 1.00 0.00 ? 9   CYS A CB   7  
ATOM   4042  S  SG   . CYS A 1 9  ? 7.311   28.174  -19.248 1.00 0.00 ? 9   CYS A SG   7  
ATOM   4043  H  H    . CYS A 1 9  ? 4.169   30.382  -21.483 1.00 0.00 ? 9   CYS A H    7  
ATOM   4044  H  HA   . CYS A 1 9  ? 7.084   30.055  -21.444 1.00 0.00 ? 9   CYS A HA   7  
ATOM   4045  H  HB2  . CYS A 1 9  ? 5.750   29.958  -19.295 1.00 0.00 ? 9   CYS A HB2  7  
ATOM   4046  H  HB3  . CYS A 1 9  ? 5.045   28.460  -19.890 1.00 0.00 ? 9   CYS A HB3  7  
ATOM   4047  H  HG   . CYS A 1 9  ? 6.939   27.673  -18.080 1.00 0.00 ? 9   CYS A HG   7  
ATOM   4048  N  N    . LEU A 1 10 ? 7.226   28.115  -22.960 1.00 0.00 ? 10  LEU A N    7  
ATOM   4049  C  CA   . LEU A 1 10 ? 7.331   27.003  -23.899 1.00 0.00 ? 10  LEU A CA   7  
ATOM   4050  C  C    . LEU A 1 10 ? 7.215   25.666  -23.174 1.00 0.00 ? 10  LEU A C    7  
ATOM   4051  O  O    . LEU A 1 10 ? 7.578   25.532  -22.005 1.00 0.00 ? 10  LEU A O    7  
ATOM   4052  C  CB   . LEU A 1 10 ? 8.659   27.072  -24.655 1.00 0.00 ? 10  LEU A CB   7  
ATOM   4053  C  CG   . LEU A 1 10 ? 8.980   28.408  -25.327 1.00 0.00 ? 10  LEU A CG   7  
ATOM   4054  C  CD1  . LEU A 1 10 ? 9.672   29.345  -24.350 1.00 0.00 ? 10  LEU A CD1  7  
ATOM   4055  C  CD2  . LEU A 1 10 ? 9.843   28.190  -26.561 1.00 0.00 ? 10  LEU A CD2  7  
ATOM   4056  H  H    . LEU A 1 10 ? 8.010   28.680  -22.800 1.00 0.00 ? 10  LEU A H    7  
ATOM   4057  H  HA   . LEU A 1 10 ? 6.519   27.088  -24.605 1.00 0.00 ? 10  LEU A HA   7  
ATOM   4058  H  HB2  . LEU A 1 10 ? 9.450   26.857  -23.954 1.00 0.00 ? 10  LEU A HB2  7  
ATOM   4059  H  HB3  . LEU A 1 10 ? 8.642   26.310  -25.421 1.00 0.00 ? 10  LEU A HB3  7  
ATOM   4060  H  HG   . LEU A 1 10 ? 8.057   28.876  -25.641 1.00 0.00 ? 10  LEU A HG   7  
ATOM   4061  H  HD11 . LEU A 1 10 ? 8.981   30.114  -24.038 1.00 0.00 ? 10  LEU A HD11 7  
ATOM   4062  H  HD12 . LEU A 1 10 ? 10.525  29.800  -24.830 1.00 0.00 ? 10  LEU A HD12 7  
ATOM   4063  H  HD13 . LEU A 1 10 ? 10.001  28.785  -23.486 1.00 0.00 ? 10  LEU A HD13 7  
ATOM   4064  H  HD21 . LEU A 1 10 ? 9.225   27.835  -27.373 1.00 0.00 ? 10  LEU A HD21 7  
ATOM   4065  H  HD22 . LEU A 1 10 ? 10.605  27.456  -26.342 1.00 0.00 ? 10  LEU A HD22 7  
ATOM   4066  H  HD23 . LEU A 1 10 ? 10.309  29.122  -26.844 1.00 0.00 ? 10  LEU A HD23 7  
ATOM   4067  N  N    . PRO A 1 11 ? 6.698   24.652  -23.882 1.00 0.00 ? 11  PRO A N    7  
ATOM   4068  C  CA   . PRO A 1 11 ? 6.525   23.306  -23.327 1.00 0.00 ? 11  PRO A CA   7  
ATOM   4069  C  C    . PRO A 1 11 ? 7.855   22.597  -23.098 1.00 0.00 ? 11  PRO A C    7  
ATOM   4070  O  O    . PRO A 1 11 ? 8.912   23.053  -23.535 1.00 0.00 ? 11  PRO A O    7  
ATOM   4071  C  CB   . PRO A 1 11 ? 5.711   22.581  -24.402 1.00 0.00 ? 11  PRO A CB   7  
ATOM   4072  C  CG   . PRO A 1 11 ? 6.026   23.303  -25.667 1.00 0.00 ? 11  PRO A CG   7  
ATOM   4073  C  CD   . PRO A 1 11 ? 6.244   24.740  -25.280 1.00 0.00 ? 11  PRO A CD   7  
ATOM   4074  H  HA   . PRO A 1 11 ? 5.965   23.327  -22.403 1.00 0.00 ? 11  PRO A HA   7  
ATOM   4075  H  HB2  . PRO A 1 11 ? 6.016   21.545  -24.451 1.00 0.00 ? 11  PRO A HB2  7  
ATOM   4076  H  HB3  . PRO A 1 11 ? 4.660   22.641  -24.165 1.00 0.00 ? 11  PRO A HB3  7  
ATOM   4077  H  HG2  . PRO A 1 11 ? 6.921   22.894  -26.110 1.00 0.00 ? 11  PRO A HG2  7  
ATOM   4078  H  HG3  . PRO A 1 11 ? 5.196   23.221  -26.352 1.00 0.00 ? 11  PRO A HG3  7  
ATOM   4079  H  HD2  . PRO A 1 11 ? 7.003   25.187  -25.905 1.00 0.00 ? 11  PRO A HD2  7  
ATOM   4080  H  HD3  . PRO A 1 11 ? 5.320   25.294  -25.351 1.00 0.00 ? 11  PRO A HD3  7  
ATOM   4081  N  N    . PRO A 1 12 ? 7.805   21.455  -22.396 1.00 0.00 ? 12  PRO A N    7  
ATOM   4082  C  CA   . PRO A 1 12 ? 8.998   20.659  -22.094 1.00 0.00 ? 12  PRO A CA   7  
ATOM   4083  C  C    . PRO A 1 12 ? 9.576   19.986  -23.335 1.00 0.00 ? 12  PRO A C    7  
ATOM   4084  O  O    . PRO A 1 12 ? 8.923   19.917  -24.375 1.00 0.00 ? 12  PRO A O    7  
ATOM   4085  C  CB   . PRO A 1 12 ? 8.483   19.609  -21.107 1.00 0.00 ? 12  PRO A CB   7  
ATOM   4086  C  CG   . PRO A 1 12 ? 7.030   19.486  -21.409 1.00 0.00 ? 12  PRO A CG   7  
ATOM   4087  C  CD   . PRO A 1 12 ? 6.580   20.853  -21.844 1.00 0.00 ? 12  PRO A CD   7  
ATOM   4088  H  HA   . PRO A 1 12 ? 9.764   21.256  -21.621 1.00 0.00 ? 12  PRO A HA   7  
ATOM   4089  H  HB2  . PRO A 1 12 ? 9.002   18.674  -21.269 1.00 0.00 ? 12  PRO A HB2  7  
ATOM   4090  H  HB3  . PRO A 1 12 ? 8.649   19.948  -20.096 1.00 0.00 ? 12  PRO A HB3  7  
ATOM   4091  H  HG2  . PRO A 1 12 ? 6.879   18.771  -22.203 1.00 0.00 ? 12  PRO A HG2  7  
ATOM   4092  H  HG3  . PRO A 1 12 ? 6.495   19.181  -20.521 1.00 0.00 ? 12  PRO A HG3  7  
ATOM   4093  H  HD2  . PRO A 1 12 ? 5.814   20.775  -22.601 1.00 0.00 ? 12  PRO A HD2  7  
ATOM   4094  H  HD3  . PRO A 1 12 ? 6.221   21.420  -20.998 1.00 0.00 ? 12  PRO A HD3  7  
ATOM   4095  N  N    . ALA A 1 13 ? 10.803  19.491  -23.216 1.00 0.00 ? 13  ALA A N    7  
ATOM   4096  C  CA   . ALA A 1 13 ? 11.467  18.821  -24.328 1.00 0.00 ? 13  ALA A CA   7  
ATOM   4097  C  C    . ALA A 1 13 ? 10.915  17.414  -24.529 1.00 0.00 ? 13  ALA A C    7  
ATOM   4098  O  O    . ALA A 1 13 ? 10.434  17.073  -25.610 1.00 0.00 ? 13  ALA A O    7  
ATOM   4099  C  CB   . ALA A 1 13 ? 12.970  18.773  -24.093 1.00 0.00 ? 13  ALA A CB   7  
ATOM   4100  H  H    . ALA A 1 13 ? 11.273  19.577  -22.361 1.00 0.00 ? 13  ALA A H    7  
ATOM   4101  H  HA   . ALA A 1 13 ? 11.286  19.400  -25.223 1.00 0.00 ? 13  ALA A HA   7  
ATOM   4102  H  HB1  . ALA A 1 13 ? 13.191  19.151  -23.106 1.00 0.00 ? 13  ALA A HB1  7  
ATOM   4103  H  HB2  . ALA A 1 13 ? 13.314  17.752  -24.174 1.00 0.00 ? 13  ALA A HB2  7  
ATOM   4104  H  HB3  . ALA A 1 13 ? 13.469  19.381  -24.833 1.00 0.00 ? 13  ALA A HB3  7  
ATOM   4105  N  N    . THR A 1 14 ? 10.989  16.599  -23.482 1.00 0.00 ? 14  THR A N    7  
ATOM   4106  C  CA   . THR A 1 14 ? 10.498  15.228  -23.544 1.00 0.00 ? 14  THR A CA   7  
ATOM   4107  C  C    . THR A 1 14 ? 9.133   15.102  -22.879 1.00 0.00 ? 14  THR A C    7  
ATOM   4108  O  O    . THR A 1 14 ? 8.953   15.499  -21.727 1.00 0.00 ? 14  THR A O    7  
ATOM   4109  C  CB   . THR A 1 14 ? 11.478  14.250  -22.869 1.00 0.00 ? 14  THR A CB   7  
ATOM   4110  O  OG1  . THR A 1 14 ? 10.937  12.924  -22.886 1.00 0.00 ? 14  THR A OG1  7  
ATOM   4111  C  CG2  . THR A 1 14 ? 11.760  14.670  -21.434 1.00 0.00 ? 14  THR A CG2  7  
ATOM   4112  H  H    . THR A 1 14 ? 11.383  16.929  -22.647 1.00 0.00 ? 14  THR A H    7  
ATOM   4113  H  HA   . THR A 1 14 ? 10.408  14.953  -24.585 1.00 0.00 ? 14  THR A HA   7  
ATOM   4114  H  HB   . THR A 1 14 ? 12.408  14.258  -23.420 1.00 0.00 ? 14  THR A HB   7  
ATOM   4115  H  HG1  . THR A 1 14 ? 10.113  12.909  -22.392 1.00 0.00 ? 14  THR A HG1  7  
ATOM   4116  H  HG21 . THR A 1 14 ? 12.827  14.726  -21.279 1.00 0.00 ? 14  THR A HG21 7  
ATOM   4117  H  HG22 . THR A 1 14 ? 11.335  13.945  -20.757 1.00 0.00 ? 14  THR A HG22 7  
ATOM   4118  H  HG23 . THR A 1 14 ? 11.319  15.637  -21.250 1.00 0.00 ? 14  THR A HG23 7  
ATOM   4119  N  N    . HIS A 1 15 ? 8.172   14.545  -23.610 1.00 0.00 ? 15  HIS A N    7  
ATOM   4120  C  CA   . HIS A 1 15 ? 6.822   14.365  -23.089 1.00 0.00 ? 15  HIS A CA   7  
ATOM   4121  C  C    . HIS A 1 15 ? 6.560   12.900  -22.753 1.00 0.00 ? 15  HIS A C    7  
ATOM   4122  O  O    . HIS A 1 15 ? 5.846   12.205  -23.475 1.00 0.00 ? 15  HIS A O    7  
ATOM   4123  C  CB   . HIS A 1 15 ? 5.791   14.859  -24.105 1.00 0.00 ? 15  HIS A CB   7  
ATOM   4124  C  CG   . HIS A 1 15 ? 5.872   16.330  -24.373 1.00 0.00 ? 15  HIS A CG   7  
ATOM   4125  N  ND1  . HIS A 1 15 ? 4.762   17.145  -24.438 1.00 0.00 ? 15  HIS A ND1  7  
ATOM   4126  C  CD2  . HIS A 1 15 ? 6.940   17.133  -24.592 1.00 0.00 ? 15  HIS A CD2  7  
ATOM   4127  C  CE1  . HIS A 1 15 ? 5.143   18.385  -24.687 1.00 0.00 ? 15  HIS A CE1  7  
ATOM   4128  N  NE2  . HIS A 1 15 ? 6.460   18.405  -24.784 1.00 0.00 ? 15  HIS A NE2  7  
ATOM   4129  H  H    . HIS A 1 15 ? 8.377   14.248  -24.521 1.00 0.00 ? 15  HIS A H    7  
ATOM   4130  H  HA   . HIS A 1 15 ? 6.734   14.950  -22.186 1.00 0.00 ? 15  HIS A HA   7  
ATOM   4131  H  HB2  . HIS A 1 15 ? 5.942   14.342  -25.041 1.00 0.00 ? 15  HIS A HB2  7  
ATOM   4132  H  HB3  . HIS A 1 15 ? 4.799   14.642  -23.735 1.00 0.00 ? 15  HIS A HB3  7  
ATOM   4133  H  HD1  . HIS A 1 15 ? 3.833   16.857  -24.321 1.00 0.00 ? 15  HIS A HD1  7  
ATOM   4134  H  HD2  . HIS A 1 15 ? 7.977   16.829  -24.612 1.00 0.00 ? 15  HIS A HD2  7  
ATOM   4135  H  HE1  . HIS A 1 15 ? 4.490   19.239  -24.792 1.00 0.00 ? 15  HIS A HE1  7  
ATOM   4136  N  N    . ARG A 1 16 ? 7.144   12.437  -21.652 1.00 0.00 ? 16  ARG A N    7  
ATOM   4137  C  CA   . ARG A 1 16 ? 6.976   11.055  -21.221 1.00 0.00 ? 16  ARG A CA   7  
ATOM   4138  C  C    . ARG A 1 16 ? 6.661   10.985  -19.730 1.00 0.00 ? 16  ARG A C    7  
ATOM   4139  O  O    . ARG A 1 16 ? 7.142   11.788  -18.930 1.00 0.00 ? 16  ARG A O    7  
ATOM   4140  C  CB   . ARG A 1 16 ? 8.238   10.246  -21.526 1.00 0.00 ? 16  ARG A CB   7  
ATOM   4141  C  CG   . ARG A 1 16 ? 8.222   9.584   -22.894 1.00 0.00 ? 16  ARG A CG   7  
ATOM   4142  C  CD   . ARG A 1 16 ? 8.455   10.595  -24.005 1.00 0.00 ? 16  ARG A CD   7  
ATOM   4143  N  NE   . ARG A 1 16 ? 9.083   9.987   -25.175 1.00 0.00 ? 16  ARG A NE   7  
ATOM   4144  C  CZ   . ARG A 1 16 ? 9.155   10.581  -26.361 1.00 0.00 ? 16  ARG A CZ   7  
ATOM   4145  N  NH1  . ARG A 1 16 ? 8.642   11.791  -26.534 1.00 0.00 ? 16  ARG A NH1  7  
ATOM   4146  N  NH2  . ARG A 1 16 ? 9.743   9.963   -27.379 1.00 0.00 ? 16  ARG A NH2  7  
ATOM   4147  H  H    . ARG A 1 16 ? 7.703   13.040  -21.117 1.00 0.00 ? 16  ARG A H    7  
ATOM   4148  H  HA   . ARG A 1 16 ? 6.148   10.634  -21.772 1.00 0.00 ? 16  ARG A HA   7  
ATOM   4149  H  HB2  . ARG A 1 16 ? 9.094   10.904  -21.479 1.00 0.00 ? 16  ARG A HB2  7  
ATOM   4150  H  HB3  . ARG A 1 16 ? 8.346   9.475   -20.778 1.00 0.00 ? 16  ARG A HB3  7  
ATOM   4151  H  HG2  . ARG A 1 16 ? 9.002   8.838   -22.932 1.00 0.00 ? 16  ARG A HG2  7  
ATOM   4152  H  HG3  . ARG A 1 16 ? 7.262   9.112   -23.043 1.00 0.00 ? 16  ARG A HG3  7  
ATOM   4153  H  HD2  . ARG A 1 16 ? 7.504   11.015  -24.296 1.00 0.00 ? 16  ARG A HD2  7  
ATOM   4154  H  HD3  . ARG A 1 16 ? 9.096   11.379  -23.631 1.00 0.00 ? 16  ARG A HD3  7  
ATOM   4155  H  HE   . ARG A 1 16 ? 9.469   9.093   -25.070 1.00 0.00 ? 16  ARG A HE   7  
ATOM   4156  H  HH11 . ARG A 1 16 ? 8.200   12.259  -25.769 1.00 0.00 ? 16  ARG A HH11 7  
ATOM   4157  H  HH12 . ARG A 1 16 ? 8.699   12.236  -27.428 1.00 0.00 ? 16  ARG A HH12 7  
ATOM   4158  H  HH21 . ARG A 1 16 ? 10.131  9.051   -27.252 1.00 0.00 ? 16  ARG A HH21 7  
ATOM   4159  H  HH22 . ARG A 1 16 ? 9.797   10.410  -28.271 1.00 0.00 ? 16  ARG A HH22 7  
ATOM   4160  N  N    . PRO A 1 17 ? 5.834   10.001  -19.345 1.00 0.00 ? 17  PRO A N    7  
ATOM   4161  C  CA   . PRO A 1 17 ? 5.437   9.802   -17.948 1.00 0.00 ? 17  PRO A CA   7  
ATOM   4162  C  C    . PRO A 1 17 ? 6.590   9.305   -17.082 1.00 0.00 ? 17  PRO A C    7  
ATOM   4163  O  O    . PRO A 1 17 ? 7.305   8.375   -17.458 1.00 0.00 ? 17  PRO A O    7  
ATOM   4164  C  CB   . PRO A 1 17 ? 4.339   8.739   -18.039 1.00 0.00 ? 17  PRO A CB   7  
ATOM   4165  C  CG   . PRO A 1 17 ? 4.633   7.999   -19.298 1.00 0.00 ? 17  PRO A CG   7  
ATOM   4166  C  CD   . PRO A 1 17 ? 5.224   9.007   -20.244 1.00 0.00 ? 17  PRO A CD   7  
ATOM   4167  H  HA   . PRO A 1 17 ? 5.030   10.707  -17.519 1.00 0.00 ? 17  PRO A HA   7  
ATOM   4168  H  HB2  . PRO A 1 17 ? 4.391   8.090   -17.176 1.00 0.00 ? 17  PRO A HB2  7  
ATOM   4169  H  HB3  . PRO A 1 17 ? 3.372   9.218   -18.079 1.00 0.00 ? 17  PRO A HB3  7  
ATOM   4170  H  HG2  . PRO A 1 17 ? 5.342   7.208   -19.102 1.00 0.00 ? 17  PRO A HG2  7  
ATOM   4171  H  HG3  . PRO A 1 17 ? 3.719   7.593   -19.706 1.00 0.00 ? 17  PRO A HG3  7  
ATOM   4172  H  HD2  . PRO A 1 17 ? 5.971   8.544   -20.870 1.00 0.00 ? 17  PRO A HD2  7  
ATOM   4173  H  HD3  . PRO A 1 17 ? 4.449   9.458   -20.847 1.00 0.00 ? 17  PRO A HD3  7  
ATOM   4174  N  N    . HIS A 1 18 ? 6.765   9.929   -15.922 1.00 0.00 ? 18  HIS A N    7  
ATOM   4175  C  CA   . HIS A 1 18 ? 7.831   9.549   -15.002 1.00 0.00 ? 18  HIS A CA   7  
ATOM   4176  C  C    . HIS A 1 18 ? 7.257   8.918   -13.737 1.00 0.00 ? 18  HIS A C    7  
ATOM   4177  O  O    . HIS A 1 18 ? 6.292   9.409   -13.151 1.00 0.00 ? 18  HIS A O    7  
ATOM   4178  C  CB   . HIS A 1 18 ? 8.679   10.768  -14.638 1.00 0.00 ? 18  HIS A CB   7  
ATOM   4179  C  CG   . HIS A 1 18 ? 10.098  10.430  -14.297 1.00 0.00 ? 18  HIS A CG   7  
ATOM   4180  N  ND1  . HIS A 1 18 ? 10.612  10.539  -13.023 1.00 0.00 ? 18  HIS A ND1  7  
ATOM   4181  C  CD2  . HIS A 1 18 ? 11.112  9.982   -15.074 1.00 0.00 ? 18  HIS A CD2  7  
ATOM   4182  C  CE1  . HIS A 1 18 ? 11.881  10.174  -13.030 1.00 0.00 ? 18  HIS A CE1  7  
ATOM   4183  N  NE2  . HIS A 1 18 ? 12.210  9.832   -14.262 1.00 0.00 ? 18  HIS A NE2  7  
ATOM   4184  H  H    . HIS A 1 18 ? 6.162   10.663  -15.678 1.00 0.00 ? 18  HIS A H    7  
ATOM   4185  H  HA   . HIS A 1 18 ? 8.455   8.823   -15.500 1.00 0.00 ? 18  HIS A HA   7  
ATOM   4186  H  HB2  . HIS A 1 18 ? 8.693   11.451  -15.475 1.00 0.00 ? 18  HIS A HB2  7  
ATOM   4187  H  HB3  . HIS A 1 18 ? 8.240   11.262  -13.784 1.00 0.00 ? 18  HIS A HB3  7  
ATOM   4188  H  HD1  . HIS A 1 18 ? 10.119  10.840  -12.231 1.00 0.00 ? 18  HIS A HD1  7  
ATOM   4189  H  HD2  . HIS A 1 18 ? 11.068  9.781   -16.135 1.00 0.00 ? 18  HIS A HD2  7  
ATOM   4190  H  HE1  . HIS A 1 18 ? 12.539  10.158  -12.174 1.00 0.00 ? 18  HIS A HE1  7  
ATOM   4191  N  N    . PRO A 1 19 ? 7.863   7.802   -13.305 1.00 0.00 ? 19  PRO A N    7  
ATOM   4192  C  CA   . PRO A 1 19 ? 7.429   7.079   -12.105 1.00 0.00 ? 19  PRO A CA   7  
ATOM   4193  C  C    . PRO A 1 19 ? 7.724   7.853   -10.824 1.00 0.00 ? 19  PRO A C    7  
ATOM   4194  O  O    . PRO A 1 19 ? 8.532   8.782   -10.819 1.00 0.00 ? 19  PRO A O    7  
ATOM   4195  C  CB   . PRO A 1 19 ? 8.251   5.789   -12.152 1.00 0.00 ? 19  PRO A CB   7  
ATOM   4196  C  CG   . PRO A 1 19 ? 9.464   6.140   -12.941 1.00 0.00 ? 19  PRO A CG   7  
ATOM   4197  C  CD   . PRO A 1 19 ? 9.018   7.159   -13.953 1.00 0.00 ? 19  PRO A CD   7  
ATOM   4198  H  HA   . PRO A 1 19 ? 6.376   6.840   -12.145 1.00 0.00 ? 19  PRO A HA   7  
ATOM   4199  H  HB2  . PRO A 1 19 ? 8.507   5.486   -11.146 1.00 0.00 ? 19  PRO A HB2  7  
ATOM   4200  H  HB3  . PRO A 1 19 ? 7.678   5.010   -12.633 1.00 0.00 ? 19  PRO A HB3  7  
ATOM   4201  H  HG2  . PRO A 1 19 ? 10.216  6.561   -12.291 1.00 0.00 ? 19  PRO A HG2  7  
ATOM   4202  H  HG3  . PRO A 1 19 ? 9.845   5.261   -13.439 1.00 0.00 ? 19  PRO A HG3  7  
ATOM   4203  H  HD2  . PRO A 1 19 ? 9.804   7.876   -14.138 1.00 0.00 ? 19  PRO A HD2  7  
ATOM   4204  H  HD3  . PRO A 1 19 ? 8.723   6.675   -14.872 1.00 0.00 ? 19  PRO A HD3  7  
ATOM   4205  N  N    . THR A 1 20 ? 7.063   7.464   -9.738  1.00 0.00 ? 20  THR A N    7  
ATOM   4206  C  CA   . THR A 1 20 ? 7.254   8.121   -8.451  1.00 0.00 ? 20  THR A CA   7  
ATOM   4207  C  C    . THR A 1 20 ? 7.569   7.107   -7.358  1.00 0.00 ? 20  THR A C    7  
ATOM   4208  O  O    . THR A 1 20 ? 8.298   7.407   -6.412  1.00 0.00 ? 20  THR A O    7  
ATOM   4209  C  CB   . THR A 1 20 ? 6.007   8.929   -8.043  1.00 0.00 ? 20  THR A CB   7  
ATOM   4210  O  OG1  . THR A 1 20 ? 6.195   9.494   -6.741  1.00 0.00 ? 20  THR A OG1  7  
ATOM   4211  C  CG2  . THR A 1 20 ? 4.767   8.048   -8.045  1.00 0.00 ? 20  THR A CG2  7  
ATOM   4212  H  H    . THR A 1 20 ? 6.432   6.717   -9.806  1.00 0.00 ? 20  THR A H    7  
ATOM   4213  H  HA   . THR A 1 20 ? 8.085   8.805   -8.546  1.00 0.00 ? 20  THR A HA   7  
ATOM   4214  H  HB   . THR A 1 20 ? 5.864   9.727   -8.757  1.00 0.00 ? 20  THR A HB   7  
ATOM   4215  H  HG1  . THR A 1 20 ? 6.027   8.824   -6.074  1.00 0.00 ? 20  THR A HG1  7  
ATOM   4216  H  HG21 . THR A 1 20 ? 4.572   7.699   -7.041  1.00 0.00 ? 20  THR A HG21 7  
ATOM   4217  H  HG22 . THR A 1 20 ? 4.928   7.201   -8.696  1.00 0.00 ? 20  THR A HG22 7  
ATOM   4218  H  HG23 . THR A 1 20 ? 3.921   8.618   -8.398  1.00 0.00 ? 20  THR A HG23 7  
ATOM   4219  N  N    . SER A 1 21 ? 7.016   5.906   -7.493  1.00 0.00 ? 21  SER A N    7  
ATOM   4220  C  CA   . SER A 1 21 ? 7.237   4.848   -6.514  1.00 0.00 ? 21  SER A CA   7  
ATOM   4221  C  C    . SER A 1 21 ? 6.710   3.512   -7.030  1.00 0.00 ? 21  SER A C    7  
ATOM   4222  O  O    . SER A 1 21 ? 5.502   3.319   -7.163  1.00 0.00 ? 21  SER A O    7  
ATOM   4223  C  CB   . SER A 1 21 ? 6.557   5.200   -5.190  1.00 0.00 ? 21  SER A CB   7  
ATOM   4224  O  OG   . SER A 1 21 ? 7.072   4.417   -4.127  1.00 0.00 ? 21  SER A OG   7  
ATOM   4225  H  H    . SER A 1 21 ? 6.444   5.728   -8.269  1.00 0.00 ? 21  SER A H    7  
ATOM   4226  H  HA   . SER A 1 21 ? 8.301   4.764   -6.351  1.00 0.00 ? 21  SER A HA   7  
ATOM   4227  H  HB2  . SER A 1 21 ? 6.726   6.243   -4.967  1.00 0.00 ? 21  SER A HB2  7  
ATOM   4228  H  HB3  . SER A 1 21 ? 5.495   5.018   -5.274  1.00 0.00 ? 21  SER A HB3  7  
ATOM   4229  H  HG   . SER A 1 21 ? 7.023   3.487   -4.362  1.00 0.00 ? 21  SER A HG   7  
ATOM   4230  N  N    . ILE A 1 22 ? 7.627   2.594   -7.318  1.00 0.00 ? 22  ILE A N    7  
ATOM   4231  C  CA   . ILE A 1 22 ? 7.256   1.277   -7.818  1.00 0.00 ? 22  ILE A CA   7  
ATOM   4232  C  C    . ILE A 1 22 ? 6.629   0.427   -6.718  1.00 0.00 ? 22  ILE A C    7  
ATOM   4233  O  O    . ILE A 1 22 ? 7.018   0.515   -5.553  1.00 0.00 ? 22  ILE A O    7  
ATOM   4234  C  CB   . ILE A 1 22 ? 8.473   0.531   -8.396  1.00 0.00 ? 22  ILE A CB   7  
ATOM   4235  C  CG1  . ILE A 1 22 ? 8.858   1.115   -9.757  1.00 0.00 ? 22  ILE A CG1  7  
ATOM   4236  C  CG2  . ILE A 1 22 ? 8.174   -0.956  -8.518  1.00 0.00 ? 22  ILE A CG2  7  
ATOM   4237  C  CD1  . ILE A 1 22 ? 9.547   2.458   -9.664  1.00 0.00 ? 22  ILE A CD1  7  
ATOM   4238  H  H    . ILE A 1 22 ? 8.574   2.808   -7.191  1.00 0.00 ? 22  ILE A H    7  
ATOM   4239  H  HA   . ILE A 1 22 ? 6.532   1.412   -8.610  1.00 0.00 ? 22  ILE A HA   7  
ATOM   4240  H  HB   . ILE A 1 22 ? 9.299   0.652   -7.713  1.00 0.00 ? 22  ILE A HB   7  
ATOM   4241  H  HG12 . ILE A 1 22 ? 9.526   0.433   -10.258 1.00 0.00 ? 22  ILE A HG12 7  
ATOM   4242  H  HG13 . ILE A 1 22 ? 7.965   1.240   -10.352 1.00 0.00 ? 22  ILE A HG13 7  
ATOM   4243  H  HG21 . ILE A 1 22 ? 7.113   -1.100  -8.661  1.00 0.00 ? 22  ILE A HG21 7  
ATOM   4244  H  HG22 . ILE A 1 22 ? 8.708   -1.362  -9.363  1.00 0.00 ? 22  ILE A HG22 7  
ATOM   4245  H  HG23 . ILE A 1 22 ? 8.487   -1.462  -7.617  1.00 0.00 ? 22  ILE A HG23 7  
ATOM   4246  H  HD11 . ILE A 1 22 ? 8.865   3.186   -9.250  1.00 0.00 ? 22  ILE A HD11 7  
ATOM   4247  H  HD12 . ILE A 1 22 ? 10.416  2.374   -9.029  1.00 0.00 ? 22  ILE A HD12 7  
ATOM   4248  H  HD13 . ILE A 1 22 ? 9.853   2.774   -10.651 1.00 0.00 ? 22  ILE A HD13 7  
ATOM   4249  N  N    . CYS A 1 23 ? 5.656   -0.396  -7.095  1.00 0.00 ? 23  CYS A N    7  
ATOM   4250  C  CA   . CYS A 1 23 ? 4.975   -1.263  -6.141  1.00 0.00 ? 23  CYS A CA   7  
ATOM   4251  C  C    . CYS A 1 23 ? 5.931   -2.314  -5.583  1.00 0.00 ? 23  CYS A C    7  
ATOM   4252  O  O    . CYS A 1 23 ? 7.064   -2.446  -6.045  1.00 0.00 ? 23  CYS A O    7  
ATOM   4253  C  CB   . CYS A 1 23 ? 3.779   -1.947  -6.806  1.00 0.00 ? 23  CYS A CB   7  
ATOM   4254  S  SG   . CYS A 1 23 ? 2.419   -2.344  -5.661  1.00 0.00 ? 23  CYS A SG   7  
ATOM   4255  H  H    . CYS A 1 23 ? 5.390   -0.421  -8.038  1.00 0.00 ? 23  CYS A H    7  
ATOM   4256  H  HA   . CYS A 1 23 ? 4.621   -0.649  -5.327  1.00 0.00 ? 23  CYS A HA   7  
ATOM   4257  H  HB2  . CYS A 1 23 ? 3.383   -1.298  -7.573  1.00 0.00 ? 23  CYS A HB2  7  
ATOM   4258  H  HB3  . CYS A 1 23 ? 4.108   -2.871  -7.258  1.00 0.00 ? 23  CYS A HB3  7  
ATOM   4259  N  N    . ASP A 1 24 ? 5.465   -3.059  -4.586  1.00 0.00 ? 24  ASP A N    7  
ATOM   4260  C  CA   . ASP A 1 24 ? 6.277   -4.100  -3.965  1.00 0.00 ? 24  ASP A CA   7  
ATOM   4261  C  C    . ASP A 1 24 ? 5.828   -5.484  -4.423  1.00 0.00 ? 24  ASP A C    7  
ATOM   4262  O  O    . ASP A 1 24 ? 6.603   -6.439  -4.394  1.00 0.00 ? 24  ASP A O    7  
ATOM   4263  C  CB   . ASP A 1 24 ? 6.193   -4.000  -2.441  1.00 0.00 ? 24  ASP A CB   7  
ATOM   4264  C  CG   . ASP A 1 24 ? 7.069   -5.023  -1.745  1.00 0.00 ? 24  ASP A CG   7  
ATOM   4265  O  OD1  . ASP A 1 24 ? 8.300   -4.989  -1.954  1.00 0.00 ? 24  ASP A OD1  7  
ATOM   4266  O  OD2  . ASP A 1 24 ? 6.524   -5.857  -0.993  1.00 0.00 ? 24  ASP A OD2  7  
ATOM   4267  H  H    . ASP A 1 24 ? 4.553   -2.906  -4.261  1.00 0.00 ? 24  ASP A H    7  
ATOM   4268  H  HA   . ASP A 1 24 ? 7.301   -3.948  -4.271  1.00 0.00 ? 24  ASP A HA   7  
ATOM   4269  H  HB2  . ASP A 1 24 ? 6.509   -3.014  -2.133  1.00 0.00 ? 24  ASP A HB2  7  
ATOM   4270  H  HB3  . ASP A 1 24 ? 5.170   -4.159  -2.133  1.00 0.00 ? 24  ASP A HB3  7  
ATOM   4271  N  N    . ASN A 1 25 ? 4.571   -5.585  -4.843  1.00 0.00 ? 25  ASN A N    7  
ATOM   4272  C  CA   . ASN A 1 25 ? 4.019   -6.853  -5.305  1.00 0.00 ? 25  ASN A CA   7  
ATOM   4273  C  C    . ASN A 1 25 ? 4.268   -7.043  -6.798  1.00 0.00 ? 25  ASN A C    7  
ATOM   4274  O  O    . ASN A 1 25 ? 5.053   -7.902  -7.202  1.00 0.00 ? 25  ASN A O    7  
ATOM   4275  C  CB   . ASN A 1 25 ? 2.518   -6.915  -5.015  1.00 0.00 ? 25  ASN A CB   7  
ATOM   4276  C  CG   . ASN A 1 25 ? 2.220   -7.387  -3.605  1.00 0.00 ? 25  ASN A CG   7  
ATOM   4277  O  OD1  . ASN A 1 25 ? 3.119   -7.805  -2.876  1.00 0.00 ? 25  ASN A OD1  7  
ATOM   4278  N  ND2  . ASN A 1 25 ? 0.953   -7.321  -3.214  1.00 0.00 ? 25  ASN A ND2  7  
ATOM   4279  H  H    . ASN A 1 25 ? 4.001   -4.787  -4.842  1.00 0.00 ? 25  ASN A H    7  
ATOM   4280  H  HA   . ASN A 1 25 ? 4.514   -7.646  -4.765  1.00 0.00 ? 25  ASN A HA   7  
ATOM   4281  H  HB2  . ASN A 1 25 ? 2.092   -5.930  -5.141  1.00 0.00 ? 25  ASN A HB2  7  
ATOM   4282  H  HB3  . ASN A 1 25 ? 2.051   -7.596  -5.710  1.00 0.00 ? 25  ASN A HB3  7  
ATOM   4283  H  HD21 . ASN A 1 25 ? 0.290   -6.977  -3.849  1.00 0.00 ? 25  ASN A HD21 7  
ATOM   4284  H  HD22 . ASN A 1 25 ? 0.732   -7.619  -2.307  1.00 0.00 ? 25  ASN A HD22 7  
ATOM   4285  N  N    . PHE A 1 26 ? 3.596   -6.237  -7.612  1.00 0.00 ? 26  PHE A N    7  
ATOM   4286  C  CA   . PHE A 1 26 ? 3.744   -6.316  -9.061  1.00 0.00 ? 26  PHE A CA   7  
ATOM   4287  C  C    . PHE A 1 26 ? 5.209   -6.188  -9.465  1.00 0.00 ? 26  PHE A C    7  
ATOM   4288  O  O    . PHE A 1 26 ? 5.621   -6.686  -10.513 1.00 0.00 ? 26  PHE A O    7  
ATOM   4289  C  CB   . PHE A 1 26 ? 2.918   -5.222  -9.740  1.00 0.00 ? 26  PHE A CB   7  
ATOM   4290  C  CG   . PHE A 1 26 ? 2.421   -5.606  -11.104 1.00 0.00 ? 26  PHE A CG   7  
ATOM   4291  C  CD1  . PHE A 1 26 ? 3.298   -5.704  -12.173 1.00 0.00 ? 26  PHE A CD1  7  
ATOM   4292  C  CD2  . PHE A 1 26 ? 1.078   -5.868  -11.319 1.00 0.00 ? 26  PHE A CD2  7  
ATOM   4293  C  CE1  . PHE A 1 26 ? 2.843   -6.056  -13.429 1.00 0.00 ? 26  PHE A CE1  7  
ATOM   4294  C  CE2  . PHE A 1 26 ? 0.617   -6.221  -12.573 1.00 0.00 ? 26  PHE A CE2  7  
ATOM   4295  C  CZ   . PHE A 1 26 ? 1.501   -6.316  -13.630 1.00 0.00 ? 26  PHE A CZ   7  
ATOM   4296  H  H    . PHE A 1 26 ? 2.985   -5.573  -7.229  1.00 0.00 ? 26  PHE A H    7  
ATOM   4297  H  HA   . PHE A 1 26 ? 3.378   -7.281  -9.378  1.00 0.00 ? 26  PHE A HA   7  
ATOM   4298  H  HB2  . PHE A 1 26 ? 2.059   -4.996  -9.126  1.00 0.00 ? 26  PHE A HB2  7  
ATOM   4299  H  HB3  . PHE A 1 26 ? 3.524   -4.335  -9.843  1.00 0.00 ? 26  PHE A HB3  7  
ATOM   4300  H  HD1  . PHE A 1 26 ? 4.347   -5.502  -12.017 1.00 0.00 ? 26  PHE A HD1  7  
ATOM   4301  H  HD2  . PHE A 1 26 ? 0.385   -5.794  -10.492 1.00 0.00 ? 26  PHE A HD2  7  
ATOM   4302  H  HE1  . PHE A 1 26 ? 3.537   -6.130  -14.254 1.00 0.00 ? 26  PHE A HE1  7  
ATOM   4303  H  HE2  . PHE A 1 26 ? -0.433  -6.423  -12.726 1.00 0.00 ? 26  PHE A HE2  7  
ATOM   4304  H  HZ   . PHE A 1 26 ? 1.144   -6.591  -14.611 1.00 0.00 ? 26  PHE A HZ   7  
ATOM   4305  N  N    . SER A 1 27 ? 5.992   -5.516  -8.627  1.00 0.00 ? 27  SER A N    7  
ATOM   4306  C  CA   . SER A 1 27 ? 7.411   -5.317  -8.899  1.00 0.00 ? 27  SER A CA   7  
ATOM   4307  C  C    . SER A 1 27 ? 8.093   -6.644  -9.219  1.00 0.00 ? 27  SER A C    7  
ATOM   4308  O  O    . SER A 1 27 ? 8.576   -6.853  -10.332 1.00 0.00 ? 27  SER A O    7  
ATOM   4309  C  CB   . SER A 1 27 ? 8.094   -4.656  -7.700  1.00 0.00 ? 27  SER A CB   7  
ATOM   4310  O  OG   . SER A 1 27 ? 9.494   -4.872  -7.728  1.00 0.00 ? 27  SER A OG   7  
ATOM   4311  H  H    . SER A 1 27 ? 5.605   -5.142  -7.808  1.00 0.00 ? 27  SER A H    7  
ATOM   4312  H  HA   . SER A 1 27 ? 7.496   -4.666  -9.756  1.00 0.00 ? 27  SER A HA   7  
ATOM   4313  H  HB2  . SER A 1 27 ? 7.905   -3.593  -7.723  1.00 0.00 ? 27  SER A HB2  7  
ATOM   4314  H  HB3  . SER A 1 27 ? 7.694   -5.073  -6.787  1.00 0.00 ? 27  SER A HB3  7  
ATOM   4315  H  HG   . SER A 1 27 ? 9.949   -4.049  -7.533  1.00 0.00 ? 27  SER A HG   7  
ATOM   4316  N  N    . ALA A 1 28 ? 8.129   -7.536  -8.235  1.00 0.00 ? 28  ALA A N    7  
ATOM   4317  C  CA   . ALA A 1 28 ? 8.750   -8.843  -8.412  1.00 0.00 ? 28  ALA A CA   7  
ATOM   4318  C  C    . ALA A 1 28 ? 7.707   -9.907  -8.734  1.00 0.00 ? 28  ALA A C    7  
ATOM   4319  O  O    . ALA A 1 28 ? 7.764   -10.549 -9.784  1.00 0.00 ? 28  ALA A O    7  
ATOM   4320  C  CB   . ALA A 1 28 ? 9.532   -9.229  -7.165  1.00 0.00 ? 28  ALA A CB   7  
ATOM   4321  H  H    . ALA A 1 28 ? 7.727   -7.311  -7.371  1.00 0.00 ? 28  ALA A H    7  
ATOM   4322  H  HA   . ALA A 1 28 ? 9.445   -8.774  -9.236  1.00 0.00 ? 28  ALA A HA   7  
ATOM   4323  H  HB1  . ALA A 1 28 ? 9.191   -8.634  -6.329  1.00 0.00 ? 28  ALA A HB1  7  
ATOM   4324  H  HB2  . ALA A 1 28 ? 9.374   -10.275 -6.950  1.00 0.00 ? 28  ALA A HB2  7  
ATOM   4325  H  HB3  . ALA A 1 28 ? 10.583  -9.049  -7.330  1.00 0.00 ? 28  ALA A HB3  7  
ATOM   4326  N  N    . TYR A 1 29 ? 6.755   -10.091 -7.826  1.00 0.00 ? 29  TYR A N    7  
ATOM   4327  C  CA   . TYR A 1 29 ? 5.700   -11.080 -8.013  1.00 0.00 ? 29  TYR A CA   7  
ATOM   4328  C  C    . TYR A 1 29 ? 5.084   -10.964 -9.404  1.00 0.00 ? 29  TYR A C    7  
ATOM   4329  O  O    . TYR A 1 29 ? 5.024   -11.938 -10.152 1.00 0.00 ? 29  TYR A O    7  
ATOM   4330  C  CB   . TYR A 1 29 ? 4.617   -10.909 -6.947  1.00 0.00 ? 29  TYR A CB   7  
ATOM   4331  C  CG   . TYR A 1 29 ? 5.139   -11.007 -5.532  1.00 0.00 ? 29  TYR A CG   7  
ATOM   4332  C  CD1  . TYR A 1 29 ? 5.735   -9.916  -4.912  1.00 0.00 ? 29  TYR A CD1  7  
ATOM   4333  C  CD2  . TYR A 1 29 ? 5.034   -12.192 -4.813  1.00 0.00 ? 29  TYR A CD2  7  
ATOM   4334  C  CE1  . TYR A 1 29 ? 6.214   -10.002 -3.619  1.00 0.00 ? 29  TYR A CE1  7  
ATOM   4335  C  CE2  . TYR A 1 29 ? 5.509   -12.287 -3.519  1.00 0.00 ? 29  TYR A CE2  7  
ATOM   4336  C  CZ   . TYR A 1 29 ? 6.098   -11.190 -2.927  1.00 0.00 ? 29  TYR A CZ   7  
ATOM   4337  O  OH   . TYR A 1 29 ? 6.573   -11.279 -1.638  1.00 0.00 ? 29  TYR A OH   7  
ATOM   4338  H  H    . TYR A 1 29 ? 6.762   -9.549  -7.010  1.00 0.00 ? 29  TYR A H    7  
ATOM   4339  H  HA   . TYR A 1 29 ? 6.142   -12.060 -7.908  1.00 0.00 ? 29  TYR A HA   7  
ATOM   4340  H  HB2  . TYR A 1 29 ? 4.157   -9.939  -7.063  1.00 0.00 ? 29  TYR A HB2  7  
ATOM   4341  H  HB3  . TYR A 1 29 ? 3.867   -11.675 -7.079  1.00 0.00 ? 29  TYR A HB3  7  
ATOM   4342  H  HD1  . TYR A 1 29 ? 5.824   -8.988  -5.458  1.00 0.00 ? 29  TYR A HD1  7  
ATOM   4343  H  HD2  . TYR A 1 29 ? 4.571   -13.050 -5.279  1.00 0.00 ? 29  TYR A HD2  7  
ATOM   4344  H  HE1  . TYR A 1 29 ? 6.676   -9.143  -3.155  1.00 0.00 ? 29  TYR A HE1  7  
ATOM   4345  H  HE2  . TYR A 1 29 ? 5.419   -13.216 -2.976  1.00 0.00 ? 29  TYR A HE2  7  
ATOM   4346  H  HH   . TYR A 1 29 ? 7.325   -11.875 -1.615  1.00 0.00 ? 29  TYR A HH   7  
ATOM   4347  N  N    . GLY A 1 30 ? 4.628   -9.762  -9.743  1.00 0.00 ? 30  GLY A N    7  
ATOM   4348  C  CA   . GLY A 1 30 ? 4.023   -9.538  -11.043 1.00 0.00 ? 30  GLY A CA   7  
ATOM   4349  C  C    . GLY A 1 30 ? 2.556   -9.169  -10.944 1.00 0.00 ? 30  GLY A C    7  
ATOM   4350  O  O    . GLY A 1 30 ? 2.013   -8.514  -11.834 1.00 0.00 ? 30  GLY A O    7  
ATOM   4351  H  H    . GLY A 1 30 ? 4.703   -9.021  -9.106  1.00 0.00 ? 30  GLY A H    7  
ATOM   4352  H  HA2  . GLY A 1 30 ? 4.552   -8.739  -11.542 1.00 0.00 ? 30  GLY A HA2  7  
ATOM   4353  H  HA3  . GLY A 1 30 ? 4.116   -10.439 -11.631 1.00 0.00 ? 30  GLY A HA3  7  
ATOM   4354  N  N    . TRP A 1 31 ? 1.914   -9.591  -9.862  1.00 0.00 ? 31  TRP A N    7  
ATOM   4355  C  CA   . TRP A 1 31 ? 0.500   -9.302  -9.651  1.00 0.00 ? 31  TRP A CA   7  
ATOM   4356  C  C    . TRP A 1 31 ? 0.310   -8.321  -8.499  1.00 0.00 ? 31  TRP A C    7  
ATOM   4357  O  O    . TRP A 1 31 ? 1.183   -8.178  -7.643  1.00 0.00 ? 31  TRP A O    7  
ATOM   4358  C  CB   . TRP A 1 31 ? -0.269  -10.594 -9.369  1.00 0.00 ? 31  TRP A CB   7  
ATOM   4359  C  CG   . TRP A 1 31 ? -0.359  -10.925 -7.910  1.00 0.00 ? 31  TRP A CG   7  
ATOM   4360  C  CD1  . TRP A 1 31 ? 0.584   -11.560 -7.153  1.00 0.00 ? 31  TRP A CD1  7  
ATOM   4361  C  CD2  . TRP A 1 31 ? -1.454  -10.640 -7.032  1.00 0.00 ? 31  TRP A CD2  7  
ATOM   4362  N  NE1  . TRP A 1 31 ? 0.142   -11.686 -5.859  1.00 0.00 ? 31  TRP A NE1  7  
ATOM   4363  C  CE2  . TRP A 1 31 ? -1.105  -11.129 -5.758  1.00 0.00 ? 31  TRP A CE2  7  
ATOM   4364  C  CE3  . TRP A 1 31 ? -2.694  -10.018 -7.198  1.00 0.00 ? 31  TRP A CE3  7  
ATOM   4365  C  CZ2  . TRP A 1 31 ? -1.953  -11.015 -4.659  1.00 0.00 ? 31  TRP A CZ2  7  
ATOM   4366  C  CZ3  . TRP A 1 31 ? -3.535  -9.905  -6.107  1.00 0.00 ? 31  TRP A CZ3  7  
ATOM   4367  C  CH2  . TRP A 1 31 ? -3.161  -10.401 -4.851  1.00 0.00 ? 31  TRP A CH2  7  
ATOM   4368  H  H    . TRP A 1 31 ? 2.401   -10.110 -9.187  1.00 0.00 ? 31  TRP A H    7  
ATOM   4369  H  HA   . TRP A 1 31 ? 0.115   -8.856  -10.556 1.00 0.00 ? 31  TRP A HA   7  
ATOM   4370  H  HB2  . TRP A 1 31 ? -1.274  -10.499 -9.751  1.00 0.00 ? 31  TRP A HB2  7  
ATOM   4371  H  HB3  . TRP A 1 31 ? 0.225   -11.415 -9.868  1.00 0.00 ? 31  TRP A HB3  7  
ATOM   4372  H  HD1  . TRP A 1 31 ? 1.534   -11.907 -7.532  1.00 0.00 ? 31  TRP A HD1  7  
ATOM   4373  H  HE1  . TRP A 1 31 ? 0.641   -12.106 -5.126  1.00 0.00 ? 31  TRP A HE1  7  
ATOM   4374  H  HE3  . TRP A 1 31 ? -3.000  -9.629  -8.158  1.00 0.00 ? 31  TRP A HE3  7  
ATOM   4375  H  HZ2  . TRP A 1 31 ? -1.679  -11.392 -3.685  1.00 0.00 ? 31  TRP A HZ2  7  
ATOM   4376  H  HZ3  . TRP A 1 31 ? -4.497  -9.428  -6.216  1.00 0.00 ? 31  TRP A HZ3  7  
ATOM   4377  H  HH2  . TRP A 1 31 ? -3.849  -10.292 -4.026  1.00 0.00 ? 31  TRP A HH2  7  
ATOM   4378  N  N    . CYS A 1 32 ? -0.836  -7.648  -8.484  1.00 0.00 ? 32  CYS A N    7  
ATOM   4379  C  CA   . CYS A 1 32 ? -1.140  -6.680  -7.437  1.00 0.00 ? 32  CYS A CA   7  
ATOM   4380  C  C    . CYS A 1 32 ? -2.632  -6.675  -7.118  1.00 0.00 ? 32  CYS A C    7  
ATOM   4381  O  O    . CYS A 1 32 ? -3.483  -6.677  -8.008  1.00 0.00 ? 32  CYS A O    7  
ATOM   4382  C  CB   . CYS A 1 32 ? -0.693  -5.280  -7.863  1.00 0.00 ? 32  CYS A CB   7  
ATOM   4383  S  SG   . CYS A 1 32 ? -0.928  -4.004  -6.584  1.00 0.00 ? 32  CYS A SG   7  
ATOM   4384  H  H    . CYS A 1 32 ? -1.493  -7.806  -9.194  1.00 0.00 ? 32  CYS A H    7  
ATOM   4385  H  HA   . CYS A 1 32 ? -0.596  -6.968  -6.550  1.00 0.00 ? 32  CYS A HA   7  
ATOM   4386  H  HB2  . CYS A 1 32 ? 0.358   -5.306  -8.111  1.00 0.00 ? 32  CYS A HB2  7  
ATOM   4387  H  HB3  . CYS A 1 32 ? -1.256  -4.980  -8.734  1.00 0.00 ? 32  CYS A HB3  7  
ATOM   4388  N  N    . PRO A 1 33 ? -2.959  -6.668  -5.817  1.00 0.00 ? 33  PRO A N    7  
ATOM   4389  C  CA   . PRO A 1 33 ? -4.348  -6.661  -5.350  1.00 0.00 ? 33  PRO A CA   7  
ATOM   4390  C  C    . PRO A 1 33 ? -5.049  -5.337  -5.634  1.00 0.00 ? 33  PRO A C    7  
ATOM   4391  O  O    . PRO A 1 33 ? -6.229  -5.168  -5.323  1.00 0.00 ? 33  PRO A O    7  
ATOM   4392  C  CB   . PRO A 1 33 ? -4.216  -6.884  -3.841  1.00 0.00 ? 33  PRO A CB   7  
ATOM   4393  C  CG   . PRO A 1 33 ? -2.856  -6.379  -3.501  1.00 0.00 ? 33  PRO A CG   7  
ATOM   4394  C  CD   . PRO A 1 33 ? -1.997  -6.665  -4.702  1.00 0.00 ? 33  PRO A CD   7  
ATOM   4395  H  HA   . PRO A 1 33 ? -4.917  -7.469  -5.786  1.00 0.00 ? 33  PRO A HA   7  
ATOM   4396  H  HB2  . PRO A 1 33 ? -4.986  -6.327  -3.324  1.00 0.00 ? 33  PRO A HB2  7  
ATOM   4397  H  HB3  . PRO A 1 33 ? -4.314  -7.936  -3.619  1.00 0.00 ? 33  PRO A HB3  7  
ATOM   4398  H  HG2  . PRO A 1 33 ? -2.895  -5.318  -3.312  1.00 0.00 ? 33  PRO A HG2  7  
ATOM   4399  H  HG3  . PRO A 1 33 ? -2.477  -6.903  -2.636  1.00 0.00 ? 33  PRO A HG3  7  
ATOM   4400  H  HD2  . PRO A 1 33 ? -1.259  -5.887  -4.831  1.00 0.00 ? 33  PRO A HD2  7  
ATOM   4401  H  HD3  . PRO A 1 33 ? -1.519  -7.628  -4.603  1.00 0.00 ? 33  PRO A HD3  7  
ATOM   4402  N  N    . LEU A 1 34 ? -4.317  -4.400  -6.226  1.00 0.00 ? 34  LEU A N    7  
ATOM   4403  C  CA   . LEU A 1 34 ? -4.869  -3.090  -6.553  1.00 0.00 ? 34  LEU A CA   7  
ATOM   4404  C  C    . LEU A 1 34 ? -5.007  -2.919  -8.062  1.00 0.00 ? 34  LEU A C    7  
ATOM   4405  O  O    . LEU A 1 34 ? -5.676  -2.000  -8.534  1.00 0.00 ? 34  LEU A O    7  
ATOM   4406  C  CB   . LEU A 1 34 ? -3.980  -1.984  -5.981  1.00 0.00 ? 34  LEU A CB   7  
ATOM   4407  C  CG   . LEU A 1 34 ? -4.131  -1.707  -4.485  1.00 0.00 ? 34  LEU A CG   7  
ATOM   4408  C  CD1  . LEU A 1 34 ? -3.214  -0.572  -4.057  1.00 0.00 ? 34  LEU A CD1  7  
ATOM   4409  C  CD2  . LEU A 1 34 ? -5.578  -1.383  -4.146  1.00 0.00 ? 34  LEU A CD2  7  
ATOM   4410  H  H    . LEU A 1 34 ? -3.382  -4.593  -6.449  1.00 0.00 ? 34  LEU A H    7  
ATOM   4411  H  HA   . LEU A 1 34 ? -5.848  -3.022  -6.103  1.00 0.00 ? 34  LEU A HA   7  
ATOM   4412  H  HB2  . LEU A 1 34 ? -2.952  -2.257  -6.165  1.00 0.00 ? 34  LEU A HB2  7  
ATOM   4413  H  HB3  . LEU A 1 34 ? -4.208  -1.071  -6.512  1.00 0.00 ? 34  LEU A HB3  7  
ATOM   4414  H  HG   . LEU A 1 34 ? -3.847  -2.592  -3.931  1.00 0.00 ? 34  LEU A HG   7  
ATOM   4415  H  HD11 . LEU A 1 34 ? -3.751  0.363   -4.106  1.00 0.00 ? 34  LEU A HD11 7  
ATOM   4416  H  HD12 . LEU A 1 34 ? -2.360  -0.531  -4.716  1.00 0.00 ? 34  LEU A HD12 7  
ATOM   4417  H  HD13 . LEU A 1 34 ? -2.879  -0.742  -3.044  1.00 0.00 ? 34  LEU A HD13 7  
ATOM   4418  H  HD21 . LEU A 1 34 ? -5.613  -0.801  -3.236  1.00 0.00 ? 34  LEU A HD21 7  
ATOM   4419  H  HD22 . LEU A 1 34 ? -6.130  -2.301  -4.007  1.00 0.00 ? 34  LEU A HD22 7  
ATOM   4420  H  HD23 . LEU A 1 34 ? -6.019  -0.816  -4.953  1.00 0.00 ? 34  LEU A HD23 7  
ATOM   4421  N  N    . GLY A 1 35 ? -4.371  -3.811  -8.815  1.00 0.00 ? 35  GLY A N    7  
ATOM   4422  C  CA   . GLY A 1 35 ? -4.438  -3.742  -10.263 1.00 0.00 ? 35  GLY A CA   7  
ATOM   4423  C  C    . GLY A 1 35 ? -3.882  -2.442  -10.807 1.00 0.00 ? 35  GLY A C    7  
ATOM   4424  O  O    . GLY A 1 35 ? -2.900  -1.900  -10.299 1.00 0.00 ? 35  GLY A O    7  
ATOM   4425  H  H    . GLY A 1 35 ? -3.853  -4.522  -8.383  1.00 0.00 ? 35  GLY A H    7  
ATOM   4426  H  HA2  . GLY A 1 35 ? -3.874  -4.565  -10.678 1.00 0.00 ? 35  GLY A HA2  7  
ATOM   4427  H  HA3  . GLY A 1 35 ? -5.469  -3.836  -10.569 1.00 0.00 ? 35  GLY A HA3  7  
ATOM   4428  N  N    . PRO A 1 36 ? -4.516  -1.921  -11.868 1.00 0.00 ? 36  PRO A N    7  
ATOM   4429  C  CA   . PRO A 1 36 ? -4.096  -0.670  -12.506 1.00 0.00 ? 36  PRO A CA   7  
ATOM   4430  C  C    . PRO A 1 36 ? -4.361  0.547   -11.627 1.00 0.00 ? 36  PRO A C    7  
ATOM   4431  O  O    . PRO A 1 36 ? -3.638  1.541   -11.693 1.00 0.00 ? 36  PRO A O    7  
ATOM   4432  C  CB   . PRO A 1 36 ? -4.953  -0.612  -13.773 1.00 0.00 ? 36  PRO A CB   7  
ATOM   4433  C  CG   . PRO A 1 36 ? -6.161  -1.423  -13.450 1.00 0.00 ? 36  PRO A CG   7  
ATOM   4434  C  CD   . PRO A 1 36 ? -5.693  -2.513  -12.527 1.00 0.00 ? 36  PRO A CD   7  
ATOM   4435  H  HA   . PRO A 1 36 ? -3.050  -0.695  -12.778 1.00 0.00 ? 36  PRO A HA   7  
ATOM   4436  H  HB2  . PRO A 1 36 ? -5.212  0.415   -13.989 1.00 0.00 ? 36  PRO A HB2  7  
ATOM   4437  H  HB3  . PRO A 1 36 ? -4.405  -1.033  -14.603 1.00 0.00 ? 36  PRO A HB3  7  
ATOM   4438  H  HG2  . PRO A 1 36 ? -6.897  -0.805  -12.959 1.00 0.00 ? 36  PRO A HG2  7  
ATOM   4439  H  HG3  . PRO A 1 36 ? -6.569  -1.848  -14.355 1.00 0.00 ? 36  PRO A HG3  7  
ATOM   4440  H  HD2  . PRO A 1 36 ? -6.460  -2.751  -11.805 1.00 0.00 ? 36  PRO A HD2  7  
ATOM   4441  H  HD3  . PRO A 1 36 ? -5.416  -3.392  -13.090 1.00 0.00 ? 36  PRO A HD3  7  
ATOM   4442  N  N    . GLN A 1 37 ? -5.402  0.461   -10.805 1.00 0.00 ? 37  GLN A N    7  
ATOM   4443  C  CA   . GLN A 1 37 ? -5.762  1.557   -9.913  1.00 0.00 ? 37  GLN A CA   7  
ATOM   4444  C  C    . GLN A 1 37 ? -4.654  1.821   -8.899  1.00 0.00 ? 37  GLN A C    7  
ATOM   4445  O  O    . GLN A 1 37 ? -4.527  2.928   -8.376  1.00 0.00 ? 37  GLN A O    7  
ATOM   4446  C  CB   . GLN A 1 37 ? -7.070  1.241   -9.185  1.00 0.00 ? 37  GLN A CB   7  
ATOM   4447  C  CG   . GLN A 1 37 ? -8.312  1.637   -9.967  1.00 0.00 ? 37  GLN A CG   7  
ATOM   4448  C  CD   . GLN A 1 37 ? -8.156  1.421   -11.459 1.00 0.00 ? 37  GLN A CD   7  
ATOM   4449  O  OE1  . GLN A 1 37 ? -7.606  2.266   -12.166 1.00 0.00 ? 37  GLN A OE1  7  
ATOM   4450  N  NE2  . GLN A 1 37 ? -8.641  0.285   -11.947 1.00 0.00 ? 37  GLN A NE2  7  
ATOM   4451  H  H    . GLN A 1 37 ? -5.940  -0.357  -10.799 1.00 0.00 ? 37  GLN A H    7  
ATOM   4452  H  HA   . GLN A 1 37 ? -5.901  2.442   -10.514 1.00 0.00 ? 37  GLN A HA   7  
ATOM   4453  H  HB2  . GLN A 1 37 ? -7.114  0.179   -8.993  1.00 0.00 ? 37  GLN A HB2  7  
ATOM   4454  H  HB3  . GLN A 1 37 ? -7.081  1.770   -8.243  1.00 0.00 ? 37  GLN A HB3  7  
ATOM   4455  H  HG2  . GLN A 1 37 ? -9.145  1.044   -9.619  1.00 0.00 ? 37  GLN A HG2  7  
ATOM   4456  H  HG3  . GLN A 1 37 ? -8.516  2.682   -9.788  1.00 0.00 ? 37  GLN A HG3  7  
ATOM   4457  H  HE21 . GLN A 1 37 ? -9.067  -0.341  -11.325 1.00 0.00 ? 37  GLN A HE21 7  
ATOM   4458  H  HE22 . GLN A 1 37 ? -8.554  0.120   -12.908 1.00 0.00 ? 37  GLN A HE22 7  
ATOM   4459  N  N    . CYS A 1 38 ? -3.853  0.796   -8.626  1.00 0.00 ? 38  CYS A N    7  
ATOM   4460  C  CA   . CYS A 1 38 ? -2.755  0.916   -7.675  1.00 0.00 ? 38  CYS A CA   7  
ATOM   4461  C  C    . CYS A 1 38 ? -2.021  2.242   -7.854  1.00 0.00 ? 38  CYS A C    7  
ATOM   4462  O  O    . CYS A 1 38 ? -1.722  2.669   -8.970  1.00 0.00 ? 38  CYS A O    7  
ATOM   4463  C  CB   . CYS A 1 38 ? -1.776  -0.247  -7.844  1.00 0.00 ? 38  CYS A CB   7  
ATOM   4464  S  SG   . CYS A 1 38 ? -0.389  -0.231  -6.664  1.00 0.00 ? 38  CYS A SG   7  
ATOM   4465  H  H    . CYS A 1 38 ? -4.004  -0.062  -9.075  1.00 0.00 ? 38  CYS A H    7  
ATOM   4466  H  HA   . CYS A 1 38 ? -3.172  0.882   -6.680  1.00 0.00 ? 38  CYS A HA   7  
ATOM   4467  H  HB2  . CYS A 1 38 ? -2.308  -1.178  -7.711  1.00 0.00 ? 38  CYS A HB2  7  
ATOM   4468  H  HB3  . CYS A 1 38 ? -1.360  -0.216  -8.841  1.00 0.00 ? 38  CYS A HB3  7  
ATOM   4469  N  N    . PRO A 1 39 ? -1.724  2.911   -6.730  1.00 0.00 ? 39  PRO A N    7  
ATOM   4470  C  CA   . PRO A 1 39 ? -1.022  4.198   -6.737  1.00 0.00 ? 39  PRO A CA   7  
ATOM   4471  C  C    . PRO A 1 39 ? 0.438   4.059   -7.157  1.00 0.00 ? 39  PRO A C    7  
ATOM   4472  O  O    . PRO A 1 39 ? 1.037   5.004   -7.669  1.00 0.00 ? 39  PRO A O    7  
ATOM   4473  C  CB   . PRO A 1 39 ? -1.117  4.661   -5.281  1.00 0.00 ? 39  PRO A CB   7  
ATOM   4474  C  CG   . PRO A 1 39 ? -1.271  3.406   -4.493  1.00 0.00 ? 39  PRO A CG   7  
ATOM   4475  C  CD   . PRO A 1 39 ? -2.050  2.462   -5.366  1.00 0.00 ? 39  PRO A CD   7  
ATOM   4476  H  HA   . PRO A 1 39 ? -1.513  4.915   -7.378  1.00 0.00 ? 39  PRO A HA   7  
ATOM   4477  H  HB2  . PRO A 1 39 ? -0.215  5.191   -5.009  1.00 0.00 ? 39  PRO A HB2  7  
ATOM   4478  H  HB3  . PRO A 1 39 ? -1.972  5.310   -5.161  1.00 0.00 ? 39  PRO A HB3  7  
ATOM   4479  H  HG2  . PRO A 1 39 ? -0.300  2.993   -4.267  1.00 0.00 ? 39  PRO A HG2  7  
ATOM   4480  H  HG3  . PRO A 1 39 ? -1.815  3.609   -3.583  1.00 0.00 ? 39  PRO A HG3  7  
ATOM   4481  H  HD2  . PRO A 1 39 ? -1.724  1.445   -5.207  1.00 0.00 ? 39  PRO A HD2  7  
ATOM   4482  H  HD3  . PRO A 1 39 ? -3.109  2.556   -5.173  1.00 0.00 ? 39  PRO A HD3  7  
ATOM   4483  N  N    . GLN A 1 40 ? 1.002   2.877   -6.937  1.00 0.00 ? 40  GLN A N    7  
ATOM   4484  C  CA   . GLN A 1 40 ? 2.392   2.616   -7.293  1.00 0.00 ? 40  GLN A CA   7  
ATOM   4485  C  C    . GLN A 1 40 ? 2.499   2.089   -8.720  1.00 0.00 ? 40  GLN A C    7  
ATOM   4486  O  O    . GLN A 1 40 ? 1.558   1.493   -9.244  1.00 0.00 ? 40  GLN A O    7  
ATOM   4487  C  CB   . GLN A 1 40 ? 3.011   1.612   -6.319  1.00 0.00 ? 40  GLN A CB   7  
ATOM   4488  C  CG   . GLN A 1 40 ? 3.331   2.205   -4.956  1.00 0.00 ? 40  GLN A CG   7  
ATOM   4489  C  CD   . GLN A 1 40 ? 3.419   1.154   -3.868  1.00 0.00 ? 40  GLN A CD   7  
ATOM   4490  O  OE1  . GLN A 1 40 ? 2.404   0.610   -3.431  1.00 0.00 ? 40  GLN A OE1  7  
ATOM   4491  N  NE2  . GLN A 1 40 ? 4.636   0.860   -3.425  1.00 0.00 ? 40  GLN A NE2  7  
ATOM   4492  H  H    . GLN A 1 40 ? 0.473   2.163   -6.525  1.00 0.00 ? 40  GLN A H    7  
ATOM   4493  H  HA   . GLN A 1 40 ? 2.932   3.549   -7.226  1.00 0.00 ? 40  GLN A HA   7  
ATOM   4494  H  HB2  . GLN A 1 40 ? 2.322   0.793   -6.178  1.00 0.00 ? 40  GLN A HB2  7  
ATOM   4495  H  HB3  . GLN A 1 40 ? 3.927   1.232   -6.746  1.00 0.00 ? 40  GLN A HB3  7  
ATOM   4496  H  HG2  . GLN A 1 40 ? 4.279   2.719   -5.015  1.00 0.00 ? 40  GLN A HG2  7  
ATOM   4497  H  HG3  . GLN A 1 40 ? 2.557   2.910   -4.694  1.00 0.00 ? 40  GLN A HG3  7  
ATOM   4498  H  HE21 . GLN A 1 40 ? 5.398   1.334   -3.819  1.00 0.00 ? 40  GLN A HE21 7  
ATOM   4499  H  HE22 . GLN A 1 40 ? 4.722   0.185   -2.721  1.00 0.00 ? 40  GLN A HE22 7  
ATOM   4500  N  N    . SER A 1 41 ? 3.650   2.314   -9.345  1.00 0.00 ? 41  SER A N    7  
ATOM   4501  C  CA   . SER A 1 41 ? 3.878   1.866   -10.713 1.00 0.00 ? 41  SER A CA   7  
ATOM   4502  C  C    . SER A 1 41 ? 4.167   0.369   -10.753 1.00 0.00 ? 41  SER A C    7  
ATOM   4503  O  O    . SER A 1 41 ? 4.561   -0.227  -9.750  1.00 0.00 ? 41  SER A O    7  
ATOM   4504  C  CB   . SER A 1 41 ? 5.042   2.638   -11.338 1.00 0.00 ? 41  SER A CB   7  
ATOM   4505  O  OG   . SER A 1 41 ? 4.908   2.711   -12.747 1.00 0.00 ? 41  SER A OG   7  
ATOM   4506  H  H    . SER A 1 41 ? 4.363   2.796   -8.874  1.00 0.00 ? 41  SER A H    7  
ATOM   4507  H  HA   . SER A 1 41 ? 2.981   2.063   -11.281 1.00 0.00 ? 41  SER A HA   7  
ATOM   4508  H  HB2  . SER A 1 41 ? 5.061   3.641   -10.939 1.00 0.00 ? 41  SER A HB2  7  
ATOM   4509  H  HB3  . SER A 1 41 ? 5.970   2.139   -11.102 1.00 0.00 ? 41  SER A HB3  7  
ATOM   4510  H  HG   . SER A 1 41 ? 5.255   1.908   -13.144 1.00 0.00 ? 41  SER A HG   7  
ATOM   4511  N  N    . HIS A 1 42 ? 3.969   -0.235  -11.921 1.00 0.00 ? 42  HIS A N    7  
ATOM   4512  C  CA   . HIS A 1 42 ? 4.209   -1.664  -12.094 1.00 0.00 ? 42  HIS A CA   7  
ATOM   4513  C  C    . HIS A 1 42 ? 5.167   -1.917  -13.254 1.00 0.00 ? 42  HIS A C    7  
ATOM   4514  O  O    . HIS A 1 42 ? 4.748   -2.310  -14.343 1.00 0.00 ? 42  HIS A O    7  
ATOM   4515  C  CB   . HIS A 1 42 ? 2.889   -2.397  -12.336 1.00 0.00 ? 42  HIS A CB   7  
ATOM   4516  C  CG   . HIS A 1 42 ? 2.005   -2.455  -11.129 1.00 0.00 ? 42  HIS A CG   7  
ATOM   4517  N  ND1  . HIS A 1 42 ? 0.645   -2.668  -11.202 1.00 0.00 ? 42  HIS A ND1  7  
ATOM   4518  C  CD2  . HIS A 1 42 ? 2.295   -2.328  -9.813  1.00 0.00 ? 42  HIS A CD2  7  
ATOM   4519  C  CE1  . HIS A 1 42 ? 0.135   -2.667  -9.983  1.00 0.00 ? 42  HIS A CE1  7  
ATOM   4520  N  NE2  . HIS A 1 42 ? 1.116   -2.464  -9.121  1.00 0.00 ? 42  HIS A NE2  7  
ATOM   4521  H  H    . HIS A 1 42 ? 3.655   0.293   -12.684 1.00 0.00 ? 42  HIS A H    7  
ATOM   4522  H  HA   . HIS A 1 42 ? 4.656   -2.037  -11.185 1.00 0.00 ? 42  HIS A HA   7  
ATOM   4523  H  HB2  . HIS A 1 42 ? 2.345   -1.895  -13.122 1.00 0.00 ? 42  HIS A HB2  7  
ATOM   4524  H  HB3  . HIS A 1 42 ? 3.100   -3.412  -12.643 1.00 0.00 ? 42  HIS A HB3  7  
ATOM   4525  H  HD1  . HIS A 1 42 ? 0.129   -2.798  -12.024 1.00 0.00 ? 42  HIS A HD1  7  
ATOM   4526  H  HD2  . HIS A 1 42 ? 3.272   -2.152  -9.384  1.00 0.00 ? 42  HIS A HD2  7  
ATOM   4527  H  HE1  . HIS A 1 42 ? -0.905  -2.809  -9.732  1.00 0.00 ? 42  HIS A HE1  7  
ATOM   4528  N  N    . ASP A 1 43 ? 6.453   -1.690  -13.013 1.00 0.00 ? 43  ASP A N    7  
ATOM   4529  C  CA   . ASP A 1 43 ? 7.470   -1.895  -14.037 1.00 0.00 ? 43  ASP A CA   7  
ATOM   4530  C  C    . ASP A 1 43 ? 7.978   -3.333  -14.019 1.00 0.00 ? 43  ASP A C    7  
ATOM   4531  O  O    . ASP A 1 43 ? 8.429   -3.830  -12.986 1.00 0.00 ? 43  ASP A O    7  
ATOM   4532  C  CB   . ASP A 1 43 ? 8.636   -0.927  -13.829 1.00 0.00 ? 43  ASP A CB   7  
ATOM   4533  C  CG   . ASP A 1 43 ? 9.629   -0.961  -14.974 1.00 0.00 ? 43  ASP A CG   7  
ATOM   4534  O  OD1  . ASP A 1 43 ? 9.199   -0.807  -16.136 1.00 0.00 ? 43  ASP A OD1  7  
ATOM   4535  O  OD2  . ASP A 1 43 ? 10.836  -1.143  -14.708 1.00 0.00 ? 43  ASP A OD2  7  
ATOM   4536  H  H    . ASP A 1 43 ? 6.725   -1.378  -12.124 1.00 0.00 ? 43  ASP A H    7  
ATOM   4537  H  HA   . ASP A 1 43 ? 7.018   -1.698  -14.998 1.00 0.00 ? 43  ASP A HA   7  
ATOM   4538  H  HB2  . ASP A 1 43 ? 8.250   0.079   -13.742 1.00 0.00 ? 43  ASP A HB2  7  
ATOM   4539  H  HB3  . ASP A 1 43 ? 9.154   -1.188  -12.918 1.00 0.00 ? 43  ASP A HB3  7  
ATOM   4540  N  N    . ILE A 1 44 ? 7.901   -3.997  -15.168 1.00 0.00 ? 44  ILE A N    7  
ATOM   4541  C  CA   . ILE A 1 44 ? 8.353   -5.378  -15.283 1.00 0.00 ? 44  ILE A CA   7  
ATOM   4542  C  C    . ILE A 1 44 ? 9.675   -5.462  -16.039 1.00 0.00 ? 44  ILE A C    7  
ATOM   4543  O  O    . ILE A 1 44 ? 9.696   -5.528  -17.268 1.00 0.00 ? 44  ILE A O    7  
ATOM   4544  C  CB   . ILE A 1 44 ? 7.308   -6.254  -16.000 1.00 0.00 ? 44  ILE A CB   7  
ATOM   4545  C  CG1  . ILE A 1 44 ? 5.988   -6.246  -15.227 1.00 0.00 ? 44  ILE A CG1  7  
ATOM   4546  C  CG2  . ILE A 1 44 ? 7.827   -7.675  -16.157 1.00 0.00 ? 44  ILE A CG2  7  
ATOM   4547  C  CD1  . ILE A 1 44 ? 6.146   -6.563  -13.756 1.00 0.00 ? 44  ILE A CD1  7  
ATOM   4548  H  H    . ILE A 1 44 ? 7.532   -3.547  -15.956 1.00 0.00 ? 44  ILE A H    7  
ATOM   4549  H  HA   . ILE A 1 44 ? 8.496   -5.766  -14.285 1.00 0.00 ? 44  ILE A HA   7  
ATOM   4550  H  HB   . ILE A 1 44 ? 7.143   -5.845  -16.985 1.00 0.00 ? 44  ILE A HB   7  
ATOM   4551  H  HG12 . ILE A 1 44 ? 5.536   -5.270  -15.307 1.00 0.00 ? 44  ILE A HG12 7  
ATOM   4552  H  HG13 . ILE A 1 44 ? 5.324   -6.982  -15.656 1.00 0.00 ? 44  ILE A HG13 7  
ATOM   4553  H  HG21 . ILE A 1 44 ? 7.344   -8.317  -15.436 1.00 0.00 ? 44  ILE A HG21 7  
ATOM   4554  H  HG22 . ILE A 1 44 ? 7.611   -8.028  -17.154 1.00 0.00 ? 44  ILE A HG22 7  
ATOM   4555  H  HG23 . ILE A 1 44 ? 8.894   -7.689  -15.993 1.00 0.00 ? 44  ILE A HG23 7  
ATOM   4556  H  HD11 . ILE A 1 44 ? 6.497   -5.686  -13.233 1.00 0.00 ? 44  ILE A HD11 7  
ATOM   4557  H  HD12 . ILE A 1 44 ? 5.195   -6.871  -13.349 1.00 0.00 ? 44  ILE A HD12 7  
ATOM   4558  H  HD13 . ILE A 1 44 ? 6.864   -7.363  -13.636 1.00 0.00 ? 44  ILE A HD13 7  
ATOM   4559  N  N    . SER A 1 45 ? 10.776  -5.461  -15.295 1.00 0.00 ? 45  SER A N    7  
ATOM   4560  C  CA   . SER A 1 45 ? 12.104  -5.536  -15.895 1.00 0.00 ? 45  SER A CA   7  
ATOM   4561  C  C    . SER A 1 45 ? 12.294  -6.859  -16.631 1.00 0.00 ? 45  SER A C    7  
ATOM   4562  O  O    . SER A 1 45 ? 12.030  -7.929  -16.085 1.00 0.00 ? 45  SER A O    7  
ATOM   4563  C  CB   . SER A 1 45 ? 13.181  -5.377  -14.821 1.00 0.00 ? 45  SER A CB   7  
ATOM   4564  O  OG   . SER A 1 45 ? 14.465  -5.230  -15.404 1.00 0.00 ? 45  SER A OG   7  
ATOM   4565  H  H    . SER A 1 45 ? 10.694  -5.406  -14.320 1.00 0.00 ? 45  SER A H    7  
ATOM   4566  H  HA   . SER A 1 45 ? 12.193  -4.727  -16.605 1.00 0.00 ? 45  SER A HA   7  
ATOM   4567  H  HB2  . SER A 1 45 ? 12.967  -4.502  -14.226 1.00 0.00 ? 45  SER A HB2  7  
ATOM   4568  H  HB3  . SER A 1 45 ? 13.185  -6.252  -14.187 1.00 0.00 ? 45  SER A HB3  7  
ATOM   4569  H  HG   . SER A 1 45 ? 14.606  -5.928  -16.047 1.00 0.00 ? 45  SER A HG   7  
ATOM   4570  N  N    . GLY A 1 46 ? 12.753  -6.776  -17.876 1.00 0.00 ? 46  GLY A N    7  
ATOM   4571  C  CA   . GLY A 1 46 ? 12.971  -7.973  -18.667 1.00 0.00 ? 46  GLY A CA   7  
ATOM   4572  C  C    . GLY A 1 46 ? 14.389  -8.495  -18.550 1.00 0.00 ? 46  GLY A C    7  
ATOM   4573  O  O    . GLY A 1 46 ? 15.096  -8.221  -17.580 1.00 0.00 ? 46  GLY A O    7  
ATOM   4574  H  H    . GLY A 1 46 ? 12.946  -5.895  -18.260 1.00 0.00 ? 46  GLY A H    7  
ATOM   4575  H  HA2  . GLY A 1 46 ? 12.287  -8.740  -18.336 1.00 0.00 ? 46  GLY A HA2  7  
ATOM   4576  H  HA3  . GLY A 1 46 ? 12.768  -7.746  -19.704 1.00 0.00 ? 46  GLY A HA3  7  
ATOM   4577  N  N    . PRO A 1 47 ? 14.824  -9.269  -19.556 1.00 0.00 ? 47  PRO A N    7  
ATOM   4578  C  CA   . PRO A 1 47 ? 16.170  -9.849  -19.583 1.00 0.00 ? 47  PRO A CA   7  
ATOM   4579  C  C    . PRO A 1 47 ? 17.251  -8.795  -19.797 1.00 0.00 ? 47  PRO A C    7  
ATOM   4580  O  O    . PRO A 1 47 ? 16.973  -7.596  -19.783 1.00 0.00 ? 47  PRO A O    7  
ATOM   4581  C  CB   . PRO A 1 47 ? 16.117  -10.810 -20.773 1.00 0.00 ? 47  PRO A CB   7  
ATOM   4582  C  CG   . PRO A 1 47 ? 15.053  -10.260 -21.658 1.00 0.00 ? 47  PRO A CG   7  
ATOM   4583  C  CD   . PRO A 1 47 ? 14.035  -9.637  -20.743 1.00 0.00 ? 47  PRO A CD   7  
ATOM   4584  H  HA   . PRO A 1 47 ? 16.382  -10.402 -18.680 1.00 0.00 ? 47  PRO A HA   7  
ATOM   4585  H  HB2  . PRO A 1 47 ? 17.077  -10.824 -21.271 1.00 0.00 ? 47  PRO A HB2  7  
ATOM   4586  H  HB3  . PRO A 1 47 ? 15.870  -11.803 -20.428 1.00 0.00 ? 47  PRO A HB3  7  
ATOM   4587  H  HG2  . PRO A 1 47 ? 15.471  -9.514  -22.317 1.00 0.00 ? 47  PRO A HG2  7  
ATOM   4588  H  HG3  . PRO A 1 47 ? 14.603  -11.058 -22.230 1.00 0.00 ? 47  PRO A HG3  7  
ATOM   4589  H  HD2  . PRO A 1 47 ? 13.599  -8.763  -21.203 1.00 0.00 ? 47  PRO A HD2  7  
ATOM   4590  H  HD3  . PRO A 1 47 ? 13.268  -10.354 -20.488 1.00 0.00 ? 47  PRO A HD3  7  
ATOM   4591  N  N    . SER A 1 48 ? 18.484  -9.250  -19.995 1.00 0.00 ? 48  SER A N    7  
ATOM   4592  C  CA   . SER A 1 48 ? 19.607  -8.345  -20.209 1.00 0.00 ? 48  SER A CA   7  
ATOM   4593  C  C    . SER A 1 48 ? 19.836  -7.465  -18.984 1.00 0.00 ? 48  SER A C    7  
ATOM   4594  O  O    . SER A 1 48 ? 20.067  -6.262  -19.105 1.00 0.00 ? 48  SER A O    7  
ATOM   4595  C  CB   . SER A 1 48 ? 19.359  -7.471  -21.440 1.00 0.00 ? 48  SER A CB   7  
ATOM   4596  O  OG   . SER A 1 48 ? 20.543  -6.802  -21.837 1.00 0.00 ? 48  SER A OG   7  
ATOM   4597  H  H    . SER A 1 48 ? 18.642  -10.217 -19.995 1.00 0.00 ? 48  SER A H    7  
ATOM   4598  H  HA   . SER A 1 48 ? 20.489  -8.946  -20.376 1.00 0.00 ? 48  SER A HA   7  
ATOM   4599  H  HB2  . SER A 1 48 ? 19.019  -8.091  -22.256 1.00 0.00 ? 48  SER A HB2  7  
ATOM   4600  H  HB3  . SER A 1 48 ? 18.603  -6.735  -21.208 1.00 0.00 ? 48  SER A HB3  7  
ATOM   4601  H  HG   . SER A 1 48 ? 21.122  -6.697  -21.079 1.00 0.00 ? 48  SER A HG   7  
ATOM   4602  N  N    . SER A 1 49 ? 19.771  -8.074  -17.805 1.00 0.00 ? 49  SER A N    7  
ATOM   4603  C  CA   . SER A 1 49 ? 19.968  -7.347  -16.556 1.00 0.00 ? 49  SER A CA   7  
ATOM   4604  C  C    . SER A 1 49 ? 21.157  -6.398  -16.662 1.00 0.00 ? 49  SER A C    7  
ATOM   4605  O  O    . SER A 1 49 ? 21.019  -5.189  -16.481 1.00 0.00 ? 49  SER A O    7  
ATOM   4606  C  CB   . SER A 1 49 ? 20.182  -8.325  -15.400 1.00 0.00 ? 49  SER A CB   7  
ATOM   4607  O  OG   . SER A 1 49 ? 21.257  -9.208  -15.671 1.00 0.00 ? 49  SER A OG   7  
ATOM   4608  H  H    . SER A 1 49 ? 19.584  -9.036  -17.774 1.00 0.00 ? 49  SER A H    7  
ATOM   4609  H  HA   . SER A 1 49 ? 19.076  -6.768  -16.366 1.00 0.00 ? 49  SER A HA   7  
ATOM   4610  H  HB2  . SER A 1 49 ? 20.405  -7.771  -14.500 1.00 0.00 ? 49  SER A HB2  7  
ATOM   4611  H  HB3  . SER A 1 49 ? 19.283  -8.906  -15.251 1.00 0.00 ? 49  SER A HB3  7  
ATOM   4612  H  HG   . SER A 1 49 ? 21.067  -9.709  -16.467 1.00 0.00 ? 49  SER A HG   7  
ATOM   4613  N  N    . GLY A 1 50 ? 22.328  -6.956  -16.957 1.00 0.00 ? 50  GLY A N    7  
ATOM   4614  C  CA   . GLY A 1 50 ? 23.526  -6.146  -17.082 1.00 0.00 ? 50  GLY A CA   7  
ATOM   4615  C  C    . GLY A 1 50 ? 24.738  -6.804  -16.454 1.00 0.00 ? 50  GLY A C    7  
ATOM   4616  O  O    . GLY A 1 50 ? 25.847  -6.297  -16.618 1.00 0.00 ? 50  GLY A O    7  
ATOM   4617  H  H    . GLY A 1 50 ? 22.378  -7.926  -17.090 1.00 0.00 ? 50  GLY A H    7  
ATOM   4618  H  HA2  . GLY A 1 50 ? 23.723  -5.974  -18.129 1.00 0.00 ? 50  GLY A HA2  7  
ATOM   4619  H  HA3  . GLY A 1 50 ? 23.356  -5.196  -16.597 1.00 0.00 ? 50  GLY A HA3  7  
HETATM 4620  ZN ZN   . ZN  B 2 .  ? 0.599   -2.308  -7.147  1.00 0.00 ? 201 ZN  A ZN   7  
ATOM   4621  N  N    . GLY A 1 1  ? -16.583 15.454  -23.225 1.00 0.00 ? 1   GLY A N    8  
ATOM   4622  C  CA   . GLY A 1 1  ? -16.505 16.839  -23.651 1.00 0.00 ? 1   GLY A CA   8  
ATOM   4623  C  C    . GLY A 1 1  ? -16.410 16.978  -25.157 1.00 0.00 ? 1   GLY A C    8  
ATOM   4624  O  O    . GLY A 1 1  ? -16.715 16.041  -25.895 1.00 0.00 ? 1   GLY A O    8  
ATOM   4625  H  H1   . GLY A 1 1  ? -16.641 15.240  -22.271 1.00 0.00 ? 1   GLY A H1   8  
ATOM   4626  H  HA2  . GLY A 1 1  ? -17.386 17.361  -23.306 1.00 0.00 ? 1   GLY A HA2  8  
ATOM   4627  H  HA3  . GLY A 1 1  ? -15.633 17.293  -23.204 1.00 0.00 ? 1   GLY A HA3  8  
ATOM   4628  N  N    . SER A 1 2  ? -15.988 18.152  -25.616 1.00 0.00 ? 2   SER A N    8  
ATOM   4629  C  CA   . SER A 1 2  ? -15.859 18.413  -27.045 1.00 0.00 ? 2   SER A CA   8  
ATOM   4630  C  C    . SER A 1 2  ? -14.399 18.639  -27.427 1.00 0.00 ? 2   SER A C    8  
ATOM   4631  O  O    . SER A 1 2  ? -13.623 19.200  -26.653 1.00 0.00 ? 2   SER A O    8  
ATOM   4632  C  CB   . SER A 1 2  ? -16.695 19.631  -27.441 1.00 0.00 ? 2   SER A CB   8  
ATOM   4633  O  OG   . SER A 1 2  ? -18.053 19.458  -27.074 1.00 0.00 ? 2   SER A OG   8  
ATOM   4634  H  H    . SER A 1 2  ? -15.760 18.861  -24.978 1.00 0.00 ? 2   SER A H    8  
ATOM   4635  H  HA   . SER A 1 2  ? -16.227 17.547  -27.575 1.00 0.00 ? 2   SER A HA   8  
ATOM   4636  H  HB2  . SER A 1 2  ? -16.309 20.507  -26.942 1.00 0.00 ? 2   SER A HB2  8  
ATOM   4637  H  HB3  . SER A 1 2  ? -16.638 19.772  -28.510 1.00 0.00 ? 2   SER A HB3  8  
ATOM   4638  H  HG   . SER A 1 2  ? -18.617 19.878  -27.728 1.00 0.00 ? 2   SER A HG   8  
ATOM   4639  N  N    . SER A 1 3  ? -14.032 18.197  -28.625 1.00 0.00 ? 3   SER A N    8  
ATOM   4640  C  CA   . SER A 1 3  ? -12.664 18.347  -29.109 1.00 0.00 ? 3   SER A CA   8  
ATOM   4641  C  C    . SER A 1 3  ? -12.614 19.279  -30.316 1.00 0.00 ? 3   SER A C    8  
ATOM   4642  O  O    . SER A 1 3  ? -13.514 19.276  -31.154 1.00 0.00 ? 3   SER A O    8  
ATOM   4643  C  CB   . SER A 1 3  ? -12.080 16.982  -29.480 1.00 0.00 ? 3   SER A CB   8  
ATOM   4644  O  OG   . SER A 1 3  ? -10.747 17.108  -29.945 1.00 0.00 ? 3   SER A OG   8  
ATOM   4645  H  H    . SER A 1 3  ? -14.696 17.757  -29.196 1.00 0.00 ? 3   SER A H    8  
ATOM   4646  H  HA   . SER A 1 3  ? -12.076 18.776  -28.312 1.00 0.00 ? 3   SER A HA   8  
ATOM   4647  H  HB2  . SER A 1 3  ? -12.086 16.342  -28.611 1.00 0.00 ? 3   SER A HB2  8  
ATOM   4648  H  HB3  . SER A 1 3  ? -12.680 16.537  -30.260 1.00 0.00 ? 3   SER A HB3  8  
ATOM   4649  H  HG   . SER A 1 3  ? -10.550 16.389  -30.551 1.00 0.00 ? 3   SER A HG   8  
ATOM   4650  N  N    . GLY A 1 4  ? -11.553 20.077  -30.396 1.00 0.00 ? 4   GLY A N    8  
ATOM   4651  C  CA   . GLY A 1 4  ? -11.404 21.004  -31.502 1.00 0.00 ? 4   GLY A CA   8  
ATOM   4652  C  C    . GLY A 1 4  ? -10.779 20.356  -32.721 1.00 0.00 ? 4   GLY A C    8  
ATOM   4653  O  O    . GLY A 1 4  ? -11.483 19.824  -33.580 1.00 0.00 ? 4   GLY A O    8  
ATOM   4654  H  H    . GLY A 1 4  ? -10.867 20.035  -29.698 1.00 0.00 ? 4   GLY A H    8  
ATOM   4655  H  HA2  . GLY A 1 4  ? -12.378 21.387  -31.770 1.00 0.00 ? 4   GLY A HA2  8  
ATOM   4656  H  HA3  . GLY A 1 4  ? -10.779 21.826  -31.186 1.00 0.00 ? 4   GLY A HA3  8  
ATOM   4657  N  N    . SER A 1 5  ? -9.453  20.401  -32.799 1.00 0.00 ? 5   SER A N    8  
ATOM   4658  C  CA   . SER A 1 5  ? -8.733  19.818  -33.926 1.00 0.00 ? 5   SER A CA   8  
ATOM   4659  C  C    . SER A 1 5  ? -7.622  18.892  -33.440 1.00 0.00 ? 5   SER A C    8  
ATOM   4660  O  O    . SER A 1 5  ? -6.509  18.911  -33.966 1.00 0.00 ? 5   SER A O    8  
ATOM   4661  C  CB   . SER A 1 5  ? -8.144  20.921  -34.807 1.00 0.00 ? 5   SER A CB   8  
ATOM   4662  O  OG   . SER A 1 5  ? -7.535  20.378  -35.966 1.00 0.00 ? 5   SER A OG   8  
ATOM   4663  H  H    . SER A 1 5  ? -8.947  20.839  -32.083 1.00 0.00 ? 5   SER A H    8  
ATOM   4664  H  HA   . SER A 1 5  ? -9.438  19.242  -34.507 1.00 0.00 ? 5   SER A HA   8  
ATOM   4665  H  HB2  . SER A 1 5  ? -8.932  21.594  -35.112 1.00 0.00 ? 5   SER A HB2  8  
ATOM   4666  H  HB3  . SER A 1 5  ? -7.400  21.468  -34.246 1.00 0.00 ? 5   SER A HB3  8  
ATOM   4667  H  HG   . SER A 1 5  ? -7.924  19.522  -36.160 1.00 0.00 ? 5   SER A HG   8  
ATOM   4668  N  N    . SER A 1 6  ? -7.933  18.083  -32.433 1.00 0.00 ? 6   SER A N    8  
ATOM   4669  C  CA   . SER A 1 6  ? -6.961  17.152  -31.872 1.00 0.00 ? 6   SER A CA   8  
ATOM   4670  C  C    . SER A 1 6  ? -6.796  15.931  -32.773 1.00 0.00 ? 6   SER A C    8  
ATOM   4671  O  O    . SER A 1 6  ? -5.685  15.582  -33.167 1.00 0.00 ? 6   SER A O    8  
ATOM   4672  C  CB   . SER A 1 6  ? -7.393  16.712  -30.472 1.00 0.00 ? 6   SER A CB   8  
ATOM   4673  O  OG   . SER A 1 6  ? -6.635  15.599  -30.031 1.00 0.00 ? 6   SER A OG   8  
ATOM   4674  H  H    . SER A 1 6  ? -8.838  18.115  -32.056 1.00 0.00 ? 6   SER A H    8  
ATOM   4675  H  HA   . SER A 1 6  ? -6.013  17.664  -31.803 1.00 0.00 ? 6   SER A HA   8  
ATOM   4676  H  HB2  . SER A 1 6  ? -7.248  17.528  -29.781 1.00 0.00 ? 6   SER A HB2  8  
ATOM   4677  H  HB3  . SER A 1 6  ? -8.438  16.437  -30.491 1.00 0.00 ? 6   SER A HB3  8  
ATOM   4678  H  HG   . SER A 1 6  ? -6.016  15.881  -29.354 1.00 0.00 ? 6   SER A HG   8  
ATOM   4679  N  N    . GLY A 1 7  ? -7.913  15.285  -33.094 1.00 0.00 ? 7   GLY A N    8  
ATOM   4680  C  CA   . GLY A 1 7  ? -7.872  14.111  -33.946 1.00 0.00 ? 7   GLY A CA   8  
ATOM   4681  C  C    . GLY A 1 7  ? -6.841  13.099  -33.488 1.00 0.00 ? 7   GLY A C    8  
ATOM   4682  O  O    . GLY A 1 7  ? -6.634  12.913  -32.288 1.00 0.00 ? 7   GLY A O    8  
ATOM   4683  H  H    . GLY A 1 7  ? -8.772  15.609  -32.751 1.00 0.00 ? 7   GLY A H    8  
ATOM   4684  H  HA2  . GLY A 1 7  ? -8.846  13.643  -33.943 1.00 0.00 ? 7   GLY A HA2  8  
ATOM   4685  H  HA3  . GLY A 1 7  ? -7.634  14.419  -34.953 1.00 0.00 ? 7   GLY A HA3  8  
ATOM   4686  N  N    . CYS A 1 8  ? -6.194  12.442  -34.444 1.00 0.00 ? 8   CYS A N    8  
ATOM   4687  C  CA   . CYS A 1 8  ? -5.179  11.441  -34.133 1.00 0.00 ? 8   CYS A CA   8  
ATOM   4688  C  C    . CYS A 1 8  ? -3.777  12.019  -34.294 1.00 0.00 ? 8   CYS A C    8  
ATOM   4689  O  O    . CYS A 1 8  ? -3.261  12.121  -35.407 1.00 0.00 ? 8   CYS A O    8  
ATOM   4690  C  CB   . CYS A 1 8  ? -5.347  10.218  -35.035 1.00 0.00 ? 8   CYS A CB   8  
ATOM   4691  S  SG   . CYS A 1 8  ? -6.457  8.955   -34.369 1.00 0.00 ? 8   CYS A SG   8  
ATOM   4692  H  H    . CYS A 1 8  ? -6.403  12.634  -35.382 1.00 0.00 ? 8   CYS A H    8  
ATOM   4693  H  HA   . CYS A 1 8  ? -5.316  11.141  -33.105 1.00 0.00 ? 8   CYS A HA   8  
ATOM   4694  H  HB2  . CYS A 1 8  ? -5.744  10.534  -35.988 1.00 0.00 ? 8   CYS A HB2  8  
ATOM   4695  H  HB3  . CYS A 1 8  ? -4.381  9.760   -35.190 1.00 0.00 ? 8   CYS A HB3  8  
ATOM   4696  H  HG   . CYS A 1 8  ? -7.662  9.492   -34.252 1.00 0.00 ? 8   CYS A HG   8  
ATOM   4697  N  N    . CYS A 1 9  ? -3.168  12.398  -33.176 1.00 0.00 ? 9   CYS A N    8  
ATOM   4698  C  CA   . CYS A 1 9  ? -1.825  12.969  -33.193 1.00 0.00 ? 9   CYS A CA   8  
ATOM   4699  C  C    . CYS A 1 9  ? -1.033  12.533  -31.965 1.00 0.00 ? 9   CYS A C    8  
ATOM   4700  O  O    . CYS A 1 9  ? -1.607  12.234  -30.917 1.00 0.00 ? 9   CYS A O    8  
ATOM   4701  C  CB   . CYS A 1 9  ? -1.899  14.496  -33.252 1.00 0.00 ? 9   CYS A CB   8  
ATOM   4702  S  SG   . CYS A 1 9  ? -2.588  15.142  -34.793 1.00 0.00 ? 9   CYS A SG   8  
ATOM   4703  H  H    . CYS A 1 9  ? -3.630  12.292  -32.319 1.00 0.00 ? 9   CYS A H    8  
ATOM   4704  H  HA   . CYS A 1 9  ? -1.323  12.607  -34.077 1.00 0.00 ? 9   CYS A HA   8  
ATOM   4705  H  HB2  . CYS A 1 9  ? -2.518  14.850  -32.442 1.00 0.00 ? 9   CYS A HB2  8  
ATOM   4706  H  HB3  . CYS A 1 9  ? -0.904  14.901  -33.140 1.00 0.00 ? 9   CYS A HB3  8  
ATOM   4707  H  HG   . CYS A 1 9  ? -3.825  14.683  -34.912 1.00 0.00 ? 9   CYS A HG   8  
ATOM   4708  N  N    . LEU A 1 10 ? 0.288   12.497  -32.102 1.00 0.00 ? 10  LEU A N    8  
ATOM   4709  C  CA   . LEU A 1 10 ? 1.160   12.096  -31.003 1.00 0.00 ? 10  LEU A CA   8  
ATOM   4710  C  C    . LEU A 1 10 ? 1.393   13.256  -30.041 1.00 0.00 ? 10  LEU A C    8  
ATOM   4711  O  O    . LEU A 1 10 ? 1.385   14.426  -30.426 1.00 0.00 ? 10  LEU A O    8  
ATOM   4712  C  CB   . LEU A 1 10 ? 2.498   11.592  -31.547 1.00 0.00 ? 10  LEU A CB   8  
ATOM   4713  C  CG   . LEU A 1 10 ? 2.568   10.102  -31.883 1.00 0.00 ? 10  LEU A CG   8  
ATOM   4714  C  CD1  . LEU A 1 10 ? 2.514   9.265   -30.615 1.00 0.00 ? 10  LEU A CD1  8  
ATOM   4715  C  CD2  . LEU A 1 10 ? 1.439   9.715   -32.827 1.00 0.00 ? 10  LEU A CD2  8  
ATOM   4716  H  H    . LEU A 1 10 ? 0.687   12.747  -32.961 1.00 0.00 ? 10  LEU A H    8  
ATOM   4717  H  HA   . LEU A 1 10 ? 0.672   11.294  -30.469 1.00 0.00 ? 10  LEU A HA   8  
ATOM   4718  H  HB2  . LEU A 1 10 ? 2.718   12.145  -32.447 1.00 0.00 ? 10  LEU A HB2  8  
ATOM   4719  H  HB3  . LEU A 1 10 ? 3.255   11.800  -30.804 1.00 0.00 ? 10  LEU A HB3  8  
ATOM   4720  H  HG   . LEU A 1 10 ? 3.506   9.895   -32.380 1.00 0.00 ? 10  LEU A HG   8  
ATOM   4721  H  HD11 . LEU A 1 10 ? 2.522   8.217   -30.874 1.00 0.00 ? 10  LEU A HD11 8  
ATOM   4722  H  HD12 . LEU A 1 10 ? 1.610   9.494   -30.070 1.00 0.00 ? 10  LEU A HD12 8  
ATOM   4723  H  HD13 . LEU A 1 10 ? 3.372   9.491   -29.998 1.00 0.00 ? 10  LEU A HD13 8  
ATOM   4724  H  HD21 . LEU A 1 10 ? 0.550   10.273  -32.572 1.00 0.00 ? 10  LEU A HD21 8  
ATOM   4725  H  HD22 . LEU A 1 10 ? 1.239   8.657   -32.736 1.00 0.00 ? 10  LEU A HD22 8  
ATOM   4726  H  HD23 . LEU A 1 10 ? 1.726   9.941   -33.844 1.00 0.00 ? 10  LEU A HD23 8  
ATOM   4727  N  N    . PRO A 1 11 ? 1.608   12.928  -28.759 1.00 0.00 ? 11  PRO A N    8  
ATOM   4728  C  CA   . PRO A 1 11 ? 1.851   13.928  -27.715 1.00 0.00 ? 11  PRO A CA   8  
ATOM   4729  C  C    . PRO A 1 11 ? 3.206   14.610  -27.870 1.00 0.00 ? 11  PRO A C    8  
ATOM   4730  O  O    . PRO A 1 11 ? 4.179   14.014  -28.334 1.00 0.00 ? 11  PRO A O    8  
ATOM   4731  C  CB   . PRO A 1 11 ? 1.809   13.110  -26.422 1.00 0.00 ? 11  PRO A CB   8  
ATOM   4732  C  CG   . PRO A 1 11 ? 2.176   11.727  -26.837 1.00 0.00 ? 11  PRO A CG   8  
ATOM   4733  C  CD   . PRO A 1 11 ? 1.632   11.554  -28.228 1.00 0.00 ? 11  PRO A CD   8  
ATOM   4734  H  HA   . PRO A 1 11 ? 1.073   14.677  -27.695 1.00 0.00 ? 11  PRO A HA   8  
ATOM   4735  H  HB2  . PRO A 1 11 ? 2.520   13.513  -25.715 1.00 0.00 ? 11  PRO A HB2  8  
ATOM   4736  H  HB3  . PRO A 1 11 ? 0.815   13.145  -26.002 1.00 0.00 ? 11  PRO A HB3  8  
ATOM   4737  H  HG2  . PRO A 1 11 ? 3.249   11.616  -26.838 1.00 0.00 ? 11  PRO A HG2  8  
ATOM   4738  H  HG3  . PRO A 1 11 ? 1.724   11.011  -26.167 1.00 0.00 ? 11  PRO A HG3  8  
ATOM   4739  H  HD2  . PRO A 1 11 ? 2.287   10.926  -28.814 1.00 0.00 ? 11  PRO A HD2  8  
ATOM   4740  H  HD3  . PRO A 1 11 ? 0.636   11.137  -28.195 1.00 0.00 ? 11  PRO A HD3  8  
ATOM   4741  N  N    . PRO A 1 12 ? 3.275   15.890  -27.473 1.00 0.00 ? 12  PRO A N    8  
ATOM   4742  C  CA   . PRO A 1 12 ? 4.506   16.680  -27.557 1.00 0.00 ? 12  PRO A CA   8  
ATOM   4743  C  C    . PRO A 1 12 ? 5.564   16.213  -26.563 1.00 0.00 ? 12  PRO A C    8  
ATOM   4744  O  O    . PRO A 1 12 ? 6.746   16.524  -26.707 1.00 0.00 ? 12  PRO A O    8  
ATOM   4745  C  CB   . PRO A 1 12 ? 4.042   18.098  -27.216 1.00 0.00 ? 12  PRO A CB   8  
ATOM   4746  C  CG   . PRO A 1 12 ? 2.818   17.907  -26.388 1.00 0.00 ? 12  PRO A CG   8  
ATOM   4747  C  CD   . PRO A 1 12 ? 2.155   16.663  -26.911 1.00 0.00 ? 12  PRO A CD   8  
ATOM   4748  H  HA   . PRO A 1 12 ? 4.920   16.665  -28.555 1.00 0.00 ? 12  PRO A HA   8  
ATOM   4749  H  HB2  . PRO A 1 12 ? 4.817   18.611  -26.665 1.00 0.00 ? 12  PRO A HB2  8  
ATOM   4750  H  HB3  . PRO A 1 12 ? 3.823   18.637  -28.126 1.00 0.00 ? 12  PRO A HB3  8  
ATOM   4751  H  HG2  . PRO A 1 12 ? 3.092   17.780  -25.352 1.00 0.00 ? 12  PRO A HG2  8  
ATOM   4752  H  HG3  . PRO A 1 12 ? 2.162   18.757  -26.503 1.00 0.00 ? 12  PRO A HG3  8  
ATOM   4753  H  HD2  . PRO A 1 12 ? 1.679   16.123  -26.106 1.00 0.00 ? 12  PRO A HD2  8  
ATOM   4754  H  HD3  . PRO A 1 12 ? 1.436   16.912  -27.677 1.00 0.00 ? 12  PRO A HD3  8  
ATOM   4755  N  N    . ALA A 1 13 ? 5.131   15.463  -25.554 1.00 0.00 ? 13  ALA A N    8  
ATOM   4756  C  CA   . ALA A 1 13 ? 6.042   14.951  -24.538 1.00 0.00 ? 13  ALA A CA   8  
ATOM   4757  C  C    . ALA A 1 13 ? 7.269   14.307  -25.174 1.00 0.00 ? 13  ALA A C    8  
ATOM   4758  O  O    . ALA A 1 13 ? 7.162   13.596  -26.174 1.00 0.00 ? 13  ALA A O    8  
ATOM   4759  C  CB   . ALA A 1 13 ? 5.324   13.952  -23.642 1.00 0.00 ? 13  ALA A CB   8  
ATOM   4760  H  H    . ALA A 1 13 ? 4.177   15.248  -25.493 1.00 0.00 ? 13  ALA A H    8  
ATOM   4761  H  HA   . ALA A 1 13 ? 6.361   15.782  -23.926 1.00 0.00 ? 13  ALA A HA   8  
ATOM   4762  H  HB1  . ALA A 1 13 ? 4.528   13.479  -24.197 1.00 0.00 ? 13  ALA A HB1  8  
ATOM   4763  H  HB2  . ALA A 1 13 ? 6.025   13.202  -23.306 1.00 0.00 ? 13  ALA A HB2  8  
ATOM   4764  H  HB3  . ALA A 1 13 ? 4.911   14.467  -22.788 1.00 0.00 ? 13  ALA A HB3  8  
ATOM   4765  N  N    . THR A 1 14 ? 8.435   14.561  -24.589 1.00 0.00 ? 14  THR A N    8  
ATOM   4766  C  CA   . THR A 1 14 ? 9.683   14.008  -25.100 1.00 0.00 ? 14  THR A CA   8  
ATOM   4767  C  C    . THR A 1 14 ? 10.351  13.110  -24.066 1.00 0.00 ? 14  THR A C    8  
ATOM   4768  O  O    . THR A 1 14 ? 10.559  11.919  -24.303 1.00 0.00 ? 14  THR A O    8  
ATOM   4769  C  CB   . THR A 1 14 ? 10.666  15.122  -25.508 1.00 0.00 ? 14  THR A CB   8  
ATOM   4770  O  OG1  . THR A 1 14 ? 10.083  15.942  -26.526 1.00 0.00 ? 14  THR A OG1  8  
ATOM   4771  C  CG2  . THR A 1 14 ? 11.974  14.531  -26.012 1.00 0.00 ? 14  THR A CG2  8  
ATOM   4772  H  H    . THR A 1 14 ? 8.456   15.135  -23.796 1.00 0.00 ? 14  THR A H    8  
ATOM   4773  H  HA   . THR A 1 14 ? 9.453   13.421  -25.978 1.00 0.00 ? 14  THR A HA   8  
ATOM   4774  H  HB   . THR A 1 14 ? 10.875  15.732  -24.640 1.00 0.00 ? 14  THR A HB   8  
ATOM   4775  H  HG1  . THR A 1 14 ? 10.206  15.525  -27.382 1.00 0.00 ? 14  THR A HG1  8  
ATOM   4776  H  HG21 . THR A 1 14 ? 12.802  14.992  -25.493 1.00 0.00 ? 14  THR A HG21 8  
ATOM   4777  H  HG22 . THR A 1 14 ? 12.067  14.715  -27.072 1.00 0.00 ? 14  THR A HG22 8  
ATOM   4778  H  HG23 . THR A 1 14 ? 11.983  13.467  -25.829 1.00 0.00 ? 14  THR A HG23 8  
ATOM   4779  N  N    . HIS A 1 15 ? 10.685  13.687  -22.916 1.00 0.00 ? 15  HIS A N    8  
ATOM   4780  C  CA   . HIS A 1 15 ? 11.329  12.937  -21.843 1.00 0.00 ? 15  HIS A CA   8  
ATOM   4781  C  C    . HIS A 1 15 ? 10.369  11.914  -21.243 1.00 0.00 ? 15  HIS A C    8  
ATOM   4782  O  O    . HIS A 1 15 ? 9.390   12.276  -20.589 1.00 0.00 ? 15  HIS A O    8  
ATOM   4783  C  CB   . HIS A 1 15 ? 11.826  13.888  -20.754 1.00 0.00 ? 15  HIS A CB   8  
ATOM   4784  C  CG   . HIS A 1 15 ? 10.864  14.993  -20.440 1.00 0.00 ? 15  HIS A CG   8  
ATOM   4785  N  ND1  . HIS A 1 15 ? 10.014  14.965  -19.354 1.00 0.00 ? 15  HIS A ND1  8  
ATOM   4786  C  CD2  . HIS A 1 15 ? 10.623  16.163  -21.075 1.00 0.00 ? 15  HIS A CD2  8  
ATOM   4787  C  CE1  . HIS A 1 15 ? 9.290   16.069  -19.337 1.00 0.00 ? 15  HIS A CE1  8  
ATOM   4788  N  NE2  . HIS A 1 15 ? 9.640   16.814  -20.370 1.00 0.00 ? 15  HIS A NE2  8  
ATOM   4789  H  H    . HIS A 1 15 ? 10.494  14.639  -22.785 1.00 0.00 ? 15  HIS A H    8  
ATOM   4790  H  HA   . HIS A 1 15 ? 12.174  12.414  -22.265 1.00 0.00 ? 15  HIS A HA   8  
ATOM   4791  H  HB2  . HIS A 1 15 ? 11.995  13.328  -19.846 1.00 0.00 ? 15  HIS A HB2  8  
ATOM   4792  H  HB3  . HIS A 1 15 ? 12.755  14.337  -21.073 1.00 0.00 ? 15  HIS A HB3  8  
ATOM   4793  H  HD1  . HIS A 1 15 ? 9.950   14.242  -18.696 1.00 0.00 ? 15  HIS A HD1  8  
ATOM   4794  H  HD2  . HIS A 1 15 ? 11.112  16.520  -21.970 1.00 0.00 ? 15  HIS A HD2  8  
ATOM   4795  H  HE1  . HIS A 1 15 ? 8.539   16.322  -18.602 1.00 0.00 ? 15  HIS A HE1  8  
ATOM   4796  N  N    . ARG A 1 16 ? 10.655  10.636  -21.470 1.00 0.00 ? 16  ARG A N    8  
ATOM   4797  C  CA   . ARG A 1 16 ? 9.816   9.562   -20.953 1.00 0.00 ? 16  ARG A CA   8  
ATOM   4798  C  C    . ARG A 1 16 ? 9.543   9.753   -19.464 1.00 0.00 ? 16  ARG A C    8  
ATOM   4799  O  O    . ARG A 1 16 ? 10.403  10.196  -18.702 1.00 0.00 ? 16  ARG A O    8  
ATOM   4800  C  CB   . ARG A 1 16 ? 10.483  8.206   -21.190 1.00 0.00 ? 16  ARG A CB   8  
ATOM   4801  C  CG   . ARG A 1 16 ? 10.687  7.876   -22.660 1.00 0.00 ? 16  ARG A CG   8  
ATOM   4802  C  CD   . ARG A 1 16 ? 11.086  6.422   -22.855 1.00 0.00 ? 16  ARG A CD   8  
ATOM   4803  N  NE   . ARG A 1 16 ? 11.059  6.030   -24.261 1.00 0.00 ? 16  ARG A NE   8  
ATOM   4804  C  CZ   . ARG A 1 16 ? 11.082  4.768   -24.673 1.00 0.00 ? 16  ARG A CZ   8  
ATOM   4805  N  NH1  . ARG A 1 16 ? 11.134  3.780   -23.791 1.00 0.00 ? 16  ARG A NH1  8  
ATOM   4806  N  NH2  . ARG A 1 16 ? 11.054  4.491   -25.971 1.00 0.00 ? 16  ARG A NH2  8  
ATOM   4807  H  H    . ARG A 1 16 ? 11.449  10.410  -21.998 1.00 0.00 ? 16  ARG A H    8  
ATOM   4808  H  HA   . ARG A 1 16 ? 8.877   9.589   -21.485 1.00 0.00 ? 16  ARG A HA   8  
ATOM   4809  H  HB2  . ARG A 1 16 ? 11.449  8.203   -20.706 1.00 0.00 ? 16  ARG A HB2  8  
ATOM   4810  H  HB3  . ARG A 1 16 ? 9.868   7.434   -20.753 1.00 0.00 ? 16  ARG A HB3  8  
ATOM   4811  H  HG2  . ARG A 1 16 ? 9.766   8.059   -23.192 1.00 0.00 ? 16  ARG A HG2  8  
ATOM   4812  H  HG3  . ARG A 1 16 ? 11.466  8.511   -23.056 1.00 0.00 ? 16  ARG A HG3  8  
ATOM   4813  H  HD2  . ARG A 1 16 ? 12.087  6.282   -22.472 1.00 0.00 ? 16  ARG A HD2  8  
ATOM   4814  H  HD3  . ARG A 1 16 ? 10.400  5.798   -22.303 1.00 0.00 ? 16  ARG A HD3  8  
ATOM   4815  H  HE   . ARG A 1 16 ? 11.020  6.744   -24.931 1.00 0.00 ? 16  ARG A HE   8  
ATOM   4816  H  HH11 . ARG A 1 16 ? 11.154  3.985   -22.812 1.00 0.00 ? 16  ARG A HH11 8  
ATOM   4817  H  HH12 . ARG A 1 16 ? 11.151  2.830   -24.103 1.00 0.00 ? 16  ARG A HH12 8  
ATOM   4818  H  HH21 . ARG A 1 16 ? 11.015  5.233   -26.639 1.00 0.00 ? 16  ARG A HH21 8  
ATOM   4819  H  HH22 . ARG A 1 16 ? 11.072  3.541   -26.280 1.00 0.00 ? 16  ARG A HH22 8  
ATOM   4820  N  N    . PRO A 1 17 ? 8.318   9.412   -19.038 1.00 0.00 ? 17  PRO A N    8  
ATOM   4821  C  CA   . PRO A 1 17 ? 7.904   9.537   -17.637 1.00 0.00 ? 17  PRO A CA   8  
ATOM   4822  C  C    . PRO A 1 17 ? 8.606   8.530   -16.733 1.00 0.00 ? 17  PRO A C    8  
ATOM   4823  O  O    . PRO A 1 17 ? 8.811   7.377   -17.113 1.00 0.00 ? 17  PRO A O    8  
ATOM   4824  C  CB   . PRO A 1 17 ? 6.400   9.255   -17.686 1.00 0.00 ? 17  PRO A CB   8  
ATOM   4825  C  CG   . PRO A 1 17 ? 6.212   8.412   -18.900 1.00 0.00 ? 17  PRO A CG   8  
ATOM   4826  C  CD   . PRO A 1 17 ? 7.243   8.877   -19.891 1.00 0.00 ? 17  PRO A CD   8  
ATOM   4827  H  HA   . PRO A 1 17 ? 8.072   10.536  -17.262 1.00 0.00 ? 17  PRO A HA   8  
ATOM   4828  H  HB2  . PRO A 1 17 ? 6.100   8.730   -16.790 1.00 0.00 ? 17  PRO A HB2  8  
ATOM   4829  H  HB3  . PRO A 1 17 ? 5.858   10.185  -17.763 1.00 0.00 ? 17  PRO A HB3  8  
ATOM   4830  H  HG2  . PRO A 1 17 ? 6.369   7.373   -18.654 1.00 0.00 ? 17  PRO A HG2  8  
ATOM   4831  H  HG3  . PRO A 1 17 ? 5.218   8.559   -19.298 1.00 0.00 ? 17  PRO A HG3  8  
ATOM   4832  H  HD2  . PRO A 1 17 ? 7.598   8.047   -20.483 1.00 0.00 ? 17  PRO A HD2  8  
ATOM   4833  H  HD3  . PRO A 1 17 ? 6.836   9.649   -20.526 1.00 0.00 ? 17  PRO A HD3  8  
ATOM   4834  N  N    . HIS A 1 18 ? 8.971   8.973   -15.534 1.00 0.00 ? 18  HIS A N    8  
ATOM   4835  C  CA   . HIS A 1 18 ? 9.649   8.109   -14.574 1.00 0.00 ? 18  HIS A CA   8  
ATOM   4836  C  C    . HIS A 1 18 ? 8.703   7.698   -13.450 1.00 0.00 ? 18  HIS A C    8  
ATOM   4837  O  O    . HIS A 1 18 ? 7.875   8.481   -12.985 1.00 0.00 ? 18  HIS A O    8  
ATOM   4838  C  CB   . HIS A 1 18 ? 10.873  8.818   -13.993 1.00 0.00 ? 18  HIS A CB   8  
ATOM   4839  C  CG   . HIS A 1 18 ? 12.103  8.677   -14.836 1.00 0.00 ? 18  HIS A CG   8  
ATOM   4840  N  ND1  . HIS A 1 18 ? 13.333  8.328   -14.319 1.00 0.00 ? 18  HIS A ND1  8  
ATOM   4841  C  CD2  . HIS A 1 18 ? 12.288  8.837   -16.167 1.00 0.00 ? 18  HIS A CD2  8  
ATOM   4842  C  CE1  . HIS A 1 18 ? 14.222  8.282   -15.296 1.00 0.00 ? 18  HIS A CE1  8  
ATOM   4843  N  NE2  . HIS A 1 18 ? 13.613  8.587   -16.428 1.00 0.00 ? 18  HIS A NE2  8  
ATOM   4844  H  H    . HIS A 1 18 ? 8.779   9.902   -15.289 1.00 0.00 ? 18  HIS A H    8  
ATOM   4845  H  HA   . HIS A 1 18 ? 9.973   7.222   -15.097 1.00 0.00 ? 18  HIS A HA   8  
ATOM   4846  H  HB2  . HIS A 1 18 ? 10.657  9.872   -13.896 1.00 0.00 ? 18  HIS A HB2  8  
ATOM   4847  H  HB3  . HIS A 1 18 ? 11.089  8.408   -13.017 1.00 0.00 ? 18  HIS A HB3  8  
ATOM   4848  H  HD1  . HIS A 1 18 ? 13.526  8.144   -13.377 1.00 0.00 ? 18  HIS A HD1  8  
ATOM   4849  H  HD2  . HIS A 1 18 ? 11.533  9.112   -16.891 1.00 0.00 ? 18  HIS A HD2  8  
ATOM   4850  H  HE1  . HIS A 1 18 ? 15.267  8.037   -15.188 1.00 0.00 ? 18  HIS A HE1  8  
ATOM   4851  N  N    . PRO A 1 19 ? 8.827   6.439   -13.002 1.00 0.00 ? 19  PRO A N    8  
ATOM   4852  C  CA   . PRO A 1 19 ? 7.992   5.896   -11.927 1.00 0.00 ? 19  PRO A CA   8  
ATOM   4853  C  C    . PRO A 1 19 ? 8.316   6.515   -10.571 1.00 0.00 ? 19  PRO A C    8  
ATOM   4854  O  O    . PRO A 1 19 ? 9.374   6.258   -9.997  1.00 0.00 ? 19  PRO A O    8  
ATOM   4855  C  CB   . PRO A 1 19 ? 8.335   4.404   -11.930 1.00 0.00 ? 19  PRO A CB   8  
ATOM   4856  C  CG   . PRO A 1 19 ? 9.707   4.333   -12.507 1.00 0.00 ? 19  PRO A CG   8  
ATOM   4857  C  CD   . PRO A 1 19 ? 9.793   5.450   -13.510 1.00 0.00 ? 19  PRO A CD   8  
ATOM   4858  H  HA   . PRO A 1 19 ? 6.940   6.025   -12.138 1.00 0.00 ? 19  PRO A HA   8  
ATOM   4859  H  HB2  . PRO A 1 19 ? 8.311   4.025   -10.918 1.00 0.00 ? 19  PRO A HB2  8  
ATOM   4860  H  HB3  . PRO A 1 19 ? 7.623   3.868   -12.538 1.00 0.00 ? 19  PRO A HB3  8  
ATOM   4861  H  HG2  . PRO A 1 19 ? 10.441  4.471   -11.728 1.00 0.00 ? 19  PRO A HG2  8  
ATOM   4862  H  HG3  . PRO A 1 19 ? 9.850   3.380   -12.996 1.00 0.00 ? 19  PRO A HG3  8  
ATOM   4863  H  HD2  . PRO A 1 19 ? 10.791  5.862   -13.531 1.00 0.00 ? 19  PRO A HD2  8  
ATOM   4864  H  HD3  . PRO A 1 19 ? 9.506   5.101   -14.490 1.00 0.00 ? 19  PRO A HD3  8  
ATOM   4865  N  N    . THR A 1 20 ? 7.398   7.332   -10.064 1.00 0.00 ? 20  THR A N    8  
ATOM   4866  C  CA   . THR A 1 20 ? 7.587   7.987   -8.776  1.00 0.00 ? 20  THR A CA   8  
ATOM   4867  C  C    . THR A 1 20 ? 7.794   6.966   -7.664  1.00 0.00 ? 20  THR A C    8  
ATOM   4868  O  O    . THR A 1 20 ? 8.576   7.190   -6.740  1.00 0.00 ? 20  THR A O    8  
ATOM   4869  C  CB   . THR A 1 20 ? 6.384   8.881   -8.419  1.00 0.00 ? 20  THR A CB   8  
ATOM   4870  O  OG1  . THR A 1 20 ? 6.502   9.346   -7.070  1.00 0.00 ? 20  THR A OG1  8  
ATOM   4871  C  CG2  . THR A 1 20 ? 5.077   8.120   -8.586  1.00 0.00 ? 20  THR A CG2  8  
ATOM   4872  H  H    . THR A 1 20 ? 6.575   7.497   -10.569 1.00 0.00 ? 20  THR A H    8  
ATOM   4873  H  HA   . THR A 1 20 ? 8.465   8.613   -8.846  1.00 0.00 ? 20  THR A HA   8  
ATOM   4874  H  HB   . THR A 1 20 ? 6.376   9.731   -9.086  1.00 0.00 ? 20  THR A HB   8  
ATOM   4875  H  HG1  . THR A 1 20 ? 6.151   8.682   -6.471  1.00 0.00 ? 20  THR A HG1  8  
ATOM   4876  H  HG21 . THR A 1 20 ? 5.248   7.236   -9.182  1.00 0.00 ? 20  THR A HG21 8  
ATOM   4877  H  HG22 . THR A 1 20 ? 4.353   8.753   -9.079  1.00 0.00 ? 20  THR A HG22 8  
ATOM   4878  H  HG23 . THR A 1 20 ? 4.702   7.832   -7.616  1.00 0.00 ? 20  THR A HG23 8  
ATOM   4879  N  N    . SER A 1 21 ? 7.090   5.843   -7.759  1.00 0.00 ? 21  SER A N    8  
ATOM   4880  C  CA   . SER A 1 21 ? 7.195   4.787   -6.759  1.00 0.00 ? 21  SER A CA   8  
ATOM   4881  C  C    . SER A 1 21 ? 6.703   3.456   -7.320  1.00 0.00 ? 21  SER A C    8  
ATOM   4882  O  O    . SER A 1 21 ? 5.602   3.368   -7.863  1.00 0.00 ? 21  SER A O    8  
ATOM   4883  C  CB   . SER A 1 21 ? 6.391   5.156   -5.511  1.00 0.00 ? 21  SER A CB   8  
ATOM   4884  O  OG   . SER A 1 21 ? 7.125   6.029   -4.670  1.00 0.00 ? 21  SER A OG   8  
ATOM   4885  H  H    . SER A 1 21 ? 6.483   5.723   -8.520  1.00 0.00 ? 21  SER A H    8  
ATOM   4886  H  HA   . SER A 1 21 ? 8.236   4.688   -6.490  1.00 0.00 ? 21  SER A HA   8  
ATOM   4887  H  HB2  . SER A 1 21 ? 5.476   5.646   -5.807  1.00 0.00 ? 21  SER A HB2  8  
ATOM   4888  H  HB3  . SER A 1 21 ? 6.155   4.257   -4.959  1.00 0.00 ? 21  SER A HB3  8  
ATOM   4889  H  HG   . SER A 1 21 ? 7.701   6.580   -5.206  1.00 0.00 ? 21  SER A HG   8  
ATOM   4890  N  N    . ILE A 1 22 ? 7.528   2.423   -7.183  1.00 0.00 ? 22  ILE A N    8  
ATOM   4891  C  CA   . ILE A 1 22 ? 7.177   1.096   -7.675  1.00 0.00 ? 22  ILE A CA   8  
ATOM   4892  C  C    . ILE A 1 22 ? 6.506   0.266   -6.586  1.00 0.00 ? 22  ILE A C    8  
ATOM   4893  O  O    . ILE A 1 22 ? 6.860   0.362   -5.410  1.00 0.00 ? 22  ILE A O    8  
ATOM   4894  C  CB   . ILE A 1 22 ? 8.417   0.341   -8.190  1.00 0.00 ? 22  ILE A CB   8  
ATOM   4895  C  CG1  . ILE A 1 22 ? 8.929   0.979   -9.483  1.00 0.00 ? 22  ILE A CG1  8  
ATOM   4896  C  CG2  . ILE A 1 22 ? 8.088   -1.128  -8.411  1.00 0.00 ? 22  ILE A CG2  8  
ATOM   4897  C  CD1  . ILE A 1 22 ? 9.747   2.231   -9.257  1.00 0.00 ? 22  ILE A CD1  8  
ATOM   4898  H  H    . ILE A 1 22 ? 8.392   2.556   -6.741  1.00 0.00 ? 22  ILE A H    8  
ATOM   4899  H  HA   . ILE A 1 22 ? 6.487   1.218   -8.497  1.00 0.00 ? 22  ILE A HA   8  
ATOM   4900  H  HB   . ILE A 1 22 ? 9.187   0.403   -7.436  1.00 0.00 ? 22  ILE A HB   8  
ATOM   4901  H  HG12 . ILE A 1 22 ? 9.549   0.268   -10.006 1.00 0.00 ? 22  ILE A HG12 8  
ATOM   4902  H  HG13 . ILE A 1 22 ? 8.085   1.241   -10.105 1.00 0.00 ? 22  ILE A HG13 8  
ATOM   4903  H  HG21 . ILE A 1 22 ? 7.143   -1.211  -8.927  1.00 0.00 ? 22  ILE A HG21 8  
ATOM   4904  H  HG22 . ILE A 1 22 ? 8.864   -1.584  -9.007  1.00 0.00 ? 22  ILE A HG22 8  
ATOM   4905  H  HG23 . ILE A 1 22 ? 8.023   -1.630  -7.458  1.00 0.00 ? 22  ILE A HG23 8  
ATOM   4906  H  HD11 . ILE A 1 22 ? 9.903   2.735   -10.199 1.00 0.00 ? 22  ILE A HD11 8  
ATOM   4907  H  HD12 . ILE A 1 22 ? 9.223   2.887   -8.578  1.00 0.00 ? 22  ILE A HD12 8  
ATOM   4908  H  HD13 . ILE A 1 22 ? 10.704  1.963   -8.831  1.00 0.00 ? 22  ILE A HD13 8  
ATOM   4909  N  N    . CYS A 1 23 ? 5.537   -0.550  -6.985  1.00 0.00 ? 23  CYS A N    8  
ATOM   4910  C  CA   . CYS A 1 23 ? 4.816   -1.399  -6.044  1.00 0.00 ? 23  CYS A CA   8  
ATOM   4911  C  C    . CYS A 1 23 ? 5.746   -2.441  -5.429  1.00 0.00 ? 23  CYS A C    8  
ATOM   4912  O  O    . CYS A 1 23 ? 6.918   -2.534  -5.794  1.00 0.00 ? 23  CYS A O    8  
ATOM   4913  C  CB   . CYS A 1 23 ? 3.646   -2.094  -6.745  1.00 0.00 ? 23  CYS A CB   8  
ATOM   4914  S  SG   . CYS A 1 23 ? 2.270   -2.534  -5.635  1.00 0.00 ? 23  CYS A SG   8  
ATOM   4915  H  H    . CYS A 1 23 ? 5.300   -0.582  -7.936  1.00 0.00 ? 23  CYS A H    8  
ATOM   4916  H  HA   . CYS A 1 23 ? 4.430   -0.770  -5.257  1.00 0.00 ? 23  CYS A HA   8  
ATOM   4917  H  HB2  . CYS A 1 23 ? 3.254   -1.438  -7.509  1.00 0.00 ? 23  CYS A HB2  8  
ATOM   4918  H  HB3  . CYS A 1 23 ? 4.002   -3.003  -7.206  1.00 0.00 ? 23  CYS A HB3  8  
ATOM   4919  N  N    . ASP A 1 24 ? 5.214   -3.222  -4.495  1.00 0.00 ? 24  ASP A N    8  
ATOM   4920  C  CA   . ASP A 1 24 ? 5.995   -4.258  -3.829  1.00 0.00 ? 24  ASP A CA   8  
ATOM   4921  C  C    . ASP A 1 24 ? 5.598   -5.643  -4.329  1.00 0.00 ? 24  ASP A C    8  
ATOM   4922  O  O    . ASP A 1 24 ? 6.385   -6.587  -4.264  1.00 0.00 ? 24  ASP A O    8  
ATOM   4923  C  CB   . ASP A 1 24 ? 5.806   -4.175  -2.314  1.00 0.00 ? 24  ASP A CB   8  
ATOM   4924  C  CG   . ASP A 1 24 ? 6.493   -2.966  -1.710  1.00 0.00 ? 24  ASP A CG   8  
ATOM   4925  O  OD1  . ASP A 1 24 ? 6.092   -1.831  -2.038  1.00 0.00 ? 24  ASP A OD1  8  
ATOM   4926  O  OD2  . ASP A 1 24 ? 7.433   -3.156  -0.909  1.00 0.00 ? 24  ASP A OD2  8  
ATOM   4927  H  H    . ASP A 1 24 ? 4.274   -3.099  -4.247  1.00 0.00 ? 24  ASP A H    8  
ATOM   4928  H  HA   . ASP A 1 24 ? 7.036   -4.090  -4.063  1.00 0.00 ? 24  ASP A HA   8  
ATOM   4929  H  HB2  . ASP A 1 24 ? 4.750   -4.114  -2.092  1.00 0.00 ? 24  ASP A HB2  8  
ATOM   4930  H  HB3  . ASP A 1 24 ? 6.214   -5.065  -1.858  1.00 0.00 ? 24  ASP A HB3  8  
ATOM   4931  N  N    . ASN A 1 25 ? 4.371   -5.758  -4.827  1.00 0.00 ? 25  ASN A N    8  
ATOM   4932  C  CA   . ASN A 1 25 ? 3.868   -7.028  -5.337  1.00 0.00 ? 25  ASN A CA   8  
ATOM   4933  C  C    . ASN A 1 25 ? 4.201   -7.191  -6.817  1.00 0.00 ? 25  ASN A C    8  
ATOM   4934  O  O    . ASN A 1 25 ? 5.012   -8.039  -7.192  1.00 0.00 ? 25  ASN A O    8  
ATOM   4935  C  CB   . ASN A 1 25 ? 2.355   -7.121  -5.130  1.00 0.00 ? 25  ASN A CB   8  
ATOM   4936  C  CG   . ASN A 1 25 ? 1.988   -7.501  -3.708  1.00 0.00 ? 25  ASN A CG   8  
ATOM   4937  O  OD1  . ASN A 1 25 ? 2.191   -8.639  -3.286  1.00 0.00 ? 25  ASN A OD1  8  
ATOM   4938  N  ND2  . ASN A 1 25 ? 1.445   -6.546  -2.963  1.00 0.00 ? 25  ASN A ND2  8  
ATOM   4939  H  H    . ASN A 1 25 ? 3.790   -4.969  -4.853  1.00 0.00 ? 25  ASN A H    8  
ATOM   4940  H  HA   . ASN A 1 25 ? 4.348   -7.821  -4.782  1.00 0.00 ? 25  ASN A HA   8  
ATOM   4941  H  HB2  . ASN A 1 25 ? 1.907   -6.164  -5.353  1.00 0.00 ? 25  ASN A HB2  8  
ATOM   4942  H  HB3  . ASN A 1 25 ? 1.951   -7.867  -5.798  1.00 0.00 ? 25  ASN A HB3  8  
ATOM   4943  H  HD21 . ASN A 1 25 ? 1.313   -5.662  -3.366  1.00 0.00 ? 25  ASN A HD21 8  
ATOM   4944  H  HD22 . ASN A 1 25 ? 1.198   -6.763  -2.040  1.00 0.00 ? 25  ASN A HD22 8  
ATOM   4945  N  N    . PHE A 1 26 ? 3.571   -6.373  -7.653  1.00 0.00 ? 26  PHE A N    8  
ATOM   4946  C  CA   . PHE A 1 26 ? 3.800   -6.426  -9.092  1.00 0.00 ? 26  PHE A CA   8  
ATOM   4947  C  C    . PHE A 1 26 ? 5.284   -6.278  -9.413  1.00 0.00 ? 26  PHE A C    8  
ATOM   4948  O  O    . PHE A 1 26 ? 5.771   -6.812  -10.409 1.00 0.00 ? 26  PHE A O    8  
ATOM   4949  C  CB   . PHE A 1 26 ? 3.002   -5.327  -9.798  1.00 0.00 ? 26  PHE A CB   8  
ATOM   4950  C  CG   . PHE A 1 26 ? 2.581   -5.694  -11.192 1.00 0.00 ? 26  PHE A CG   8  
ATOM   4951  C  CD1  . PHE A 1 26 ? 3.500   -5.697  -12.229 1.00 0.00 ? 26  PHE A CD1  8  
ATOM   4952  C  CD2  . PHE A 1 26 ? 1.266   -6.036  -11.466 1.00 0.00 ? 26  PHE A CD2  8  
ATOM   4953  C  CE1  . PHE A 1 26 ? 3.114   -6.032  -13.513 1.00 0.00 ? 26  PHE A CE1  8  
ATOM   4954  C  CE2  . PHE A 1 26 ? 0.875   -6.373  -12.748 1.00 0.00 ? 26  PHE A CE2  8  
ATOM   4955  C  CZ   . PHE A 1 26 ? 1.801   -6.373  -13.773 1.00 0.00 ? 26  PHE A CZ   8  
ATOM   4956  H  H    . PHE A 1 26 ? 2.936   -5.718  -7.293  1.00 0.00 ? 26  PHE A H    8  
ATOM   4957  H  HA   . PHE A 1 26 ? 3.462   -7.388  -9.446  1.00 0.00 ? 26  PHE A HA   8  
ATOM   4958  H  HB2  . PHE A 1 26 ? 2.110   -5.117  -9.227  1.00 0.00 ? 26  PHE A HB2  8  
ATOM   4959  H  HB3  . PHE A 1 26 ? 3.607   -4.435  -9.856  1.00 0.00 ? 26  PHE A HB3  8  
ATOM   4960  H  HD1  . PHE A 1 26 ? 4.527   -5.432  -12.028 1.00 0.00 ? 26  PHE A HD1  8  
ATOM   4961  H  HD2  . PHE A 1 26 ? 0.541   -6.037  -10.664 1.00 0.00 ? 26  PHE A HD2  8  
ATOM   4962  H  HE1  . PHE A 1 26 ? 3.840   -6.031  -14.313 1.00 0.00 ? 26  PHE A HE1  8  
ATOM   4963  H  HE2  . PHE A 1 26 ? -0.152  -6.639  -12.947 1.00 0.00 ? 26  PHE A HE2  8  
ATOM   4964  H  HZ   . PHE A 1 26 ? 1.497   -6.635  -14.775 1.00 0.00 ? 26  PHE A HZ   8  
ATOM   4965  N  N    . SER A 1 27 ? 5.998   -5.549  -8.560  1.00 0.00 ? 27  SER A N    8  
ATOM   4966  C  CA   . SER A 1 27 ? 7.426   -5.326  -8.754  1.00 0.00 ? 27  SER A CA   8  
ATOM   4967  C  C    . SER A 1 27 ? 8.143   -6.637  -9.061  1.00 0.00 ? 27  SER A C    8  
ATOM   4968  O  O    . SER A 1 27 ? 8.686   -6.820  -10.150 1.00 0.00 ? 27  SER A O    8  
ATOM   4969  C  CB   . SER A 1 27 ? 8.036   -4.677  -7.510  1.00 0.00 ? 27  SER A CB   8  
ATOM   4970  O  OG   . SER A 1 27 ? 9.439   -4.867  -7.472  1.00 0.00 ? 27  SER A OG   8  
ATOM   4971  H  H    . SER A 1 27 ? 5.552   -5.149  -7.784  1.00 0.00 ? 27  SER A H    8  
ATOM   4972  H  HA   . SER A 1 27 ? 7.546   -4.659  -9.594  1.00 0.00 ? 27  SER A HA   8  
ATOM   4973  H  HB2  . SER A 1 27 ? 7.828   -3.618  -7.522  1.00 0.00 ? 27  SER A HB2  8  
ATOM   4974  H  HB3  . SER A 1 27 ? 7.600   -5.120  -6.626  1.00 0.00 ? 27  SER A HB3  8  
ATOM   4975  H  HG   . SER A 1 27 ? 9.771   -4.985  -8.365  1.00 0.00 ? 27  SER A HG   8  
ATOM   4976  N  N    . ALA A 1 28 ? 8.141   -7.547  -8.092  1.00 0.00 ? 28  ALA A N    8  
ATOM   4977  C  CA   . ALA A 1 28 ? 8.789   -8.841  -8.258  1.00 0.00 ? 28  ALA A CA   8  
ATOM   4978  C  C    . ALA A 1 28 ? 7.779   -9.916  -8.643  1.00 0.00 ? 28  ALA A C    8  
ATOM   4979  O  O    . ALA A 1 28 ? 7.884   -10.528 -9.706  1.00 0.00 ? 28  ALA A O    8  
ATOM   4980  C  CB   . ALA A 1 28 ? 9.519   -9.234  -6.981  1.00 0.00 ? 28  ALA A CB   8  
ATOM   4981  H  H    . ALA A 1 28 ? 7.691   -7.342  -7.246  1.00 0.00 ? 28  ALA A H    8  
ATOM   4982  H  HA   . ALA A 1 28 ? 9.521   -8.750  -9.047  1.00 0.00 ? 28  ALA A HA   8  
ATOM   4983  H  HB1  . ALA A 1 28 ? 10.583  -9.120  -7.126  1.00 0.00 ? 28  ALA A HB1  8  
ATOM   4984  H  HB2  . ALA A 1 28 ? 9.195   -8.597  -6.172  1.00 0.00 ? 28  ALA A HB2  8  
ATOM   4985  H  HB3  . ALA A 1 28 ? 9.296   -10.263 -6.742  1.00 0.00 ? 28  ALA A HB3  8  
ATOM   4986  N  N    . TYR A 1 29 ? 6.800   -10.141 -7.774  1.00 0.00 ? 29  TYR A N    8  
ATOM   4987  C  CA   . TYR A 1 29 ? 5.772   -11.145 -8.022  1.00 0.00 ? 29  TYR A CA   8  
ATOM   4988  C  C    . TYR A 1 29 ? 5.200   -11.001 -9.429  1.00 0.00 ? 29  TYR A C    8  
ATOM   4989  O  O    . TYR A 1 29 ? 5.112   -11.973 -10.178 1.00 0.00 ? 29  TYR A O    8  
ATOM   4990  C  CB   . TYR A 1 29 ? 4.651   -11.024 -6.989  1.00 0.00 ? 29  TYR A CB   8  
ATOM   4991  C  CG   . TYR A 1 29 ? 5.131   -11.135 -5.559  1.00 0.00 ? 29  TYR A CG   8  
ATOM   4992  C  CD1  . TYR A 1 29 ? 5.678   -10.041 -4.901  1.00 0.00 ? 29  TYR A CD1  8  
ATOM   4993  C  CD2  . TYR A 1 29 ? 5.036   -12.336 -4.866  1.00 0.00 ? 29  TYR A CD2  8  
ATOM   4994  C  CE1  . TYR A 1 29 ? 6.119   -10.139 -3.596  1.00 0.00 ? 29  TYR A CE1  8  
ATOM   4995  C  CE2  . TYR A 1 29 ? 5.472   -12.443 -3.560  1.00 0.00 ? 29  TYR A CE2  8  
ATOM   4996  C  CZ   . TYR A 1 29 ? 6.013   -11.342 -2.929  1.00 0.00 ? 29  TYR A CZ   8  
ATOM   4997  O  OH   . TYR A 1 29 ? 6.449   -11.444 -1.628  1.00 0.00 ? 29  TYR A OH   8  
ATOM   4998  H  H    . TYR A 1 29 ? 6.769   -9.621  -6.944  1.00 0.00 ? 29  TYR A H    8  
ATOM   4999  H  HA   . TYR A 1 29 ? 6.230   -12.119 -7.930  1.00 0.00 ? 29  TYR A HA   8  
ATOM   5000  H  HB2  . TYR A 1 29 ? 4.169   -10.065 -7.102  1.00 0.00 ? 29  TYR A HB2  8  
ATOM   5001  H  HB3  . TYR A 1 29 ? 3.928   -11.808 -7.159  1.00 0.00 ? 29  TYR A HB3  8  
ATOM   5002  H  HD1  . TYR A 1 29 ? 5.759   -9.100  -5.427  1.00 0.00 ? 29  TYR A HD1  8  
ATOM   5003  H  HD2  . TYR A 1 29 ? 4.611   -13.197 -5.363  1.00 0.00 ? 29  TYR A HD2  8  
ATOM   5004  H  HE1  . TYR A 1 29 ? 6.542   -9.277  -3.102  1.00 0.00 ? 29  TYR A HE1  8  
ATOM   5005  H  HE2  . TYR A 1 29 ? 5.390   -13.385 -3.037  1.00 0.00 ? 29  TYR A HE2  8  
ATOM   5006  H  HH   . TYR A 1 29 ? 5.741   -11.788 -1.079  1.00 0.00 ? 29  TYR A HH   8  
ATOM   5007  N  N    . GLY A 1 30 ? 4.812   -9.779  -9.781  1.00 0.00 ? 30  GLY A N    8  
ATOM   5008  C  CA   . GLY A 1 30 ? 4.253   -9.528  -11.097 1.00 0.00 ? 30  GLY A CA   8  
ATOM   5009  C  C    . GLY A 1 30 ? 2.780   -9.175  -11.044 1.00 0.00 ? 30  GLY A C    8  
ATOM   5010  O  O    . GLY A 1 30 ? 2.277   -8.452  -11.904 1.00 0.00 ? 30  GLY A O    8  
ATOM   5011  H  H    . GLY A 1 30 ? 4.906   -9.041  -9.142  1.00 0.00 ? 30  GLY A H    8  
ATOM   5012  H  HA2  . GLY A 1 30 ? 4.792   -8.713  -11.556 1.00 0.00 ? 30  GLY A HA2  8  
ATOM   5013  H  HA3  . GLY A 1 30 ? 4.377   -10.414 -11.703 1.00 0.00 ? 30  GLY A HA3  8  
ATOM   5014  N  N    . TRP A 1 31 ? 2.087   -9.686  -10.033 1.00 0.00 ? 31  TRP A N    8  
ATOM   5015  C  CA   . TRP A 1 31 ? 0.662   -9.422  -9.872  1.00 0.00 ? 31  TRP A CA   8  
ATOM   5016  C  C    . TRP A 1 31 ? 0.414   -8.457  -8.717  1.00 0.00 ? 31  TRP A C    8  
ATOM   5017  O  O    . TRP A 1 31 ? 1.258   -8.300  -7.835  1.00 0.00 ? 31  TRP A O    8  
ATOM   5018  C  CB   . TRP A 1 31 ? -0.097  -10.728 -9.633  1.00 0.00 ? 31  TRP A CB   8  
ATOM   5019  C  CG   . TRP A 1 31 ? -0.227  -11.083 -8.183  1.00 0.00 ? 31  TRP A CG   8  
ATOM   5020  C  CD1  . TRP A 1 31 ? 0.702   -11.717 -7.408  1.00 0.00 ? 31  TRP A CD1  8  
ATOM   5021  C  CD2  . TRP A 1 31 ? -1.351  -10.826 -7.335  1.00 0.00 ? 31  TRP A CD2  8  
ATOM   5022  N  NE1  . TRP A 1 31 ? 0.223   -11.870 -6.130  1.00 0.00 ? 31  TRP A NE1  8  
ATOM   5023  C  CE2  . TRP A 1 31 ? -1.034  -11.331 -6.059  1.00 0.00 ? 31  TRP A CE2  8  
ATOM   5024  C  CE3  . TRP A 1 31 ? -2.594  -10.217 -7.529  1.00 0.00 ? 31  TRP A CE3  8  
ATOM   5025  C  CZ2  . TRP A 1 31 ? -1.917  -11.245 -4.985  1.00 0.00 ? 31  TRP A CZ2  8  
ATOM   5026  C  CZ3  . TRP A 1 31 ? -3.468  -10.133 -6.462  1.00 0.00 ? 31  TRP A CZ3  8  
ATOM   5027  C  CH2  . TRP A 1 31 ? -3.126  -10.644 -5.203  1.00 0.00 ? 31  TRP A CH2  8  
ATOM   5028  H  H    . TRP A 1 31 ? 2.544   -10.256 -9.379  1.00 0.00 ? 31  TRP A H    8  
ATOM   5029  H  HA   . TRP A 1 31 ? 0.304   -8.970  -10.786 1.00 0.00 ? 31  TRP A HA   8  
ATOM   5030  H  HB2  . TRP A 1 31 ? -1.091  -10.641 -10.045 1.00 0.00 ? 31  TRP A HB2  8  
ATOM   5031  H  HB3  . TRP A 1 31 ? 0.424   -11.534 -10.129 1.00 0.00 ? 31  TRP A HB3  8  
ATOM   5032  H  HD1  . TRP A 1 31 ? 1.667   -12.046 -7.763  1.00 0.00 ? 31  TRP A HD1  8  
ATOM   5033  H  HE1  . TRP A 1 31 ? 0.704   -12.294 -5.388  1.00 0.00 ? 31  TRP A HE1  8  
ATOM   5034  H  HE3  . TRP A 1 31 ? -2.876  -9.817  -8.492  1.00 0.00 ? 31  TRP A HE3  8  
ATOM   5035  H  HZ2  . TRP A 1 31 ? -1.667  -11.633 -4.008  1.00 0.00 ? 31  TRP A HZ2  8  
ATOM   5036  H  HZ3  . TRP A 1 31 ? -4.434  -9.666  -6.594  1.00 0.00 ? 31  TRP A HZ3  8  
ATOM   5037  H  HH2  . TRP A 1 31 ? -3.840  -10.556 -4.399  1.00 0.00 ? 31  TRP A HH2  8  
ATOM   5038  N  N    . CYS A 1 32 ? -0.748  -7.813  -8.729  1.00 0.00 ? 32  CYS A N    8  
ATOM   5039  C  CA   . CYS A 1 32 ? -1.107  -6.863  -7.683  1.00 0.00 ? 32  CYS A CA   8  
ATOM   5040  C  C    . CYS A 1 32 ? -2.609  -6.894  -7.412  1.00 0.00 ? 32  CYS A C    8  
ATOM   5041  O  O    . CYS A 1 32 ? -3.430  -6.909  -8.330  1.00 0.00 ? 32  CYS A O    8  
ATOM   5042  C  CB   . CYS A 1 32 ? -0.678  -5.449  -8.080  1.00 0.00 ? 32  CYS A CB   8  
ATOM   5043  S  SG   . CYS A 1 32 ? -1.005  -4.188  -6.806  1.00 0.00 ? 32  CYS A SG   8  
ATOM   5044  H  H    . CYS A 1 32 ? -1.380  -7.980  -9.460  1.00 0.00 ? 32  CYS A H    8  
ATOM   5045  H  HA   . CYS A 1 32 ? -0.586  -7.149  -6.782  1.00 0.00 ? 32  CYS A HA   8  
ATOM   5046  H  HB2  . CYS A 1 32 ? 0.384   -5.446  -8.279  1.00 0.00 ? 32  CYS A HB2  8  
ATOM   5047  H  HB3  . CYS A 1 32 ? -1.208  -5.158  -8.975  1.00 0.00 ? 32  CYS A HB3  8  
ATOM   5048  N  N    . PRO A 1 33 ? -2.977  -6.904  -6.123  1.00 0.00 ? 33  PRO A N    8  
ATOM   5049  C  CA   . PRO A 1 33 ? -4.381  -6.932  -5.701  1.00 0.00 ? 33  PRO A CA   8  
ATOM   5050  C  C    . PRO A 1 33 ? -5.102  -5.622  -5.998  1.00 0.00 ? 33  PRO A C    8  
ATOM   5051  O  O    . PRO A 1 33 ? -6.294  -5.481  -5.722  1.00 0.00 ? 33  PRO A O    8  
ATOM   5052  C  CB   . PRO A 1 33 ? -4.292  -7.162  -4.190  1.00 0.00 ? 33  PRO A CB   8  
ATOM   5053  C  CG   . PRO A 1 33 ? -2.956  -6.630  -3.803  1.00 0.00 ? 33  PRO A CG   8  
ATOM   5054  C  CD   . PRO A 1 33 ? -2.052  -6.887  -4.977  1.00 0.00 ? 33  PRO A CD   8  
ATOM   5055  H  HA   . PRO A 1 33 ? -4.917  -7.749  -6.160  1.00 0.00 ? 33  PRO A HA   8  
ATOM   5056  H  HB2  . PRO A 1 33 ? -5.090  -6.627  -3.694  1.00 0.00 ? 33  PRO A HB2  8  
ATOM   5057  H  HB3  . PRO A 1 33 ? -4.373  -8.218  -3.978  1.00 0.00 ? 33  PRO A HB3  8  
ATOM   5058  H  HG2  . PRO A 1 33 ? -3.025  -5.571  -3.608  1.00 0.00 ? 33  PRO A HG2  8  
ATOM   5059  H  HG3  . PRO A 1 33 ? -2.592  -7.151  -2.930  1.00 0.00 ? 33  PRO A HG3  8  
ATOM   5060  H  HD2  . PRO A 1 33 ? -1.328  -6.093  -5.077  1.00 0.00 ? 33  PRO A HD2  8  
ATOM   5061  H  HD3  . PRO A 1 33 ? -1.556  -7.841  -4.870  1.00 0.00 ? 33  PRO A HD3  8  
ATOM   5062  N  N    . LEU A 1 34 ? -4.373  -4.666  -6.564  1.00 0.00 ? 34  LEU A N    8  
ATOM   5063  C  CA   . LEU A 1 34 ? -4.944  -3.366  -6.900  1.00 0.00 ? 34  LEU A CA   8  
ATOM   5064  C  C    . LEU A 1 34 ? -4.995  -3.168  -8.411  1.00 0.00 ? 34  LEU A C    8  
ATOM   5065  O  O    . LEU A 1 34 ? -5.789  -2.377  -8.917  1.00 0.00 ? 34  LEU A O    8  
ATOM   5066  C  CB   . LEU A 1 34 ? -4.126  -2.246  -6.255  1.00 0.00 ? 34  LEU A CB   8  
ATOM   5067  C  CG   . LEU A 1 34 ? -4.334  -2.041  -4.754  1.00 0.00 ? 34  LEU A CG   8  
ATOM   5068  C  CD1  . LEU A 1 34 ? -3.425  -0.939  -4.234  1.00 0.00 ? 34  LEU A CD1  8  
ATOM   5069  C  CD2  . LEU A 1 34 ? -5.791  -1.718  -4.456  1.00 0.00 ? 34  LEU A CD2  8  
ATOM   5070  H  H    . LEU A 1 34 ? -3.429  -4.837  -6.760  1.00 0.00 ? 34  LEU A H    8  
ATOM   5071  H  HA   . LEU A 1 34 ? -5.951  -3.336  -6.510  1.00 0.00 ? 34  LEU A HA   8  
ATOM   5072  H  HB2  . LEU A 1 34 ? -3.082  -2.463  -6.417  1.00 0.00 ? 34  LEU A HB2  8  
ATOM   5073  H  HB3  . LEU A 1 34 ? -4.381  -1.322  -6.754  1.00 0.00 ? 34  LEU A HB3  8  
ATOM   5074  H  HG   . LEU A 1 34 ? -4.080  -2.955  -4.234  1.00 0.00 ? 34  LEU A HG   8  
ATOM   5075  H  HD11 . LEU A 1 34 ? -3.934  0.010   -4.304  1.00 0.00 ? 34  LEU A HD11 8  
ATOM   5076  H  HD12 . LEU A 1 34 ? -2.522  -0.908  -4.826  1.00 0.00 ? 34  LEU A HD12 8  
ATOM   5077  H  HD13 . LEU A 1 34 ? -3.171  -1.137  -3.203  1.00 0.00 ? 34  LEU A HD13 8  
ATOM   5078  H  HD21 . LEU A 1 34 ? -5.854  -1.165  -3.531  1.00 0.00 ? 34  LEU A HD21 8  
ATOM   5079  H  HD22 . LEU A 1 34 ? -6.352  -2.637  -4.365  1.00 0.00 ? 34  LEU A HD22 8  
ATOM   5080  H  HD23 . LEU A 1 34 ? -6.199  -1.124  -5.260  1.00 0.00 ? 34  LEU A HD23 8  
ATOM   5081  N  N    . GLY A 1 35 ? -4.144  -3.896  -9.128  1.00 0.00 ? 35  GLY A N    8  
ATOM   5082  C  CA   . GLY A 1 35 ? -4.110  -3.788  -10.574 1.00 0.00 ? 35  GLY A CA   8  
ATOM   5083  C  C    . GLY A 1 35 ? -3.606  -2.437  -11.043 1.00 0.00 ? 35  GLY A C    8  
ATOM   5084  O  O    . GLY A 1 35 ? -2.650  -1.885  -10.500 1.00 0.00 ? 35  GLY A O    8  
ATOM   5085  H  H    . GLY A 1 35 ? -3.533  -4.512  -8.670  1.00 0.00 ? 35  GLY A H    8  
ATOM   5086  H  HA2  . GLY A 1 35 ? -3.462  -4.558  -10.967 1.00 0.00 ? 35  GLY A HA2  8  
ATOM   5087  H  HA3  . GLY A 1 35 ? -5.108  -3.940  -10.959 1.00 0.00 ? 35  GLY A HA3  8  
ATOM   5088  N  N    . PRO A 1 36 ? -4.258  -1.884  -12.077 1.00 0.00 ? 36  PRO A N    8  
ATOM   5089  C  CA   . PRO A 1 36 ? -3.887  -0.584  -12.642 1.00 0.00 ? 36  PRO A CA   8  
ATOM   5090  C  C    . PRO A 1 36 ? -4.206  0.571   -11.698 1.00 0.00 ? 36  PRO A C    8  
ATOM   5091  O  O    . PRO A 1 36 ? -3.440  1.528   -11.595 1.00 0.00 ? 36  PRO A O    8  
ATOM   5092  C  CB   . PRO A 1 36 ? -4.743  -0.490  -13.908 1.00 0.00 ? 36  PRO A CB   8  
ATOM   5093  C  CG   . PRO A 1 36 ? -5.917  -1.366  -13.637 1.00 0.00 ? 36  PRO A CG   8  
ATOM   5094  C  CD   . PRO A 1 36 ? -5.407  -2.487  -12.773 1.00 0.00 ? 36  PRO A CD   8  
ATOM   5095  H  HA   . PRO A 1 36 ? -2.841  -0.551  -12.909 1.00 0.00 ? 36  PRO A HA   8  
ATOM   5096  H  HB2  . PRO A 1 36 ? -5.043  0.536   -14.068 1.00 0.00 ? 36  PRO A HB2  8  
ATOM   5097  H  HB3  . PRO A 1 36 ? -4.176  -0.842  -14.757 1.00 0.00 ? 36  PRO A HB3  8  
ATOM   5098  H  HG2  . PRO A 1 36 ? -6.680  -0.808  -13.116 1.00 0.00 ? 36  PRO A HG2  8  
ATOM   5099  H  HG3  . PRO A 1 36 ? -6.305  -1.757  -14.567 1.00 0.00 ? 36  PRO A HG3  8  
ATOM   5100  H  HD2  . PRO A 1 36 ? -6.166  -2.796  -12.070 1.00 0.00 ? 36  PRO A HD2  8  
ATOM   5101  H  HD3  . PRO A 1 36 ? -5.093  -3.321  -13.383 1.00 0.00 ? 36  PRO A HD3  8  
ATOM   5102  N  N    . GLN A 1 37 ? -5.340  0.472   -11.012 1.00 0.00 ? 37  GLN A N    8  
ATOM   5103  C  CA   . GLN A 1 37 ? -5.758  1.509   -10.076 1.00 0.00 ? 37  GLN A CA   8  
ATOM   5104  C  C    . GLN A 1 37 ? -4.710  1.716   -8.988  1.00 0.00 ? 37  GLN A C    8  
ATOM   5105  O  O    . GLN A 1 37 ? -4.605  2.798   -8.409  1.00 0.00 ? 37  GLN A O    8  
ATOM   5106  C  CB   . GLN A 1 37 ? -7.102  1.143   -9.443  1.00 0.00 ? 37  GLN A CB   8  
ATOM   5107  C  CG   . GLN A 1 37 ? -8.302  1.578   -10.268 1.00 0.00 ? 37  GLN A CG   8  
ATOM   5108  C  CD   . GLN A 1 37 ? -9.572  0.845   -9.883  1.00 0.00 ? 37  GLN A CD   8  
ATOM   5109  O  OE1  . GLN A 1 37 ? -9.611  0.133   -8.879  1.00 0.00 ? 37  GLN A OE1  8  
ATOM   5110  N  NE2  . GLN A 1 37 ? -10.619 1.015   -10.682 1.00 0.00 ? 37  GLN A NE2  8  
ATOM   5111  H  H    . GLN A 1 37 ? -5.908  -0.316  -11.137 1.00 0.00 ? 37  GLN A H    8  
ATOM   5112  H  HA   . GLN A 1 37 ? -5.870  2.429   -10.629 1.00 0.00 ? 37  GLN A HA   8  
ATOM   5113  H  HB2  . GLN A 1 37 ? -7.147  0.071   -9.318  1.00 0.00 ? 37  GLN A HB2  8  
ATOM   5114  H  HB3  . GLN A 1 37 ? -7.170  1.613   -8.473  1.00 0.00 ? 37  GLN A HB3  8  
ATOM   5115  H  HG2  . GLN A 1 37 ? -8.458  2.637   -10.123 1.00 0.00 ? 37  GLN A HG2  8  
ATOM   5116  H  HG3  . GLN A 1 37 ? -8.094  1.386   -11.311 1.00 0.00 ? 37  GLN A HG3  8  
ATOM   5117  H  HE21 . GLN A 1 37 ? -10.514 1.596   -11.465 1.00 0.00 ? 37  GLN A HE21 8  
ATOM   5118  H  HE22 . GLN A 1 37 ? -11.452 0.553   -10.457 1.00 0.00 ? 37  GLN A HE22 8  
ATOM   5119  N  N    . CYS A 1 38 ? -3.935  0.672   -8.713  1.00 0.00 ? 38  CYS A N    8  
ATOM   5120  C  CA   . CYS A 1 38 ? -2.895  0.738   -7.694  1.00 0.00 ? 38  CYS A CA   8  
ATOM   5121  C  C    . CYS A 1 38 ? -2.198  2.095   -7.715  1.00 0.00 ? 38  CYS A C    8  
ATOM   5122  O  O    . CYS A 1 38 ? -1.845  2.624   -8.769  1.00 0.00 ? 38  CYS A O    8  
ATOM   5123  C  CB   . CYS A 1 38 ? -1.870  -0.377  -7.909  1.00 0.00 ? 38  CYS A CB   8  
ATOM   5124  S  SG   . CYS A 1 38 ? -0.593  -0.474  -6.613  1.00 0.00 ? 38  CYS A SG   8  
ATOM   5125  H  H    . CYS A 1 38 ? -4.067  -0.165  -9.208  1.00 0.00 ? 38  CYS A H    8  
ATOM   5126  H  HA   . CYS A 1 38 ? -3.364  0.602   -6.731  1.00 0.00 ? 38  CYS A HA   8  
ATOM   5127  H  HB2  . CYS A 1 38 ? -2.383  -1.328  -7.935  1.00 0.00 ? 38  CYS A HB2  8  
ATOM   5128  H  HB3  . CYS A 1 38 ? -1.369  -0.219  -8.853  1.00 0.00 ? 38  CYS A HB3  8  
ATOM   5129  N  N    . PRO A 1 39 ? -1.995  2.674   -6.522  1.00 0.00 ? 39  PRO A N    8  
ATOM   5130  C  CA   . PRO A 1 39 ? -1.338  3.976   -6.376  1.00 0.00 ? 39  PRO A CA   8  
ATOM   5131  C  C    . PRO A 1 39 ? 0.148   3.917   -6.710  1.00 0.00 ? 39  PRO A C    8  
ATOM   5132  O  O    . PRO A 1 39 ? 0.796   4.949   -6.881  1.00 0.00 ? 39  PRO A O    8  
ATOM   5133  C  CB   . PRO A 1 39 ? -1.541  4.312   -4.896  1.00 0.00 ? 39  PRO A CB   8  
ATOM   5134  C  CG   . PRO A 1 39 ? -1.700  2.990   -4.227  1.00 0.00 ? 39  PRO A CG   8  
ATOM   5135  C  CD   . PRO A 1 39 ? -2.390  2.101   -5.224  1.00 0.00 ? 39  PRO A CD   8  
ATOM   5136  H  HA   . PRO A 1 39 ? -1.814  4.731   -6.986  1.00 0.00 ? 39  PRO A HA   8  
ATOM   5137  H  HB2  . PRO A 1 39 ? -0.676  4.843   -4.523  1.00 0.00 ? 39  PRO A HB2  8  
ATOM   5138  H  HB3  . PRO A 1 39 ? -2.423  4.922   -4.779  1.00 0.00 ? 39  PRO A HB3  8  
ATOM   5139  H  HG2  . PRO A 1 39 ? -0.731  2.588   -3.973  1.00 0.00 ? 39  PRO A HG2  8  
ATOM   5140  H  HG3  . PRO A 1 39 ? -2.306  3.099   -3.340  1.00 0.00 ? 39  PRO A HG3  8  
ATOM   5141  H  HD2  . PRO A 1 39 ? -2.039  1.084   -5.129  1.00 0.00 ? 39  PRO A HD2  8  
ATOM   5142  H  HD3  . PRO A 1 39 ? -3.461  2.147   -5.093  1.00 0.00 ? 39  PRO A HD3  8  
ATOM   5143  N  N    . GLN A 1 40 ? 0.681   2.703   -6.802  1.00 0.00 ? 40  GLN A N    8  
ATOM   5144  C  CA   . GLN A 1 40 ? 2.092   2.511   -7.115  1.00 0.00 ? 40  GLN A CA   8  
ATOM   5145  C  C    . GLN A 1 40 ? 2.282   2.189   -8.594  1.00 0.00 ? 40  GLN A C    8  
ATOM   5146  O  O    . GLN A 1 40 ? 1.312   2.004   -9.329  1.00 0.00 ? 40  GLN A O    8  
ATOM   5147  C  CB   . GLN A 1 40 ? 2.679   1.388   -6.258  1.00 0.00 ? 40  GLN A CB   8  
ATOM   5148  C  CG   . GLN A 1 40 ? 2.792   1.745   -4.784  1.00 0.00 ? 40  GLN A CG   8  
ATOM   5149  C  CD   . GLN A 1 40 ? 3.951   2.679   -4.497  1.00 0.00 ? 40  GLN A CD   8  
ATOM   5150  O  OE1  . GLN A 1 40 ? 3.837   3.895   -4.658  1.00 0.00 ? 40  GLN A OE1  8  
ATOM   5151  N  NE2  . GLN A 1 40 ? 5.075   2.116   -4.070  1.00 0.00 ? 40  GLN A NE2  8  
ATOM   5152  H  H    . GLN A 1 40 ? 0.113   1.919   -6.654  1.00 0.00 ? 40  GLN A H    8  
ATOM   5153  H  HA   . GLN A 1 40 ? 2.610   3.431   -6.891  1.00 0.00 ? 40  GLN A HA   8  
ATOM   5154  H  HB2  . GLN A 1 40 ? 2.049   0.516   -6.348  1.00 0.00 ? 40  GLN A HB2  8  
ATOM   5155  H  HB3  . GLN A 1 40 ? 3.666   1.149   -6.625  1.00 0.00 ? 40  GLN A HB3  8  
ATOM   5156  H  HG2  . GLN A 1 40 ? 1.877   2.225   -4.471  1.00 0.00 ? 40  GLN A HG2  8  
ATOM   5157  H  HG3  . GLN A 1 40 ? 2.933   0.836   -4.217  1.00 0.00 ? 40  GLN A HG3  8  
ATOM   5158  H  HE21 . GLN A 1 40 ? 5.093   1.141   -3.967  1.00 0.00 ? 40  GLN A HE21 8  
ATOM   5159  H  HE22 . GLN A 1 40 ? 5.840   2.696   -3.878  1.00 0.00 ? 40  GLN A HE22 8  
ATOM   5160  N  N    . SER A 1 41 ? 3.538   2.124   -9.024  1.00 0.00 ? 41  SER A N    8  
ATOM   5161  C  CA   . SER A 1 41 ? 3.855   1.829   -10.416 1.00 0.00 ? 41  SER A CA   8  
ATOM   5162  C  C    . SER A 1 41 ? 4.250   0.365   -10.585 1.00 0.00 ? 41  SER A C    8  
ATOM   5163  O  O    . SER A 1 41 ? 4.863   -0.231  -9.698  1.00 0.00 ? 41  SER A O    8  
ATOM   5164  C  CB   . SER A 1 41 ? 4.987   2.734   -10.907 1.00 0.00 ? 41  SER A CB   8  
ATOM   5165  O  OG   . SER A 1 41 ? 4.976   2.843   -12.320 1.00 0.00 ? 41  SER A OG   8  
ATOM   5166  H  H    . SER A 1 41 ? 4.269   2.281   -8.390  1.00 0.00 ? 41  SER A H    8  
ATOM   5167  H  HA   . SER A 1 41 ? 2.971   2.021   -11.006 1.00 0.00 ? 41  SER A HA   8  
ATOM   5168  H  HB2  . SER A 1 41 ? 4.868   3.718   -10.481 1.00 0.00 ? 41  SER A HB2  8  
ATOM   5169  H  HB3  . SER A 1 41 ? 5.935   2.319   -10.597 1.00 0.00 ? 41  SER A HB3  8  
ATOM   5170  H  HG   . SER A 1 41 ? 5.754   2.411   -12.681 1.00 0.00 ? 41  SER A HG   8  
ATOM   5171  N  N    . HIS A 1 42 ? 3.894   -0.210  -11.729 1.00 0.00 ? 42  HIS A N    8  
ATOM   5172  C  CA   . HIS A 1 42 ? 4.211   -1.605  -12.016 1.00 0.00 ? 42  HIS A CA   8  
ATOM   5173  C  C    . HIS A 1 42 ? 5.148   -1.713  -13.215 1.00 0.00 ? 42  HIS A C    8  
ATOM   5174  O  O    . HIS A 1 42 ? 4.726   -2.077  -14.314 1.00 0.00 ? 42  HIS A O    8  
ATOM   5175  C  CB   . HIS A 1 42 ? 2.930   -2.397  -12.280 1.00 0.00 ? 42  HIS A CB   8  
ATOM   5176  C  CG   . HIS A 1 42 ? 2.040   -2.513  -11.082 1.00 0.00 ? 42  HIS A CG   8  
ATOM   5177  N  ND1  . HIS A 1 42 ? 0.680   -2.723  -11.172 1.00 0.00 ? 42  HIS A ND1  8  
ATOM   5178  C  CD2  . HIS A 1 42 ? 2.322   -2.449  -9.759  1.00 0.00 ? 42  HIS A CD2  8  
ATOM   5179  C  CE1  . HIS A 1 42 ? 0.164   -2.781  -9.957  1.00 0.00 ? 42  HIS A CE1  8  
ATOM   5180  N  NE2  . HIS A 1 42 ? 1.140   -2.618  -9.082  1.00 0.00 ? 42  HIS A NE2  8  
ATOM   5181  H  H    . HIS A 1 42 ? 3.407   0.317   -12.397 1.00 0.00 ? 42  HIS A H    8  
ATOM   5182  H  HA   . HIS A 1 42 ? 4.707   -2.017  -11.150 1.00 0.00 ? 42  HIS A HA   8  
ATOM   5183  H  HB2  . HIS A 1 42 ? 2.369   -1.910  -13.064 1.00 0.00 ? 42  HIS A HB2  8  
ATOM   5184  H  HB3  . HIS A 1 42 ? 3.192   -3.396  -12.598 1.00 0.00 ? 42  HIS A HB3  8  
ATOM   5185  H  HD1  . HIS A 1 42 ? 0.169   -2.814  -12.003 1.00 0.00 ? 42  HIS A HD1  8  
ATOM   5186  H  HD2  . HIS A 1 42 ? 3.296   -2.293  -9.318  1.00 0.00 ? 42  HIS A HD2  8  
ATOM   5187  H  HE1  . HIS A 1 42 ? -0.878  -2.936  -9.720  1.00 0.00 ? 42  HIS A HE1  8  
ATOM   5188  N  N    . ASP A 1 43 ? 6.419   -1.396  -12.998 1.00 0.00 ? 43  ASP A N    8  
ATOM   5189  C  CA   . ASP A 1 43 ? 7.415   -1.458  -14.061 1.00 0.00 ? 43  ASP A CA   8  
ATOM   5190  C  C    . ASP A 1 43 ? 8.142   -2.800  -14.047 1.00 0.00 ? 43  ASP A C    8  
ATOM   5191  O  O    . ASP A 1 43 ? 8.918   -3.086  -13.135 1.00 0.00 ? 43  ASP A O    8  
ATOM   5192  C  CB   . ASP A 1 43 ? 8.422   -0.317  -13.913 1.00 0.00 ? 43  ASP A CB   8  
ATOM   5193  C  CG   . ASP A 1 43 ? 9.073   0.056   -15.230 1.00 0.00 ? 43  ASP A CG   8  
ATOM   5194  O  OD1  . ASP A 1 43 ? 9.866   -0.757  -15.752 1.00 0.00 ? 43  ASP A OD1  8  
ATOM   5195  O  OD2  . ASP A 1 43 ? 8.789   1.159   -15.741 1.00 0.00 ? 43  ASP A OD2  8  
ATOM   5196  H  H    . ASP A 1 43 ? 6.694   -1.113  -12.101 1.00 0.00 ? 43  ASP A H    8  
ATOM   5197  H  HA   . ASP A 1 43 ? 6.901   -1.352  -15.004 1.00 0.00 ? 43  ASP A HA   8  
ATOM   5198  H  HB2  . ASP A 1 43 ? 7.915   0.554   -13.525 1.00 0.00 ? 43  ASP A HB2  8  
ATOM   5199  H  HB3  . ASP A 1 43 ? 9.196   -0.616  -13.221 1.00 0.00 ? 43  ASP A HB3  8  
ATOM   5200  N  N    . ILE A 1 44 ? 7.884   -3.617  -15.062 1.00 0.00 ? 44  ILE A N    8  
ATOM   5201  C  CA   . ILE A 1 44 ? 8.513   -4.928  -15.166 1.00 0.00 ? 44  ILE A CA   8  
ATOM   5202  C  C    . ILE A 1 44 ? 9.893   -4.826  -15.806 1.00 0.00 ? 44  ILE A C    8  
ATOM   5203  O  O    . ILE A 1 44 ? 10.024  -4.842  -17.030 1.00 0.00 ? 44  ILE A O    8  
ATOM   5204  C  CB   . ILE A 1 44 ? 7.650   -5.904  -15.987 1.00 0.00 ? 44  ILE A CB   8  
ATOM   5205  C  CG1  . ILE A 1 44 ? 6.277   -6.077  -15.334 1.00 0.00 ? 44  ILE A CG1  8  
ATOM   5206  C  CG2  . ILE A 1 44 ? 8.351   -7.247  -16.122 1.00 0.00 ? 44  ILE A CG2  8  
ATOM   5207  C  CD1  . ILE A 1 44 ? 6.338   -6.233  -13.830 1.00 0.00 ? 44  ILE A CD1  8  
ATOM   5208  H  H    . ILE A 1 44 ? 7.256   -3.332  -15.758 1.00 0.00 ? 44  ILE A H    8  
ATOM   5209  H  HA   . ILE A 1 44 ? 8.620   -5.326  -14.167 1.00 0.00 ? 44  ILE A HA   8  
ATOM   5210  H  HB   . ILE A 1 44 ? 7.520   -5.491  -16.975 1.00 0.00 ? 44  ILE A HB   8  
ATOM   5211  H  HG12 . ILE A 1 44 ? 5.669   -5.214  -15.553 1.00 0.00 ? 44  ILE A HG12 8  
ATOM   5212  H  HG13 . ILE A 1 44 ? 5.802   -6.959  -15.740 1.00 0.00 ? 44  ILE A HG13 8  
ATOM   5213  H  HG21 . ILE A 1 44 ? 7.984   -7.758  -16.999 1.00 0.00 ? 44  ILE A HG21 8  
ATOM   5214  H  HG22 . ILE A 1 44 ? 9.415   -7.088  -16.218 1.00 0.00 ? 44  ILE A HG22 8  
ATOM   5215  H  HG23 . ILE A 1 44 ? 8.154   -7.846  -15.246 1.00 0.00 ? 44  ILE A HG23 8  
ATOM   5216  H  HD11 . ILE A 1 44 ? 5.523   -6.859  -13.499 1.00 0.00 ? 44  ILE A HD11 8  
ATOM   5217  H  HD12 . ILE A 1 44 ? 7.277   -6.686  -13.553 1.00 0.00 ? 44  ILE A HD12 8  
ATOM   5218  H  HD13 . ILE A 1 44 ? 6.256   -5.261  -13.365 1.00 0.00 ? 44  ILE A HD13 8  
ATOM   5219  N  N    . SER A 1 45 ? 10.921  -4.722  -14.970 1.00 0.00 ? 45  SER A N    8  
ATOM   5220  C  CA   . SER A 1 45 ? 12.293  -4.615  -15.454 1.00 0.00 ? 45  SER A CA   8  
ATOM   5221  C  C    . SER A 1 45 ? 12.760  -5.936  -16.059 1.00 0.00 ? 45  SER A C    8  
ATOM   5222  O  O    . SER A 1 45 ? 12.511  -7.007  -15.506 1.00 0.00 ? 45  SER A O    8  
ATOM   5223  C  CB   . SER A 1 45 ? 13.227  -4.204  -14.315 1.00 0.00 ? 45  SER A CB   8  
ATOM   5224  O  OG   . SER A 1 45 ? 13.286  -5.207  -13.316 1.00 0.00 ? 45  SER A OG   8  
ATOM   5225  H  H    . SER A 1 45 ? 10.753  -4.714  -14.004 1.00 0.00 ? 45  SER A H    8  
ATOM   5226  H  HA   . SER A 1 45 ? 12.315  -3.855  -16.220 1.00 0.00 ? 45  SER A HA   8  
ATOM   5227  H  HB2  . SER A 1 45 ? 14.221  -4.046  -14.708 1.00 0.00 ? 45  SER A HB2  8  
ATOM   5228  H  HB3  . SER A 1 45 ? 12.866  -3.288  -13.870 1.00 0.00 ? 45  SER A HB3  8  
ATOM   5229  H  HG   . SER A 1 45 ? 14.165  -5.225  -12.931 1.00 0.00 ? 45  SER A HG   8  
ATOM   5230  N  N    . GLY A 1 46 ? 13.439  -5.851  -17.199 1.00 0.00 ? 46  GLY A N    8  
ATOM   5231  C  CA   . GLY A 1 46 ? 13.930  -7.045  -17.861 1.00 0.00 ? 46  GLY A CA   8  
ATOM   5232  C  C    . GLY A 1 46 ? 15.061  -6.750  -18.826 1.00 0.00 ? 46  GLY A C    8  
ATOM   5233  O  O    . GLY A 1 46 ? 15.195  -5.638  -19.336 1.00 0.00 ? 46  GLY A O    8  
ATOM   5234  H  H    . GLY A 1 46 ? 13.607  -4.970  -17.594 1.00 0.00 ? 46  GLY A H    8  
ATOM   5235  H  HA2  . GLY A 1 46 ? 14.281  -7.740  -17.112 1.00 0.00 ? 46  GLY A HA2  8  
ATOM   5236  H  HA3  . GLY A 1 46 ? 13.117  -7.501  -18.406 1.00 0.00 ? 46  GLY A HA3  8  
ATOM   5237  N  N    . PRO A 1 47 ? 15.900  -7.762  -19.087 1.00 0.00 ? 47  PRO A N    8  
ATOM   5238  C  CA   . PRO A 1 47 ? 17.041  -7.630  -19.999 1.00 0.00 ? 47  PRO A CA   8  
ATOM   5239  C  C    . PRO A 1 47 ? 16.607  -7.484  -21.453 1.00 0.00 ? 47  PRO A C    8  
ATOM   5240  O  O    . PRO A 1 47 ? 17.400  -7.095  -22.311 1.00 0.00 ? 47  PRO A O    8  
ATOM   5241  C  CB   . PRO A 1 47 ? 17.810  -8.938  -19.798 1.00 0.00 ? 47  PRO A CB   8  
ATOM   5242  C  CG   . PRO A 1 47 ? 16.784  -9.911  -19.327 1.00 0.00 ? 47  PRO A CG   8  
ATOM   5243  C  CD   . PRO A 1 47 ? 15.801  -9.115  -18.514 1.00 0.00 ? 47  PRO A CD   8  
ATOM   5244  H  HA   . PRO A 1 47 ? 17.671  -6.795  -19.727 1.00 0.00 ? 47  PRO A HA   8  
ATOM   5245  H  HB2  . PRO A 1 47 ? 18.248  -9.248  -20.736 1.00 0.00 ? 47  PRO A HB2  8  
ATOM   5246  H  HB3  . PRO A 1 47 ? 18.585  -8.795  -19.061 1.00 0.00 ? 47  PRO A HB3  8  
ATOM   5247  H  HG2  . PRO A 1 47 ? 16.292  -10.364 -20.174 1.00 0.00 ? 47  PRO A HG2  8  
ATOM   5248  H  HG3  . PRO A 1 47 ? 17.251  -10.667 -18.713 1.00 0.00 ? 47  PRO A HG3  8  
ATOM   5249  H  HD2  . PRO A 1 47 ? 14.804  -9.512  -18.634 1.00 0.00 ? 47  PRO A HD2  8  
ATOM   5250  H  HD3  . PRO A 1 47 ? 16.086  -9.114  -17.473 1.00 0.00 ? 47  PRO A HD3  8  
ATOM   5251  N  N    . SER A 1 48 ? 15.345  -7.799  -21.724 1.00 0.00 ? 48  SER A N    8  
ATOM   5252  C  CA   . SER A 1 48 ? 14.806  -7.706  -23.076 1.00 0.00 ? 48  SER A CA   8  
ATOM   5253  C  C    . SER A 1 48 ? 15.325  -6.457  -23.782 1.00 0.00 ? 48  SER A C    8  
ATOM   5254  O  O    . SER A 1 48 ? 14.993  -5.334  -23.404 1.00 0.00 ? 48  SER A O    8  
ATOM   5255  C  CB   . SER A 1 48 ? 13.277  -7.687  -23.039 1.00 0.00 ? 48  SER A CB   8  
ATOM   5256  O  OG   . SER A 1 48 ? 12.796  -6.490  -22.452 1.00 0.00 ? 48  SER A OG   8  
ATOM   5257  H  H    . SER A 1 48 ? 14.762  -8.102  -20.996 1.00 0.00 ? 48  SER A H    8  
ATOM   5258  H  HA   . SER A 1 48 ? 15.134  -8.577  -23.623 1.00 0.00 ? 48  SER A HA   8  
ATOM   5259  H  HB2  . SER A 1 48 ? 12.894  -7.760  -24.045 1.00 0.00 ? 48  SER A HB2  8  
ATOM   5260  H  HB3  . SER A 1 48 ? 12.924  -8.527  -22.457 1.00 0.00 ? 48  SER A HB3  8  
ATOM   5261  H  HG   . SER A 1 48 ? 13.310  -5.746  -22.775 1.00 0.00 ? 48  SER A HG   8  
ATOM   5262  N  N    . SER A 1 49 ? 16.141  -6.662  -24.811 1.00 0.00 ? 49  SER A N    8  
ATOM   5263  C  CA   . SER A 1 49 ? 16.709  -5.554  -25.569 1.00 0.00 ? 49  SER A CA   8  
ATOM   5264  C  C    . SER A 1 49 ? 15.618  -4.788  -26.312 1.00 0.00 ? 49  SER A C    8  
ATOM   5265  O  O    . SER A 1 49 ? 15.634  -3.559  -26.365 1.00 0.00 ? 49  SER A O    8  
ATOM   5266  C  CB   . SER A 1 49 ? 17.753  -6.069  -26.562 1.00 0.00 ? 49  SER A CB   8  
ATOM   5267  O  OG   . SER A 1 49 ? 17.168  -6.950  -27.505 1.00 0.00 ? 49  SER A OG   8  
ATOM   5268  H  H    . SER A 1 49 ? 16.368  -7.582  -25.064 1.00 0.00 ? 49  SER A H    8  
ATOM   5269  H  HA   . SER A 1 49 ? 17.189  -4.885  -24.870 1.00 0.00 ? 49  SER A HA   8  
ATOM   5270  H  HB2  . SER A 1 49 ? 18.188  -5.234  -27.089 1.00 0.00 ? 49  SER A HB2  8  
ATOM   5271  H  HB3  . SER A 1 49 ? 18.526  -6.598  -26.024 1.00 0.00 ? 49  SER A HB3  8  
ATOM   5272  H  HG   . SER A 1 49 ? 17.316  -7.858  -27.231 1.00 0.00 ? 49  SER A HG   8  
ATOM   5273  N  N    . GLY A 1 50 ? 14.672  -5.525  -26.884 1.00 0.00 ? 50  GLY A N    8  
ATOM   5274  C  CA   . GLY A 1 50 ? 13.586  -4.900  -27.617 1.00 0.00 ? 50  GLY A CA   8  
ATOM   5275  C  C    . GLY A 1 50 ? 13.175  -5.699  -28.838 1.00 0.00 ? 50  GLY A C    8  
ATOM   5276  O  O    . GLY A 1 50 ? 13.832  -6.689  -29.155 1.00 0.00 ? 50  GLY A O    8  
ATOM   5277  H  H    . GLY A 1 50 ? 14.711  -6.502  -26.809 1.00 0.00 ? 50  GLY A H    8  
ATOM   5278  H  HA2  . GLY A 1 50 ? 12.734  -4.800  -26.961 1.00 0.00 ? 50  GLY A HA2  8  
ATOM   5279  H  HA3  . GLY A 1 50 ? 13.900  -3.917  -27.934 1.00 0.00 ? 50  GLY A HA3  8  
HETATM 5280  ZN ZN   . ZN  B 2 .  ? 0.477   -2.490  -7.152  1.00 0.00 ? 201 ZN  A ZN   8  
ATOM   5281  N  N    . GLY A 1 1  ? 1.984   12.876  -9.395  1.00 0.00 ? 1   GLY A N    9  
ATOM   5282  C  CA   . GLY A 1 1  ? 1.386   14.188  -9.232  1.00 0.00 ? 1   GLY A CA   9  
ATOM   5283  C  C    . GLY A 1 1  ? 1.950   14.938  -8.041  1.00 0.00 ? 1   GLY A C    9  
ATOM   5284  O  O    . GLY A 1 1  ? 2.832   14.436  -7.344  1.00 0.00 ? 1   GLY A O    9  
ATOM   5285  H  H1   . GLY A 1 1  ? 2.551   12.506  -8.686  1.00 0.00 ? 1   GLY A H1   9  
ATOM   5286  H  HA2  . GLY A 1 1  ? 1.565   14.767  -10.126 1.00 0.00 ? 1   GLY A HA2  9  
ATOM   5287  H  HA3  . GLY A 1 1  ? 0.321   14.072  -9.097  1.00 0.00 ? 1   GLY A HA3  9  
ATOM   5288  N  N    . SER A 1 2  ? 1.441   16.143  -7.807  1.00 0.00 ? 2   SER A N    9  
ATOM   5289  C  CA   . SER A 1 2  ? 1.903   16.966  -6.695  1.00 0.00 ? 2   SER A CA   9  
ATOM   5290  C  C    . SER A 1 2  ? 0.995   18.176  -6.501  1.00 0.00 ? 2   SER A C    9  
ATOM   5291  O  O    . SER A 1 2  ? 0.202   18.519  -7.379  1.00 0.00 ? 2   SER A O    9  
ATOM   5292  C  CB   . SER A 1 2  ? 3.341   17.427  -6.938  1.00 0.00 ? 2   SER A CB   9  
ATOM   5293  O  OG   . SER A 1 2  ? 3.433   18.217  -8.111  1.00 0.00 ? 2   SER A OG   9  
ATOM   5294  H  H    . SER A 1 2  ? 0.739   16.488  -8.399  1.00 0.00 ? 2   SER A H    9  
ATOM   5295  H  HA   . SER A 1 2  ? 1.873   16.361  -5.801  1.00 0.00 ? 2   SER A HA   9  
ATOM   5296  H  HB2  . SER A 1 2  ? 3.675   18.014  -6.096  1.00 0.00 ? 2   SER A HB2  9  
ATOM   5297  H  HB3  . SER A 1 2  ? 3.979   16.562  -7.049  1.00 0.00 ? 2   SER A HB3  9  
ATOM   5298  H  HG   . SER A 1 2  ? 2.615   18.146  -8.609  1.00 0.00 ? 2   SER A HG   9  
ATOM   5299  N  N    . SER A 1 3  ? 1.117   18.820  -5.345  1.00 0.00 ? 3   SER A N    9  
ATOM   5300  C  CA   . SER A 1 3  ? 0.305   19.990  -5.032  1.00 0.00 ? 3   SER A CA   9  
ATOM   5301  C  C    . SER A 1 3  ? 0.970   21.265  -5.542  1.00 0.00 ? 3   SER A C    9  
ATOM   5302  O  O    . SER A 1 3  ? 0.330   22.102  -6.177  1.00 0.00 ? 3   SER A O    9  
ATOM   5303  C  CB   . SER A 1 3  ? 0.076   20.090  -3.523  1.00 0.00 ? 3   SER A CB   9  
ATOM   5304  O  OG   . SER A 1 3  ? -0.708  19.007  -3.053  1.00 0.00 ? 3   SER A OG   9  
ATOM   5305  H  H    . SER A 1 3  ? 1.766   18.498  -4.685  1.00 0.00 ? 3   SER A H    9  
ATOM   5306  H  HA   . SER A 1 3  ? -0.649  19.874  -5.525  1.00 0.00 ? 3   SER A HA   9  
ATOM   5307  H  HB2  . SER A 1 3  ? 1.028   20.076  -3.015  1.00 0.00 ? 3   SER A HB2  9  
ATOM   5308  H  HB3  . SER A 1 3  ? -0.438  21.014  -3.299  1.00 0.00 ? 3   SER A HB3  9  
ATOM   5309  H  HG   . SER A 1 3  ? -0.370  18.709  -2.206  1.00 0.00 ? 3   SER A HG   9  
ATOM   5310  N  N    . GLY A 1 4  ? 2.262   21.406  -5.257  1.00 0.00 ? 4   GLY A N    9  
ATOM   5311  C  CA   . GLY A 1 4  ? 2.994   22.580  -5.694  1.00 0.00 ? 4   GLY A CA   9  
ATOM   5312  C  C    . GLY A 1 4  ? 4.478   22.314  -5.850  1.00 0.00 ? 4   GLY A C    9  
ATOM   5313  O  O    . GLY A 1 4  ? 5.251   22.498  -4.910  1.00 0.00 ? 4   GLY A O    9  
ATOM   5314  H  H    . GLY A 1 4  ? 2.721   20.706  -4.747  1.00 0.00 ? 4   GLY A H    9  
ATOM   5315  H  HA2  . GLY A 1 4  ? 2.595   22.907  -6.643  1.00 0.00 ? 4   GLY A HA2  9  
ATOM   5316  H  HA3  . GLY A 1 4  ? 2.856   23.367  -4.966  1.00 0.00 ? 4   GLY A HA3  9  
ATOM   5317  N  N    . SER A 1 5  ? 4.877   21.877  -7.040  1.00 0.00 ? 5   SER A N    9  
ATOM   5318  C  CA   . SER A 1 5  ? 6.277   21.579  -7.315  1.00 0.00 ? 5   SER A CA   9  
ATOM   5319  C  C    . SER A 1 5  ? 7.165   22.768  -6.963  1.00 0.00 ? 5   SER A C    9  
ATOM   5320  O  O    . SER A 1 5  ? 7.142   23.796  -7.640  1.00 0.00 ? 5   SER A O    9  
ATOM   5321  C  CB   . SER A 1 5  ? 6.463   21.208  -8.788  1.00 0.00 ? 5   SER A CB   9  
ATOM   5322  O  OG   . SER A 1 5  ? 6.183   22.312  -9.631  1.00 0.00 ? 5   SER A OG   9  
ATOM   5323  H  H    . SER A 1 5  ? 4.212   21.749  -7.750  1.00 0.00 ? 5   SER A H    9  
ATOM   5324  H  HA   . SER A 1 5  ? 6.564   20.737  -6.702  1.00 0.00 ? 5   SER A HA   9  
ATOM   5325  H  HB2  . SER A 1 5  ? 7.482   20.894  -8.952  1.00 0.00 ? 5   SER A HB2  9  
ATOM   5326  H  HB3  . SER A 1 5  ? 5.792   20.399  -9.039  1.00 0.00 ? 5   SER A HB3  9  
ATOM   5327  H  HG   . SER A 1 5  ? 7.007   22.705  -9.927  1.00 0.00 ? 5   SER A HG   9  
ATOM   5328  N  N    . SER A 1 6  ? 7.947   22.621  -5.898  1.00 0.00 ? 6   SER A N    9  
ATOM   5329  C  CA   . SER A 1 6  ? 8.840   23.684  -5.452  1.00 0.00 ? 6   SER A CA   9  
ATOM   5330  C  C    . SER A 1 6  ? 9.856   24.030  -6.537  1.00 0.00 ? 6   SER A C    9  
ATOM   5331  O  O    . SER A 1 6  ? 10.128  25.202  -6.796  1.00 0.00 ? 6   SER A O    9  
ATOM   5332  C  CB   . SER A 1 6  ? 9.566   23.266  -4.173  1.00 0.00 ? 6   SER A CB   9  
ATOM   5333  O  OG   . SER A 1 6  ? 10.531  22.262  -4.438  1.00 0.00 ? 6   SER A OG   9  
ATOM   5334  H  H    . SER A 1 6  ? 7.920   21.778  -5.399  1.00 0.00 ? 6   SER A H    9  
ATOM   5335  H  HA   . SER A 1 6  ? 8.239   24.557  -5.246  1.00 0.00 ? 6   SER A HA   9  
ATOM   5336  H  HB2  . SER A 1 6  ? 10.065  24.123  -3.748  1.00 0.00 ? 6   SER A HB2  9  
ATOM   5337  H  HB3  . SER A 1 6  ? 8.848   22.879  -3.464  1.00 0.00 ? 6   SER A HB3  9  
ATOM   5338  H  HG   . SER A 1 6  ? 10.589  21.667  -3.688  1.00 0.00 ? 6   SER A HG   9  
ATOM   5339  N  N    . GLY A 1 7  ? 10.413  23.001  -7.168  1.00 0.00 ? 7   GLY A N    9  
ATOM   5340  C  CA   . GLY A 1 7  ? 11.392  23.216  -8.217  1.00 0.00 ? 7   GLY A CA   9  
ATOM   5341  C  C    . GLY A 1 7  ? 10.966  22.613  -9.540  1.00 0.00 ? 7   GLY A C    9  
ATOM   5342  O  O    . GLY A 1 7  ? 10.688  21.416  -9.624  1.00 0.00 ? 7   GLY A O    9  
ATOM   5343  H  H    . GLY A 1 7  ? 10.157  22.088  -6.919  1.00 0.00 ? 7   GLY A H    9  
ATOM   5344  H  HA2  . GLY A 1 7  ? 11.537  24.278  -8.347  1.00 0.00 ? 7   GLY A HA2  9  
ATOM   5345  H  HA3  . GLY A 1 7  ? 12.329  22.770  -7.916  1.00 0.00 ? 7   GLY A HA3  9  
ATOM   5346  N  N    . CYS A 1 8  ? 10.913  23.442  -10.577 1.00 0.00 ? 8   CYS A N    9  
ATOM   5347  C  CA   . CYS A 1 8  ? 10.515  22.984  -11.903 1.00 0.00 ? 8   CYS A CA   9  
ATOM   5348  C  C    . CYS A 1 8  ? 11.737  22.738  -12.783 1.00 0.00 ? 8   CYS A C    9  
ATOM   5349  O  O    . CYS A 1 8  ? 12.132  23.600  -13.569 1.00 0.00 ? 8   CYS A O    9  
ATOM   5350  C  CB   . CYS A 1 8  ? 9.594   24.010  -12.565 1.00 0.00 ? 8   CYS A CB   9  
ATOM   5351  S  SG   . CYS A 1 8  ? 8.838   23.439  -14.105 1.00 0.00 ? 8   CYS A SG   9  
ATOM   5352  H  H    . CYS A 1 8  ? 11.147  24.385  -10.448 1.00 0.00 ? 8   CYS A H    9  
ATOM   5353  H  HA   . CYS A 1 8  ? 9.979   22.055  -11.785 1.00 0.00 ? 8   CYS A HA   9  
ATOM   5354  H  HB2  . CYS A 1 8  ? 8.796   24.260  -11.881 1.00 0.00 ? 8   CYS A HB2  9  
ATOM   5355  H  HB3  . CYS A 1 8  ? 10.161  24.902  -12.786 1.00 0.00 ? 8   CYS A HB3  9  
ATOM   5356  H  HG   . CYS A 1 8  ? 9.518   22.383  -14.526 1.00 0.00 ? 8   CYS A HG   9  
ATOM   5357  N  N    . CYS A 1 9  ? 12.331  21.558  -12.644 1.00 0.00 ? 9   CYS A N    9  
ATOM   5358  C  CA   . CYS A 1 9  ? 13.509  21.199  -13.425 1.00 0.00 ? 9   CYS A CA   9  
ATOM   5359  C  C    . CYS A 1 9  ? 13.548  19.698  -13.691 1.00 0.00 ? 9   CYS A C    9  
ATOM   5360  O  O    . CYS A 1 9  ? 13.124  18.897  -12.857 1.00 0.00 ? 9   CYS A O    9  
ATOM   5361  C  CB   . CYS A 1 9  ? 14.781  21.633  -12.695 1.00 0.00 ? 9   CYS A CB   9  
ATOM   5362  S  SG   . CYS A 1 9  ? 14.950  20.944  -11.031 1.00 0.00 ? 9   CYS A SG   9  
ATOM   5363  H  H    . CYS A 1 9  ? 11.969  20.912  -12.002 1.00 0.00 ? 9   CYS A H    9  
ATOM   5364  H  HA   . CYS A 1 9  ? 13.451  21.718  -14.369 1.00 0.00 ? 9   CYS A HA   9  
ATOM   5365  H  HB2  . CYS A 1 9  ? 15.641  21.319  -13.268 1.00 0.00 ? 9   CYS A HB2  9  
ATOM   5366  H  HB3  . CYS A 1 9  ? 14.788  22.709  -12.609 1.00 0.00 ? 9   CYS A HB3  9  
ATOM   5367  H  HG   . CYS A 1 9  ? 14.900  19.625  -11.129 1.00 0.00 ? 9   CYS A HG   9  
ATOM   5368  N  N    . LEU A 1 10 ? 14.059  19.322  -14.859 1.00 0.00 ? 10  LEU A N    9  
ATOM   5369  C  CA   . LEU A 1 10 ? 14.152  17.916  -15.237 1.00 0.00 ? 10  LEU A CA   9  
ATOM   5370  C  C    . LEU A 1 10 ? 15.584  17.548  -15.613 1.00 0.00 ? 10  LEU A C    9  
ATOM   5371  O  O    . LEU A 1 10 ? 16.384  18.393  -16.012 1.00 0.00 ? 10  LEU A O    9  
ATOM   5372  C  CB   . LEU A 1 10 ? 13.213  17.619  -16.407 1.00 0.00 ? 10  LEU A CB   9  
ATOM   5373  C  CG   . LEU A 1 10 ? 13.191  18.656  -17.530 1.00 0.00 ? 10  LEU A CG   9  
ATOM   5374  C  CD1  . LEU A 1 10 ? 12.474  19.918  -17.078 1.00 0.00 ? 10  LEU A CD1  9  
ATOM   5375  C  CD2  . LEU A 1 10 ? 14.607  18.979  -17.985 1.00 0.00 ? 10  LEU A CD2  9  
ATOM   5376  H  H    . LEU A 1 10 ? 14.381  20.006  -15.482 1.00 0.00 ? 10  LEU A H    9  
ATOM   5377  H  HA   . LEU A 1 10 ? 13.853  17.324  -14.385 1.00 0.00 ? 10  LEU A HA   9  
ATOM   5378  H  HB2  . LEU A 1 10 ? 13.508  16.674  -16.835 1.00 0.00 ? 10  LEU A HB2  9  
ATOM   5379  H  HB3  . LEU A 1 10 ? 12.210  17.536  -16.012 1.00 0.00 ? 10  LEU A HB3  9  
ATOM   5380  H  HG   . LEU A 1 10 ? 12.651  18.251  -18.375 1.00 0.00 ? 10  LEU A HG   9  
ATOM   5381  H  HD11 . LEU A 1 10 ? 12.038  19.755  -16.104 1.00 0.00 ? 10  LEU A HD11 9  
ATOM   5382  H  HD12 . LEU A 1 10 ? 11.695  20.163  -17.785 1.00 0.00 ? 10  LEU A HD12 9  
ATOM   5383  H  HD13 . LEU A 1 10 ? 13.180  20.734  -17.024 1.00 0.00 ? 10  LEU A HD13 9  
ATOM   5384  H  HD21 . LEU A 1 10 ? 15.061  19.665  -17.286 1.00 0.00 ? 10  LEU A HD21 9  
ATOM   5385  H  HD22 . LEU A 1 10 ? 14.575  19.433  -18.965 1.00 0.00 ? 10  LEU A HD22 9  
ATOM   5386  H  HD23 . LEU A 1 10 ? 15.187  18.070  -18.028 1.00 0.00 ? 10  LEU A HD23 9  
ATOM   5387  N  N    . PRO A 1 11 ? 15.915  16.254  -15.485 1.00 0.00 ? 11  PRO A N    9  
ATOM   5388  C  CA   . PRO A 1 11 ? 17.250  15.743  -15.809 1.00 0.00 ? 11  PRO A CA   9  
ATOM   5389  C  C    . PRO A 1 11 ? 17.533  15.768  -17.307 1.00 0.00 ? 11  PRO A C    9  
ATOM   5390  O  O    . PRO A 1 11 ? 16.636  15.954  -18.129 1.00 0.00 ? 11  PRO A O    9  
ATOM   5391  C  CB   . PRO A 1 11 ? 17.212  14.301  -15.296 1.00 0.00 ? 11  PRO A CB   9  
ATOM   5392  C  CG   . PRO A 1 11 ? 15.770  13.929  -15.319 1.00 0.00 ? 11  PRO A CG   9  
ATOM   5393  C  CD   . PRO A 1 11 ? 15.011  15.191  -15.014 1.00 0.00 ? 11  PRO A CD   9  
ATOM   5394  H  HA   . PRO A 1 11 ? 18.022  16.291  -15.289 1.00 0.00 ? 11  PRO A HA   9  
ATOM   5395  H  HB2  . PRO A 1 11 ? 17.795  13.668  -15.950 1.00 0.00 ? 11  PRO A HB2  9  
ATOM   5396  H  HB3  . PRO A 1 11 ? 17.614  14.260  -14.295 1.00 0.00 ? 11  PRO A HB3  9  
ATOM   5397  H  HG2  . PRO A 1 11 ? 15.502  13.557  -16.297 1.00 0.00 ? 11  PRO A HG2  9  
ATOM   5398  H  HG3  . PRO A 1 11 ? 15.572  13.181  -14.565 1.00 0.00 ? 11  PRO A HG3  9  
ATOM   5399  H  HD2  . PRO A 1 11 ? 14.077  15.210  -15.557 1.00 0.00 ? 11  PRO A HD2  9  
ATOM   5400  H  HD3  . PRO A 1 11 ? 14.835  15.278  -13.952 1.00 0.00 ? 11  PRO A HD3  9  
ATOM   5401  N  N    . PRO A 1 12 ? 18.809  15.576  -17.672 1.00 0.00 ? 12  PRO A N    9  
ATOM   5402  C  CA   . PRO A 1 12 ? 19.239  15.572  -19.074 1.00 0.00 ? 12  PRO A CA   9  
ATOM   5403  C  C    . PRO A 1 12 ? 18.735  14.347  -19.831 1.00 0.00 ? 12  PRO A C    9  
ATOM   5404  O  O    . PRO A 1 12 ? 18.283  14.453  -20.970 1.00 0.00 ? 12  PRO A O    9  
ATOM   5405  C  CB   . PRO A 1 12 ? 20.766  15.549  -18.976 1.00 0.00 ? 12  PRO A CB   9  
ATOM   5406  C  CG   . PRO A 1 12 ? 21.052  14.926  -17.654 1.00 0.00 ? 12  PRO A CG   9  
ATOM   5407  C  CD   . PRO A 1 12 ? 19.930  15.348  -16.746 1.00 0.00 ? 12  PRO A CD   9  
ATOM   5408  H  HA   . PRO A 1 12 ? 18.922  16.467  -19.589 1.00 0.00 ? 12  PRO A HA   9  
ATOM   5409  H  HB2  . PRO A 1 12 ? 21.172  14.961  -19.787 1.00 0.00 ? 12  PRO A HB2  9  
ATOM   5410  H  HB3  . PRO A 1 12 ? 21.149  16.558  -19.028 1.00 0.00 ? 12  PRO A HB3  9  
ATOM   5411  H  HG2  . PRO A 1 12 ? 21.072  13.851  -17.751 1.00 0.00 ? 12  PRO A HG2  9  
ATOM   5412  H  HG3  . PRO A 1 12 ? 21.997  15.287  -17.275 1.00 0.00 ? 12  PRO A HG3  9  
ATOM   5413  H  HD2  . PRO A 1 12 ? 19.697  14.562  -16.044 1.00 0.00 ? 12  PRO A HD2  9  
ATOM   5414  H  HD3  . PRO A 1 12 ? 20.189  16.258  -16.224 1.00 0.00 ? 12  PRO A HD3  9  
ATOM   5415  N  N    . ALA A 1 13 ? 18.817  13.186  -19.189 1.00 0.00 ? 13  ALA A N    9  
ATOM   5416  C  CA   . ALA A 1 13 ? 18.367  11.942  -19.802 1.00 0.00 ? 13  ALA A CA   9  
ATOM   5417  C  C    . ALA A 1 13 ? 16.947  12.078  -20.341 1.00 0.00 ? 13  ALA A C    9  
ATOM   5418  O  O    . ALA A 1 13 ? 15.973  11.840  -19.624 1.00 0.00 ? 13  ALA A O    9  
ATOM   5419  C  CB   . ALA A 1 13 ? 18.446  10.801  -18.798 1.00 0.00 ? 13  ALA A CB   9  
ATOM   5420  H  H    . ALA A 1 13 ? 19.187  13.166  -18.282 1.00 0.00 ? 13  ALA A H    9  
ATOM   5421  H  HA   . ALA A 1 13 ? 19.032  11.714  -20.622 1.00 0.00 ? 13  ALA A HA   9  
ATOM   5422  H  HB1  . ALA A 1 13 ? 17.675  10.076  -19.017 1.00 0.00 ? 13  ALA A HB1  9  
ATOM   5423  H  HB2  . ALA A 1 13 ? 19.414  10.330  -18.865 1.00 0.00 ? 13  ALA A HB2  9  
ATOM   5424  H  HB3  . ALA A 1 13 ? 18.302  11.189  -17.801 1.00 0.00 ? 13  ALA A HB3  9  
ATOM   5425  N  N    . THR A 1 14 ? 16.834  12.462  -21.608 1.00 0.00 ? 14  THR A N    9  
ATOM   5426  C  CA   . THR A 1 14 ? 15.533  12.632  -22.243 1.00 0.00 ? 14  THR A CA   9  
ATOM   5427  C  C    . THR A 1 14 ? 15.129  11.379  -23.011 1.00 0.00 ? 14  THR A C    9  
ATOM   5428  O  O    . THR A 1 14 ? 14.563  11.463  -24.102 1.00 0.00 ? 14  THR A O    9  
ATOM   5429  C  CB   . THR A 1 14 ? 15.529  13.834  -23.205 1.00 0.00 ? 14  THR A CB   9  
ATOM   5430  O  OG1  . THR A 1 14 ? 16.600  13.711  -24.148 1.00 0.00 ? 14  THR A OG1  9  
ATOM   5431  C  CG2  . THR A 1 14 ? 15.669  15.141  -22.439 1.00 0.00 ? 14  THR A CG2  9  
ATOM   5432  H  H    . THR A 1 14 ? 17.646  12.637  -22.128 1.00 0.00 ? 14  THR A H    9  
ATOM   5433  H  HA   . THR A 1 14 ? 14.804  12.816  -21.466 1.00 0.00 ? 14  THR A HA   9  
ATOM   5434  H  HB   . THR A 1 14 ? 14.590  13.846  -23.739 1.00 0.00 ? 14  THR A HB   9  
ATOM   5435  H  HG1  . THR A 1 14 ? 17.413  14.035  -23.753 1.00 0.00 ? 14  THR A HG1  9  
ATOM   5436  H  HG21 . THR A 1 14 ? 16.110  14.946  -21.473 1.00 0.00 ? 14  THR A HG21 9  
ATOM   5437  H  HG22 . THR A 1 14 ? 14.695  15.587  -22.308 1.00 0.00 ? 14  THR A HG22 9  
ATOM   5438  H  HG23 . THR A 1 14 ? 16.303  15.816  -22.994 1.00 0.00 ? 14  THR A HG23 9  
ATOM   5439  N  N    . HIS A 1 15 ? 15.422  10.217  -22.436 1.00 0.00 ? 15  HIS A N    9  
ATOM   5440  C  CA   . HIS A 1 15 ? 15.088  8.945   -23.068 1.00 0.00 ? 15  HIS A CA   9  
ATOM   5441  C  C    . HIS A 1 15 ? 13.608  8.621   -22.885 1.00 0.00 ? 15  HIS A C    9  
ATOM   5442  O  O    . HIS A 1 15 ? 12.904  8.326   -23.851 1.00 0.00 ? 15  HIS A O    9  
ATOM   5443  C  CB   . HIS A 1 15 ? 15.944  7.821   -22.484 1.00 0.00 ? 15  HIS A CB   9  
ATOM   5444  C  CG   . HIS A 1 15 ? 17.309  7.730   -23.093 1.00 0.00 ? 15  HIS A CG   9  
ATOM   5445  N  ND1  . HIS A 1 15 ? 17.866  6.543   -23.518 1.00 0.00 ? 15  HIS A ND1  9  
ATOM   5446  C  CD2  . HIS A 1 15 ? 18.230  8.689   -23.349 1.00 0.00 ? 15  HIS A CD2  9  
ATOM   5447  C  CE1  . HIS A 1 15 ? 19.071  6.774   -24.008 1.00 0.00 ? 15  HIS A CE1  9  
ATOM   5448  N  NE2  . HIS A 1 15 ? 19.316  8.069   -23.917 1.00 0.00 ? 15  HIS A NE2  9  
ATOM   5449  H  H    . HIS A 1 15 ? 15.873  10.215  -21.567 1.00 0.00 ? 15  HIS A H    9  
ATOM   5450  H  HA   . HIS A 1 15 ? 15.296  9.034   -24.123 1.00 0.00 ? 15  HIS A HA   9  
ATOM   5451  H  HB2  . HIS A 1 15 ? 16.065  7.983   -21.423 1.00 0.00 ? 15  HIS A HB2  9  
ATOM   5452  H  HB3  . HIS A 1 15 ? 15.445  6.876   -22.645 1.00 0.00 ? 15  HIS A HB3  9  
ATOM   5453  H  HD1  . HIS A 1 15 ? 17.442  5.661   -23.467 1.00 0.00 ? 15  HIS A HD1  9  
ATOM   5454  H  HD2  . HIS A 1 15 ? 18.130  9.746   -23.144 1.00 0.00 ? 15  HIS A HD2  9  
ATOM   5455  H  HE1  . HIS A 1 15 ? 19.742  6.032   -24.414 1.00 0.00 ? 15  HIS A HE1  9  
ATOM   5456  N  N    . ARG A 1 16 ? 13.144  8.675   -21.641 1.00 0.00 ? 16  ARG A N    9  
ATOM   5457  C  CA   . ARG A 1 16 ? 11.749  8.385   -21.333 1.00 0.00 ? 16  ARG A CA   9  
ATOM   5458  C  C    . ARG A 1 16 ? 11.384  8.889   -19.939 1.00 0.00 ? 16  ARG A C    9  
ATOM   5459  O  O    . ARG A 1 16 ? 12.222  8.965   -19.041 1.00 0.00 ? 16  ARG A O    9  
ATOM   5460  C  CB   . ARG A 1 16 ? 11.485  6.881   -21.428 1.00 0.00 ? 16  ARG A CB   9  
ATOM   5461  C  CG   . ARG A 1 16 ? 12.076  6.086   -20.275 1.00 0.00 ? 16  ARG A CG   9  
ATOM   5462  C  CD   . ARG A 1 16 ? 11.284  4.814   -20.013 1.00 0.00 ? 16  ARG A CD   9  
ATOM   5463  N  NE   . ARG A 1 16 ? 12.063  3.828   -19.269 1.00 0.00 ? 16  ARG A NE   9  
ATOM   5464  C  CZ   . ARG A 1 16 ? 11.520  2.823   -18.591 1.00 0.00 ? 16  ARG A CZ   9  
ATOM   5465  N  NH1  . ARG A 1 16 ? 10.203  2.672   -18.562 1.00 0.00 ? 16  ARG A NH1  9  
ATOM   5466  N  NH2  . ARG A 1 16 ? 12.296  1.966   -17.939 1.00 0.00 ? 16  ARG A NH2  9  
ATOM   5467  H  H    . ARG A 1 16 ? 13.754  8.916   -20.913 1.00 0.00 ? 16  ARG A H    9  
ATOM   5468  H  HA   . ARG A 1 16 ? 11.135  8.896   -22.059 1.00 0.00 ? 16  ARG A HA   9  
ATOM   5469  H  HB2  . ARG A 1 16 ? 10.418  6.715   -21.442 1.00 0.00 ? 16  ARG A HB2  9  
ATOM   5470  H  HB3  . ARG A 1 16 ? 11.912  6.511   -22.348 1.00 0.00 ? 16  ARG A HB3  9  
ATOM   5471  H  HG2  . ARG A 1 16 ? 13.094  5.818   -20.518 1.00 0.00 ? 16  ARG A HG2  9  
ATOM   5472  H  HG3  . ARG A 1 16 ? 12.065  6.697   -19.385 1.00 0.00 ? 16  ARG A HG3  9  
ATOM   5473  H  HD2  . ARG A 1 16 ? 10.402  5.066   -19.443 1.00 0.00 ? 16  ARG A HD2  9  
ATOM   5474  H  HD3  . ARG A 1 16 ? 10.990  4.388   -20.960 1.00 0.00 ? 16  ARG A HD3  9  
ATOM   5475  H  HE   . ARG A 1 16 ? 13.038  3.920   -19.277 1.00 0.00 ? 16  ARG A HE   9  
ATOM   5476  H  HH11 . ARG A 1 16 ? 9.617   3.316   -19.053 1.00 0.00 ? 16  ARG A HH11 9  
ATOM   5477  H  HH12 . ARG A 1 16 ? 9.797   1.914   -18.051 1.00 0.00 ? 16  ARG A HH12 9  
ATOM   5478  H  HH21 . ARG A 1 16 ? 13.289  2.076   -17.958 1.00 0.00 ? 16  ARG A HH21 9  
ATOM   5479  H  HH22 . ARG A 1 16 ? 11.887  1.210   -17.428 1.00 0.00 ? 16  ARG A HH22 9  
ATOM   5480  N  N    . PRO A 1 17 ? 10.104  9.244   -19.754 1.00 0.00 ? 17  PRO A N    9  
ATOM   5481  C  CA   . PRO A 1 17 ? 9.599   9.746   -18.473 1.00 0.00 ? 17  PRO A CA   9  
ATOM   5482  C  C    . PRO A 1 17 ? 9.556   8.663   -17.401 1.00 0.00 ? 17  PRO A C    9  
ATOM   5483  O  O    . PRO A 1 17 ? 8.744   7.740   -17.469 1.00 0.00 ? 17  PRO A O    9  
ATOM   5484  C  CB   . PRO A 1 17 ? 8.183   10.220  -18.811 1.00 0.00 ? 17  PRO A CB   9  
ATOM   5485  C  CG   . PRO A 1 17 ? 7.787   9.413   -19.999 1.00 0.00 ? 17  PRO A CG   9  
ATOM   5486  C  CD   . PRO A 1 17 ? 9.050   9.180   -20.781 1.00 0.00 ? 17  PRO A CD   9  
ATOM   5487  H  HA   . PRO A 1 17 ? 10.184  10.582  -18.117 1.00 0.00 ? 17  PRO A HA   9  
ATOM   5488  H  HB2  . PRO A 1 17 ? 7.529   10.035  -17.971 1.00 0.00 ? 17  PRO A HB2  9  
ATOM   5489  H  HB3  . PRO A 1 17 ? 8.197   11.275  -19.038 1.00 0.00 ? 17  PRO A HB3  9  
ATOM   5490  H  HG2  . PRO A 1 17 ? 7.365   8.472   -19.680 1.00 0.00 ? 17  PRO A HG2  9  
ATOM   5491  H  HG3  . PRO A 1 17 ? 7.074   9.963   -20.596 1.00 0.00 ? 17  PRO A HG3  9  
ATOM   5492  H  HD2  . PRO A 1 17 ? 9.029   8.208   -21.252 1.00 0.00 ? 17  PRO A HD2  9  
ATOM   5493  H  HD3  . PRO A 1 17 ? 9.186   9.956   -21.520 1.00 0.00 ? 17  PRO A HD3  9  
ATOM   5494  N  N    . HIS A 1 18 ? 10.436  8.781   -16.412 1.00 0.00 ? 18  HIS A N    9  
ATOM   5495  C  CA   . HIS A 1 18 ? 10.497  7.811   -15.324 1.00 0.00 ? 18  HIS A CA   9  
ATOM   5496  C  C    . HIS A 1 18 ? 9.289   7.951   -14.402 1.00 0.00 ? 18  HIS A C    9  
ATOM   5497  O  O    . HIS A 1 18 ? 8.717   9.030   -14.248 1.00 0.00 ? 18  HIS A O    9  
ATOM   5498  C  CB   . HIS A 1 18 ? 11.788  7.993   -14.523 1.00 0.00 ? 18  HIS A CB   9  
ATOM   5499  C  CG   . HIS A 1 18 ? 13.029  7.773   -15.331 1.00 0.00 ? 18  HIS A CG   9  
ATOM   5500  N  ND1  . HIS A 1 18 ? 14.004  8.736   -15.490 1.00 0.00 ? 18  HIS A ND1  9  
ATOM   5501  C  CD2  . HIS A 1 18 ? 13.454  6.692   -16.026 1.00 0.00 ? 18  HIS A CD2  9  
ATOM   5502  C  CE1  . HIS A 1 18 ? 14.973  8.257   -16.250 1.00 0.00 ? 18  HIS A CE1  9  
ATOM   5503  N  NE2  . HIS A 1 18 ? 14.664  7.018   -16.588 1.00 0.00 ? 18  HIS A NE2  9  
ATOM   5504  H  H    . HIS A 1 18 ? 11.057  9.538   -16.413 1.00 0.00 ? 18  HIS A H    9  
ATOM   5505  H  HA   . HIS A 1 18 ? 10.490  6.824   -15.759 1.00 0.00 ? 18  HIS A HA   9  
ATOM   5506  H  HB2  . HIS A 1 18 ? 11.821  8.998   -14.130 1.00 0.00 ? 18  HIS A HB2  9  
ATOM   5507  H  HB3  . HIS A 1 18 ? 11.796  7.290   -13.703 1.00 0.00 ? 18  HIS A HB3  9  
ATOM   5508  H  HD1  . HIS A 1 18 ? 13.986  9.636   -15.105 1.00 0.00 ? 18  HIS A HD1  9  
ATOM   5509  H  HD2  . HIS A 1 18 ? 12.937  5.747   -16.123 1.00 0.00 ? 18  HIS A HD2  9  
ATOM   5510  H  HE1  . HIS A 1 18 ? 15.866  8.787   -16.544 1.00 0.00 ? 18  HIS A HE1  9  
ATOM   5511  N  N    . PRO A 1 19 ? 8.890   6.834   -13.776 1.00 0.00 ? 19  PRO A N    9  
ATOM   5512  C  CA   . PRO A 1 19 ? 7.746   6.806   -12.859 1.00 0.00 ? 19  PRO A CA   9  
ATOM   5513  C  C    . PRO A 1 19 ? 8.027   7.553   -11.560 1.00 0.00 ? 19  PRO A C    9  
ATOM   5514  O  O    . PRO A 1 19 ? 9.061   8.206   -11.417 1.00 0.00 ? 19  PRO A O    9  
ATOM   5515  C  CB   . PRO A 1 19 ? 7.547   5.314   -12.586 1.00 0.00 ? 19  PRO A CB   9  
ATOM   5516  C  CG   . PRO A 1 19 ? 8.886   4.704   -12.819 1.00 0.00 ? 19  PRO A CG   9  
ATOM   5517  C  CD   . PRO A 1 19 ? 9.525   5.513   -13.913 1.00 0.00 ? 19  PRO A CD   9  
ATOM   5518  H  HA   . PRO A 1 19 ? 6.858   7.212   -13.321 1.00 0.00 ? 19  PRO A HA   9  
ATOM   5519  H  HB2  . PRO A 1 19 ? 7.219   5.173   -11.566 1.00 0.00 ? 19  PRO A HB2  9  
ATOM   5520  H  HB3  . PRO A 1 19 ? 6.809   4.915   -13.266 1.00 0.00 ? 19  PRO A HB3  9  
ATOM   5521  H  HG2  . PRO A 1 19 ? 9.476   4.760   -11.917 1.00 0.00 ? 19  PRO A HG2  9  
ATOM   5522  H  HG3  . PRO A 1 19 ? 8.772   3.676   -13.131 1.00 0.00 ? 19  PRO A HG3  9  
ATOM   5523  H  HD2  . PRO A 1 19 ? 10.592  5.580   -13.759 1.00 0.00 ? 19  PRO A HD2  9  
ATOM   5524  H  HD3  . PRO A 1 19 ? 9.308   5.080   -14.878 1.00 0.00 ? 19  PRO A HD3  9  
ATOM   5525  N  N    . THR A 1 20 ? 7.099   7.452   -10.612 1.00 0.00 ? 20  THR A N    9  
ATOM   5526  C  CA   . THR A 1 20 ? 7.246   8.118   -9.325  1.00 0.00 ? 20  THR A CA   9  
ATOM   5527  C  C    . THR A 1 20 ? 7.622   7.124   -8.231  1.00 0.00 ? 20  THR A C    9  
ATOM   5528  O  O    . THR A 1 20 ? 8.350   7.460   -7.298  1.00 0.00 ? 20  THR A O    9  
ATOM   5529  C  CB   . THR A 1 20 ? 5.951   8.846   -8.917  1.00 0.00 ? 20  THR A CB   9  
ATOM   5530  O  OG1  . THR A 1 20 ? 6.092   9.398   -7.604  1.00 0.00 ? 20  THR A OG1  9  
ATOM   5531  C  CG2  . THR A 1 20 ? 4.763   7.896   -8.950  1.00 0.00 ? 20  THR A CG2  9  
ATOM   5532  H  H    . THR A 1 20 ? 6.297   6.917   -10.786 1.00 0.00 ? 20  THR A H    9  
ATOM   5533  H  HA   . THR A 1 20 ? 8.033   8.852   -9.417  1.00 0.00 ? 20  THR A HA   9  
ATOM   5534  H  HB   . THR A 1 20 ? 5.771   9.648   -9.619  1.00 0.00 ? 20  THR A HB   9  
ATOM   5535  H  HG1  . THR A 1 20 ? 6.440   10.291  -7.667  1.00 0.00 ? 20  THR A HG1  9  
ATOM   5536  H  HG21 . THR A 1 20 ? 5.096   6.914   -9.253  1.00 0.00 ? 20  THR A HG21 9  
ATOM   5537  H  HG22 . THR A 1 20 ? 4.029   8.261   -9.653  1.00 0.00 ? 20  THR A HG22 9  
ATOM   5538  H  HG23 . THR A 1 20 ? 4.322   7.838   -7.966  1.00 0.00 ? 20  THR A HG23 9  
ATOM   5539  N  N    . SER A 1 21 ? 7.122   5.899   -8.354  1.00 0.00 ? 21  SER A N    9  
ATOM   5540  C  CA   . SER A 1 21 ? 7.403   4.857   -7.374  1.00 0.00 ? 21  SER A CA   9  
ATOM   5541  C  C    . SER A 1 21 ? 6.930   3.496   -7.877  1.00 0.00 ? 21  SER A C    9  
ATOM   5542  O  O    . SER A 1 21 ? 5.853   3.379   -8.462  1.00 0.00 ? 21  SER A O    9  
ATOM   5543  C  CB   . SER A 1 21 ? 6.726   5.184   -6.042  1.00 0.00 ? 21  SER A CB   9  
ATOM   5544  O  OG   . SER A 1 21 ? 6.780   4.078   -5.157  1.00 0.00 ? 21  SER A OG   9  
ATOM   5545  H  H    . SER A 1 21 ? 6.548   5.692   -9.121  1.00 0.00 ? 21  SER A H    9  
ATOM   5546  H  HA   . SER A 1 21 ? 8.472   4.821   -7.226  1.00 0.00 ? 21  SER A HA   9  
ATOM   5547  H  HB2  . SER A 1 21 ? 7.228   6.022   -5.582  1.00 0.00 ? 21  SER A HB2  9  
ATOM   5548  H  HB3  . SER A 1 21 ? 5.691   5.437   -6.220  1.00 0.00 ? 21  SER A HB3  9  
ATOM   5549  H  HG   . SER A 1 21 ? 5.948   4.005   -4.685  1.00 0.00 ? 21  SER A HG   9  
ATOM   5550  N  N    . ILE A 1 22 ? 7.744   2.471   -7.646  1.00 0.00 ? 22  ILE A N    9  
ATOM   5551  C  CA   . ILE A 1 22 ? 7.409   1.119   -8.074  1.00 0.00 ? 22  ILE A CA   9  
ATOM   5552  C  C    . ILE A 1 22 ? 6.751   0.332   -6.946  1.00 0.00 ? 22  ILE A C    9  
ATOM   5553  O  O    . ILE A 1 22 ? 7.186   0.393   -5.795  1.00 0.00 ? 22  ILE A O    9  
ATOM   5554  C  CB   . ILE A 1 22 ? 8.657   0.356   -8.557  1.00 0.00 ? 22  ILE A CB   9  
ATOM   5555  C  CG1  . ILE A 1 22 ? 9.264   1.049   -9.778  1.00 0.00 ? 22  ILE A CG1  9  
ATOM   5556  C  CG2  . ILE A 1 22 ? 8.303   -1.087  -8.881  1.00 0.00 ? 22  ILE A CG2  9  
ATOM   5557  C  CD1  . ILE A 1 22 ? 9.848   2.411   -9.472  1.00 0.00 ? 22  ILE A CD1  9  
ATOM   5558  H  H    . ILE A 1 22 ? 8.589   2.629   -7.175  1.00 0.00 ? 22  ILE A H    9  
ATOM   5559  H  HA   . ILE A 1 22 ? 6.715   1.193   -8.899  1.00 0.00 ? 22  ILE A HA   9  
ATOM   5560  H  HB   . ILE A 1 22 ? 9.381   0.352   -7.756  1.00 0.00 ? 22  ILE A HB   9  
ATOM   5561  H  HG12 . ILE A 1 22 ? 10.054  0.433   -10.178 1.00 0.00 ? 22  ILE A HG12 9  
ATOM   5562  H  HG13 . ILE A 1 22 ? 8.497   1.177   -10.528 1.00 0.00 ? 22  ILE A HG13 9  
ATOM   5563  H  HG21 . ILE A 1 22 ? 7.265   -1.266  -8.641  1.00 0.00 ? 22  ILE A HG21 9  
ATOM   5564  H  HG22 . ILE A 1 22 ? 8.464   -1.269  -9.933  1.00 0.00 ? 22  ILE A HG22 9  
ATOM   5565  H  HG23 . ILE A 1 22 ? 8.926   -1.751  -8.301  1.00 0.00 ? 22  ILE A HG23 9  
ATOM   5566  H  HD11 . ILE A 1 22 ? 10.492  2.717   -10.283 1.00 0.00 ? 22  ILE A HD11 9  
ATOM   5567  H  HD12 . ILE A 1 22 ? 9.049   3.127   -9.355  1.00 0.00 ? 22  ILE A HD12 9  
ATOM   5568  H  HD13 . ILE A 1 22 ? 10.422  2.359   -8.558  1.00 0.00 ? 22  ILE A HD13 9  
ATOM   5569  N  N    . CYS A 1 23 ? 5.700   -0.408  -7.283  1.00 0.00 ? 23  CYS A N    9  
ATOM   5570  C  CA   . CYS A 1 23 ? 4.981   -1.209  -6.299  1.00 0.00 ? 23  CYS A CA   9  
ATOM   5571  C  C    . CYS A 1 23 ? 5.906   -2.240  -5.657  1.00 0.00 ? 23  CYS A C    9  
ATOM   5572  O  O    . CYS A 1 23 ? 7.060   -2.388  -6.057  1.00 0.00 ? 23  CYS A O    9  
ATOM   5573  C  CB   . CYS A 1 23 ? 3.792   -1.913  -6.955  1.00 0.00 ? 23  CYS A CB   9  
ATOM   5574  S  SG   . CYS A 1 23 ? 2.429   -2.294  -5.808  1.00 0.00 ? 23  CYS A SG   9  
ATOM   5575  H  H    . CYS A 1 23 ? 5.400   -0.416  -8.216  1.00 0.00 ? 23  CYS A H    9  
ATOM   5576  H  HA   . CYS A 1 23 ? 4.616   -0.544  -5.532  1.00 0.00 ? 23  CYS A HA   9  
ATOM   5577  H  HB2  . CYS A 1 23 ? 3.395   -1.281  -7.736  1.00 0.00 ? 23  CYS A HB2  9  
ATOM   5578  H  HB3  . CYS A 1 23 ? 4.128   -2.844  -7.388  1.00 0.00 ? 23  CYS A HB3  9  
ATOM   5579  N  N    . ASP A 1 24 ? 5.389   -2.949  -4.659  1.00 0.00 ? 24  ASP A N    9  
ATOM   5580  C  CA   . ASP A 1 24 ? 6.166   -3.967  -3.962  1.00 0.00 ? 24  ASP A CA   9  
ATOM   5581  C  C    . ASP A 1 24 ? 5.729   -5.367  -4.382  1.00 0.00 ? 24  ASP A C    9  
ATOM   5582  O  O    . ASP A 1 24 ? 6.493   -6.325  -4.271  1.00 0.00 ? 24  ASP A O    9  
ATOM   5583  C  CB   . ASP A 1 24 ? 6.017   -3.805  -2.448  1.00 0.00 ? 24  ASP A CB   9  
ATOM   5584  C  CG   . ASP A 1 24 ? 6.385   -2.412  -1.976  1.00 0.00 ? 24  ASP A CG   9  
ATOM   5585  O  OD1  . ASP A 1 24 ? 5.682   -1.452  -2.355  1.00 0.00 ? 24  ASP A OD1  9  
ATOM   5586  O  OD2  . ASP A 1 24 ? 7.377   -2.282  -1.228  1.00 0.00 ? 24  ASP A OD2  9  
ATOM   5587  H  H    . ASP A 1 24 ? 4.462   -2.784  -4.386  1.00 0.00 ? 24  ASP A H    9  
ATOM   5588  H  HA   . ASP A 1 24 ? 7.204   -3.832  -4.228  1.00 0.00 ? 24  ASP A HA   9  
ATOM   5589  H  HB2  . ASP A 1 24 ? 4.991   -3.999  -2.172  1.00 0.00 ? 24  ASP A HB2  9  
ATOM   5590  H  HB3  . ASP A 1 24 ? 6.660   -4.516  -1.952  1.00 0.00 ? 24  ASP A HB3  9  
ATOM   5591  N  N    . ASN A 1 25 ? 4.496   -5.476  -4.864  1.00 0.00 ? 25  ASN A N    9  
ATOM   5592  C  CA   . ASN A 1 25 ? 3.957   -6.760  -5.299  1.00 0.00 ? 25  ASN A CA   9  
ATOM   5593  C  C    . ASN A 1 25 ? 4.255   -7.003  -6.775  1.00 0.00 ? 25  ASN A C    9  
ATOM   5594  O  O    . ASN A 1 25 ? 5.038   -7.887  -7.124  1.00 0.00 ? 25  ASN A O    9  
ATOM   5595  C  CB   . ASN A 1 25 ? 2.446   -6.810  -5.058  1.00 0.00 ? 25  ASN A CB   9  
ATOM   5596  C  CG   . ASN A 1 25 ? 2.102   -7.154  -3.622  1.00 0.00 ? 25  ASN A CG   9  
ATOM   5597  O  OD1  . ASN A 1 25 ? 2.902   -6.940  -2.711  1.00 0.00 ? 25  ASN A OD1  9  
ATOM   5598  N  ND2  . ASN A 1 25 ? 0.905   -7.690  -3.413  1.00 0.00 ? 25  ASN A ND2  9  
ATOM   5599  H  H    . ASN A 1 25 ? 3.934   -4.676  -4.929  1.00 0.00 ? 25  ASN A H    9  
ATOM   5600  H  HA   . ASN A 1 25 ? 4.431   -7.534  -4.715  1.00 0.00 ? 25  ASN A HA   9  
ATOM   5601  H  HB2  . ASN A 1 25 ? 2.019   -5.845  -5.289  1.00 0.00 ? 25  ASN A HB2  9  
ATOM   5602  H  HB3  . ASN A 1 25 ? 2.009   -7.557  -5.703  1.00 0.00 ? 25  ASN A HB3  9  
ATOM   5603  H  HD21 . ASN A 1 25 ? 0.319   -7.832  -4.186  1.00 0.00 ? 25  ASN A HD21 9  
ATOM   5604  H  HD22 . ASN A 1 25 ? 0.656   -7.921  -2.493  1.00 0.00 ? 25  ASN A HD22 9  
ATOM   5605  N  N    . PHE A 1 26 ? 3.627   -6.212  -7.639  1.00 0.00 ? 26  PHE A N    9  
ATOM   5606  C  CA   . PHE A 1 26 ? 3.824   -6.341  -9.078  1.00 0.00 ? 26  PHE A CA   9  
ATOM   5607  C  C    . PHE A 1 26 ? 5.301   -6.209  -9.438  1.00 0.00 ? 26  PHE A C    9  
ATOM   5608  O  O    . PHE A 1 26 ? 5.756   -6.747  -10.447 1.00 0.00 ? 26  PHE A O    9  
ATOM   5609  C  CB   . PHE A 1 26 ? 3.009   -5.282  -9.823  1.00 0.00 ? 26  PHE A CB   9  
ATOM   5610  C  CG   . PHE A 1 26 ? 2.560   -5.722  -11.187 1.00 0.00 ? 26  PHE A CG   9  
ATOM   5611  C  CD1  . PHE A 1 26 ? 3.467   -5.824  -12.230 1.00 0.00 ? 26  PHE A CD1  9  
ATOM   5612  C  CD2  . PHE A 1 26 ? 1.232   -6.034  -11.427 1.00 0.00 ? 26  PHE A CD2  9  
ATOM   5613  C  CE1  . PHE A 1 26 ? 3.056   -6.228  -13.486 1.00 0.00 ? 26  PHE A CE1  9  
ATOM   5614  C  CE2  . PHE A 1 26 ? 0.815   -6.438  -12.681 1.00 0.00 ? 26  PHE A CE2  9  
ATOM   5615  C  CZ   . PHE A 1 26 ? 1.729   -6.536  -13.712 1.00 0.00 ? 26  PHE A CZ   9  
ATOM   5616  H  H    . PHE A 1 26 ? 3.014   -5.525  -7.300  1.00 0.00 ? 26  PHE A H    9  
ATOM   5617  H  HA   . PHE A 1 26 ? 3.481   -7.321  -9.372  1.00 0.00 ? 26  PHE A HA   9  
ATOM   5618  H  HB2  . PHE A 1 26 ? 2.129   -5.044  -9.246  1.00 0.00 ? 26  PHE A HB2  9  
ATOM   5619  H  HB3  . PHE A 1 26 ? 3.610   -4.393  -9.940  1.00 0.00 ? 26  PHE A HB3  9  
ATOM   5620  H  HD1  . PHE A 1 26 ? 4.506   -5.585  -12.055 1.00 0.00 ? 26  PHE A HD1  9  
ATOM   5621  H  HD2  . PHE A 1 26 ? 0.516   -5.957  -10.621 1.00 0.00 ? 26  PHE A HD2  9  
ATOM   5622  H  HE1  . PHE A 1 26 ? 3.773   -6.304  -14.291 1.00 0.00 ? 26  PHE A HE1  9  
ATOM   5623  H  HE2  . PHE A 1 26 ? -0.223  -6.678  -12.854 1.00 0.00 ? 26  PHE A HE2  9  
ATOM   5624  H  HZ   . PHE A 1 26 ? 1.406   -6.852  -14.693 1.00 0.00 ? 26  PHE A HZ   9  
ATOM   5625  N  N    . SER A 1 27 ? 6.045   -5.488  -8.605  1.00 0.00 ? 27  SER A N    9  
ATOM   5626  C  CA   . SER A 1 27 ? 7.470   -5.280  -8.836  1.00 0.00 ? 27  SER A CA   9  
ATOM   5627  C  C    . SER A 1 27 ? 8.175   -6.605  -9.108  1.00 0.00 ? 27  SER A C    9  
ATOM   5628  O  O    . SER A 1 27 ? 8.694   -6.832  -10.201 1.00 0.00 ? 27  SER A O    9  
ATOM   5629  C  CB   . SER A 1 27 ? 8.108   -4.588  -7.631  1.00 0.00 ? 27  SER A CB   9  
ATOM   5630  O  OG   . SER A 1 27 ? 9.499   -4.854  -7.567  1.00 0.00 ? 27  SER A OG   9  
ATOM   5631  H  H    . SER A 1 27 ? 5.625   -5.084  -7.816  1.00 0.00 ? 27  SER A H    9  
ATOM   5632  H  HA   . SER A 1 27 ? 7.575   -4.645  -9.703  1.00 0.00 ? 27  SER A HA   9  
ATOM   5633  H  HB2  . SER A 1 27 ? 7.962   -3.521  -7.712  1.00 0.00 ? 27  SER A HB2  9  
ATOM   5634  H  HB3  . SER A 1 27 ? 7.643   -4.947  -6.725  1.00 0.00 ? 27  SER A HB3  9  
ATOM   5635  H  HG   . SER A 1 27 ? 9.866   -4.454  -6.776  1.00 0.00 ? 27  SER A HG   9  
ATOM   5636  N  N    . ALA A 1 28 ? 8.188   -7.478  -8.106  1.00 0.00 ? 28  ALA A N    9  
ATOM   5637  C  CA   . ALA A 1 28 ? 8.827   -8.782  -8.236  1.00 0.00 ? 28  ALA A CA   9  
ATOM   5638  C  C    . ALA A 1 28 ? 7.803   -9.865  -8.556  1.00 0.00 ? 28  ALA A C    9  
ATOM   5639  O  O    . ALA A 1 28 ? 7.880   -10.518 -9.597  1.00 0.00 ? 28  ALA A O    9  
ATOM   5640  C  CB   . ALA A 1 28 ? 9.585   -9.128  -6.963  1.00 0.00 ? 28  ALA A CB   9  
ATOM   5641  H  H    . ALA A 1 28 ? 7.757   -7.239  -7.259  1.00 0.00 ? 28  ALA A H    9  
ATOM   5642  H  HA   . ALA A 1 28 ? 9.540   -8.724  -9.046  1.00 0.00 ? 28  ALA A HA   9  
ATOM   5643  H  HB1  . ALA A 1 28 ? 10.623  -8.851  -7.076  1.00 0.00 ? 28  ALA A HB1  9  
ATOM   5644  H  HB2  . ALA A 1 28 ? 9.156   -8.588  -6.132  1.00 0.00 ? 28  ALA A HB2  9  
ATOM   5645  H  HB3  . ALA A 1 28 ? 9.513   -10.189 -6.779  1.00 0.00 ? 28  ALA A HB3  9  
ATOM   5646  N  N    . TYR A 1 29 ? 6.845   -10.052 -7.655  1.00 0.00 ? 29  TYR A N    9  
ATOM   5647  C  CA   . TYR A 1 29 ? 5.807   -11.059 -7.840  1.00 0.00 ? 29  TYR A CA   9  
ATOM   5648  C  C    . TYR A 1 29 ? 5.217   -10.981 -9.245  1.00 0.00 ? 29  TYR A C    9  
ATOM   5649  O  O    . TYR A 1 29 ? 5.137   -11.983 -9.954  1.00 0.00 ? 29  TYR A O    9  
ATOM   5650  C  CB   . TYR A 1 29 ? 4.701   -10.879 -6.799  1.00 0.00 ? 29  TYR A CB   9  
ATOM   5651  C  CG   . TYR A 1 29 ? 5.198   -10.926 -5.372  1.00 0.00 ? 29  TYR A CG   9  
ATOM   5652  C  CD1  . TYR A 1 29 ? 5.763   -9.805  -4.775  1.00 0.00 ? 29  TYR A CD1  9  
ATOM   5653  C  CD2  . TYR A 1 29 ? 5.103   -12.091 -4.621  1.00 0.00 ? 29  TYR A CD2  9  
ATOM   5654  C  CE1  . TYR A 1 29 ? 6.219   -9.845  -3.472  1.00 0.00 ? 29  TYR A CE1  9  
ATOM   5655  C  CE2  . TYR A 1 29 ? 5.556   -12.138 -3.317  1.00 0.00 ? 29  TYR A CE2  9  
ATOM   5656  C  CZ   . TYR A 1 29 ? 6.114   -11.013 -2.747  1.00 0.00 ? 29  TYR A CZ   9  
ATOM   5657  O  OH   . TYR A 1 29 ? 6.566   -11.055 -1.448  1.00 0.00 ? 29  TYR A OH   9  
ATOM   5658  H  H    . TYR A 1 29 ? 6.836   -9.500  -6.845  1.00 0.00 ? 29  TYR A H    9  
ATOM   5659  H  HA   . TYR A 1 29 ? 6.260   -12.030 -7.705  1.00 0.00 ? 29  TYR A HA   9  
ATOM   5660  H  HB2  . TYR A 1 29 ? 4.224   -9.923  -6.952  1.00 0.00 ? 29  TYR A HB2  9  
ATOM   5661  H  HB3  . TYR A 1 29 ? 3.969   -11.664 -6.922  1.00 0.00 ? 29  TYR A HB3  9  
ATOM   5662  H  HD1  . TYR A 1 29 ? 5.844   -8.892  -5.346  1.00 0.00 ? 29  TYR A HD1  9  
ATOM   5663  H  HD2  . TYR A 1 29 ? 4.666   -12.971 -5.070  1.00 0.00 ? 29  TYR A HD2  9  
ATOM   5664  H  HE1  . TYR A 1 29 ? 6.656   -8.963  -3.025  1.00 0.00 ? 29  TYR A HE1  9  
ATOM   5665  H  HE2  . TYR A 1 29 ? 5.474   -13.053 -2.748  1.00 0.00 ? 29  TYR A HE2  9  
ATOM   5666  H  HH   . TYR A 1 29 ? 5.971   -11.593 -0.919  1.00 0.00 ? 29  TYR A HH   9  
ATOM   5667  N  N    . GLY A 1 30 ? 4.804   -9.781  -9.641  1.00 0.00 ? 30  GLY A N    9  
ATOM   5668  C  CA   . GLY A 1 30 ? 4.227   -9.592  -10.959 1.00 0.00 ? 30  GLY A CA   9  
ATOM   5669  C  C    . GLY A 1 30 ? 2.754   -9.236  -10.901 1.00 0.00 ? 30  GLY A C    9  
ATOM   5670  O  O    . GLY A 1 30 ? 2.231   -8.586  -11.806 1.00 0.00 ? 30  GLY A O    9  
ATOM   5671  H  H    . GLY A 1 30 ? 4.892   -9.017  -9.033  1.00 0.00 ? 30  GLY A H    9  
ATOM   5672  H  HA2  . GLY A 1 30 ? 4.759   -8.800  -11.463 1.00 0.00 ? 30  GLY A HA2  9  
ATOM   5673  H  HA3  . GLY A 1 30 ? 4.342   -10.506 -11.524 1.00 0.00 ? 30  GLY A HA3  9  
ATOM   5674  N  N    . TRP A 1 31 ? 2.085   -9.664  -9.837  1.00 0.00 ? 31  TRP A N    9  
ATOM   5675  C  CA   . TRP A 1 31 ? 0.663   -9.388  -9.666  1.00 0.00 ? 31  TRP A CA   9  
ATOM   5676  C  C    . TRP A 1 31 ? 0.435   -8.381  -8.545  1.00 0.00 ? 31  TRP A C    9  
ATOM   5677  O  O    . TRP A 1 31 ? 1.288   -8.202  -7.674  1.00 0.00 ? 31  TRP A O    9  
ATOM   5678  C  CB   . TRP A 1 31 ? -0.097  -10.682 -9.370  1.00 0.00 ? 31  TRP A CB   9  
ATOM   5679  C  CG   . TRP A 1 31 ? -0.215  -10.978 -7.905  1.00 0.00 ? 31  TRP A CG   9  
ATOM   5680  C  CD1  . TRP A 1 31 ? 0.717   -11.588 -7.115  1.00 0.00 ? 31  TRP A CD1  9  
ATOM   5681  C  CD2  . TRP A 1 31 ? -1.330  -10.680 -7.058  1.00 0.00 ? 31  TRP A CD2  9  
ATOM   5682  N  NE1  . TRP A 1 31 ? 0.248   -11.687 -5.827  1.00 0.00 ? 31  TRP A NE1  9  
ATOM   5683  C  CE2  . TRP A 1 31 ? -1.004  -11.136 -5.765  1.00 0.00 ? 31  TRP A CE2  9  
ATOM   5684  C  CE3  . TRP A 1 31 ? -2.570  -10.070 -7.264  1.00 0.00 ? 31  TRP A CE3  9  
ATOM   5685  C  CZ2  . TRP A 1 31 ? -1.875  -11.002 -4.687  1.00 0.00 ? 31  TRP A CZ2  9  
ATOM   5686  C  CZ3  . TRP A 1 31 ? -3.433  -9.937  -6.193  1.00 0.00 ? 31  TRP A CZ3  9  
ATOM   5687  C  CH2  . TRP A 1 31 ? -3.083  -10.400 -4.918  1.00 0.00 ? 31  TRP A CH2  9  
ATOM   5688  H  H    . TRP A 1 31 ? 2.558   -10.179 -9.149  1.00 0.00 ? 31  TRP A H    9  
ATOM   5689  H  HA   . TRP A 1 31 ? 0.295   -8.969  -10.591 1.00 0.00 ? 31  TRP A HA   9  
ATOM   5690  H  HB2  . TRP A 1 31 ? -1.094  -10.607 -9.776  1.00 0.00 ? 31  TRP A HB2  9  
ATOM   5691  H  HB3  . TRP A 1 31 ? 0.418   -11.508 -9.837  1.00 0.00 ? 31  TRP A HB3  9  
ATOM   5692  H  HD1  . TRP A 1 31 ? 1.676   -11.938 -7.465  1.00 0.00 ? 31  TRP A HD1  9  
ATOM   5693  H  HE1  . TRP A 1 31 ? 0.734   -12.086 -5.074  1.00 0.00 ? 31  TRP A HE1  9  
ATOM   5694  H  HE3  . TRP A 1 31 ? -2.858  -9.706  -8.239  1.00 0.00 ? 31  TRP A HE3  9  
ATOM   5695  H  HZ2  . TRP A 1 31 ? -1.619  -11.353 -3.699  1.00 0.00 ? 31  TRP A HZ2  9  
ATOM   5696  H  HZ3  . TRP A 1 31 ? -4.396  -9.469  -6.334  1.00 0.00 ? 31  TRP A HZ3  9  
ATOM   5697  H  HH2  . TRP A 1 31 ? -3.788  -10.276 -4.111  1.00 0.00 ? 31  TRP A HH2  9  
ATOM   5698  N  N    . CYS A 1 32 ? -0.720  -7.725  -8.570  1.00 0.00 ? 32  CYS A N    9  
ATOM   5699  C  CA   . CYS A 1 32 ? -1.060  -6.735  -7.555  1.00 0.00 ? 32  CYS A CA   9  
ATOM   5700  C  C    . CYS A 1 32 ? -2.559  -6.742  -7.270  1.00 0.00 ? 32  CYS A C    9  
ATOM   5701  O  O    . CYS A 1 32 ? -3.389  -6.775  -8.178  1.00 0.00 ? 32  CYS A O    9  
ATOM   5702  C  CB   . CYS A 1 32 ? -0.622  -5.340  -8.005  1.00 0.00 ? 32  CYS A CB   9  
ATOM   5703  S  SG   . CYS A 1 32 ? -0.872  -4.042  -6.753  1.00 0.00 ? 32  CYS A SG   9  
ATOM   5704  H  H    . CYS A 1 32 ? -1.360  -7.911  -9.289  1.00 0.00 ? 32  CYS A H    9  
ATOM   5705  H  HA   . CYS A 1 32 ? -0.533  -6.994  -6.649  1.00 0.00 ? 32  CYS A HA   9  
ATOM   5706  H  HB2  . CYS A 1 32 ? 0.431   -5.363  -8.248  1.00 0.00 ? 32  CYS A HB2  9  
ATOM   5707  H  HB3  . CYS A 1 32 ? -1.183  -5.062  -8.885  1.00 0.00 ? 32  CYS A HB3  9  
ATOM   5708  N  N    . PRO A 1 33 ? -2.916  -6.709  -5.977  1.00 0.00 ? 33  PRO A N    9  
ATOM   5709  C  CA   . PRO A 1 33 ? -4.316  -6.710  -5.542  1.00 0.00 ? 33  PRO A CA   9  
ATOM   5710  C  C    . PRO A 1 33 ? -5.026  -5.402  -5.872  1.00 0.00 ? 33  PRO A C    9  
ATOM   5711  O  O    . PRO A 1 33 ? -6.208  -5.232  -5.571  1.00 0.00 ? 33  PRO A O    9  
ATOM   5712  C  CB   . PRO A 1 33 ? -4.215  -6.897  -4.026  1.00 0.00 ? 33  PRO A CB   9  
ATOM   5713  C  CG   . PRO A 1 33 ? -2.870  -6.367  -3.667  1.00 0.00 ? 33  PRO A CG   9  
ATOM   5714  C  CD   . PRO A 1 33 ? -1.980  -6.669  -4.841  1.00 0.00 ? 33  PRO A CD   9  
ATOM   5715  H  HA   . PRO A 1 33 ? -4.865  -7.535  -5.972  1.00 0.00 ? 33  PRO A HA   9  
ATOM   5716  H  HB2  . PRO A 1 33 ? -5.003  -6.338  -3.539  1.00 0.00 ? 33  PRO A HB2  9  
ATOM   5717  H  HB3  . PRO A 1 33 ? -4.305  -7.944  -3.781  1.00 0.00 ? 33  PRO A HB3  9  
ATOM   5718  H  HG2  . PRO A 1 33 ? -2.926  -5.302  -3.503  1.00 0.00 ? 33  PRO A HG2  9  
ATOM   5719  H  HG3  . PRO A 1 33 ? -2.504  -6.866  -2.782  1.00 0.00 ? 33  PRO A HG3  9  
ATOM   5720  H  HD2  . PRO A 1 33 ? -1.249  -5.885  -4.971  1.00 0.00 ? 33  PRO A HD2  9  
ATOM   5721  H  HD3  . PRO A 1 33 ? -1.493  -7.624  -4.710  1.00 0.00 ? 33  PRO A HD3  9  
ATOM   5722  N  N    . LEU A 1 34 ? -4.299  -4.479  -6.492  1.00 0.00 ? 34  LEU A N    9  
ATOM   5723  C  CA   . LEU A 1 34 ? -4.860  -3.185  -6.863  1.00 0.00 ? 34  LEU A CA   9  
ATOM   5724  C  C    . LEU A 1 34 ? -4.942  -3.042  -8.380  1.00 0.00 ? 34  LEU A C    9  
ATOM   5725  O  O    . LEU A 1 34 ? -5.628  -2.161  -8.894  1.00 0.00 ? 34  LEU A O    9  
ATOM   5726  C  CB   . LEU A 1 34 ? -4.013  -2.053  -6.278  1.00 0.00 ? 34  LEU A CB   9  
ATOM   5727  C  CG   . LEU A 1 34 ? -4.204  -1.774  -4.787  1.00 0.00 ? 34  LEU A CG   9  
ATOM   5728  C  CD1  . LEU A 1 34 ? -3.290  -0.647  -4.334  1.00 0.00 ? 34  LEU A CD1  9  
ATOM   5729  C  CD2  . LEU A 1 34 ? -5.658  -1.437  -4.489  1.00 0.00 ? 34  LEU A CD2  9  
ATOM   5730  H  H    . LEU A 1 34 ? -3.362  -4.672  -6.705  1.00 0.00 ? 34  LEU A H    9  
ATOM   5731  H  HA   . LEU A 1 34 ? -5.857  -3.126  -6.454  1.00 0.00 ? 34  LEU A HA   9  
ATOM   5732  H  HB2  . LEU A 1 34 ? -2.975  -2.300  -6.438  1.00 0.00 ? 34  LEU A HB2  9  
ATOM   5733  H  HB3  . LEU A 1 34 ? -4.254  -1.148  -6.818  1.00 0.00 ? 34  LEU A HB3  9  
ATOM   5734  H  HG   . LEU A 1 34 ? -3.943  -2.661  -4.225  1.00 0.00 ? 34  LEU A HG   9  
ATOM   5735  H  HD11 . LEU A 1 34 ? -2.305  -0.792  -4.751  1.00 0.00 ? 34  LEU A HD11 9  
ATOM   5736  H  HD12 . LEU A 1 34 ? -3.227  -0.646  -3.255  1.00 0.00 ? 34  LEU A HD12 9  
ATOM   5737  H  HD13 . LEU A 1 34 ? -3.689  0.298   -4.671  1.00 0.00 ? 34  LEU A HD13 9  
ATOM   5738  H  HD21 . LEU A 1 34 ? -6.089  -0.927  -5.337  1.00 0.00 ? 34  LEU A HD21 9  
ATOM   5739  H  HD22 . LEU A 1 34 ? -5.708  -0.796  -3.620  1.00 0.00 ? 34  LEU A HD22 9  
ATOM   5740  H  HD23 . LEU A 1 34 ? -6.206  -2.347  -4.298  1.00 0.00 ? 34  LEU A HD23 9  
ATOM   5741  N  N    . GLY A 1 35 ? -4.238  -3.918  -9.091  1.00 0.00 ? 35  GLY A N    9  
ATOM   5742  C  CA   . GLY A 1 35 ? -4.246  -3.874  -10.541 1.00 0.00 ? 35  GLY A CA   9  
ATOM   5743  C  C    . GLY A 1 35 ? -3.710  -2.565  -11.084 1.00 0.00 ? 35  GLY A C    9  
ATOM   5744  O  O    . GLY A 1 35 ? -2.757  -1.992  -10.555 1.00 0.00 ? 35  GLY A O    9  
ATOM   5745  H  H    . GLY A 1 35 ? -3.708  -4.600  -8.626  1.00 0.00 ? 35  GLY A H    9  
ATOM   5746  H  HA2  . GLY A 1 35 ? -3.640  -4.684  -10.919 1.00 0.00 ? 35  GLY A HA2  9  
ATOM   5747  H  HA3  . GLY A 1 35 ? -5.261  -4.006  -10.888 1.00 0.00 ? 35  GLY A HA3  9  
ATOM   5748  N  N    . PRO A 1 36 ? -4.328  -2.071  -12.168 1.00 0.00 ? 36  PRO A N    9  
ATOM   5749  C  CA   . PRO A 1 36 ? -3.923  -0.816  -12.807 1.00 0.00 ? 36  PRO A CA   9  
ATOM   5750  C  C    . PRO A 1 36 ? -4.244  0.402   -11.948 1.00 0.00 ? 36  PRO A C    9  
ATOM   5751  O  O    . PRO A 1 36 ? -3.529  1.403   -11.983 1.00 0.00 ? 36  PRO A O    9  
ATOM   5752  C  CB   . PRO A 1 36 ? -4.748  -0.793  -14.097 1.00 0.00 ? 36  PRO A CB   9  
ATOM   5753  C  CG   . PRO A 1 36 ? -5.942  -1.632  -13.798 1.00 0.00 ? 36  PRO A CG   9  
ATOM   5754  C  CD   . PRO A 1 36 ? -5.471  -2.701  -12.851 1.00 0.00 ? 36  PRO A CD   9  
ATOM   5755  H  HA   . PRO A 1 36 ? -2.871  -0.816  -13.051 1.00 0.00 ? 36  PRO A HA   9  
ATOM   5756  H  HB2  . PRO A 1 36 ? -5.027  0.224   -14.331 1.00 0.00 ? 36  PRO A HB2  9  
ATOM   5757  H  HB3  . PRO A 1 36 ? -4.167  -1.208  -14.907 1.00 0.00 ? 36  PRO A HB3  9  
ATOM   5758  H  HG2  . PRO A 1 36 ? -6.707  -1.029  -13.333 1.00 0.00 ? 36  PRO A HG2  9  
ATOM   5759  H  HG3  . PRO A 1 36 ? -6.315  -2.077  -14.709 1.00 0.00 ? 36  PRO A HG3  9  
ATOM   5760  H  HD2  . PRO A 1 36 ? -6.251  -2.952  -12.147 1.00 0.00 ? 36  PRO A HD2  9  
ATOM   5761  H  HD3  . PRO A 1 36 ? -5.157  -3.578  -13.397 1.00 0.00 ? 36  PRO A HD3  9  
ATOM   5762  N  N    . GLN A 1 37 ? -5.324  0.310   -11.178 1.00 0.00 ? 37  GLN A N    9  
ATOM   5763  C  CA   . GLN A 1 37 ? -5.738  1.406   -10.310 1.00 0.00 ? 37  GLN A CA   9  
ATOM   5764  C  C    . GLN A 1 37 ? -4.675  1.698   -9.257  1.00 0.00 ? 37  GLN A C    9  
ATOM   5765  O  O    . GLN A 1 37 ? -4.584  2.814   -8.744  1.00 0.00 ? 37  GLN A O    9  
ATOM   5766  C  CB   . GLN A 1 37 ? -7.067  1.072   -9.631  1.00 0.00 ? 37  GLN A CB   9  
ATOM   5767  C  CG   . GLN A 1 37 ? -8.284  1.404   -10.479 1.00 0.00 ? 37  GLN A CG   9  
ATOM   5768  C  CD   . GLN A 1 37 ? -9.585  1.271   -9.711  1.00 0.00 ? 37  GLN A CD   9  
ATOM   5769  O  OE1  . GLN A 1 37 ? -10.026 0.164   -9.403  1.00 0.00 ? 37  GLN A OE1  9  
ATOM   5770  N  NE2  . GLN A 1 37 ? -10.206 2.402   -9.397  1.00 0.00 ? 37  GLN A NE2  9  
ATOM   5771  H  H    . GLN A 1 37 ? -5.853  -0.514  -11.194 1.00 0.00 ? 37  GLN A H    9  
ATOM   5772  H  HA   . GLN A 1 37 ? -5.869  2.284   -10.925 1.00 0.00 ? 37  GLN A HA   9  
ATOM   5773  H  HB2  . GLN A 1 37 ? -7.088  0.015   -9.408  1.00 0.00 ? 37  GLN A HB2  9  
ATOM   5774  H  HB3  . GLN A 1 37 ? -7.136  1.628   -8.708  1.00 0.00 ? 37  GLN A HB3  9  
ATOM   5775  H  HG2  . GLN A 1 37 ? -8.195  2.421   -10.831 1.00 0.00 ? 37  GLN A HG2  9  
ATOM   5776  H  HG3  . GLN A 1 37 ? -8.312  0.733   -11.325 1.00 0.00 ? 37  GLN A HG3  9  
ATOM   5777  H  HE21 . GLN A 1 37 ? -9.795  3.248   -9.677  1.00 0.00 ? 37  GLN A HE21 9  
ATOM   5778  H  HE22 . GLN A 1 37 ? -11.048 2.346   -8.902  1.00 0.00 ? 37  GLN A HE22 9  
ATOM   5779  N  N    . CYS A 1 38 ? -3.871  0.689   -8.939  1.00 0.00 ? 38  CYS A N    9  
ATOM   5780  C  CA   . CYS A 1 38 ? -2.814  0.837   -7.946  1.00 0.00 ? 38  CYS A CA   9  
ATOM   5781  C  C    . CYS A 1 38 ? -2.109  2.182   -8.098  1.00 0.00 ? 38  CYS A C    9  
ATOM   5782  O  O    . CYS A 1 38 ? -1.771  2.612   -9.200  1.00 0.00 ? 38  CYS A O    9  
ATOM   5783  C  CB   . CYS A 1 38 ? -1.799  -0.301  -8.077  1.00 0.00 ? 38  CYS A CB   9  
ATOM   5784  S  SG   . CYS A 1 38 ? -0.497  -0.287  -6.804  1.00 0.00 ? 38  CYS A SG   9  
ATOM   5785  H  H    . CYS A 1 38 ? -3.992  -0.177  -9.382  1.00 0.00 ? 38  CYS A H    9  
ATOM   5786  H  HA   . CYS A 1 38 ? -3.268  0.791   -6.968  1.00 0.00 ? 38  CYS A HA   9  
ATOM   5787  H  HB2  . CYS A 1 38 ? -2.318  -1.246  -8.005  1.00 0.00 ? 38  CYS A HB2  9  
ATOM   5788  H  HB3  . CYS A 1 38 ? -1.318  -0.233  -9.042  1.00 0.00 ? 38  CYS A HB3  9  
ATOM   5789  N  N    . PRO A 1 39 ? -1.882  2.862   -6.964  1.00 0.00 ? 39  PRO A N    9  
ATOM   5790  C  CA   . PRO A 1 39 ? -1.215  4.167   -6.944  1.00 0.00 ? 39  PRO A CA   9  
ATOM   5791  C  C    . PRO A 1 39 ? 0.265   4.067   -7.296  1.00 0.00 ? 39  PRO A C    9  
ATOM   5792  O  O    . PRO A 1 39 ? 0.906   5.069   -7.611  1.00 0.00 ? 39  PRO A O    9  
ATOM   5793  C  CB   . PRO A 1 39 ? -1.391  4.633   -5.496  1.00 0.00 ? 39  PRO A CB   9  
ATOM   5794  C  CG   . PRO A 1 39 ? -1.547  3.377   -4.711  1.00 0.00 ? 39  PRO A CG   9  
ATOM   5795  C  CD   . PRO A 1 39 ? -2.259  2.409   -5.614  1.00 0.00 ? 39  PRO A CD   9  
ATOM   5796  H  HA   . PRO A 1 39 ? -1.696  4.869   -7.610  1.00 0.00 ? 39  PRO A HA   9  
ATOM   5797  H  HB2  . PRO A 1 39 ? -0.517  5.188   -5.186  1.00 0.00 ? 39  PRO A HB2  9  
ATOM   5798  H  HB3  . PRO A 1 39 ? -2.267  5.258   -5.419  1.00 0.00 ? 39  PRO A HB3  9  
ATOM   5799  H  HG2  . PRO A 1 39 ? -0.576  2.991   -4.438  1.00 0.00 ? 39  PRO A HG2  9  
ATOM   5800  H  HG3  . PRO A 1 39 ? -2.138  3.568   -3.827  1.00 0.00 ? 39  PRO A HG3  9  
ATOM   5801  H  HD2  . PRO A 1 39 ? -1.913  1.402   -5.435  1.00 0.00 ? 39  PRO A HD2  9  
ATOM   5802  H  HD3  . PRO A 1 39 ? -3.327  2.475   -5.471  1.00 0.00 ? 39  PRO A HD3  9  
ATOM   5803  N  N    . GLN A 1 40 ? 0.801   2.852   -7.240  1.00 0.00 ? 40  GLN A N    9  
ATOM   5804  C  CA   . GLN A 1 40 ? 2.207   2.623   -7.553  1.00 0.00 ? 40  GLN A CA   9  
ATOM   5805  C  C    . GLN A 1 40 ? 2.371   2.124   -8.985  1.00 0.00 ? 40  GLN A C    9  
ATOM   5806  O  O    . GLN A 1 40 ? 1.412   1.670   -9.608  1.00 0.00 ? 40  GLN A O    9  
ATOM   5807  C  CB   . GLN A 1 40 ? 2.810   1.613   -6.576  1.00 0.00 ? 40  GLN A CB   9  
ATOM   5808  C  CG   . GLN A 1 40 ? 2.503   1.918   -5.119  1.00 0.00 ? 40  GLN A CG   9  
ATOM   5809  C  CD   . GLN A 1 40 ? 3.175   0.949   -4.165  1.00 0.00 ? 40  GLN A CD   9  
ATOM   5810  O  OE1  . GLN A 1 40 ? 2.593   -0.065  -3.779  1.00 0.00 ? 40  GLN A OE1  9  
ATOM   5811  N  NE2  . GLN A 1 40 ? 4.409   1.257   -3.781  1.00 0.00 ? 40  GLN A NE2  9  
ATOM   5812  H  H    . GLN A 1 40 ? 0.239   2.093   -6.982  1.00 0.00 ? 40  GLN A H    9  
ATOM   5813  H  HA   . GLN A 1 40 ? 2.726   3.563   -7.451  1.00 0.00 ? 40  GLN A HA   9  
ATOM   5814  H  HB2  . GLN A 1 40 ? 2.422   0.631   -6.805  1.00 0.00 ? 40  GLN A HB2  9  
ATOM   5815  H  HB3  . GLN A 1 40 ? 3.883   1.605   -6.701  1.00 0.00 ? 40  GLN A HB3  9  
ATOM   5816  H  HG2  . GLN A 1 40 ? 2.846   2.916   -4.893  1.00 0.00 ? 40  GLN A HG2  9  
ATOM   5817  H  HG3  . GLN A 1 40 ? 1.435   1.863   -4.970  1.00 0.00 ? 40  GLN A HG3  9  
ATOM   5818  H  HE21 . GLN A 1 40 ? 4.809   2.082   -4.128  1.00 0.00 ? 40  GLN A HE21 9  
ATOM   5819  H  HE22 . GLN A 1 40 ? 4.866   0.649   -3.164  1.00 0.00 ? 40  GLN A HE22 9  
ATOM   5820  N  N    . SER A 1 41 ? 3.593   2.212   -9.500  1.00 0.00 ? 41  SER A N    9  
ATOM   5821  C  CA   . SER A 1 41 ? 3.882   1.774   -10.861 1.00 0.00 ? 41  SER A CA   9  
ATOM   5822  C  C    . SER A 1 41 ? 4.202   0.282   -10.894 1.00 0.00 ? 41  SER A C    9  
ATOM   5823  O  O    . SER A 1 41 ? 4.616   -0.298  -9.890  1.00 0.00 ? 41  SER A O    9  
ATOM   5824  C  CB   . SER A 1 41 ? 5.054   2.571   -11.438 1.00 0.00 ? 41  SER A CB   9  
ATOM   5825  O  OG   . SER A 1 41 ? 5.129   2.421   -12.845 1.00 0.00 ? 41  SER A OG   9  
ATOM   5826  H  H    . SER A 1 41 ? 4.317   2.584   -8.953  1.00 0.00 ? 41  SER A H    9  
ATOM   5827  H  HA   . SER A 1 41 ? 3.004   1.955   -11.461 1.00 0.00 ? 41  SER A HA   9  
ATOM   5828  H  HB2  . SER A 1 41 ? 4.923   3.617   -11.206 1.00 0.00 ? 41  SER A HB2  9  
ATOM   5829  H  HB3  . SER A 1 41 ? 5.976   2.218   -11.000 1.00 0.00 ? 41  SER A HB3  9  
ATOM   5830  H  HG   . SER A 1 41 ? 6.033   2.219   -13.098 1.00 0.00 ? 41  SER A HG   9  
ATOM   5831  N  N    . HIS A 1 42 ? 4.006   -0.333  -12.056 1.00 0.00 ? 42  HIS A N    9  
ATOM   5832  C  CA   . HIS A 1 42 ? 4.273   -1.757  -12.222 1.00 0.00 ? 42  HIS A CA   9  
ATOM   5833  C  C    . HIS A 1 42 ? 5.228   -1.998  -13.388 1.00 0.00 ? 42  HIS A C    9  
ATOM   5834  O  O    . HIS A 1 42 ? 4.806   -2.382  -14.479 1.00 0.00 ? 42  HIS A O    9  
ATOM   5835  C  CB   . HIS A 1 42 ? 2.967   -2.519  -12.451 1.00 0.00 ? 42  HIS A CB   9  
ATOM   5836  C  CG   . HIS A 1 42 ? 2.072   -2.547  -11.250 1.00 0.00 ? 42  HIS A CG   9  
ATOM   5837  N  ND1  . HIS A 1 42 ? 0.711   -2.753  -11.331 1.00 0.00 ? 42  HIS A ND1  9  
ATOM   5838  C  CD2  . HIS A 1 42 ? 2.350   -2.395  -9.935  1.00 0.00 ? 42  HIS A CD2  9  
ATOM   5839  C  CE1  . HIS A 1 42 ? 0.191   -2.725  -10.117 1.00 0.00 ? 42  HIS A CE1  9  
ATOM   5840  N  NE2  . HIS A 1 42 ? 1.165   -2.509  -9.252  1.00 0.00 ? 42  HIS A NE2  9  
ATOM   5841  H  H    . HIS A 1 42 ? 3.674   0.184   -12.820 1.00 0.00 ? 42  HIS A H    9  
ATOM   5842  H  HA   . HIS A 1 42 ? 4.735   -2.116  -11.315 1.00 0.00 ? 42  HIS A HA   9  
ATOM   5843  H  HB2  . HIS A 1 42 ? 2.423   -2.053  -13.259 1.00 0.00 ? 42  HIS A HB2  9  
ATOM   5844  H  HB3  . HIS A 1 42 ? 3.196   -3.540  -12.719 1.00 0.00 ? 42  HIS A HB3  9  
ATOM   5845  H  HD1  . HIS A 1 42 ? 0.202   -2.897  -12.156 1.00 0.00 ? 42  HIS A HD1  9  
ATOM   5846  H  HD2  . HIS A 1 42 ? 3.325   -2.216  -9.501  1.00 0.00 ? 42  HIS A HD2  9  
ATOM   5847  H  HE1  . HIS A 1 42 ? -0.853  -2.856  -9.874  1.00 0.00 ? 42  HIS A HE1  9  
ATOM   5848  N  N    . ASP A 1 43 ? 6.514   -1.770  -13.149 1.00 0.00 ? 43  ASP A N    9  
ATOM   5849  C  CA   . ASP A 1 43 ? 7.529   -1.963  -14.179 1.00 0.00 ? 43  ASP A CA   9  
ATOM   5850  C  C    . ASP A 1 43 ? 8.324   -3.240  -13.926 1.00 0.00 ? 43  ASP A C    9  
ATOM   5851  O  O    . ASP A 1 43 ? 9.044   -3.347  -12.932 1.00 0.00 ? 43  ASP A O    9  
ATOM   5852  C  CB   . ASP A 1 43 ? 8.472   -0.760  -14.227 1.00 0.00 ? 43  ASP A CB   9  
ATOM   5853  C  CG   . ASP A 1 43 ? 9.047   -0.530  -15.611 1.00 0.00 ? 43  ASP A CG   9  
ATOM   5854  O  OD1  . ASP A 1 43 ? 9.184   -1.514  -16.368 1.00 0.00 ? 43  ASP A OD1  9  
ATOM   5855  O  OD2  . ASP A 1 43 ? 9.359   0.634   -15.937 1.00 0.00 ? 43  ASP A OD2  9  
ATOM   5856  H  H    . ASP A 1 43 ? 6.789   -1.465  -12.259 1.00 0.00 ? 43  ASP A H    9  
ATOM   5857  H  HA   . ASP A 1 43 ? 7.024   -2.051  -15.129 1.00 0.00 ? 43  ASP A HA   9  
ATOM   5858  H  HB2  . ASP A 1 43 ? 7.931   0.126   -13.930 1.00 0.00 ? 43  ASP A HB2  9  
ATOM   5859  H  HB3  . ASP A 1 43 ? 9.289   -0.924  -13.540 1.00 0.00 ? 43  ASP A HB3  9  
ATOM   5860  N  N    . ILE A 1 44 ? 8.189   -4.204  -14.829 1.00 0.00 ? 44  ILE A N    9  
ATOM   5861  C  CA   . ILE A 1 44 ? 8.895   -5.473  -14.703 1.00 0.00 ? 44  ILE A CA   9  
ATOM   5862  C  C    . ILE A 1 44 ? 10.237  -5.429  -15.425 1.00 0.00 ? 44  ILE A C    9  
ATOM   5863  O  O    . ILE A 1 44 ? 10.307  -5.618  -16.639 1.00 0.00 ? 44  ILE A O    9  
ATOM   5864  C  CB   . ILE A 1 44 ? 8.061   -6.640  -15.265 1.00 0.00 ? 44  ILE A CB   9  
ATOM   5865  C  CG1  . ILE A 1 44 ? 6.690   -6.687  -14.587 1.00 0.00 ? 44  ILE A CG1  9  
ATOM   5866  C  CG2  . ILE A 1 44 ? 8.797   -7.957  -15.074 1.00 0.00 ? 44  ILE A CG2  9  
ATOM   5867  C  CD1  . ILE A 1 44 ? 6.745   -7.126  -13.140 1.00 0.00 ? 44  ILE A CD1  9  
ATOM   5868  H  H    . ILE A 1 44 ? 7.600   -4.059  -15.599 1.00 0.00 ? 44  ILE A H    9  
ATOM   5869  H  HA   . ILE A 1 44 ? 9.069   -5.654  -13.652 1.00 0.00 ? 44  ILE A HA   9  
ATOM   5870  H  HB   . ILE A 1 44 ? 7.926   -6.480  -16.323 1.00 0.00 ? 44  ILE A HB   9  
ATOM   5871  H  HG12 . ILE A 1 44 ? 6.245   -5.705  -14.618 1.00 0.00 ? 44  ILE A HG12 9  
ATOM   5872  H  HG13 . ILE A 1 44 ? 6.057   -7.382  -15.121 1.00 0.00 ? 44  ILE A HG13 9  
ATOM   5873  H  HG21 . ILE A 1 44 ? 9.518   -7.855  -14.277 1.00 0.00 ? 44  ILE A HG21 9  
ATOM   5874  H  HG22 . ILE A 1 44 ? 8.089   -8.732  -14.821 1.00 0.00 ? 44  ILE A HG22 9  
ATOM   5875  H  HG23 . ILE A 1 44 ? 9.308   -8.220  -15.989 1.00 0.00 ? 44  ILE A HG23 9  
ATOM   5876  H  HD11 . ILE A 1 44 ? 5.773   -6.998  -12.687 1.00 0.00 ? 44  ILE A HD11 9  
ATOM   5877  H  HD12 . ILE A 1 44 ? 7.034   -8.165  -13.089 1.00 0.00 ? 44  ILE A HD12 9  
ATOM   5878  H  HD13 . ILE A 1 44 ? 7.470   -6.524  -12.610 1.00 0.00 ? 44  ILE A HD13 9  
ATOM   5879  N  N    . SER A 1 45 ? 11.302  -5.180  -14.668 1.00 0.00 ? 45  SER A N    9  
ATOM   5880  C  CA   . SER A 1 45 ? 12.643  -5.110  -15.236 1.00 0.00 ? 45  SER A CA   9  
ATOM   5881  C  C    . SER A 1 45 ? 12.731  -4.008  -16.287 1.00 0.00 ? 45  SER A C    9  
ATOM   5882  O  O    . SER A 1 45 ? 13.142  -4.248  -17.422 1.00 0.00 ? 45  SER A O    9  
ATOM   5883  C  CB   . SER A 1 45 ? 13.028  -6.454  -15.856 1.00 0.00 ? 45  SER A CB   9  
ATOM   5884  O  OG   . SER A 1 45 ? 13.431  -7.379  -14.861 1.00 0.00 ? 45  SER A OG   9  
ATOM   5885  H  H    . SER A 1 45 ? 11.181  -5.038  -13.706 1.00 0.00 ? 45  SER A H    9  
ATOM   5886  H  HA   . SER A 1 45 ? 13.330  -4.882  -14.435 1.00 0.00 ? 45  SER A HA   9  
ATOM   5887  H  HB2  . SER A 1 45 ? 12.180  -6.860  -16.386 1.00 0.00 ? 45  SER A HB2  9  
ATOM   5888  H  HB3  . SER A 1 45 ? 13.847  -6.307  -16.547 1.00 0.00 ? 45  SER A HB3  9  
ATOM   5889  H  HG   . SER A 1 45 ? 14.273  -7.104  -14.490 1.00 0.00 ? 45  SER A HG   9  
ATOM   5890  N  N    . GLY A 1 46 ? 12.340  -2.797  -15.901 1.00 0.00 ? 46  GLY A N    9  
ATOM   5891  C  CA   . GLY A 1 46 ? 12.381  -1.675  -16.821 1.00 0.00 ? 46  GLY A CA   9  
ATOM   5892  C  C    . GLY A 1 46 ? 13.780  -1.396  -17.332 1.00 0.00 ? 46  GLY A C    9  
ATOM   5893  O  O    . GLY A 1 46 ? 14.772  -1.593  -16.629 1.00 0.00 ? 46  GLY A O    9  
ATOM   5894  H  H    . GLY A 1 46 ? 12.020  -2.665  -14.984 1.00 0.00 ? 46  GLY A H    9  
ATOM   5895  H  HA2  . GLY A 1 46 ? 11.738  -1.889  -17.661 1.00 0.00 ? 46  GLY A HA2  9  
ATOM   5896  H  HA3  . GLY A 1 46 ? 12.014  -0.795  -16.314 1.00 0.00 ? 46  GLY A HA3  9  
ATOM   5897  N  N    . PRO A 1 47 ? 13.874  -0.928  -18.586 1.00 0.00 ? 47  PRO A N    9  
ATOM   5898  C  CA   . PRO A 1 47 ? 15.158  -0.613  -19.219 1.00 0.00 ? 47  PRO A CA   9  
ATOM   5899  C  C    . PRO A 1 47 ? 15.821  0.616   -18.606 1.00 0.00 ? 47  PRO A C    9  
ATOM   5900  O  O    . PRO A 1 47 ? 16.882  1.050   -19.054 1.00 0.00 ? 47  PRO A O    9  
ATOM   5901  C  CB   . PRO A 1 47 ? 14.778  -0.344  -20.677 1.00 0.00 ? 47  PRO A CB   9  
ATOM   5902  C  CG   . PRO A 1 47 ? 13.353  0.087   -20.624 1.00 0.00 ? 47  PRO A CG   9  
ATOM   5903  C  CD   . PRO A 1 47 ? 12.734  -0.670  -19.481 1.00 0.00 ? 47  PRO A CD   9  
ATOM   5904  H  HA   . PRO A 1 47 ? 15.840  -1.449  -19.171 1.00 0.00 ? 47  PRO A HA   9  
ATOM   5905  H  HB2  . PRO A 1 47 ? 15.412  0.434   -21.079 1.00 0.00 ? 47  PRO A HB2  9  
ATOM   5906  H  HB3  . PRO A 1 47 ? 14.895  -1.247  -21.256 1.00 0.00 ? 47  PRO A HB3  9  
ATOM   5907  H  HG2  . PRO A 1 47 ? 13.297  1.150   -20.443 1.00 0.00 ? 47  PRO A HG2  9  
ATOM   5908  H  HG3  . PRO A 1 47 ? 12.858  -0.165  -21.550 1.00 0.00 ? 47  PRO A HG3  9  
ATOM   5909  H  HD2  . PRO A 1 47 ? 11.986  -0.065  -18.989 1.00 0.00 ? 47  PRO A HD2  9  
ATOM   5910  H  HD3  . PRO A 1 47 ? 12.302  -1.596  -19.831 1.00 0.00 ? 47  PRO A HD3  9  
ATOM   5911  N  N    . SER A 1 48 ? 15.188  1.173   -17.578 1.00 0.00 ? 48  SER A N    9  
ATOM   5912  C  CA   . SER A 1 48 ? 15.715  2.355   -16.905 1.00 0.00 ? 48  SER A CA   9  
ATOM   5913  C  C    . SER A 1 48 ? 17.240  2.326   -16.873 1.00 0.00 ? 48  SER A C    9  
ATOM   5914  O  O    . SER A 1 48 ? 17.899  3.284   -17.278 1.00 0.00 ? 48  SER A O    9  
ATOM   5915  C  CB   . SER A 1 48 ? 15.165  2.444   -15.480 1.00 0.00 ? 48  SER A CB   9  
ATOM   5916  O  OG   . SER A 1 48 ? 13.753  2.321   -15.470 1.00 0.00 ? 48  SER A OG   9  
ATOM   5917  H  H    . SER A 1 48 ? 14.346  0.781   -17.266 1.00 0.00 ? 48  SER A H    9  
ATOM   5918  H  HA   . SER A 1 48 ? 15.395  3.223   -17.461 1.00 0.00 ? 48  SER A HA   9  
ATOM   5919  H  HB2  . SER A 1 48 ? 15.588  1.650   -14.883 1.00 0.00 ? 48  SER A HB2  9  
ATOM   5920  H  HB3  . SER A 1 48 ? 15.435  3.399   -15.053 1.00 0.00 ? 48  SER A HB3  9  
ATOM   5921  H  HG   . SER A 1 48 ? 13.358  3.147   -15.758 1.00 0.00 ? 48  SER A HG   9  
ATOM   5922  N  N    . SER A 1 49 ? 17.795  1.220   -16.387 1.00 0.00 ? 49  SER A N    9  
ATOM   5923  C  CA   . SER A 1 49 ? 19.243  1.067   -16.298 1.00 0.00 ? 49  SER A CA   9  
ATOM   5924  C  C    . SER A 1 49 ? 19.689  -0.249  -16.926 1.00 0.00 ? 49  SER A C    9  
ATOM   5925  O  O    . SER A 1 49 ? 19.090  -1.298  -16.691 1.00 0.00 ? 49  SER A O    9  
ATOM   5926  C  CB   . SER A 1 49 ? 19.694  1.127   -14.837 1.00 0.00 ? 49  SER A CB   9  
ATOM   5927  O  OG   . SER A 1 49 ? 21.102  1.256   -14.743 1.00 0.00 ? 49  SER A OG   9  
ATOM   5928  H  H    . SER A 1 49 ? 17.217  0.491   -16.080 1.00 0.00 ? 49  SER A H    9  
ATOM   5929  H  HA   . SER A 1 49 ? 19.696  1.883   -16.840 1.00 0.00 ? 49  SER A HA   9  
ATOM   5930  H  HB2  . SER A 1 49 ? 19.234  1.977   -14.356 1.00 0.00 ? 49  SER A HB2  9  
ATOM   5931  H  HB3  . SER A 1 49 ? 19.392  0.221   -14.332 1.00 0.00 ? 49  SER A HB3  9  
ATOM   5932  H  HG   . SER A 1 49 ? 21.521  0.593   -15.296 1.00 0.00 ? 49  SER A HG   9  
ATOM   5933  N  N    . GLY A 1 50 ? 20.748  -0.186  -17.728 1.00 0.00 ? 50  GLY A N    9  
ATOM   5934  C  CA   . GLY A 1 50 ? 21.259  -1.379  -18.378 1.00 0.00 ? 50  GLY A CA   9  
ATOM   5935  C  C    . GLY A 1 50 ? 20.479  -1.736  -19.628 1.00 0.00 ? 50  GLY A C    9  
ATOM   5936  O  O    . GLY A 1 50 ? 21.092  -1.996  -20.662 1.00 0.00 ? 50  GLY A O    9  
ATOM   5937  H  H    . GLY A 1 50 ? 21.187  0.678   -17.879 1.00 0.00 ? 50  GLY A H    9  
ATOM   5938  H  HA2  . GLY A 1 50 ? 22.292  -1.216  -18.645 1.00 0.00 ? 50  GLY A HA2  9  
ATOM   5939  H  HA3  . GLY A 1 50 ? 21.203  -2.205  -17.685 1.00 0.00 ? 50  GLY A HA3  9  
HETATM 5940  ZN ZN   . ZN  B 2 .  ? 0.607   -2.300  -7.293  1.00 0.00 ? 201 ZN  A ZN   9  
ATOM   5941  N  N    . GLY A 1 1  ? 31.164  32.456  -27.853 1.00 0.00 ? 1   GLY A N    10 
ATOM   5942  C  CA   . GLY A 1 1  ? 30.207  32.710  -26.792 1.00 0.00 ? 1   GLY A CA   10 
ATOM   5943  C  C    . GLY A 1 1  ? 30.610  33.880  -25.916 1.00 0.00 ? 1   GLY A C    10 
ATOM   5944  O  O    . GLY A 1 1  ? 31.313  34.786  -26.363 1.00 0.00 ? 1   GLY A O    10 
ATOM   5945  H  H1   . GLY A 1 1  ? 31.542  33.206  -28.359 1.00 0.00 ? 1   GLY A H1   10 
ATOM   5946  H  HA2  . GLY A 1 1  ? 29.244  32.918  -27.232 1.00 0.00 ? 1   GLY A HA2  10 
ATOM   5947  H  HA3  . GLY A 1 1  ? 30.127  31.826  -26.176 1.00 0.00 ? 1   GLY A HA3  10 
ATOM   5948  N  N    . SER A 1 2  ? 30.161  33.862  -24.665 1.00 0.00 ? 2   SER A N    10 
ATOM   5949  C  CA   . SER A 1 2  ? 30.474  34.933  -23.726 1.00 0.00 ? 2   SER A CA   10 
ATOM   5950  C  C    . SER A 1 2  ? 31.852  34.725  -23.104 1.00 0.00 ? 2   SER A C    10 
ATOM   5951  O  O    . SER A 1 2  ? 32.381  33.614  -23.098 1.00 0.00 ? 2   SER A O    10 
ATOM   5952  C  CB   . SER A 1 2  ? 29.412  35.003  -22.627 1.00 0.00 ? 2   SER A CB   10 
ATOM   5953  O  OG   . SER A 1 2  ? 28.120  35.194  -23.178 1.00 0.00 ? 2   SER A OG   10 
ATOM   5954  H  H    . SER A 1 2  ? 29.605  33.112  -24.367 1.00 0.00 ? 2   SER A H    10 
ATOM   5955  H  HA   . SER A 1 2  ? 30.476  35.864  -24.273 1.00 0.00 ? 2   SER A HA   10 
ATOM   5956  H  HB2  . SER A 1 2  ? 29.417  34.082  -22.065 1.00 0.00 ? 2   SER A HB2  10 
ATOM   5957  H  HB3  . SER A 1 2  ? 29.635  35.829  -21.967 1.00 0.00 ? 2   SER A HB3  10 
ATOM   5958  H  HG   . SER A 1 2  ? 28.091  36.035  -23.641 1.00 0.00 ? 2   SER A HG   10 
ATOM   5959  N  N    . SER A 1 3  ? 32.427  35.803  -22.581 1.00 0.00 ? 3   SER A N    10 
ATOM   5960  C  CA   . SER A 1 3  ? 33.745  35.741  -21.960 1.00 0.00 ? 3   SER A CA   10 
ATOM   5961  C  C    . SER A 1 3  ? 33.626  35.563  -20.449 1.00 0.00 ? 3   SER A C    10 
ATOM   5962  O  O    . SER A 1 3  ? 33.464  36.533  -19.710 1.00 0.00 ? 3   SER A O    10 
ATOM   5963  C  CB   . SER A 1 3  ? 34.541  37.010  -22.274 1.00 0.00 ? 3   SER A CB   10 
ATOM   5964  O  OG   . SER A 1 3  ? 34.939  37.038  -23.634 1.00 0.00 ? 3   SER A OG   10 
ATOM   5965  H  H    . SER A 1 3  ? 31.955  36.661  -22.617 1.00 0.00 ? 3   SER A H    10 
ATOM   5966  H  HA   . SER A 1 3  ? 34.266  34.889  -22.371 1.00 0.00 ? 3   SER A HA   10 
ATOM   5967  H  HB2  . SER A 1 3  ? 33.928  37.875  -22.073 1.00 0.00 ? 3   SER A HB2  10 
ATOM   5968  H  HB3  . SER A 1 3  ? 35.423  37.041  -21.652 1.00 0.00 ? 3   SER A HB3  10 
ATOM   5969  H  HG   . SER A 1 3  ? 34.980  37.948  -23.936 1.00 0.00 ? 3   SER A HG   10 
ATOM   5970  N  N    . GLY A 1 4  ? 33.706  34.315  -19.999 1.00 0.00 ? 4   GLY A N    10 
ATOM   5971  C  CA   . GLY A 1 4  ? 33.605  34.031  -18.579 1.00 0.00 ? 4   GLY A CA   10 
ATOM   5972  C  C    . GLY A 1 4  ? 32.391  33.189  -18.241 1.00 0.00 ? 4   GLY A C    10 
ATOM   5973  O  O    . GLY A 1 4  ? 31.395  33.701  -17.730 1.00 0.00 ? 4   GLY A O    10 
ATOM   5974  H  H    . GLY A 1 4  ? 33.836  33.581  -20.635 1.00 0.00 ? 4   GLY A H    10 
ATOM   5975  H  HA2  . GLY A 1 4  ? 34.494  33.505  -18.264 1.00 0.00 ? 4   GLY A HA2  10 
ATOM   5976  H  HA3  . GLY A 1 4  ? 33.542  34.965  -18.040 1.00 0.00 ? 4   GLY A HA3  10 
ATOM   5977  N  N    . SER A 1 5  ? 32.472  31.894  -18.528 1.00 0.00 ? 5   SER A N    10 
ATOM   5978  C  CA   . SER A 1 5  ? 31.369  30.980  -18.257 1.00 0.00 ? 5   SER A CA   10 
ATOM   5979  C  C    . SER A 1 5  ? 31.760  29.957  -17.194 1.00 0.00 ? 5   SER A C    10 
ATOM   5980  O  O    . SER A 1 5  ? 31.444  28.773  -17.310 1.00 0.00 ? 5   SER A O    10 
ATOM   5981  C  CB   . SER A 1 5  ? 30.946  30.262  -19.540 1.00 0.00 ? 5   SER A CB   10 
ATOM   5982  O  OG   . SER A 1 5  ? 31.888  29.268  -19.903 1.00 0.00 ? 5   SER A OG   10 
ATOM   5983  H  H    . SER A 1 5  ? 33.294  31.545  -18.935 1.00 0.00 ? 5   SER A H    10 
ATOM   5984  H  HA   . SER A 1 5  ? 30.538  31.563  -17.889 1.00 0.00 ? 5   SER A HA   10 
ATOM   5985  H  HB2  . SER A 1 5  ? 29.986  29.792  -19.387 1.00 0.00 ? 5   SER A HB2  10 
ATOM   5986  H  HB3  . SER A 1 5  ? 30.870  30.981  -20.343 1.00 0.00 ? 5   SER A HB3  10 
ATOM   5987  H  HG   . SER A 1 5  ? 32.510  29.633  -20.537 1.00 0.00 ? 5   SER A HG   10 
ATOM   5988  N  N    . SER A 1 6  ? 32.450  30.424  -16.158 1.00 0.00 ? 6   SER A N    10 
ATOM   5989  C  CA   . SER A 1 6  ? 32.888  29.550  -15.076 1.00 0.00 ? 6   SER A CA   10 
ATOM   5990  C  C    . SER A 1 6  ? 31.785  29.378  -14.036 1.00 0.00 ? 6   SER A C    10 
ATOM   5991  O  O    . SER A 1 6  ? 31.277  30.355  -13.487 1.00 0.00 ? 6   SER A O    10 
ATOM   5992  C  CB   . SER A 1 6  ? 34.146  30.115  -14.413 1.00 0.00 ? 6   SER A CB   10 
ATOM   5993  O  OG   . SER A 1 6  ? 33.958  31.467  -14.033 1.00 0.00 ? 6   SER A OG   10 
ATOM   5994  H  H    . SER A 1 6  ? 32.671  31.378  -16.123 1.00 0.00 ? 6   SER A H    10 
ATOM   5995  H  HA   . SER A 1 6  ? 33.119  28.585  -15.502 1.00 0.00 ? 6   SER A HA   10 
ATOM   5996  H  HB2  . SER A 1 6  ? 34.378  29.535  -13.533 1.00 0.00 ? 6   SER A HB2  10 
ATOM   5997  H  HB3  . SER A 1 6  ? 34.971  30.061  -15.109 1.00 0.00 ? 6   SER A HB3  10 
ATOM   5998  H  HG   . SER A 1 6  ? 33.034  31.615  -13.820 1.00 0.00 ? 6   SER A HG   10 
ATOM   5999  N  N    . GLY A 1 7  ? 31.420  28.128  -13.770 1.00 0.00 ? 7   GLY A N    10 
ATOM   6000  C  CA   . GLY A 1 7  ? 30.380  27.849  -12.797 1.00 0.00 ? 7   GLY A CA   10 
ATOM   6001  C  C    . GLY A 1 7  ? 29.579  26.610  -13.144 1.00 0.00 ? 7   GLY A C    10 
ATOM   6002  O  O    . GLY A 1 7  ? 28.800  26.612  -14.097 1.00 0.00 ? 7   GLY A O    10 
ATOM   6003  H  H    . GLY A 1 7  ? 31.861  27.388  -14.239 1.00 0.00 ? 7   GLY A H    10 
ATOM   6004  H  HA2  . GLY A 1 7  ? 30.836  27.712  -11.828 1.00 0.00 ? 7   GLY A HA2  10 
ATOM   6005  H  HA3  . GLY A 1 7  ? 29.710  28.695  -12.752 1.00 0.00 ? 7   GLY A HA3  10 
ATOM   6006  N  N    . CYS A 1 8  ? 29.771  25.548  -12.369 1.00 0.00 ? 8   CYS A N    10 
ATOM   6007  C  CA   . CYS A 1 8  ? 29.062  24.294  -12.600 1.00 0.00 ? 8   CYS A CA   10 
ATOM   6008  C  C    . CYS A 1 8  ? 27.580  24.440  -12.272 1.00 0.00 ? 8   CYS A C    10 
ATOM   6009  O  O    . CYS A 1 8  ? 27.215  24.992  -11.233 1.00 0.00 ? 8   CYS A O    10 
ATOM   6010  C  CB   . CYS A 1 8  ? 29.676  23.174  -11.759 1.00 0.00 ? 8   CYS A CB   10 
ATOM   6011  S  SG   . CYS A 1 8  ? 31.366  22.738  -12.231 1.00 0.00 ? 8   CYS A SG   10 
ATOM   6012  H  H    . CYS A 1 8  ? 30.405  25.607  -11.624 1.00 0.00 ? 8   CYS A H    10 
ATOM   6013  H  HA   . CYS A 1 8  ? 29.164  24.045  -13.645 1.00 0.00 ? 8   CYS A HA   10 
ATOM   6014  H  HB2  . CYS A 1 8  ? 29.694  23.481  -10.723 1.00 0.00 ? 8   CYS A HB2  10 
ATOM   6015  H  HB3  . CYS A 1 8  ? 29.067  22.288  -11.854 1.00 0.00 ? 8   CYS A HB3  10 
ATOM   6016  H  HG   . CYS A 1 8  ? 32.181  23.181  -11.286 1.00 0.00 ? 8   CYS A HG   10 
ATOM   6017  N  N    . CYS A 1 9  ? 26.731  23.942  -13.164 1.00 0.00 ? 9   CYS A N    10 
ATOM   6018  C  CA   . CYS A 1 9  ? 25.287  24.018  -12.970 1.00 0.00 ? 9   CYS A CA   10 
ATOM   6019  C  C    . CYS A 1 9  ? 24.604  22.746  -13.462 1.00 0.00 ? 9   CYS A C    10 
ATOM   6020  O  O    . CYS A 1 9  ? 25.180  21.978  -14.234 1.00 0.00 ? 9   CYS A O    10 
ATOM   6021  C  CB   . CYS A 1 9  ? 24.717  25.233  -13.703 1.00 0.00 ? 9   CYS A CB   10 
ATOM   6022  S  SG   . CYS A 1 9  ? 25.255  26.822  -13.027 1.00 0.00 ? 9   CYS A SG   10 
ATOM   6023  H  H    . CYS A 1 9  ? 27.082  23.513  -13.972 1.00 0.00 ? 9   CYS A H    10 
ATOM   6024  H  HA   . CYS A 1 9  ? 25.100  24.126  -11.912 1.00 0.00 ? 9   CYS A HA   10 
ATOM   6025  H  HB2  . CYS A 1 9  ? 25.023  25.197  -14.738 1.00 0.00 ? 9   CYS A HB2  10 
ATOM   6026  H  HB3  . CYS A 1 9  ? 23.638  25.201  -13.652 1.00 0.00 ? 9   CYS A HB3  10 
ATOM   6027  H  HG   . CYS A 1 9  ? 25.988  27.430  -13.948 1.00 0.00 ? 9   CYS A HG   10 
ATOM   6028  N  N    . LEU A 1 10 ? 23.375  22.528  -13.009 1.00 0.00 ? 10  LEU A N    10 
ATOM   6029  C  CA   . LEU A 1 10 ? 22.613  21.347  -13.402 1.00 0.00 ? 10  LEU A CA   10 
ATOM   6030  C  C    . LEU A 1 10 ? 21.140  21.690  -13.599 1.00 0.00 ? 10  LEU A C    10 
ATOM   6031  O  O    . LEU A 1 10 ? 20.614  22.639  -13.016 1.00 0.00 ? 10  LEU A O    10 
ATOM   6032  C  CB   . LEU A 1 10 ? 22.755  20.250  -12.345 1.00 0.00 ? 10  LEU A CB   10 
ATOM   6033  C  CG   . LEU A 1 10 ? 22.678  20.707  -10.888 1.00 0.00 ? 10  LEU A CG   10 
ATOM   6034  C  CD1  . LEU A 1 10 ? 23.962  21.412  -10.481 1.00 0.00 ? 10  LEU A CD1  10 
ATOM   6035  C  CD2  . LEU A 1 10 ? 21.477  21.617  -10.678 1.00 0.00 ? 10  LEU A CD2  10 
ATOM   6036  H  H    . LEU A 1 10 ? 22.968  23.175  -12.396 1.00 0.00 ? 10  LEU A H    10 
ATOM   6037  H  HA   . LEU A 1 10 ? 23.016  20.989  -14.337 1.00 0.00 ? 10  LEU A HA   10 
ATOM   6038  H  HB2  . LEU A 1 10 ? 21.968  19.530  -12.508 1.00 0.00 ? 10  LEU A HB2  10 
ATOM   6039  H  HB3  . LEU A 1 10 ? 23.714  19.772  -12.493 1.00 0.00 ? 10  LEU A HB3  10 
ATOM   6040  H  HG   . LEU A 1 10 ? 22.558  19.840  -10.252 1.00 0.00 ? 10  LEU A HG   10 
ATOM   6041  H  HD11 . LEU A 1 10 ? 24.485  20.815  -9.750  1.00 0.00 ? 10  LEU A HD11 10 
ATOM   6042  H  HD12 . LEU A 1 10 ? 23.724  22.376  -10.055 1.00 0.00 ? 10  LEU A HD12 10 
ATOM   6043  H  HD13 . LEU A 1 10 ? 24.589  21.549  -11.350 1.00 0.00 ? 10  LEU A HD13 10 
ATOM   6044  H  HD21 . LEU A 1 10 ? 21.714  22.611  -11.025 1.00 0.00 ? 10  LEU A HD21 10 
ATOM   6045  H  HD22 . LEU A 1 10 ? 21.232  21.652  -9.626  1.00 0.00 ? 10  LEU A HD22 10 
ATOM   6046  H  HD23 . LEU A 1 10 ? 20.633  21.234  -11.232 1.00 0.00 ? 10  LEU A HD23 10 
ATOM   6047  N  N    . PRO A 1 11 ? 20.456  20.900  -14.440 1.00 0.00 ? 11  PRO A N    10 
ATOM   6048  C  CA   . PRO A 1 11 ? 19.033  21.099  -14.732 1.00 0.00 ? 11  PRO A CA   10 
ATOM   6049  C  C    . PRO A 1 11 ? 18.144  20.765  -13.539 1.00 0.00 ? 11  PRO A C    10 
ATOM   6050  O  O    . PRO A 1 11 ? 18.500  19.964  -12.674 1.00 0.00 ? 11  PRO A O    10 
ATOM   6051  C  CB   . PRO A 1 11 ? 18.768  20.127  -15.885 1.00 0.00 ? 11  PRO A CB   10 
ATOM   6052  C  CG   . PRO A 1 11 ? 19.803  19.067  -15.731 1.00 0.00 ? 11  PRO A CG   10 
ATOM   6053  C  CD   . PRO A 1 11 ? 21.018  19.752  -15.170 1.00 0.00 ? 11  PRO A CD   10 
ATOM   6054  H  HA   . PRO A 1 11 ? 18.832  22.109  -15.057 1.00 0.00 ? 11  PRO A HA   10 
ATOM   6055  H  HB2  . PRO A 1 11 ? 17.770  19.723  -15.795 1.00 0.00 ? 11  PRO A HB2  10 
ATOM   6056  H  HB3  . PRO A 1 11 ? 18.870  20.644  -16.827 1.00 0.00 ? 11  PRO A HB3  10 
ATOM   6057  H  HG2  . PRO A 1 11 ? 19.452  18.307  -15.049 1.00 0.00 ? 11  PRO A HG2  10 
ATOM   6058  H  HG3  . PRO A 1 11 ? 20.029  18.633  -16.694 1.00 0.00 ? 11  PRO A HG3  10 
ATOM   6059  H  HD2  . PRO A 1 11 ? 21.548  19.091  -14.500 1.00 0.00 ? 11  PRO A HD2  10 
ATOM   6060  H  HD3  . PRO A 1 11 ? 21.667  20.083  -15.967 1.00 0.00 ? 11  PRO A HD3  10 
ATOM   6061  N  N    . PRO A 1 12 ? 16.960  21.392  -13.488 1.00 0.00 ? 12  PRO A N    10 
ATOM   6062  C  CA   . PRO A 1 12 ? 15.995  21.176  -12.406 1.00 0.00 ? 12  PRO A CA   10 
ATOM   6063  C  C    . PRO A 1 12 ? 15.368  19.787  -12.457 1.00 0.00 ? 12  PRO A C    10 
ATOM   6064  O  O    . PRO A 1 12 ? 15.312  19.084  -11.449 1.00 0.00 ? 12  PRO A O    10 
ATOM   6065  C  CB   . PRO A 1 12 ? 14.935  22.252  -12.656 1.00 0.00 ? 12  PRO A CB   10 
ATOM   6066  C  CG   . PRO A 1 12 ? 15.024  22.540  -14.115 1.00 0.00 ? 12  PRO A CG   10 
ATOM   6067  C  CD   . PRO A 1 12 ? 16.471  22.360  -14.484 1.00 0.00 ? 12  PRO A CD   10 
ATOM   6068  H  HA   . PRO A 1 12 ? 16.446  21.331  -11.436 1.00 0.00 ? 12  PRO A HA   10 
ATOM   6069  H  HB2  . PRO A 1 12 ? 13.960  21.869  -12.387 1.00 0.00 ? 12  PRO A HB2  10 
ATOM   6070  H  HB3  . PRO A 1 12 ? 15.159  23.128  -12.066 1.00 0.00 ? 12  PRO A HB3  10 
ATOM   6071  H  HG2  . PRO A 1 12 ? 14.408  21.845  -14.665 1.00 0.00 ? 12  PRO A HG2  10 
ATOM   6072  H  HG3  . PRO A 1 12 ? 14.712  23.555  -14.308 1.00 0.00 ? 12  PRO A HG3  10 
ATOM   6073  H  HD2  . PRO A 1 12 ? 16.558  21.962  -15.484 1.00 0.00 ? 12  PRO A HD2  10 
ATOM   6074  H  HD3  . PRO A 1 12 ? 17.000  23.298  -14.402 1.00 0.00 ? 12  PRO A HD3  10 
ATOM   6075  N  N    . ALA A 1 13 ? 14.898  19.399  -13.638 1.00 0.00 ? 13  ALA A N    10 
ATOM   6076  C  CA   . ALA A 1 13 ? 14.277  18.092  -13.820 1.00 0.00 ? 13  ALA A CA   10 
ATOM   6077  C  C    . ALA A 1 13 ? 15.278  17.081  -14.369 1.00 0.00 ? 13  ALA A C    10 
ATOM   6078  O  O    . ALA A 1 13 ? 15.333  16.838  -15.575 1.00 0.00 ? 13  ALA A O    10 
ATOM   6079  C  CB   . ALA A 1 13 ? 13.075  18.204  -14.746 1.00 0.00 ? 13  ALA A CB   10 
ATOM   6080  H  H    . ALA A 1 13 ? 14.972  20.004  -14.404 1.00 0.00 ? 13  ALA A H    10 
ATOM   6081  H  HA   . ALA A 1 13 ? 13.928  17.751  -12.856 1.00 0.00 ? 13  ALA A HA   10 
ATOM   6082  H  HB1  . ALA A 1 13 ? 13.412  18.431  -15.747 1.00 0.00 ? 13  ALA A HB1  10 
ATOM   6083  H  HB2  . ALA A 1 13 ? 12.536  17.269  -14.750 1.00 0.00 ? 13  ALA A HB2  10 
ATOM   6084  H  HB3  . ALA A 1 13 ? 12.425  18.993  -14.397 1.00 0.00 ? 13  ALA A HB3  10 
ATOM   6085  N  N    . THR A 1 14 ? 16.068  16.493  -13.476 1.00 0.00 ? 14  THR A N    10 
ATOM   6086  C  CA   . THR A 1 14 ? 17.068  15.509  -13.872 1.00 0.00 ? 14  THR A CA   10 
ATOM   6087  C  C    . THR A 1 14 ? 16.411  14.227  -14.369 1.00 0.00 ? 14  THR A C    10 
ATOM   6088  O  O    . THR A 1 14 ? 15.447  13.741  -13.776 1.00 0.00 ? 14  THR A O    10 
ATOM   6089  C  CB   . THR A 1 14 ? 18.014  15.169  -12.704 1.00 0.00 ? 14  THR A CB   10 
ATOM   6090  O  OG1  . THR A 1 14 ? 18.581  16.369  -12.167 1.00 0.00 ? 14  THR A OG1  10 
ATOM   6091  C  CG2  . THR A 1 14 ? 19.126  14.237  -13.163 1.00 0.00 ? 14  THR A CG2  10 
ATOM   6092  H  H    . THR A 1 14 ? 15.976  16.728  -12.530 1.00 0.00 ? 14  THR A H    10 
ATOM   6093  H  HA   . THR A 1 14 ? 17.656  15.934  -14.672 1.00 0.00 ? 14  THR A HA   10 
ATOM   6094  H  HB   . THR A 1 14 ? 17.443  14.672  -11.932 1.00 0.00 ? 14  THR A HB   10 
ATOM   6095  H  HG1  . THR A 1 14 ? 19.415  16.165  -11.738 1.00 0.00 ? 14  THR A HG1  10 
ATOM   6096  H  HG21 . THR A 1 14 ? 18.776  13.639  -13.991 1.00 0.00 ? 14  THR A HG21 10 
ATOM   6097  H  HG22 . THR A 1 14 ? 19.413  13.591  -12.347 1.00 0.00 ? 14  THR A HG22 10 
ATOM   6098  H  HG23 . THR A 1 14 ? 19.977  14.822  -13.476 1.00 0.00 ? 14  THR A HG23 10 
ATOM   6099  N  N    . HIS A 1 15 ? 16.938  13.682  -15.461 1.00 0.00 ? 15  HIS A N    10 
ATOM   6100  C  CA   . HIS A 1 15 ? 16.403  12.453  -16.037 1.00 0.00 ? 15  HIS A CA   10 
ATOM   6101  C  C    . HIS A 1 15 ? 16.689  11.259  -15.132 1.00 0.00 ? 15  HIS A C    10 
ATOM   6102  O  O    . HIS A 1 15 ? 17.844  10.882  -14.933 1.00 0.00 ? 15  HIS A O    10 
ATOM   6103  C  CB   . HIS A 1 15 ? 17.001  12.213  -17.424 1.00 0.00 ? 15  HIS A CB   10 
ATOM   6104  C  CG   . HIS A 1 15 ? 16.346  13.015  -18.506 1.00 0.00 ? 15  HIS A CG   10 
ATOM   6105  N  ND1  . HIS A 1 15 ? 16.246  14.390  -18.467 1.00 0.00 ? 15  HIS A ND1  10 
ATOM   6106  C  CD2  . HIS A 1 15 ? 15.758  12.629  -19.662 1.00 0.00 ? 15  HIS A CD2  10 
ATOM   6107  C  CE1  . HIS A 1 15 ? 15.623  14.814  -19.552 1.00 0.00 ? 15  HIS A CE1  10 
ATOM   6108  N  NE2  . HIS A 1 15 ? 15.317  13.765  -20.294 1.00 0.00 ? 15  HIS A NE2  10 
ATOM   6109  H  H    . HIS A 1 15 ? 17.705  14.116  -15.889 1.00 0.00 ? 15  HIS A H    10 
ATOM   6110  H  HA   . HIS A 1 15 ? 15.334  12.570  -16.131 1.00 0.00 ? 15  HIS A HA   10 
ATOM   6111  H  HB2  . HIS A 1 15 ? 18.049  12.473  -17.406 1.00 0.00 ? 15  HIS A HB2  10 
ATOM   6112  H  HB3  . HIS A 1 15 ? 16.898  11.167  -17.676 1.00 0.00 ? 15  HIS A HB3  10 
ATOM   6113  H  HD1  . HIS A 1 15 ? 16.580  14.968  -17.750 1.00 0.00 ? 15  HIS A HD1  10 
ATOM   6114  H  HD2  . HIS A 1 15 ? 15.655  11.615  -20.022 1.00 0.00 ? 15  HIS A HD2  10 
ATOM   6115  H  HE1  . HIS A 1 15 ? 15.402  15.844  -19.793 1.00 0.00 ? 15  HIS A HE1  10 
ATOM   6116  N  N    . ARG A 1 16 ? 15.631  10.669  -14.586 1.00 0.00 ? 16  ARG A N    10 
ATOM   6117  C  CA   . ARG A 1 16 ? 15.769  9.519   -13.701 1.00 0.00 ? 16  ARG A CA   10 
ATOM   6118  C  C    . ARG A 1 16 ? 15.569  8.215   -14.469 1.00 0.00 ? 16  ARG A C    10 
ATOM   6119  O  O    . ARG A 1 16 ? 14.741  8.120   -15.375 1.00 0.00 ? 16  ARG A O    10 
ATOM   6120  C  CB   . ARG A 1 16 ? 14.761  9.607   -12.554 1.00 0.00 ? 16  ARG A CB   10 
ATOM   6121  C  CG   . ARG A 1 16 ? 13.396  9.032   -12.896 1.00 0.00 ? 16  ARG A CG   10 
ATOM   6122  C  CD   . ARG A 1 16 ? 12.657  9.908   -13.895 1.00 0.00 ? 16  ARG A CD   10 
ATOM   6123  N  NE   . ARG A 1 16 ? 12.534  11.286  -13.429 1.00 0.00 ? 16  ARG A NE   10 
ATOM   6124  C  CZ   . ARG A 1 16 ? 11.859  12.226  -14.083 1.00 0.00 ? 16  ARG A CZ   10 
ATOM   6125  N  NH1  . ARG A 1 16 ? 11.250  11.936  -15.224 1.00 0.00 ? 16  ARG A NH1  10 
ATOM   6126  N  NH2  . ARG A 1 16 ? 11.793  13.458  -13.594 1.00 0.00 ? 16  ARG A NH2  10 
ATOM   6127  H  H    . ARG A 1 16 ? 14.735  11.016  -14.783 1.00 0.00 ? 16  ARG A H    10 
ATOM   6128  H  HA   . ARG A 1 16 ? 16.768  9.533   -13.293 1.00 0.00 ? 16  ARG A HA   10 
ATOM   6129  H  HB2  . ARG A 1 16 ? 15.152  9.068   -11.704 1.00 0.00 ? 16  ARG A HB2  10 
ATOM   6130  H  HB3  . ARG A 1 16 ? 14.632  10.645  -12.283 1.00 0.00 ? 16  ARG A HB3  10 
ATOM   6131  H  HG2  . ARG A 1 16 ? 13.527  8.049   -13.324 1.00 0.00 ? 16  ARG A HG2  10 
ATOM   6132  H  HG3  . ARG A 1 16 ? 12.810  8.958   -11.992 1.00 0.00 ? 16  ARG A HG3  10 
ATOM   6133  H  HD2  . ARG A 1 16 ? 13.198  9.901   -14.830 1.00 0.00 ? 16  ARG A HD2  10 
ATOM   6134  H  HD3  . ARG A 1 16 ? 11.669  9.500   -14.049 1.00 0.00 ? 16  ARG A HD3  10 
ATOM   6135  H  HE   . ARG A 1 16 ? 12.976  11.522  -12.588 1.00 0.00 ? 16  ARG A HE   10 
ATOM   6136  H  HH11 . ARG A 1 16 ? 11.298  11.008  -15.594 1.00 0.00 ? 16  ARG A HH11 10 
ATOM   6137  H  HH12 . ARG A 1 16 ? 10.742  12.645  -15.714 1.00 0.00 ? 16  ARG A HH12 10 
ATOM   6138  H  HH21 . ARG A 1 16 ? 12.251  13.680  -12.734 1.00 0.00 ? 16  ARG A HH21 10 
ATOM   6139  H  HH22 . ARG A 1 16 ? 11.285  14.164  -14.087 1.00 0.00 ? 16  ARG A HH22 10 
ATOM   6140  N  N    . PRO A 1 17 ? 16.345  7.186   -14.098 1.00 0.00 ? 17  PRO A N    10 
ATOM   6141  C  CA   . PRO A 1 17 ? 16.272  5.869   -14.739 1.00 0.00 ? 17  PRO A CA   10 
ATOM   6142  C  C    . PRO A 1 17 ? 14.975  5.136   -14.412 1.00 0.00 ? 17  PRO A C    10 
ATOM   6143  O  O    . PRO A 1 17 ? 14.277  4.658   -15.307 1.00 0.00 ? 17  PRO A O    10 
ATOM   6144  C  CB   . PRO A 1 17 ? 17.471  5.121   -14.151 1.00 0.00 ? 17  PRO A CB   10 
ATOM   6145  C  CG   . PRO A 1 17 ? 17.723  5.782   -12.840 1.00 0.00 ? 17  PRO A CG   10 
ATOM   6146  C  CD   . PRO A 1 17 ? 17.353  7.227   -13.026 1.00 0.00 ? 17  PRO A CD   10 
ATOM   6147  H  HA   . PRO A 1 17 ? 16.381  5.943   -15.811 1.00 0.00 ? 17  PRO A HA   10 
ATOM   6148  H  HB2  . PRO A 1 17 ? 17.222  4.077   -14.027 1.00 0.00 ? 17  PRO A HB2  10 
ATOM   6149  H  HB3  . PRO A 1 17 ? 18.319  5.219   -14.811 1.00 0.00 ? 17  PRO A HB3  10 
ATOM   6150  H  HG2  . PRO A 1 17 ? 17.106  5.332   -12.077 1.00 0.00 ? 17  PRO A HG2  10 
ATOM   6151  H  HG3  . PRO A 1 17 ? 18.768  5.694   -12.580 1.00 0.00 ? 17  PRO A HG3  10 
ATOM   6152  H  HD2  . PRO A 1 17 ? 16.932  7.629   -12.116 1.00 0.00 ? 17  PRO A HD2  10 
ATOM   6153  H  HD3  . PRO A 1 17 ? 18.215  7.802   -13.331 1.00 0.00 ? 17  PRO A HD3  10 
ATOM   6154  N  N    . HIS A 1 18 ? 14.657  5.052   -13.124 1.00 0.00 ? 18  HIS A N    10 
ATOM   6155  C  CA   . HIS A 1 18 ? 13.442  4.378   -12.679 1.00 0.00 ? 18  HIS A CA   10 
ATOM   6156  C  C    . HIS A 1 18 ? 12.285  5.365   -12.561 1.00 0.00 ? 18  HIS A C    10 
ATOM   6157  O  O    . HIS A 1 18 ? 12.459  6.518   -12.165 1.00 0.00 ? 18  HIS A O    10 
ATOM   6158  C  CB   . HIS A 1 18 ? 13.679  3.690   -11.334 1.00 0.00 ? 18  HIS A CB   10 
ATOM   6159  C  CG   . HIS A 1 18 ? 13.745  4.640   -10.178 1.00 0.00 ? 18  HIS A CG   10 
ATOM   6160  N  ND1  . HIS A 1 18 ? 14.712  5.615   -10.060 1.00 0.00 ? 18  HIS A ND1  10 
ATOM   6161  C  CD2  . HIS A 1 18 ? 12.955  4.761   -9.086  1.00 0.00 ? 18  HIS A CD2  10 
ATOM   6162  C  CE1  . HIS A 1 18 ? 14.515  6.295   -8.944  1.00 0.00 ? 18  HIS A CE1  10 
ATOM   6163  N  NE2  . HIS A 1 18 ? 13.454  5.796   -8.335  1.00 0.00 ? 18  HIS A NE2  10 
ATOM   6164  H  H    . HIS A 1 18 ? 15.253  5.453   -12.457 1.00 0.00 ? 18  HIS A H    10 
ATOM   6165  H  HA   . HIS A 1 18 ? 13.189  3.631   -13.415 1.00 0.00 ? 18  HIS A HA   10 
ATOM   6166  H  HB2  . HIS A 1 18 ? 12.874  2.995   -11.146 1.00 0.00 ? 18  HIS A HB2  10 
ATOM   6167  H  HB3  . HIS A 1 18 ? 14.614  3.149   -11.373 1.00 0.00 ? 18  HIS A HB3  10 
ATOM   6168  H  HD1  . HIS A 1 18 ? 15.436  5.784   -10.698 1.00 0.00 ? 18  HIS A HD1  10 
ATOM   6169  H  HD2  . HIS A 1 18 ? 12.091  4.156   -8.848  1.00 0.00 ? 18  HIS A HD2  10 
ATOM   6170  H  HE1  . HIS A 1 18 ? 15.118  7.117   -8.590  1.00 0.00 ? 18  HIS A HE1  10 
ATOM   6171  N  N    . PRO A 1 19 ? 11.076  4.905   -12.914 1.00 0.00 ? 19  PRO A N    10 
ATOM   6172  C  CA   . PRO A 1 19 ? 9.867   5.732   -12.857 1.00 0.00 ? 19  PRO A CA   10 
ATOM   6173  C  C    . PRO A 1 19 ? 9.441   6.038   -11.425 1.00 0.00 ? 19  PRO A C    10 
ATOM   6174  O  O    . PRO A 1 19 ? 10.208  5.841   -10.482 1.00 0.00 ? 19  PRO A O    10 
ATOM   6175  C  CB   . PRO A 1 19 ? 8.813   4.868   -13.555 1.00 0.00 ? 19  PRO A CB   10 
ATOM   6176  C  CG   . PRO A 1 19 ? 9.294   3.469   -13.380 1.00 0.00 ? 19  PRO A CG   10 
ATOM   6177  C  CD   . PRO A 1 19 ? 10.795  3.542   -13.395 1.00 0.00 ? 19  PRO A CD   10 
ATOM   6178  H  HA   . PRO A 1 19 ? 9.993   6.657   -13.399 1.00 0.00 ? 19  PRO A HA   10 
ATOM   6179  H  HB2  . PRO A 1 19 ? 7.851   5.019   -13.084 1.00 0.00 ? 19  PRO A HB2  10 
ATOM   6180  H  HB3  . PRO A 1 19 ? 8.755   5.138   -14.599 1.00 0.00 ? 19  PRO A HB3  10 
ATOM   6181  H  HG2  . PRO A 1 19 ? 8.947   3.077   -12.436 1.00 0.00 ? 19  PRO A HG2  10 
ATOM   6182  H  HG3  . PRO A 1 19 ? 8.940   2.855   -14.195 1.00 0.00 ? 19  PRO A HG3  10 
ATOM   6183  H  HD2  . PRO A 1 19 ? 11.216  2.804   -12.729 1.00 0.00 ? 19  PRO A HD2  10 
ATOM   6184  H  HD3  . PRO A 1 19 ? 11.170  3.404   -14.399 1.00 0.00 ? 19  PRO A HD3  10 
ATOM   6185  N  N    . THR A 1 20 ? 8.212   6.521   -11.268 1.00 0.00 ? 20  THR A N    10 
ATOM   6186  C  CA   . THR A 1 20 ? 7.684   6.855   -9.951  1.00 0.00 ? 20  THR A CA   10 
ATOM   6187  C  C    . THR A 1 20 ? 7.751   5.656   -9.012  1.00 0.00 ? 20  THR A C    10 
ATOM   6188  O  O    . THR A 1 20 ? 8.102   4.550   -9.425  1.00 0.00 ? 20  THR A O    10 
ATOM   6189  C  CB   . THR A 1 20 ? 6.226   7.344   -10.038 1.00 0.00 ? 20  THR A CB   10 
ATOM   6190  O  OG1  . THR A 1 20 ? 5.806   7.858   -8.769  1.00 0.00 ? 20  THR A OG1  10 
ATOM   6191  C  CG2  . THR A 1 20 ? 5.301   6.215   -10.465 1.00 0.00 ? 20  THR A CG2  10 
ATOM   6192  H  H    . THR A 1 20 ? 7.648   6.655   -12.058 1.00 0.00 ? 20  THR A H    10 
ATOM   6193  H  HA   . THR A 1 20 ? 8.287   7.653   -9.543  1.00 0.00 ? 20  THR A HA   10 
ATOM   6194  H  HB   . THR A 1 20 ? 6.171   8.133   -10.774 1.00 0.00 ? 20  THR A HB   10 
ATOM   6195  H  HG1  . THR A 1 20 ? 6.300   8.657   -8.568  1.00 0.00 ? 20  THR A HG1  10 
ATOM   6196  H  HG21 . THR A 1 20 ? 5.204   6.217   -11.540 1.00 0.00 ? 20  THR A HG21 10 
ATOM   6197  H  HG22 . THR A 1 20 ? 4.329   6.356   -10.015 1.00 0.00 ? 20  THR A HG22 10 
ATOM   6198  H  HG23 . THR A 1 20 ? 5.713   5.271   -10.142 1.00 0.00 ? 20  THR A HG23 10 
ATOM   6199  N  N    . SER A 1 21 ? 7.411   5.881   -7.747  1.00 0.00 ? 21  SER A N    10 
ATOM   6200  C  CA   . SER A 1 21 ? 7.436   4.819   -6.748  1.00 0.00 ? 21  SER A CA   10 
ATOM   6201  C  C    . SER A 1 21 ? 6.856   3.527   -7.314  1.00 0.00 ? 21  SER A C    10 
ATOM   6202  O  O    . SER A 1 21 ? 5.709   3.492   -7.761  1.00 0.00 ? 21  SER A O    10 
ATOM   6203  C  CB   . SER A 1 21 ? 6.651   5.242   -5.504  1.00 0.00 ? 21  SER A CB   10 
ATOM   6204  O  OG   . SER A 1 21 ? 7.332   6.261   -4.793  1.00 0.00 ? 21  SER A OG   10 
ATOM   6205  H  H    . SER A 1 21 ? 7.140   6.785   -7.479  1.00 0.00 ? 21  SER A H    10 
ATOM   6206  H  HA   . SER A 1 21 ? 8.465   4.647   -6.472  1.00 0.00 ? 21  SER A HA   10 
ATOM   6207  H  HB2  . SER A 1 21 ? 5.682   5.614   -5.802  1.00 0.00 ? 21  SER A HB2  10 
ATOM   6208  H  HB3  . SER A 1 21 ? 6.524   4.388   -4.855  1.00 0.00 ? 21  SER A HB3  10 
ATOM   6209  H  HG   . SER A 1 21 ? 7.785   5.876   -4.039  1.00 0.00 ? 21  SER A HG   10 
ATOM   6210  N  N    . ILE A 1 22 ? 7.656   2.467   -7.292  1.00 0.00 ? 22  ILE A N    10 
ATOM   6211  C  CA   . ILE A 1 22 ? 7.223   1.172   -7.802  1.00 0.00 ? 22  ILE A CA   10 
ATOM   6212  C  C    . ILE A 1 22 ? 6.577   0.336   -6.703  1.00 0.00 ? 22  ILE A C    10 
ATOM   6213  O  O    . ILE A 1 22 ? 6.977   0.404   -5.540  1.00 0.00 ? 22  ILE A O    10 
ATOM   6214  C  CB   . ILE A 1 22 ? 8.399   0.383   -8.408  1.00 0.00 ? 22  ILE A CB   10 
ATOM   6215  C  CG1  . ILE A 1 22 ? 8.822   1.000   -9.742  1.00 0.00 ? 22  ILE A CG1  10 
ATOM   6216  C  CG2  . ILE A 1 22 ? 8.018   -1.078  -8.590  1.00 0.00 ? 22  ILE A CG2  10 
ATOM   6217  C  CD1  . ILE A 1 22 ? 9.650   2.257   -9.592  1.00 0.00 ? 22  ILE A CD1  10 
ATOM   6218  H  H    . ILE A 1 22 ? 8.559   2.558   -6.924  1.00 0.00 ? 22  ILE A H    10 
ATOM   6219  H  HA   . ILE A 1 22 ? 6.495   1.348   -8.581  1.00 0.00 ? 22  ILE A HA   10 
ATOM   6220  H  HB   . ILE A 1 22 ? 9.228   0.431   -7.718  1.00 0.00 ? 22  ILE A HB   10 
ATOM   6221  H  HG12 . ILE A 1 22 ? 9.408   0.282   -10.294 1.00 0.00 ? 22  ILE A HG12 10 
ATOM   6222  H  HG13 . ILE A 1 22 ? 7.938   1.250   -10.311 1.00 0.00 ? 22  ILE A HG13 10 
ATOM   6223  H  HG21 . ILE A 1 22 ? 8.512   -1.472  -9.466  1.00 0.00 ? 22  ILE A HG21 10 
ATOM   6224  H  HG22 . ILE A 1 22 ? 8.325   -1.641  -7.722  1.00 0.00 ? 22  ILE A HG22 10 
ATOM   6225  H  HG23 . ILE A 1 22 ? 6.949   -1.159  -8.713  1.00 0.00 ? 22  ILE A HG23 10 
ATOM   6226  H  HD11 . ILE A 1 22 ? 9.439   2.715   -8.637  1.00 0.00 ? 22  ILE A HD11 10 
ATOM   6227  H  HD12 . ILE A 1 22 ? 10.699  2.008   -9.649  1.00 0.00 ? 22  ILE A HD12 10 
ATOM   6228  H  HD13 . ILE A 1 22 ? 9.401   2.949   -10.384 1.00 0.00 ? 22  ILE A HD13 10 
ATOM   6229  N  N    . CYS A 1 23 ? 5.577   -0.454  -7.078  1.00 0.00 ? 23  CYS A N    10 
ATOM   6230  C  CA   . CYS A 1 23 ? 4.875   -1.305  -6.125  1.00 0.00 ? 23  CYS A CA   10 
ATOM   6231  C  C    . CYS A 1 23 ? 5.818   -2.347  -5.529  1.00 0.00 ? 23  CYS A C    10 
ATOM   6232  O  O    . CYS A 1 23 ? 6.980   -2.445  -5.924  1.00 0.00 ? 23  CYS A O    10 
ATOM   6233  C  CB   . CYS A 1 23 ? 3.693   -2.000  -6.804  1.00 0.00 ? 23  CYS A CB   10 
ATOM   6234  S  SG   . CYS A 1 23 ? 2.349   -2.463  -5.666  1.00 0.00 ? 23  CYS A SG   10 
ATOM   6235  H  H    . CYS A 1 23 ? 5.303   -0.465  -8.020  1.00 0.00 ? 23  CYS A H    10 
ATOM   6236  H  HA   . CYS A 1 23 ? 4.503   -0.677  -5.330  1.00 0.00 ? 23  CYS A HA   10 
ATOM   6237  H  HB2  . CYS A 1 23 ? 3.277   -1.339  -7.551  1.00 0.00 ? 23  CYS A HB2  10 
ATOM   6238  H  HB3  . CYS A 1 23 ? 4.043   -2.902  -7.284  1.00 0.00 ? 23  CYS A HB3  10 
ATOM   6239  N  N    . ASP A 1 24 ? 5.309   -3.121  -4.578  1.00 0.00 ? 24  ASP A N    10 
ATOM   6240  C  CA   . ASP A 1 24 ? 6.104   -4.157  -3.928  1.00 0.00 ? 24  ASP A CA   10 
ATOM   6241  C  C    . ASP A 1 24 ? 5.693   -5.543  -4.414  1.00 0.00 ? 24  ASP A C    10 
ATOM   6242  O  O    . ASP A 1 24 ? 6.480   -6.487  -4.366  1.00 0.00 ? 24  ASP A O    10 
ATOM   6243  C  CB   . ASP A 1 24 ? 5.951   -4.069  -2.409  1.00 0.00 ? 24  ASP A CB   10 
ATOM   6244  C  CG   . ASP A 1 24 ? 6.774   -5.115  -1.682  1.00 0.00 ? 24  ASP A CG   10 
ATOM   6245  O  OD1  . ASP A 1 24 ? 7.942   -5.326  -2.071  1.00 0.00 ? 24  ASP A OD1  10 
ATOM   6246  O  OD2  . ASP A 1 24 ? 6.250   -5.723  -0.726  1.00 0.00 ? 24  ASP A OD2  10 
ATOM   6247  H  H    . ASP A 1 24 ? 4.375   -2.995  -4.307  1.00 0.00 ? 24  ASP A H    10 
ATOM   6248  H  HA   . ASP A 1 24 ? 7.139   -3.991  -4.186  1.00 0.00 ? 24  ASP A HA   10 
ATOM   6249  H  HB2  . ASP A 1 24 ? 6.272   -3.092  -2.077  1.00 0.00 ? 24  ASP A HB2  10 
ATOM   6250  H  HB3  . ASP A 1 24 ? 4.912   -4.210  -2.149  1.00 0.00 ? 24  ASP A HB3  10 
ATOM   6251  N  N    . ASN A 1 25 ? 4.454   -5.658  -4.880  1.00 0.00 ? 25  ASN A N    10 
ATOM   6252  C  CA   . ASN A 1 25 ? 3.937   -6.929  -5.373  1.00 0.00 ? 25  ASN A CA   10 
ATOM   6253  C  C    . ASN A 1 25 ? 4.234   -7.097  -6.860  1.00 0.00 ? 25  ASN A C    10 
ATOM   6254  O  O    . ASN A 1 25 ? 5.064   -7.918  -7.250  1.00 0.00 ? 25  ASN A O    10 
ATOM   6255  C  CB   . ASN A 1 25 ? 2.429   -7.020  -5.129  1.00 0.00 ? 25  ASN A CB   10 
ATOM   6256  C  CG   . ASN A 1 25 ? 2.098   -7.486  -3.724  1.00 0.00 ? 25  ASN A CG   10 
ATOM   6257  O  OD1  . ASN A 1 25 ? 2.395   -8.620  -3.349  1.00 0.00 ? 25  ASN A OD1  10 
ATOM   6258  N  ND2  . ASN A 1 25 ? 1.479   -6.611  -2.941  1.00 0.00 ? 25  ASN A ND2  10 
ATOM   6259  H  H    . ASN A 1 25 ? 3.872   -4.868  -4.893  1.00 0.00 ? 25  ASN A H    10 
ATOM   6260  H  HA   . ASN A 1 25 ? 4.429   -7.720  -4.828  1.00 0.00 ? 25  ASN A HA   10 
ATOM   6261  H  HB2  . ASN A 1 25 ? 1.987   -6.045  -5.277  1.00 0.00 ? 25  ASN A HB2  10 
ATOM   6262  H  HB3  . ASN A 1 25 ? 1.998   -7.717  -5.831  1.00 0.00 ? 25  ASN A HB3  10 
ATOM   6263  H  HD21 . ASN A 1 25 ? 1.273   -5.725  -3.308  1.00 0.00 ? 25  ASN A HD21 10 
ATOM   6264  H  HD22 . ASN A 1 25 ? 1.254   -6.886  -2.028  1.00 0.00 ? 25  ASN A HD22 10 
ATOM   6265  N  N    . PHE A 1 26 ? 3.549   -6.313  -7.687  1.00 0.00 ? 26  PHE A N    10 
ATOM   6266  C  CA   . PHE A 1 26 ? 3.739   -6.374  -9.131  1.00 0.00 ? 26  PHE A CA   10 
ATOM   6267  C  C    . PHE A 1 26 ? 5.211   -6.202  -9.495  1.00 0.00 ? 26  PHE A C    10 
ATOM   6268  O  O    . PHE A 1 26 ? 5.663   -6.675  -10.537 1.00 0.00 ? 26  PHE A O    10 
ATOM   6269  C  CB   . PHE A 1 26 ? 2.901   -5.297  -9.823  1.00 0.00 ? 26  PHE A CB   10 
ATOM   6270  C  CG   . PHE A 1 26 ? 2.447   -5.684  -11.202 1.00 0.00 ? 26  PHE A CG   10 
ATOM   6271  C  CD1  . PHE A 1 26 ? 3.363   -5.831  -12.231 1.00 0.00 ? 26  PHE A CD1  10 
ATOM   6272  C  CD2  . PHE A 1 26 ? 1.105   -5.901  -11.468 1.00 0.00 ? 26  PHE A CD2  10 
ATOM   6273  C  CE1  . PHE A 1 26 ? 2.947   -6.186  -13.501 1.00 0.00 ? 26  PHE A CE1  10 
ATOM   6274  C  CE2  . PHE A 1 26 ? 0.683   -6.256  -12.735 1.00 0.00 ? 26  PHE A CE2  10 
ATOM   6275  C  CZ   . PHE A 1 26 ? 1.606   -6.400  -13.753 1.00 0.00 ? 26  PHE A CZ   10 
ATOM   6276  H  H    . PHE A 1 26 ? 2.901   -5.678  -7.316  1.00 0.00 ? 26  PHE A H    10 
ATOM   6277  H  HA   . PHE A 1 26 ? 3.409   -7.345  -9.467  1.00 0.00 ? 26  PHE A HA   10 
ATOM   6278  H  HB2  . PHE A 1 26 ? 2.022   -5.097  -9.229  1.00 0.00 ? 26  PHE A HB2  10 
ATOM   6279  H  HB3  . PHE A 1 26 ? 3.487   -4.394  -9.907  1.00 0.00 ? 26  PHE A HB3  10 
ATOM   6280  H  HD1  . PHE A 1 26 ? 4.412   -5.664  -12.036 1.00 0.00 ? 26  PHE A HD1  10 
ATOM   6281  H  HD2  . PHE A 1 26 ? 0.382   -5.789  -10.672 1.00 0.00 ? 26  PHE A HD2  10 
ATOM   6282  H  HE1  . PHE A 1 26 ? 3.670   -6.298  -14.294 1.00 0.00 ? 26  PHE A HE1  10 
ATOM   6283  H  HE2  . PHE A 1 26 ? -0.366  -6.423  -12.928 1.00 0.00 ? 26  PHE A HE2  10 
ATOM   6284  H  HZ   . PHE A 1 26 ? 1.279   -6.677  -14.744 1.00 0.00 ? 26  PHE A HZ   10 
ATOM   6285  N  N    . SER A 1 27 ? 5.952   -5.521  -8.627  1.00 0.00 ? 27  SER A N    10 
ATOM   6286  C  CA   . SER A 1 27 ? 7.372   -5.281  -8.858  1.00 0.00 ? 27  SER A CA   10 
ATOM   6287  C  C    . SER A 1 27 ? 8.098   -6.585  -9.174  1.00 0.00 ? 27  SER A C    10 
ATOM   6288  O  O    . SER A 1 27 ? 8.616   -6.768  -10.276 1.00 0.00 ? 27  SER A O    10 
ATOM   6289  C  CB   . SER A 1 27 ? 8.004   -4.616  -7.634  1.00 0.00 ? 27  SER A CB   10 
ATOM   6290  O  OG   . SER A 1 27 ? 9.412   -4.776  -7.636  1.00 0.00 ? 27  SER A OG   10 
ATOM   6291  H  H    . SER A 1 27 ? 5.533   -5.168  -7.814  1.00 0.00 ? 27  SER A H    10 
ATOM   6292  H  HA   . SER A 1 27 ? 7.463   -4.617  -9.705  1.00 0.00 ? 27  SER A HA   10 
ATOM   6293  H  HB2  . SER A 1 27 ? 7.774   -3.562  -7.641  1.00 0.00 ? 27  SER A HB2  10 
ATOM   6294  H  HB3  . SER A 1 27 ? 7.604   -5.066  -6.736  1.00 0.00 ? 27  SER A HB3  10 
ATOM   6295  H  HG   . SER A 1 27 ? 9.640   -5.610  -7.218  1.00 0.00 ? 27  SER A HG   10 
ATOM   6296  N  N    . ALA A 1 28 ? 8.132   -7.488  -8.200  1.00 0.00 ? 28  ALA A N    10 
ATOM   6297  C  CA   . ALA A 1 28 ? 8.792   -8.776  -8.374  1.00 0.00 ? 28  ALA A CA   10 
ATOM   6298  C  C    . ALA A 1 28 ? 7.787   -9.863  -8.739  1.00 0.00 ? 28  ALA A C    10 
ATOM   6299  O  O    . ALA A 1 28 ? 7.925   -10.529 -9.766  1.00 0.00 ? 28  ALA A O    10 
ATOM   6300  C  CB   . ALA A 1 28 ? 9.548   -9.156  -7.110  1.00 0.00 ? 28  ALA A CB   10 
ATOM   6301  H  H    . ALA A 1 28 ? 7.700   -7.284  -7.344  1.00 0.00 ? 28  ALA A H    10 
ATOM   6302  H  HA   . ALA A 1 28 ? 9.509   -8.677  -9.177  1.00 0.00 ? 28  ALA A HA   10 
ATOM   6303  H  HB1  . ALA A 1 28 ? 9.281   -10.162 -6.821  1.00 0.00 ? 28  ALA A HB1  10 
ATOM   6304  H  HB2  . ALA A 1 28 ? 10.610  -9.104  -7.297  1.00 0.00 ? 28  ALA A HB2  10 
ATOM   6305  H  HB3  . ALA A 1 28 ? 9.288   -8.472  -6.316  1.00 0.00 ? 28  ALA A HB3  10 
ATOM   6306  N  N    . TYR A 1 29 ? 6.779   -10.038 -7.893  1.00 0.00 ? 29  TYR A N    10 
ATOM   6307  C  CA   . TYR A 1 29 ? 5.752   -11.047 -8.126  1.00 0.00 ? 29  TYR A CA   10 
ATOM   6308  C  C    . TYR A 1 29 ? 5.148   -10.899 -9.519  1.00 0.00 ? 29  TYR A C    10 
ATOM   6309  O  O    . TYR A 1 29 ? 5.066   -11.863 -10.278 1.00 0.00 ? 29  TYR A O    10 
ATOM   6310  C  CB   . TYR A 1 29 ? 4.654   -10.941 -7.067  1.00 0.00 ? 29  TYR A CB   10 
ATOM   6311  C  CG   . TYR A 1 29 ? 5.164   -11.068 -5.649  1.00 0.00 ? 29  TYR A CG   10 
ATOM   6312  C  CD1  . TYR A 1 29 ? 5.719   -9.978  -4.990  1.00 0.00 ? 29  TYR A CD1  10 
ATOM   6313  C  CD2  . TYR A 1 29 ? 5.091   -12.278 -4.970  1.00 0.00 ? 29  TYR A CD2  10 
ATOM   6314  C  CE1  . TYR A 1 29 ? 6.187   -10.090 -3.695  1.00 0.00 ? 29  TYR A CE1  10 
ATOM   6315  C  CE2  . TYR A 1 29 ? 5.556   -12.398 -3.674  1.00 0.00 ? 29  TYR A CE2  10 
ATOM   6316  C  CZ   . TYR A 1 29 ? 6.103   -11.302 -3.041  1.00 0.00 ? 29  TYR A CZ   10 
ATOM   6317  O  OH   . TYR A 1 29 ? 6.568   -11.417 -1.751  1.00 0.00 ? 29  TYR A OH   10 
ATOM   6318  H  H    . TYR A 1 29 ? 6.723   -9.476  -7.092  1.00 0.00 ? 29  TYR A H    10 
ATOM   6319  H  HA   . TYR A 1 29 ? 6.219   -12.019 -8.050  1.00 0.00 ? 29  TYR A HA   10 
ATOM   6320  H  HB2  . TYR A 1 29 ? 4.166   -9.983  -7.159  1.00 0.00 ? 29  TYR A HB2  10 
ATOM   6321  H  HB3  . TYR A 1 29 ? 3.929   -11.725 -7.230  1.00 0.00 ? 29  TYR A HB3  10 
ATOM   6322  H  HD1  . TYR A 1 29 ? 5.783   -9.031  -5.504  1.00 0.00 ? 29  TYR A HD1  10 
ATOM   6323  H  HD2  . TYR A 1 29 ? 4.661   -13.135 -5.468  1.00 0.00 ? 29  TYR A HD2  10 
ATOM   6324  H  HE1  . TYR A 1 29 ? 6.616   -9.232  -3.199  1.00 0.00 ? 29  TYR A HE1  10 
ATOM   6325  H  HE2  . TYR A 1 29 ? 5.490   -13.347 -3.162  1.00 0.00 ? 29  TYR A HE2  10 
ATOM   6326  H  HH   . TYR A 1 29 ? 6.062   -12.089 -1.288  1.00 0.00 ? 29  TYR A HH   10 
ATOM   6327  N  N    . GLY A 1 30 ? 4.726   -9.682  -9.847  1.00 0.00 ? 30  GLY A N    10 
ATOM   6328  C  CA   . GLY A 1 30 ? 4.135   -9.427  -11.148 1.00 0.00 ? 30  GLY A CA   10 
ATOM   6329  C  C    . GLY A 1 30 ? 2.661   -9.085  -11.058 1.00 0.00 ? 30  GLY A C    10 
ATOM   6330  O  O    . GLY A 1 30 ? 2.134   -8.356  -11.898 1.00 0.00 ? 30  GLY A O    10 
ATOM   6331  H  H    . GLY A 1 30 ? 4.817   -8.950  -9.201  1.00 0.00 ? 30  GLY A H    10 
ATOM   6332  H  HA2  . GLY A 1 30 ? 4.657   -8.605  -11.614 1.00 0.00 ? 30  GLY A HA2  10 
ATOM   6333  H  HA3  . GLY A 1 30 ? 4.251   -10.308 -11.762 1.00 0.00 ? 30  GLY A HA3  10 
ATOM   6334  N  N    . TRP A 1 31 ? 1.994   -9.613  -10.038 1.00 0.00 ? 31  TRP A N    10 
ATOM   6335  C  CA   . TRP A 1 31 ? 0.571   -9.361  -9.843  1.00 0.00 ? 31  TRP A CA   10 
ATOM   6336  C  C    . TRP A 1 31 ? 0.342   -8.411  -8.672  1.00 0.00 ? 31  TRP A C    10 
ATOM   6337  O  O    . TRP A 1 31 ? 1.197   -8.270  -7.798  1.00 0.00 ? 31  TRP A O    10 
ATOM   6338  C  CB   . TRP A 1 31 ? -0.173  -10.675 -9.602  1.00 0.00 ? 31  TRP A CB   10 
ATOM   6339  C  CG   . TRP A 1 31 ? -0.282  -11.039 -8.152  1.00 0.00 ? 31  TRP A CG   10 
ATOM   6340  C  CD1  . TRP A 1 31 ? 0.656   -11.682 -7.395  1.00 0.00 ? 31  TRP A CD1  10 
ATOM   6341  C  CD2  . TRP A 1 31 ? -1.393  -10.783 -7.286  1.00 0.00 ? 31  TRP A CD2  10 
ATOM   6342  N  NE1  . TRP A 1 31 ? 0.195   -11.841 -6.111  1.00 0.00 ? 31  TRP A NE1  10 
ATOM   6343  C  CE2  . TRP A 1 31 ? -1.059  -11.297 -6.017  1.00 0.00 ? 31  TRP A CE2  10 
ATOM   6344  C  CE3  . TRP A 1 31 ? -2.635  -10.167 -7.457  1.00 0.00 ? 31  TRP A CE3  10 
ATOM   6345  C  CZ2  . TRP A 1 31 ? -1.924  -11.214 -4.930  1.00 0.00 ? 31  TRP A CZ2  10 
ATOM   6346  C  CZ3  . TRP A 1 31 ? -3.493  -10.086 -6.377  1.00 0.00 ? 31  TRP A CZ3  10 
ATOM   6347  C  CH2  . TRP A 1 31 ? -3.134  -10.606 -5.126  1.00 0.00 ? 31  TRP A CH2  10 
ATOM   6348  H  H    . TRP A 1 31 ? 2.470   -10.187 -9.401  1.00 0.00 ? 31  TRP A H    10 
ATOM   6349  H  HA   . TRP A 1 31 ? 0.190   -8.902  -10.743 1.00 0.00 ? 31  TRP A HA   10 
ATOM   6350  H  HB2  . TRP A 1 31 ? -1.173  -10.595 -10.002 1.00 0.00 ? 31  TRP A HB2  10 
ATOM   6351  H  HB3  . TRP A 1 31 ? 0.350   -11.474 -10.108 1.00 0.00 ? 31  TRP A HB3  10 
ATOM   6352  H  HD1  . TRP A 1 31 ? 1.613   -12.013 -7.767  1.00 0.00 ? 31  TRP A HD1  10 
ATOM   6353  H  HE1  . TRP A 1 31 ? 0.686   -12.272 -5.380  1.00 0.00 ? 31  TRP A HE1  10 
ATOM   6354  H  HE3  . TRP A 1 31 ? -2.930  -9.760  -8.413  1.00 0.00 ? 31  TRP A HE3  10 
ATOM   6355  H  HZ2  . TRP A 1 31 ? -1.662  -11.609 -3.959  1.00 0.00 ? 31  TRP A HZ2  10 
ATOM   6356  H  HZ3  . TRP A 1 31 ? -4.458  -9.614  -6.490  1.00 0.00 ? 31  TRP A HZ3  10 
ATOM   6357  H  HH2  . TRP A 1 31 ? -3.836  -10.521 -4.310  1.00 0.00 ? 31  TRP A HH2  10 
ATOM   6358  N  N    . CYS A 1 32 ? -0.817  -7.761  -8.661  1.00 0.00 ? 32  CYS A N    10 
ATOM   6359  C  CA   . CYS A 1 32 ? -1.158  -6.824  -7.598  1.00 0.00 ? 32  CYS A CA   10 
ATOM   6360  C  C    . CYS A 1 32 ? -2.656  -6.853  -7.308  1.00 0.00 ? 32  CYS A C    10 
ATOM   6361  O  O    . CYS A 1 32 ? -3.490  -6.844  -8.214  1.00 0.00 ? 32  CYS A O    10 
ATOM   6362  C  CB   . CYS A 1 32 ? -0.729  -5.407  -7.981  1.00 0.00 ? 32  CYS A CB   10 
ATOM   6363  S  SG   . CYS A 1 32 ? -0.957  -4.177  -6.657  1.00 0.00 ? 32  CYS A SG   10 
ATOM   6364  H  H    . CYS A 1 32 ? -1.459  -7.915  -9.386  1.00 0.00 ? 32  CYS A H    10 
ATOM   6365  H  HA   . CYS A 1 32 ? -0.626  -7.124  -6.708  1.00 0.00 ? 32  CYS A HA   10 
ATOM   6366  H  HB2  . CYS A 1 32 ? 0.319   -5.415  -8.243  1.00 0.00 ? 32  CYS A HB2  10 
ATOM   6367  H  HB3  . CYS A 1 32 ? -1.306  -5.082  -8.835  1.00 0.00 ? 32  CYS A HB3  10 
ATOM   6368  N  N    . PRO A 1 33 ? -3.008  -6.888  -6.014  1.00 0.00 ? 33  PRO A N    10 
ATOM   6369  C  CA   . PRO A 1 33 ? -4.406  -6.918  -5.574  1.00 0.00 ? 33  PRO A CA   10 
ATOM   6370  C  C    . PRO A 1 33 ? -5.124  -5.598  -5.835  1.00 0.00 ? 33  PRO A C    10 
ATOM   6371  O  O    . PRO A 1 33 ? -6.331  -5.483  -5.619  1.00 0.00 ? 33  PRO A O    10 
ATOM   6372  C  CB   . PRO A 1 33 ? -4.299  -7.180  -4.070  1.00 0.00 ? 33  PRO A CB   10 
ATOM   6373  C  CG   . PRO A 1 33 ? -2.955  -6.663  -3.690  1.00 0.00 ? 33  PRO A CG   10 
ATOM   6374  C  CD   . PRO A 1 33 ? -2.068  -6.900  -4.881  1.00 0.00 ? 33  PRO A CD   10 
ATOM   6375  H  HA   . PRO A 1 33 ? -4.953  -7.722  -6.044  1.00 0.00 ? 33  PRO A HA   10 
ATOM   6376  H  HB2  . PRO A 1 33 ? -5.087  -6.651  -3.553  1.00 0.00 ? 33  PRO A HB2  10 
ATOM   6377  H  HB3  . PRO A 1 33 ? -4.383  -8.239  -3.879  1.00 0.00 ? 33  PRO A HB3  10 
ATOM   6378  H  HG2  . PRO A 1 33 ? -3.015  -5.608  -3.471  1.00 0.00 ? 33  PRO A HG2  10 
ATOM   6379  H  HG3  . PRO A 1 33 ? -2.583  -7.205  -2.832  1.00 0.00 ? 33  PRO A HG3  10 
ATOM   6380  H  HD2  . PRO A 1 33 ? -1.341  -6.107  -4.974  1.00 0.00 ? 33  PRO A HD2  10 
ATOM   6381  H  HD3  . PRO A 1 33 ? -1.576  -7.858  -4.800  1.00 0.00 ? 33  PRO A HD3  10 
ATOM   6382  N  N    . LEU A 1 34 ? -4.375  -4.604  -6.300  1.00 0.00 ? 34  LEU A N    10 
ATOM   6383  C  CA   . LEU A 1 34 ? -4.941  -3.291  -6.591  1.00 0.00 ? 34  LEU A CA   10 
ATOM   6384  C  C    . LEU A 1 34 ? -5.063  -3.072  -8.095  1.00 0.00 ? 34  LEU A C    10 
ATOM   6385  O  O    . LEU A 1 34 ? -5.774  -2.175  -8.546  1.00 0.00 ? 34  LEU A O    10 
ATOM   6386  C  CB   . LEU A 1 34 ? -4.074  -2.193  -5.973  1.00 0.00 ? 34  LEU A CB   10 
ATOM   6387  C  CG   . LEU A 1 34 ? -4.271  -1.944  -4.477  1.00 0.00 ? 34  LEU A CG   10 
ATOM   6388  C  CD1  . LEU A 1 34 ? -3.409  -0.781  -4.011  1.00 0.00 ? 34  LEU A CD1  10 
ATOM   6389  C  CD2  . LEU A 1 34 ? -5.738  -1.680  -4.169  1.00 0.00 ? 34  LEU A CD2  10 
ATOM   6390  H  H    . LEU A 1 34 ? -3.419  -4.756  -6.452  1.00 0.00 ? 34  LEU A H    10 
ATOM   6391  H  HA   . LEU A 1 34 ? -5.926  -3.251  -6.152  1.00 0.00 ? 34  LEU A HA   10 
ATOM   6392  H  HB2  . LEU A 1 34 ? -3.040  -2.459  -6.130  1.00 0.00 ? 34  LEU A HB2  10 
ATOM   6393  H  HB3  . LEU A 1 34 ? -4.289  -1.270  -6.493  1.00 0.00 ? 34  LEU A HB3  10 
ATOM   6394  H  HG   . LEU A 1 34 ? -3.966  -2.825  -3.929  1.00 0.00 ? 34  LEU A HG   10 
ATOM   6395  H  HD11 . LEU A 1 34 ? -2.708  -0.519  -4.788  1.00 0.00 ? 34  LEU A HD11 10 
ATOM   6396  H  HD12 . LEU A 1 34 ? -2.869  -1.068  -3.121  1.00 0.00 ? 34  LEU A HD12 10 
ATOM   6397  H  HD13 . LEU A 1 34 ? -4.039  0.069   -3.791  1.00 0.00 ? 34  LEU A HD13 10 
ATOM   6398  H  HD21 . LEU A 1 34 ? -5.817  -1.122  -3.247  1.00 0.00 ? 34  LEU A HD21 10 
ATOM   6399  H  HD22 . LEU A 1 34 ? -6.259  -2.621  -4.065  1.00 0.00 ? 34  LEU A HD22 10 
ATOM   6400  H  HD23 . LEU A 1 34 ? -6.178  -1.110  -4.974  1.00 0.00 ? 34  LEU A HD23 10 
ATOM   6401  N  N    . GLY A 1 35 ? -4.366  -3.900  -8.867  1.00 0.00 ? 35  GLY A N    10 
ATOM   6402  C  CA   . GLY A 1 35 ? -4.412  -3.782  -10.313 1.00 0.00 ? 35  GLY A CA   10 
ATOM   6403  C  C    . GLY A 1 35 ? -3.878  -2.450  -10.803 1.00 0.00 ? 35  GLY A C    10 
ATOM   6404  O  O    . GLY A 1 35 ? -2.911  -1.910  -10.266 1.00 0.00 ? 35  GLY A O    10 
ATOM   6405  H  H    . GLY A 1 35 ? -3.816  -4.597  -8.452  1.00 0.00 ? 35  GLY A H    10 
ATOM   6406  H  HA2  . GLY A 1 35 ? -3.823  -4.576  -10.747 1.00 0.00 ? 35  GLY A HA2  10 
ATOM   6407  H  HA3  . GLY A 1 35 ? -5.436  -3.887  -10.639 1.00 0.00 ? 35  GLY A HA3  10 
ATOM   6408  N  N    . PRO A 1 36 ? -4.515  -1.901  -11.848 1.00 0.00 ? 36  PRO A N    10 
ATOM   6409  C  CA   . PRO A 1 36 ? -4.114  -0.619  -12.434 1.00 0.00 ? 36  PRO A CA   10 
ATOM   6410  C  C    . PRO A 1 36 ? -4.410  0.558   -11.511 1.00 0.00 ? 36  PRO A C    10 
ATOM   6411  O  O    . PRO A 1 36 ? -3.690  1.556   -11.514 1.00 0.00 ? 36  PRO A O    10 
ATOM   6412  C  CB   . PRO A 1 36 ? -4.964  -0.529  -13.704 1.00 0.00 ? 36  PRO A CB   10 
ATOM   6413  C  CG   . PRO A 1 36 ? -6.158  -1.374  -13.422 1.00 0.00 ? 36  PRO A CG   10 
ATOM   6414  C  CD   . PRO A 1 36 ? -5.675  -2.490  -12.538 1.00 0.00 ? 36  PRO A CD   10 
ATOM   6415  H  HA   . PRO A 1 36 ? -3.067  -0.613  -12.699 1.00 0.00 ? 36  PRO A HA   10 
ATOM   6416  H  HB2  . PRO A 1 36 ? -5.242  0.501   -13.882 1.00 0.00 ? 36  PRO A HB2  10 
ATOM   6417  H  HB3  . PRO A 1 36 ? -4.403  -0.907  -14.545 1.00 0.00 ? 36  PRO A HB3  10 
ATOM   6418  H  HG2  . PRO A 1 36 ? -6.909  -0.791  -12.913 1.00 0.00 ? 36  PRO A HG2  10 
ATOM   6419  H  HG3  . PRO A 1 36 ? -6.552  -1.772  -14.345 1.00 0.00 ? 36  PRO A HG3  10 
ATOM   6420  H  HD2  . PRO A 1 36 ? -6.442  -2.771  -11.831 1.00 0.00 ? 36  PRO A HD2  10 
ATOM   6421  H  HD3  . PRO A 1 36 ? -5.378  -3.342  -13.132 1.00 0.00 ? 36  PRO A HD3  10 
ATOM   6422  N  N    . GLN A 1 37 ? -5.472  0.433   -10.722 1.00 0.00 ? 37  GLN A N    10 
ATOM   6423  C  CA   . GLN A 1 37 ? -5.862  1.487   -9.793  1.00 0.00 ? 37  GLN A CA   10 
ATOM   6424  C  C    . GLN A 1 37 ? -4.777  1.720   -8.747  1.00 0.00 ? 37  GLN A C    10 
ATOM   6425  O  O    . GLN A 1 37 ? -4.697  2.792   -8.147  1.00 0.00 ? 37  GLN A O    10 
ATOM   6426  C  CB   . GLN A 1 37 ? -7.181  1.130   -9.106  1.00 0.00 ? 37  GLN A CB   10 
ATOM   6427  C  CG   . GLN A 1 37 ? -8.410  1.488   -9.926  1.00 0.00 ? 37  GLN A CG   10 
ATOM   6428  C  CD   . GLN A 1 37 ? -8.672  0.502   -11.047 1.00 0.00 ? 37  GLN A CD   10 
ATOM   6429  O  OE1  . GLN A 1 37 ? -9.057  -0.642  -10.806 1.00 0.00 ? 37  GLN A OE1  10 
ATOM   6430  N  NE2  . GLN A 1 37 ? -8.465  0.942   -12.283 1.00 0.00 ? 37  GLN A NE2  10 
ATOM   6431  H  H    . GLN A 1 37 ? -6.006  -0.387  -10.765 1.00 0.00 ? 37  GLN A H    10 
ATOM   6432  H  HA   . GLN A 1 37 ? -5.997  2.395   -10.361 1.00 0.00 ? 37  GLN A HA   10 
ATOM   6433  H  HB2  . GLN A 1 37 ? -7.198  0.067   -8.918  1.00 0.00 ? 37  GLN A HB2  10 
ATOM   6434  H  HB3  . GLN A 1 37 ? -7.237  1.655   -8.165  1.00 0.00 ? 37  GLN A HB3  10 
ATOM   6435  H  HG2  . GLN A 1 37 ? -9.270  1.504   -9.273  1.00 0.00 ? 37  GLN A HG2  10 
ATOM   6436  H  HG3  . GLN A 1 37 ? -8.267  2.469   -10.354 1.00 0.00 ? 37  GLN A HG3  10 
ATOM   6437  H  HE21 . GLN A 1 37 ? -8.156  1.866   -12.399 1.00 0.00 ? 37  GLN A HE21 10 
ATOM   6438  H  HE22 . GLN A 1 37 ? -8.625  0.326   -13.026 1.00 0.00 ? 37  GLN A HE22 10 
ATOM   6439  N  N    . CYS A 1 38 ? -3.943  0.707   -8.531  1.00 0.00 ? 38  CYS A N    10 
ATOM   6440  C  CA   . CYS A 1 38 ? -2.863  0.800   -7.556  1.00 0.00 ? 38  CYS A CA   10 
ATOM   6441  C  C    . CYS A 1 38 ? -2.113  2.121   -7.699  1.00 0.00 ? 38  CYS A C    10 
ATOM   6442  O  O    . CYS A 1 38 ? -1.782  2.560   -8.801  1.00 0.00 ? 38  CYS A O    10 
ATOM   6443  C  CB   . CYS A 1 38 ? -1.893  -0.371  -7.727  1.00 0.00 ? 38  CYS A CB   10 
ATOM   6444  S  SG   . CYS A 1 38 ? -0.547  -0.406  -6.499  1.00 0.00 ? 38  CYS A SG   10 
ATOM   6445  H  H    . CYS A 1 38 ? -4.058  -0.123  -9.040  1.00 0.00 ? 38  CYS A H    10 
ATOM   6446  H  HA   . CYS A 1 38 ? -3.300  0.753   -6.571  1.00 0.00 ? 38  CYS A HA   10 
ATOM   6447  H  HB2  . CYS A 1 38 ? -2.440  -1.298  -7.639  1.00 0.00 ? 38  CYS A HB2  10 
ATOM   6448  H  HB3  . CYS A 1 38 ? -1.443  -0.316  -8.707  1.00 0.00 ? 38  CYS A HB3  10 
ATOM   6449  N  N    . PRO A 1 39 ? -1.838  2.771   -6.559  1.00 0.00 ? 39  PRO A N    10 
ATOM   6450  C  CA   . PRO A 1 39 ? -1.124  4.051   -6.530  1.00 0.00 ? 39  PRO A CA   10 
ATOM   6451  C  C    . PRO A 1 39 ? 0.344   3.905   -6.915  1.00 0.00 ? 39  PRO A C    10 
ATOM   6452  O  O    . PRO A 1 39 ? 0.995   4.878   -7.296  1.00 0.00 ? 39  PRO A O    10 
ATOM   6453  C  CB   . PRO A 1 39 ? -1.252  4.496   -5.071  1.00 0.00 ? 39  PRO A CB   10 
ATOM   6454  C  CG   . PRO A 1 39 ? -1.437  3.232   -4.304  1.00 0.00 ? 39  PRO A CG   10 
ATOM   6455  C  CD   . PRO A 1 39 ? -2.202  2.307   -5.210  1.00 0.00 ? 39  PRO A CD   10 
ATOM   6456  H  HA   . PRO A 1 39 ? -1.593  4.782   -7.173  1.00 0.00 ? 39  PRO A HA   10 
ATOM   6457  H  HB2  . PRO A 1 39 ? -0.352  5.013   -4.769  1.00 0.00 ? 39  PRO A HB2  10 
ATOM   6458  H  HB3  . PRO A 1 39 ? -2.103  5.151   -4.963  1.00 0.00 ? 39  PRO A HB3  10 
ATOM   6459  H  HG2  . PRO A 1 39 ? -0.476  2.806   -4.060  1.00 0.00 ? 39  PRO A HG2  10 
ATOM   6460  H  HG3  . PRO A 1 39 ? -2.002  3.428   -3.405  1.00 0.00 ? 39  PRO A HG3  10 
ATOM   6461  H  HD2  . PRO A 1 39 ? -1.890  1.285   -5.056  1.00 0.00 ? 39  PRO A HD2  10 
ATOM   6462  H  HD3  . PRO A 1 39 ? -3.265  2.408   -5.042  1.00 0.00 ? 39  PRO A HD3  10 
ATOM   6463  N  N    . GLN A 1 40 ? 0.859   2.683   -6.815  1.00 0.00 ? 40  GLN A N    10 
ATOM   6464  C  CA   . GLN A 1 40 ? 2.250   2.411   -7.153  1.00 0.00 ? 40  GLN A CA   10 
ATOM   6465  C  C    . GLN A 1 40 ? 2.398   2.097   -8.638  1.00 0.00 ? 40  GLN A C    10 
ATOM   6466  O  O    . GLN A 1 40 ? 1.407   1.939   -9.351  1.00 0.00 ? 40  GLN A O    10 
ATOM   6467  C  CB   . GLN A 1 40 ? 2.782   1.245   -6.318  1.00 0.00 ? 40  GLN A CB   10 
ATOM   6468  C  CG   . GLN A 1 40 ? 3.131   1.629   -4.889  1.00 0.00 ? 40  GLN A CG   10 
ATOM   6469  C  CD   . GLN A 1 40 ? 4.479   2.315   -4.783  1.00 0.00 ? 40  GLN A CD   10 
ATOM   6470  O  OE1  . GLN A 1 40 ? 5.273   2.300   -5.724  1.00 0.00 ? 40  GLN A OE1  10 
ATOM   6471  N  NE2  . GLN A 1 40 ? 4.745   2.922   -3.632  1.00 0.00 ? 40  GLN A NE2  10 
ATOM   6472  H  H    . GLN A 1 40 ? 0.289   1.949   -6.505  1.00 0.00 ? 40  GLN A H    10 
ATOM   6473  H  HA   . GLN A 1 40 ? 2.826   3.296   -6.926  1.00 0.00 ? 40  GLN A HA   10 
ATOM   6474  H  HB2  . GLN A 1 40 ? 2.031   0.469   -6.286  1.00 0.00 ? 40  GLN A HB2  10 
ATOM   6475  H  HB3  . GLN A 1 40 ? 3.671   0.855   -6.791  1.00 0.00 ? 40  GLN A HB3  10 
ATOM   6476  H  HG2  . GLN A 1 40 ? 2.373   2.300   -4.514  1.00 0.00 ? 40  GLN A HG2  10 
ATOM   6477  H  HG3  . GLN A 1 40 ? 3.150   0.735   -4.284  1.00 0.00 ? 40  GLN A HG3  10 
ATOM   6478  H  HE21 . GLN A 1 40 ? 4.066   2.893   -2.926  1.00 0.00 ? 40  GLN A HE21 10 
ATOM   6479  H  HE22 . GLN A 1 40 ? 5.609   3.373   -3.536  1.00 0.00 ? 40  GLN A HE22 10 
ATOM   6480  N  N    . SER A 1 41 ? 3.642   2.009   -9.098  1.00 0.00 ? 41  SER A N    10 
ATOM   6481  C  CA   . SER A 1 41 ? 3.920   1.719   -10.500 1.00 0.00 ? 41  SER A CA   10 
ATOM   6482  C  C    . SER A 1 41 ? 4.296   0.252   -10.687 1.00 0.00 ? 41  SER A C    10 
ATOM   6483  O  O    . SER A 1 41 ? 5.000   -0.330  -9.861  1.00 0.00 ? 41  SER A O    10 
ATOM   6484  C  CB   . SER A 1 41 ? 5.047   2.616   -11.015 1.00 0.00 ? 41  SER A CB   10 
ATOM   6485  O  OG   . SER A 1 41 ? 5.265   2.415   -12.401 1.00 0.00 ? 41  SER A OG   10 
ATOM   6486  H  H    . SER A 1 41 ? 4.391   2.146   -8.481  1.00 0.00 ? 41  SER A H    10 
ATOM   6487  H  HA   . SER A 1 41 ? 3.022   1.922   -11.065 1.00 0.00 ? 41  SER A HA   10 
ATOM   6488  H  HB2  . SER A 1 41 ? 4.784   3.650   -10.851 1.00 0.00 ? 41  SER A HB2  10 
ATOM   6489  H  HB3  . SER A 1 41 ? 5.958   2.386   -10.482 1.00 0.00 ? 41  SER A HB3  10 
ATOM   6490  H  HG   . SER A 1 41 ? 4.467   2.066   -12.804 1.00 0.00 ? 41  SER A HG   10 
ATOM   6491  N  N    . HIS A 1 42 ? 3.822   -0.340  -11.778 1.00 0.00 ? 42  HIS A N    10 
ATOM   6492  C  CA   . HIS A 1 42 ? 4.109   -1.739  -12.075 1.00 0.00 ? 42  HIS A CA   10 
ATOM   6493  C  C    . HIS A 1 42 ? 5.008   -1.861  -13.302 1.00 0.00 ? 42  HIS A C    10 
ATOM   6494  O  O    . HIS A 1 42 ? 4.542   -2.181  -14.395 1.00 0.00 ? 42  HIS A O    10 
ATOM   6495  C  CB   . HIS A 1 42 ? 2.809   -2.511  -12.302 1.00 0.00 ? 42  HIS A CB   10 
ATOM   6496  C  CG   . HIS A 1 42 ? 1.919   -2.553  -11.098 1.00 0.00 ? 42  HIS A CG   10 
ATOM   6497  N  ND1  . HIS A 1 42 ? 0.562   -2.788  -11.173 1.00 0.00 ? 42  HIS A ND1  10 
ATOM   6498  C  CD2  . HIS A 1 42 ? 2.199   -2.390  -9.784  1.00 0.00 ? 42  HIS A CD2  10 
ATOM   6499  C  CE1  . HIS A 1 42 ? 0.046   -2.766  -9.957  1.00 0.00 ? 42  HIS A CE1  10 
ATOM   6500  N  NE2  . HIS A 1 42 ? 1.019   -2.527  -9.096  1.00 0.00 ? 42  HIS A NE2  10 
ATOM   6501  H  H    . HIS A 1 42 ? 3.267   0.176   -12.399 1.00 0.00 ? 42  HIS A H    10 
ATOM   6502  H  HA   . HIS A 1 42 ? 4.623   -2.160  -11.224 1.00 0.00 ? 42  HIS A HA   10 
ATOM   6503  H  HB2  . HIS A 1 42 ? 2.257   -2.045  -13.106 1.00 0.00 ? 42  HIS A HB2  10 
ATOM   6504  H  HB3  . HIS A 1 42 ? 3.045   -3.529  -12.577 1.00 0.00 ? 42  HIS A HB3  10 
ATOM   6505  H  HD1  . HIS A 1 42 ? 0.053   -2.946  -11.995 1.00 0.00 ? 42  HIS A HD1  10 
ATOM   6506  H  HD2  . HIS A 1 42 ? 3.171   -2.189  -9.355  1.00 0.00 ? 42  HIS A HD2  10 
ATOM   6507  H  HE1  . HIS A 1 42 ? -0.993  -2.919  -9.708  1.00 0.00 ? 42  HIS A HE1  10 
ATOM   6508  N  N    . ASP A 1 43 ? 6.297   -1.604  -13.112 1.00 0.00 ? 43  ASP A N    10 
ATOM   6509  C  CA   . ASP A 1 43 ? 7.261   -1.685  -14.203 1.00 0.00 ? 43  ASP A CA   10 
ATOM   6510  C  C    . ASP A 1 43 ? 7.946   -3.048  -14.223 1.00 0.00 ? 43  ASP A C    10 
ATOM   6511  O  O    . ASP A 1 43 ? 8.663   -3.407  -13.289 1.00 0.00 ? 43  ASP A O    10 
ATOM   6512  C  CB   . ASP A 1 43 ? 8.308   -0.577  -14.071 1.00 0.00 ? 43  ASP A CB   10 
ATOM   6513  C  CG   . ASP A 1 43 ? 9.163   -0.437  -15.315 1.00 0.00 ? 43  ASP A CG   10 
ATOM   6514  O  OD1  . ASP A 1 43 ? 9.878   -1.402  -15.655 1.00 0.00 ? 43  ASP A OD1  10 
ATOM   6515  O  OD2  . ASP A 1 43 ? 9.116   0.638   -15.949 1.00 0.00 ? 43  ASP A OD2  10 
ATOM   6516  H  H    . ASP A 1 43 ? 6.608   -1.353  -12.217 1.00 0.00 ? 43  ASP A H    10 
ATOM   6517  H  HA   . ASP A 1 43 ? 6.725   -1.552  -15.130 1.00 0.00 ? 43  ASP A HA   10 
ATOM   6518  H  HB2  . ASP A 1 43 ? 7.806   0.364   -13.894 1.00 0.00 ? 43  ASP A HB2  10 
ATOM   6519  H  HB3  . ASP A 1 43 ? 8.954   -0.799  -13.234 1.00 0.00 ? 43  ASP A HB3  10 
ATOM   6520  N  N    . ILE A 1 44 ? 7.719   -3.803  -15.292 1.00 0.00 ? 44  ILE A N    10 
ATOM   6521  C  CA   . ILE A 1 44 ? 8.313   -5.126  -15.433 1.00 0.00 ? 44  ILE A CA   10 
ATOM   6522  C  C    . ILE A 1 44 ? 9.693   -5.043  -16.077 1.00 0.00 ? 44  ILE A C    10 
ATOM   6523  O  O    . ILE A 1 44 ? 9.816   -4.993  -17.300 1.00 0.00 ? 44  ILE A O    10 
ATOM   6524  C  CB   . ILE A 1 44 ? 7.422   -6.058  -16.275 1.00 0.00 ? 44  ILE A CB   10 
ATOM   6525  C  CG1  . ILE A 1 44 ? 6.044   -6.204  -15.626 1.00 0.00 ? 44  ILE A CG1  10 
ATOM   6526  C  CG2  . ILE A 1 44 ? 8.083   -7.418  -16.439 1.00 0.00 ? 44  ILE A CG2  10 
ATOM   6527  C  CD1  . ILE A 1 44 ? 6.089   -6.816  -14.243 1.00 0.00 ? 44  ILE A CD1  10 
ATOM   6528  H  H    . ILE A 1 44 ? 7.138   -3.462  -16.004 1.00 0.00 ? 44  ILE A H    10 
ATOM   6529  H  HA   . ILE A 1 44 ? 8.414   -5.553  -14.445 1.00 0.00 ? 44  ILE A HA   10 
ATOM   6530  H  HB   . ILE A 1 44 ? 7.306   -5.620  -17.255 1.00 0.00 ? 44  ILE A HB   10 
ATOM   6531  H  HG12 . ILE A 1 44 ? 5.586   -5.231  -15.543 1.00 0.00 ? 44  ILE A HG12 10 
ATOM   6532  H  HG13 . ILE A 1 44 ? 5.426   -6.836  -16.249 1.00 0.00 ? 44  ILE A HG13 10 
ATOM   6533  H  HG21 . ILE A 1 44 ? 9.107   -7.364  -16.100 1.00 0.00 ? 44  ILE A HG21 10 
ATOM   6534  H  HG22 . ILE A 1 44 ? 7.549   -8.151  -15.853 1.00 0.00 ? 44  ILE A HG22 10 
ATOM   6535  H  HG23 . ILE A 1 44 ? 8.063   -7.705  -17.480 1.00 0.00 ? 44  ILE A HG23 10 
ATOM   6536  H  HD11 . ILE A 1 44 ? 5.665   -6.124  -13.530 1.00 0.00 ? 44  ILE A HD11 10 
ATOM   6537  H  HD12 . ILE A 1 44 ? 5.522   -7.734  -14.237 1.00 0.00 ? 44  ILE A HD12 10 
ATOM   6538  H  HD13 . ILE A 1 44 ? 7.115   -7.024  -13.975 1.00 0.00 ? 44  ILE A HD13 10 
ATOM   6539  N  N    . SER A 1 45 ? 10.729  -5.030  -15.244 1.00 0.00 ? 45  SER A N    10 
ATOM   6540  C  CA   . SER A 1 45 ? 12.101  -4.951  -15.731 1.00 0.00 ? 45  SER A CA   10 
ATOM   6541  C  C    . SER A 1 45 ? 12.428  -6.141  -16.629 1.00 0.00 ? 45  SER A C    10 
ATOM   6542  O  O    . SER A 1 45 ? 13.006  -5.982  -17.703 1.00 0.00 ? 45  SER A O    10 
ATOM   6543  C  CB   . SER A 1 45 ? 13.080  -4.900  -14.557 1.00 0.00 ? 45  SER A CB   10 
ATOM   6544  O  OG   . SER A 1 45 ? 14.367  -4.489  -14.983 1.00 0.00 ? 45  SER A OG   10 
ATOM   6545  H  H    . SER A 1 45 ? 10.566  -5.072  -14.278 1.00 0.00 ? 45  SER A H    10 
ATOM   6546  H  HA   . SER A 1 45 ? 12.196  -4.043  -16.308 1.00 0.00 ? 45  SER A HA   10 
ATOM   6547  H  HB2  . SER A 1 45 ? 12.717  -4.200  -13.819 1.00 0.00 ? 45  SER A HB2  10 
ATOM   6548  H  HB3  . SER A 1 45 ? 13.157  -5.883  -14.114 1.00 0.00 ? 45  SER A HB3  10 
ATOM   6549  H  HG   . SER A 1 45 ? 14.374  -4.397  -15.939 1.00 0.00 ? 45  SER A HG   10 
ATOM   6550  N  N    . GLY A 1 46 ? 12.052  -7.334  -16.180 1.00 0.00 ? 46  GLY A N    10 
ATOM   6551  C  CA   . GLY A 1 46 ? 12.313  -8.534  -16.953 1.00 0.00 ? 46  GLY A CA   10 
ATOM   6552  C  C    . GLY A 1 46 ? 13.789  -8.730  -17.238 1.00 0.00 ? 46  GLY A C    10 
ATOM   6553  O  O    . GLY A 1 46 ? 14.292  -8.366  -18.302 1.00 0.00 ? 46  GLY A O    10 
ATOM   6554  H  H    . GLY A 1 46 ? 11.595  -7.401  -15.315 1.00 0.00 ? 46  GLY A H    10 
ATOM   6555  H  HA2  . GLY A 1 46 ? 11.946  -9.389  -16.406 1.00 0.00 ? 46  GLY A HA2  10 
ATOM   6556  H  HA3  . GLY A 1 46 ? 11.783  -8.466  -17.892 1.00 0.00 ? 46  GLY A HA3  10 
ATOM   6557  N  N    . PRO A 1 47 ? 14.510  -9.317  -16.271 1.00 0.00 ? 47  PRO A N    10 
ATOM   6558  C  CA   . PRO A 1 47 ? 15.948  -9.573  -16.400 1.00 0.00 ? 47  PRO A CA   10 
ATOM   6559  C  C    . PRO A 1 47 ? 16.253  -10.661 -17.424 1.00 0.00 ? 47  PRO A C    10 
ATOM   6560  O  O    . PRO A 1 47 ? 17.412  -11.017 -17.639 1.00 0.00 ? 47  PRO A O    10 
ATOM   6561  C  CB   . PRO A 1 47 ? 16.354  -10.030 -14.997 1.00 0.00 ? 47  PRO A CB   10 
ATOM   6562  C  CG   . PRO A 1 47 ? 15.106  -10.587 -14.404 1.00 0.00 ? 47  PRO A CG   10 
ATOM   6563  C  CD   . PRO A 1 47 ? 13.977  -9.777  -14.978 1.00 0.00 ? 47  PRO A CD   10 
ATOM   6564  H  HA   . PRO A 1 47 ? 16.489  -8.675  -16.659 1.00 0.00 ? 47  PRO A HA   10 
ATOM   6565  H  HB2  . PRO A 1 47 ? 17.127  -10.782 -15.070 1.00 0.00 ? 47  PRO A HB2  10 
ATOM   6566  H  HB3  . PRO A 1 47 ? 16.717  -9.186  -14.431 1.00 0.00 ? 47  PRO A HB3  10 
ATOM   6567  H  HG2  . PRO A 1 47 ? 15.000  -11.626 -14.680 1.00 0.00 ? 47  PRO A HG2  10 
ATOM   6568  H  HG3  . PRO A 1 47 ? 15.132  -10.484 -13.329 1.00 0.00 ? 47  PRO A HG3  10 
ATOM   6569  H  HD2  . PRO A 1 47 ? 13.102  -10.395 -15.119 1.00 0.00 ? 47  PRO A HD2  10 
ATOM   6570  H  HD3  . PRO A 1 47 ? 13.750  -8.939  -14.336 1.00 0.00 ? 47  PRO A HD3  10 
ATOM   6571  N  N    . SER A 1 48 ? 15.207  -11.187 -18.053 1.00 0.00 ? 48  SER A N    10 
ATOM   6572  C  CA   . SER A 1 48 ? 15.363  -12.237 -19.052 1.00 0.00 ? 48  SER A CA   10 
ATOM   6573  C  C    . SER A 1 48 ? 16.307  -11.792 -20.165 1.00 0.00 ? 48  SER A C    10 
ATOM   6574  O  O    . SER A 1 48 ? 16.409  -10.603 -20.468 1.00 0.00 ? 48  SER A O    10 
ATOM   6575  C  CB   . SER A 1 48 ? 14.003  -12.617 -19.641 1.00 0.00 ? 48  SER A CB   10 
ATOM   6576  O  OG   . SER A 1 48 ? 13.106  -13.032 -18.627 1.00 0.00 ? 48  SER A OG   10 
ATOM   6577  H  H    . SER A 1 48 ? 14.307  -10.862 -17.837 1.00 0.00 ? 48  SER A H    10 
ATOM   6578  H  HA   . SER A 1 48 ? 15.787  -13.101 -18.561 1.00 0.00 ? 48  SER A HA   10 
ATOM   6579  H  HB2  . SER A 1 48 ? 13.583  -11.762 -20.149 1.00 0.00 ? 48  SER A HB2  10 
ATOM   6580  H  HB3  . SER A 1 48 ? 14.133  -13.426 -20.345 1.00 0.00 ? 48  SER A HB3  10 
ATOM   6581  H  HG   . SER A 1 48 ? 13.600  -13.416 -17.899 1.00 0.00 ? 48  SER A HG   10 
ATOM   6582  N  N    . SER A 1 49 ? 16.994  -12.755 -20.770 1.00 0.00 ? 49  SER A N    10 
ATOM   6583  C  CA   . SER A 1 49 ? 17.932  -12.463 -21.848 1.00 0.00 ? 49  SER A CA   10 
ATOM   6584  C  C    . SER A 1 49 ? 18.062  -13.654 -22.793 1.00 0.00 ? 49  SER A C    10 
ATOM   6585  O  O    . SER A 1 49 ? 18.146  -14.801 -22.357 1.00 0.00 ? 49  SER A O    10 
ATOM   6586  C  CB   . SER A 1 49 ? 19.304  -12.102 -21.274 1.00 0.00 ? 49  SER A CB   10 
ATOM   6587  O  OG   . SER A 1 49 ? 19.746  -13.083 -20.353 1.00 0.00 ? 49  SER A OG   10 
ATOM   6588  H  H    . SER A 1 49 ? 16.869  -13.684 -20.483 1.00 0.00 ? 49  SER A H    10 
ATOM   6589  H  HA   . SER A 1 49 ? 17.549  -11.619 -22.401 1.00 0.00 ? 49  SER A HA   10 
ATOM   6590  H  HB2  . SER A 1 49 ? 20.020  -12.031 -22.078 1.00 0.00 ? 49  SER A HB2  10 
ATOM   6591  H  HB3  . SER A 1 49 ? 19.239  -11.151 -20.765 1.00 0.00 ? 49  SER A HB3  10 
ATOM   6592  H  HG   . SER A 1 49 ? 18.992  -13.442 -19.880 1.00 0.00 ? 49  SER A HG   10 
ATOM   6593  N  N    . GLY A 1 50 ? 18.077  -13.371 -24.092 1.00 0.00 ? 50  GLY A N    10 
ATOM   6594  C  CA   . GLY A 1 50 ? 18.196  -14.428 -25.080 1.00 0.00 ? 50  GLY A CA   10 
ATOM   6595  C  C    . GLY A 1 50 ? 17.019  -14.464 -26.035 1.00 0.00 ? 50  GLY A C    10 
ATOM   6596  O  O    . GLY A 1 50 ? 15.877  -14.455 -25.579 1.00 0.00 ? 50  GLY A O    10 
ATOM   6597  H  H    . GLY A 1 50 ? 18.006  -12.438 -24.382 1.00 0.00 ? 50  GLY A H    10 
ATOM   6598  H  HA2  . GLY A 1 50 ? 19.102  -14.275 -25.647 1.00 0.00 ? 50  GLY A HA2  10 
ATOM   6599  H  HA3  . GLY A 1 50 ? 18.258  -15.377 -24.568 1.00 0.00 ? 50  GLY A HA3  10 
HETATM 6600  ZN ZN   . ZN  B 2 .  ? 0.515   -2.413  -7.111  1.00 0.00 ? 201 ZN  A ZN   10 
ATOM   6601  N  N    . GLY A 1 1  ? 34.764  9.683   2.598   1.00 0.00 ? 1   GLY A N    11 
ATOM   6602  C  CA   . GLY A 1 1  ? 36.004  9.721   3.350   1.00 0.00 ? 1   GLY A CA   11 
ATOM   6603  C  C    . GLY A 1 1  ? 37.034  10.639  2.723   1.00 0.00 ? 1   GLY A C    11 
ATOM   6604  O  O    . GLY A 1 1  ? 37.253  10.602  1.512   1.00 0.00 ? 1   GLY A O    11 
ATOM   6605  H  H1   . GLY A 1 1  ? 34.093  10.386  2.727   1.00 0.00 ? 1   GLY A H1   11 
ATOM   6606  H  HA2  . GLY A 1 1  ? 35.794  10.063  4.352   1.00 0.00 ? 1   GLY A HA2  11 
ATOM   6607  H  HA3  . GLY A 1 1  ? 36.412  8.722   3.399   1.00 0.00 ? 1   GLY A HA3  11 
ATOM   6608  N  N    . SER A 1 2  ? 37.667  11.466  3.548   1.00 0.00 ? 2   SER A N    11 
ATOM   6609  C  CA   . SER A 1 2  ? 38.676  12.403  3.066   1.00 0.00 ? 2   SER A CA   11 
ATOM   6610  C  C    . SER A 1 2  ? 38.078  13.371  2.050   1.00 0.00 ? 2   SER A C    11 
ATOM   6611  O  O    . SER A 1 2  ? 38.692  13.671  1.027   1.00 0.00 ? 2   SER A O    11 
ATOM   6612  C  CB   . SER A 1 2  ? 39.847  11.645  2.438   1.00 0.00 ? 2   SER A CB   11 
ATOM   6613  O  OG   . SER A 1 2  ? 40.970  12.492  2.267   1.00 0.00 ? 2   SER A OG   11 
ATOM   6614  H  H    . SER A 1 2  ? 37.449  11.448  4.503   1.00 0.00 ? 2   SER A H    11 
ATOM   6615  H  HA   . SER A 1 2  ? 39.037  12.966  3.914   1.00 0.00 ? 2   SER A HA   11 
ATOM   6616  H  HB2  . SER A 1 2  ? 40.126  10.823  3.079   1.00 0.00 ? 2   SER A HB2  11 
ATOM   6617  H  HB3  . SER A 1 2  ? 39.548  11.263  1.472   1.00 0.00 ? 2   SER A HB3  11 
ATOM   6618  H  HG   . SER A 1 2  ? 41.170  12.931  3.097   1.00 0.00 ? 2   SER A HG   11 
ATOM   6619  N  N    . SER A 1 3  ? 36.875  13.856  2.341   1.00 0.00 ? 3   SER A N    11 
ATOM   6620  C  CA   . SER A 1 3  ? 36.191  14.787  1.452   1.00 0.00 ? 3   SER A CA   11 
ATOM   6621  C  C    . SER A 1 3  ? 35.214  15.663  2.230   1.00 0.00 ? 3   SER A C    11 
ATOM   6622  O  O    . SER A 1 3  ? 34.990  15.455  3.422   1.00 0.00 ? 3   SER A O    11 
ATOM   6623  C  CB   . SER A 1 3  ? 35.446  14.024  0.355   1.00 0.00 ? 3   SER A CB   11 
ATOM   6624  O  OG   . SER A 1 3  ? 34.491  13.136  0.910   1.00 0.00 ? 3   SER A OG   11 
ATOM   6625  H  H    . SER A 1 3  ? 36.437  13.578  3.173   1.00 0.00 ? 3   SER A H    11 
ATOM   6626  H  HA   . SER A 1 3  ? 36.938  15.419  0.995   1.00 0.00 ? 3   SER A HA   11 
ATOM   6627  H  HB2  . SER A 1 3  ? 34.936  14.726  -0.286  1.00 0.00 ? 3   SER A HB2  11 
ATOM   6628  H  HB3  . SER A 1 3  ? 36.155  13.453  -0.227  1.00 0.00 ? 3   SER A HB3  11 
ATOM   6629  H  HG   . SER A 1 3  ? 33.607  13.462  0.729   1.00 0.00 ? 3   SER A HG   11 
ATOM   6630  N  N    . GLY A 1 4  ? 34.634  16.645  1.546   1.00 0.00 ? 4   GLY A N    11 
ATOM   6631  C  CA   . GLY A 1 4  ? 33.688  17.539  2.188   1.00 0.00 ? 4   GLY A CA   11 
ATOM   6632  C  C    . GLY A 1 4  ? 32.306  16.930  2.309   1.00 0.00 ? 4   GLY A C    11 
ATOM   6633  O  O    . GLY A 1 4  ? 31.383  17.321  1.595   1.00 0.00 ? 4   GLY A O    11 
ATOM   6634  H  H    . GLY A 1 4  ? 34.851  16.763  0.598   1.00 0.00 ? 4   GLY A H    11 
ATOM   6635  H  HA2  . GLY A 1 4  ? 34.052  17.780  3.176   1.00 0.00 ? 4   GLY A HA2  11 
ATOM   6636  H  HA3  . GLY A 1 4  ? 33.619  18.447  1.609   1.00 0.00 ? 4   GLY A HA3  11 
ATOM   6637  N  N    . SER A 1 5  ? 32.162  15.968  3.215   1.00 0.00 ? 5   SER A N    11 
ATOM   6638  C  CA   . SER A 1 5  ? 30.882  15.299  3.423   1.00 0.00 ? 5   SER A CA   11 
ATOM   6639  C  C    . SER A 1 5  ? 30.335  15.595  4.816   1.00 0.00 ? 5   SER A C    11 
ATOM   6640  O  O    . SER A 1 5  ? 29.154  15.901  4.979   1.00 0.00 ? 5   SER A O    11 
ATOM   6641  C  CB   . SER A 1 5  ? 31.035  13.789  3.233   1.00 0.00 ? 5   SER A CB   11 
ATOM   6642  O  OG   . SER A 1 5  ? 31.631  13.490  1.982   1.00 0.00 ? 5   SER A OG   11 
ATOM   6643  H  H    . SER A 1 5  ? 32.935  15.699  3.754   1.00 0.00 ? 5   SER A H    11 
ATOM   6644  H  HA   . SER A 1 5  ? 30.187  15.677  2.688   1.00 0.00 ? 5   SER A HA   11 
ATOM   6645  H  HB2  . SER A 1 5  ? 31.658  13.391  4.019   1.00 0.00 ? 5   SER A HB2  11 
ATOM   6646  H  HB3  . SER A 1 5  ? 30.061  13.323  3.275   1.00 0.00 ? 5   SER A HB3  11 
ATOM   6647  H  HG   . SER A 1 5  ? 32.169  12.699  2.065   1.00 0.00 ? 5   SER A HG   11 
ATOM   6648  N  N    . SER A 1 6  ? 31.203  15.500  5.818   1.00 0.00 ? 6   SER A N    11 
ATOM   6649  C  CA   . SER A 1 6  ? 30.808  15.754  7.199   1.00 0.00 ? 6   SER A CA   11 
ATOM   6650  C  C    . SER A 1 6  ? 31.185  17.170  7.621   1.00 0.00 ? 6   SER A C    11 
ATOM   6651  O  O    . SER A 1 6  ? 32.364  17.503  7.734   1.00 0.00 ? 6   SER A O    11 
ATOM   6652  C  CB   . SER A 1 6  ? 31.466  14.738  8.135   1.00 0.00 ? 6   SER A CB   11 
ATOM   6653  O  OG   . SER A 1 6  ? 30.804  14.696  9.387   1.00 0.00 ? 6   SER A OG   11 
ATOM   6654  H  H    . SER A 1 6  ? 32.132  15.252  5.624   1.00 0.00 ? 6   SER A H    11 
ATOM   6655  H  HA   . SER A 1 6  ? 29.735  15.646  7.261   1.00 0.00 ? 6   SER A HA   11 
ATOM   6656  H  HB2  . SER A 1 6  ? 31.423  13.758  7.685   1.00 0.00 ? 6   SER A HB2  11 
ATOM   6657  H  HB3  . SER A 1 6  ? 32.497  15.016  8.295   1.00 0.00 ? 6   SER A HB3  11 
ATOM   6658  H  HG   . SER A 1 6  ? 30.040  14.118  9.326   1.00 0.00 ? 6   SER A HG   11 
ATOM   6659  N  N    . GLY A 1 7  ? 30.174  18.002  7.852   1.00 0.00 ? 7   GLY A N    11 
ATOM   6660  C  CA   . GLY A 1 7  ? 30.419  19.373  8.259   1.00 0.00 ? 7   GLY A CA   11 
ATOM   6661  C  C    . GLY A 1 7  ? 29.402  20.339  7.683   1.00 0.00 ? 7   GLY A C    11 
ATOM   6662  O  O    . GLY A 1 7  ? 28.195  20.135  7.819   1.00 0.00 ? 7   GLY A O    11 
ATOM   6663  H  H    . GLY A 1 7  ? 29.253  17.682  7.746   1.00 0.00 ? 7   GLY A H    11 
ATOM   6664  H  HA2  . GLY A 1 7  ? 30.383  19.429  9.337   1.00 0.00 ? 7   GLY A HA2  11 
ATOM   6665  H  HA3  . GLY A 1 7  ? 31.404  19.665  7.926   1.00 0.00 ? 7   GLY A HA3  11 
ATOM   6666  N  N    . CYS A 1 8  ? 29.890  21.394  7.040   1.00 0.00 ? 8   CYS A N    11 
ATOM   6667  C  CA   . CYS A 1 8  ? 29.015  22.398  6.443   1.00 0.00 ? 8   CYS A CA   11 
ATOM   6668  C  C    . CYS A 1 8  ? 27.798  21.743  5.798   1.00 0.00 ? 8   CYS A C    11 
ATOM   6669  O  O    . CYS A 1 8  ? 27.922  20.749  5.081   1.00 0.00 ? 8   CYS A O    11 
ATOM   6670  C  CB   . CYS A 1 8  ? 29.780  23.217  5.403   1.00 0.00 ? 8   CYS A CB   11 
ATOM   6671  S  SG   . CYS A 1 8  ? 30.824  24.514  6.107   1.00 0.00 ? 8   CYS A SG   11 
ATOM   6672  H  H    . CYS A 1 8  ? 30.861  21.503  6.965   1.00 0.00 ? 8   CYS A H    11 
ATOM   6673  H  HA   . CYS A 1 8  ? 28.680  23.055  7.231   1.00 0.00 ? 8   CYS A HA   11 
ATOM   6674  H  HB2  . CYS A 1 8  ? 30.417  22.557  4.833   1.00 0.00 ? 8   CYS A HB2  11 
ATOM   6675  H  HB3  . CYS A 1 8  ? 29.072  23.688  4.737   1.00 0.00 ? 8   CYS A HB3  11 
ATOM   6676  H  HG   . CYS A 1 8  ? 30.389  24.770  7.331   1.00 0.00 ? 8   CYS A HG   11 
ATOM   6677  N  N    . CYS A 1 9  ? 26.623  22.305  6.060   1.00 0.00 ? 9   CYS A N    11 
ATOM   6678  C  CA   . CYS A 1 9  ? 25.382  21.774  5.507   1.00 0.00 ? 9   CYS A CA   11 
ATOM   6679  C  C    . CYS A 1 9  ? 24.394  22.898  5.210   1.00 0.00 ? 9   CYS A C    11 
ATOM   6680  O  O    . CYS A 1 9  ? 24.534  24.012  5.716   1.00 0.00 ? 9   CYS A O    11 
ATOM   6681  C  CB   . CYS A 1 9  ? 24.755  20.771  6.476   1.00 0.00 ? 9   CYS A CB   11 
ATOM   6682  S  SG   . CYS A 1 9  ? 25.443  19.103  6.360   1.00 0.00 ? 9   CYS A SG   11 
ATOM   6683  H  H    . CYS A 1 9  ? 26.588  23.095  6.639   1.00 0.00 ? 9   CYS A H    11 
ATOM   6684  H  HA   . CYS A 1 9  ? 25.621  21.268  4.584   1.00 0.00 ? 9   CYS A HA   11 
ATOM   6685  H  HB2  . CYS A 1 9  ? 24.905  21.118  7.488   1.00 0.00 ? 9   CYS A HB2  11 
ATOM   6686  H  HB3  . CYS A 1 9  ? 23.695  20.706  6.279   1.00 0.00 ? 9   CYS A HB3  11 
ATOM   6687  H  HG   . CYS A 1 9  ? 26.279  18.934  7.372   1.00 0.00 ? 9   CYS A HG   11 
ATOM   6688  N  N    . LEU A 1 10 ? 23.397  22.600  4.384   1.00 0.00 ? 10  LEU A N    11 
ATOM   6689  C  CA   . LEU A 1 10 ? 22.386  23.586  4.018   1.00 0.00 ? 10  LEU A CA   11 
ATOM   6690  C  C    . LEU A 1 10 ? 21.162  23.472  4.921   1.00 0.00 ? 10  LEU A C    11 
ATOM   6691  O  O    . LEU A 1 10 ? 20.753  22.381  5.319   1.00 0.00 ? 10  LEU A O    11 
ATOM   6692  C  CB   . LEU A 1 10 ? 21.974  23.403  2.556   1.00 0.00 ? 10  LEU A CB   11 
ATOM   6693  C  CG   . LEU A 1 10 ? 23.106  23.449  1.529   1.00 0.00 ? 10  LEU A CG   11 
ATOM   6694  C  CD1  . LEU A 1 10 ? 23.812  22.104  1.451   1.00 0.00 ? 10  LEU A CD1  11 
ATOM   6695  C  CD2  . LEU A 1 10 ? 22.571  23.852  0.163   1.00 0.00 ? 10  LEU A CD2  11 
ATOM   6696  H  H    . LEU A 1 10 ? 23.338  21.695  4.012   1.00 0.00 ? 10  LEU A H    11 
ATOM   6697  H  HA   . LEU A 1 10 ? 22.820  24.567  4.141   1.00 0.00 ? 10  LEU A HA   11 
ATOM   6698  H  HB2  . LEU A 1 10 ? 21.486  22.445  2.467   1.00 0.00 ? 10  LEU A HB2  11 
ATOM   6699  H  HB3  . LEU A 1 10 ? 21.272  24.187  2.311   1.00 0.00 ? 10  LEU A HB3  11 
ATOM   6700  H  HG   . LEU A 1 10 ? 23.833  24.189  1.836   1.00 0.00 ? 10  LEU A HG   11 
ATOM   6701  H  HD11 . LEU A 1 10 ? 23.080  21.311  1.489   1.00 0.00 ? 10  LEU A HD11 11 
ATOM   6702  H  HD12 . LEU A 1 10 ? 24.492  22.006  2.284   1.00 0.00 ? 10  LEU A HD12 11 
ATOM   6703  H  HD13 . LEU A 1 10 ? 24.365  22.041  0.526   1.00 0.00 ? 10  LEU A HD13 11 
ATOM   6704  H  HD21 . LEU A 1 10 ? 22.447  24.924  0.127   1.00 0.00 ? 10  LEU A HD21 11 
ATOM   6705  H  HD22 . LEU A 1 10 ? 21.616  23.374  -0.005  1.00 0.00 ? 10  LEU A HD22 11 
ATOM   6706  H  HD23 . LEU A 1 10 ? 23.267  23.544  -0.602  1.00 0.00 ? 10  LEU A HD23 11 
ATOM   6707  N  N    . PRO A 1 11 ? 20.562  24.625  5.252   1.00 0.00 ? 11  PRO A N    11 
ATOM   6708  C  CA   . PRO A 1 11 ? 19.374  24.681  6.109   1.00 0.00 ? 11  PRO A CA   11 
ATOM   6709  C  C    . PRO A 1 11 ? 18.135  24.120  5.421   1.00 0.00 ? 11  PRO A C    11 
ATOM   6710  O  O    . PRO A 1 11 ? 17.998  24.172  4.198   1.00 0.00 ? 11  PRO A O    11 
ATOM   6711  C  CB   . PRO A 1 11 ? 19.204  26.178  6.381   1.00 0.00 ? 11  PRO A CB   11 
ATOM   6712  C  CG   . PRO A 1 11 ? 19.852  26.850  5.220   1.00 0.00 ? 11  PRO A CG   11 
ATOM   6713  C  CD   . PRO A 1 11 ? 20.996  25.962  4.814   1.00 0.00 ? 11  PRO A CD   11 
ATOM   6714  H  HA   . PRO A 1 11 ? 19.533  24.160  7.042   1.00 0.00 ? 11  PRO A HA   11 
ATOM   6715  H  HB2  . PRO A 1 11 ? 18.151  26.418  6.440   1.00 0.00 ? 11  PRO A HB2  11 
ATOM   6716  H  HB3  . PRO A 1 11 ? 19.690  26.437  7.309   1.00 0.00 ? 11  PRO A HB3  11 
ATOM   6717  H  HG2  . PRO A 1 11 ? 19.146  26.946  4.410   1.00 0.00 ? 11  PRO A HG2  11 
ATOM   6718  H  HG3  . PRO A 1 11 ? 20.220  27.821  5.517   1.00 0.00 ? 11  PRO A HG3  11 
ATOM   6719  H  HD2  . PRO A 1 11 ? 21.135  25.991  3.743   1.00 0.00 ? 11  PRO A HD2  11 
ATOM   6720  H  HD3  . PRO A 1 11 ? 21.902  26.258  5.322   1.00 0.00 ? 11  PRO A HD3  11 
ATOM   6721  N  N    . PRO A 1 12 ? 17.210  23.571  6.221   1.00 0.00 ? 12  PRO A N    11 
ATOM   6722  C  CA   . PRO A 1 12 ? 15.965  22.990  5.710   1.00 0.00 ? 12  PRO A CA   11 
ATOM   6723  C  C    . PRO A 1 12 ? 15.010  24.049  5.170   1.00 0.00 ? 12  PRO A C    11 
ATOM   6724  O  O    . PRO A 1 12 ? 14.247  24.653  5.924   1.00 0.00 ? 12  PRO A O    11 
ATOM   6725  C  CB   . PRO A 1 12 ? 15.362  22.304  6.939   1.00 0.00 ? 12  PRO A CB   11 
ATOM   6726  C  CG   . PRO A 1 12 ? 15.927  23.045  8.101   1.00 0.00 ? 12  PRO A CG   11 
ATOM   6727  C  CD   . PRO A 1 12 ? 17.308  23.475  7.688   1.00 0.00 ? 12  PRO A CD   11 
ATOM   6728  H  HA   . PRO A 1 12 ? 16.156  22.254  4.943   1.00 0.00 ? 12  PRO A HA   11 
ATOM   6729  H  HB2  . PRO A 1 12 ? 14.285  22.382  6.906   1.00 0.00 ? 12  PRO A HB2  11 
ATOM   6730  H  HB3  . PRO A 1 12 ? 15.654  21.265  6.954   1.00 0.00 ? 12  PRO A HB3  11 
ATOM   6731  H  HG2  . PRO A 1 12 ? 15.316  23.907  8.320   1.00 0.00 ? 12  PRO A HG2  11 
ATOM   6732  H  HG3  . PRO A 1 12 ? 15.980  22.393  8.961   1.00 0.00 ? 12  PRO A HG3  11 
ATOM   6733  H  HD2  . PRO A 1 12 ? 17.551  24.433  8.121   1.00 0.00 ? 12  PRO A HD2  11 
ATOM   6734  H  HD3  . PRO A 1 12 ? 18.037  22.732  7.977   1.00 0.00 ? 12  PRO A HD3  11 
ATOM   6735  N  N    . ALA A 1 13 ? 15.058  24.270  3.861   1.00 0.00 ? 13  ALA A N    11 
ATOM   6736  C  CA   . ALA A 1 13 ? 14.195  25.255  3.220   1.00 0.00 ? 13  ALA A CA   11 
ATOM   6737  C  C    . ALA A 1 13 ? 13.474  24.654  2.018   1.00 0.00 ? 13  ALA A C    11 
ATOM   6738  O  O    . ALA A 1 13 ? 12.245  24.655  1.952   1.00 0.00 ? 13  ALA A O    11 
ATOM   6739  C  CB   . ALA A 1 13 ? 15.005  26.471  2.798   1.00 0.00 ? 13  ALA A CB   11 
ATOM   6740  H  H    . ALA A 1 13 ? 15.687  23.757  3.312   1.00 0.00 ? 13  ALA A H    11 
ATOM   6741  H  HA   . ALA A 1 13 ? 13.460  25.576  3.944   1.00 0.00 ? 13  ALA A HA   11 
ATOM   6742  H  HB1  . ALA A 1 13 ? 14.925  26.603  1.728   1.00 0.00 ? 13  ALA A HB1  11 
ATOM   6743  H  HB2  . ALA A 1 13 ? 14.624  27.349  3.298   1.00 0.00 ? 13  ALA A HB2  11 
ATOM   6744  H  HB3  . ALA A 1 13 ? 16.041  26.324  3.066   1.00 0.00 ? 13  ALA A HB3  11 
ATOM   6745  N  N    . THR A 1 14 ? 14.248  24.140  1.066   1.00 0.00 ? 14  THR A N    11 
ATOM   6746  C  CA   . THR A 1 14 ? 13.683  23.537  -0.135  1.00 0.00 ? 14  THR A CA   11 
ATOM   6747  C  C    . THR A 1 14 ? 13.911  22.030  -0.153  1.00 0.00 ? 14  THR A C    11 
ATOM   6748  O  O    . THR A 1 14 ? 14.805  21.519  0.522   1.00 0.00 ? 14  THR A O    11 
ATOM   6749  C  CB   . THR A 1 14 ? 14.290  24.152  -1.410  1.00 0.00 ? 14  THR A CB   11 
ATOM   6750  O  OG1  . THR A 1 14 ? 15.703  23.920  -1.442  1.00 0.00 ? 14  THR A OG1  11 
ATOM   6751  C  CG2  . THR A 1 14 ? 14.016  25.647  -1.474  1.00 0.00 ? 14  THR A CG2  11 
ATOM   6752  H  H    . THR A 1 14 ? 15.221  24.168  1.175   1.00 0.00 ? 14  THR A H    11 
ATOM   6753  H  HA   . THR A 1 14 ? 12.620  23.731  -0.138  1.00 0.00 ? 14  THR A HA   11 
ATOM   6754  H  HB   . THR A 1 14 ? 13.836  23.681  -2.270  1.00 0.00 ? 14  THR A HB   11 
ATOM   6755  H  HG1  . THR A 1 14 ? 15.875  22.981  -1.338  1.00 0.00 ? 14  THR A HG1  11 
ATOM   6756  H  HG21 . THR A 1 14 ? 14.147  25.994  -2.488  1.00 0.00 ? 14  THR A HG21 11 
ATOM   6757  H  HG22 . THR A 1 14 ? 14.703  26.167  -0.823  1.00 0.00 ? 14  THR A HG22 11 
ATOM   6758  H  HG23 . THR A 1 14 ? 13.002  25.840  -1.156  1.00 0.00 ? 14  THR A HG23 11 
ATOM   6759  N  N    . HIS A 1 15 ? 13.097  21.323  -0.931  1.00 0.00 ? 15  HIS A N    11 
ATOM   6760  C  CA   . HIS A 1 15 ? 13.212  19.873  -1.038  1.00 0.00 ? 15  HIS A CA   11 
ATOM   6761  C  C    . HIS A 1 15 ? 13.138  19.428  -2.495  1.00 0.00 ? 15  HIS A C    11 
ATOM   6762  O  O    . HIS A 1 15 ? 12.771  20.208  -3.374  1.00 0.00 ? 15  HIS A O    11 
ATOM   6763  C  CB   . HIS A 1 15 ? 12.108  19.192  -0.228  1.00 0.00 ? 15  HIS A CB   11 
ATOM   6764  C  CG   . HIS A 1 15 ? 12.463  18.983  1.212   1.00 0.00 ? 15  HIS A CG   11 
ATOM   6765  N  ND1  . HIS A 1 15 ? 13.596  18.310  1.618   1.00 0.00 ? 15  HIS A ND1  11 
ATOM   6766  C  CD2  . HIS A 1 15 ? 11.828  19.365  2.345   1.00 0.00 ? 15  HIS A CD2  11 
ATOM   6767  C  CE1  . HIS A 1 15 ? 13.641  18.286  2.938   1.00 0.00 ? 15  HIS A CE1  11 
ATOM   6768  N  NE2  . HIS A 1 15 ? 12.580  18.919  3.403   1.00 0.00 ? 15  HIS A NE2  11 
ATOM   6769  H  H    . HIS A 1 15 ? 12.405  21.787  -1.445  1.00 0.00 ? 15  HIS A H    11 
ATOM   6770  H  HA   . HIS A 1 15 ? 14.171  19.585  -0.635  1.00 0.00 ? 15  HIS A HA   11 
ATOM   6771  H  HB2  . HIS A 1 15 ? 11.216  19.801  -0.265  1.00 0.00 ? 15  HIS A HB2  11 
ATOM   6772  H  HB3  . HIS A 1 15 ? 11.896  18.225  -0.662  1.00 0.00 ? 15  HIS A HB3  11 
ATOM   6773  H  HD1  . HIS A 1 15 ? 14.266  17.909  1.026   1.00 0.00 ? 15  HIS A HD1  11 
ATOM   6774  H  HD2  . HIS A 1 15 ? 10.900  19.917  2.406   1.00 0.00 ? 15  HIS A HD2  11 
ATOM   6775  H  HE1  . HIS A 1 15 ? 14.415  17.826  3.535   1.00 0.00 ? 15  HIS A HE1  11 
ATOM   6776  N  N    . ARG A 1 16 ? 13.489  18.170  -2.744  1.00 0.00 ? 16  ARG A N    11 
ATOM   6777  C  CA   . ARG A 1 16 ? 13.465  17.623  -4.095  1.00 0.00 ? 16  ARG A CA   11 
ATOM   6778  C  C    . ARG A 1 16 ? 12.256  16.712  -4.290  1.00 0.00 ? 16  ARG A C    11 
ATOM   6779  O  O    . ARG A 1 16 ? 11.908  15.907  -3.426  1.00 0.00 ? 16  ARG A O    11 
ATOM   6780  C  CB   . ARG A 1 16 ? 14.753  16.847  -4.377  1.00 0.00 ? 16  ARG A CB   11 
ATOM   6781  C  CG   . ARG A 1 16 ? 15.110  16.777  -5.853  1.00 0.00 ? 16  ARG A CG   11 
ATOM   6782  C  CD   . ARG A 1 16 ? 16.566  16.387  -6.055  1.00 0.00 ? 16  ARG A CD   11 
ATOM   6783  N  NE   . ARG A 1 16 ? 17.481  17.352  -5.450  1.00 0.00 ? 16  ARG A NE   11 
ATOM   6784  C  CZ   . ARG A 1 16 ? 18.782  17.133  -5.294  1.00 0.00 ? 16  ARG A CZ   11 
ATOM   6785  N  NH1  . ARG A 1 16 ? 19.318  15.990  -5.697  1.00 0.00 ? 16  ARG A NH1  11 
ATOM   6786  N  NH2  . ARG A 1 16 ? 19.549  18.060  -4.735  1.00 0.00 ? 16  ARG A NH2  11 
ATOM   6787  H  H    . ARG A 1 16 ? 13.773  17.597  -2.001  1.00 0.00 ? 16  ARG A H    11 
ATOM   6788  H  HA   . ARG A 1 16 ? 13.394  18.449  -4.786  1.00 0.00 ? 16  ARG A HA   11 
ATOM   6789  H  HB2  . ARG A 1 16 ? 15.569  17.324  -3.854  1.00 0.00 ? 16  ARG A HB2  11 
ATOM   6790  H  HB3  . ARG A 1 16 ? 14.640  15.839  -4.008  1.00 0.00 ? 16  ARG A HB3  11 
ATOM   6791  H  HG2  . ARG A 1 16 ? 14.482  16.040  -6.331  1.00 0.00 ? 16  ARG A HG2  11 
ATOM   6792  H  HG3  . ARG A 1 16 ? 14.940  17.744  -6.301  1.00 0.00 ? 16  ARG A HG3  11 
ATOM   6793  H  HD2  . ARG A 1 16 ? 16.732  15.419  -5.606  1.00 0.00 ? 16  ARG A HD2  11 
ATOM   6794  H  HD3  . ARG A 1 16 ? 16.766  16.331  -7.115  1.00 0.00 ? 16  ARG A HD3  11 
ATOM   6795  H  HE   . ARG A 1 16 ? 17.105  18.203  -5.145  1.00 0.00 ? 16  ARG A HE   11 
ATOM   6796  H  HH11 . ARG A 1 16 ? 18.743  15.290  -6.120  1.00 0.00 ? 16  ARG A HH11 11 
ATOM   6797  H  HH12 . ARG A 1 16 ? 20.298  15.829  -5.579  1.00 0.00 ? 16  ARG A HH12 11 
ATOM   6798  H  HH21 . ARG A 1 16 ? 19.148  18.924  -4.430  1.00 0.00 ? 16  ARG A HH21 11 
ATOM   6799  H  HH22 . ARG A 1 16 ? 20.527  17.895  -4.618  1.00 0.00 ? 16  ARG A HH22 11 
ATOM   6800  N  N    . PRO A 1 17 ? 11.600  16.841  -5.453  1.00 0.00 ? 17  PRO A N    11 
ATOM   6801  C  CA   . PRO A 1 17 ? 10.421  16.037  -5.789  1.00 0.00 ? 17  PRO A CA   11 
ATOM   6802  C  C    . PRO A 1 17 ? 10.768  14.573  -6.034  1.00 0.00 ? 17  PRO A C    11 
ATOM   6803  O  O    . PRO A 1 17 ? 11.296  14.217  -7.088  1.00 0.00 ? 17  PRO A O    11 
ATOM   6804  C  CB   . PRO A 1 17 ? 9.905   16.687  -7.076  1.00 0.00 ? 17  PRO A CB   11 
ATOM   6805  C  CG   . PRO A 1 17 ? 11.103  17.333  -7.681  1.00 0.00 ? 17  PRO A CG   11 
ATOM   6806  C  CD   . PRO A 1 17 ? 11.960  17.779  -6.529  1.00 0.00 ? 17  PRO A CD   11 
ATOM   6807  H  HA   . PRO A 1 17 ? 9.664   16.103  -5.022  1.00 0.00 ? 17  PRO A HA   11 
ATOM   6808  H  HB2  . PRO A 1 17 ? 9.493   15.927  -7.726  1.00 0.00 ? 17  PRO A HB2  11 
ATOM   6809  H  HB3  . PRO A 1 17 ? 9.144   17.414  -6.836  1.00 0.00 ? 17  PRO A HB3  11 
ATOM   6810  H  HG2  . PRO A 1 17 ? 11.636  16.619  -8.291  1.00 0.00 ? 17  PRO A HG2  11 
ATOM   6811  H  HG3  . PRO A 1 17 ? 10.801  18.183  -8.275  1.00 0.00 ? 17  PRO A HG3  11 
ATOM   6812  H  HD2  . PRO A 1 17 ? 13.006  17.694  -6.782  1.00 0.00 ? 17  PRO A HD2  11 
ATOM   6813  H  HD3  . PRO A 1 17 ? 11.718  18.795  -6.251  1.00 0.00 ? 17  PRO A HD3  11 
ATOM   6814  N  N    . HIS A 1 18 ? 10.467  13.726  -5.055  1.00 0.00 ? 18  HIS A N    11 
ATOM   6815  C  CA   . HIS A 1 18 ? 10.746  12.299  -5.165  1.00 0.00 ? 18  HIS A CA   11 
ATOM   6816  C  C    . HIS A 1 18 ? 9.887   11.660  -6.252  1.00 0.00 ? 18  HIS A C    11 
ATOM   6817  O  O    . HIS A 1 18 ? 8.715   11.995  -6.428  1.00 0.00 ? 18  HIS A O    11 
ATOM   6818  C  CB   . HIS A 1 18 ? 10.495  11.604  -3.826  1.00 0.00 ? 18  HIS A CB   11 
ATOM   6819  C  CG   . HIS A 1 18 ? 11.050  12.349  -2.651  1.00 0.00 ? 18  HIS A CG   11 
ATOM   6820  N  ND1  . HIS A 1 18 ? 12.380  12.697  -2.540  1.00 0.00 ? 18  HIS A ND1  11 
ATOM   6821  C  CD2  . HIS A 1 18 ? 10.446  12.815  -1.533  1.00 0.00 ? 18  HIS A CD2  11 
ATOM   6822  C  CE1  . HIS A 1 18 ? 12.570  13.343  -1.404  1.00 0.00 ? 18  HIS A CE1  11 
ATOM   6823  N  NE2  . HIS A 1 18 ? 11.412  13.429  -0.774  1.00 0.00 ? 18  HIS A NE2  11 
ATOM   6824  H  H    . HIS A 1 18 ? 10.046  14.070  -4.239  1.00 0.00 ? 18  HIS A H    11 
ATOM   6825  H  HA   . HIS A 1 18 ? 11.785  12.184  -5.431  1.00 0.00 ? 18  HIS A HA   11 
ATOM   6826  H  HB2  . HIS A 1 18 ? 9.431   11.496  -3.678  1.00 0.00 ? 18  HIS A HB2  11 
ATOM   6827  H  HB3  . HIS A 1 18 ? 10.953  10.625  -3.845  1.00 0.00 ? 18  HIS A HB3  11 
ATOM   6828  H  HD1  . HIS A 1 18 ? 13.080  12.498  -3.196  1.00 0.00 ? 18  HIS A HD1  11 
ATOM   6829  H  HD2  . HIS A 1 18 ? 9.398   12.722  -1.283  1.00 0.00 ? 18  HIS A HD2  11 
ATOM   6830  H  HE1  . HIS A 1 18 ? 13.511  13.735  -1.049  1.00 0.00 ? 18  HIS A HE1  11 
ATOM   6831  N  N    . PRO A 1 19 ? 10.481  10.718  -6.999  1.00 0.00 ? 19  PRO A N    11 
ATOM   6832  C  CA   . PRO A 1 19 ? 9.788   10.012  -8.082  1.00 0.00 ? 19  PRO A CA   11 
ATOM   6833  C  C    . PRO A 1 19 ? 8.716   9.062   -7.561  1.00 0.00 ? 19  PRO A C    11 
ATOM   6834  O  O    . PRO A 1 19 ? 8.557   8.890   -6.352  1.00 0.00 ? 19  PRO A O    11 
ATOM   6835  C  CB   . PRO A 1 19 ? 10.910  9.229   -8.769  1.00 0.00 ? 19  PRO A CB   11 
ATOM   6836  C  CG   . PRO A 1 19 ? 11.944  9.043   -7.713  1.00 0.00 ? 19  PRO A CG   11 
ATOM   6837  C  CD   . PRO A 1 19 ? 11.875  10.268  -6.845  1.00 0.00 ? 19  PRO A CD   11 
ATOM   6838  H  HA   . PRO A 1 19 ? 9.345   10.702  -8.785  1.00 0.00 ? 19  PRO A HA   11 
ATOM   6839  H  HB2  . PRO A 1 19 ? 10.527  8.281   -9.120  1.00 0.00 ? 19  PRO A HB2  11 
ATOM   6840  H  HB3  . PRO A 1 19 ? 11.294  9.799   -9.601  1.00 0.00 ? 19  PRO A HB3  11 
ATOM   6841  H  HG2  . PRO A 1 19 ? 11.722  8.160   -7.133  1.00 0.00 ? 19  PRO A HG2  11 
ATOM   6842  H  HG3  . PRO A 1 19 ? 12.920  8.960   -8.167  1.00 0.00 ? 19  PRO A HG3  11 
ATOM   6843  H  HD2  . PRO A 1 19 ? 12.087  10.015  -5.816  1.00 0.00 ? 19  PRO A HD2  11 
ATOM   6844  H  HD3  . PRO A 1 19 ? 12.563  11.021  -7.199  1.00 0.00 ? 19  PRO A HD3  11 
ATOM   6845  N  N    . THR A 1 20 ? 7.981   8.444   -8.481  1.00 0.00 ? 20  THR A N    11 
ATOM   6846  C  CA   . THR A 1 20 ? 6.924   7.511   -8.115  1.00 0.00 ? 20  THR A CA   11 
ATOM   6847  C  C    . THR A 1 20 ? 7.497   6.258   -7.464  1.00 0.00 ? 20  THR A C    11 
ATOM   6848  O  O    . THR A 1 20 ? 8.526   5.738   -7.896  1.00 0.00 ? 20  THR A O    11 
ATOM   6849  C  CB   . THR A 1 20 ? 6.086   7.102   -9.341  1.00 0.00 ? 20  THR A CB   11 
ATOM   6850  O  OG1  . THR A 1 20 ? 4.786   6.669   -8.925  1.00 0.00 ? 20  THR A OG1  11 
ATOM   6851  C  CG2  . THR A 1 20 ? 6.773   5.988   -10.118 1.00 0.00 ? 20  THR A CG2  11 
ATOM   6852  H  H    . THR A 1 20 ? 8.156   8.622   -9.429  1.00 0.00 ? 20  THR A H    11 
ATOM   6853  H  HA   . THR A 1 20 ? 6.272   8.006   -7.409  1.00 0.00 ? 20  THR A HA   11 
ATOM   6854  H  HB   . THR A 1 20 ? 5.981   7.960   -9.989  1.00 0.00 ? 20  THR A HB   11 
ATOM   6855  H  HG1  . THR A 1 20 ? 4.838   6.313   -8.034  1.00 0.00 ? 20  THR A HG1  11 
ATOM   6856  H  HG21 . THR A 1 20 ? 6.584   5.042   -9.633  1.00 0.00 ? 20  THR A HG21 11 
ATOM   6857  H  HG22 . THR A 1 20 ? 7.836   6.172   -10.147 1.00 0.00 ? 20  THR A HG22 11 
ATOM   6858  H  HG23 . THR A 1 20 ? 6.384   5.960   -11.125 1.00 0.00 ? 20  THR A HG23 11 
ATOM   6859  N  N    . SER A 1 21 ? 6.825   5.776   -6.423  1.00 0.00 ? 21  SER A N    11 
ATOM   6860  C  CA   . SER A 1 21 ? 7.270   4.585   -5.711  1.00 0.00 ? 21  SER A CA   11 
ATOM   6861  C  C    . SER A 1 21 ? 6.735   3.321   -6.377  1.00 0.00 ? 21  SER A C    11 
ATOM   6862  O  O    . SER A 1 21 ? 5.560   3.247   -6.739  1.00 0.00 ? 21  SER A O    11 
ATOM   6863  C  CB   . SER A 1 21 ? 6.814   4.637   -4.251  1.00 0.00 ? 21  SER A CB   11 
ATOM   6864  O  OG   . SER A 1 21 ? 6.983   3.381   -3.618  1.00 0.00 ? 21  SER A OG   11 
ATOM   6865  H  H    . SER A 1 21 ? 6.011   6.236   -6.126  1.00 0.00 ? 21  SER A H    11 
ATOM   6866  H  HA   . SER A 1 21 ? 8.349   4.564   -5.741  1.00 0.00 ? 21  SER A HA   11 
ATOM   6867  H  HB2  . SER A 1 21 ? 7.396   5.375   -3.721  1.00 0.00 ? 21  SER A HB2  11 
ATOM   6868  H  HB3  . SER A 1 21 ? 5.768   4.908   -4.213  1.00 0.00 ? 21  SER A HB3  11 
ATOM   6869  H  HG   . SER A 1 21 ? 7.767   2.949   -3.967  1.00 0.00 ? 21  SER A HG   11 
ATOM   6870  N  N    . ILE A 1 22 ? 7.605   2.330   -6.536  1.00 0.00 ? 22  ILE A N    11 
ATOM   6871  C  CA   . ILE A 1 22 ? 7.220   1.069   -7.158  1.00 0.00 ? 22  ILE A CA   11 
ATOM   6872  C  C    . ILE A 1 22 ? 6.519   0.154   -6.159  1.00 0.00 ? 22  ILE A C    11 
ATOM   6873  O  O    . ILE A 1 22 ? 6.843   0.150   -4.971  1.00 0.00 ? 22  ILE A O    11 
ATOM   6874  C  CB   . ILE A 1 22 ? 8.441   0.333   -7.741  1.00 0.00 ? 22  ILE A CB   11 
ATOM   6875  C  CG1  . ILE A 1 22 ? 8.918   1.025   -9.020  1.00 0.00 ? 22  ILE A CG1  11 
ATOM   6876  C  CG2  . ILE A 1 22 ? 8.100   -1.124  -8.016  1.00 0.00 ? 22  ILE A CG2  11 
ATOM   6877  C  CD1  . ILE A 1 22 ? 9.513   2.395   -8.780  1.00 0.00 ? 22  ILE A CD1  11 
ATOM   6878  H  H    . ILE A 1 22 ? 8.527   2.449   -6.227  1.00 0.00 ? 22  ILE A H    11 
ATOM   6879  H  HA   . ILE A 1 22 ? 6.539   1.291   -7.967  1.00 0.00 ? 22  ILE A HA   11 
ATOM   6880  H  HB   . ILE A 1 22 ? 9.233   0.360   -7.009  1.00 0.00 ? 22  ILE A HB   11 
ATOM   6881  H  HG12 . ILE A 1 22 ? 9.672   0.415   -9.492  1.00 0.00 ? 22  ILE A HG12 11 
ATOM   6882  H  HG13 . ILE A 1 22 ? 8.080   1.139   -9.692  1.00 0.00 ? 22  ILE A HG13 11 
ATOM   6883  H  HG21 . ILE A 1 22 ? 8.114   -1.678  -7.090  1.00 0.00 ? 22  ILE A HG21 11 
ATOM   6884  H  HG22 . ILE A 1 22 ? 7.116   -1.186  -8.457  1.00 0.00 ? 22  ILE A HG22 11 
ATOM   6885  H  HG23 . ILE A 1 22 ? 8.826   -1.542  -8.697  1.00 0.00 ? 22  ILE A HG23 11 
ATOM   6886  H  HD11 . ILE A 1 22 ? 10.034  2.722   -9.668  1.00 0.00 ? 22  ILE A HD11 11 
ATOM   6887  H  HD12 . ILE A 1 22 ? 8.725   3.094   -8.544  1.00 0.00 ? 22  ILE A HD12 11 
ATOM   6888  H  HD13 . ILE A 1 22 ? 10.208  2.345   -7.954  1.00 0.00 ? 22  ILE A HD13 11 
ATOM   6889  N  N    . CYS A 1 23 ? 5.557   -0.621  -6.649  1.00 0.00 ? 23  CYS A N    11 
ATOM   6890  C  CA   . CYS A 1 23 ? 4.810   -1.541  -5.801  1.00 0.00 ? 23  CYS A CA   11 
ATOM   6891  C  C    . CYS A 1 23 ? 5.730   -2.607  -5.213  1.00 0.00 ? 23  CYS A C    11 
ATOM   6892  O  O    . CYS A 1 23 ? 6.913   -2.672  -5.545  1.00 0.00 ? 23  CYS A O    11 
ATOM   6893  C  CB   . CYS A 1 23 ? 3.686   -2.206  -6.600  1.00 0.00 ? 23  CYS A CB   11 
ATOM   6894  S  SG   . CYS A 1 23 ? 2.264   -2.728  -5.588  1.00 0.00 ? 23  CYS A SG   11 
ATOM   6895  H  H    . CYS A 1 23 ? 5.344   -0.572  -7.606  1.00 0.00 ? 23  CYS A H    11 
ATOM   6896  H  HA   . CYS A 1 23 ? 4.377   -0.971  -4.993  1.00 0.00 ? 23  CYS A HA   11 
ATOM   6897  H  HB2  . CYS A 1 23 ? 3.323   -1.510  -7.342  1.00 0.00 ? 23  CYS A HB2  11 
ATOM   6898  H  HB3  . CYS A 1 23 ? 4.077   -3.082  -7.096  1.00 0.00 ? 23  CYS A HB3  11 
ATOM   6899  N  N    . ASP A 1 24 ? 5.177   -3.441  -4.339  1.00 0.00 ? 24  ASP A N    11 
ATOM   6900  C  CA   . ASP A 1 24 ? 5.946   -4.505  -3.705  1.00 0.00 ? 24  ASP A CA   11 
ATOM   6901  C  C    . ASP A 1 24 ? 5.546   -5.869  -4.260  1.00 0.00 ? 24  ASP A C    11 
ATOM   6902  O  O    . ASP A 1 24 ? 6.323   -6.821  -4.211  1.00 0.00 ? 24  ASP A O    11 
ATOM   6903  C  CB   . ASP A 1 24 ? 5.743   -4.477  -2.189  1.00 0.00 ? 24  ASP A CB   11 
ATOM   6904  C  CG   . ASP A 1 24 ? 6.857   -5.184  -1.443  1.00 0.00 ? 24  ASP A CG   11 
ATOM   6905  O  OD1  . ASP A 1 24 ? 8.034   -4.825  -1.655  1.00 0.00 ? 24  ASP A OD1  11 
ATOM   6906  O  OD2  . ASP A 1 24 ? 6.552   -6.097  -0.646  1.00 0.00 ? 24  ASP A OD2  11 
ATOM   6907  H  H    . ASP A 1 24 ? 4.228   -3.338  -4.115  1.00 0.00 ? 24  ASP A H    11 
ATOM   6908  H  HA   . ASP A 1 24 ? 6.990   -4.334  -3.922  1.00 0.00 ? 24  ASP A HA   11 
ATOM   6909  H  HB2  . ASP A 1 24 ? 5.706   -3.450  -1.856  1.00 0.00 ? 24  ASP A HB2  11 
ATOM   6910  H  HB3  . ASP A 1 24 ? 4.808   -4.963  -1.949  1.00 0.00 ? 24  ASP A HB3  11 
ATOM   6911  N  N    . ASN A 1 25 ? 4.329   -5.955  -4.785  1.00 0.00 ? 25  ASN A N    11 
ATOM   6912  C  CA   . ASN A 1 25 ? 3.825   -7.202  -5.348  1.00 0.00 ? 25  ASN A CA   11 
ATOM   6913  C  C    . ASN A 1 25 ? 4.189   -7.319  -6.825  1.00 0.00 ? 25  ASN A C    11 
ATOM   6914  O  O    . ASN A 1 25 ? 4.990   -8.170  -7.212  1.00 0.00 ? 25  ASN A O    11 
ATOM   6915  C  CB   . ASN A 1 25 ? 2.307   -7.287  -5.176  1.00 0.00 ? 25  ASN A CB   11 
ATOM   6916  C  CG   . ASN A 1 25 ? 1.634   -5.934  -5.306  1.00 0.00 ? 25  ASN A CG   11 
ATOM   6917  O  OD1  . ASN A 1 25 ? 1.436   -5.430  -6.411  1.00 0.00 ? 25  ASN A OD1  11 
ATOM   6918  N  ND2  . ASN A 1 25 ? 1.280   -5.339  -4.172  1.00 0.00 ? 25  ASN A ND2  11 
ATOM   6919  H  H    . ASN A 1 25 ? 3.755   -5.160  -4.795  1.00 0.00 ? 25  ASN A H    11 
ATOM   6920  H  HA   . ASN A 1 25 ? 4.285   -8.018  -4.810  1.00 0.00 ? 25  ASN A HA   11 
ATOM   6921  H  HB2  . ASN A 1 25 ? 1.902   -7.943  -5.933  1.00 0.00 ? 25  ASN A HB2  11 
ATOM   6922  H  HB3  . ASN A 1 25 ? 2.082   -7.689  -4.200  1.00 0.00 ? 25  ASN A HB3  11 
ATOM   6923  H  HD21 . ASN A 1 25 ? 1.469   -5.800  -3.328  1.00 0.00 ? 25  ASN A HD21 11 
ATOM   6924  H  HD22 . ASN A 1 25 ? 0.842   -4.464  -4.227  1.00 0.00 ? 25  ASN A HD22 11 
ATOM   6925  N  N    . PHE A 1 26 ? 3.594   -6.459  -7.645  1.00 0.00 ? 26  PHE A N    11 
ATOM   6926  C  CA   . PHE A 1 26 ? 3.855   -6.465  -9.079  1.00 0.00 ? 26  PHE A CA   11 
ATOM   6927  C  C    . PHE A 1 26 ? 5.344   -6.292  -9.362  1.00 0.00 ? 26  PHE A C    11 
ATOM   6928  O  O    . PHE A 1 26 ? 5.842   -6.714  -10.406 1.00 0.00 ? 26  PHE A O    11 
ATOM   6929  C  CB   . PHE A 1 26 ? 3.061   -5.354  -9.769  1.00 0.00 ? 26  PHE A CB   11 
ATOM   6930  C  CG   . PHE A 1 26 ? 2.678   -5.679  -11.184 1.00 0.00 ? 26  PHE A CG   11 
ATOM   6931  C  CD1  . PHE A 1 26 ? 3.645   -5.775  -12.172 1.00 0.00 ? 26  PHE A CD1  11 
ATOM   6932  C  CD2  . PHE A 1 26 ? 1.353   -5.890  -11.527 1.00 0.00 ? 26  PHE A CD2  11 
ATOM   6933  C  CE1  . PHE A 1 26 ? 3.296   -6.074  -13.476 1.00 0.00 ? 26  PHE A CE1  11 
ATOM   6934  C  CE2  . PHE A 1 26 ? 0.997   -6.190  -12.828 1.00 0.00 ? 26  PHE A CE2  11 
ATOM   6935  C  CZ   . PHE A 1 26 ? 1.970   -6.283  -13.804 1.00 0.00 ? 26  PHE A CZ   11 
ATOM   6936  H  H    . PHE A 1 26 ? 2.964   -5.804  -7.276  1.00 0.00 ? 26  PHE A H    11 
ATOM   6937  H  HA   . PHE A 1 26 ? 3.535   -7.419  -9.469  1.00 0.00 ? 26  PHE A HA   11 
ATOM   6938  H  HB2  . PHE A 1 26 ? 2.153   -5.173  -9.214  1.00 0.00 ? 26  PHE A HB2  11 
ATOM   6939  H  HB3  . PHE A 1 26 ? 3.655   -4.453  -9.783  1.00 0.00 ? 26  PHE A HB3  11 
ATOM   6940  H  HD1  . PHE A 1 26 ? 4.682   -5.613  -11.917 1.00 0.00 ? 26  PHE A HD1  11 
ATOM   6941  H  HD2  . PHE A 1 26 ? 0.590   -5.818  -10.764 1.00 0.00 ? 26  PHE A HD2  11 
ATOM   6942  H  HE1  . PHE A 1 26 ? 4.058   -6.146  -14.237 1.00 0.00 ? 26  PHE A HE1  11 
ATOM   6943  H  HE2  . PHE A 1 26 ? -0.040  -6.352  -13.081 1.00 0.00 ? 26  PHE A HE2  11 
ATOM   6944  H  HZ   . PHE A 1 26 ? 1.695   -6.516  -14.822 1.00 0.00 ? 26  PHE A HZ   11 
ATOM   6945  N  N    . SER A 1 27 ? 6.050   -5.668  -8.425  1.00 0.00 ? 27  SER A N    11 
ATOM   6946  C  CA   . SER A 1 27 ? 7.482   -5.435  -8.574  1.00 0.00 ? 27  SER A CA   11 
ATOM   6947  C  C    . SER A 1 27 ? 8.209   -6.729  -8.926  1.00 0.00 ? 27  SER A C    11 
ATOM   6948  O  O    . SER A 1 27 ? 8.781   -6.858  -10.007 1.00 0.00 ? 27  SER A O    11 
ATOM   6949  C  CB   . SER A 1 27 ? 8.061   -4.844  -7.287  1.00 0.00 ? 27  SER A CB   11 
ATOM   6950  O  OG   . SER A 1 27 ? 9.465   -5.026  -7.229  1.00 0.00 ? 27  SER A OG   11 
ATOM   6951  H  H    . SER A 1 27 ? 5.596   -5.355  -7.614  1.00 0.00 ? 27  SER A H    11 
ATOM   6952  H  HA   . SER A 1 27 ? 7.620   -4.728  -9.379  1.00 0.00 ? 27  SER A HA   11 
ATOM   6953  H  HB2  . SER A 1 27 ? 7.845   -3.787  -7.251  1.00 0.00 ? 27  SER A HB2  11 
ATOM   6954  H  HB3  . SER A 1 27 ? 7.610   -5.333  -6.436  1.00 0.00 ? 27  SER A HB3  11 
ATOM   6955  H  HG   . SER A 1 27 ? 9.864   -4.291  -6.758  1.00 0.00 ? 27  SER A HG   11 
ATOM   6956  N  N    . ALA A 1 28 ? 8.183   -7.684  -8.002  1.00 0.00 ? 28  ALA A N    11 
ATOM   6957  C  CA   . ALA A 1 28 ? 8.838   -8.969  -8.214  1.00 0.00 ? 28  ALA A CA   11 
ATOM   6958  C  C    . ALA A 1 28 ? 7.841   -10.023 -8.684  1.00 0.00 ? 28  ALA A C    11 
ATOM   6959  O  O    . ALA A 1 28 ? 8.015   -10.627 -9.743  1.00 0.00 ? 28  ALA A O    11 
ATOM   6960  C  CB   . ALA A 1 28 ? 9.528   -9.426  -6.937  1.00 0.00 ? 28  ALA A CB   11 
ATOM   6961  H  H    . ALA A 1 28 ? 7.711   -7.522  -7.159  1.00 0.00 ? 28  ALA A H    11 
ATOM   6962  H  HA   . ALA A 1 28 ? 9.593   -8.838  -8.975  1.00 0.00 ? 28  ALA A HA   11 
ATOM   6963  H  HB1  . ALA A 1 28 ? 9.124   -8.882  -6.096  1.00 0.00 ? 28  ALA A HB1  11 
ATOM   6964  H  HB2  . ALA A 1 28 ? 9.361   -10.484 -6.797  1.00 0.00 ? 28  ALA A HB2  11 
ATOM   6965  H  HB3  . ALA A 1 28 ? 10.588  -9.236  -7.013  1.00 0.00 ? 28  ALA A HB3  11 
ATOM   6966  N  N    . TYR A 1 29 ? 6.797   -10.239 -7.892  1.00 0.00 ? 29  TYR A N    11 
ATOM   6967  C  CA   . TYR A 1 29 ? 5.774   -11.222 -8.226  1.00 0.00 ? 29  TYR A CA   11 
ATOM   6968  C  C    . TYR A 1 29 ? 5.235   -10.990 -9.634  1.00 0.00 ? 29  TYR A C    11 
ATOM   6969  O  O    . TYR A 1 29 ? 5.189   -11.906 -10.453 1.00 0.00 ? 29  TYR A O    11 
ATOM   6970  C  CB   . TYR A 1 29 ? 4.629   -11.163 -7.213  1.00 0.00 ? 29  TYR A CB   11 
ATOM   6971  C  CG   . TYR A 1 29 ? 5.075   -11.367 -5.783  1.00 0.00 ? 29  TYR A CG   11 
ATOM   6972  C  CD1  . TYR A 1 29 ? 5.607   -10.318 -5.043  1.00 0.00 ? 29  TYR A CD1  11 
ATOM   6973  C  CD2  . TYR A 1 29 ? 4.964   -12.610 -5.171  1.00 0.00 ? 29  TYR A CD2  11 
ATOM   6974  C  CE1  . TYR A 1 29 ? 6.016   -10.501 -3.736  1.00 0.00 ? 29  TYR A CE1  11 
ATOM   6975  C  CE2  . TYR A 1 29 ? 5.369   -12.802 -3.864  1.00 0.00 ? 29  TYR A CE2  11 
ATOM   6976  C  CZ   . TYR A 1 29 ? 5.895   -11.744 -3.152  1.00 0.00 ? 29  TYR A CZ   11 
ATOM   6977  O  OH   . TYR A 1 29 ? 6.300   -11.930 -1.850  1.00 0.00 ? 29  TYR A OH   11 
ATOM   6978  H  H    . TYR A 1 29 ? 6.714   -9.726  -7.060  1.00 0.00 ? 29  TYR A H    11 
ATOM   6979  H  HA   . TYR A 1 29 ? 6.228   -12.201 -8.184  1.00 0.00 ? 29  TYR A HA   11 
ATOM   6980  H  HB2  . TYR A 1 29 ? 4.152   -10.197 -7.276  1.00 0.00 ? 29  TYR A HB2  11 
ATOM   6981  H  HB3  . TYR A 1 29 ? 3.908   -11.931 -7.449  1.00 0.00 ? 29  TYR A HB3  11 
ATOM   6982  H  HD1  . TYR A 1 29 ? 5.699   -9.346  -5.504  1.00 0.00 ? 29  TYR A HD1  11 
ATOM   6983  H  HD2  . TYR A 1 29 ? 4.552   -13.436 -5.732  1.00 0.00 ? 29  TYR A HD2  11 
ATOM   6984  H  HE1  . TYR A 1 29 ? 6.427   -9.673  -3.178  1.00 0.00 ? 29  TYR A HE1  11 
ATOM   6985  H  HE2  . TYR A 1 29 ? 5.275   -13.775 -3.406  1.00 0.00 ? 29  TYR A HE2  11 
ATOM   6986  H  HH   . TYR A 1 29 ? 6.559   -11.086 -1.472  1.00 0.00 ? 29  TYR A HH   11 
ATOM   6987  N  N    . GLY A 1 30 ? 4.826   -9.754  -9.908  1.00 0.00 ? 30  GLY A N    11 
ATOM   6988  C  CA   . GLY A 1 30 ? 4.296   -9.421  -11.217 1.00 0.00 ? 30  GLY A CA   11 
ATOM   6989  C  C    . GLY A 1 30 ? 2.826   -9.053  -11.170 1.00 0.00 ? 30  GLY A C    11 
ATOM   6990  O  O    . GLY A 1 30 ? 2.353   -8.258  -11.983 1.00 0.00 ? 30  GLY A O    11 
ATOM   6991  H  H    . GLY A 1 30 ? 4.886   -9.063  -9.215  1.00 0.00 ? 30  GLY A H    11 
ATOM   6992  H  HA2  . GLY A 1 30 ? 4.853   -8.588  -11.618 1.00 0.00 ? 30  GLY A HA2  11 
ATOM   6993  H  HA3  . GLY A 1 30 ? 4.421   -10.272 -11.870 1.00 0.00 ? 30  GLY A HA3  11 
ATOM   6994  N  N    . TRP A 1 31 ? 2.103   -9.632  -10.219 1.00 0.00 ? 31  TRP A N    11 
ATOM   6995  C  CA   . TRP A 1 31 ? 0.677   -9.360  -10.071 1.00 0.00 ? 31  TRP A CA   11 
ATOM   6996  C  C    . TRP A 1 31 ? 0.419   -8.434  -8.888  1.00 0.00 ? 31  TRP A C    11 
ATOM   6997  O  O    . TRP A 1 31 ? 1.257   -8.303  -7.995  1.00 0.00 ? 31  TRP A O    11 
ATOM   6998  C  CB   . TRP A 1 31 ? -0.095  -10.668 -9.889  1.00 0.00 ? 31  TRP A CB   11 
ATOM   6999  C  CG   . TRP A 1 31 ? -0.245  -11.075 -8.455  1.00 0.00 ? 31  TRP A CG   11 
ATOM   7000  C  CD1  . TRP A 1 31 ? 0.674   -11.735 -7.690  1.00 0.00 ? 31  TRP A CD1  11 
ATOM   7001  C  CD2  . TRP A 1 31 ? -1.382  -10.849 -7.614  1.00 0.00 ? 31  TRP A CD2  11 
ATOM   7002  N  NE1  . TRP A 1 31 ? 0.176   -11.933 -6.424  1.00 0.00 ? 31  TRP A NE1  11 
ATOM   7003  C  CE2  . TRP A 1 31 ? -1.083  -11.398 -6.352  1.00 0.00 ? 31  TRP A CE2  11 
ATOM   7004  C  CE3  . TRP A 1 31 ? -2.623  -10.235 -7.804  1.00 0.00 ? 31  TRP A CE3  11 
ATOM   7005  C  CZ2  . TRP A 1 31 ? -1.980  -11.352 -5.289  1.00 0.00 ? 31  TRP A CZ2  11 
ATOM   7006  C  CZ3  . TRP A 1 31 ? -3.513  -10.189 -6.748  1.00 0.00 ? 31  TRP A CZ3  11 
ATOM   7007  C  CH2  . TRP A 1 31 ? -3.188  -10.744 -5.503  1.00 0.00 ? 31  TRP A CH2  11 
ATOM   7008  H  H    . TRP A 1 31 ? 2.537   -10.257 -9.601  1.00 0.00 ? 31  TRP A H    11 
ATOM   7009  H  HA   . TRP A 1 31 ? 0.338   -8.875  -10.974 1.00 0.00 ? 31  TRP A HA   11 
ATOM   7010  H  HB2  . TRP A 1 31 ? -1.084  -10.556 -10.309 1.00 0.00 ? 31  TRP A HB2  11 
ATOM   7011  H  HB3  . TRP A 1 31 ? 0.425   -11.460 -10.409 1.00 0.00 ? 31  TRP A HB3  11 
ATOM   7012  H  HD1  . TRP A 1 31 ? 1.644   -12.050 -8.042  1.00 0.00 ? 31  TRP A HD1  11 
ATOM   7013  H  HE1  . TRP A 1 31 ? 0.647   -12.384 -5.692  1.00 0.00 ? 31  TRP A HE1  11 
ATOM   7014  H  HE3  . TRP A 1 31 ? -2.891  -9.801  -8.757  1.00 0.00 ? 31  TRP A HE3  11 
ATOM   7015  H  HZ2  . TRP A 1 31 ? -1.745  -11.774 -4.323  1.00 0.00 ? 31  TRP A HZ2  11 
ATOM   7016  H  HZ3  . TRP A 1 31 ? -4.476  -9.719  -6.876  1.00 0.00 ? 31  TRP A HZ3  11 
ATOM   7017  H  HH2  . TRP A 1 31 ? -3.913  -10.686 -4.706  1.00 0.00 ? 31  TRP A HH2  11 
ATOM   7018  N  N    . CYS A 1 32 ? -0.745  -7.793  -8.887  1.00 0.00 ? 32  CYS A N    11 
ATOM   7019  C  CA   . CYS A 1 32 ? -1.113  -6.879  -7.813  1.00 0.00 ? 32  CYS A CA   11 
ATOM   7020  C  C    . CYS A 1 32 ? -2.616  -6.923  -7.553  1.00 0.00 ? 32  CYS A C    11 
ATOM   7021  O  O    . CYS A 1 32 ? -3.432  -6.912  -8.475  1.00 0.00 ? 32  CYS A O    11 
ATOM   7022  C  CB   . CYS A 1 32 ? -0.687  -5.451  -8.161  1.00 0.00 ? 32  CYS A CB   11 
ATOM   7023  S  SG   . CYS A 1 32 ? -1.048  -4.229  -6.860  1.00 0.00 ? 32  CYS A SG   11 
ATOM   7024  H  H    . CYS A 1 32 ? -1.372  -7.939  -9.627  1.00 0.00 ? 32  CYS A H    11 
ATOM   7025  H  HA   . CYS A 1 32 ? -0.597  -7.191  -6.918  1.00 0.00 ? 32  CYS A HA   11 
ATOM   7026  H  HB2  . CYS A 1 32 ? 0.379   -5.436  -8.339  1.00 0.00 ? 32  CYS A HB2  11 
ATOM   7027  H  HB3  . CYS A 1 32 ? -1.200  -5.139  -9.059  1.00 0.00 ? 32  CYS A HB3  11 
ATOM   7028  N  N    . PRO A 1 33 ? -2.993  -6.973  -6.267  1.00 0.00 ? 33  PRO A N    11 
ATOM   7029  C  CA   . PRO A 1 33 ? -4.399  -7.019  -5.855  1.00 0.00 ? 33  PRO A CA   11 
ATOM   7030  C  C    . PRO A 1 33 ? -5.123  -5.703  -6.117  1.00 0.00 ? 33  PRO A C    11 
ATOM   7031  O  O    . PRO A 1 33 ? -6.315  -5.571  -5.834  1.00 0.00 ? 33  PRO A O    11 
ATOM   7032  C  CB   . PRO A 1 33 ? -4.319  -7.295  -4.351  1.00 0.00 ? 33  PRO A CB   11 
ATOM   7033  C  CG   . PRO A 1 33 ? -2.987  -6.771  -3.940  1.00 0.00 ? 33  PRO A CG   11 
ATOM   7034  C  CD   . PRO A 1 33 ? -2.075  -6.989  -5.115  1.00 0.00 ? 33  PRO A CD   11 
ATOM   7035  H  HA   . PRO A 1 33 ? -4.930  -7.824  -6.343  1.00 0.00 ? 33  PRO A HA   11 
ATOM   7036  H  HB2  . PRO A 1 33 ? -5.122  -6.778  -3.845  1.00 0.00 ? 33  PRO A HB2  11 
ATOM   7037  H  HB3  . PRO A 1 33 ? -4.398  -8.357  -4.172  1.00 0.00 ? 33  PRO A HB3  11 
ATOM   7038  H  HG2  . PRO A 1 33 ? -3.061  -5.718  -3.713  1.00 0.00 ? 33  PRO A HG2  11 
ATOM   7039  H  HG3  . PRO A 1 33 ? -2.627  -7.317  -3.080  1.00 0.00 ? 33  PRO A HG3  11 
ATOM   7040  H  HD2  . PRO A 1 33 ? -1.353  -6.189  -5.186  1.00 0.00 ? 33  PRO A HD2  11 
ATOM   7041  H  HD3  . PRO A 1 33 ? -1.576  -7.943  -5.034  1.00 0.00 ? 33  PRO A HD3  11 
ATOM   7042  N  N    . LEU A 1 34 ? -4.397  -4.731  -6.658  1.00 0.00 ? 34  LEU A N    11 
ATOM   7043  C  CA   . LEU A 1 34 ? -4.970  -3.424  -6.959  1.00 0.00 ? 34  LEU A CA   11 
ATOM   7044  C  C    . LEU A 1 34 ? -4.991  -3.172  -8.464  1.00 0.00 ? 34  LEU A C    11 
ATOM   7045  O  O    . LEU A 1 34 ? -5.536  -2.171  -8.928  1.00 0.00 ? 34  LEU A O    11 
ATOM   7046  C  CB   . LEU A 1 34 ? -4.176  -2.322  -6.256  1.00 0.00 ? 34  LEU A CB   11 
ATOM   7047  C  CG   . LEU A 1 34 ? -4.436  -2.159  -4.758  1.00 0.00 ? 34  LEU A CG   11 
ATOM   7048  C  CD1  . LEU A 1 34 ? -3.554  -1.063  -4.180  1.00 0.00 ? 34  LEU A CD1  11 
ATOM   7049  C  CD2  . LEU A 1 34 ? -5.905  -1.855  -4.502  1.00 0.00 ? 34  LEU A CD2  11 
ATOM   7050  H  H    . LEU A 1 34 ? -3.453  -4.896  -6.861  1.00 0.00 ? 34  LEU A H    11 
ATOM   7051  H  HA   . LEU A 1 34 ? -5.986  -3.415  -6.592  1.00 0.00 ? 34  LEU A HA   11 
ATOM   7052  H  HB2  . LEU A 1 34 ? -3.126  -2.536  -6.388  1.00 0.00 ? 34  LEU A HB2  11 
ATOM   7053  H  HB3  . LEU A 1 34 ? -4.414  -1.385  -6.739  1.00 0.00 ? 34  LEU A HB3  11 
ATOM   7054  H  HG   . LEU A 1 34 ? -4.191  -3.084  -4.254  1.00 0.00 ? 34  LEU A HG   11 
ATOM   7055  H  HD11 . LEU A 1 34 ? -3.268  -0.380  -4.965  1.00 0.00 ? 34  LEU A HD11 11 
ATOM   7056  H  HD12 . LEU A 1 34 ? -2.669  -1.505  -3.746  1.00 0.00 ? 34  LEU A HD12 11 
ATOM   7057  H  HD13 . LEU A 1 34 ? -4.100  -0.528  -3.417  1.00 0.00 ? 34  LEU A HD13 11 
ATOM   7058  H  HD21 . LEU A 1 34 ? -6.447  -2.781  -4.381  1.00 0.00 ? 34  LEU A HD21 11 
ATOM   7059  H  HD22 . LEU A 1 34 ? -6.310  -1.307  -5.340  1.00 0.00 ? 34  LEU A HD22 11 
ATOM   7060  H  HD23 . LEU A 1 34 ? -5.998  -1.263  -3.604  1.00 0.00 ? 34  LEU A HD23 11 
ATOM   7061  N  N    . GLY A 1 35 ? -4.393  -4.087  -9.220  1.00 0.00 ? 35  GLY A N    11 
ATOM   7062  C  CA   . GLY A 1 35 ? -4.356  -3.947  -10.664 1.00 0.00 ? 35  GLY A CA   11 
ATOM   7063  C  C    . GLY A 1 35 ? -3.788  -2.611  -11.102 1.00 0.00 ? 35  GLY A C    11 
ATOM   7064  O  O    . GLY A 1 35 ? -2.851  -2.084  -10.502 1.00 0.00 ? 35  GLY A O    11 
ATOM   7065  H  H    . GLY A 1 35 ? -3.975  -4.865  -8.795  1.00 0.00 ? 35  GLY A H    11 
ATOM   7066  H  HA2  . GLY A 1 35 ? -3.747  -4.738  -11.076 1.00 0.00 ? 35  GLY A HA2  11 
ATOM   7067  H  HA3  . GLY A 1 35 ? -5.360  -4.041  -11.050 1.00 0.00 ? 35  GLY A HA3  11 
ATOM   7068  N  N    . PRO A 1 36 ? -4.361  -2.043  -12.173 1.00 0.00 ? 36  PRO A N    11 
ATOM   7069  C  CA   . PRO A 1 36 ? -3.922  -0.754  -12.716 1.00 0.00 ? 36  PRO A CA   11 
ATOM   7070  C  C    . PRO A 1 36 ? -4.264  0.410   -11.793 1.00 0.00 ? 36  PRO A C    11 
ATOM   7071  O  O    . PRO A 1 36 ? -3.534  1.399   -11.729 1.00 0.00 ? 36  PRO A O    11 
ATOM   7072  C  CB   . PRO A 1 36 ? -4.697  -0.640  -14.031 1.00 0.00 ? 36  PRO A CB   11 
ATOM   7073  C  CG   . PRO A 1 36 ? -5.908  -1.483  -13.831 1.00 0.00 ? 36  PRO A CG   11 
ATOM   7074  C  CD   . PRO A 1 36 ? -5.482  -2.615  -12.938 1.00 0.00 ? 36  PRO A CD   11 
ATOM   7075  H  HA   . PRO A 1 36 ? -2.861  -0.750  -12.919 1.00 0.00 ? 36  PRO A HA   11 
ATOM   7076  H  HB2  . PRO A 1 36 ? -4.958  0.394   -14.209 1.00 0.00 ? 36  PRO A HB2  11 
ATOM   7077  H  HB3  . PRO A 1 36 ? -4.089  -1.008  -14.844 1.00 0.00 ? 36  PRO A HB3  11 
ATOM   7078  H  HG2  . PRO A 1 36 ? -6.685  -0.903  -13.357 1.00 0.00 ? 36  PRO A HG2  11 
ATOM   7079  H  HG3  . PRO A 1 36 ? -6.250  -1.865  -14.782 1.00 0.00 ? 36  PRO A HG3  11 
ATOM   7080  H  HD2  . PRO A 1 36 ? -6.290  -2.902  -12.281 1.00 0.00 ? 36  PRO A HD2  11 
ATOM   7081  H  HD3  . PRO A 1 36 ? -5.156  -3.459  -13.527 1.00 0.00 ? 36  PRO A HD3  11 
ATOM   7082  N  N    . GLN A 1 37 ? -5.379  0.286   -11.079 1.00 0.00 ? 37  GLN A N    11 
ATOM   7083  C  CA   . GLN A 1 37 ? -5.817  1.329   -10.160 1.00 0.00 ? 37  GLN A CA   11 
ATOM   7084  C  C    . GLN A 1 37 ? -4.774  1.572   -9.074  1.00 0.00 ? 37  GLN A C    11 
ATOM   7085  O  O    . GLN A 1 37 ? -4.716  2.651   -8.484  1.00 0.00 ? 37  GLN A O    11 
ATOM   7086  C  CB   . GLN A 1 37 ? -7.154  0.947   -9.522  1.00 0.00 ? 37  GLN A CB   11 
ATOM   7087  C  CG   . GLN A 1 37 ? -8.361  1.336   -10.360 1.00 0.00 ? 37  GLN A CG   11 
ATOM   7088  C  CD   . GLN A 1 37 ? -9.672  0.906   -9.731  1.00 0.00 ? 37  GLN A CD   11 
ATOM   7089  O  OE1  . GLN A 1 37 ? -10.177 -0.183  -10.005 1.00 0.00 ? 37  GLN A OE1  11 
ATOM   7090  N  NE2  . GLN A 1 37 ? -10.230 1.761   -8.882  1.00 0.00 ? 37  GLN A NE2  11 
ATOM   7091  H  H    . GLN A 1 37 ? -5.918  -0.526  -11.173 1.00 0.00 ? 37  GLN A H    11 
ATOM   7092  H  HA   . GLN A 1 37 ? -5.946  2.238   -10.727 1.00 0.00 ? 37  GLN A HA   11 
ATOM   7093  H  HB2  . GLN A 1 37 ? -7.176  -0.122  -9.372  1.00 0.00 ? 37  GLN A HB2  11 
ATOM   7094  H  HB3  . GLN A 1 37 ? -7.235  1.439   -8.563  1.00 0.00 ? 37  GLN A HB3  11 
ATOM   7095  H  HG2  . GLN A 1 37 ? -8.372  2.410   -10.476 1.00 0.00 ? 37  GLN A HG2  11 
ATOM   7096  H  HG3  . GLN A 1 37 ? -8.274  0.871   -11.330 1.00 0.00 ? 37  GLN A HG3  11 
ATOM   7097  H  HE21 . GLN A 1 37 ? -9.771  2.611   -8.713  1.00 0.00 ? 37  GLN A HE21 11 
ATOM   7098  H  HE22 . GLN A 1 37 ? -11.078 1.509   -8.462  1.00 0.00 ? 37  GLN A HE22 11 
ATOM   7099  N  N    . CYS A 1 38 ? -3.950  0.562   -8.816  1.00 0.00 ? 38  CYS A N    11 
ATOM   7100  C  CA   . CYS A 1 38 ? -2.908  0.665   -7.801  1.00 0.00 ? 38  CYS A CA   11 
ATOM   7101  C  C    . CYS A 1 38 ? -2.162  1.990   -7.920  1.00 0.00 ? 38  CYS A C    11 
ATOM   7102  O  O    . CYS A 1 38 ? -1.786  2.424   -9.009  1.00 0.00 ? 38  CYS A O    11 
ATOM   7103  C  CB   . CYS A 1 38 ? -1.925  -0.500  -7.930  1.00 0.00 ? 38  CYS A CB   11 
ATOM   7104  S  SG   . CYS A 1 38 ? -0.673  -0.567  -6.608  1.00 0.00 ? 38  CYS A SG   11 
ATOM   7105  H  H    . CYS A 1 38 ? -4.045  -0.274  -9.320  1.00 0.00 ? 38  CYS A H    11 
ATOM   7106  H  HA   . CYS A 1 38 ? -3.382  0.618   -6.833  1.00 0.00 ? 38  CYS A HA   11 
ATOM   7107  H  HB2  . CYS A 1 38 ? -2.475  -1.430  -7.908  1.00 0.00 ? 38  CYS A HB2  11 
ATOM   7108  H  HB3  . CYS A 1 38 ? -1.404  -0.419  -8.873  1.00 0.00 ? 38  CYS A HB3  11 
ATOM   7109  N  N    . PRO A 1 39 ? -1.940  2.649   -6.773  1.00 0.00 ? 39  PRO A N    11 
ATOM   7110  C  CA   . PRO A 1 39 ? -1.236  3.934   -6.721  1.00 0.00 ? 39  PRO A CA   11 
ATOM   7111  C  C    . PRO A 1 39 ? 0.248   3.795   -7.042  1.00 0.00 ? 39  PRO A C    11 
ATOM   7112  O  O    . PRO A 1 39 ? 0.856   4.703   -7.609  1.00 0.00 ? 39  PRO A O    11 
ATOM   7113  C  CB   . PRO A 1 39 ? -1.430  4.387   -5.272  1.00 0.00 ? 39  PRO A CB   11 
ATOM   7114  C  CG   . PRO A 1 39 ? -1.640  3.126   -4.506  1.00 0.00 ? 39  PRO A CG   11 
ATOM   7115  C  CD   . PRO A 1 39 ? -2.360  2.191   -5.438  1.00 0.00 ? 39  PRO A CD   11 
ATOM   7116  H  HA   . PRO A 1 39 ? -1.682  4.657   -7.389  1.00 0.00 ? 39  PRO A HA   11 
ATOM   7117  H  HB2  . PRO A 1 39 ? -0.548  4.912   -4.935  1.00 0.00 ? 39  PRO A HB2  11 
ATOM   7118  H  HB3  . PRO A 1 39 ? -2.290  5.036   -5.206  1.00 0.00 ? 39  PRO A HB3  11 
ATOM   7119  H  HG2  . PRO A 1 39 ? -0.687  2.709   -4.218  1.00 0.00 ? 39  PRO A HG2  11 
ATOM   7120  H  HG3  . PRO A 1 39 ? -2.244  3.324   -3.633  1.00 0.00 ? 39  PRO A HG3  11 
ATOM   7121  H  HD2  . PRO A 1 39 ? -2.047  1.171   -5.265  1.00 0.00 ? 39  PRO A HD2  11 
ATOM   7122  H  HD3  . PRO A 1 39 ? -3.429  2.286   -5.316  1.00 0.00 ? 39  PRO A HD3  11 
ATOM   7123  N  N    . GLN A 1 40 ? 0.823   2.654   -6.677  1.00 0.00 ? 40  GLN A N    11 
ATOM   7124  C  CA   . GLN A 1 40 ? 2.237   2.398   -6.926  1.00 0.00 ? 40  GLN A CA   11 
ATOM   7125  C  C    . GLN A 1 40 ? 2.462   1.939   -8.363  1.00 0.00 ? 40  GLN A C    11 
ATOM   7126  O  O    . GLN A 1 40 ? 1.559   1.396   -9.000  1.00 0.00 ? 40  GLN A O    11 
ATOM   7127  C  CB   . GLN A 1 40 ? 2.765   1.343   -5.953  1.00 0.00 ? 40  GLN A CB   11 
ATOM   7128  C  CG   . GLN A 1 40 ? 2.648   1.750   -4.493  1.00 0.00 ? 40  GLN A CG   11 
ATOM   7129  C  CD   . GLN A 1 40 ? 2.875   0.590   -3.544  1.00 0.00 ? 40  GLN A CD   11 
ATOM   7130  O  OE1  . GLN A 1 40 ? 2.036   -0.305  -3.427  1.00 0.00 ? 40  GLN A OE1  11 
ATOM   7131  N  NE2  . GLN A 1 40 ? 4.013   0.598   -2.860  1.00 0.00 ? 40  GLN A NE2  11 
ATOM   7132  H  H    . GLN A 1 40 ? 0.285   1.969   -6.229  1.00 0.00 ? 40  GLN A H    11 
ATOM   7133  H  HA   . GLN A 1 40 ? 2.774   3.321   -6.769  1.00 0.00 ? 40  GLN A HA   11 
ATOM   7134  H  HB2  . GLN A 1 40 ? 2.210   0.429   -6.095  1.00 0.00 ? 40  GLN A HB2  11 
ATOM   7135  H  HB3  . GLN A 1 40 ? 3.807   1.160   -6.170  1.00 0.00 ? 40  GLN A HB3  11 
ATOM   7136  H  HG2  . GLN A 1 40 ? 3.382   2.514   -4.284  1.00 0.00 ? 40  GLN A HG2  11 
ATOM   7137  H  HG3  . GLN A 1 40 ? 1.658   2.148   -4.322  1.00 0.00 ? 40  GLN A HG3  11 
ATOM   7138  H  HE21 . GLN A 1 40 ? 4.633   1.343   -3.003  1.00 0.00 ? 40  GLN A HE21 11 
ATOM   7139  H  HE22 . GLN A 1 40 ? 4.185   -0.140  -2.239  1.00 0.00 ? 40  GLN A HE22 11 
ATOM   7140  N  N    . SER A 1 41 ? 3.671   2.161   -8.868  1.00 0.00 ? 41  SER A N    11 
ATOM   7141  C  CA   . SER A 1 41 ? 4.013   1.774   -10.231 1.00 0.00 ? 41  SER A CA   11 
ATOM   7142  C  C    . SER A 1 41 ? 4.311   0.280   -10.313 1.00 0.00 ? 41  SER A C    11 
ATOM   7143  O  O    . SER A 1 41 ? 4.555   -0.373  -9.298  1.00 0.00 ? 41  SER A O    11 
ATOM   7144  C  CB   . SER A 1 41 ? 5.221   2.573   -10.724 1.00 0.00 ? 41  SER A CB   11 
ATOM   7145  O  OG   . SER A 1 41 ? 5.325   2.523   -12.136 1.00 0.00 ? 41  SER A OG   11 
ATOM   7146  H  H    . SER A 1 41 ? 4.349   2.598   -8.310  1.00 0.00 ? 41  SER A H    11 
ATOM   7147  H  HA   . SER A 1 41 ? 3.165   1.995   -10.862 1.00 0.00 ? 41  SER A HA   11 
ATOM   7148  H  HB2  . SER A 1 41 ? 5.116   3.604   -10.419 1.00 0.00 ? 41  SER A HB2  11 
ATOM   7149  H  HB3  . SER A 1 41 ? 6.122   2.161   -10.293 1.00 0.00 ? 41  SER A HB3  11 
ATOM   7150  H  HG   . SER A 1 41 ? 4.458   2.651   -12.526 1.00 0.00 ? 41  SER A HG   11 
ATOM   7151  N  N    . HIS A 1 42 ? 4.288   -0.256  -11.530 1.00 0.00 ? 42  HIS A N    11 
ATOM   7152  C  CA   . HIS A 1 42 ? 4.556   -1.674  -11.746 1.00 0.00 ? 42  HIS A CA   11 
ATOM   7153  C  C    . HIS A 1 42 ? 5.602   -1.868  -12.839 1.00 0.00 ? 42  HIS A C    11 
ATOM   7154  O  O    . HIS A 1 42 ? 5.271   -2.210  -13.975 1.00 0.00 ? 42  HIS A O    11 
ATOM   7155  C  CB   . HIS A 1 42 ? 3.267   -2.406  -12.121 1.00 0.00 ? 42  HIS A CB   11 
ATOM   7156  C  CG   . HIS A 1 42 ? 2.263   -2.460  -11.011 1.00 0.00 ? 42  HIS A CG   11 
ATOM   7157  N  ND1  . HIS A 1 42 ? 0.904   -2.537  -11.228 1.00 0.00 ? 42  HIS A ND1  11 
ATOM   7158  C  CD2  . HIS A 1 42 ? 2.428   -2.448  -9.667  1.00 0.00 ? 42  HIS A CD2  11 
ATOM   7159  C  CE1  . HIS A 1 42 ? 0.276   -2.569  -10.066 1.00 0.00 ? 42  HIS A CE1  11 
ATOM   7160  N  NE2  . HIS A 1 42 ? 1.178   -2.517  -9.103  1.00 0.00 ? 42  HIS A NE2  11 
ATOM   7161  H  H    . HIS A 1 42 ? 4.087   0.315   -12.300 1.00 0.00 ? 42  HIS A H    11 
ATOM   7162  H  HA   . HIS A 1 42 ? 4.937   -2.084  -10.823 1.00 0.00 ? 42  HIS A HA   11 
ATOM   7163  H  HB2  . HIS A 1 42 ? 2.807   -1.905  -12.959 1.00 0.00 ? 42  HIS A HB2  11 
ATOM   7164  H  HB3  . HIS A 1 42 ? 3.506   -3.422  -12.402 1.00 0.00 ? 42  HIS A HB3  11 
ATOM   7165  H  HD1  . HIS A 1 42 ? 0.465   -2.562  -12.103 1.00 0.00 ? 42  HIS A HD1  11 
ATOM   7166  H  HD2  . HIS A 1 42 ? 3.368   -2.395  -9.136  1.00 0.00 ? 42  HIS A HD2  11 
ATOM   7167  H  HE1  . HIS A 1 42 ? -0.793  -2.628  -9.927  1.00 0.00 ? 42  HIS A HE1  11 
ATOM   7168  N  N    . ASP A 1 43 ? 6.864   -1.648  -12.489 1.00 0.00 ? 43  ASP A N    11 
ATOM   7169  C  CA   . ASP A 1 43 ? 7.959   -1.800  -13.440 1.00 0.00 ? 43  ASP A CA   11 
ATOM   7170  C  C    . ASP A 1 43 ? 8.534   -3.212  -13.386 1.00 0.00 ? 43  ASP A C    11 
ATOM   7171  O  O    . ASP A 1 43 ? 8.997   -3.665  -12.339 1.00 0.00 ? 43  ASP A O    11 
ATOM   7172  C  CB   . ASP A 1 43 ? 9.059   -0.777  -13.151 1.00 0.00 ? 43  ASP A CB   11 
ATOM   7173  C  CG   . ASP A 1 43 ? 9.925   -0.499  -14.365 1.00 0.00 ? 43  ASP A CG   11 
ATOM   7174  O  OD1  . ASP A 1 43 ? 9.370   -0.106  -15.411 1.00 0.00 ? 43  ASP A OD1  11 
ATOM   7175  O  OD2  . ASP A 1 43 ? 11.157  -0.677  -14.268 1.00 0.00 ? 43  ASP A OD2  11 
ATOM   7176  H  H    . ASP A 1 43 ? 7.065   -1.378  -11.568 1.00 0.00 ? 43  ASP A H    11 
ATOM   7177  H  HA   . ASP A 1 43 ? 7.566   -1.622  -14.429 1.00 0.00 ? 43  ASP A HA   11 
ATOM   7178  H  HB2  . ASP A 1 43 ? 8.605   0.152   -12.837 1.00 0.00 ? 43  ASP A HB2  11 
ATOM   7179  H  HB3  . ASP A 1 43 ? 9.690   -1.151  -12.359 1.00 0.00 ? 43  ASP A HB3  11 
ATOM   7180  N  N    . ILE A 1 44 ? 8.500   -3.902  -14.521 1.00 0.00 ? 44  ILE A N    11 
ATOM   7181  C  CA   . ILE A 1 44 ? 9.018   -5.262  -14.603 1.00 0.00 ? 44  ILE A CA   11 
ATOM   7182  C  C    . ILE A 1 44 ? 10.230  -5.335  -15.525 1.00 0.00 ? 44  ILE A C    11 
ATOM   7183  O  O    . ILE A 1 44 ? 10.098  -5.277  -16.747 1.00 0.00 ? 44  ILE A O    11 
ATOM   7184  C  CB   . ILE A 1 44 ? 7.944   -6.244  -15.108 1.00 0.00 ? 44  ILE A CB   11 
ATOM   7185  C  CG1  . ILE A 1 44 ? 6.692   -6.160  -14.232 1.00 0.00 ? 44  ILE A CG1  11 
ATOM   7186  C  CG2  . ILE A 1 44 ? 8.490   -7.664  -15.125 1.00 0.00 ? 44  ILE A CG2  11 
ATOM   7187  C  CD1  . ILE A 1 44 ? 6.945   -6.511  -12.782 1.00 0.00 ? 44  ILE A CD1  11 
ATOM   7188  H  H    . ILE A 1 44 ? 8.119   -3.487  -15.322 1.00 0.00 ? 44  ILE A H    11 
ATOM   7189  H  HA   . ILE A 1 44 ? 9.316   -5.566  -13.610 1.00 0.00 ? 44  ILE A HA   11 
ATOM   7190  H  HB   . ILE A 1 44 ? 7.685   -5.971  -16.119 1.00 0.00 ? 44  ILE A HB   11 
ATOM   7191  H  HG12 . ILE A 1 44 ? 6.304   -5.154  -14.266 1.00 0.00 ? 44  ILE A HG12 11 
ATOM   7192  H  HG13 . ILE A 1 44 ? 5.947   -6.842  -14.615 1.00 0.00 ? 44  ILE A HG13 11 
ATOM   7193  H  HG21 . ILE A 1 44 ? 8.413   -8.091  -14.137 1.00 0.00 ? 44  ILE A HG21 11 
ATOM   7194  H  HG22 . ILE A 1 44 ? 7.918   -8.260  -15.820 1.00 0.00 ? 44  ILE A HG22 11 
ATOM   7195  H  HG23 . ILE A 1 44 ? 9.525   -7.648  -15.431 1.00 0.00 ? 44  ILE A HG23 11 
ATOM   7196  H  HD11 . ILE A 1 44 ? 6.345   -7.367  -12.509 1.00 0.00 ? 44  ILE A HD11 11 
ATOM   7197  H  HD12 . ILE A 1 44 ? 7.990   -6.744  -12.644 1.00 0.00 ? 44  ILE A HD12 11 
ATOM   7198  H  HD13 . ILE A 1 44 ? 6.678   -5.671  -12.157 1.00 0.00 ? 44  ILE A HD13 11 
ATOM   7199  N  N    . SER A 1 45 ? 11.412  -5.464  -14.930 1.00 0.00 ? 45  SER A N    11 
ATOM   7200  C  CA   . SER A 1 45 ? 12.650  -5.542  -15.698 1.00 0.00 ? 45  SER A CA   11 
ATOM   7201  C  C    . SER A 1 45 ? 13.702  -6.356  -14.950 1.00 0.00 ? 45  SER A C    11 
ATOM   7202  O  O    . SER A 1 45 ? 13.462  -6.832  -13.842 1.00 0.00 ? 45  SER A O    11 
ATOM   7203  C  CB   . SER A 1 45 ? 13.185  -4.139  -15.988 1.00 0.00 ? 45  SER A CB   11 
ATOM   7204  O  OG   . SER A 1 45 ? 13.389  -3.413  -14.788 1.00 0.00 ? 45  SER A OG   11 
ATOM   7205  H  H    . SER A 1 45 ? 11.453  -5.504  -13.952 1.00 0.00 ? 45  SER A H    11 
ATOM   7206  H  HA   . SER A 1 45 ? 12.428  -6.034  -16.633 1.00 0.00 ? 45  SER A HA   11 
ATOM   7207  H  HB2  . SER A 1 45 ? 14.125  -4.216  -16.512 1.00 0.00 ? 45  SER A HB2  11 
ATOM   7208  H  HB3  . SER A 1 45 ? 12.473  -3.605  -16.601 1.00 0.00 ? 45  SER A HB3  11 
ATOM   7209  H  HG   . SER A 1 45 ? 13.550  -4.025  -14.066 1.00 0.00 ? 45  SER A HG   11 
ATOM   7210  N  N    . GLY A 1 46 ? 14.869  -6.510  -15.567 1.00 0.00 ? 46  GLY A N    11 
ATOM   7211  C  CA   . GLY A 1 46 ? 15.942  -7.267  -14.947 1.00 0.00 ? 46  GLY A CA   11 
ATOM   7212  C  C    . GLY A 1 46 ? 17.073  -6.380  -14.466 1.00 0.00 ? 46  GLY A C    11 
ATOM   7213  O  O    . GLY A 1 46 ? 17.193  -5.221  -14.862 1.00 0.00 ? 46  GLY A O    11 
ATOM   7214  H  H    . GLY A 1 46 ? 15.004  -6.108  -16.451 1.00 0.00 ? 46  GLY A H    11 
ATOM   7215  H  HA2  . GLY A 1 46 ? 15.542  -7.812  -14.105 1.00 0.00 ? 46  GLY A HA2  11 
ATOM   7216  H  HA3  . GLY A 1 46 ? 16.333  -7.971  -15.666 1.00 0.00 ? 46  GLY A HA3  11 
ATOM   7217  N  N    . PRO A 1 47 ? 17.928  -6.928  -13.589 1.00 0.00 ? 47  PRO A N    11 
ATOM   7218  C  CA   . PRO A 1 47 ? 19.070  -6.196  -13.034 1.00 0.00 ? 47  PRO A CA   11 
ATOM   7219  C  C    . PRO A 1 47 ? 20.153  -5.934  -14.075 1.00 0.00 ? 47  PRO A C    11 
ATOM   7220  O  O    . PRO A 1 47 ? 20.676  -6.865  -14.688 1.00 0.00 ? 47  PRO A O    11 
ATOM   7221  C  CB   . PRO A 1 47 ? 19.594  -7.132  -11.941 1.00 0.00 ? 47  PRO A CB   11 
ATOM   7222  C  CG   . PRO A 1 47 ? 19.160  -8.492  -12.368 1.00 0.00 ? 47  PRO A CG   11 
ATOM   7223  C  CD   . PRO A 1 47 ? 17.845  -8.305  -13.074 1.00 0.00 ? 47  PRO A CD   11 
ATOM   7224  H  HA   . PRO A 1 47 ? 18.764  -5.260  -12.591 1.00 0.00 ? 47  PRO A HA   11 
ATOM   7225  H  HB2  . PRO A 1 47 ? 20.671  -7.059  -11.887 1.00 0.00 ? 47  PRO A HB2  11 
ATOM   7226  H  HB3  . PRO A 1 47 ? 19.161  -6.860  -10.991 1.00 0.00 ? 47  PRO A HB3  11 
ATOM   7227  H  HG2  . PRO A 1 47 ? 19.890  -8.916  -13.040 1.00 0.00 ? 47  PRO A HG2  11 
ATOM   7228  H  HG3  . PRO A 1 47 ? 19.033  -9.125  -11.502 1.00 0.00 ? 47  PRO A HG3  11 
ATOM   7229  H  HD2  . PRO A 1 47 ? 17.747  -9.015  -13.882 1.00 0.00 ? 47  PRO A HD2  11 
ATOM   7230  H  HD3  . PRO A 1 47 ? 17.026  -8.407  -12.378 1.00 0.00 ? 47  PRO A HD3  11 
ATOM   7231  N  N    . SER A 1 48 ? 20.485  -4.662  -14.269 1.00 0.00 ? 48  SER A N    11 
ATOM   7232  C  CA   . SER A 1 48 ? 21.503  -4.278  -15.239 1.00 0.00 ? 48  SER A CA   11 
ATOM   7233  C  C    . SER A 1 48 ? 22.848  -4.050  -14.554 1.00 0.00 ? 48  SER A C    11 
ATOM   7234  O  O    . SER A 1 48 ? 22.911  -3.835  -13.344 1.00 0.00 ? 48  SER A O    11 
ATOM   7235  C  CB   . SER A 1 48 ? 21.077  -3.011  -15.984 1.00 0.00 ? 48  SER A CB   11 
ATOM   7236  O  OG   . SER A 1 48 ? 19.808  -3.180  -16.593 1.00 0.00 ? 48  SER A OG   11 
ATOM   7237  H  H    . SER A 1 48 ? 20.032  -3.965  -13.750 1.00 0.00 ? 48  SER A H    11 
ATOM   7238  H  HA   . SER A 1 48 ? 21.607  -5.085  -15.949 1.00 0.00 ? 48  SER A HA   11 
ATOM   7239  H  HB2  . SER A 1 48 ? 21.021  -2.188  -15.287 1.00 0.00 ? 48  SER A HB2  11 
ATOM   7240  H  HB3  . SER A 1 48 ? 21.804  -2.785  -16.751 1.00 0.00 ? 48  SER A HB3  11 
ATOM   7241  H  HG   . SER A 1 48 ? 19.135  -2.763  -16.050 1.00 0.00 ? 48  SER A HG   11 
ATOM   7242  N  N    . SER A 1 49 ? 23.920  -4.100  -15.338 1.00 0.00 ? 49  SER A N    11 
ATOM   7243  C  CA   . SER A 1 49 ? 25.264  -3.903  -14.808 1.00 0.00 ? 49  SER A CA   11 
ATOM   7244  C  C    . SER A 1 49 ? 25.343  -2.617  -13.992 1.00 0.00 ? 49  SER A C    11 
ATOM   7245  O  O    . SER A 1 49 ? 24.606  -1.664  -14.241 1.00 0.00 ? 49  SER A O    11 
ATOM   7246  C  CB   . SER A 1 49 ? 26.284  -3.862  -15.948 1.00 0.00 ? 49  SER A CB   11 
ATOM   7247  O  OG   . SER A 1 49 ? 27.609  -3.915  -15.448 1.00 0.00 ? 49  SER A OG   11 
ATOM   7248  H  H    . SER A 1 49 ? 23.804  -4.276  -16.295 1.00 0.00 ? 49  SER A H    11 
ATOM   7249  H  HA   . SER A 1 49 ? 25.492  -4.739  -14.163 1.00 0.00 ? 49  SER A HA   11 
ATOM   7250  H  HB2  . SER A 1 49 ? 26.124  -4.705  -16.601 1.00 0.00 ? 49  SER A HB2  11 
ATOM   7251  H  HB3  . SER A 1 49 ? 26.158  -2.945  -16.506 1.00 0.00 ? 49  SER A HB3  11 
ATOM   7252  H  HG   . SER A 1 49 ? 27.613  -4.361  -14.598 1.00 0.00 ? 49  SER A HG   11 
ATOM   7253  N  N    . GLY A 1 50 ? 26.245  -2.597  -13.015 1.00 0.00 ? 50  GLY A N    11 
ATOM   7254  C  CA   . GLY A 1 50 ? 26.405  -1.424  -12.176 1.00 0.00 ? 50  GLY A CA   11 
ATOM   7255  C  C    . GLY A 1 50 ? 27.744  -1.396  -11.467 1.00 0.00 ? 50  GLY A C    11 
ATOM   7256  O  O    . GLY A 1 50 ? 28.754  -1.103  -12.105 1.00 0.00 ? 50  GLY A O    11 
ATOM   7257  H  H    . GLY A 1 50 ? 26.806  -3.387  -12.862 1.00 0.00 ? 50  GLY A H    11 
ATOM   7258  H  HA2  . GLY A 1 50 ? 26.316  -0.541  -12.791 1.00 0.00 ? 50  GLY A HA2  11 
ATOM   7259  H  HA3  . GLY A 1 50 ? 25.618  -1.415  -11.435 1.00 0.00 ? 50  GLY A HA3  11 
HETATM 7260  ZN ZN   . ZN  B 2 .  ? 0.529   -2.511  -7.158  1.00 0.00 ? 201 ZN  A ZN   11 
ATOM   7261  N  N    . GLY A 1 1  ? -5.860  5.753   -38.847 1.00 0.00 ? 1   GLY A N    12 
ATOM   7262  C  CA   . GLY A 1 1  ? -4.516  6.293   -38.940 1.00 0.00 ? 1   GLY A CA   12 
ATOM   7263  C  C    . GLY A 1 1  ? -3.454  5.211   -38.922 1.00 0.00 ? 1   GLY A C    12 
ATOM   7264  O  O    . GLY A 1 1  ? -2.569  5.216   -38.067 1.00 0.00 ? 1   GLY A O    12 
ATOM   7265  H  H1   . GLY A 1 1  ? -5.993  4.784   -38.773 1.00 0.00 ? 1   GLY A H1   12 
ATOM   7266  H  HA2  . GLY A 1 1  ? -4.429  6.854   -39.859 1.00 0.00 ? 1   GLY A HA2  12 
ATOM   7267  H  HA3  . GLY A 1 1  ? -4.350  6.959   -38.106 1.00 0.00 ? 1   GLY A HA3  12 
ATOM   7268  N  N    . SER A 1 2  ? -3.543  4.281   -39.867 1.00 0.00 ? 2   SER A N    12 
ATOM   7269  C  CA   . SER A 1 2  ? -2.585  3.185   -39.953 1.00 0.00 ? 2   SER A CA   12 
ATOM   7270  C  C    . SER A 1 2  ? -1.339  3.611   -40.724 1.00 0.00 ? 2   SER A C    12 
ATOM   7271  O  O    . SER A 1 2  ? -0.897  2.920   -41.641 1.00 0.00 ? 2   SER A O    12 
ATOM   7272  C  CB   . SER A 1 2  ? -3.226  1.971   -40.628 1.00 0.00 ? 2   SER A CB   12 
ATOM   7273  O  OG   . SER A 1 2  ? -3.329  2.162   -42.029 1.00 0.00 ? 2   SER A OG   12 
ATOM   7274  H  H    . SER A 1 2  ? -4.272  4.332   -40.521 1.00 0.00 ? 2   SER A H    12 
ATOM   7275  H  HA   . SER A 1 2  ? -2.298  2.916   -38.947 1.00 0.00 ? 2   SER A HA   12 
ATOM   7276  H  HB2  . SER A 1 2  ? -2.622  1.097   -40.439 1.00 0.00 ? 2   SER A HB2  12 
ATOM   7277  H  HB3  . SER A 1 2  ? -4.216  1.819   -40.224 1.00 0.00 ? 2   SER A HB3  12 
ATOM   7278  H  HG   . SER A 1 2  ? -3.927  1.508   -42.398 1.00 0.00 ? 2   SER A HG   12 
ATOM   7279  N  N    . SER A 1 3  ? -0.779  4.755   -40.344 1.00 0.00 ? 3   SER A N    12 
ATOM   7280  C  CA   . SER A 1 3  ? 0.414   5.277   -41.001 1.00 0.00 ? 3   SER A CA   12 
ATOM   7281  C  C    . SER A 1 3  ? 1.529   4.235   -41.011 1.00 0.00 ? 3   SER A C    12 
ATOM   7282  O  O    . SER A 1 3  ? 2.158   3.973   -39.987 1.00 0.00 ? 3   SER A O    12 
ATOM   7283  C  CB   . SER A 1 3  ? 0.895   6.547   -40.298 1.00 0.00 ? 3   SER A CB   12 
ATOM   7284  O  OG   . SER A 1 3  ? 1.230   6.287   -38.946 1.00 0.00 ? 3   SER A OG   12 
ATOM   7285  H  H    . SER A 1 3  ? -1.179  5.261   -39.606 1.00 0.00 ? 3   SER A H    12 
ATOM   7286  H  HA   . SER A 1 3  ? 0.152   5.517   -42.021 1.00 0.00 ? 3   SER A HA   12 
ATOM   7287  H  HB2  . SER A 1 3  ? 1.768   6.928   -40.805 1.00 0.00 ? 3   SER A HB2  12 
ATOM   7288  H  HB3  . SER A 1 3  ? 0.110   7.289   -40.325 1.00 0.00 ? 3   SER A HB3  12 
ATOM   7289  H  HG   . SER A 1 3  ? 0.582   6.700   -38.370 1.00 0.00 ? 3   SER A HG   12 
ATOM   7290  N  N    . GLY A 1 4  ? 1.767   3.643   -42.178 1.00 0.00 ? 4   GLY A N    12 
ATOM   7291  C  CA   . GLY A 1 4  ? 2.805   2.636   -42.301 1.00 0.00 ? 4   GLY A CA   12 
ATOM   7292  C  C    . GLY A 1 4  ? 4.198   3.224   -42.195 1.00 0.00 ? 4   GLY A C    12 
ATOM   7293  O  O    . GLY A 1 4  ? 4.450   4.331   -42.672 1.00 0.00 ? 4   GLY A O    12 
ATOM   7294  H  H    . GLY A 1 4  ? 1.233   3.892   -42.961 1.00 0.00 ? 4   GLY A H    12 
ATOM   7295  H  HA2  . GLY A 1 4  ? 2.674   1.903   -41.519 1.00 0.00 ? 4   GLY A HA2  12 
ATOM   7296  H  HA3  . GLY A 1 4  ? 2.704   2.148   -43.259 1.00 0.00 ? 4   GLY A HA3  12 
ATOM   7297  N  N    . SER A 1 5  ? 5.105   2.483   -41.568 1.00 0.00 ? 5   SER A N    12 
ATOM   7298  C  CA   . SER A 1 5  ? 6.479   2.940   -41.396 1.00 0.00 ? 5   SER A CA   12 
ATOM   7299  C  C    . SER A 1 5  ? 6.515   4.350   -40.814 1.00 0.00 ? 5   SER A C    12 
ATOM   7300  O  O    . SER A 1 5  ? 7.310   5.189   -41.238 1.00 0.00 ? 5   SER A O    12 
ATOM   7301  C  CB   . SER A 1 5  ? 7.220   2.910   -42.735 1.00 0.00 ? 5   SER A CB   12 
ATOM   7302  O  OG   . SER A 1 5  ? 7.471   1.578   -43.149 1.00 0.00 ? 5   SER A OG   12 
ATOM   7303  H  H    . SER A 1 5  ? 4.844   1.609   -41.209 1.00 0.00 ? 5   SER A H    12 
ATOM   7304  H  HA   . SER A 1 5  ? 6.969   2.267   -40.708 1.00 0.00 ? 5   SER A HA   12 
ATOM   7305  H  HB2  . SER A 1 5  ? 6.620   3.401   -43.486 1.00 0.00 ? 5   SER A HB2  12 
ATOM   7306  H  HB3  . SER A 1 5  ? 8.163   3.427   -42.632 1.00 0.00 ? 5   SER A HB3  12 
ATOM   7307  H  HG   . SER A 1 5  ? 8.074   1.584   -43.896 1.00 0.00 ? 5   SER A HG   12 
ATOM   7308  N  N    . SER A 1 6  ? 5.646   4.603   -39.840 1.00 0.00 ? 6   SER A N    12 
ATOM   7309  C  CA   . SER A 1 6  ? 5.574   5.912   -39.201 1.00 0.00 ? 6   SER A CA   12 
ATOM   7310  C  C    . SER A 1 6  ? 6.229   5.881   -37.824 1.00 0.00 ? 6   SER A C    12 
ATOM   7311  O  O    . SER A 1 6  ? 6.568   4.817   -37.309 1.00 0.00 ? 6   SER A O    12 
ATOM   7312  C  CB   . SER A 1 6  ? 4.117   6.362   -39.076 1.00 0.00 ? 6   SER A CB   12 
ATOM   7313  O  OG   . SER A 1 6  ? 4.035   7.726   -38.700 1.00 0.00 ? 6   SER A OG   12 
ATOM   7314  H  H    . SER A 1 6  ? 5.038   3.893   -39.546 1.00 0.00 ? 6   SER A H    12 
ATOM   7315  H  HA   . SER A 1 6  ? 6.106   6.615   -39.825 1.00 0.00 ? 6   SER A HA   12 
ATOM   7316  H  HB2  . SER A 1 6  ? 3.620   6.231   -40.024 1.00 0.00 ? 6   SER A HB2  12 
ATOM   7317  H  HB3  . SER A 1 6  ? 3.622   5.763   -38.324 1.00 0.00 ? 6   SER A HB3  12 
ATOM   7318  H  HG   . SER A 1 6  ? 3.438   7.817   -37.954 1.00 0.00 ? 6   SER A HG   12 
ATOM   7319  N  N    . GLY A 1 7  ? 6.405   7.059   -37.233 1.00 0.00 ? 7   GLY A N    12 
ATOM   7320  C  CA   . GLY A 1 7  ? 7.019   7.146   -35.921 1.00 0.00 ? 7   GLY A CA   12 
ATOM   7321  C  C    . GLY A 1 7  ? 7.477   8.552   -35.587 1.00 0.00 ? 7   GLY A C    12 
ATOM   7322  O  O    . GLY A 1 7  ? 8.552   8.744   -35.018 1.00 0.00 ? 7   GLY A O    12 
ATOM   7323  H  H    . GLY A 1 7  ? 6.116   7.876   -37.691 1.00 0.00 ? 7   GLY A H    12 
ATOM   7324  H  HA2  . GLY A 1 7  ? 6.304   6.825   -35.178 1.00 0.00 ? 7   GLY A HA2  12 
ATOM   7325  H  HA3  . GLY A 1 7  ? 7.874   6.486   -35.892 1.00 0.00 ? 7   GLY A HA3  12 
ATOM   7326  N  N    . CYS A 1 8  ? 6.660   9.538   -35.941 1.00 0.00 ? 8   CYS A N    12 
ATOM   7327  C  CA   . CYS A 1 8  ? 6.987   10.935  -35.678 1.00 0.00 ? 8   CYS A CA   12 
ATOM   7328  C  C    . CYS A 1 8  ? 6.007   11.544  -34.681 1.00 0.00 ? 8   CYS A C    12 
ATOM   7329  O  O    . CYS A 1 8  ? 5.067   12.240  -35.066 1.00 0.00 ? 8   CYS A O    12 
ATOM   7330  C  CB   . CYS A 1 8  ? 6.975   11.737  -36.980 1.00 0.00 ? 8   CYS A CB   12 
ATOM   7331  S  SG   . CYS A 1 8  ? 8.441   11.495  -38.010 1.00 0.00 ? 8   CYS A SG   12 
ATOM   7332  H  H    . CYS A 1 8  ? 5.816   9.322   -36.391 1.00 0.00 ? 8   CYS A H    12 
ATOM   7333  H  HA   . CYS A 1 8  ? 7.980   10.967  -35.254 1.00 0.00 ? 8   CYS A HA   12 
ATOM   7334  H  HB2  . CYS A 1 8  ? 6.113   11.449  -37.563 1.00 0.00 ? 8   CYS A HB2  12 
ATOM   7335  H  HB3  . CYS A 1 8  ? 6.907   12.789  -36.744 1.00 0.00 ? 8   CYS A HB3  12 
ATOM   7336  H  HG   . CYS A 1 8  ? 9.199   12.576  -37.902 1.00 0.00 ? 8   CYS A HG   12 
ATOM   7337  N  N    . CYS A 1 9  ? 6.232   11.277  -33.399 1.00 0.00 ? 9   CYS A N    12 
ATOM   7338  C  CA   . CYS A 1 9  ? 5.367   11.797  -32.347 1.00 0.00 ? 9   CYS A CA   12 
ATOM   7339  C  C    . CYS A 1 9  ? 6.026   12.973  -31.633 1.00 0.00 ? 9   CYS A C    12 
ATOM   7340  O  O    . CYS A 1 9  ? 7.242   12.993  -31.440 1.00 0.00 ? 9   CYS A O    12 
ATOM   7341  C  CB   . CYS A 1 9  ? 5.035   10.695  -31.340 1.00 0.00 ? 9   CYS A CB   12 
ATOM   7342  S  SG   . CYS A 1 9  ? 4.114   9.306   -32.042 1.00 0.00 ? 9   CYS A SG   12 
ATOM   7343  H  H    . CYS A 1 9  ? 6.997   10.716  -33.155 1.00 0.00 ? 9   CYS A H    12 
ATOM   7344  H  HA   . CYS A 1 9  ? 4.453   12.139  -32.808 1.00 0.00 ? 9   CYS A HA   12 
ATOM   7345  H  HB2  . CYS A 1 9  ? 5.954   10.304  -30.928 1.00 0.00 ? 9   CYS A HB2  12 
ATOM   7346  H  HB3  . CYS A 1 9  ? 4.441   11.115  -30.541 1.00 0.00 ? 9   CYS A HB3  12 
ATOM   7347  H  HG   . CYS A 1 9  ? 3.330   8.815   -31.095 1.00 0.00 ? 9   CYS A HG   12 
ATOM   7348  N  N    . LEU A 1 10 ? 5.216   13.952  -31.245 1.00 0.00 ? 10  LEU A N    12 
ATOM   7349  C  CA   . LEU A 1 10 ? 5.721   15.133  -30.554 1.00 0.00 ? 10  LEU A CA   12 
ATOM   7350  C  C    . LEU A 1 10 ? 5.872   14.867  -29.059 1.00 0.00 ? 10  LEU A C    12 
ATOM   7351  O  O    . LEU A 1 10 ? 5.034   14.221  -28.431 1.00 0.00 ? 10  LEU A O    12 
ATOM   7352  C  CB   . LEU A 1 10 ? 4.782   16.320  -30.778 1.00 0.00 ? 10  LEU A CB   12 
ATOM   7353  C  CG   . LEU A 1 10 ? 4.440   16.638  -32.234 1.00 0.00 ? 10  LEU A CG   12 
ATOM   7354  C  CD1  . LEU A 1 10 ? 3.263   15.796  -32.703 1.00 0.00 ? 10  LEU A CD1  12 
ATOM   7355  C  CD2  . LEU A 1 10 ? 4.136   18.121  -32.399 1.00 0.00 ? 10  LEU A CD2  12 
ATOM   7356  H  H    . LEU A 1 10 ? 4.256   13.879  -31.427 1.00 0.00 ? 10  LEU A H    12 
ATOM   7357  H  HA   . LEU A 1 10 ? 6.690   15.369  -30.965 1.00 0.00 ? 10  LEU A HA   12 
ATOM   7358  H  HB2  . LEU A 1 10 ? 3.858   16.113  -30.260 1.00 0.00 ? 10  LEU A HB2  12 
ATOM   7359  H  HB3  . LEU A 1 10 ? 5.247   17.195  -30.347 1.00 0.00 ? 10  LEU A HB3  12 
ATOM   7360  H  HG   . LEU A 1 10 ? 5.290   16.399  -32.858 1.00 0.00 ? 10  LEU A HG   12 
ATOM   7361  H  HD11 . LEU A 1 10 ? 2.454   16.444  -33.004 1.00 0.00 ? 10  LEU A HD11 12 
ATOM   7362  H  HD12 . LEU A 1 10 ? 2.933   15.159  -31.896 1.00 0.00 ? 10  LEU A HD12 12 
ATOM   7363  H  HD13 . LEU A 1 10 ? 3.568   15.187  -33.541 1.00 0.00 ? 10  LEU A HD13 12 
ATOM   7364  H  HD21 . LEU A 1 10 ? 3.156   18.333  -31.998 1.00 0.00 ? 10  LEU A HD21 12 
ATOM   7365  H  HD22 . LEU A 1 10 ? 4.160   18.379  -33.448 1.00 0.00 ? 10  LEU A HD22 12 
ATOM   7366  H  HD23 . LEU A 1 10 ? 4.876   18.701  -31.868 1.00 0.00 ? 10  LEU A HD23 12 
ATOM   7367  N  N    . PRO A 1 11 ? 6.967   15.377  -28.475 1.00 0.00 ? 11  PRO A N    12 
ATOM   7368  C  CA   . PRO A 1 11 ? 7.253   15.209  -27.047 1.00 0.00 ? 11  PRO A CA   12 
ATOM   7369  C  C    . PRO A 1 11 ? 6.294   16.002  -26.167 1.00 0.00 ? 11  PRO A C    12 
ATOM   7370  O  O    . PRO A 1 11 ? 5.846   17.093  -26.520 1.00 0.00 ? 11  PRO A O    12 
ATOM   7371  C  CB   . PRO A 1 11 ? 8.679   15.748  -26.906 1.00 0.00 ? 11  PRO A CB   12 
ATOM   7372  C  CG   . PRO A 1 11 ? 8.835   16.708  -28.034 1.00 0.00 ? 11  PRO A CG   12 
ATOM   7373  C  CD   . PRO A 1 11 ? 8.009   16.157  -29.164 1.00 0.00 ? 11  PRO A CD   12 
ATOM   7374  H  HA   . PRO A 1 11 ? 7.229   14.168  -26.758 1.00 0.00 ? 11  PRO A HA   12 
ATOM   7375  H  HB2  . PRO A 1 11 ? 8.787   16.240  -25.949 1.00 0.00 ? 11  PRO A HB2  12 
ATOM   7376  H  HB3  . PRO A 1 11 ? 9.384   14.934  -26.980 1.00 0.00 ? 11  PRO A HB3  12 
ATOM   7377  H  HG2  . PRO A 1 11 ? 8.469   17.680  -27.742 1.00 0.00 ? 11  PRO A HG2  12 
ATOM   7378  H  HG3  . PRO A 1 11 ? 9.873   16.767  -28.324 1.00 0.00 ? 11  PRO A HG3  12 
ATOM   7379  H  HD2  . PRO A 1 11 ? 7.573   16.960  -29.739 1.00 0.00 ? 11  PRO A HD2  12 
ATOM   7380  H  HD3  . PRO A 1 11 ? 8.611   15.521  -29.796 1.00 0.00 ? 11  PRO A HD3  12 
ATOM   7381  N  N    . PRO A 1 12 ? 5.970   15.443  -24.991 1.00 0.00 ? 12  PRO A N    12 
ATOM   7382  C  CA   . PRO A 1 12 ? 5.061   16.083  -24.035 1.00 0.00 ? 12  PRO A CA   12 
ATOM   7383  C  C    . PRO A 1 12 ? 5.675   17.320  -23.389 1.00 0.00 ? 12  PRO A C    12 
ATOM   7384  O  O    . PRO A 1 12 ? 6.882   17.544  -23.480 1.00 0.00 ? 12  PRO A O    12 
ATOM   7385  C  CB   . PRO A 1 12 ? 4.825   14.993  -22.986 1.00 0.00 ? 12  PRO A CB   12 
ATOM   7386  C  CG   . PRO A 1 12 ? 6.034   14.125  -23.064 1.00 0.00 ? 12  PRO A CG   12 
ATOM   7387  C  CD   . PRO A 1 12 ? 6.466   14.145  -24.504 1.00 0.00 ? 12  PRO A CD   12 
ATOM   7388  H  HA   . PRO A 1 12 ? 4.121   16.349  -24.497 1.00 0.00 ? 12  PRO A HA   12 
ATOM   7389  H  HB2  . PRO A 1 12 ? 4.725   15.445  -22.010 1.00 0.00 ? 12  PRO A HB2  12 
ATOM   7390  H  HB3  . PRO A 1 12 ? 3.928   14.443  -23.228 1.00 0.00 ? 12  PRO A HB3  12 
ATOM   7391  H  HG2  . PRO A 1 12 ? 6.813   14.523  -22.433 1.00 0.00 ? 12  PRO A HG2  12 
ATOM   7392  H  HG3  . PRO A 1 12 ? 5.782   13.118  -22.763 1.00 0.00 ? 12  PRO A HG3  12 
ATOM   7393  H  HD2  . PRO A 1 12 ? 7.542   14.092  -24.576 1.00 0.00 ? 12  PRO A HD2  12 
ATOM   7394  H  HD3  . PRO A 1 12 ? 6.009   13.331  -25.047 1.00 0.00 ? 12  PRO A HD3  12 
ATOM   7395  N  N    . ALA A 1 13 ? 4.838   18.119  -22.737 1.00 0.00 ? 13  ALA A N    12 
ATOM   7396  C  CA   . ALA A 1 13 ? 5.300   19.332  -22.074 1.00 0.00 ? 13  ALA A CA   12 
ATOM   7397  C  C    . ALA A 1 13 ? 5.418   19.124  -20.568 1.00 0.00 ? 13  ALA A C    12 
ATOM   7398  O  O    . ALA A 1 13 ? 5.069   20.003  -19.779 1.00 0.00 ? 13  ALA A O    12 
ATOM   7399  C  CB   . ALA A 1 13 ? 4.359   20.490  -22.376 1.00 0.00 ? 13  ALA A CB   12 
ATOM   7400  H  H    . ALA A 1 13 ? 3.887   17.887  -22.699 1.00 0.00 ? 13  ALA A H    12 
ATOM   7401  H  HA   . ALA A 1 13 ? 6.274   19.579  -22.470 1.00 0.00 ? 13  ALA A HA   12 
ATOM   7402  H  HB1  . ALA A 1 13 ? 4.478   20.789  -23.407 1.00 0.00 ? 13  ALA A HB1  12 
ATOM   7403  H  HB2  . ALA A 1 13 ? 3.340   20.179  -22.206 1.00 0.00 ? 13  ALA A HB2  12 
ATOM   7404  H  HB3  . ALA A 1 13 ? 4.595   21.322  -21.730 1.00 0.00 ? 13  ALA A HB3  12 
ATOM   7405  N  N    . THR A 1 14 ? 5.911   17.953  -20.174 1.00 0.00 ? 14  THR A N    12 
ATOM   7406  C  CA   . THR A 1 14 ? 6.073   17.629  -18.762 1.00 0.00 ? 14  THR A CA   12 
ATOM   7407  C  C    . THR A 1 14 ? 7.314   16.774  -18.534 1.00 0.00 ? 14  THR A C    12 
ATOM   7408  O  O    . THR A 1 14 ? 7.479   15.723  -19.154 1.00 0.00 ? 14  THR A O    12 
ATOM   7409  C  CB   . THR A 1 14 ? 4.842   16.883  -18.212 1.00 0.00 ? 14  THR A CB   12 
ATOM   7410  O  OG1  . THR A 1 14 ? 4.984   16.677  -16.802 1.00 0.00 ? 14  THR A OG1  12 
ATOM   7411  C  CG2  . THR A 1 14 ? 4.664   15.544  -18.911 1.00 0.00 ? 14  THR A CG2  12 
ATOM   7412  H  H    . THR A 1 14 ? 6.170   17.293  -20.850 1.00 0.00 ? 14  THR A H    12 
ATOM   7413  H  HA   . THR A 1 14 ? 6.180   18.555  -18.217 1.00 0.00 ? 14  THR A HA   12 
ATOM   7414  H  HB   . THR A 1 14 ? 3.964   17.487  -18.394 1.00 0.00 ? 14  THR A HB   12 
ATOM   7415  H  HG1  . THR A 1 14 ? 4.302   16.073  -16.497 1.00 0.00 ? 14  THR A HG1  12 
ATOM   7416  H  HG21 . THR A 1 14 ? 5.354   14.826  -18.494 1.00 0.00 ? 14  THR A HG21 12 
ATOM   7417  H  HG22 . THR A 1 14 ? 4.858   15.659  -19.966 1.00 0.00 ? 14  THR A HG22 12 
ATOM   7418  H  HG23 . THR A 1 14 ? 3.652   15.195  -18.766 1.00 0.00 ? 14  THR A HG23 12 
ATOM   7419  N  N    . HIS A 1 15 ? 8.185   17.230  -17.639 1.00 0.00 ? 15  HIS A N    12 
ATOM   7420  C  CA   . HIS A 1 15 ? 9.412   16.506  -17.328 1.00 0.00 ? 15  HIS A CA   12 
ATOM   7421  C  C    . HIS A 1 15 ? 9.590   16.362  -15.819 1.00 0.00 ? 15  HIS A C    12 
ATOM   7422  O  O    . HIS A 1 15 ? 9.842   17.342  -15.118 1.00 0.00 ? 15  HIS A O    12 
ATOM   7423  C  CB   . HIS A 1 15 ? 10.620  17.224  -17.930 1.00 0.00 ? 15  HIS A CB   12 
ATOM   7424  C  CG   . HIS A 1 15 ? 11.823  16.345  -18.085 1.00 0.00 ? 15  HIS A CG   12 
ATOM   7425  N  ND1  . HIS A 1 15 ? 12.391  16.056  -19.308 1.00 0.00 ? 15  HIS A ND1  12 
ATOM   7426  C  CD2  . HIS A 1 15 ? 12.567  15.692  -17.162 1.00 0.00 ? 15  HIS A CD2  12 
ATOM   7427  C  CE1  . HIS A 1 15 ? 13.432  15.261  -19.130 1.00 0.00 ? 15  HIS A CE1  12 
ATOM   7428  N  NE2  . HIS A 1 15 ? 13.560  15.026  -17.837 1.00 0.00 ? 15  HIS A NE2  12 
ATOM   7429  H  H    . HIS A 1 15 ? 7.997   18.074  -17.177 1.00 0.00 ? 15  HIS A H    12 
ATOM   7430  H  HA   . HIS A 1 15 ? 9.335   15.521  -17.764 1.00 0.00 ? 15  HIS A HA   12 
ATOM   7431  H  HB2  . HIS A 1 15 ? 10.356  17.600  -18.907 1.00 0.00 ? 15  HIS A HB2  12 
ATOM   7432  H  HB3  . HIS A 1 15 ? 10.893  18.052  -17.292 1.00 0.00 ? 15  HIS A HB3  12 
ATOM   7433  H  HD1  . HIS A 1 15 ? 12.077  16.382  -20.176 1.00 0.00 ? 15  HIS A HD1  12 
ATOM   7434  H  HD2  . HIS A 1 15 ? 12.410  15.694  -16.093 1.00 0.00 ? 15  HIS A HD2  12 
ATOM   7435  H  HE1  . HIS A 1 15 ? 14.069  14.871  -19.909 1.00 0.00 ? 15  HIS A HE1  12 
ATOM   7436  N  N    . ARG A 1 16 ? 9.457   15.135  -15.327 1.00 0.00 ? 16  ARG A N    12 
ATOM   7437  C  CA   . ARG A 1 16 ? 9.601   14.864  -13.901 1.00 0.00 ? 16  ARG A CA   12 
ATOM   7438  C  C    . ARG A 1 16 ? 11.043  14.500  -13.561 1.00 0.00 ? 16  ARG A C    12 
ATOM   7439  O  O    . ARG A 1 16 ? 11.715  13.773  -14.293 1.00 0.00 ? 16  ARG A O    12 
ATOM   7440  C  CB   . ARG A 1 16 ? 8.664   13.731  -13.478 1.00 0.00 ? 16  ARG A CB   12 
ATOM   7441  C  CG   . ARG A 1 16 ? 8.370   13.709  -11.987 1.00 0.00 ? 16  ARG A CG   12 
ATOM   7442  C  CD   . ARG A 1 16 ? 7.323   12.661  -11.641 1.00 0.00 ? 16  ARG A CD   12 
ATOM   7443  N  NE   . ARG A 1 16 ? 5.991   13.048  -12.097 1.00 0.00 ? 16  ARG A NE   12 
ATOM   7444  C  CZ   . ARG A 1 16 ? 4.884   12.388  -11.775 1.00 0.00 ? 16  ARG A CZ   12 
ATOM   7445  N  NH1  . ARG A 1 16 ? 4.950   11.314  -11.000 1.00 0.00 ? 16  ARG A NH1  12 
ATOM   7446  N  NH2  . ARG A 1 16 ? 3.708   12.802  -12.228 1.00 0.00 ? 16  ARG A NH2  12 
ATOM   7447  H  H    . ARG A 1 16 ? 9.256   14.394  -15.936 1.00 0.00 ? 16  ARG A H    12 
ATOM   7448  H  HA   . ARG A 1 16 ? 9.333   15.761  -13.364 1.00 0.00 ? 16  ARG A HA   12 
ATOM   7449  H  HB2  . ARG A 1 16 ? 7.727   13.838  -14.006 1.00 0.00 ? 16  ARG A HB2  12 
ATOM   7450  H  HB3  . ARG A 1 16 ? 9.114   12.788  -13.749 1.00 0.00 ? 16  ARG A HB3  12 
ATOM   7451  H  HG2  . ARG A 1 16 ? 9.281   13.481  -11.453 1.00 0.00 ? 16  ARG A HG2  12 
ATOM   7452  H  HG3  . ARG A 1 16 ? 8.008   14.681  -11.687 1.00 0.00 ? 16  ARG A HG3  12 
ATOM   7453  H  HD2  . ARG A 1 16 ? 7.597   11.729  -12.112 1.00 0.00 ? 16  ARG A HD2  12 
ATOM   7454  H  HD3  . ARG A 1 16 ? 7.304   12.532  -10.570 1.00 0.00 ? 16  ARG A HD3  12 
ATOM   7455  H  HE   . ARG A 1 16 ? 5.919   13.839  -12.671 1.00 0.00 ? 16  ARG A HE   12 
ATOM   7456  H  HH11 . ARG A 1 16 ? 5.835   11.001  -10.656 1.00 0.00 ? 16  ARG A HH11 12 
ATOM   7457  H  HH12 . ARG A 1 16 ? 4.115   10.820  -10.758 1.00 0.00 ? 16  ARG A HH12 12 
ATOM   7458  H  HH21 . ARG A 1 16 ? 3.654   13.611  -12.813 1.00 0.00 ? 16  ARG A HH21 12 
ATOM   7459  H  HH22 . ARG A 1 16 ? 2.875   12.304  -11.986 1.00 0.00 ? 16  ARG A HH22 12 
ATOM   7460  N  N    . PRO A 1 17 ? 11.531  15.015  -12.423 1.00 0.00 ? 17  PRO A N    12 
ATOM   7461  C  CA   . PRO A 1 17 ? 12.898  14.758  -11.959 1.00 0.00 ? 17  PRO A CA   12 
ATOM   7462  C  C    . PRO A 1 17 ? 13.094  13.316  -11.504 1.00 0.00 ? 17  PRO A C    12 
ATOM   7463  O  O    . PRO A 1 17 ? 14.033  12.642  -11.930 1.00 0.00 ? 17  PRO A O    12 
ATOM   7464  C  CB   . PRO A 1 17 ? 13.058  15.718  -10.777 1.00 0.00 ? 17  PRO A CB   12 
ATOM   7465  C  CG   . PRO A 1 17 ? 11.670  15.949  -10.286 1.00 0.00 ? 17  PRO A CG   12 
ATOM   7466  C  CD   . PRO A 1 17 ? 10.786  15.889  -11.501 1.00 0.00 ? 17  PRO A CD   12 
ATOM   7467  H  HA   . PRO A 1 17 ? 13.626  14.997  -12.720 1.00 0.00 ? 17  PRO A HA   12 
ATOM   7468  H  HB2  . PRO A 1 17 ? 13.675  15.258  -10.018 1.00 0.00 ? 17  PRO A HB2  12 
ATOM   7469  H  HB3  . PRO A 1 17 ? 13.515  16.636  -11.114 1.00 0.00 ? 17  PRO A HB3  12 
ATOM   7470  H  HG2  . PRO A 1 17 ? 11.396  15.176  -9.584  1.00 0.00 ? 17  PRO A HG2  12 
ATOM   7471  H  HG3  . PRO A 1 17 ? 11.603  16.921  -9.822  1.00 0.00 ? 17  PRO A HG3  12 
ATOM   7472  H  HD2  . PRO A 1 17 ? 9.829   15.457  -11.249 1.00 0.00 ? 17  PRO A HD2  12 
ATOM   7473  H  HD3  . PRO A 1 17 ? 10.658  16.875  -11.923 1.00 0.00 ? 17  PRO A HD3  12 
ATOM   7474  N  N    . HIS A 1 18 ? 12.202  12.847  -10.638 1.00 0.00 ? 18  HIS A N    12 
ATOM   7475  C  CA   . HIS A 1 18 ? 12.276  11.483  -10.126 1.00 0.00 ? 18  HIS A CA   12 
ATOM   7476  C  C    . HIS A 1 18 ? 11.048  10.679  -10.541 1.00 0.00 ? 18  HIS A C    12 
ATOM   7477  O  O    . HIS A 1 18 ? 9.959   11.219  -10.736 1.00 0.00 ? 18  HIS A O    12 
ATOM   7478  C  CB   . HIS A 1 18 ? 12.402  11.493  -8.602  1.00 0.00 ? 18  HIS A CB   12 
ATOM   7479  C  CG   . HIS A 1 18 ? 11.117  11.802  -7.897  1.00 0.00 ? 18  HIS A CG   12 
ATOM   7480  N  ND1  . HIS A 1 18 ? 10.210  10.832  -7.527  1.00 0.00 ? 18  HIS A ND1  12 
ATOM   7481  C  CD2  . HIS A 1 18 ? 10.591  12.982  -7.493  1.00 0.00 ? 18  HIS A CD2  12 
ATOM   7482  C  CE1  . HIS A 1 18 ? 9.180   11.402  -6.927  1.00 0.00 ? 18  HIS A CE1  12 
ATOM   7483  N  NE2  . HIS A 1 18 ? 9.387   12.706  -6.893  1.00 0.00 ? 18  HIS A NE2  12 
ATOM   7484  H  H    . HIS A 1 18 ? 11.476  13.432  -10.335 1.00 0.00 ? 18  HIS A H    12 
ATOM   7485  H  HA   . HIS A 1 18 ? 13.155  11.018  -10.548 1.00 0.00 ? 18  HIS A HA   12 
ATOM   7486  H  HB2  . HIS A 1 18 ? 12.738  10.523  -8.269  1.00 0.00 ? 18  HIS A HB2  12 
ATOM   7487  H  HB3  . HIS A 1 18 ? 13.128  12.239  -8.312  1.00 0.00 ? 18  HIS A HB3  12 
ATOM   7488  H  HD1  . HIS A 1 18 ? 10.306  9.870   -7.682  1.00 0.00 ? 18  HIS A HD1  12 
ATOM   7489  H  HD2  . HIS A 1 18 ? 11.035  13.960  -7.619  1.00 0.00 ? 18  HIS A HD2  12 
ATOM   7490  H  HE1  . HIS A 1 18 ? 8.316   10.890  -6.531  1.00 0.00 ? 18  HIS A HE1  12 
ATOM   7491  N  N    . PRO A 1 19 ? 11.225  9.357   -10.681 1.00 0.00 ? 19  PRO A N    12 
ATOM   7492  C  CA   . PRO A 1 19 ? 10.142  8.450   -11.075 1.00 0.00 ? 19  PRO A CA   12 
ATOM   7493  C  C    . PRO A 1 19 ? 9.091   8.293   -9.981  1.00 0.00 ? 19  PRO A C    12 
ATOM   7494  O  O    . PRO A 1 19 ? 9.159   8.949   -8.941  1.00 0.00 ? 19  PRO A O    12 
ATOM   7495  C  CB   . PRO A 1 19 ? 10.863  7.122   -11.319 1.00 0.00 ? 19  PRO A CB   12 
ATOM   7496  C  CG   . PRO A 1 19 ? 12.090  7.197   -10.478 1.00 0.00 ? 19  PRO A CG   12 
ATOM   7497  C  CD   . PRO A 1 19 ? 12.496  8.645   -10.465 1.00 0.00 ? 19  PRO A CD   12 
ATOM   7498  H  HA   . PRO A 1 19 ? 9.665   8.776   -11.987 1.00 0.00 ? 19  PRO A HA   12 
ATOM   7499  H  HB2  . PRO A 1 19 ? 10.225  6.303   -11.017 1.00 0.00 ? 19  PRO A HB2  12 
ATOM   7500  H  HB3  . PRO A 1 19 ? 11.107  7.028   -12.366 1.00 0.00 ? 19  PRO A HB3  12 
ATOM   7501  H  HG2  . PRO A 1 19 ? 11.870  6.860   -9.476  1.00 0.00 ? 19  PRO A HG2  12 
ATOM   7502  H  HG3  . PRO A 1 19 ? 12.872  6.593   -10.915 1.00 0.00 ? 19  PRO A HG3  12 
ATOM   7503  H  HD2  . PRO A 1 19 ? 12.927  8.907   -9.510  1.00 0.00 ? 19  PRO A HD2  12 
ATOM   7504  H  HD3  . PRO A 1 19 ? 13.192  8.849   -11.265 1.00 0.00 ? 19  PRO A HD3  12 
ATOM   7505  N  N    . THR A 1 20 ? 8.119   7.418   -10.222 1.00 0.00 ? 20  THR A N    12 
ATOM   7506  C  CA   . THR A 1 20 ? 7.054   7.175   -9.258  1.00 0.00 ? 20  THR A CA   12 
ATOM   7507  C  C    . THR A 1 20 ? 7.319   5.908   -8.453  1.00 0.00 ? 20  THR A C    12 
ATOM   7508  O  O    . THR A 1 20 ? 7.767   4.899   -8.996  1.00 0.00 ? 20  THR A O    12 
ATOM   7509  C  CB   . THR A 1 20 ? 5.685   7.052   -9.953  1.00 0.00 ? 20  THR A CB   12 
ATOM   7510  O  OG1  . THR A 1 20 ? 4.665   6.790   -8.983  1.00 0.00 ? 20  THR A OG1  12 
ATOM   7511  C  CG2  . THR A 1 20 ? 5.703   5.939   -10.990 1.00 0.00 ? 20  THR A CG2  12 
ATOM   7512  H  H    . THR A 1 20 ? 8.120   6.926   -11.069 1.00 0.00 ? 20  THR A H    12 
ATOM   7513  H  HA   . THR A 1 20 ? 7.016   8.018   -8.582  1.00 0.00 ? 20  THR A HA   12 
ATOM   7514  H  HB   . THR A 1 20 ? 5.466   7.985   -10.452 1.00 0.00 ? 20  THR A HB   12 
ATOM   7515  H  HG1  . THR A 1 20 ? 4.495   7.587   -8.474  1.00 0.00 ? 20  THR A HG1  12 
ATOM   7516  H  HG21 . THR A 1 20 ? 4.780   5.381   -10.935 1.00 0.00 ? 20  THR A HG21 12 
ATOM   7517  H  HG22 . THR A 1 20 ? 6.535   5.279   -10.795 1.00 0.00 ? 20  THR A HG22 12 
ATOM   7518  H  HG23 . THR A 1 20 ? 5.806   6.368   -11.975 1.00 0.00 ? 20  THR A HG23 12 
ATOM   7519  N  N    . SER A 1 21 ? 7.038   5.967   -7.155  1.00 0.00 ? 21  SER A N    12 
ATOM   7520  C  CA   . SER A 1 21 ? 7.249   4.824   -6.275  1.00 0.00 ? 21  SER A CA   12 
ATOM   7521  C  C    . SER A 1 21 ? 6.759   3.536   -6.929  1.00 0.00 ? 21  SER A C    12 
ATOM   7522  O  O    . SER A 1 21 ? 5.654   3.484   -7.471  1.00 0.00 ? 21  SER A O    12 
ATOM   7523  C  CB   . SER A 1 21 ? 6.527   5.039   -4.943  1.00 0.00 ? 21  SER A CB   12 
ATOM   7524  O  OG   . SER A 1 21 ? 7.034   6.176   -4.266  1.00 0.00 ? 21  SER A OG   12 
ATOM   7525  H  H    . SER A 1 21 ? 6.682   6.801   -6.781  1.00 0.00 ? 21  SER A H    12 
ATOM   7526  H  HA   . SER A 1 21 ? 8.309   4.739   -6.090  1.00 0.00 ? 21  SER A HA   12 
ATOM   7527  H  HB2  . SER A 1 21 ? 5.474   5.185   -5.127  1.00 0.00 ? 21  SER A HB2  12 
ATOM   7528  H  HB3  . SER A 1 21 ? 6.667   4.170   -4.317  1.00 0.00 ? 21  SER A HB3  12 
ATOM   7529  H  HG   . SER A 1 21 ? 6.874   6.086   -3.324  1.00 0.00 ? 21  SER A HG   12 
ATOM   7530  N  N    . ILE A 1 22 ? 7.589   2.500   -6.876  1.00 0.00 ? 22  ILE A N    12 
ATOM   7531  C  CA   . ILE A 1 22 ? 7.240   1.212   -7.462  1.00 0.00 ? 22  ILE A CA   12 
ATOM   7532  C  C    . ILE A 1 22 ? 6.543   0.315   -6.445  1.00 0.00 ? 22  ILE A C    12 
ATOM   7533  O  O    . ILE A 1 22 ? 6.845   0.359   -5.252  1.00 0.00 ? 22  ILE A O    12 
ATOM   7534  C  CB   . ILE A 1 22 ? 8.485   0.484   -8.002  1.00 0.00 ? 22  ILE A CB   12 
ATOM   7535  C  CG1  . ILE A 1 22 ? 8.975   1.151   -9.290  1.00 0.00 ? 22  ILE A CG1  12 
ATOM   7536  C  CG2  . ILE A 1 22 ? 8.176   -0.986  -8.246  1.00 0.00 ? 22  ILE A CG2  12 
ATOM   7537  C  CD1  . ILE A 1 22 ? 9.660   2.480   -9.059  1.00 0.00 ? 22  ILE A CD1  12 
ATOM   7538  H  H    . ILE A 1 22 ? 8.455   2.604   -6.431  1.00 0.00 ? 22  ILE A H    12 
ATOM   7539  H  HA   . ILE A 1 22 ? 6.567   1.393   -8.288  1.00 0.00 ? 22  ILE A HA   12 
ATOM   7540  H  HB   . ILE A 1 22 ? 9.262   0.545   -7.256  1.00 0.00 ? 22  ILE A HB   12 
ATOM   7541  H  HG12 . ILE A 1 22 ? 9.677   0.498   -9.782  1.00 0.00 ? 22  ILE A HG12 12 
ATOM   7542  H  HG13 . ILE A 1 22 ? 8.130   1.321   -9.941  1.00 0.00 ? 22  ILE A HG13 12 
ATOM   7543  H  HG21 . ILE A 1 22 ? 8.416   -1.555  -7.360  1.00 0.00 ? 22  ILE A HG21 12 
ATOM   7544  H  HG22 . ILE A 1 22 ? 7.126   -1.099  -8.472  1.00 0.00 ? 22  ILE A HG22 12 
ATOM   7545  H  HG23 . ILE A 1 22 ? 8.764   -1.345  -9.076  1.00 0.00 ? 22  ILE A HG23 12 
ATOM   7546  H  HD11 . ILE A 1 22 ? 10.563  2.325   -8.488  1.00 0.00 ? 22  ILE A HD11 12 
ATOM   7547  H  HD12 . ILE A 1 22 ? 9.905   2.929   -10.009 1.00 0.00 ? 22  ILE A HD12 12 
ATOM   7548  H  HD13 . ILE A 1 22 ? 8.998   3.136   -8.511  1.00 0.00 ? 22  ILE A HD13 12 
ATOM   7549  N  N    . CYS A 1 23 ? 5.608   -0.499  -6.924  1.00 0.00 ? 23  CYS A N    12 
ATOM   7550  C  CA   . CYS A 1 23 ? 4.868   -1.408  -6.058  1.00 0.00 ? 23  CYS A CA   12 
ATOM   7551  C  C    . CYS A 1 23 ? 5.796   -2.452  -5.445  1.00 0.00 ? 23  CYS A C    12 
ATOM   7552  O  O    . CYS A 1 23 ? 6.964   -2.557  -5.821  1.00 0.00 ? 23  CYS A O    12 
ATOM   7553  C  CB   . CYS A 1 23 ? 3.753   -2.100  -6.844  1.00 0.00 ? 23  CYS A CB   12 
ATOM   7554  S  SG   . CYS A 1 23 ? 2.382   -2.710  -5.811  1.00 0.00 ? 23  CYS A SG   12 
ATOM   7555  H  H    . CYS A 1 23 ? 5.412   -0.488  -7.885  1.00 0.00 ? 23  CYS A H    12 
ATOM   7556  H  HA   . CYS A 1 23 ? 4.428   -0.825  -5.264  1.00 0.00 ? 23  CYS A HA   12 
ATOM   7557  H  HB2  . CYS A 1 23 ? 3.339   -1.402  -7.558  1.00 0.00 ? 23  CYS A HB2  12 
ATOM   7558  H  HB3  . CYS A 1 23 ? 4.167   -2.945  -7.374  1.00 0.00 ? 23  CYS A HB3  12 
ATOM   7559  N  N    . ASP A 1 24 ? 5.269   -3.222  -4.500  1.00 0.00 ? 24  ASP A N    12 
ATOM   7560  C  CA   . ASP A 1 24 ? 6.049   -4.260  -3.835  1.00 0.00 ? 24  ASP A CA   12 
ATOM   7561  C  C    . ASP A 1 24 ? 5.646   -5.645  -4.332  1.00 0.00 ? 24  ASP A C    12 
ATOM   7562  O  O    . ASP A 1 24 ? 6.423   -6.595  -4.247  1.00 0.00 ? 24  ASP A O    12 
ATOM   7563  C  CB   . ASP A 1 24 ? 5.863   -4.175  -2.319  1.00 0.00 ? 24  ASP A CB   12 
ATOM   7564  C  CG   . ASP A 1 24 ? 6.537   -2.956  -1.721  1.00 0.00 ? 24  ASP A CG   12 
ATOM   7565  O  OD1  . ASP A 1 24 ? 6.267   -1.834  -2.198  1.00 0.00 ? 24  ASP A OD1  12 
ATOM   7566  O  OD2  . ASP A 1 24 ? 7.336   -3.123  -0.775  1.00 0.00 ? 24  ASP A OD2  12 
ATOM   7567  H  H    . ASP A 1 24 ? 4.332   -3.090  -4.243  1.00 0.00 ? 24  ASP A H    12 
ATOM   7568  H  HA   . ASP A 1 24 ? 7.089   -4.095  -4.070  1.00 0.00 ? 24  ASP A HA   12 
ATOM   7569  H  HB2  . ASP A 1 24 ? 4.807   -4.125  -2.094  1.00 0.00 ? 24  ASP A HB2  12 
ATOM   7570  H  HB3  . ASP A 1 24 ? 6.284   -5.058  -1.861  1.00 0.00 ? 24  ASP A HB3  12 
ATOM   7571  N  N    . ASN A 1 25 ? 4.427   -5.751  -4.850  1.00 0.00 ? 25  ASN A N    12 
ATOM   7572  C  CA   . ASN A 1 25 ? 3.921   -7.020  -5.359  1.00 0.00 ? 25  ASN A CA   12 
ATOM   7573  C  C    . ASN A 1 25 ? 4.254   -7.184  -6.839  1.00 0.00 ? 25  ASN A C    12 
ATOM   7574  O  O    . ASN A 1 25 ? 5.079   -8.018  -7.212  1.00 0.00 ? 25  ASN A O    12 
ATOM   7575  C  CB   . ASN A 1 25 ? 2.408   -7.109  -5.153  1.00 0.00 ? 25  ASN A CB   12 
ATOM   7576  C  CG   . ASN A 1 25 ? 2.039   -7.480  -3.729  1.00 0.00 ? 25  ASN A CG   12 
ATOM   7577  O  OD1  . ASN A 1 25 ? 2.390   -8.557  -3.246  1.00 0.00 ? 25  ASN A OD1  12 
ATOM   7578  N  ND2  . ASN A 1 25 ? 1.328   -6.587  -3.051  1.00 0.00 ? 25  ASN A ND2  12 
ATOM   7579  H  H    . ASN A 1 25 ? 3.854   -4.957  -4.891  1.00 0.00 ? 25  ASN A H    12 
ATOM   7580  H  HA   . ASN A 1 25 ? 4.398   -7.814  -4.805  1.00 0.00 ? 25  ASN A HA   12 
ATOM   7581  H  HB2  . ASN A 1 25 ? 1.962   -6.152  -5.382  1.00 0.00 ? 25  ASN A HB2  12 
ATOM   7582  H  HB3  . ASN A 1 25 ? 2.003   -7.858  -5.817  1.00 0.00 ? 25  ASN A HB3  12 
ATOM   7583  H  HD21 . ASN A 1 25 ? 1.084   -5.751  -3.500  1.00 0.00 ? 25  ASN A HD21 12 
ATOM   7584  H  HD22 . ASN A 1 25 ? 1.077   -6.801  -2.128  1.00 0.00 ? 25  ASN A HD22 12 
ATOM   7585  N  N    . PHE A 1 26 ? 3.607   -6.382  -7.678  1.00 0.00 ? 26  PHE A N    12 
ATOM   7586  C  CA   . PHE A 1 26 ? 3.833   -6.438  -9.118  1.00 0.00 ? 26  PHE A CA   12 
ATOM   7587  C  C    . PHE A 1 26 ? 5.317   -6.284  -9.441  1.00 0.00 ? 26  PHE A C    12 
ATOM   7588  O  O    . PHE A 1 26 ? 5.802   -6.810  -10.442 1.00 0.00 ? 26  PHE A O    12 
ATOM   7589  C  CB   . PHE A 1 26 ? 3.029   -5.345  -9.825  1.00 0.00 ? 26  PHE A CB   12 
ATOM   7590  C  CG   . PHE A 1 26 ? 2.595   -5.723  -11.212 1.00 0.00 ? 26  PHE A CG   12 
ATOM   7591  C  CD1  . PHE A 1 26 ? 3.532   -5.938  -12.211 1.00 0.00 ? 26  PHE A CD1  12 
ATOM   7592  C  CD2  . PHE A 1 26 ? 1.251   -5.863  -11.518 1.00 0.00 ? 26  PHE A CD2  12 
ATOM   7593  C  CE1  . PHE A 1 26 ? 3.135   -6.285  -13.488 1.00 0.00 ? 26  PHE A CE1  12 
ATOM   7594  C  CE2  . PHE A 1 26 ? 0.849   -6.211  -12.794 1.00 0.00 ? 26  PHE A CE2  12 
ATOM   7595  C  CZ   . PHE A 1 26 ? 1.792   -6.423  -13.780 1.00 0.00 ? 26  PHE A CZ   12 
ATOM   7596  H  H    . PHE A 1 26 ? 2.960   -5.738  -7.320  1.00 0.00 ? 26  PHE A H    12 
ATOM   7597  H  HA   . PHE A 1 26 ? 3.499   -7.403  -9.468  1.00 0.00 ? 26  PHE A HA   12 
ATOM   7598  H  HB2  . PHE A 1 26 ? 2.143   -5.130  -9.248  1.00 0.00 ? 26  PHE A HB2  12 
ATOM   7599  H  HB3  . PHE A 1 26 ? 3.633   -4.453  -9.896  1.00 0.00 ? 26  PHE A HB3  12 
ATOM   7600  H  HD1  . PHE A 1 26 ? 4.582   -5.832  -11.984 1.00 0.00 ? 26  PHE A HD1  12 
ATOM   7601  H  HD2  . PHE A 1 26 ? 0.512   -5.698  -10.747 1.00 0.00 ? 26  PHE A HD2  12 
ATOM   7602  H  HE1  . PHE A 1 26 ? 3.875   -6.451  -14.257 1.00 0.00 ? 26  PHE A HE1  12 
ATOM   7603  H  HE2  . PHE A 1 26 ? -0.202  -6.317  -13.018 1.00 0.00 ? 26  PHE A HE2  12 
ATOM   7604  H  HZ   . PHE A 1 26 ? 1.480   -6.693  -14.778 1.00 0.00 ? 26  PHE A HZ   12 
ATOM   7605  N  N    . SER A 1 27 ? 6.030   -5.559  -8.586  1.00 0.00 ? 27  SER A N    12 
ATOM   7606  C  CA   . SER A 1 27 ? 7.457   -5.331  -8.782  1.00 0.00 ? 27  SER A CA   12 
ATOM   7607  C  C    . SER A 1 27 ? 8.181   -6.641  -9.078  1.00 0.00 ? 27  SER A C    12 
ATOM   7608  O  O    . SER A 1 27 ? 8.724   -6.830  -10.166 1.00 0.00 ? 27  SER A O    12 
ATOM   7609  C  CB   . SER A 1 27 ? 8.064   -4.669  -7.543  1.00 0.00 ? 27  SER A CB   12 
ATOM   7610  O  OG   . SER A 1 27 ? 9.474   -4.812  -7.528  1.00 0.00 ? 27  SER A OG   12 
ATOM   7611  H  H    . SER A 1 27 ? 5.586   -5.166  -7.805  1.00 0.00 ? 27  SER A H    12 
ATOM   7612  H  HA   . SER A 1 27 ? 7.574   -4.670  -9.627  1.00 0.00 ? 27  SER A HA   12 
ATOM   7613  H  HB2  . SER A 1 27 ? 7.821   -3.618  -7.545  1.00 0.00 ? 27  SER A HB2  12 
ATOM   7614  H  HB3  . SER A 1 27 ? 7.657   -5.132  -6.655  1.00 0.00 ? 27  SER A HB3  12 
ATOM   7615  H  HG   . SER A 1 27 ? 9.790   -4.774  -6.622  1.00 0.00 ? 27  SER A HG   12 
ATOM   7616  N  N    . ALA A 1 28 ? 8.183   -7.543  -8.102  1.00 0.00 ? 28  ALA A N    12 
ATOM   7617  C  CA   . ALA A 1 28 ? 8.838   -8.836  -8.258  1.00 0.00 ? 28  ALA A CA   12 
ATOM   7618  C  C    . ALA A 1 28 ? 7.834   -9.915  -8.649  1.00 0.00 ? 28  ALA A C    12 
ATOM   7619  O  O    . ALA A 1 28 ? 8.002   -10.595 -9.662  1.00 0.00 ? 28  ALA A O    12 
ATOM   7620  C  CB   . ALA A 1 28 ? 9.557   -9.222  -6.974  1.00 0.00 ? 28  ALA A CB   12 
ATOM   7621  H  H    . ALA A 1 28 ? 7.733   -7.334  -7.257  1.00 0.00 ? 28  ALA A H    12 
ATOM   7622  H  HA   . ALA A 1 28 ? 9.576   -8.744  -9.041  1.00 0.00 ? 28  ALA A HA   12 
ATOM   7623  H  HB1  . ALA A 1 28 ? 10.544  -9.591  -7.212  1.00 0.00 ? 28  ALA A HB1  12 
ATOM   7624  H  HB2  . ALA A 1 28 ? 9.641   -8.355  -6.334  1.00 0.00 ? 28  ALA A HB2  12 
ATOM   7625  H  HB3  . ALA A 1 28 ? 8.997   -9.992  -6.465  1.00 0.00 ? 28  ALA A HB3  12 
ATOM   7626  N  N    . TYR A 1 29 ? 6.792   -10.068 -7.840  1.00 0.00 ? 29  TYR A N    12 
ATOM   7627  C  CA   . TYR A 1 29 ? 5.763   -11.068 -8.100  1.00 0.00 ? 29  TYR A CA   12 
ATOM   7628  C  C    . TYR A 1 29 ? 5.160   -10.881 -9.489  1.00 0.00 ? 29  TYR A C    12 
ATOM   7629  O  O    . TYR A 1 29 ? 4.962   -11.845 -10.228 1.00 0.00 ? 29  TYR A O    12 
ATOM   7630  C  CB   . TYR A 1 29 ? 4.663   -10.986 -7.040  1.00 0.00 ? 29  TYR A CB   12 
ATOM   7631  C  CG   . TYR A 1 29 ? 5.174   -11.133 -5.625  1.00 0.00 ? 29  TYR A CG   12 
ATOM   7632  C  CD1  . TYR A 1 29 ? 5.726   -10.052 -4.948  1.00 0.00 ? 29  TYR A CD1  12 
ATOM   7633  C  CD2  . TYR A 1 29 ? 5.105   -12.353 -4.964  1.00 0.00 ? 29  TYR A CD2  12 
ATOM   7634  C  CE1  . TYR A 1 29 ? 6.195   -10.182 -3.656  1.00 0.00 ? 29  TYR A CE1  12 
ATOM   7635  C  CE2  . TYR A 1 29 ? 5.570   -12.492 -3.670  1.00 0.00 ? 29  TYR A CE2  12 
ATOM   7636  C  CZ   . TYR A 1 29 ? 6.115   -11.404 -3.021  1.00 0.00 ? 29  TYR A CZ   12 
ATOM   7637  O  OH   . TYR A 1 29 ? 6.580   -11.538 -1.732  1.00 0.00 ? 29  TYR A OH   12 
ATOM   7638  H  H    . TYR A 1 29 ? 6.713   -9.496  -7.048  1.00 0.00 ? 29  TYR A H    12 
ATOM   7639  H  HA   . TYR A 1 29 ? 6.226   -12.042 -8.050  1.00 0.00 ? 29  TYR A HA   12 
ATOM   7640  H  HB2  . TYR A 1 29 ? 4.170   -10.030 -7.116  1.00 0.00 ? 29  TYR A HB2  12 
ATOM   7641  H  HB3  . TYR A 1 29 ? 3.943   -11.772 -7.216  1.00 0.00 ? 29  TYR A HB3  12 
ATOM   7642  H  HD1  . TYR A 1 29 ? 5.787   -9.096  -5.449  1.00 0.00 ? 29  TYR A HD1  12 
ATOM   7643  H  HD2  . TYR A 1 29 ? 4.678   -13.204 -5.475  1.00 0.00 ? 29  TYR A HD2  12 
ATOM   7644  H  HE1  . TYR A 1 29 ? 6.621   -9.330  -3.147  1.00 0.00 ? 29  TYR A HE1  12 
ATOM   7645  H  HE2  . TYR A 1 29 ? 5.508   -13.449 -3.173  1.00 0.00 ? 29  TYR A HE2  12 
ATOM   7646  H  HH   . TYR A 1 29 ? 5.859   -11.391 -1.116  1.00 0.00 ? 29  TYR A HH   12 
ATOM   7647  N  N    . GLY A 1 30 ? 4.871   -9.631  -9.839  1.00 0.00 ? 30  GLY A N    12 
ATOM   7648  C  CA   . GLY A 1 30 ? 4.295   -9.338  -11.138 1.00 0.00 ? 30  GLY A CA   12 
ATOM   7649  C  C    . GLY A 1 30 ? 2.819   -9.002  -11.055 1.00 0.00 ? 30  GLY A C    12 
ATOM   7650  O  O    . GLY A 1 30 ? 2.308   -8.221  -11.858 1.00 0.00 ? 30  GLY A O    12 
ATOM   7651  H  H    . GLY A 1 30 ? 5.051   -8.901  -9.209  1.00 0.00 ? 30  GLY A H    12 
ATOM   7652  H  HA2  . GLY A 1 30 ? 4.821   -8.500  -11.572 1.00 0.00 ? 30  GLY A HA2  12 
ATOM   7653  H  HA3  . GLY A 1 30 ? 4.421   -10.199 -11.777 1.00 0.00 ? 30  GLY A HA3  12 
ATOM   7654  N  N    . TRP A 1 31 ? 2.133   -9.593  -10.084 1.00 0.00 ? 31  TRP A N    12 
ATOM   7655  C  CA   . TRP A 1 31 ? 0.706   -9.354  -9.901  1.00 0.00 ? 31  TRP A CA   12 
ATOM   7656  C  C    . TRP A 1 31 ? 0.460   -8.388  -8.747  1.00 0.00 ? 31  TRP A C    12 
ATOM   7657  O  O    . TRP A 1 31 ? 1.311   -8.221  -7.872  1.00 0.00 ? 31  TRP A O    12 
ATOM   7658  C  CB   . TRP A 1 31 ? -0.024  -10.672 -9.643  1.00 0.00 ? 31  TRP A CB   12 
ATOM   7659  C  CG   . TRP A 1 31 ? -0.134  -11.017 -8.189  1.00 0.00 ? 31  TRP A CG   12 
ATOM   7660  C  CD1  . TRP A 1 31 ? 0.808   -11.640 -7.421  1.00 0.00 ? 31  TRP A CD1  12 
ATOM   7661  C  CD2  . TRP A 1 31 ? -1.249  -10.758 -7.329  1.00 0.00 ? 31  TRP A CD2  12 
ATOM   7662  N  NE1  . TRP A 1 31 ? 0.345   -11.785 -6.135  1.00 0.00 ? 31  TRP A NE1  12 
ATOM   7663  C  CE2  . TRP A 1 31 ? -0.914  -11.252 -6.053  1.00 0.00 ? 31  TRP A CE2  12 
ATOM   7664  C  CE3  . TRP A 1 31 ? -2.497  -10.157 -7.512  1.00 0.00 ? 31  TRP A CE3  12 
ATOM   7665  C  CZ2  . TRP A 1 31 ? -1.782  -11.162 -4.968  1.00 0.00 ? 31  TRP A CZ2  12 
ATOM   7666  C  CZ3  . TRP A 1 31 ? -3.358  -10.068 -6.435  1.00 0.00 ? 31  TRP A CZ3  12 
ATOM   7667  C  CH2  . TRP A 1 31 ? -2.998  -10.568 -5.176  1.00 0.00 ? 31  TRP A CH2  12 
ATOM   7668  H  H    . TRP A 1 31 ? 2.597   -10.206 -9.475  1.00 0.00 ? 31  TRP A H    12 
ATOM   7669  H  HA   . TRP A 1 31 ? 0.326   -8.913  -10.810 1.00 0.00 ? 31  TRP A HA   12 
ATOM   7670  H  HB2  . TRP A 1 31 ? -1.024  -10.608 -10.047 1.00 0.00 ? 31  TRP A HB2  12 
ATOM   7671  H  HB3  . TRP A 1 31 ? 0.508   -11.472 -10.137 1.00 0.00 ? 31  TRP A HB3  12 
ATOM   7672  H  HD1  . TRP A 1 31 ? 1.769   -11.968 -7.785  1.00 0.00 ? 31  TRP A HD1  12 
ATOM   7673  H  HE1  . TRP A 1 31 ? 0.838   -12.202 -5.397  1.00 0.00 ? 31  TRP A HE1  12 
ATOM   7674  H  HE3  . TRP A 1 31 ? -2.793  -9.766  -8.474  1.00 0.00 ? 31  TRP A HE3  12 
ATOM   7675  H  HZ2  . TRP A 1 31 ? -1.519  -11.541 -3.992  1.00 0.00 ? 31  TRP A HZ2  12 
ATOM   7676  H  HZ3  . TRP A 1 31 ? -4.327  -9.607  -6.557  1.00 0.00 ? 31  TRP A HZ3  12 
ATOM   7677  H  HH2  . TRP A 1 31 ? -3.702  -10.477 -4.363  1.00 0.00 ? 31  TRP A HH2  12 
ATOM   7678  N  N    . CYS A 1 32 ? -0.708  -7.755  -8.749  1.00 0.00 ? 32  CYS A N    12 
ATOM   7679  C  CA   . CYS A 1 32 ? -1.066  -6.805  -7.703  1.00 0.00 ? 32  CYS A CA   12 
ATOM   7680  C  C    . CYS A 1 32 ? -2.564  -6.851  -7.416  1.00 0.00 ? 32  CYS A C    12 
ATOM   7681  O  O    . CYS A 1 32 ? -3.395  -6.881  -8.324  1.00 0.00 ? 32  CYS A O    12 
ATOM   7682  C  CB   . CYS A 1 32 ? -0.656  -5.388  -8.108  1.00 0.00 ? 32  CYS A CB   12 
ATOM   7683  S  SG   . CYS A 1 32 ? -1.012  -4.122  -6.848  1.00 0.00 ? 32  CYS A SG   12 
ATOM   7684  H  H    . CYS A 1 32 ? -1.345  -7.930  -9.474  1.00 0.00 ? 32  CYS A H    12 
ATOM   7685  H  HA   . CYS A 1 32 ? -0.532  -7.082  -6.806  1.00 0.00 ? 32  CYS A HA   12 
ATOM   7686  H  HB2  . CYS A 1 32 ? 0.407   -5.370  -8.300  1.00 0.00 ? 32  CYS A HB2  12 
ATOM   7687  H  HB3  . CYS A 1 32 ? -1.184  -5.113  -9.009  1.00 0.00 ? 32  CYS A HB3  12 
ATOM   7688  N  N    . PRO A 1 33 ? -2.919  -6.857  -6.122  1.00 0.00 ? 33  PRO A N    12 
ATOM   7689  C  CA   . PRO A 1 33 ? -4.318  -6.899  -5.686  1.00 0.00 ? 33  PRO A CA   12 
ATOM   7690  C  C    . PRO A 1 33 ? -5.057  -5.599  -5.984  1.00 0.00 ? 33  PRO A C    12 
ATOM   7691  O  O    . PRO A 1 33 ? -6.242  -5.462  -5.678  1.00 0.00 ? 33  PRO A O    12 
ATOM   7692  C  CB   . PRO A 1 33 ? -4.211  -7.119  -4.175  1.00 0.00 ? 33  PRO A CB   12 
ATOM   7693  C  CG   . PRO A 1 33 ? -2.877  -6.569  -3.805  1.00 0.00 ? 33  PRO A CG   12 
ATOM   7694  C  CD   . PRO A 1 33 ? -1.982  -6.823  -4.987  1.00 0.00 ? 33  PRO A CD   12 
ATOM   7695  H  HA   . PRO A 1 33 ? -4.849  -7.725  -6.135  1.00 0.00 ? 33  PRO A HA   12 
ATOM   7696  H  HB2  . PRO A 1 33 ? -5.010  -6.589  -3.674  1.00 0.00 ? 33  PRO A HB2  12 
ATOM   7697  H  HB3  . PRO A 1 33 ? -4.278  -8.173  -3.955  1.00 0.00 ? 33  PRO A HB3  12 
ATOM   7698  H  HG2  . PRO A 1 33 ? -2.955  -5.509  -3.616  1.00 0.00 ? 33  PRO A HG2  12 
ATOM   7699  H  HG3  . PRO A 1 33 ? -2.498  -7.080  -2.932  1.00 0.00 ? 33  PRO A HG3  12 
ATOM   7700  H  HD2  . PRO A 1 33 ? -1.268  -6.021  -5.100  1.00 0.00 ? 33  PRO A HD2  12 
ATOM   7701  H  HD3  . PRO A 1 33 ? -1.474  -7.770  -4.879  1.00 0.00 ? 33  PRO A HD3  12 
ATOM   7702  N  N    . LEU A 1 34 ? -4.351  -4.646  -6.583  1.00 0.00 ? 34  LEU A N    12 
ATOM   7703  C  CA   . LEU A 1 34 ? -4.941  -3.356  -6.924  1.00 0.00 ? 34  LEU A CA   12 
ATOM   7704  C  C    . LEU A 1 34 ? -5.052  -3.191  -8.436  1.00 0.00 ? 34  LEU A C    12 
ATOM   7705  O  O    . LEU A 1 34 ? -5.910  -2.459  -8.929  1.00 0.00 ? 34  LEU A O    12 
ATOM   7706  C  CB   . LEU A 1 34 ? -4.104  -2.219  -6.335  1.00 0.00 ? 34  LEU A CB   12 
ATOM   7707  C  CG   . LEU A 1 34 ? -4.302  -1.942  -4.844  1.00 0.00 ? 34  LEU A CG   12 
ATOM   7708  C  CD1  . LEU A 1 34 ? -3.438  -0.772  -4.399  1.00 0.00 ? 34  LEU A CD1  12 
ATOM   7709  C  CD2  . LEU A 1 34 ? -5.769  -1.670  -4.543  1.00 0.00 ? 34  LEU A CD2  12 
ATOM   7710  H  H    . LEU A 1 34 ? -3.411  -4.813  -6.802  1.00 0.00 ? 34  LEU A H    12 
ATOM   7711  H  HA   . LEU A 1 34 ? -5.931  -3.322  -6.496  1.00 0.00 ? 34  LEU A HA   12 
ATOM   7712  H  HB2  . LEU A 1 34 ? -3.063  -2.460  -6.491  1.00 0.00 ? 34  LEU A HB2  12 
ATOM   7713  H  HB3  . LEU A 1 34 ? -4.347  -1.316  -6.876  1.00 0.00 ? 34  LEU A HB3  12 
ATOM   7714  H  HG   . LEU A 1 34 ? -4.000  -2.813  -4.279  1.00 0.00 ? 34  LEU A HG   12 
ATOM   7715  H  HD11 . LEU A 1 34 ? -2.446  -0.880  -4.811  1.00 0.00 ? 34  LEU A HD11 12 
ATOM   7716  H  HD12 . LEU A 1 34 ? -3.382  -0.756  -3.321  1.00 0.00 ? 34  LEU A HD12 12 
ATOM   7717  H  HD13 . LEU A 1 34 ? -3.876  0.152   -4.750  1.00 0.00 ? 34  LEU A HD13 12 
ATOM   7718  H  HD21 . LEU A 1 34 ? -5.846  -1.055  -3.658  1.00 0.00 ? 34  LEU A HD21 12 
ATOM   7719  H  HD22 . LEU A 1 34 ? -6.282  -2.606  -4.376  1.00 0.00 ? 34  LEU A HD22 12 
ATOM   7720  H  HD23 . LEU A 1 34 ? -6.218  -1.156  -5.379  1.00 0.00 ? 34  LEU A HD23 12 
ATOM   7721  N  N    . GLY A 1 35 ? -4.180  -3.878  -9.167  1.00 0.00 ? 35  GLY A N    12 
ATOM   7722  C  CA   . GLY A 1 35 ? -4.199  -3.795  -10.616 1.00 0.00 ? 35  GLY A CA   12 
ATOM   7723  C  C    . GLY A 1 35 ? -3.681  -2.465  -11.127 1.00 0.00 ? 35  GLY A C    12 
ATOM   7724  O  O    . GLY A 1 35 ? -2.709  -1.913  -10.611 1.00 0.00 ? 35  GLY A O    12 
ATOM   7725  H  H    . GLY A 1 35 ? -3.518  -4.445  -8.719  1.00 0.00 ? 35  GLY A H    12 
ATOM   7726  H  HA2  . GLY A 1 35 ? -3.586  -4.587  -11.019 1.00 0.00 ? 35  GLY A HA2  12 
ATOM   7727  H  HA3  . GLY A 1 35 ? -5.214  -3.928  -10.960 1.00 0.00 ? 35  GLY A HA3  12 
ATOM   7728  N  N    . PRO A 1 36 ? -4.337  -1.930  -12.168 1.00 0.00 ? 36  PRO A N    12 
ATOM   7729  C  CA   . PRO A 1 36 ? -3.953  -0.651  -12.773 1.00 0.00 ? 36  PRO A CA   12 
ATOM   7730  C  C    . PRO A 1 36 ? -4.242  0.533   -11.857 1.00 0.00 ? 36  PRO A C    12 
ATOM   7731  O  O    . PRO A 1 36 ? -3.485  1.503   -11.824 1.00 0.00 ? 36  PRO A O    12 
ATOM   7732  C  CB   . PRO A 1 36 ? -4.823  -0.579  -14.030 1.00 0.00 ? 36  PRO A CB   12 
ATOM   7733  C  CG   . PRO A 1 36 ? -6.007  -1.429  -13.722 1.00 0.00 ? 36  PRO A CG   12 
ATOM   7734  C  CD   . PRO A 1 36 ? -5.504  -2.533  -12.834 1.00 0.00 ? 36  PRO A CD   12 
ATOM   7735  H  HA   . PRO A 1 36 ? -2.910  -0.642  -13.053 1.00 0.00 ? 36  PRO A HA   12 
ATOM   7736  H  HB2  . PRO A 1 36 ? -5.110  0.447   -14.214 1.00 0.00 ? 36  PRO A HB2  12 
ATOM   7737  H  HB3  . PRO A 1 36 ? -4.272  -0.962  -14.876 1.00 0.00 ? 36  PRO A HB3  12 
ATOM   7738  H  HG2  . PRO A 1 36 ? -6.754  -0.845  -13.207 1.00 0.00 ? 36  PRO A HG2  12 
ATOM   7739  H  HG3  . PRO A 1 36 ? -6.413  -1.839  -14.635 1.00 0.00 ? 36  PRO A HG3  12 
ATOM   7740  H  HD2  . PRO A 1 36 ? -6.258  -2.811  -12.113 1.00 0.00 ? 36  PRO A HD2  12 
ATOM   7741  H  HD3  . PRO A 1 36 ? -5.210  -3.388  -13.424 1.00 0.00 ? 36  PRO A HD3  12 
ATOM   7742  N  N    . GLN A 1 37 ? -5.341  0.446   -11.114 1.00 0.00 ? 37  GLN A N    12 
ATOM   7743  C  CA   . GLN A 1 37 ? -5.728  1.512   -10.197 1.00 0.00 ? 37  GLN A CA   12 
ATOM   7744  C  C    . GLN A 1 37 ? -4.661  1.727   -9.129  1.00 0.00 ? 37  GLN A C    12 
ATOM   7745  O  O    . GLN A 1 37 ? -4.533  2.819   -8.575  1.00 0.00 ? 37  GLN A O    12 
ATOM   7746  C  CB   . GLN A 1 37 ? -7.068  1.183   -9.536  1.00 0.00 ? 37  GLN A CB   12 
ATOM   7747  C  CG   . GLN A 1 37 ? -8.273  1.626   -10.351 1.00 0.00 ? 37  GLN A CG   12 
ATOM   7748  C  CD   . GLN A 1 37 ? -9.549  1.660   -9.533  1.00 0.00 ? 37  GLN A CD   12 
ATOM   7749  O  OE1  . GLN A 1 37 ? -9.596  2.260   -8.459  1.00 0.00 ? 37  GLN A OE1  12 
ATOM   7750  N  NE2  . GLN A 1 37 ? -10.594 1.015   -10.038 1.00 0.00 ? 37  GLN A NE2  12 
ATOM   7751  H  H    . GLN A 1 37 ? -5.904  -0.352  -11.184 1.00 0.00 ? 37  GLN A H    12 
ATOM   7752  H  HA   . GLN A 1 37 ? -5.834  2.420   -10.771 1.00 0.00 ? 37  GLN A HA   12 
ATOM   7753  H  HB2  . GLN A 1 37 ? -7.132  0.115   -9.391  1.00 0.00 ? 37  GLN A HB2  12 
ATOM   7754  H  HB3  . GLN A 1 37 ? -7.112  1.672   -8.575  1.00 0.00 ? 37  GLN A HB3  12 
ATOM   7755  H  HG2  . GLN A 1 37 ? -8.086  2.616   -10.738 1.00 0.00 ? 37  GLN A HG2  12 
ATOM   7756  H  HG3  . GLN A 1 37 ? -8.408  0.939   -11.173 1.00 0.00 ? 37  GLN A HG3  12 
ATOM   7757  H  HE21 . GLN A 1 37 ? -10.483 0.558   -10.899 1.00 0.00 ? 37  GLN A HE21 12 
ATOM   7758  H  HE22 . GLN A 1 37 ? -11.431 1.020   -9.531  1.00 0.00 ? 37  GLN A HE22 12 
ATOM   7759  N  N    . CYS A 1 38 ? -3.896  0.678   -8.845  1.00 0.00 ? 38  CYS A N    12 
ATOM   7760  C  CA   . CYS A 1 38 ? -2.839  0.751   -7.844  1.00 0.00 ? 38  CYS A CA   12 
ATOM   7761  C  C    . CYS A 1 38 ? -2.116  2.093   -7.911  1.00 0.00 ? 38  CYS A C    12 
ATOM   7762  O  O    . CYS A 1 38 ? -1.778  2.591   -8.986  1.00 0.00 ? 38  CYS A O    12 
ATOM   7763  C  CB   . CYS A 1 38 ? -1.839  -0.390  -8.043  1.00 0.00 ? 38  CYS A CB   12 
ATOM   7764  S  SG   . CYS A 1 38 ? -0.494  -0.423  -6.815  1.00 0.00 ? 38  CYS A SG   12 
ATOM   7765  H  H    . CYS A 1 38 ? -4.045  -0.166  -9.321  1.00 0.00 ? 38  CYS A H    12 
ATOM   7766  H  HA   . CYS A 1 38 ? -3.296  0.651   -6.871  1.00 0.00 ? 38  CYS A HA   12 
ATOM   7767  H  HB2  . CYS A 1 38 ? -2.363  -1.332  -7.981  1.00 0.00 ? 38  CYS A HB2  12 
ATOM   7768  H  HB3  . CYS A 1 38 ? -1.390  -0.297  -9.021  1.00 0.00 ? 38  CYS A HB3  12 
ATOM   7769  N  N    . PRO A 1 39 ? -1.874  2.694   -6.737  1.00 0.00 ? 39  PRO A N    12 
ATOM   7770  C  CA   . PRO A 1 39 ? -1.188  3.986   -6.636  1.00 0.00 ? 39  PRO A CA   12 
ATOM   7771  C  C    . PRO A 1 39 ? 0.288   3.890   -7.003  1.00 0.00 ? 39  PRO A C    12 
ATOM   7772  O  O    . PRO A 1 39 ? 0.880   4.852   -7.492  1.00 0.00 ? 39  PRO A O    12 
ATOM   7773  C  CB   . PRO A 1 39 ? -1.349  4.358   -5.160  1.00 0.00 ? 39  PRO A CB   12 
ATOM   7774  C  CG   . PRO A 1 39 ? -1.518  3.056   -4.457  1.00 0.00 ? 39  PRO A CG   12 
ATOM   7775  C  CD   . PRO A 1 39 ? -2.249  2.159   -5.418  1.00 0.00 ? 39  PRO A CD   12 
ATOM   7776  H  HA   . PRO A 1 39 ? -1.663  4.736   -7.252  1.00 0.00 ? 39  PRO A HA   12 
ATOM   7777  H  HB2  . PRO A 1 39 ? -0.466  4.880   -4.820  1.00 0.00 ? 39  PRO A HB2  12 
ATOM   7778  H  HB3  . PRO A 1 39 ? -2.216  4.989   -5.036  1.00 0.00 ? 39  PRO A HB3  12 
ATOM   7779  H  HG2  . PRO A 1 39 ? -0.552  2.640   -4.217  1.00 0.00 ? 39  PRO A HG2  12 
ATOM   7780  H  HG3  . PRO A 1 39 ? -2.101  3.197   -3.559  1.00 0.00 ? 39  PRO A HG3  12 
ATOM   7781  H  HD2  . PRO A 1 39 ? -1.916  1.137   -5.308  1.00 0.00 ? 39  PRO A HD2  12 
ATOM   7782  H  HD3  . PRO A 1 39 ? -3.315  2.229   -5.263  1.00 0.00 ? 39  PRO A HD3  12 
ATOM   7783  N  N    . GLN A 1 40 ? 0.877   2.722   -6.766  1.00 0.00 ? 40  GLN A N    12 
ATOM   7784  C  CA   . GLN A 1 40 ? 2.286   2.501   -7.072  1.00 0.00 ? 40  GLN A CA   12 
ATOM   7785  C  C    . GLN A 1 40 ? 2.463   2.040   -8.515  1.00 0.00 ? 40  GLN A C    12 
ATOM   7786  O  O    . GLN A 1 40 ? 1.506   1.618   -9.164  1.00 0.00 ? 40  GLN A O    12 
ATOM   7787  C  CB   . GLN A 1 40 ? 2.881   1.465   -6.117  1.00 0.00 ? 40  GLN A CB   12 
ATOM   7788  C  CG   . GLN A 1 40 ? 3.009   1.961   -4.685  1.00 0.00 ? 40  GLN A CG   12 
ATOM   7789  C  CD   . GLN A 1 40 ? 3.365   0.853   -3.714  1.00 0.00 ? 40  GLN A CD   12 
ATOM   7790  O  OE1  . GLN A 1 40 ? 2.586   -0.078  -3.503  1.00 0.00 ? 40  GLN A OE1  12 
ATOM   7791  N  NE2  . GLN A 1 40 ? 4.547   0.947   -3.116  1.00 0.00 ? 40  GLN A NE2  12 
ATOM   7792  H  H    . GLN A 1 40 ? 0.353   1.993   -6.375  1.00 0.00 ? 40  GLN A H    12 
ATOM   7793  H  HA   . GLN A 1 40 ? 2.804   3.439   -6.940  1.00 0.00 ? 40  GLN A HA   12 
ATOM   7794  H  HB2  . GLN A 1 40 ? 2.250   0.589   -6.117  1.00 0.00 ? 40  GLN A HB2  12 
ATOM   7795  H  HB3  . GLN A 1 40 ? 3.864   1.191   -6.469  1.00 0.00 ? 40  GLN A HB3  12 
ATOM   7796  H  HG2  . GLN A 1 40 ? 3.782   2.714   -4.646  1.00 0.00 ? 40  GLN A HG2  12 
ATOM   7797  H  HG3  . GLN A 1 40 ? 2.068   2.396   -4.383  1.00 0.00 ? 40  GLN A HG3  12 
ATOM   7798  H  HE21 . GLN A 1 40 ? 5.114   1.717   -3.331  1.00 0.00 ? 40  GLN A HE21 12 
ATOM   7799  H  HE22 . GLN A 1 40 ? 4.802   0.245   -2.482  1.00 0.00 ? 40  GLN A HE22 12 
ATOM   7800  N  N    . SER A 1 41 ? 3.693   2.125   -9.011  1.00 0.00 ? 41  SER A N    12 
ATOM   7801  C  CA   . SER A 1 41 ? 3.996   1.721   -10.379 1.00 0.00 ? 41  SER A CA   12 
ATOM   7802  C  C    . SER A 1 41 ? 4.262   0.220   -10.456 1.00 0.00 ? 41  SER A C    12 
ATOM   7803  O  O    . SER A 1 41 ? 4.506   -0.432  -9.440  1.00 0.00 ? 41  SER A O    12 
ATOM   7804  C  CB   . SER A 1 41 ? 5.207   2.492   -10.906 1.00 0.00 ? 41  SER A CB   12 
ATOM   7805  O  OG   . SER A 1 41 ? 5.158   2.618   -12.316 1.00 0.00 ? 41  SER A OG   12 
ATOM   7806  H  H    . SER A 1 41 ? 4.415   2.470   -8.444  1.00 0.00 ? 41  SER A H    12 
ATOM   7807  H  HA   . SER A 1 41 ? 3.137   1.954   -10.991 1.00 0.00 ? 41  SER A HA   12 
ATOM   7808  H  HB2  . SER A 1 41 ? 5.220   3.479   -10.469 1.00 0.00 ? 41  SER A HB2  12 
ATOM   7809  H  HB3  . SER A 1 41 ? 6.111   1.967   -10.634 1.00 0.00 ? 41  SER A HB3  12 
ATOM   7810  H  HG   . SER A 1 41 ? 6.033   2.467   -12.682 1.00 0.00 ? 41  SER A HG   12 
ATOM   7811  N  N    . HIS A 1 42 ? 4.213   -0.322  -11.669 1.00 0.00 ? 42  HIS A N    12 
ATOM   7812  C  CA   . HIS A 1 42 ? 4.449   -1.746  -11.880 1.00 0.00 ? 42  HIS A CA   12 
ATOM   7813  C  C    . HIS A 1 42 ? 5.522   -1.967  -12.941 1.00 0.00 ? 42  HIS A C    12 
ATOM   7814  O  O    . HIS A 1 42 ? 5.216   -2.273  -14.093 1.00 0.00 ? 42  HIS A O    12 
ATOM   7815  C  CB   . HIS A 1 42 ? 3.153   -2.443  -12.296 1.00 0.00 ? 42  HIS A CB   12 
ATOM   7816  C  CG   . HIS A 1 42 ? 2.158   -2.572  -11.183 1.00 0.00 ? 42  HIS A CG   12 
ATOM   7817  N  ND1  . HIS A 1 42 ? 0.815   -2.794  -11.397 1.00 0.00 ? 42  HIS A ND1  12 
ATOM   7818  C  CD2  . HIS A 1 42 ? 2.319   -2.510  -9.841  1.00 0.00 ? 42  HIS A CD2  12 
ATOM   7819  C  CE1  . HIS A 1 42 ? 0.191   -2.862  -10.234 1.00 0.00 ? 42  HIS A CE1  12 
ATOM   7820  N  NE2  . HIS A 1 42 ? 1.082   -2.693  -9.274  1.00 0.00 ? 42  HIS A NE2  12 
ATOM   7821  H  H    . HIS A 1 42 ? 4.013   0.249   -12.439 1.00 0.00 ? 42  HIS A H    12 
ATOM   7822  H  HA   . HIS A 1 42 ? 4.790   -2.167  -10.947 1.00 0.00 ? 42  HIS A HA   12 
ATOM   7823  H  HB2  . HIS A 1 42 ? 2.688   -1.879  -13.091 1.00 0.00 ? 42  HIS A HB2  12 
ATOM   7824  H  HB3  . HIS A 1 42 ? 3.384   -3.436  -12.652 1.00 0.00 ? 42  HIS A HB3  12 
ATOM   7825  H  HD1  . HIS A 1 42 ? 0.382   -2.886  -12.271 1.00 0.00 ? 42  HIS A HD1  12 
ATOM   7826  H  HD2  . HIS A 1 42 ? 3.248   -2.347  -9.312  1.00 0.00 ? 42  HIS A HD2  12 
ATOM   7827  H  HE1  . HIS A 1 42 ? -0.866  -3.027  -10.092 1.00 0.00 ? 42  HIS A HE1  12 
ATOM   7828  N  N    . ASP A 1 43 ? 6.780   -1.809  -12.544 1.00 0.00 ? 43  ASP A N    12 
ATOM   7829  C  CA   . ASP A 1 43 ? 7.900   -1.991  -13.461 1.00 0.00 ? 43  ASP A CA   12 
ATOM   7830  C  C    . ASP A 1 43 ? 8.694   -3.244  -13.106 1.00 0.00 ? 43  ASP A C    12 
ATOM   7831  O  O    . ASP A 1 43 ? 9.249   -3.349  -12.012 1.00 0.00 ? 43  ASP A O    12 
ATOM   7832  C  CB   . ASP A 1 43 ? 8.815   -0.767  -13.432 1.00 0.00 ? 43  ASP A CB   12 
ATOM   7833  C  CG   . ASP A 1 43 ? 8.384   0.302   -14.418 1.00 0.00 ? 43  ASP A CG   12 
ATOM   7834  O  OD1  . ASP A 1 43 ? 8.372   0.018   -15.634 1.00 0.00 ? 43  ASP A OD1  12 
ATOM   7835  O  OD2  . ASP A 1 43 ? 8.059   1.422   -13.973 1.00 0.00 ? 43  ASP A OD2  12 
ATOM   7836  H  H    . ASP A 1 43 ? 6.961   -1.564  -11.612 1.00 0.00 ? 43  ASP A H    12 
ATOM   7837  H  HA   . ASP A 1 43 ? 7.498   -2.105  -14.457 1.00 0.00 ? 43  ASP A HA   12 
ATOM   7838  H  HB2  . ASP A 1 43 ? 8.804   -0.340  -12.440 1.00 0.00 ? 43  ASP A HB2  12 
ATOM   7839  H  HB3  . ASP A 1 43 ? 9.822   -1.072  -13.677 1.00 0.00 ? 43  ASP A HB3  12 
ATOM   7840  N  N    . ILE A 1 44 ? 8.742   -4.191  -14.037 1.00 0.00 ? 44  ILE A N    12 
ATOM   7841  C  CA   . ILE A 1 44 ? 9.468   -5.437  -13.821 1.00 0.00 ? 44  ILE A CA   12 
ATOM   7842  C  C    . ILE A 1 44 ? 10.808  -5.425  -14.550 1.00 0.00 ? 44  ILE A C    12 
ATOM   7843  O  O    . ILE A 1 44 ? 10.875  -5.678  -15.752 1.00 0.00 ? 44  ILE A O    12 
ATOM   7844  C  CB   . ILE A 1 44 ? 8.651   -6.654  -14.293 1.00 0.00 ? 44  ILE A CB   12 
ATOM   7845  C  CG1  . ILE A 1 44 ? 7.274   -6.661  -13.626 1.00 0.00 ? 44  ILE A CG1  12 
ATOM   7846  C  CG2  . ILE A 1 44 ? 9.399   -7.944  -13.991 1.00 0.00 ? 44  ILE A CG2  12 
ATOM   7847  C  CD1  . ILE A 1 44 ? 6.227   -5.884  -14.393 1.00 0.00 ? 44  ILE A CD1  12 
ATOM   7848  H  H    . ILE A 1 44 ? 8.279   -4.049  -14.888 1.00 0.00 ? 44  ILE A H    12 
ATOM   7849  H  HA   . ILE A 1 44 ? 9.648   -5.538  -12.761 1.00 0.00 ? 44  ILE A HA   12 
ATOM   7850  H  HB   . ILE A 1 44 ? 8.525   -6.582  -15.363 1.00 0.00 ? 44  ILE A HB   12 
ATOM   7851  H  HG12 . ILE A 1 44 ? 6.930   -7.679  -13.535 1.00 0.00 ? 44  ILE A HG12 12 
ATOM   7852  H  HG13 . ILE A 1 44 ? 7.358   -6.224  -12.641 1.00 0.00 ? 44  ILE A HG13 12 
ATOM   7853  H  HG21 . ILE A 1 44 ? 8.689   -8.732  -13.785 1.00 0.00 ? 44  ILE A HG21 12 
ATOM   7854  H  HG22 . ILE A 1 44 ? 10.003  -8.218  -14.843 1.00 0.00 ? 44  ILE A HG22 12 
ATOM   7855  H  HG23 . ILE A 1 44 ? 10.034  -7.798  -13.130 1.00 0.00 ? 44  ILE A HG23 12 
ATOM   7856  H  HD11 . ILE A 1 44 ? 5.526   -5.443  -13.700 1.00 0.00 ? 44  ILE A HD11 12 
ATOM   7857  H  HD12 . ILE A 1 44 ? 6.705   -5.105  -14.968 1.00 0.00 ? 44  ILE A HD12 12 
ATOM   7858  H  HD13 . ILE A 1 44 ? 5.701   -6.552  -15.060 1.00 0.00 ? 44  ILE A HD13 12 
ATOM   7859  N  N    . SER A 1 45 ? 11.874  -5.131  -13.812 1.00 0.00 ? 45  SER A N    12 
ATOM   7860  C  CA   . SER A 1 45 ? 13.213  -5.084  -14.388 1.00 0.00 ? 45  SER A CA   12 
ATOM   7861  C  C    . SER A 1 45 ? 14.227  -5.744  -13.458 1.00 0.00 ? 45  SER A C    12 
ATOM   7862  O  O    . SER A 1 45 ? 14.483  -5.260  -12.356 1.00 0.00 ? 45  SER A O    12 
ATOM   7863  C  CB   . SER A 1 45 ? 13.622  -3.636  -14.662 1.00 0.00 ? 45  SER A CB   12 
ATOM   7864  O  OG   . SER A 1 45 ? 14.893  -3.575  -15.288 1.00 0.00 ? 45  SER A OG   12 
ATOM   7865  H  H    . SER A 1 45 ? 11.756  -4.938  -12.858 1.00 0.00 ? 45  SER A H    12 
ATOM   7866  H  HA   . SER A 1 45 ? 13.191  -5.627  -15.321 1.00 0.00 ? 45  SER A HA   12 
ATOM   7867  H  HB2  . SER A 1 45 ? 12.893  -3.175  -15.311 1.00 0.00 ? 45  SER A HB2  12 
ATOM   7868  H  HB3  . SER A 1 45 ? 13.668  -3.094  -13.729 1.00 0.00 ? 45  SER A HB3  12 
ATOM   7869  H  HG   . SER A 1 45 ? 15.554  -3.307  -14.646 1.00 0.00 ? 45  SER A HG   12 
ATOM   7870  N  N    . GLY A 1 46 ? 14.802  -6.853  -13.912 1.00 0.00 ? 46  GLY A N    12 
ATOM   7871  C  CA   . GLY A 1 46 ? 15.782  -7.563  -13.110 1.00 0.00 ? 46  GLY A CA   12 
ATOM   7872  C  C    . GLY A 1 46 ? 17.181  -7.470  -13.687 1.00 0.00 ? 46  GLY A C    12 
ATOM   7873  O  O    . GLY A 1 46 ? 17.931  -6.535  -13.406 1.00 0.00 ? 46  GLY A O    12 
ATOM   7874  H  H    . GLY A 1 46 ? 14.560  -7.193  -14.799 1.00 0.00 ? 46  GLY A H    12 
ATOM   7875  H  HA2  . GLY A 1 46 ? 15.786  -7.145  -12.114 1.00 0.00 ? 46  GLY A HA2  12 
ATOM   7876  H  HA3  . GLY A 1 46 ? 15.497  -8.603  -13.052 1.00 0.00 ? 46  GLY A HA3  12 
ATOM   7877  N  N    . PRO A 1 47 ? 17.550  -8.460  -14.514 1.00 0.00 ? 47  PRO A N    12 
ATOM   7878  C  CA   . PRO A 1 47 ? 18.871  -8.509  -15.149 1.00 0.00 ? 47  PRO A CA   12 
ATOM   7879  C  C    . PRO A 1 47 ? 19.046  -7.426  -16.208 1.00 0.00 ? 47  PRO A C    12 
ATOM   7880  O  O    . PRO A 1 47 ? 20.142  -7.229  -16.732 1.00 0.00 ? 47  PRO A O    12 
ATOM   7881  C  CB   . PRO A 1 47 ? 18.903  -9.897  -15.793 1.00 0.00 ? 47  PRO A CB   12 
ATOM   7882  C  CG   . PRO A 1 47 ? 17.472  -10.242 -16.021 1.00 0.00 ? 47  PRO A CG   12 
ATOM   7883  C  CD   . PRO A 1 47 ? 16.707  -9.606  -14.893 1.00 0.00 ? 47  PRO A CD   12 
ATOM   7884  H  HA   . PRO A 1 47 ? 19.664  -8.430  -14.420 1.00 0.00 ? 47  PRO A HA   12 
ATOM   7885  H  HB2  . PRO A 1 47 ? 19.453  -9.853  -16.722 1.00 0.00 ? 47  PRO A HB2  12 
ATOM   7886  H  HB3  . PRO A 1 47 ? 19.375  -10.599 -15.122 1.00 0.00 ? 47  PRO A HB3  12 
ATOM   7887  H  HG2  . PRO A 1 47 ? 17.144  -9.842  -16.969 1.00 0.00 ? 47  PRO A HG2  12 
ATOM   7888  H  HG3  . PRO A 1 47 ? 17.345  -11.315 -16.001 1.00 0.00 ? 47  PRO A HG3  12 
ATOM   7889  H  HD2  . PRO A 1 47 ? 15.737  -9.275  -15.234 1.00 0.00 ? 47  PRO A HD2  12 
ATOM   7890  H  HD3  . PRO A 1 47 ? 16.604  -10.297 -14.070 1.00 0.00 ? 47  PRO A HD3  12 
ATOM   7891  N  N    . SER A 1 48 ? 17.959  -6.727  -16.517 1.00 0.00 ? 48  SER A N    12 
ATOM   7892  C  CA   . SER A 1 48 ? 17.992  -5.665  -17.517 1.00 0.00 ? 48  SER A CA   12 
ATOM   7893  C  C    . SER A 1 48 ? 18.292  -4.317  -16.868 1.00 0.00 ? 48  SER A C    12 
ATOM   7894  O  O    . SER A 1 48 ? 17.613  -3.903  -15.929 1.00 0.00 ? 48  SER A O    12 
ATOM   7895  C  CB   . SER A 1 48 ? 16.660  -5.599  -18.265 1.00 0.00 ? 48  SER A CB   12 
ATOM   7896  O  OG   . SER A 1 48 ? 16.776  -4.825  -19.447 1.00 0.00 ? 48  SER A OG   12 
ATOM   7897  H  H    . SER A 1 48 ? 17.114  -6.931  -16.064 1.00 0.00 ? 48  SER A H    12 
ATOM   7898  H  HA   . SER A 1 48 ? 18.779  -5.896  -18.220 1.00 0.00 ? 48  SER A HA   12 
ATOM   7899  H  HB2  . SER A 1 48 ? 16.349  -6.597  -18.533 1.00 0.00 ? 48  SER A HB2  12 
ATOM   7900  H  HB3  . SER A 1 48 ? 15.913  -5.149  -17.627 1.00 0.00 ? 48  SER A HB3  12 
ATOM   7901  H  HG   . SER A 1 48 ? 16.371  -3.966  -19.309 1.00 0.00 ? 48  SER A HG   12 
ATOM   7902  N  N    . SER A 1 49 ? 19.315  -3.638  -17.377 1.00 0.00 ? 49  SER A N    12 
ATOM   7903  C  CA   . SER A 1 49 ? 19.709  -2.338  -16.846 1.00 0.00 ? 49  SER A CA   12 
ATOM   7904  C  C    . SER A 1 49 ? 18.719  -1.256  -17.267 1.00 0.00 ? 49  SER A C    12 
ATOM   7905  O  O    . SER A 1 49 ? 18.292  -1.204  -18.420 1.00 0.00 ? 49  SER A O    12 
ATOM   7906  C  CB   . SER A 1 49 ? 21.115  -1.973  -17.324 1.00 0.00 ? 49  SER A CB   12 
ATOM   7907  O  OG   . SER A 1 49 ? 21.213  -2.063  -18.735 1.00 0.00 ? 49  SER A OG   12 
ATOM   7908  H  H    . SER A 1 49 ? 19.818  -4.021  -18.126 1.00 0.00 ? 49  SER A H    12 
ATOM   7909  H  HA   . SER A 1 49 ? 19.711  -2.407  -15.768 1.00 0.00 ? 49  SER A HA   12 
ATOM   7910  H  HB2  . SER A 1 49 ? 21.343  -0.961  -17.024 1.00 0.00 ? 49  SER A HB2  12 
ATOM   7911  H  HB3  . SER A 1 49 ? 21.830  -2.650  -16.881 1.00 0.00 ? 49  SER A HB3  12 
ATOM   7912  H  HG   . SER A 1 49 ? 22.097  -1.810  -19.011 1.00 0.00 ? 49  SER A HG   12 
ATOM   7913  N  N    . GLY A 1 50 ? 18.357  -0.393  -16.323 1.00 0.00 ? 50  GLY A N    12 
ATOM   7914  C  CA   . GLY A 1 50 ? 17.420  0.676   -16.614 1.00 0.00 ? 50  GLY A CA   12 
ATOM   7915  C  C    . GLY A 1 50 ? 15.999  0.324   -16.222 1.00 0.00 ? 50  GLY A C    12 
ATOM   7916  O  O    . GLY A 1 50 ? 15.275  -0.242  -17.040 1.00 0.00 ? 50  GLY A O    12 
ATOM   7917  H  H    . GLY A 1 50 ? 18.729  -0.483  -15.420 1.00 0.00 ? 50  GLY A H    12 
ATOM   7918  H  HA2  . GLY A 1 50 ? 17.722  1.562   -16.076 1.00 0.00 ? 50  GLY A HA2  12 
ATOM   7919  H  HA3  . GLY A 1 50 ? 17.448  0.884   -17.674 1.00 0.00 ? 50  GLY A HA3  12 
HETATM 7920  ZN ZN   . ZN  B 2 .  ? 0.580   -2.456  -7.301  1.00 0.00 ? 201 ZN  A ZN   12 
ATOM   7921  N  N    . GLY A 1 1  ? 42.057  19.561  -28.044 1.00 0.00 ? 1   GLY A N    13 
ATOM   7922  C  CA   . GLY A 1 1  ? 42.724  18.372  -27.545 1.00 0.00 ? 1   GLY A CA   13 
ATOM   7923  C  C    . GLY A 1 1  ? 42.461  18.135  -26.071 1.00 0.00 ? 1   GLY A C    13 
ATOM   7924  O  O    . GLY A 1 1  ? 43.369  17.774  -25.322 1.00 0.00 ? 1   GLY A O    13 
ATOM   7925  H  H1   . GLY A 1 1  ? 42.585  20.291  -28.429 1.00 0.00 ? 1   GLY A H1   13 
ATOM   7926  H  HA2  . GLY A 1 1  ? 42.376  17.516  -28.104 1.00 0.00 ? 1   GLY A HA2  13 
ATOM   7927  H  HA3  . GLY A 1 1  ? 43.788  18.480  -27.696 1.00 0.00 ? 1   GLY A HA3  13 
ATOM   7928  N  N    . SER A 1 2  ? 41.216  18.341  -25.653 1.00 0.00 ? 2   SER A N    13 
ATOM   7929  C  CA   . SER A 1 2  ? 40.838  18.153  -24.257 1.00 0.00 ? 2   SER A CA   13 
ATOM   7930  C  C    . SER A 1 2  ? 41.730  18.980  -23.336 1.00 0.00 ? 2   SER A C    13 
ATOM   7931  O  O    . SER A 1 2  ? 42.159  18.509  -22.283 1.00 0.00 ? 2   SER A O    13 
ATOM   7932  C  CB   . SER A 1 2  ? 40.926  16.673  -23.878 1.00 0.00 ? 2   SER A CB   13 
ATOM   7933  O  OG   . SER A 1 2  ? 39.706  16.004  -24.147 1.00 0.00 ? 2   SER A OG   13 
ATOM   7934  H  H    . SER A 1 2  ? 40.537  18.628  -26.299 1.00 0.00 ? 2   SER A H    13 
ATOM   7935  H  HA   . SER A 1 2  ? 39.817  18.485  -24.143 1.00 0.00 ? 2   SER A HA   13 
ATOM   7936  H  HB2  . SER A 1 2  ? 41.713  16.204  -24.448 1.00 0.00 ? 2   SER A HB2  13 
ATOM   7937  H  HB3  . SER A 1 2  ? 41.145  16.588  -22.823 1.00 0.00 ? 2   SER A HB3  13 
ATOM   7938  H  HG   . SER A 1 2  ? 38.971  16.597  -23.975 1.00 0.00 ? 2   SER A HG   13 
ATOM   7939  N  N    . SER A 1 3  ? 42.005  20.215  -23.743 1.00 0.00 ? 3   SER A N    13 
ATOM   7940  C  CA   . SER A 1 3  ? 42.849  21.108  -22.957 1.00 0.00 ? 3   SER A CA   13 
ATOM   7941  C  C    . SER A 1 3  ? 42.009  21.943  -21.995 1.00 0.00 ? 3   SER A C    13 
ATOM   7942  O  O    . SER A 1 3  ? 41.115  22.677  -22.412 1.00 0.00 ? 3   SER A O    13 
ATOM   7943  C  CB   . SER A 1 3  ? 43.654  22.026  -23.879 1.00 0.00 ? 3   SER A CB   13 
ATOM   7944  O  OG   . SER A 1 3  ? 42.806  22.707  -24.787 1.00 0.00 ? 3   SER A OG   13 
ATOM   7945  H  H    . SER A 1 3  ? 41.634  20.533  -24.592 1.00 0.00 ? 3   SER A H    13 
ATOM   7946  H  HA   . SER A 1 3  ? 43.532  20.499  -22.384 1.00 0.00 ? 3   SER A HA   13 
ATOM   7947  H  HB2  . SER A 1 3  ? 44.183  22.755  -23.284 1.00 0.00 ? 3   SER A HB2  13 
ATOM   7948  H  HB3  . SER A 1 3  ? 44.363  21.435  -24.440 1.00 0.00 ? 3   SER A HB3  13 
ATOM   7949  H  HG   . SER A 1 3  ? 43.162  23.580  -24.965 1.00 0.00 ? 3   SER A HG   13 
ATOM   7950  N  N    . GLY A 1 4  ? 42.305  21.825  -20.704 1.00 0.00 ? 4   GLY A N    13 
ATOM   7951  C  CA   . GLY A 1 4  ? 41.569  22.574  -19.703 1.00 0.00 ? 4   GLY A CA   13 
ATOM   7952  C  C    . GLY A 1 4  ? 40.070  22.381  -19.820 1.00 0.00 ? 4   GLY A C    13 
ATOM   7953  O  O    . GLY A 1 4  ? 39.425  22.988  -20.675 1.00 0.00 ? 4   GLY A O    13 
ATOM   7954  H  H    . GLY A 1 4  ? 43.030  21.224  -20.430 1.00 0.00 ? 4   GLY A H    13 
ATOM   7955  H  HA2  . GLY A 1 4  ? 41.888  22.252  -18.722 1.00 0.00 ? 4   GLY A HA2  13 
ATOM   7956  H  HA3  . GLY A 1 4  ? 41.796  23.624  -19.817 1.00 0.00 ? 4   GLY A HA3  13 
ATOM   7957  N  N    . SER A 1 5  ? 39.515  21.533  -18.961 1.00 0.00 ? 5   SER A N    13 
ATOM   7958  C  CA   . SER A 1 5  ? 38.083  21.257  -18.976 1.00 0.00 ? 5   SER A CA   13 
ATOM   7959  C  C    . SER A 1 5  ? 37.619  20.723  -17.624 1.00 0.00 ? 5   SER A C    13 
ATOM   7960  O  O    . SER A 1 5  ? 38.428  20.286  -16.806 1.00 0.00 ? 5   SER A O    13 
ATOM   7961  C  CB   . SER A 1 5  ? 37.747  20.250  -20.078 1.00 0.00 ? 5   SER A CB   13 
ATOM   7962  O  OG   . SER A 1 5  ? 36.350  20.029  -20.158 1.00 0.00 ? 5   SER A OG   13 
ATOM   7963  H  H    . SER A 1 5  ? 40.083  21.079  -18.303 1.00 0.00 ? 5   SER A H    13 
ATOM   7964  H  HA   . SER A 1 5  ? 37.569  22.185  -19.179 1.00 0.00 ? 5   SER A HA   13 
ATOM   7965  H  HB2  . SER A 1 5  ? 38.095  20.630  -21.027 1.00 0.00 ? 5   SER A HB2  13 
ATOM   7966  H  HB3  . SER A 1 5  ? 38.237  19.311  -19.865 1.00 0.00 ? 5   SER A HB3  13 
ATOM   7967  H  HG   . SER A 1 5  ? 36.137  19.178  -19.769 1.00 0.00 ? 5   SER A HG   13 
ATOM   7968  N  N    . SER A 1 6  ? 36.310  20.762  -17.398 1.00 0.00 ? 6   SER A N    13 
ATOM   7969  C  CA   . SER A 1 6  ? 35.736  20.285  -16.145 1.00 0.00 ? 6   SER A CA   13 
ATOM   7970  C  C    . SER A 1 6  ? 35.635  18.763  -16.137 1.00 0.00 ? 6   SER A C    13 
ATOM   7971  O  O    . SER A 1 6  ? 36.071  18.105  -15.193 1.00 0.00 ? 6   SER A O    13 
ATOM   7972  C  CB   . SER A 1 6  ? 34.352  20.900  -15.926 1.00 0.00 ? 6   SER A CB   13 
ATOM   7973  O  OG   . SER A 1 6  ? 34.448  22.145  -15.255 1.00 0.00 ? 6   SER A OG   13 
ATOM   7974  H  H    . SER A 1 6  ? 35.716  21.121  -18.090 1.00 0.00 ? 6   SER A H    13 
ATOM   7975  H  HA   . SER A 1 6  ? 36.389  20.595  -15.342 1.00 0.00 ? 6   SER A HA   13 
ATOM   7976  H  HB2  . SER A 1 6  ? 33.876  21.056  -16.882 1.00 0.00 ? 6   SER A HB2  13 
ATOM   7977  H  HB3  . SER A 1 6  ? 33.753  20.228  -15.330 1.00 0.00 ? 6   SER A HB3  13 
ATOM   7978  H  HG   . SER A 1 6  ? 33.600  22.361  -14.859 1.00 0.00 ? 6   SER A HG   13 
ATOM   7979  N  N    . GLY A 1 7  ? 35.057  18.209  -17.199 1.00 0.00 ? 7   GLY A N    13 
ATOM   7980  C  CA   . GLY A 1 7  ? 34.908  16.769  -17.296 1.00 0.00 ? 7   GLY A CA   13 
ATOM   7981  C  C    . GLY A 1 7  ? 33.941  16.358  -18.388 1.00 0.00 ? 7   GLY A C    13 
ATOM   7982  O  O    . GLY A 1 7  ? 34.122  16.713  -19.553 1.00 0.00 ? 7   GLY A O    13 
ATOM   7983  H  H    . GLY A 1 7  ? 34.728  18.783  -17.922 1.00 0.00 ? 7   GLY A H    13 
ATOM   7984  H  HA2  . GLY A 1 7  ? 35.874  16.331  -17.501 1.00 0.00 ? 7   GLY A HA2  13 
ATOM   7985  H  HA3  . GLY A 1 7  ? 34.547  16.391  -16.350 1.00 0.00 ? 7   GLY A HA3  13 
ATOM   7986  N  N    . CYS A 1 8  ? 32.912  15.606  -18.012 1.00 0.00 ? 8   CYS A N    13 
ATOM   7987  C  CA   . CYS A 1 8  ? 31.913  15.143  -18.969 1.00 0.00 ? 8   CYS A CA   13 
ATOM   7988  C  C    . CYS A 1 8  ? 30.511  15.226  -18.374 1.00 0.00 ? 8   CYS A C    13 
ATOM   7989  O  O    . CYS A 1 8  ? 30.269  14.753  -17.263 1.00 0.00 ? 8   CYS A O    13 
ATOM   7990  C  CB   . CYS A 1 8  ? 32.215  13.707  -19.399 1.00 0.00 ? 8   CYS A CB   13 
ATOM   7991  S  SG   . CYS A 1 8  ? 33.538  13.565  -20.623 1.00 0.00 ? 8   CYS A SG   13 
ATOM   7992  H  H    . CYS A 1 8  ? 32.822  15.355  -17.069 1.00 0.00 ? 8   CYS A H    13 
ATOM   7993  H  HA   . CYS A 1 8  ? 31.962  15.787  -19.835 1.00 0.00 ? 8   CYS A HA   13 
ATOM   7994  H  HB2  . CYS A 1 8  ? 32.508  13.134  -18.532 1.00 0.00 ? 8   CYS A HB2  13 
ATOM   7995  H  HB3  . CYS A 1 8  ? 31.323  13.272  -19.824 1.00 0.00 ? 8   CYS A HB3  13 
ATOM   7996  H  HG   . CYS A 1 8  ? 33.441  14.594  -21.451 1.00 0.00 ? 8   CYS A HG   13 
ATOM   7997  N  N    . CYS A 1 9  ? 29.593  15.830  -19.120 1.00 0.00 ? 9   CYS A N    13 
ATOM   7998  C  CA   . CYS A 1 9  ? 28.215  15.976  -18.665 1.00 0.00 ? 9   CYS A CA   13 
ATOM   7999  C  C    . CYS A 1 9  ? 27.242  15.381  -19.678 1.00 0.00 ? 9   CYS A C    13 
ATOM   8000  O  O    . CYS A 1 9  ? 26.767  16.072  -20.580 1.00 0.00 ? 9   CYS A O    13 
ATOM   8001  C  CB   . CYS A 1 9  ? 27.887  17.452  -18.432 1.00 0.00 ? 9   CYS A CB   13 
ATOM   8002  S  SG   . CYS A 1 9  ? 28.512  18.109  -16.868 1.00 0.00 ? 9   CYS A SG   13 
ATOM   8003  H  H    . CYS A 1 9  ? 29.847  16.186  -19.997 1.00 0.00 ? 9   CYS A H    13 
ATOM   8004  H  HA   . CYS A 1 9  ? 28.116  15.443  -17.732 1.00 0.00 ? 9   CYS A HA   13 
ATOM   8005  H  HB2  . CYS A 1 9  ? 28.318  18.039  -19.229 1.00 0.00 ? 9   CYS A HB2  13 
ATOM   8006  H  HB3  . CYS A 1 9  ? 26.815  17.580  -18.439 1.00 0.00 ? 9   CYS A HB3  13 
ATOM   8007  H  HG   . CYS A 1 9  ? 28.825  17.083  -16.090 1.00 0.00 ? 9   CYS A HG   13 
ATOM   8008  N  N    . LEU A 1 10 ? 26.950  14.094  -19.523 1.00 0.00 ? 10  LEU A N    13 
ATOM   8009  C  CA   . LEU A 1 10 ? 26.034  13.404  -20.425 1.00 0.00 ? 10  LEU A CA   13 
ATOM   8010  C  C    . LEU A 1 10 ? 24.587  13.783  -20.127 1.00 0.00 ? 10  LEU A C    13 
ATOM   8011  O  O    . LEU A 1 10 ? 24.243  14.194  -19.019 1.00 0.00 ? 10  LEU A O    13 
ATOM   8012  C  CB   . LEU A 1 10 ? 26.212  11.889  -20.303 1.00 0.00 ? 10  LEU A CB   13 
ATOM   8013  C  CG   . LEU A 1 10 ? 26.320  11.339  -18.880 1.00 0.00 ? 10  LEU A CG   13 
ATOM   8014  C  CD1  . LEU A 1 10 ? 27.762  11.380  -18.400 1.00 0.00 ? 10  LEU A CD1  13 
ATOM   8015  C  CD2  . LEU A 1 10 ? 25.419  12.121  -17.936 1.00 0.00 ? 10  LEU A CD2  13 
ATOM   8016  H  H    . LEU A 1 10 ? 27.359  13.596  -18.786 1.00 0.00 ? 10  LEU A H    13 
ATOM   8017  H  HA   . LEU A 1 10 ? 26.273  13.706  -21.434 1.00 0.00 ? 10  LEU A HA   13 
ATOM   8018  H  HB2  . LEU A 1 10 ? 25.365  11.418  -20.776 1.00 0.00 ? 10  LEU A HB2  13 
ATOM   8019  H  HB3  . LEU A 1 10 ? 27.115  11.619  -20.833 1.00 0.00 ? 10  LEU A HB3  13 
ATOM   8020  H  HG   . LEU A 1 10 ? 25.996  10.307  -18.875 1.00 0.00 ? 10  LEU A HG   13 
ATOM   8021  H  HD11 . LEU A 1 10 ? 28.395  11.747  -19.193 1.00 0.00 ? 10  LEU A HD11 13 
ATOM   8022  H  HD12 . LEU A 1 10 ? 28.077  10.386  -18.119 1.00 0.00 ? 10  LEU A HD12 13 
ATOM   8023  H  HD13 . LEU A 1 10 ? 27.838  12.036  -17.545 1.00 0.00 ? 10  LEU A HD13 13 
ATOM   8024  H  HD21 . LEU A 1 10 ? 24.410  12.122  -18.321 1.00 0.00 ? 10  LEU A HD21 13 
ATOM   8025  H  HD22 . LEU A 1 10 ? 25.775  13.138  -17.858 1.00 0.00 ? 10  LEU A HD22 13 
ATOM   8026  H  HD23 . LEU A 1 10 ? 25.431  11.658  -16.960 1.00 0.00 ? 10  LEU A HD23 13 
ATOM   8027  N  N    . PRO A 1 11 ? 23.718  13.641  -21.138 1.00 0.00 ? 11  PRO A N    13 
ATOM   8028  C  CA   . PRO A 1 11 ? 22.293  13.960  -21.008 1.00 0.00 ? 11  PRO A CA   13 
ATOM   8029  C  C    . PRO A 1 11 ? 21.557  12.974  -20.108 1.00 0.00 ? 11  PRO A C    13 
ATOM   8030  O  O    . PRO A 1 11 ? 22.069  11.908  -19.766 1.00 0.00 ? 11  PRO A O    13 
ATOM   8031  C  CB   . PRO A 1 11 ? 21.775  13.862  -22.445 1.00 0.00 ? 11  PRO A CB   13 
ATOM   8032  C  CG   . PRO A 1 11 ? 22.716  12.927  -23.124 1.00 0.00 ? 11  PRO A CG   13 
ATOM   8033  C  CD   . PRO A 1 11 ? 24.058  13.156  -22.487 1.00 0.00 ? 11  PRO A CD   13 
ATOM   8034  H  HA   . PRO A 1 11 ? 22.144  14.964  -20.638 1.00 0.00 ? 11  PRO A HA   13 
ATOM   8035  H  HB2  . PRO A 1 11 ? 20.766  13.474  -22.441 1.00 0.00 ? 11  PRO A HB2  13 
ATOM   8036  H  HB3  . PRO A 1 11 ? 21.789  14.839  -22.905 1.00 0.00 ? 11  PRO A HB3  13 
ATOM   8037  H  HG2  . PRO A 1 11 ? 22.396  11.908  -22.970 1.00 0.00 ? 11  PRO A HG2  13 
ATOM   8038  H  HG3  . PRO A 1 11 ? 22.759  13.153  -24.179 1.00 0.00 ? 11  PRO A HG3  13 
ATOM   8039  H  HD2  . PRO A 1 11 ? 24.614  12.232  -22.435 1.00 0.00 ? 11  PRO A HD2  13 
ATOM   8040  H  HD3  . PRO A 1 11 ? 24.614  13.903  -23.035 1.00 0.00 ? 11  PRO A HD3  13 
ATOM   8041  N  N    . PRO A 1 12 ? 20.328  13.336  -19.713 1.00 0.00 ? 12  PRO A N    13 
ATOM   8042  C  CA   . PRO A 1 12 ? 19.495  12.495  -18.848 1.00 0.00 ? 12  PRO A CA   13 
ATOM   8043  C  C    . PRO A 1 12 ? 19.004  11.239  -19.558 1.00 0.00 ? 12  PRO A C    13 
ATOM   8044  O  O    . PRO A 1 12 ? 18.815  11.236  -20.774 1.00 0.00 ? 12  PRO A O    13 
ATOM   8045  C  CB   . PRO A 1 12 ? 18.316  13.406  -18.496 1.00 0.00 ? 12  PRO A CB   13 
ATOM   8046  C  CG   . PRO A 1 12 ? 18.239  14.378  -19.623 1.00 0.00 ? 12  PRO A CG   13 
ATOM   8047  C  CD   . PRO A 1 12 ? 19.655  14.593  -20.082 1.00 0.00 ? 12  PRO A CD   13 
ATOM   8048  H  HA   . PRO A 1 12 ? 20.017  12.216  -17.944 1.00 0.00 ? 12  PRO A HA   13 
ATOM   8049  H  HB2  . PRO A 1 12 ? 17.413  12.817  -18.419 1.00 0.00 ? 12  PRO A HB2  13 
ATOM   8050  H  HB3  . PRO A 1 12 ? 18.508  13.904  -17.558 1.00 0.00 ? 12  PRO A HB3  13 
ATOM   8051  H  HG2  . PRO A 1 12 ? 17.644  13.965  -20.424 1.00 0.00 ? 12  PRO A HG2  13 
ATOM   8052  H  HG3  . PRO A 1 12 ? 17.812  15.307  -19.277 1.00 0.00 ? 12  PRO A HG3  13 
ATOM   8053  H  HD2  . PRO A 1 12 ? 19.686  14.748  -21.150 1.00 0.00 ? 12  PRO A HD2  13 
ATOM   8054  H  HD3  . PRO A 1 12 ? 20.096  15.431  -19.564 1.00 0.00 ? 12  PRO A HD3  13 
ATOM   8055  N  N    . ALA A 1 13 ? 18.799  10.173  -18.792 1.00 0.00 ? 13  ALA A N    13 
ATOM   8056  C  CA   . ALA A 1 13 ? 18.327  8.911   -19.348 1.00 0.00 ? 13  ALA A CA   13 
ATOM   8057  C  C    . ALA A 1 13 ? 16.943  8.558   -18.814 1.00 0.00 ? 13  ALA A C    13 
ATOM   8058  O  O    . ALA A 1 13 ? 16.348  9.319   -18.050 1.00 0.00 ? 13  ALA A O    13 
ATOM   8059  C  CB   . ALA A 1 13 ? 19.314  7.795   -19.038 1.00 0.00 ? 13  ALA A CB   13 
ATOM   8060  H  H    . ALA A 1 13 ? 18.967  10.237  -17.829 1.00 0.00 ? 13  ALA A H    13 
ATOM   8061  H  HA   . ALA A 1 13 ? 18.271  9.020   -20.422 1.00 0.00 ? 13  ALA A HA   13 
ATOM   8062  H  HB1  . ALA A 1 13 ? 18.862  6.841   -19.266 1.00 0.00 ? 13  ALA A HB1  13 
ATOM   8063  H  HB2  . ALA A 1 13 ? 20.204  7.925   -19.636 1.00 0.00 ? 13  ALA A HB2  13 
ATOM   8064  H  HB3  . ALA A 1 13 ? 19.576  7.828   -17.991 1.00 0.00 ? 13  ALA A HB3  13 
ATOM   8065  N  N    . THR A 1 14 ? 16.433  7.400   -19.222 1.00 0.00 ? 14  THR A N    13 
ATOM   8066  C  CA   . THR A 1 14 ? 15.118  6.948   -18.786 1.00 0.00 ? 14  THR A CA   13 
ATOM   8067  C  C    . THR A 1 14 ? 15.212  6.154   -17.489 1.00 0.00 ? 14  THR A C    13 
ATOM   8068  O  O    . THR A 1 14 ? 14.579  5.108   -17.342 1.00 0.00 ? 14  THR A O    13 
ATOM   8069  C  CB   . THR A 1 14 ? 14.439  6.077   -19.860 1.00 0.00 ? 14  THR A CB   13 
ATOM   8070  O  OG1  . THR A 1 14 ? 13.123  5.708   -19.432 1.00 0.00 ? 14  THR A OG1  13 
ATOM   8071  C  CG2  . THR A 1 14 ? 15.257  4.825   -20.138 1.00 0.00 ? 14  THR A CG2  13 
ATOM   8072  H  H    . THR A 1 14 ? 16.955  6.838   -19.832 1.00 0.00 ? 14  THR A H    13 
ATOM   8073  H  HA   . THR A 1 14 ? 14.504  7.821   -18.619 1.00 0.00 ? 14  THR A HA   13 
ATOM   8074  H  HB   . THR A 1 14 ? 14.365  6.651   -20.773 1.00 0.00 ? 14  THR A HB   13 
ATOM   8075  H  HG1  . THR A 1 14 ? 12.473  6.222   -19.918 1.00 0.00 ? 14  THR A HG1  13 
ATOM   8076  H  HG21 . THR A 1 14 ? 16.090  5.074   -20.779 1.00 0.00 ? 14  THR A HG21 13 
ATOM   8077  H  HG22 . THR A 1 14 ? 14.635  4.089   -20.626 1.00 0.00 ? 14  THR A HG22 13 
ATOM   8078  H  HG23 . THR A 1 14 ? 15.627  4.423   -19.207 1.00 0.00 ? 14  THR A HG23 13 
ATOM   8079  N  N    . HIS A 1 15 ? 16.005  6.657   -16.548 1.00 0.00 ? 15  HIS A N    13 
ATOM   8080  C  CA   . HIS A 1 15 ? 16.181  5.994   -15.261 1.00 0.00 ? 15  HIS A CA   13 
ATOM   8081  C  C    . HIS A 1 15 ? 15.432  6.739   -14.160 1.00 0.00 ? 15  HIS A C    13 
ATOM   8082  O  O    . HIS A 1 15 ? 15.826  7.835   -13.761 1.00 0.00 ? 15  HIS A O    13 
ATOM   8083  C  CB   . HIS A 1 15 ? 17.666  5.899   -14.910 1.00 0.00 ? 15  HIS A CB   13 
ATOM   8084  C  CG   . HIS A 1 15 ? 17.922  5.481   -13.495 1.00 0.00 ? 15  HIS A CG   13 
ATOM   8085  N  ND1  . HIS A 1 15 ? 17.315  4.390   -12.911 1.00 0.00 ? 15  HIS A ND1  13 
ATOM   8086  C  CD2  . HIS A 1 15 ? 18.726  6.015   -12.546 1.00 0.00 ? 15  HIS A CD2  13 
ATOM   8087  C  CE1  . HIS A 1 15 ? 17.733  4.271   -11.663 1.00 0.00 ? 15  HIS A CE1  13 
ATOM   8088  N  NE2  . HIS A 1 15 ? 18.591  5.245   -11.417 1.00 0.00 ? 15  HIS A NE2  13 
ATOM   8089  H  H    . HIS A 1 15 ? 16.483  7.493   -16.724 1.00 0.00 ? 15  HIS A H    13 
ATOM   8090  H  HA   . HIS A 1 15 ? 15.775  4.997   -15.344 1.00 0.00 ? 15  HIS A HA   13 
ATOM   8091  H  HB2  . HIS A 1 15 ? 18.137  5.175   -15.559 1.00 0.00 ? 15  HIS A HB2  13 
ATOM   8092  H  HB3  . HIS A 1 15 ? 18.127  6.864   -15.061 1.00 0.00 ? 15  HIS A HB3  13 
ATOM   8093  H  HD1  . HIS A 1 15 ? 16.671  3.792   -13.345 1.00 0.00 ? 15  HIS A HD1  13 
ATOM   8094  H  HD2  . HIS A 1 15 ? 19.358  6.886   -12.656 1.00 0.00 ? 15  HIS A HD2  13 
ATOM   8095  H  HE1  . HIS A 1 15 ? 17.427  3.508   -10.964 1.00 0.00 ? 15  HIS A HE1  13 
ATOM   8096  N  N    . ARG A 1 16 ? 14.352  6.137   -13.674 1.00 0.00 ? 16  ARG A N    13 
ATOM   8097  C  CA   . ARG A 1 16 ? 13.548  6.744   -12.620 1.00 0.00 ? 16  ARG A CA   13 
ATOM   8098  C  C    . ARG A 1 16 ? 13.154  8.171   -12.991 1.00 0.00 ? 16  ARG A C    13 
ATOM   8099  O  O    . ARG A 1 16 ? 13.220  9.091   -12.176 1.00 0.00 ? 16  ARG A O    13 
ATOM   8100  C  CB   . ARG A 1 16 ? 14.316  6.743   -11.298 1.00 0.00 ? 16  ARG A CB   13 
ATOM   8101  C  CG   . ARG A 1 16 ? 13.419  6.702   -10.072 1.00 0.00 ? 16  ARG A CG   13 
ATOM   8102  C  CD   . ARG A 1 16 ? 12.818  8.067   -9.775  1.00 0.00 ? 16  ARG A CD   13 
ATOM   8103  N  NE   . ARG A 1 16 ? 12.437  8.204   -8.372  1.00 0.00 ? 16  ARG A NE   13 
ATOM   8104  C  CZ   . ARG A 1 16 ? 13.311  8.383   -7.388  1.00 0.00 ? 16  ARG A CZ   13 
ATOM   8105  N  NH1  . ARG A 1 16 ? 14.609  8.447   -7.652  1.00 0.00 ? 16  ARG A NH1  13 
ATOM   8106  N  NH2  . ARG A 1 16 ? 12.888  8.500   -6.135  1.00 0.00 ? 16  ARG A NH2  13 
ATOM   8107  H  H    . ARG A 1 16 ? 14.088  5.264   -14.033 1.00 0.00 ? 16  ARG A H    13 
ATOM   8108  H  HA   . ARG A 1 16 ? 12.651  6.154   -12.505 1.00 0.00 ? 16  ARG A HA   13 
ATOM   8109  H  HB2  . ARG A 1 16 ? 14.964  5.879   -11.272 1.00 0.00 ? 16  ARG A HB2  13 
ATOM   8110  H  HB3  . ARG A 1 16 ? 14.919  7.637   -11.245 1.00 0.00 ? 16  ARG A HB3  13 
ATOM   8111  H  HG2  . ARG A 1 16 ? 12.618  5.998   -10.247 1.00 0.00 ? 16  ARG A HG2  13 
ATOM   8112  H  HG3  . ARG A 1 16 ? 14.002  6.382   -9.221  1.00 0.00 ? 16  ARG A HG3  13 
ATOM   8113  H  HD2  . ARG A 1 16 ? 13.546  8.826   -10.016 1.00 0.00 ? 16  ARG A HD2  13 
ATOM   8114  H  HD3  . ARG A 1 16 ? 11.941  8.200   -10.391 1.00 0.00 ? 16  ARG A HD3  13 
ATOM   8115  H  HE   . ARG A 1 16 ? 11.483  8.160   -8.153  1.00 0.00 ? 16  ARG A HE   13 
ATOM   8116  H  HH11 . ARG A 1 16 ? 14.931  8.361   -8.595  1.00 0.00 ? 16  ARG A HH11 13 
ATOM   8117  H  HH12 . ARG A 1 16 ? 15.265  8.584   -6.910  1.00 0.00 ? 16  ARG A HH12 13 
ATOM   8118  H  HH21 . ARG A 1 16 ? 11.911  8.452   -5.932  1.00 0.00 ? 16  ARG A HH21 13 
ATOM   8119  H  HH22 . ARG A 1 16 ? 13.547  8.634   -5.396  1.00 0.00 ? 16  ARG A HH22 13 
ATOM   8120  N  N    . PRO A 1 17 ? 12.736  8.361   -14.251 1.00 0.00 ? 17  PRO A N    13 
ATOM   8121  C  CA   . PRO A 1 17 ? 12.323  9.673   -14.759 1.00 0.00 ? 17  PRO A CA   13 
ATOM   8122  C  C    . PRO A 1 17 ? 11.008  10.144  -14.147 1.00 0.00 ? 17  PRO A C    13 
ATOM   8123  O  O    . PRO A 1 17 ? 10.815  11.337  -13.910 1.00 0.00 ? 17  PRO A O    13 
ATOM   8124  C  CB   . PRO A 1 17 ? 12.159  9.436   -16.262 1.00 0.00 ? 17  PRO A CB   13 
ATOM   8125  C  CG   . PRO A 1 17 ? 11.870  7.980   -16.387 1.00 0.00 ? 17  PRO A CG   13 
ATOM   8126  C  CD   . PRO A 1 17 ? 12.632  7.310   -15.277 1.00 0.00 ? 17  PRO A CD   13 
ATOM   8127  H  HA   . PRO A 1 17 ? 13.085  10.420  -14.592 1.00 0.00 ? 17  PRO A HA   13 
ATOM   8128  H  HB2  . PRO A 1 17 ? 11.341  10.036  -16.637 1.00 0.00 ? 17  PRO A HB2  13 
ATOM   8129  H  HB3  . PRO A 1 17 ? 13.071  9.702   -16.774 1.00 0.00 ? 17  PRO A HB3  13 
ATOM   8130  H  HG2  . PRO A 1 17 ? 10.811  7.805   -16.273 1.00 0.00 ? 17  PRO A HG2  13 
ATOM   8131  H  HG3  . PRO A 1 17 ? 12.210  7.619   -17.346 1.00 0.00 ? 17  PRO A HG3  13 
ATOM   8132  H  HD2  . PRO A 1 17 ? 12.083  6.459   -14.903 1.00 0.00 ? 17  PRO A HD2  13 
ATOM   8133  H  HD3  . PRO A 1 17 ? 13.611  7.009   -15.620 1.00 0.00 ? 17  PRO A HD3  13 
ATOM   8134  N  N    . HIS A 1 18 ? 10.107  9.201   -13.893 1.00 0.00 ? 18  HIS A N    13 
ATOM   8135  C  CA   . HIS A 1 18 ? 8.810   9.520   -13.308 1.00 0.00 ? 18  HIS A CA   13 
ATOM   8136  C  C    . HIS A 1 18 ? 8.906   9.601   -11.787 1.00 0.00 ? 18  HIS A C    13 
ATOM   8137  O  O    . HIS A 1 18 ? 9.601   8.816   -11.142 1.00 0.00 ? 18  HIS A O    13 
ATOM   8138  C  CB   . HIS A 1 18 ? 7.773   8.471   -13.710 1.00 0.00 ? 18  HIS A CB   13 
ATOM   8139  C  CG   . HIS A 1 18 ? 8.210   7.064   -13.443 1.00 0.00 ? 18  HIS A CG   13 
ATOM   8140  N  ND1  . HIS A 1 18 ? 7.966   6.413   -12.253 1.00 0.00 ? 18  HIS A ND1  13 
ATOM   8141  C  CD2  . HIS A 1 18 ? 8.877   6.181   -14.223 1.00 0.00 ? 18  HIS A CD2  13 
ATOM   8142  C  CE1  . HIS A 1 18 ? 8.466   5.192   -12.311 1.00 0.00 ? 18  HIS A CE1  13 
ATOM   8143  N  NE2  . HIS A 1 18 ? 9.024   5.026   -13.496 1.00 0.00 ? 18  HIS A NE2  13 
ATOM   8144  H  H    . HIS A 1 18 ? 10.320  8.268   -14.105 1.00 0.00 ? 18  HIS A H    13 
ATOM   8145  H  HA   . HIS A 1 18 ? 8.502   10.482  -13.688 1.00 0.00 ? 18  HIS A HA   13 
ATOM   8146  H  HB2  . HIS A 1 18 ? 6.861   8.646   -13.157 1.00 0.00 ? 18  HIS A HB2  13 
ATOM   8147  H  HB3  . HIS A 1 18 ? 7.570   8.562   -14.768 1.00 0.00 ? 18  HIS A HB3  13 
ATOM   8148  H  HD1  . HIS A 1 18 ? 7.498   6.791   -11.479 1.00 0.00 ? 18  HIS A HD1  13 
ATOM   8149  H  HD2  . HIS A 1 18 ? 9.230   6.353   -15.231 1.00 0.00 ? 18  HIS A HD2  13 
ATOM   8150  H  HE1  . HIS A 1 18 ? 8.426   4.454   -11.523 1.00 0.00 ? 18  HIS A HE1  13 
ATOM   8151  N  N    . PRO A 1 19 ? 8.192   10.573  -11.200 1.00 0.00 ? 19  PRO A N    13 
ATOM   8152  C  CA   . PRO A 1 19 ? 8.180   10.780  -9.748  1.00 0.00 ? 19  PRO A CA   13 
ATOM   8153  C  C    . PRO A 1 19 ? 7.451   9.662   -9.010  1.00 0.00 ? 19  PRO A C    13 
ATOM   8154  O  O    . PRO A 1 19 ? 7.536   9.554   -7.786  1.00 0.00 ? 19  PRO A O    13 
ATOM   8155  C  CB   . PRO A 1 19 ? 7.433   12.105  -9.585  1.00 0.00 ? 19  PRO A CB   13 
ATOM   8156  C  CG   . PRO A 1 19 ? 6.573   12.208  -10.797 1.00 0.00 ? 19  PRO A CG   13 
ATOM   8157  C  CD   . PRO A 1 19 ? 7.341   11.545  -11.907 1.00 0.00 ? 19  PRO A CD   13 
ATOM   8158  H  HA   . PRO A 1 19 ? 9.181   10.877  -9.353  1.00 0.00 ? 19  PRO A HA   13 
ATOM   8159  H  HB2  . PRO A 1 19 ? 6.841   12.079  -8.680  1.00 0.00 ? 19  PRO A HB2  13 
ATOM   8160  H  HB3  . PRO A 1 19 ? 8.142   12.918  -9.534  1.00 0.00 ? 19  PRO A HB3  13 
ATOM   8161  H  HG2  . PRO A 1 19 ? 5.639   11.694  -10.628 1.00 0.00 ? 19  PRO A HG2  13 
ATOM   8162  H  HG3  . PRO A 1 19 ? 6.395   13.246  -11.033 1.00 0.00 ? 19  PRO A HG3  13 
ATOM   8163  H  HD2  . PRO A 1 19 ? 6.666   11.044  -12.586 1.00 0.00 ? 19  PRO A HD2  13 
ATOM   8164  H  HD3  . PRO A 1 19 ? 7.942   12.270  -12.435 1.00 0.00 ? 19  PRO A HD3  13 
ATOM   8165  N  N    . THR A 1 20 ? 6.734   8.832   -9.761  1.00 0.00 ? 20  THR A N    13 
ATOM   8166  C  CA   . THR A 1 20 ? 5.989   7.724   -9.177  1.00 0.00 ? 20  THR A CA   13 
ATOM   8167  C  C    . THR A 1 20 ? 6.926   6.611   -8.721  1.00 0.00 ? 20  THR A C    13 
ATOM   8168  O  O    . THR A 1 20 ? 7.995   6.411   -9.298  1.00 0.00 ? 20  THR A O    13 
ATOM   8169  C  CB   . THR A 1 20 ? 4.971   7.143   -10.176 1.00 0.00 ? 20  THR A CB   13 
ATOM   8170  O  OG1  . THR A 1 20 ? 5.600   6.920   -11.443 1.00 0.00 ? 20  THR A OG1  13 
ATOM   8171  C  CG2  . THR A 1 20 ? 3.788   8.084   -10.351 1.00 0.00 ? 20  THR A CG2  13 
ATOM   8172  H  H    . THR A 1 20 ? 6.706   8.970   -10.730 1.00 0.00 ? 20  THR A H    13 
ATOM   8173  H  HA   . THR A 1 20 ? 5.448   8.099   -8.321  1.00 0.00 ? 20  THR A HA   13 
ATOM   8174  H  HB   . THR A 1 20 ? 4.608   6.201   -9.791  1.00 0.00 ? 20  THR A HB   13 
ATOM   8175  H  HG1  . THR A 1 20 ? 5.111   6.251   -11.930 1.00 0.00 ? 20  THR A HG1  13 
ATOM   8176  H  HG21 . THR A 1 20 ? 4.008   9.031   -9.881  1.00 0.00 ? 20  THR A HG21 13 
ATOM   8177  H  HG22 . THR A 1 20 ? 2.912   7.650   -9.893  1.00 0.00 ? 20  THR A HG22 13 
ATOM   8178  H  HG23 . THR A 1 20 ? 3.605   8.240   -11.403 1.00 0.00 ? 20  THR A HG23 13 
ATOM   8179  N  N    . SER A 1 21 ? 6.519   5.889   -7.682  1.00 0.00 ? 21  SER A N    13 
ATOM   8180  C  CA   . SER A 1 21 ? 7.324   4.798   -7.146  1.00 0.00 ? 21  SER A CA   13 
ATOM   8181  C  C    . SER A 1 21 ? 6.758   3.446   -7.569  1.00 0.00 ? 21  SER A C    13 
ATOM   8182  O  O    . SER A 1 21 ? 5.543   3.273   -7.664  1.00 0.00 ? 21  SER A O    13 
ATOM   8183  C  CB   . SER A 1 21 ? 7.385   4.883   -5.620  1.00 0.00 ? 21  SER A CB   13 
ATOM   8184  O  OG   . SER A 1 21 ? 8.199   3.854   -5.084  1.00 0.00 ? 21  SER A OG   13 
ATOM   8185  H  H    . SER A 1 21 ? 5.657   6.098   -7.264  1.00 0.00 ? 21  SER A H    13 
ATOM   8186  H  HA   . SER A 1 21 ? 8.323   4.898   -7.544  1.00 0.00 ? 21  SER A HA   13 
ATOM   8187  H  HB2  . SER A 1 21 ? 7.797   5.838   -5.331  1.00 0.00 ? 21  SER A HB2  13 
ATOM   8188  H  HB3  . SER A 1 21 ? 6.388   4.784   -5.216  1.00 0.00 ? 21  SER A HB3  13 
ATOM   8189  H  HG   . SER A 1 21 ? 8.868   3.607   -5.727  1.00 0.00 ? 21  SER A HG   13 
ATOM   8190  N  N    . ILE A 1 22 ? 7.648   2.493   -7.823  1.00 0.00 ? 22  ILE A N    13 
ATOM   8191  C  CA   . ILE A 1 22 ? 7.238   1.156   -8.235  1.00 0.00 ? 22  ILE A CA   13 
ATOM   8192  C  C    . ILE A 1 22 ? 6.605   0.393   -7.076  1.00 0.00 ? 22  ILE A C    13 
ATOM   8193  O  O    . ILE A 1 22 ? 7.010   0.546   -5.923  1.00 0.00 ? 22  ILE A O    13 
ATOM   8194  C  CB   . ILE A 1 22 ? 8.429   0.345   -8.779  1.00 0.00 ? 22  ILE A CB   13 
ATOM   8195  C  CG1  . ILE A 1 22 ? 8.872   0.896   -10.136 1.00 0.00 ? 22  ILE A CG1  13 
ATOM   8196  C  CG2  . ILE A 1 22 ? 8.059   -1.126  -8.894  1.00 0.00 ? 22  ILE A CG2  13 
ATOM   8197  C  CD1  . ILE A 1 22 ? 9.398   2.312   -10.070 1.00 0.00 ? 22  ILE A CD1  13 
ATOM   8198  H  H    . ILE A 1 22 ? 8.603   2.692   -7.729  1.00 0.00 ? 22  ILE A H    13 
ATOM   8199  H  HA   . ILE A 1 22 ? 6.508   1.260   -9.025  1.00 0.00 ? 22  ILE A HA   13 
ATOM   8200  H  HB   . ILE A 1 22 ? 9.245   0.432   -8.079  1.00 0.00 ? 22  ILE A HB   13 
ATOM   8201  H  HG12 . ILE A 1 22 ? 9.654   0.270   -10.534 1.00 0.00 ? 22  ILE A HG12 13 
ATOM   8202  H  HG13 . ILE A 1 22 ? 8.029   0.886   -10.813 1.00 0.00 ? 22  ILE A HG13 13 
ATOM   8203  H  HG21 . ILE A 1 22 ? 8.656   -1.588  -9.667  1.00 0.00 ? 22  ILE A HG21 13 
ATOM   8204  H  HG22 . ILE A 1 22 ? 8.247   -1.619  -7.952  1.00 0.00 ? 22  ILE A HG22 13 
ATOM   8205  H  HG23 . ILE A 1 22 ? 7.013   -1.216  -9.146  1.00 0.00 ? 22  ILE A HG23 13 
ATOM   8206  H  HD11 . ILE A 1 22 ? 10.089  2.479   -10.883 1.00 0.00 ? 22  ILE A HD11 13 
ATOM   8207  H  HD12 . ILE A 1 22 ? 8.576   3.007   -10.147 1.00 0.00 ? 22  ILE A HD12 13 
ATOM   8208  H  HD13 . ILE A 1 22 ? 9.909   2.463   -9.129  1.00 0.00 ? 22  ILE A HD13 13 
ATOM   8209  N  N    . CYS A 1 23 ? 5.610   -0.430  -7.390  1.00 0.00 ? 23  CYS A N    13 
ATOM   8210  C  CA   . CYS A 1 23 ? 4.921   -1.219  -6.376  1.00 0.00 ? 23  CYS A CA   13 
ATOM   8211  C  C    . CYS A 1 23 ? 5.852   -2.270  -5.779  1.00 0.00 ? 23  CYS A C    13 
ATOM   8212  O  O    . CYS A 1 23 ? 6.972   -2.463  -6.252  1.00 0.00 ? 23  CYS A O    13 
ATOM   8213  C  CB   . CYS A 1 23 ? 3.688   -1.895  -6.977  1.00 0.00 ? 23  CYS A CB   13 
ATOM   8214  S  SG   . CYS A 1 23 ? 2.413   -2.341  -5.754  1.00 0.00 ? 23  CYS A SG   13 
ATOM   8215  H  H    . CYS A 1 23 ? 5.332   -0.509  -8.327  1.00 0.00 ? 23  CYS A H    13 
ATOM   8216  H  HA   . CYS A 1 23 ? 4.606   -0.548  -5.591  1.00 0.00 ? 23  CYS A HA   13 
ATOM   8217  H  HB2  . CYS A 1 23 ? 3.234   -1.227  -7.695  1.00 0.00 ? 23  CYS A HB2  13 
ATOM   8218  H  HB3  . CYS A 1 23 ? 3.993   -2.801  -7.480  1.00 0.00 ? 23  CYS A HB3  13 
ATOM   8219  N  N    . ASP A 1 24 ? 5.380   -2.948  -4.738  1.00 0.00 ? 24  ASP A N    13 
ATOM   8220  C  CA   . ASP A 1 24 ? 6.169   -3.981  -4.078  1.00 0.00 ? 24  ASP A CA   13 
ATOM   8221  C  C    . ASP A 1 24 ? 5.702   -5.372  -4.496  1.00 0.00 ? 24  ASP A C    13 
ATOM   8222  O  O    . ASP A 1 24 ? 6.461   -6.338  -4.429  1.00 0.00 ? 24  ASP A O    13 
ATOM   8223  C  CB   . ASP A 1 24 ? 6.072   -3.833  -2.558  1.00 0.00 ? 24  ASP A CB   13 
ATOM   8224  C  CG   . ASP A 1 24 ? 6.787   -4.949  -1.821  1.00 0.00 ? 24  ASP A CG   13 
ATOM   8225  O  OD1  . ASP A 1 24 ? 7.981   -5.176  -2.104  1.00 0.00 ? 24  ASP A OD1  13 
ATOM   8226  O  OD2  . ASP A 1 24 ? 6.151   -5.595  -0.962  1.00 0.00 ? 24  ASP A OD2  13 
ATOM   8227  H  H    . ASP A 1 24 ? 4.479   -2.749  -4.407  1.00 0.00 ? 24  ASP A H    13 
ATOM   8228  H  HA   . ASP A 1 24 ? 7.198   -3.855  -4.377  1.00 0.00 ? 24  ASP A HA   13 
ATOM   8229  H  HB2  . ASP A 1 24 ? 6.516   -2.892  -2.266  1.00 0.00 ? 24  ASP A HB2  13 
ATOM   8230  H  HB3  . ASP A 1 24 ? 5.032   -3.842  -2.268  1.00 0.00 ? 24  ASP A HB3  13 
ATOM   8231  N  N    . ASN A 1 25 ? 4.448   -5.465  -4.927  1.00 0.00 ? 25  ASN A N    13 
ATOM   8232  C  CA   . ASN A 1 25 ? 3.880   -6.738  -5.355  1.00 0.00 ? 25  ASN A CA   13 
ATOM   8233  C  C    . ASN A 1 25 ? 4.178   -6.999  -6.828  1.00 0.00 ? 25  ASN A C    13 
ATOM   8234  O  O    . ASN A 1 25 ? 5.006   -7.846  -7.164  1.00 0.00 ? 25  ASN A O    13 
ATOM   8235  C  CB   . ASN A 1 25 ? 2.368   -6.750  -5.119  1.00 0.00 ? 25  ASN A CB   13 
ATOM   8236  C  CG   . ASN A 1 25 ? 2.001   -7.281  -3.747  1.00 0.00 ? 25  ASN A CG   13 
ATOM   8237  O  OD1  . ASN A 1 25 ? 2.237   -8.449  -3.437  1.00 0.00 ? 25  ASN A OD1  13 
ATOM   8238  N  ND2  . ASN A 1 25 ? 1.420   -6.422  -2.917  1.00 0.00 ? 25  ASN A ND2  13 
ATOM   8239  H  H    . ASN A 1 25 ? 3.892   -4.659  -4.958  1.00 0.00 ? 25  ASN A H    13 
ATOM   8240  H  HA   . ASN A 1 25 ? 4.333   -7.519  -4.764  1.00 0.00 ? 25  ASN A HA   13 
ATOM   8241  H  HB2  . ASN A 1 25 ? 1.988   -5.743  -5.208  1.00 0.00 ? 25  ASN A HB2  13 
ATOM   8242  H  HB3  . ASN A 1 25 ? 1.898   -7.375  -5.864  1.00 0.00 ? 25  ASN A HB3  13 
ATOM   8243  H  HD21 . ASN A 1 25 ? 1.263   -5.507  -3.232  1.00 0.00 ? 25  ASN A HD21 13 
ATOM   8244  H  HD22 . ASN A 1 25 ? 1.173   -6.738  -2.023  1.00 0.00 ? 25  ASN A HD22 13 
ATOM   8245  N  N    . PHE A 1 26 ? 3.498   -6.266  -7.703  1.00 0.00 ? 26  PHE A N    13 
ATOM   8246  C  CA   . PHE A 1 26 ? 3.689   -6.418  -9.141  1.00 0.00 ? 26  PHE A CA   13 
ATOM   8247  C  C    . PHE A 1 26 ? 5.169   -6.338  -9.504  1.00 0.00 ? 26  PHE A C    13 
ATOM   8248  O  O    . PHE A 1 26 ? 5.602   -6.893  -10.513 1.00 0.00 ? 26  PHE A O    13 
ATOM   8249  C  CB   . PHE A 1 26 ? 2.908   -5.342  -9.897  1.00 0.00 ? 26  PHE A CB   13 
ATOM   8250  C  CG   . PHE A 1 26 ? 2.661   -5.683  -11.339 1.00 0.00 ? 26  PHE A CG   13 
ATOM   8251  C  CD1  . PHE A 1 26 ? 3.705   -5.695  -12.250 1.00 0.00 ? 26  PHE A CD1  13 
ATOM   8252  C  CD2  . PHE A 1 26 ? 1.385   -5.992  -11.783 1.00 0.00 ? 26  PHE A CD2  13 
ATOM   8253  C  CE1  . PHE A 1 26 ? 3.480   -6.007  -13.578 1.00 0.00 ? 26  PHE A CE1  13 
ATOM   8254  C  CE2  . PHE A 1 26 ? 1.155   -6.305  -13.110 1.00 0.00 ? 26  PHE A CE2  13 
ATOM   8255  C  CZ   . PHE A 1 26 ? 2.204   -6.314  -14.008 1.00 0.00 ? 26  PHE A CZ   13 
ATOM   8256  H  H    . PHE A 1 26 ? 2.851   -5.607  -7.374  1.00 0.00 ? 26  PHE A H    13 
ATOM   8257  H  HA   . PHE A 1 26 ? 3.313   -7.390  -9.423  1.00 0.00 ? 26  PHE A HA   13 
ATOM   8258  H  HB2  . PHE A 1 26 ? 1.949   -5.202  -9.421  1.00 0.00 ? 26  PHE A HB2  13 
ATOM   8259  H  HB3  . PHE A 1 26 ? 3.460   -4.416  -9.864  1.00 0.00 ? 26  PHE A HB3  13 
ATOM   8260  H  HD1  . PHE A 1 26 ? 4.704   -5.457  -11.915 1.00 0.00 ? 26  PHE A HD1  13 
ATOM   8261  H  HD2  . PHE A 1 26 ? 0.563   -5.985  -11.081 1.00 0.00 ? 26  PHE A HD2  13 
ATOM   8262  H  HE1  . PHE A 1 26 ? 4.302   -6.014  -14.278 1.00 0.00 ? 26  PHE A HE1  13 
ATOM   8263  H  HE2  . PHE A 1 26 ? 0.156   -6.545  -13.442 1.00 0.00 ? 26  PHE A HE2  13 
ATOM   8264  H  HZ   . PHE A 1 26 ? 2.026   -6.558  -15.044 1.00 0.00 ? 26  PHE A HZ   13 
ATOM   8265  N  N    . SER A 1 27 ? 5.939   -5.642  -8.673  1.00 0.00 ? 27  SER A N    13 
ATOM   8266  C  CA   . SER A 1 27 ? 7.369   -5.485  -8.908  1.00 0.00 ? 27  SER A CA   13 
ATOM   8267  C  C    . SER A 1 27 ? 8.034   -6.838  -9.139  1.00 0.00 ? 27  SER A C    13 
ATOM   8268  O  O    . SER A 1 27 ? 8.548   -7.113  -10.223 1.00 0.00 ? 27  SER A O    13 
ATOM   8269  C  CB   . SER A 1 27 ? 8.027   -4.776  -7.723  1.00 0.00 ? 27  SER A CB   13 
ATOM   8270  O  OG   . SER A 1 27 ? 9.418   -5.046  -7.675  1.00 0.00 ? 27  SER A OG   13 
ATOM   8271  H  H    . SER A 1 27 ? 5.534   -5.223  -7.885  1.00 0.00 ? 27  SER A H    13 
ATOM   8272  H  HA   . SER A 1 27 ? 7.495   -4.879  -9.793  1.00 0.00 ? 27  SER A HA   13 
ATOM   8273  H  HB2  . SER A 1 27 ? 7.883   -3.711  -7.818  1.00 0.00 ? 27  SER A HB2  13 
ATOM   8274  H  HB3  . SER A 1 27 ? 7.574   -5.121  -6.804  1.00 0.00 ? 27  SER A HB3  13 
ATOM   8275  H  HG   . SER A 1 27 ? 9.851   -4.628  -8.423  1.00 0.00 ? 27  SER A HG   13 
ATOM   8276  N  N    . ALA A 1 28 ? 8.020   -7.680  -8.111  1.00 0.00 ? 28  ALA A N    13 
ATOM   8277  C  CA   . ALA A 1 28 ? 8.619   -9.006  -8.202  1.00 0.00 ? 28  ALA A CA   13 
ATOM   8278  C  C    . ALA A 1 28 ? 7.567   -10.064 -8.513  1.00 0.00 ? 28  ALA A C    13 
ATOM   8279  O  O    . ALA A 1 28 ? 7.634   -10.738 -9.542  1.00 0.00 ? 28  ALA A O    13 
ATOM   8280  C  CB   . ALA A 1 28 ? 9.346   -9.346  -6.909  1.00 0.00 ? 28  ALA A CB   13 
ATOM   8281  H  H    . ALA A 1 28 ? 7.595   -7.404  -7.273  1.00 0.00 ? 28  ALA A H    13 
ATOM   8282  H  HA   . ALA A 1 28 ? 9.347   -8.990  -9.001  1.00 0.00 ? 28  ALA A HA   13 
ATOM   8283  H  HB1  . ALA A 1 28 ? 8.998   -8.696  -6.120  1.00 0.00 ? 28  ALA A HB1  13 
ATOM   8284  H  HB2  . ALA A 1 28 ? 9.146   -10.373 -6.644  1.00 0.00 ? 28  ALA A HB2  13 
ATOM   8285  H  HB3  . ALA A 1 28 ? 10.408  -9.209  -7.046  1.00 0.00 ? 28  ALA A HB3  13 
ATOM   8286  N  N    . TYR A 1 29 ? 6.595   -10.206 -7.619  1.00 0.00 ? 29  TYR A N    13 
ATOM   8287  C  CA   . TYR A 1 29 ? 5.529   -11.186 -7.797  1.00 0.00 ? 29  TYR A CA   13 
ATOM   8288  C  C    . TYR A 1 29 ? 4.969   -11.129 -9.215  1.00 0.00 ? 29  TYR A C    13 
ATOM   8289  O  O    . TYR A 1 29 ? 4.764   -12.160 -9.855  1.00 0.00 ? 29  TYR A O    13 
ATOM   8290  C  CB   . TYR A 1 29 ? 4.409   -10.941 -6.784  1.00 0.00 ? 29  TYR A CB   13 
ATOM   8291  C  CG   . TYR A 1 29 ? 4.876   -10.966 -5.346  1.00 0.00 ? 29  TYR A CG   13 
ATOM   8292  C  CD1  . TYR A 1 29 ? 5.466   -9.849  -4.768  1.00 0.00 ? 29  TYR A CD1  13 
ATOM   8293  C  CD2  . TYR A 1 29 ? 4.727   -12.106 -4.566  1.00 0.00 ? 29  TYR A CD2  13 
ATOM   8294  C  CE1  . TYR A 1 29 ? 5.896   -9.868  -3.455  1.00 0.00 ? 29  TYR A CE1  13 
ATOM   8295  C  CE2  . TYR A 1 29 ? 5.152   -12.133 -3.252  1.00 0.00 ? 29  TYR A CE2  13 
ATOM   8296  C  CZ   . TYR A 1 29 ? 5.736   -11.012 -2.701  1.00 0.00 ? 29  TYR A CZ   13 
ATOM   8297  O  OH   . TYR A 1 29 ? 6.161   -11.034 -1.392  1.00 0.00 ? 29  TYR A OH   13 
ATOM   8298  H  H    . TYR A 1 29 ? 6.595   -9.641  -6.818  1.00 0.00 ? 29  TYR A H    13 
ATOM   8299  H  HA   . TYR A 1 29 ? 5.948   -12.166 -7.626  1.00 0.00 ? 29  TYR A HA   13 
ATOM   8300  H  HB2  . TYR A 1 29 ? 3.968   -9.975  -6.972  1.00 0.00 ? 29  TYR A HB2  13 
ATOM   8301  H  HB3  . TYR A 1 29 ? 3.655   -11.705 -6.901  1.00 0.00 ? 29  TYR A HB3  13 
ATOM   8302  H  HD1  . TYR A 1 29 ? 5.590   -8.954  -5.361  1.00 0.00 ? 29  TYR A HD1  13 
ATOM   8303  H  HD2  . TYR A 1 29 ? 4.269   -12.983 -5.001  1.00 0.00 ? 29  TYR A HD2  13 
ATOM   8304  H  HE1  . TYR A 1 29 ? 6.353   -8.989  -3.023  1.00 0.00 ? 29  TYR A HE1  13 
ATOM   8305  H  HE2  . TYR A 1 29 ? 5.027   -13.029 -2.662  1.00 0.00 ? 29  TYR A HE2  13 
ATOM   8306  H  HH   . TYR A 1 29 ? 5.882   -11.855 -0.980  1.00 0.00 ? 29  TYR A HH   13 
ATOM   8307  N  N    . GLY A 1 30 ? 4.725   -9.916  -9.700  1.00 0.00 ? 30  GLY A N    13 
ATOM   8308  C  CA   . GLY A 1 30 ? 4.192   -9.746  -11.039 1.00 0.00 ? 30  GLY A CA   13 
ATOM   8309  C  C    . GLY A 1 30 ? 2.712   -9.418  -11.037 1.00 0.00 ? 30  GLY A C    13 
ATOM   8310  O  O    . GLY A 1 30 ? 2.171   -8.955  -12.040 1.00 0.00 ? 30  GLY A O    13 
ATOM   8311  H  H    . GLY A 1 30 ? 4.908   -9.130  -9.144  1.00 0.00 ? 30  GLY A H    13 
ATOM   8312  H  HA2  . GLY A 1 30 ? 4.727   -8.946  -11.529 1.00 0.00 ? 30  GLY A HA2  13 
ATOM   8313  H  HA3  . GLY A 1 30 ? 4.345   -10.660 -11.594 1.00 0.00 ? 30  GLY A HA3  13 
ATOM   8314  N  N    . TRP A 1 31 ? 2.056   -9.661  -9.908  1.00 0.00 ? 31  TRP A N    13 
ATOM   8315  C  CA   . TRP A 1 31 ? 0.629   -9.390  -9.780  1.00 0.00 ? 31  TRP A CA   13 
ATOM   8316  C  C    . TRP A 1 31 ? 0.354   -8.463  -8.601  1.00 0.00 ? 31  TRP A C    13 
ATOM   8317  O  O    . TRP A 1 31 ? 1.137   -8.400  -7.653  1.00 0.00 ? 31  TRP A O    13 
ATOM   8318  C  CB   . TRP A 1 31 ? -0.146  -10.697 -9.608  1.00 0.00 ? 31  TRP A CB   13 
ATOM   8319  C  CG   . TRP A 1 31 ? -0.317  -11.103 -8.175  1.00 0.00 ? 31  TRP A CG   13 
ATOM   8320  C  CD1  . TRP A 1 31 ? 0.582   -11.780 -7.402  1.00 0.00 ? 31  TRP A CD1  13 
ATOM   8321  C  CD2  . TRP A 1 31 ? -1.458  -10.857 -7.346  1.00 0.00 ? 31  TRP A CD2  13 
ATOM   8322  N  NE1  . TRP A 1 31 ? 0.068   -11.971 -6.142  1.00 0.00 ? 31  TRP A NE1  13 
ATOM   8323  C  CE2  . TRP A 1 31 ? -1.182  -11.413 -6.081  1.00 0.00 ? 31  TRP A CE2  13 
ATOM   8324  C  CE3  . TRP A 1 31 ? -2.686  -10.220 -7.547  1.00 0.00 ? 31  TRP A CE3  13 
ATOM   8325  C  CZ2  . TRP A 1 31 ? -2.088  -11.351 -5.027  1.00 0.00 ? 31  TRP A CZ2  13 
ATOM   8326  C  CZ3  . TRP A 1 31 ? -3.585  -10.160 -6.500  1.00 0.00 ? 31  TRP A CZ3  13 
ATOM   8327  C  CH2  . TRP A 1 31 ? -3.282  -10.722 -5.252  1.00 0.00 ? 31  TRP A CH2  13 
ATOM   8328  H  H    . TRP A 1 31 ? 2.543   -10.031 -9.141  1.00 0.00 ? 31  TRP A H    13 
ATOM   8329  H  HA   . TRP A 1 31 ? 0.302   -8.905  -10.688 1.00 0.00 ? 31  TRP A HA   13 
ATOM   8330  H  HB2  . TRP A 1 31 ? -1.128  -10.587 -10.043 1.00 0.00 ? 31  TRP A HB2  13 
ATOM   8331  H  HB3  . TRP A 1 31 ? 0.382   -11.490 -10.118 1.00 0.00 ? 31  TRP A HB3  13 
ATOM   8332  H  HD1  . TRP A 1 31 ? 1.549   -12.113 -7.745  1.00 0.00 ? 31  TRP A HD1  13 
ATOM   8333  H  HE1  . TRP A 1 31 ? 0.524   -12.430 -5.405  1.00 0.00 ? 31  TRP A HE1  13 
ATOM   8334  H  HE3  . TRP A 1 31 ? -2.937  -9.781  -8.502  1.00 0.00 ? 31  TRP A HE3  13 
ATOM   8335  H  HZ2  . TRP A 1 31 ? -1.870  -11.779 -4.059  1.00 0.00 ? 31  TRP A HZ2  13 
ATOM   8336  H  HZ3  . TRP A 1 31 ? -4.539  -9.672  -6.637  1.00 0.00 ? 31  TRP A HZ3  13 
ATOM   8337  H  HH2  . TRP A 1 31 ? -4.015  -10.651 -4.463  1.00 0.00 ? 31  TRP A HH2  13 
ATOM   8338  N  N    . CYS A 1 32 ? -0.763  -7.746  -8.665  1.00 0.00 ? 32  CYS A N    13 
ATOM   8339  C  CA   . CYS A 1 32 ? -1.141  -6.822  -7.603  1.00 0.00 ? 32  CYS A CA   13 
ATOM   8340  C  C    . CYS A 1 32 ? -2.646  -6.864  -7.356  1.00 0.00 ? 32  CYS A C    13 
ATOM   8341  O  O    . CYS A 1 32 ? -3.454  -6.838  -8.284  1.00 0.00 ? 32  CYS A O    13 
ATOM   8342  C  CB   . CYS A 1 32 ? -0.711  -5.398  -7.960  1.00 0.00 ? 32  CYS A CB   13 
ATOM   8343  S  SG   . CYS A 1 32 ? -0.848  -4.213  -6.583  1.00 0.00 ? 32  CYS A SG   13 
ATOM   8344  H  H    . CYS A 1 32 ? -1.347  -7.840  -9.447  1.00 0.00 ? 32  CYS A H    13 
ATOM   8345  H  HA   . CYS A 1 32 ? -0.632  -7.127  -6.701  1.00 0.00 ? 32  CYS A HA   13 
ATOM   8346  H  HB2  . CYS A 1 32 ? 0.321   -5.411  -8.280  1.00 0.00 ? 32  CYS A HB2  13 
ATOM   8347  H  HB3  . CYS A 1 32 ? -1.328  -5.036  -8.769  1.00 0.00 ? 32  CYS A HB3  13 
ATOM   8348  N  N    . PRO A 1 33 ? -3.034  -6.930  -6.073  1.00 0.00 ? 33  PRO A N    13 
ATOM   8349  C  CA   . PRO A 1 33 ? -4.443  -6.976  -5.673  1.00 0.00 ? 33  PRO A CA   13 
ATOM   8350  C  C    . PRO A 1 33 ? -5.160  -5.654  -5.924  1.00 0.00 ? 33  PRO A C    13 
ATOM   8351  O  O    . PRO A 1 33 ? -6.376  -5.553  -5.754  1.00 0.00 ? 33  PRO A O    13 
ATOM   8352  C  CB   . PRO A 1 33 ? -4.377  -7.272  -4.173  1.00 0.00 ? 33  PRO A CB   13 
ATOM   8353  C  CG   . PRO A 1 33 ? -3.046  -6.757  -3.744  1.00 0.00 ? 33  PRO A CG   13 
ATOM   8354  C  CD   . PRO A 1 33 ? -2.125  -6.963  -4.914  1.00 0.00 ? 33  PRO A CD   13 
ATOM   8355  H  HA   . PRO A 1 33 ? -4.972  -7.772  -6.176  1.00 0.00 ? 33  PRO A HA   13 
ATOM   8356  H  HB2  . PRO A 1 33 ? -5.182  -6.758  -3.666  1.00 0.00 ? 33  PRO A HB2  13 
ATOM   8357  H  HB3  . PRO A 1 33 ? -4.461  -8.335  -4.008  1.00 0.00 ? 33  PRO A HB3  13 
ATOM   8358  H  HG2  . PRO A 1 33 ? -3.118  -5.707  -3.504  1.00 0.00 ? 33  PRO A HG2  13 
ATOM   8359  H  HG3  . PRO A 1 33 ? -2.696  -7.316  -2.889  1.00 0.00 ? 33  PRO A HG3  13 
ATOM   8360  H  HD2  . PRO A 1 33 ? -1.400  -6.165  -4.969  1.00 0.00 ? 33  PRO A HD2  13 
ATOM   8361  H  HD3  . PRO A 1 33 ? -1.630  -7.921  -4.841  1.00 0.00 ? 33  PRO A HD3  13 
ATOM   8362  N  N    . LEU A 1 34 ? -4.401  -4.642  -6.330  1.00 0.00 ? 34  LEU A N    13 
ATOM   8363  C  CA   . LEU A 1 34 ? -4.965  -3.325  -6.605  1.00 0.00 ? 34  LEU A CA   13 
ATOM   8364  C  C    . LEU A 1 34 ? -5.067  -3.079  -8.107  1.00 0.00 ? 34  LEU A C    13 
ATOM   8365  O  O    . LEU A 1 34 ? -5.769  -2.172  -8.552  1.00 0.00 ? 34  LEU A O    13 
ATOM   8366  C  CB   . LEU A 1 34 ? -4.108  -2.236  -5.956  1.00 0.00 ? 34  LEU A CB   13 
ATOM   8367  C  CG   . LEU A 1 34 ? -4.281  -2.056  -4.448  1.00 0.00 ? 34  LEU A CG   13 
ATOM   8368  C  CD1  . LEU A 1 34 ? -3.377  -0.946  -3.935  1.00 0.00 ? 34  LEU A CD1  13 
ATOM   8369  C  CD2  . LEU A 1 34 ? -5.735  -1.762  -4.109  1.00 0.00 ? 34  LEU A CD2  13 
ATOM   8370  H  H    . LEU A 1 34 ? -3.439  -4.783  -6.447  1.00 0.00 ? 34  LEU A H    13 
ATOM   8371  H  HA   . LEU A 1 34 ? -5.956  -3.293  -6.179  1.00 0.00 ? 34  LEU A HA   13 
ATOM   8372  H  HB2  . LEU A 1 34 ? -3.073  -2.474  -6.144  1.00 0.00 ? 34  LEU A HB2  13 
ATOM   8373  H  HB3  . LEU A 1 34 ? -4.352  -1.297  -6.432  1.00 0.00 ? 34  LEU A HB3  13 
ATOM   8374  H  HG   . LEU A 1 34 ? -4.000  -2.973  -3.948  1.00 0.00 ? 34  LEU A HG   13 
ATOM   8375  H  HD11 . LEU A 1 34 ? -2.819  -1.302  -3.083  1.00 0.00 ? 34  LEU A HD11 13 
ATOM   8376  H  HD12 . LEU A 1 34 ? -3.979  -0.098  -3.643  1.00 0.00 ? 34  LEU A HD12 13 
ATOM   8377  H  HD13 . LEU A 1 34 ? -2.693  -0.650  -4.717  1.00 0.00 ? 34  LEU A HD13 13 
ATOM   8378  H  HD21 . LEU A 1 34 ? -6.276  -2.691  -4.008  1.00 0.00 ? 34  LEU A HD21 13 
ATOM   8379  H  HD22 . LEU A 1 34 ? -6.177  -1.172  -4.899  1.00 0.00 ? 34  LEU A HD22 13 
ATOM   8380  H  HD23 . LEU A 1 34 ? -5.784  -1.214  -3.180  1.00 0.00 ? 34  LEU A HD23 13 
ATOM   8381  N  N    . GLY A 1 35 ? -4.362  -3.896  -8.885  1.00 0.00 ? 35  GLY A N    13 
ATOM   8382  C  CA   . GLY A 1 35 ? -4.389  -3.753  -10.328 1.00 0.00 ? 35  GLY A CA   13 
ATOM   8383  C  C    . GLY A 1 35 ? -3.868  -2.405  -10.787 1.00 0.00 ? 35  GLY A C    13 
ATOM   8384  O  O    . GLY A 1 35 ? -2.913  -1.863  -10.231 1.00 0.00 ? 35  GLY A O    13 
ATOM   8385  H  H    . GLY A 1 35 ? -3.819  -4.602  -8.474  1.00 0.00 ? 35  GLY A H    13 
ATOM   8386  H  HA2  . GLY A 1 35 ? -3.781  -4.530  -10.768 1.00 0.00 ? 35  GLY A HA2  13 
ATOM   8387  H  HA3  . GLY A 1 35 ? -5.407  -3.868  -10.671 1.00 0.00 ? 35  GLY A HA3  13 
ATOM   8388  N  N    . PRO A 1 36 ? -4.504  -1.843  -11.826 1.00 0.00 ? 36  PRO A N    13 
ATOM   8389  C  CA   . PRO A 1 36 ? -4.116  -0.543  -12.382 1.00 0.00 ? 36  PRO A CA   13 
ATOM   8390  C  C    . PRO A 1 36 ? -4.434  0.610   -11.438 1.00 0.00 ? 36  PRO A C    13 
ATOM   8391  O  O    . PRO A 1 36 ? -3.725  1.616   -11.411 1.00 0.00 ? 36  PRO A O    13 
ATOM   8392  C  CB   . PRO A 1 36 ? -4.957  -0.438  -13.657 1.00 0.00 ? 36  PRO A CB   13 
ATOM   8393  C  CG   . PRO A 1 36 ? -6.141  -1.305  -13.402 1.00 0.00 ? 36  PRO A CG   13 
ATOM   8394  C  CD   . PRO A 1 36 ? -5.651  -2.432  -12.537 1.00 0.00 ? 36  PRO A CD   13 
ATOM   8395  H  HA   . PRO A 1 36 ? -3.067  -0.519  -12.638 1.00 0.00 ? 36  PRO A HA   13 
ATOM   8396  H  HB2  . PRO A 1 36 ? -5.246  0.591   -13.817 1.00 0.00 ? 36  PRO A HB2  13 
ATOM   8397  H  HB3  . PRO A 1 36 ? -4.384  -0.792  -14.501 1.00 0.00 ? 36  PRO A HB3  13 
ATOM   8398  H  HG2  . PRO A 1 36 ? -6.905  -0.741  -12.887 1.00 0.00 ? 36  PRO A HG2  13 
ATOM   8399  H  HG3  . PRO A 1 36 ? -6.523  -1.689  -14.337 1.00 0.00 ? 36  PRO A HG3  13 
ATOM   8400  H  HD2  . PRO A 1 36 ? -6.420  -2.737  -11.842 1.00 0.00 ? 36  PRO A HD2  13 
ATOM   8401  H  HD3  . PRO A 1 36 ? -5.338  -3.267  -13.146 1.00 0.00 ? 36  PRO A HD3  13 
ATOM   8402  N  N    . GLN A 1 37 ? -5.504  0.458   -10.664 1.00 0.00 ? 37  GLN A N    13 
ATOM   8403  C  CA   . GLN A 1 37 ? -5.916  1.489   -9.718  1.00 0.00 ? 37  GLN A CA   13 
ATOM   8404  C  C    . GLN A 1 37 ? -4.837  1.722   -8.665  1.00 0.00 ? 37  GLN A C    13 
ATOM   8405  O  O    . GLN A 1 37 ? -4.763  2.795   -8.065  1.00 0.00 ? 37  GLN A O    13 
ATOM   8406  C  CB   . GLN A 1 37 ? -7.229  1.094   -9.041  1.00 0.00 ? 37  GLN A CB   13 
ATOM   8407  C  CG   . GLN A 1 37 ? -8.464  1.474   -9.843  1.00 0.00 ? 37  GLN A CG   13 
ATOM   8408  C  CD   . GLN A 1 37 ? -8.311  1.186   -11.323 1.00 0.00 ? 37  GLN A CD   13 
ATOM   8409  O  OE1  . GLN A 1 37 ? -7.429  1.733   -11.986 1.00 0.00 ? 37  GLN A OE1  13 
ATOM   8410  N  NE2  . GLN A 1 37 ? -9.171  0.323   -11.851 1.00 0.00 ? 37  GLN A NE2  13 
ATOM   8411  H  H    . GLN A 1 37 ? -6.030  -0.366  -10.732 1.00 0.00 ? 37  GLN A H    13 
ATOM   8412  H  HA   . GLN A 1 37 ? -6.066  2.404   -10.270 1.00 0.00 ? 37  GLN A HA   13 
ATOM   8413  H  HB2  . GLN A 1 37 ? -7.237  0.025   -8.893  1.00 0.00 ? 37  GLN A HB2  13 
ATOM   8414  H  HB3  . GLN A 1 37 ? -7.286  1.584   -8.080  1.00 0.00 ? 37  GLN A HB3  13 
ATOM   8415  H  HG2  . GLN A 1 37 ? -9.308  0.913   -9.468  1.00 0.00 ? 37  GLN A HG2  13 
ATOM   8416  H  HG3  . GLN A 1 37 ? -8.650  2.530   -9.714  1.00 0.00 ? 37  GLN A HG3  13 
ATOM   8417  H  HE21 . GLN A 1 37 ? -9.849  -0.073  -11.263 1.00 0.00 ? 37  GLN A HE21 13 
ATOM   8418  H  HE22 . GLN A 1 37 ? -9.096  0.119   -12.805 1.00 0.00 ? 37  GLN A HE22 13 
ATOM   8419  N  N    . CYS A 1 38 ? -4.003  0.711   -8.445  1.00 0.00 ? 38  CYS A N    13 
ATOM   8420  C  CA   . CYS A 1 38 ? -2.929  0.805   -7.464  1.00 0.00 ? 38  CYS A CA   13 
ATOM   8421  C  C    . CYS A 1 38 ? -2.216  2.150   -7.565  1.00 0.00 ? 38  CYS A C    13 
ATOM   8422  O  O    . CYS A 1 38 ? -1.895  2.631   -8.652  1.00 0.00 ? 38  CYS A O    13 
ATOM   8423  C  CB   . CYS A 1 38 ? -1.926  -0.333  -7.664  1.00 0.00 ? 38  CYS A CB   13 
ATOM   8424  S  SG   . CYS A 1 38 ? -0.592  -0.375  -6.424  1.00 0.00 ? 38  CYS A SG   13 
ATOM   8425  H  H    . CYS A 1 38 ? -4.113  -0.119  -8.955  1.00 0.00 ? 38  CYS A H    13 
ATOM   8426  H  HA   . CYS A 1 38 ? -3.368  0.718   -6.482  1.00 0.00 ? 38  CYS A HA   13 
ATOM   8427  H  HB2  . CYS A 1 38 ? -2.450  -1.276  -7.614  1.00 0.00 ? 38  CYS A HB2  13 
ATOM   8428  H  HB3  . CYS A 1 38 ? -1.469  -0.232  -8.637  1.00 0.00 ? 38  CYS A HB3  13 
ATOM   8429  N  N    . PRO A 1 39 ? -1.962  2.774   -6.405  1.00 0.00 ? 39  PRO A N    13 
ATOM   8430  C  CA   . PRO A 1 39 ? -1.283  4.072   -6.336  1.00 0.00 ? 39  PRO A CA   13 
ATOM   8431  C  C    . PRO A 1 39 ? 0.189   3.977   -6.721  1.00 0.00 ? 39  PRO A C    13 
ATOM   8432  O  O    . PRO A 1 39 ? 0.889   4.987   -6.782  1.00 0.00 ? 39  PRO A O    13 
ATOM   8433  C  CB   . PRO A 1 39 ? -1.427  4.469   -4.865  1.00 0.00 ? 39  PRO A CB   13 
ATOM   8434  C  CG   . PRO A 1 39 ? -1.579  3.179   -4.137  1.00 0.00 ? 39  PRO A CG   13 
ATOM   8435  C  CD   . PRO A 1 39 ? -2.317  2.260   -5.072  1.00 0.00 ? 39  PRO A CD   13 
ATOM   8436  H  HA   . PRO A 1 39 ? -1.770  4.808   -6.959  1.00 0.00 ? 39  PRO A HA   13 
ATOM   8437  H  HB2  . PRO A 1 39 ? -0.543  5.003   -4.546  1.00 0.00 ? 39  PRO A HB2  13 
ATOM   8438  H  HB3  . PRO A 1 39 ? -2.297  5.097   -4.742  1.00 0.00 ? 39  PRO A HB3  13 
ATOM   8439  H  HG2  . PRO A 1 39 ? -0.607  2.773   -3.902  1.00 0.00 ? 39  PRO A HG2  13 
ATOM   8440  H  HG3  . PRO A 1 39 ? -2.152  3.332   -3.234  1.00 0.00 ? 39  PRO A HG3  13 
ATOM   8441  H  HD2  . PRO A 1 39 ? -1.977  1.243   -4.947  1.00 0.00 ? 39  PRO A HD2  13 
ATOM   8442  H  HD3  . PRO A 1 39 ? -3.382  2.327   -4.904  1.00 0.00 ? 39  PRO A HD3  13 
ATOM   8443  N  N    . GLN A 1 40 ? 0.651   2.758   -6.979  1.00 0.00 ? 40  GLN A N    13 
ATOM   8444  C  CA   . GLN A 1 40 ? 2.042   2.533   -7.358  1.00 0.00 ? 40  GLN A CA   13 
ATOM   8445  C  C    . GLN A 1 40 ? 2.140   2.026   -8.793  1.00 0.00 ? 40  GLN A C    13 
ATOM   8446  O  O    . GLN A 1 40 ? 1.197   1.432   -9.317  1.00 0.00 ? 40  GLN A O    13 
ATOM   8447  C  CB   . GLN A 1 40 ? 2.696   1.532   -6.404  1.00 0.00 ? 40  GLN A CB   13 
ATOM   8448  C  CG   . GLN A 1 40 ? 2.824   2.044   -4.979  1.00 0.00 ? 40  GLN A CG   13 
ATOM   8449  C  CD   . GLN A 1 40 ? 3.520   1.055   -4.064  1.00 0.00 ? 40  GLN A CD   13 
ATOM   8450  O  OE1  . GLN A 1 40 ? 2.880   0.188   -3.468  1.00 0.00 ? 40  GLN A OE1  13 
ATOM   8451  N  NE2  . GLN A 1 40 ? 4.836   1.180   -3.948  1.00 0.00 ? 40  GLN A NE2  13 
ATOM   8452  H  H    . GLN A 1 40 ? 0.044   1.993   -6.913  1.00 0.00 ? 40  GLN A H    13 
ATOM   8453  H  HA   . GLN A 1 40 ? 2.561   3.477   -7.287  1.00 0.00 ? 40  GLN A HA   13 
ATOM   8454  H  HB2  . GLN A 1 40 ? 2.105   0.629   -6.388  1.00 0.00 ? 40  GLN A HB2  13 
ATOM   8455  H  HB3  . GLN A 1 40 ? 3.685   1.299   -6.770  1.00 0.00 ? 40  GLN A HB3  13 
ATOM   8456  H  HG2  . GLN A 1 40 ? 3.393   2.962   -4.989  1.00 0.00 ? 40  GLN A HG2  13 
ATOM   8457  H  HG3  . GLN A 1 40 ? 1.836   2.239   -4.590  1.00 0.00 ? 40  GLN A HG3  13 
ATOM   8458  H  HE21 . GLN A 1 40 ? 5.279   1.895   -4.452  1.00 0.00 ? 40  GLN A HE21 13 
ATOM   8459  H  HE22 . GLN A 1 40 ? 5.311   0.555   -3.363  1.00 0.00 ? 40  GLN A HE22 13 
ATOM   8460  N  N    . SER A 1 41 ? 3.286   2.264   -9.423  1.00 0.00 ? 41  SER A N    13 
ATOM   8461  C  CA   . SER A 1 41 ? 3.505   1.834   -10.799 1.00 0.00 ? 41  SER A CA   13 
ATOM   8462  C  C    . SER A 1 41 ? 3.867   0.353   -10.854 1.00 0.00 ? 41  SER A C    13 
ATOM   8463  O  O    . SER A 1 41 ? 4.340   -0.220  -9.873  1.00 0.00 ? 41  SER A O    13 
ATOM   8464  C  CB   . SER A 1 41 ? 4.615   2.666   -11.444 1.00 0.00 ? 41  SER A CB   13 
ATOM   8465  O  OG   . SER A 1 41 ? 4.427   2.769   -12.845 1.00 0.00 ? 41  SER A OG   13 
ATOM   8466  H  H    . SER A 1 41 ? 4.000   2.742   -8.951  1.00 0.00 ? 41  SER A H    13 
ATOM   8467  H  HA   . SER A 1 41 ? 2.587   1.990   -11.345 1.00 0.00 ? 41  SER A HA   13 
ATOM   8468  H  HB2  . SER A 1 41 ? 4.612   3.658   -11.018 1.00 0.00 ? 41  SER A HB2  13 
ATOM   8469  H  HB3  . SER A 1 41 ? 5.570   2.197   -11.254 1.00 0.00 ? 41  SER A HB3  13 
ATOM   8470  H  HG   . SER A 1 41 ? 4.997   2.139   -13.292 1.00 0.00 ? 41  SER A HG   13 
ATOM   8471  N  N    . HIS A 1 42 ? 3.640   -0.262  -12.011 1.00 0.00 ? 42  HIS A N    13 
ATOM   8472  C  CA   . HIS A 1 42 ? 3.941   -1.677  -12.197 1.00 0.00 ? 42  HIS A CA   13 
ATOM   8473  C  C    . HIS A 1 42 ? 4.796   -1.891  -13.442 1.00 0.00 ? 42  HIS A C    13 
ATOM   8474  O  O    . HIS A 1 42 ? 4.316   -2.395  -14.457 1.00 0.00 ? 42  HIS A O    13 
ATOM   8475  C  CB   . HIS A 1 42 ? 2.648   -2.485  -12.306 1.00 0.00 ? 42  HIS A CB   13 
ATOM   8476  C  CG   . HIS A 1 42 ? 1.838   -2.492  -11.047 1.00 0.00 ? 42  HIS A CG   13 
ATOM   8477  N  ND1  . HIS A 1 42 ? 0.464   -2.606  -11.037 1.00 0.00 ? 42  HIS A ND1  13 
ATOM   8478  C  CD2  . HIS A 1 42 ? 2.216   -2.401  -9.750  1.00 0.00 ? 42  HIS A CD2  13 
ATOM   8479  C  CE1  . HIS A 1 42 ? 0.031   -2.582  -9.789  1.00 0.00 ? 42  HIS A CE1  13 
ATOM   8480  N  NE2  . HIS A 1 42 ? 1.075   -2.459  -8.988  1.00 0.00 ? 42  HIS A NE2  13 
ATOM   8481  H  H    . HIS A 1 42 ? 3.261   0.248   -12.757 1.00 0.00 ? 42  HIS A H    13 
ATOM   8482  H  HA   . HIS A 1 42 ? 4.494   -2.014  -11.333 1.00 0.00 ? 42  HIS A HA   13 
ATOM   8483  H  HB2  . HIS A 1 42 ? 2.036   -2.068  -13.092 1.00 0.00 ? 42  HIS A HB2  13 
ATOM   8484  H  HB3  . HIS A 1 42 ? 2.891   -3.509  -12.551 1.00 0.00 ? 42  HIS A HB3  13 
ATOM   8485  H  HD1  . HIS A 1 42 ? -0.110  -2.689  -11.827 1.00 0.00 ? 42  HIS A HD1  13 
ATOM   8486  H  HD2  . HIS A 1 42 ? 3.227   -2.301  -9.382  1.00 0.00 ? 42  HIS A HD2  13 
ATOM   8487  H  HE1  . HIS A 1 42 ? -1.000  -2.651  -9.475  1.00 0.00 ? 42  HIS A HE1  13 
ATOM   8488  N  N    . ASP A 1 43 ? 6.064   -1.505  -13.357 1.00 0.00 ? 43  ASP A N    13 
ATOM   8489  C  CA   . ASP A 1 43 ? 6.986   -1.655  -14.476 1.00 0.00 ? 43  ASP A CA   13 
ATOM   8490  C  C    . ASP A 1 43 ? 7.878   -2.878  -14.286 1.00 0.00 ? 43  ASP A C    13 
ATOM   8491  O  O    . ASP A 1 43 ? 8.341   -3.153  -13.179 1.00 0.00 ? 43  ASP A O    13 
ATOM   8492  C  CB   . ASP A 1 43 ? 7.847   -0.399  -14.628 1.00 0.00 ? 43  ASP A CB   13 
ATOM   8493  C  CG   . ASP A 1 43 ? 8.176   0.241   -13.294 1.00 0.00 ? 43  ASP A CG   13 
ATOM   8494  O  OD1  . ASP A 1 43 ? 9.012   -0.322  -12.556 1.00 0.00 ? 43  ASP A OD1  13 
ATOM   8495  O  OD2  . ASP A 1 43 ? 7.598   1.305   -12.987 1.00 0.00 ? 43  ASP A OD2  13 
ATOM   8496  H  H    . ASP A 1 43 ? 6.388   -1.109  -12.520 1.00 0.00 ? 43  ASP A H    13 
ATOM   8497  H  HA   . ASP A 1 43 ? 6.400   -1.788  -15.373 1.00 0.00 ? 43  ASP A HA   13 
ATOM   8498  H  HB2  . ASP A 1 43 ? 8.773   -0.662  -15.118 1.00 0.00 ? 43  ASP A HB2  13 
ATOM   8499  H  HB3  . ASP A 1 43 ? 7.317   0.322   -15.232 1.00 0.00 ? 43  ASP A HB3  13 
ATOM   8500  N  N    . ILE A 1 44 ? 8.113   -3.607  -15.371 1.00 0.00 ? 44  ILE A N    13 
ATOM   8501  C  CA   . ILE A 1 44 ? 8.948   -4.800  -15.323 1.00 0.00 ? 44  ILE A CA   13 
ATOM   8502  C  C    . ILE A 1 44 ? 10.224  -4.611  -16.138 1.00 0.00 ? 44  ILE A C    13 
ATOM   8503  O  O    . ILE A 1 44 ? 10.191  -4.604  -17.368 1.00 0.00 ? 44  ILE A O    13 
ATOM   8504  C  CB   . ILE A 1 44 ? 8.195   -6.037  -15.849 1.00 0.00 ? 44  ILE A CB   13 
ATOM   8505  C  CG1  . ILE A 1 44 ? 6.924   -6.273  -15.031 1.00 0.00 ? 44  ILE A CG1  13 
ATOM   8506  C  CG2  . ILE A 1 44 ? 9.095   -7.263  -15.806 1.00 0.00 ? 44  ILE A CG2  13 
ATOM   8507  C  CD1  . ILE A 1 44 ? 7.179   -6.413  -13.546 1.00 0.00 ? 44  ILE A CD1  13 
ATOM   8508  H  H    . ILE A 1 44 ? 7.715   -3.336  -16.225 1.00 0.00 ? 44  ILE A H    13 
ATOM   8509  H  HA   . ILE A 1 44 ? 9.216   -4.978  -14.292 1.00 0.00 ? 44  ILE A HA   13 
ATOM   8510  H  HB   . ILE A 1 44 ? 7.924   -5.855  -16.878 1.00 0.00 ? 44  ILE A HB   13 
ATOM   8511  H  HG12 . ILE A 1 44 ? 6.251   -5.443  -15.174 1.00 0.00 ? 44  ILE A HG12 13 
ATOM   8512  H  HG13 . ILE A 1 44 ? 6.448   -7.180  -15.374 1.00 0.00 ? 44  ILE A HG13 13 
ATOM   8513  H  HG21 . ILE A 1 44 ? 10.112  -6.956  -15.609 1.00 0.00 ? 44  ILE A HG21 13 
ATOM   8514  H  HG22 . ILE A 1 44 ? 8.761   -7.926  -15.023 1.00 0.00 ? 44  ILE A HG22 13 
ATOM   8515  H  HG23 . ILE A 1 44 ? 9.052   -7.775  -16.756 1.00 0.00 ? 44  ILE A HG23 13 
ATOM   8516  H  HD11 . ILE A 1 44 ? 8.222   -6.637  -13.379 1.00 0.00 ? 44  ILE A HD11 13 
ATOM   8517  H  HD12 . ILE A 1 44 ? 6.923   -5.490  -13.048 1.00 0.00 ? 44  ILE A HD12 13 
ATOM   8518  H  HD13 . ILE A 1 44 ? 6.572   -7.215  -13.151 1.00 0.00 ? 44  ILE A HD13 13 
ATOM   8519  N  N    . SER A 1 45 ? 11.346  -4.460  -15.442 1.00 0.00 ? 45  SER A N    13 
ATOM   8520  C  CA   . SER A 1 45 ? 12.633  -4.269  -16.100 1.00 0.00 ? 45  SER A CA   13 
ATOM   8521  C  C    . SER A 1 45 ? 13.587  -5.413  -15.770 1.00 0.00 ? 45  SER A C    13 
ATOM   8522  O  O    . SER A 1 45 ? 14.065  -5.532  -14.643 1.00 0.00 ? 45  SER A O    13 
ATOM   8523  C  CB   . SER A 1 45 ? 13.253  -2.936  -15.679 1.00 0.00 ? 45  SER A CB   13 
ATOM   8524  O  OG   . SER A 1 45 ? 13.476  -2.896  -14.280 1.00 0.00 ? 45  SER A OG   13 
ATOM   8525  H  H    . SER A 1 45 ? 11.307  -4.475  -14.463 1.00 0.00 ? 45  SER A H    13 
ATOM   8526  H  HA   . SER A 1 45 ? 12.462  -4.256  -17.166 1.00 0.00 ? 45  SER A HA   13 
ATOM   8527  H  HB2  . SER A 1 45 ? 14.197  -2.804  -16.185 1.00 0.00 ? 45  SER A HB2  13 
ATOM   8528  H  HB3  . SER A 1 45 ? 12.585  -2.130  -15.948 1.00 0.00 ? 45  SER A HB3  13 
ATOM   8529  H  HG   . SER A 1 45 ? 13.380  -1.995  -13.965 1.00 0.00 ? 45  SER A HG   13 
ATOM   8530  N  N    . GLY A 1 46 ? 13.860  -6.254  -16.764 1.00 0.00 ? 46  GLY A N    13 
ATOM   8531  C  CA   . GLY A 1 46 ? 14.755  -7.378  -16.560 1.00 0.00 ? 46  GLY A CA   13 
ATOM   8532  C  C    . GLY A 1 46 ? 16.193  -7.044  -16.904 1.00 0.00 ? 46  GLY A C    13 
ATOM   8533  O  O    . GLY A 1 46 ? 17.027  -6.818  -16.027 1.00 0.00 ? 46  GLY A O    13 
ATOM   8534  H  H    . GLY A 1 46 ? 13.450  -6.110  -17.642 1.00 0.00 ? 46  GLY A H    13 
ATOM   8535  H  HA2  . GLY A 1 46 ? 14.704  -7.681  -15.525 1.00 0.00 ? 46  GLY A HA2  13 
ATOM   8536  H  HA3  . GLY A 1 46 ? 14.430  -8.199  -17.182 1.00 0.00 ? 46  GLY A HA3  13 
ATOM   8537  N  N    . PRO A 1 47 ? 16.501  -7.010  -18.209 1.00 0.00 ? 47  PRO A N    13 
ATOM   8538  C  CA   . PRO A 1 47 ? 17.849  -6.703  -18.696 1.00 0.00 ? 47  PRO A CA   13 
ATOM   8539  C  C    . PRO A 1 47 ? 18.229  -5.244  -18.469 1.00 0.00 ? 47  PRO A C    13 
ATOM   8540  O  O    . PRO A 1 47 ? 17.803  -4.359  -19.211 1.00 0.00 ? 47  PRO A O    13 
ATOM   8541  C  CB   . PRO A 1 47 ? 17.762  -7.006  -20.194 1.00 0.00 ? 47  PRO A CB   13 
ATOM   8542  C  CG   . PRO A 1 47 ? 16.320  -6.840  -20.531 1.00 0.00 ? 47  PRO A CG   13 
ATOM   8543  C  CD   . PRO A 1 47 ? 15.557  -7.269  -19.309 1.00 0.00 ? 47  PRO A CD   13 
ATOM   8544  H  HA   . PRO A 1 47 ? 18.591  -7.343  -18.241 1.00 0.00 ? 47  PRO A HA   13 
ATOM   8545  H  HB2  . PRO A 1 47 ? 18.380  -6.308  -20.742 1.00 0.00 ? 47  PRO A HB2  13 
ATOM   8546  H  HB3  . PRO A 1 47 ? 18.097  -8.015  -20.381 1.00 0.00 ? 47  PRO A HB3  13 
ATOM   8547  H  HG2  . PRO A 1 47 ? 16.113  -5.805  -20.758 1.00 0.00 ? 47  PRO A HG2  13 
ATOM   8548  H  HG3  . PRO A 1 47 ? 16.065  -7.468  -21.372 1.00 0.00 ? 47  PRO A HG3  13 
ATOM   8549  H  HD2  . PRO A 1 47 ? 14.661  -6.677  -19.196 1.00 0.00 ? 47  PRO A HD2  13 
ATOM   8550  H  HD3  . PRO A 1 47 ? 15.313  -8.320  -19.367 1.00 0.00 ? 47  PRO A HD3  13 
ATOM   8551  N  N    . SER A 1 48 ? 19.034  -5.001  -17.440 1.00 0.00 ? 48  SER A N    13 
ATOM   8552  C  CA   . SER A 1 48 ? 19.469  -3.648  -17.113 1.00 0.00 ? 48  SER A CA   13 
ATOM   8553  C  C    . SER A 1 48 ? 20.341  -3.074  -18.226 1.00 0.00 ? 48  SER A C    13 
ATOM   8554  O  O    . SER A 1 48 ? 19.987  -2.078  -18.856 1.00 0.00 ? 48  SER A O    13 
ATOM   8555  C  CB   . SER A 1 48 ? 20.240  -3.642  -15.791 1.00 0.00 ? 48  SER A CB   13 
ATOM   8556  O  OG   . SER A 1 48 ? 20.510  -2.318  -15.364 1.00 0.00 ? 48  SER A OG   13 
ATOM   8557  H  H    . SER A 1 48 ? 19.341  -5.749  -16.885 1.00 0.00 ? 48  SER A H    13 
ATOM   8558  H  HA   . SER A 1 48 ? 18.588  -3.032  -17.009 1.00 0.00 ? 48  SER A HA   13 
ATOM   8559  H  HB2  . SER A 1 48 ? 19.654  -4.140  -15.034 1.00 0.00 ? 48  SER A HB2  13 
ATOM   8560  H  HB3  . SER A 1 48 ? 21.177  -4.164  -15.922 1.00 0.00 ? 48  SER A HB3  13 
ATOM   8561  H  HG   . SER A 1 48 ? 21.048  -2.342  -14.569 1.00 0.00 ? 48  SER A HG   13 
ATOM   8562  N  N    . SER A 1 49 ? 21.484  -3.711  -18.461 1.00 0.00 ? 49  SER A N    13 
ATOM   8563  C  CA   . SER A 1 49 ? 22.410  -3.263  -19.495 1.00 0.00 ? 49  SER A CA   13 
ATOM   8564  C  C    . SER A 1 49 ? 22.121  -3.958  -20.822 1.00 0.00 ? 49  SER A C    13 
ATOM   8565  O  O    . SER A 1 49 ? 21.587  -5.066  -20.852 1.00 0.00 ? 49  SER A O    13 
ATOM   8566  C  CB   . SER A 1 49 ? 23.854  -3.534  -19.068 1.00 0.00 ? 49  SER A CB   13 
ATOM   8567  O  OG   . SER A 1 49 ? 24.154  -4.917  -19.134 1.00 0.00 ? 49  SER A OG   13 
ATOM   8568  H  H    . SER A 1 49 ? 21.711  -4.500  -17.925 1.00 0.00 ? 49  SER A H    13 
ATOM   8569  H  HA   . SER A 1 49 ? 22.275  -2.199  -19.623 1.00 0.00 ? 49  SER A HA   13 
ATOM   8570  H  HB2  . SER A 1 49 ? 24.526  -3.000  -19.723 1.00 0.00 ? 49  SER A HB2  13 
ATOM   8571  H  HB3  . SER A 1 49 ? 23.996  -3.194  -18.052 1.00 0.00 ? 49  SER A HB3  13 
ATOM   8572  H  HG   . SER A 1 49 ? 23.354  -5.426  -18.983 1.00 0.00 ? 49  SER A HG   13 
ATOM   8573  N  N    . GLY A 1 50 ? 22.477  -3.297  -21.919 1.00 0.00 ? 50  GLY A N    13 
ATOM   8574  C  CA   . GLY A 1 50 ? 22.249  -3.866  -23.235 1.00 0.00 ? 50  GLY A CA   13 
ATOM   8575  C  C    . GLY A 1 50 ? 20.810  -4.296  -23.438 1.00 0.00 ? 50  GLY A C    13 
ATOM   8576  O  O    . GLY A 1 50 ? 19.912  -3.464  -23.315 1.00 0.00 ? 50  GLY A O    13 
ATOM   8577  H  H    . GLY A 1 50 ? 22.899  -2.417  -21.835 1.00 0.00 ? 50  GLY A H    13 
ATOM   8578  H  HA2  . GLY A 1 50 ? 22.502  -3.129  -23.982 1.00 0.00 ? 50  GLY A HA2  13 
ATOM   8579  H  HA3  . GLY A 1 50 ? 22.890  -4.726  -23.359 1.00 0.00 ? 50  GLY A HA3  13 
HETATM 8580  ZN ZN   . ZN  B 2 .  ? 0.500   -2.355  -7.037  1.00 0.00 ? 201 ZN  A ZN   13 
ATOM   8581  N  N    . GLY A 1 1  ? 20.326  41.235  -18.507 1.00 0.00 ? 1   GLY A N    14 
ATOM   8582  C  CA   . GLY A 1 1  ? 20.653  42.167  -17.444 1.00 0.00 ? 1   GLY A CA   14 
ATOM   8583  C  C    . GLY A 1 1  ? 19.787  41.972  -16.215 1.00 0.00 ? 1   GLY A C    14 
ATOM   8584  O  O    . GLY A 1 1  ? 19.703  40.869  -15.676 1.00 0.00 ? 1   GLY A O    14 
ATOM   8585  H  H1   . GLY A 1 1  ? 19.962  40.352  -18.287 1.00 0.00 ? 1   GLY A H1   14 
ATOM   8586  H  HA2  . GLY A 1 1  ? 21.688  42.032  -17.167 1.00 0.00 ? 1   GLY A HA2  14 
ATOM   8587  H  HA3  . GLY A 1 1  ? 20.517  43.174  -17.810 1.00 0.00 ? 1   GLY A HA3  14 
ATOM   8588  N  N    . SER A 1 2  ? 19.143  43.047  -15.771 1.00 0.00 ? 2   SER A N    14 
ATOM   8589  C  CA   . SER A 1 2  ? 18.284  42.990  -14.594 1.00 0.00 ? 2   SER A CA   14 
ATOM   8590  C  C    . SER A 1 2  ? 16.912  42.426  -14.950 1.00 0.00 ? 2   SER A C    14 
ATOM   8591  O  O    . SER A 1 2  ? 16.123  43.071  -15.641 1.00 0.00 ? 2   SER A O    14 
ATOM   8592  C  CB   . SER A 1 2  ? 18.131  44.383  -13.980 1.00 0.00 ? 2   SER A CB   14 
ATOM   8593  O  OG   . SER A 1 2  ? 17.113  44.397  -12.995 1.00 0.00 ? 2   SER A OG   14 
ATOM   8594  H  H    . SER A 1 2  ? 19.251  43.898  -16.244 1.00 0.00 ? 2   SER A H    14 
ATOM   8595  H  HA   . SER A 1 2  ? 18.752  42.337  -13.872 1.00 0.00 ? 2   SER A HA   14 
ATOM   8596  H  HB2  . SER A 1 2  ? 19.063  44.676  -13.522 1.00 0.00 ? 2   SER A HB2  14 
ATOM   8597  H  HB3  . SER A 1 2  ? 17.874  45.089  -14.757 1.00 0.00 ? 2   SER A HB3  14 
ATOM   8598  H  HG   . SER A 1 2  ? 17.506  44.534  -12.130 1.00 0.00 ? 2   SER A HG   14 
ATOM   8599  N  N    . SER A 1 3  ? 16.634  41.217  -14.473 1.00 0.00 ? 3   SER A N    14 
ATOM   8600  C  CA   . SER A 1 3  ? 15.359  40.562  -14.744 1.00 0.00 ? 3   SER A CA   14 
ATOM   8601  C  C    . SER A 1 3  ? 14.776  39.960  -13.469 1.00 0.00 ? 3   SER A C    14 
ATOM   8602  O  O    . SER A 1 3  ? 15.394  40.011  -12.406 1.00 0.00 ? 3   SER A O    14 
ATOM   8603  C  CB   . SER A 1 3  ? 15.536  39.472  -15.802 1.00 0.00 ? 3   SER A CB   14 
ATOM   8604  O  OG   . SER A 1 3  ? 15.937  40.026  -17.043 1.00 0.00 ? 3   SER A OG   14 
ATOM   8605  H  H    . SER A 1 3  ? 17.304  40.753  -13.928 1.00 0.00 ? 3   SER A H    14 
ATOM   8606  H  HA   . SER A 1 3  ? 14.676  41.310  -15.119 1.00 0.00 ? 3   SER A HA   14 
ATOM   8607  H  HB2  . SER A 1 3  ? 16.290  38.773  -15.473 1.00 0.00 ? 3   SER A HB2  14 
ATOM   8608  H  HB3  . SER A 1 3  ? 14.599  38.952  -15.939 1.00 0.00 ? 3   SER A HB3  14 
ATOM   8609  H  HG   . SER A 1 3  ? 15.211  39.969  -17.669 1.00 0.00 ? 3   SER A HG   14 
ATOM   8610  N  N    . GLY A 1 4  ? 13.581  39.389  -13.584 1.00 0.00 ? 4   GLY A N    14 
ATOM   8611  C  CA   . GLY A 1 4  ? 12.934  38.784  -12.434 1.00 0.00 ? 4   GLY A CA   14 
ATOM   8612  C  C    . GLY A 1 4  ? 13.776  37.694  -11.801 1.00 0.00 ? 4   GLY A C    14 
ATOM   8613  O  O    . GLY A 1 4  ? 14.745  37.979  -11.097 1.00 0.00 ? 4   GLY A O    14 
ATOM   8614  H  H    . GLY A 1 4  ? 13.135  39.378  -14.457 1.00 0.00 ? 4   GLY A H    14 
ATOM   8615  H  HA2  . GLY A 1 4  ? 12.743  39.551  -11.698 1.00 0.00 ? 4   GLY A HA2  14 
ATOM   8616  H  HA3  . GLY A 1 4  ? 11.992  38.359  -12.748 1.00 0.00 ? 4   GLY A HA3  14 
ATOM   8617  N  N    . SER A 1 5  ? 13.405  36.442  -12.050 1.00 0.00 ? 5   SER A N    14 
ATOM   8618  C  CA   . SER A 1 5  ? 14.130  35.306  -11.495 1.00 0.00 ? 5   SER A CA   14 
ATOM   8619  C  C    . SER A 1 5  ? 14.612  34.375  -12.603 1.00 0.00 ? 5   SER A C    14 
ATOM   8620  O  O    . SER A 1 5  ? 13.853  33.547  -13.109 1.00 0.00 ? 5   SER A O    14 
ATOM   8621  C  CB   . SER A 1 5  ? 13.240  34.535  -10.517 1.00 0.00 ? 5   SER A CB   14 
ATOM   8622  O  OG   . SER A 1 5  ? 12.898  35.336  -9.400  1.00 0.00 ? 5   SER A OG   14 
ATOM   8623  H  H    . SER A 1 5  ? 12.623  36.280  -12.619 1.00 0.00 ? 5   SER A H    14 
ATOM   8624  H  HA   . SER A 1 5  ? 14.988  35.688  -10.963 1.00 0.00 ? 5   SER A HA   14 
ATOM   8625  H  HB2  . SER A 1 5  ? 12.334  34.234  -11.020 1.00 0.00 ? 5   SER A HB2  14 
ATOM   8626  H  HB3  . SER A 1 5  ? 13.768  33.658  -10.170 1.00 0.00 ? 5   SER A HB3  14 
ATOM   8627  H  HG   . SER A 1 5  ? 13.568  36.011  -9.272  1.00 0.00 ? 5   SER A HG   14 
ATOM   8628  N  N    . SER A 1 6  ? 15.879  34.517  -12.977 1.00 0.00 ? 6   SER A N    14 
ATOM   8629  C  CA   . SER A 1 6  ? 16.464  33.692  -14.028 1.00 0.00 ? 6   SER A CA   14 
ATOM   8630  C  C    . SER A 1 6  ? 16.874  32.328  -13.483 1.00 0.00 ? 6   SER A C    14 
ATOM   8631  O  O    . SER A 1 6  ? 18.039  32.100  -13.161 1.00 0.00 ? 6   SER A O    14 
ATOM   8632  C  CB   . SER A 1 6  ? 17.676  34.395  -14.642 1.00 0.00 ? 6   SER A CB   14 
ATOM   8633  O  OG   . SER A 1 6  ? 17.942  33.907  -15.946 1.00 0.00 ? 6   SER A OG   14 
ATOM   8634  H  H    . SER A 1 6  ? 16.434  35.195  -12.536 1.00 0.00 ? 6   SER A H    14 
ATOM   8635  H  HA   . SER A 1 6  ? 15.715  33.551  -14.793 1.00 0.00 ? 6   SER A HA   14 
ATOM   8636  H  HB2  . SER A 1 6  ? 17.484  35.455  -14.700 1.00 0.00 ? 6   SER A HB2  14 
ATOM   8637  H  HB3  . SER A 1 6  ? 18.543  34.219  -14.021 1.00 0.00 ? 6   SER A HB3  14 
ATOM   8638  H  HG   . SER A 1 6  ? 18.887  33.778  -16.053 1.00 0.00 ? 6   SER A HG   14 
ATOM   8639  N  N    . GLY A 1 7  ? 15.906  31.422  -13.383 1.00 0.00 ? 7   GLY A N    14 
ATOM   8640  C  CA   . GLY A 1 7  ? 16.185  30.091  -12.877 1.00 0.00 ? 7   GLY A CA   14 
ATOM   8641  C  C    . GLY A 1 7  ? 17.313  29.410  -13.626 1.00 0.00 ? 7   GLY A C    14 
ATOM   8642  O  O    . GLY A 1 7  ? 17.550  29.697  -14.800 1.00 0.00 ? 7   GLY A O    14 
ATOM   8643  H  H    . GLY A 1 7  ? 14.994  31.659  -13.655 1.00 0.00 ? 7   GLY A H    14 
ATOM   8644  H  HA2  . GLY A 1 7  ? 16.451  30.163  -11.833 1.00 0.00 ? 7   GLY A HA2  14 
ATOM   8645  H  HA3  . GLY A 1 7  ? 15.293  29.488  -12.970 1.00 0.00 ? 7   GLY A HA3  14 
ATOM   8646  N  N    . CYS A 1 8  ? 18.013  28.508  -12.946 1.00 0.00 ? 8   CYS A N    14 
ATOM   8647  C  CA   . CYS A 1 8  ? 19.125  27.787  -13.554 1.00 0.00 ? 8   CYS A CA   14 
ATOM   8648  C  C    . CYS A 1 8  ? 18.639  26.511  -14.235 1.00 0.00 ? 8   CYS A C    14 
ATOM   8649  O  O    . CYS A 1 8  ? 18.662  25.432  -13.642 1.00 0.00 ? 8   CYS A O    14 
ATOM   8650  C  CB   . CYS A 1 8  ? 20.177  27.446  -12.498 1.00 0.00 ? 8   CYS A CB   14 
ATOM   8651  S  SG   . CYS A 1 8  ? 21.149  28.865  -11.940 1.00 0.00 ? 8   CYS A SG   14 
ATOM   8652  H  H    . CYS A 1 8  ? 17.776  28.323  -12.013 1.00 0.00 ? 8   CYS A H    14 
ATOM   8653  H  HA   . CYS A 1 8  ? 19.569  28.430  -14.298 1.00 0.00 ? 8   CYS A HA   14 
ATOM   8654  H  HB2  . CYS A 1 8  ? 19.686  27.026  -11.633 1.00 0.00 ? 8   CYS A HB2  14 
ATOM   8655  H  HB3  . CYS A 1 8  ? 20.862  26.717  -12.905 1.00 0.00 ? 8   CYS A HB3  14 
ATOM   8656  H  HG   . CYS A 1 8  ? 20.841  29.899  -12.708 1.00 0.00 ? 8   CYS A HG   14 
ATOM   8657  N  N    . CYS A 1 9  ? 18.198  26.643  -15.481 1.00 0.00 ? 9   CYS A N    14 
ATOM   8658  C  CA   . CYS A 1 9  ? 17.703  25.502  -16.242 1.00 0.00 ? 9   CYS A CA   14 
ATOM   8659  C  C    . CYS A 1 9  ? 18.833  24.527  -16.556 1.00 0.00 ? 9   CYS A C    14 
ATOM   8660  O  O    . CYS A 1 9  ? 20.011  24.861  -16.423 1.00 0.00 ? 9   CYS A O    14 
ATOM   8661  C  CB   . CYS A 1 9  ? 17.045  25.973  -17.539 1.00 0.00 ? 9   CYS A CB   14 
ATOM   8662  S  SG   . CYS A 1 9  ? 15.588  27.015  -17.291 1.00 0.00 ? 9   CYS A SG   14 
ATOM   8663  H  H    . CYS A 1 9  ? 18.204  27.530  -15.899 1.00 0.00 ? 9   CYS A H    14 
ATOM   8664  H  HA   . CYS A 1 9  ? 16.966  24.996  -15.637 1.00 0.00 ? 9   CYS A HA   14 
ATOM   8665  H  HB2  . CYS A 1 9  ? 17.762  26.544  -18.111 1.00 0.00 ? 9   CYS A HB2  14 
ATOM   8666  H  HB3  . CYS A 1 9  ? 16.741  25.111  -18.114 1.00 0.00 ? 9   CYS A HB3  14 
ATOM   8667  H  HG   . CYS A 1 9  ? 15.576  27.934  -18.245 1.00 0.00 ? 9   CYS A HG   14 
ATOM   8668  N  N    . LEU A 1 10 ? 18.468  23.319  -16.972 1.00 0.00 ? 10  LEU A N    14 
ATOM   8669  C  CA   . LEU A 1 10 ? 19.451  22.294  -17.304 1.00 0.00 ? 10  LEU A CA   14 
ATOM   8670  C  C    . LEU A 1 10 ? 18.891  21.314  -18.330 1.00 0.00 ? 10  LEU A C    14 
ATOM   8671  O  O    . LEU A 1 10 ? 17.699  21.005  -18.343 1.00 0.00 ? 10  LEU A O    14 
ATOM   8672  C  CB   . LEU A 1 10 ? 19.877  21.541  -16.042 1.00 0.00 ? 10  LEU A CB   14 
ATOM   8673  C  CG   . LEU A 1 10 ? 18.845  20.576  -15.456 1.00 0.00 ? 10  LEU A CG   14 
ATOM   8674  C  CD1  . LEU A 1 10 ? 19.491  19.670  -14.419 1.00 0.00 ? 10  LEU A CD1  14 
ATOM   8675  C  CD2  . LEU A 1 10 ? 17.683  21.345  -14.844 1.00 0.00 ? 10  LEU A CD2  14 
ATOM   8676  H  H    . LEU A 1 10 ? 17.514  23.111  -17.058 1.00 0.00 ? 10  LEU A H    14 
ATOM   8677  H  HA   . LEU A 1 10 ? 20.313  22.787  -17.727 1.00 0.00 ? 10  LEU A HA   14 
ATOM   8678  H  HB2  . LEU A 1 10 ? 20.763  20.973  -16.280 1.00 0.00 ? 10  LEU A HB2  14 
ATOM   8679  H  HB3  . LEU A 1 10 ? 20.114  22.274  -15.284 1.00 0.00 ? 10  LEU A HB3  14 
ATOM   8680  H  HG   . LEU A 1 10 ? 18.455  19.952  -16.247 1.00 0.00 ? 10  LEU A HG   14 
ATOM   8681  H  HD11 . LEU A 1 10 ? 19.709  18.712  -14.865 1.00 0.00 ? 10  LEU A HD11 14 
ATOM   8682  H  HD12 . LEU A 1 10 ? 18.815  19.535  -13.588 1.00 0.00 ? 10  LEU A HD12 14 
ATOM   8683  H  HD13 . LEU A 1 10 ? 20.408  20.121  -14.068 1.00 0.00 ? 10  LEU A HD13 14 
ATOM   8684  H  HD21 . LEU A 1 10 ? 16.762  21.044  -15.322 1.00 0.00 ? 10  LEU A HD21 14 
ATOM   8685  H  HD22 . LEU A 1 10 ? 17.836  22.405  -14.992 1.00 0.00 ? 10  LEU A HD22 14 
ATOM   8686  H  HD23 . LEU A 1 10 ? 17.627  21.133  -13.787 1.00 0.00 ? 10  LEU A HD23 14 
ATOM   8687  N  N    . PRO A 1 11 ? 19.769  20.812  -19.210 1.00 0.00 ? 11  PRO A N    14 
ATOM   8688  C  CA   . PRO A 1 11 ? 19.386  19.858  -20.254 1.00 0.00 ? 11  PRO A CA   14 
ATOM   8689  C  C    . PRO A 1 11 ? 19.025  18.490  -19.686 1.00 0.00 ? 11  PRO A C    14 
ATOM   8690  O  O    . PRO A 1 11 ? 19.588  18.038  -18.688 1.00 0.00 ? 11  PRO A O    14 
ATOM   8691  C  CB   . PRO A 1 11 ? 20.642  19.761  -21.125 1.00 0.00 ? 11  PRO A CB   14 
ATOM   8692  C  CG   . PRO A 1 11 ? 21.763  20.124  -20.213 1.00 0.00 ? 11  PRO A CG   14 
ATOM   8693  C  CD   . PRO A 1 11 ? 21.205  21.137  -19.253 1.00 0.00 ? 11  PRO A CD   14 
ATOM   8694  H  HA   . PRO A 1 11 ? 18.563  20.228  -20.848 1.00 0.00 ? 11  PRO A HA   14 
ATOM   8695  H  HB2  . PRO A 1 11 ? 20.746  18.752  -21.499 1.00 0.00 ? 11  PRO A HB2  14 
ATOM   8696  H  HB3  . PRO A 1 11 ? 20.566  20.452  -21.951 1.00 0.00 ? 11  PRO A HB3  14 
ATOM   8697  H  HG2  . PRO A 1 11 ? 22.101  19.248  -19.680 1.00 0.00 ? 11  PRO A HG2  14 
ATOM   8698  H  HG3  . PRO A 1 11 ? 22.574  20.554  -20.782 1.00 0.00 ? 11  PRO A HG3  14 
ATOM   8699  H  HD2  . PRO A 1 11 ? 21.656  21.022  -18.279 1.00 0.00 ? 11  PRO A HD2  14 
ATOM   8700  H  HD3  . PRO A 1 11 ? 21.362  22.138  -19.628 1.00 0.00 ? 11  PRO A HD3  14 
ATOM   8701  N  N    . PRO A 1 12 ? 18.066  17.813  -20.333 1.00 0.00 ? 12  PRO A N    14 
ATOM   8702  C  CA   . PRO A 1 12 ? 17.609  16.486  -19.910 1.00 0.00 ? 12  PRO A CA   14 
ATOM   8703  C  C    . PRO A 1 12 ? 18.663  15.409  -20.144 1.00 0.00 ? 12  PRO A C    14 
ATOM   8704  O  O    . PRO A 1 12 ? 18.424  14.228  -19.892 1.00 0.00 ? 12  PRO A O    14 
ATOM   8705  C  CB   . PRO A 1 12 ? 16.383  16.234  -20.791 1.00 0.00 ? 12  PRO A CB   14 
ATOM   8706  C  CG   . PRO A 1 12 ? 16.609  17.072  -22.002 1.00 0.00 ? 12  PRO A CG   14 
ATOM   8707  C  CD   . PRO A 1 12 ? 17.352  18.291  -21.530 1.00 0.00 ? 12  PRO A CD   14 
ATOM   8708  H  HA   . PRO A 1 12 ? 17.315  16.480  -18.871 1.00 0.00 ? 12  PRO A HA   14 
ATOM   8709  H  HB2  . PRO A 1 12 ? 16.326  15.184  -21.041 1.00 0.00 ? 12  PRO A HB2  14 
ATOM   8710  H  HB3  . PRO A 1 12 ? 15.490  16.534  -20.265 1.00 0.00 ? 12  PRO A HB3  14 
ATOM   8711  H  HG2  . PRO A 1 12 ? 17.201  16.527  -22.721 1.00 0.00 ? 12  PRO A HG2  14 
ATOM   8712  H  HG3  . PRO A 1 12 ? 15.660  17.356  -22.433 1.00 0.00 ? 12  PRO A HG3  14 
ATOM   8713  H  HD2  . PRO A 1 12 ? 18.047  18.625  -22.286 1.00 0.00 ? 12  PRO A HD2  14 
ATOM   8714  H  HD3  . PRO A 1 12 ? 16.660  19.080  -21.275 1.00 0.00 ? 12  PRO A HD3  14 
ATOM   8715  N  N    . ALA A 1 13 ? 19.830  15.824  -20.626 1.00 0.00 ? 13  ALA A N    14 
ATOM   8716  C  CA   . ALA A 1 13 ? 20.921  14.894  -20.891 1.00 0.00 ? 13  ALA A CA   14 
ATOM   8717  C  C    . ALA A 1 13 ? 20.929  13.754  -19.878 1.00 0.00 ? 13  ALA A C    14 
ATOM   8718  O  O    . ALA A 1 13 ? 20.788  12.586  -20.241 1.00 0.00 ? 13  ALA A O    14 
ATOM   8719  C  CB   . ALA A 1 13 ? 22.254  15.627  -20.875 1.00 0.00 ? 13  ALA A CB   14 
ATOM   8720  H  H    . ALA A 1 13 ? 19.960  16.778  -20.807 1.00 0.00 ? 13  ALA A H    14 
ATOM   8721  H  HA   . ALA A 1 13 ? 20.776  14.483  -21.880 1.00 0.00 ? 13  ALA A HA   14 
ATOM   8722  H  HB1  . ALA A 1 13 ? 22.257  16.385  -21.645 1.00 0.00 ? 13  ALA A HB1  14 
ATOM   8723  H  HB2  . ALA A 1 13 ? 22.398  16.092  -19.911 1.00 0.00 ? 13  ALA A HB2  14 
ATOM   8724  H  HB3  . ALA A 1 13 ? 23.053  14.924  -21.059 1.00 0.00 ? 13  ALA A HB3  14 
ATOM   8725  N  N    . THR A 1 14 ? 21.097  14.101  -18.606 1.00 0.00 ? 14  THR A N    14 
ATOM   8726  C  CA   . THR A 1 14 ? 21.126  13.107  -17.540 1.00 0.00 ? 14  THR A CA   14 
ATOM   8727  C  C    . THR A 1 14 ? 19.774  12.418  -17.394 1.00 0.00 ? 14  THR A C    14 
ATOM   8728  O  O    . THR A 1 14 ? 18.786  13.044  -17.007 1.00 0.00 ? 14  THR A O    14 
ATOM   8729  C  CB   . THR A 1 14 ? 21.516  13.740  -16.191 1.00 0.00 ? 14  THR A CB   14 
ATOM   8730  O  OG1  . THR A 1 14 ? 22.772  14.416  -16.313 1.00 0.00 ? 14  THR A OG1  14 
ATOM   8731  C  CG2  . THR A 1 14 ? 21.607  12.681  -15.103 1.00 0.00 ? 14  THR A CG2  14 
ATOM   8732  H  H    . THR A 1 14 ? 21.205  15.048  -18.380 1.00 0.00 ? 14  THR A H    14 
ATOM   8733  H  HA   . THR A 1 14 ? 21.870  12.366  -17.795 1.00 0.00 ? 14  THR A HA   14 
ATOM   8734  H  HB   . THR A 1 14 ? 20.755  14.456  -15.914 1.00 0.00 ? 14  THR A HB   14 
ATOM   8735  H  HG1  . THR A 1 14 ? 22.757  14.983  -17.088 1.00 0.00 ? 14  THR A HG1  14 
ATOM   8736  H  HG21 . THR A 1 14 ? 20.833  11.943  -15.253 1.00 0.00 ? 14  THR A HG21 14 
ATOM   8737  H  HG22 . THR A 1 14 ? 21.479  13.146  -14.137 1.00 0.00 ? 14  THR A HG22 14 
ATOM   8738  H  HG23 . THR A 1 14 ? 22.573  12.203  -15.147 1.00 0.00 ? 14  THR A HG23 14 
ATOM   8739  N  N    . HIS A 1 15 ? 19.736  11.126  -17.704 1.00 0.00 ? 15  HIS A N    14 
ATOM   8740  C  CA   . HIS A 1 15 ? 18.504  10.352  -17.606 1.00 0.00 ? 15  HIS A CA   14 
ATOM   8741  C  C    . HIS A 1 15 ? 17.777  10.652  -16.298 1.00 0.00 ? 15  HIS A C    14 
ATOM   8742  O  O    . HIS A 1 15 ? 18.237  10.274  -15.220 1.00 0.00 ? 15  HIS A O    14 
ATOM   8743  C  CB   . HIS A 1 15 ? 18.807  8.856   -17.703 1.00 0.00 ? 15  HIS A CB   14 
ATOM   8744  C  CG   . HIS A 1 15 ? 18.932  8.361   -19.111 1.00 0.00 ? 15  HIS A CG   14 
ATOM   8745  N  ND1  . HIS A 1 15 ? 18.045  7.470   -19.677 1.00 0.00 ? 15  HIS A ND1  14 
ATOM   8746  C  CD2  . HIS A 1 15 ? 19.847  8.638   -20.069 1.00 0.00 ? 15  HIS A CD2  14 
ATOM   8747  C  CE1  . HIS A 1 15 ? 18.410  7.220   -20.921 1.00 0.00 ? 15  HIS A CE1  14 
ATOM   8748  N  NE2  . HIS A 1 15 ? 19.501  7.916   -21.184 1.00 0.00 ? 15  HIS A NE2  14 
ATOM   8749  H  H    . HIS A 1 15 ? 20.556  10.683  -18.006 1.00 0.00 ? 15  HIS A H    14 
ATOM   8750  H  HA   . HIS A 1 15 ? 17.867  10.636  -18.430 1.00 0.00 ? 15  HIS A HA   14 
ATOM   8751  H  HB2  . HIS A 1 15 ? 19.738  8.651   -17.195 1.00 0.00 ? 15  HIS A HB2  14 
ATOM   8752  H  HB3  . HIS A 1 15 ? 18.012  8.303   -17.225 1.00 0.00 ? 15  HIS A HB3  14 
ATOM   8753  H  HD1  . HIS A 1 15 ? 17.265  7.079   -19.232 1.00 0.00 ? 15  HIS A HD1  14 
ATOM   8754  H  HD2  . HIS A 1 15 ? 20.694  9.303   -19.974 1.00 0.00 ? 15  HIS A HD2  14 
ATOM   8755  H  HE1  . HIS A 1 15 ? 17.903  6.558   -21.608 1.00 0.00 ? 15  HIS A HE1  14 
ATOM   8756  N  N    . ARG A 1 16 ? 16.641  11.334  -16.401 1.00 0.00 ? 16  ARG A N    14 
ATOM   8757  C  CA   . ARG A 1 16 ? 15.852  11.686  -15.227 1.00 0.00 ? 16  ARG A CA   14 
ATOM   8758  C  C    . ARG A 1 16 ? 14.946  10.529  -14.813 1.00 0.00 ? 16  ARG A C    14 
ATOM   8759  O  O    . ARG A 1 16 ? 14.339  9.856   -15.646 1.00 0.00 ? 16  ARG A O    14 
ATOM   8760  C  CB   . ARG A 1 16 ? 15.010  12.932  -15.507 1.00 0.00 ? 16  ARG A CB   14 
ATOM   8761  C  CG   . ARG A 1 16 ? 15.834  14.151  -15.888 1.00 0.00 ? 16  ARG A CG   14 
ATOM   8762  C  CD   . ARG A 1 16 ? 16.444  14.816  -14.664 1.00 0.00 ? 16  ARG A CD   14 
ATOM   8763  N  NE   . ARG A 1 16 ? 15.451  15.559  -13.892 1.00 0.00 ? 16  ARG A NE   14 
ATOM   8764  C  CZ   . ARG A 1 16 ? 15.755  16.558  -13.072 1.00 0.00 ? 16  ARG A CZ   14 
ATOM   8765  N  NH1  . ARG A 1 16 ? 17.017  16.933  -12.918 1.00 0.00 ? 16  ARG A NH1  14 
ATOM   8766  N  NH2  . ARG A 1 16 ? 14.795  17.186  -12.405 1.00 0.00 ? 16  ARG A NH2  14 
ATOM   8767  H  H    . ARG A 1 16 ? 16.326  11.607  -17.288 1.00 0.00 ? 16  ARG A H    14 
ATOM   8768  H  HA   . ARG A 1 16 ? 16.536  11.898  -14.419 1.00 0.00 ? 16  ARG A HA   14 
ATOM   8769  H  HB2  . ARG A 1 16 ? 14.329  12.718  -16.317 1.00 0.00 ? 16  ARG A HB2  14 
ATOM   8770  H  HB3  . ARG A 1 16 ? 14.440  13.172  -14.622 1.00 0.00 ? 16  ARG A HB3  14 
ATOM   8771  H  HG2  . ARG A 1 16 ? 16.630  13.843  -16.550 1.00 0.00 ? 16  ARG A HG2  14 
ATOM   8772  H  HG3  . ARG A 1 16 ? 15.197  14.861  -16.393 1.00 0.00 ? 16  ARG A HG3  14 
ATOM   8773  H  HD2  . ARG A 1 16 ? 16.878  14.053  -14.034 1.00 0.00 ? 16  ARG A HD2  14 
ATOM   8774  H  HD3  . ARG A 1 16 ? 17.217  15.497  -14.988 1.00 0.00 ? 16  ARG A HD3  14 
ATOM   8775  H  HE   . ARG A 1 16 ? 14.512  15.298  -13.991 1.00 0.00 ? 16  ARG A HE   14 
ATOM   8776  H  HH11 . ARG A 1 16 ? 17.742  16.463  -13.420 1.00 0.00 ? 16  ARG A HH11 14 
ATOM   8777  H  HH12 . ARG A 1 16 ? 17.243  17.687  -12.301 1.00 0.00 ? 16  ARG A HH12 14 
ATOM   8778  H  HH21 . ARG A 1 16 ? 13.842  16.906  -12.519 1.00 0.00 ? 16  ARG A HH21 14 
ATOM   8779  H  HH22 . ARG A 1 16 ? 15.025  17.938  -11.788 1.00 0.00 ? 16  ARG A HH22 14 
ATOM   8780  N  N    . PRO A 1 17 ? 14.853  10.292  -13.496 1.00 0.00 ? 17  PRO A N    14 
ATOM   8781  C  CA   . PRO A 1 17 ? 14.024  9.217   -12.943 1.00 0.00 ? 17  PRO A CA   14 
ATOM   8782  C  C    . PRO A 1 17 ? 12.533  9.497   -13.097 1.00 0.00 ? 17  PRO A C    14 
ATOM   8783  O  O    . PRO A 1 17 ? 12.136  10.436  -13.787 1.00 0.00 ? 17  PRO A O    14 
ATOM   8784  C  CB   . PRO A 1 17 ? 14.414  9.196   -11.462 1.00 0.00 ? 17  PRO A CB   14 
ATOM   8785  C  CG   . PRO A 1 17 ? 14.899  10.576  -11.179 1.00 0.00 ? 17  PRO A CG   14 
ATOM   8786  C  CD   . PRO A 1 17 ? 15.549  11.055  -12.447 1.00 0.00 ? 17  PRO A CD   14 
ATOM   8787  H  HA   . PRO A 1 17 ? 14.259  8.264   -13.392 1.00 0.00 ? 17  PRO A HA   14 
ATOM   8788  H  HB2  . PRO A 1 17 ? 13.548  8.950   -10.863 1.00 0.00 ? 17  PRO A HB2  14 
ATOM   8789  H  HB3  . PRO A 1 17 ? 15.190  8.464   -11.301 1.00 0.00 ? 17  PRO A HB3  14 
ATOM   8790  H  HG2  . PRO A 1 17 ? 14.067  11.212  -10.920 1.00 0.00 ? 17  PRO A HG2  14 
ATOM   8791  H  HG3  . PRO A 1 17 ? 15.620  10.552  -10.374 1.00 0.00 ? 17  PRO A HG3  14 
ATOM   8792  H  HD2  . PRO A 1 17 ? 15.393  12.116  -12.573 1.00 0.00 ? 17  PRO A HD2  14 
ATOM   8793  H  HD3  . PRO A 1 17 ? 16.605  10.825  -12.440 1.00 0.00 ? 17  PRO A HD3  14 
ATOM   8794  N  N    . HIS A 1 18 ? 11.712  8.676   -12.450 1.00 0.00 ? 18  HIS A N    14 
ATOM   8795  C  CA   . HIS A 1 18 ? 10.263  8.836   -12.515 1.00 0.00 ? 18  HIS A CA   14 
ATOM   8796  C  C    . HIS A 1 18 ? 9.719   9.390   -11.202 1.00 0.00 ? 18  HIS A C    14 
ATOM   8797  O  O    . HIS A 1 18 ? 10.158  9.019   -10.114 1.00 0.00 ? 18  HIS A O    14 
ATOM   8798  C  CB   . HIS A 1 18 ? 9.595   7.499   -12.834 1.00 0.00 ? 18  HIS A CB   14 
ATOM   8799  C  CG   . HIS A 1 18 ? 10.187  6.341   -12.091 1.00 0.00 ? 18  HIS A CG   14 
ATOM   8800  N  ND1  . HIS A 1 18 ? 9.942   6.099   -10.756 1.00 0.00 ? 18  HIS A ND1  14 
ATOM   8801  C  CD2  . HIS A 1 18 ? 11.016  5.354   -12.504 1.00 0.00 ? 18  HIS A CD2  14 
ATOM   8802  C  CE1  . HIS A 1 18 ? 10.596  5.015   -10.379 1.00 0.00 ? 18  HIS A CE1  14 
ATOM   8803  N  NE2  . HIS A 1 18 ? 11.255  4.543   -11.422 1.00 0.00 ? 18  HIS A NE2  14 
ATOM   8804  H  H    . HIS A 1 18 ? 12.089  7.946   -11.917 1.00 0.00 ? 18  HIS A H    14 
ATOM   8805  H  HA   . HIS A 1 18 ? 10.043  9.537   -13.306 1.00 0.00 ? 18  HIS A HA   14 
ATOM   8806  H  HB2  . HIS A 1 18 ? 8.548   7.557   -12.577 1.00 0.00 ? 18  HIS A HB2  14 
ATOM   8807  H  HB3  . HIS A 1 18 ? 9.690   7.299   -13.892 1.00 0.00 ? 18  HIS A HB3  14 
ATOM   8808  H  HD1  . HIS A 1 18 ? 9.374   6.643   -10.171 1.00 0.00 ? 18  HIS A HD1  14 
ATOM   8809  H  HD2  . HIS A 1 18 ? 11.416  5.228   -13.501 1.00 0.00 ? 18  HIS A HD2  14 
ATOM   8810  H  HE1  . HIS A 1 18 ? 10.592  4.586   -9.389  1.00 0.00 ? 18  HIS A HE1  14 
ATOM   8811  N  N    . PRO A 1 19 ? 8.739   10.301  -11.305 1.00 0.00 ? 19  PRO A N    14 
ATOM   8812  C  CA   . PRO A 1 19 ? 8.113   10.925  -10.135 1.00 0.00 ? 19  PRO A CA   14 
ATOM   8813  C  C    . PRO A 1 19 ? 7.254   9.945   -9.345  1.00 0.00 ? 19  PRO A C    14 
ATOM   8814  O  O    . PRO A 1 19 ? 6.901   10.200  -8.193  1.00 0.00 ? 19  PRO A O    14 
ATOM   8815  C  CB   . PRO A 1 19 ? 7.244   12.028  -10.745 1.00 0.00 ? 19  PRO A CB   14 
ATOM   8816  C  CG   . PRO A 1 19 ? 6.952   11.559  -12.128 1.00 0.00 ? 19  PRO A CG   14 
ATOM   8817  C  CD   . PRO A 1 19 ? 8.166   10.790  -12.570 1.00 0.00 ? 19  PRO A CD   14 
ATOM   8818  H  HA   . PRO A 1 19 ? 8.850   11.366  -9.480  1.00 0.00 ? 19  PRO A HA   14 
ATOM   8819  H  HB2  . PRO A 1 19 ? 6.339   12.139  -10.164 1.00 0.00 ? 19  PRO A HB2  14 
ATOM   8820  H  HB3  . PRO A 1 19 ? 7.790   12.960  -10.751 1.00 0.00 ? 19  PRO A HB3  14 
ATOM   8821  H  HG2  . PRO A 1 19 ? 6.083   10.918  -12.123 1.00 0.00 ? 19  PRO A HG2  14 
ATOM   8822  H  HG3  . PRO A 1 19 ? 6.789   12.407  -12.776 1.00 0.00 ? 19  PRO A HG3  14 
ATOM   8823  H  HD2  . PRO A 1 19 ? 7.880   9.967   -13.207 1.00 0.00 ? 19  PRO A HD2  14 
ATOM   8824  H  HD3  . PRO A 1 19 ? 8.860   11.441  -13.080 1.00 0.00 ? 19  PRO A HD3  14 
ATOM   8825  N  N    . THR A 1 20 ? 6.918   8.821   -9.971  1.00 0.00 ? 20  THR A N    14 
ATOM   8826  C  CA   . THR A 1 20 ? 6.099   7.803   -9.326  1.00 0.00 ? 20  THR A CA   14 
ATOM   8827  C  C    . THR A 1 20 ? 6.965   6.775   -8.607  1.00 0.00 ? 20  THR A C    14 
ATOM   8828  O  O    . THR A 1 20 ? 8.189   6.785   -8.731  1.00 0.00 ? 20  THR A O    14 
ATOM   8829  C  CB   . THR A 1 20 ? 5.200   7.077   -10.345 1.00 0.00 ? 20  THR A CB   14 
ATOM   8830  O  OG1  . THR A 1 20 ? 5.991   6.583   -11.431 1.00 0.00 ? 20  THR A OG1  14 
ATOM   8831  C  CG2  . THR A 1 20 ? 4.123   8.010   -10.878 1.00 0.00 ? 20  THR A CG2  14 
ATOM   8832  H  H    . THR A 1 20 ? 7.229   8.675   -10.888 1.00 0.00 ? 20  THR A H    14 
ATOM   8833  H  HA   . THR A 1 20 ? 5.464   8.294   -8.603  1.00 0.00 ? 20  THR A HA   14 
ATOM   8834  H  HB   . THR A 1 20 ? 4.721   6.244   -9.850  1.00 0.00 ? 20  THR A HB   14 
ATOM   8835  H  HG1  . THR A 1 20 ? 6.272   7.317   -11.983 1.00 0.00 ? 20  THR A HG1  14 
ATOM   8836  H  HG21 . THR A 1 20 ? 4.315   9.016   -10.532 1.00 0.00 ? 20  THR A HG21 14 
ATOM   8837  H  HG22 . THR A 1 20 ? 3.157   7.685   -10.522 1.00 0.00 ? 20  THR A HG22 14 
ATOM   8838  H  HG23 . THR A 1 20 ? 4.135   7.993   -11.957 1.00 0.00 ? 20  THR A HG23 14 
ATOM   8839  N  N    . SER A 1 21 ? 6.321   5.888   -7.855  1.00 0.00 ? 21  SER A N    14 
ATOM   8840  C  CA   . SER A 1 21 ? 7.033   4.854   -7.112  1.00 0.00 ? 21  SER A CA   14 
ATOM   8841  C  C    . SER A 1 21 ? 6.564   3.464   -7.531  1.00 0.00 ? 21  SER A C    14 
ATOM   8842  O  O    . SER A 1 21 ? 5.366   3.218   -7.673  1.00 0.00 ? 21  SER A O    14 
ATOM   8843  C  CB   . SER A 1 21 ? 6.827   5.043   -5.608  1.00 0.00 ? 21  SER A CB   14 
ATOM   8844  O  OG   . SER A 1 21 ? 7.506   6.196   -5.141  1.00 0.00 ? 21  SER A OG   14 
ATOM   8845  H  H    . SER A 1 21 ? 5.343   5.932   -7.795  1.00 0.00 ? 21  SER A H    14 
ATOM   8846  H  HA   . SER A 1 21 ? 8.085   4.950   -7.338  1.00 0.00 ? 21  SER A HA   14 
ATOM   8847  H  HB2  . SER A 1 21 ? 5.773   5.153   -5.403  1.00 0.00 ? 21  SER A HB2  14 
ATOM   8848  H  HB3  . SER A 1 21 ? 7.208   4.178   -5.084  1.00 0.00 ? 21  SER A HB3  14 
ATOM   8849  H  HG   . SER A 1 21 ? 7.219   6.962   -5.642  1.00 0.00 ? 21  SER A HG   14 
ATOM   8850  N  N    . ILE A 1 22 ? 7.518   2.559   -7.726  1.00 0.00 ? 22  ILE A N    14 
ATOM   8851  C  CA   . ILE A 1 22 ? 7.203   1.194   -8.127  1.00 0.00 ? 22  ILE A CA   14 
ATOM   8852  C  C    . ILE A 1 22 ? 6.566   0.417   -6.980  1.00 0.00 ? 22  ILE A C    14 
ATOM   8853  O  O    . ILE A 1 22 ? 6.975   0.545   -5.826  1.00 0.00 ? 22  ILE A O    14 
ATOM   8854  C  CB   . ILE A 1 22 ? 8.460   0.443   -8.605  1.00 0.00 ? 22  ILE A CB   14 
ATOM   8855  C  CG1  . ILE A 1 22 ? 8.980   1.052   -9.909  1.00 0.00 ? 22  ILE A CG1  14 
ATOM   8856  C  CG2  . ILE A 1 22 ? 8.157   -1.036  -8.788  1.00 0.00 ? 22  ILE A CG2  14 
ATOM   8857  C  CD1  . ILE A 1 22 ? 9.553   2.442   -9.741  1.00 0.00 ? 22  ILE A CD1  14 
ATOM   8858  H  H    . ILE A 1 22 ? 8.454   2.816   -7.597  1.00 0.00 ? 22  ILE A H    14 
ATOM   8859  H  HA   . ILE A 1 22 ? 6.503   1.241   -8.949  1.00 0.00 ? 22  ILE A HA   14 
ATOM   8860  H  HB   . ILE A 1 22 ? 9.220   0.539   -7.844  1.00 0.00 ? 22  ILE A HB   14 
ATOM   8861  H  HG12 . ILE A 1 22 ? 9.756   0.420   -10.310 1.00 0.00 ? 22  ILE A HG12 14 
ATOM   8862  H  HG13 . ILE A 1 22 ? 8.167   1.111   -10.619 1.00 0.00 ? 22  ILE A HG13 14 
ATOM   8863  H  HG21 . ILE A 1 22 ? 7.089   -1.192  -8.746  1.00 0.00 ? 22  ILE A HG21 14 
ATOM   8864  H  HG22 . ILE A 1 22 ? 8.530   -1.363  -9.747  1.00 0.00 ? 22  ILE A HG22 14 
ATOM   8865  H  HG23 . ILE A 1 22 ? 8.635   -1.602  -8.003  1.00 0.00 ? 22  ILE A HG23 14 
ATOM   8866  H  HD11 . ILE A 1 22 ? 10.118  2.490   -8.822  1.00 0.00 ? 22  ILE A HD11 14 
ATOM   8867  H  HD12 . ILE A 1 22 ? 10.199  2.668   -10.576 1.00 0.00 ? 22  ILE A HD12 14 
ATOM   8868  H  HD13 . ILE A 1 22 ? 8.747   3.161   -9.705  1.00 0.00 ? 22  ILE A HD13 14 
ATOM   8869  N  N    . CYS A 1 23 ? 5.563   -0.391  -7.306  1.00 0.00 ? 23  CYS A N    14 
ATOM   8870  C  CA   . CYS A 1 23 ? 4.869   -1.191  -6.304  1.00 0.00 ? 23  CYS A CA   14 
ATOM   8871  C  C    . CYS A 1 23 ? 5.813   -2.210  -5.672  1.00 0.00 ? 23  CYS A C    14 
ATOM   8872  O  O    . CYS A 1 23 ? 6.976   -2.319  -6.061  1.00 0.00 ? 23  CYS A O    14 
ATOM   8873  C  CB   . CYS A 1 23 ? 3.673   -1.910  -6.933  1.00 0.00 ? 23  CYS A CB   14 
ATOM   8874  S  SG   . CYS A 1 23 ? 2.325   -2.274  -5.764  1.00 0.00 ? 23  CYS A SG   14 
ATOM   8875  H  H    . CYS A 1 23 ? 5.281   -0.451  -8.244  1.00 0.00 ? 23  CYS A H    14 
ATOM   8876  H  HA   . CYS A 1 23 ? 4.512   -0.524  -5.535  1.00 0.00 ? 23  CYS A HA   14 
ATOM   8877  H  HB2  . CYS A 1 23 ? 3.266   -1.293  -7.721  1.00 0.00 ? 23  CYS A HB2  14 
ATOM   8878  H  HB3  . CYS A 1 23 ? 4.007   -2.847  -7.354  1.00 0.00 ? 23  CYS A HB3  14 
ATOM   8879  N  N    . ASP A 1 24 ? 5.304   -2.953  -4.695  1.00 0.00 ? 24  ASP A N    14 
ATOM   8880  C  CA   . ASP A 1 24 ? 6.101   -3.963  -4.009  1.00 0.00 ? 24  ASP A CA   14 
ATOM   8881  C  C    . ASP A 1 24 ? 5.698   -5.366  -4.452  1.00 0.00 ? 24  ASP A C    14 
ATOM   8882  O  O    . ASP A 1 24 ? 6.510   -6.290  -4.436  1.00 0.00 ? 24  ASP A O    14 
ATOM   8883  C  CB   . ASP A 1 24 ? 5.940   -3.828  -2.494  1.00 0.00 ? 24  ASP A CB   14 
ATOM   8884  C  CG   . ASP A 1 24 ? 7.069   -4.492  -1.730  1.00 0.00 ? 24  ASP A CG   14 
ATOM   8885  O  OD1  . ASP A 1 24 ? 7.724   -5.390  -2.300  1.00 0.00 ? 24  ASP A OD1  14 
ATOM   8886  O  OD2  . ASP A 1 24 ? 7.299   -4.113  -0.563  1.00 0.00 ? 24  ASP A OD2  14 
ATOM   8887  H  H    . ASP A 1 24 ? 4.370   -2.819  -4.429  1.00 0.00 ? 24  ASP A H    14 
ATOM   8888  H  HA   . ASP A 1 24 ? 7.136   -3.801  -4.267  1.00 0.00 ? 24  ASP A HA   14 
ATOM   8889  H  HB2  . ASP A 1 24 ? 5.921   -2.780  -2.232  1.00 0.00 ? 24  ASP A HB2  14 
ATOM   8890  H  HB3  . ASP A 1 24 ? 5.009   -4.287  -2.195  1.00 0.00 ? 24  ASP A HB3  14 
ATOM   8891  N  N    . ASN A 1 25 ? 4.438   -5.518  -4.847  1.00 0.00 ? 25  ASN A N    14 
ATOM   8892  C  CA   . ASN A 1 25 ? 3.927   -6.808  -5.294  1.00 0.00 ? 25  ASN A CA   14 
ATOM   8893  C  C    . ASN A 1 25 ? 4.244   -7.038  -6.768  1.00 0.00 ? 25  ASN A C    14 
ATOM   8894  O  O    . ASN A 1 25 ? 5.076   -7.879  -7.112  1.00 0.00 ? 25  ASN A O    14 
ATOM   8895  C  CB   . ASN A 1 25 ? 2.416   -6.888  -5.067  1.00 0.00 ? 25  ASN A CB   14 
ATOM   8896  C  CG   . ASN A 1 25 ? 2.063   -7.183  -3.622  1.00 0.00 ? 25  ASN A CG   14 
ATOM   8897  O  OD1  . ASN A 1 25 ? 2.850   -6.921  -2.713  1.00 0.00 ? 25  ASN A OD1  14 
ATOM   8898  N  ND2  . ASN A 1 25 ? 0.873   -7.731  -3.404  1.00 0.00 ? 25  ASN A ND2  14 
ATOM   8899  H  H    . ASN A 1 25 ? 3.838   -4.743  -4.838  1.00 0.00 ? 25  ASN A H    14 
ATOM   8900  H  HA   . ASN A 1 25 ? 4.410   -7.576  -4.709  1.00 0.00 ? 25  ASN A HA   14 
ATOM   8901  H  HB2  . ASN A 1 25 ? 1.967   -5.944  -5.342  1.00 0.00 ? 25  ASN A HB2  14 
ATOM   8902  H  HB3  . ASN A 1 25 ? 2.005   -7.671  -5.686  1.00 0.00 ? 25  ASN A HB3  14 
ATOM   8903  H  HD21 . ASN A 1 25 ? 0.297   -7.912  -4.177  1.00 0.00 ? 25  ASN A HD21 14 
ATOM   8904  H  HD22 . ASN A 1 25 ? 0.619   -7.931  -2.479  1.00 0.00 ? 25  ASN A HD22 14 
ATOM   8905  N  N    . PHE A 1 26 ? 3.576   -6.286  -7.636  1.00 0.00 ? 26  PHE A N    14 
ATOM   8906  C  CA   . PHE A 1 26 ? 3.785   -6.408  -9.074  1.00 0.00 ? 26  PHE A CA   14 
ATOM   8907  C  C    . PHE A 1 26 ? 5.265   -6.272  -9.421  1.00 0.00 ? 26  PHE A C    14 
ATOM   8908  O  O    . PHE A 1 26 ? 5.738   -6.844  -10.403 1.00 0.00 ? 26  PHE A O    14 
ATOM   8909  C  CB   . PHE A 1 26 ? 2.976   -5.346  -9.821  1.00 0.00 ? 26  PHE A CB   14 
ATOM   8910  C  CG   . PHE A 1 26 ? 2.537   -5.780  -11.190 1.00 0.00 ? 26  PHE A CG   14 
ATOM   8911  C  CD1  . PHE A 1 26 ? 3.451   -5.875  -12.227 1.00 0.00 ? 26  PHE A CD1  14 
ATOM   8912  C  CD2  . PHE A 1 26 ? 1.210   -6.093  -11.440 1.00 0.00 ? 26  PHE A CD2  14 
ATOM   8913  C  CE1  . PHE A 1 26 ? 3.049   -6.273  -13.488 1.00 0.00 ? 26  PHE A CE1  14 
ATOM   8914  C  CE2  . PHE A 1 26 ? 0.803   -6.492  -12.699 1.00 0.00 ? 26  PHE A CE2  14 
ATOM   8915  C  CZ   . PHE A 1 26 ? 1.724   -6.583  -13.724 1.00 0.00 ? 26  PHE A CZ   14 
ATOM   8916  H  H    . PHE A 1 26 ? 2.925   -5.633  -7.301  1.00 0.00 ? 26  PHE A H    14 
ATOM   8917  H  HA   . PHE A 1 26 ? 3.445   -7.386  -9.376  1.00 0.00 ? 26  PHE A HA   14 
ATOM   8918  H  HB2  . PHE A 1 26 ? 2.091   -5.110  -9.249  1.00 0.00 ? 26  PHE A HB2  14 
ATOM   8919  H  HB3  . PHE A 1 26 ? 3.577   -4.456  -9.930  1.00 0.00 ? 26  PHE A HB3  14 
ATOM   8920  H  HD1  . PHE A 1 26 ? 4.487   -5.634  -12.044 1.00 0.00 ? 26  PHE A HD1  14 
ATOM   8921  H  HD2  . PHE A 1 26 ? 0.489   -6.022  -10.638 1.00 0.00 ? 26  PHE A HD2  14 
ATOM   8922  H  HE1  . PHE A 1 26 ? 3.771   -6.344  -14.288 1.00 0.00 ? 26  PHE A HE1  14 
ATOM   8923  H  HE2  . PHE A 1 26 ? -0.234  -6.734  -12.880 1.00 0.00 ? 26  PHE A HE2  14 
ATOM   8924  H  HZ   . PHE A 1 26 ? 1.408   -6.894  -14.709 1.00 0.00 ? 26  PHE A HZ   14 
ATOM   8925  N  N    . SER A 1 27 ? 5.990   -5.511  -8.608  1.00 0.00 ? 27  SER A N    14 
ATOM   8926  C  CA   . SER A 1 27 ? 7.415   -5.296  -8.830  1.00 0.00 ? 27  SER A CA   14 
ATOM   8927  C  C    . SER A 1 27 ? 8.130   -6.618  -9.093  1.00 0.00 ? 27  SER A C    14 
ATOM   8928  O  O    . SER A 1 27 ? 8.658   -6.845  -10.181 1.00 0.00 ? 27  SER A O    14 
ATOM   8929  C  CB   . SER A 1 27 ? 8.042   -4.596  -7.623  1.00 0.00 ? 27  SER A CB   14 
ATOM   8930  O  OG   . SER A 1 27 ? 9.443   -4.802  -7.584  1.00 0.00 ? 27  SER A OG   14 
ATOM   8931  H  H    . SER A 1 27 ? 5.556   -5.082  -7.841  1.00 0.00 ? 27  SER A H    14 
ATOM   8932  H  HA   . SER A 1 27 ? 7.523   -4.663  -9.699  1.00 0.00 ? 27  SER A HA   14 
ATOM   8933  H  HB2  . SER A 1 27 ? 7.848   -3.536  -7.684  1.00 0.00 ? 27  SER A HB2  14 
ATOM   8934  H  HB3  . SER A 1 27 ? 7.606   -4.990  -6.716  1.00 0.00 ? 27  SER A HB3  14 
ATOM   8935  H  HG   . SER A 1 27 ? 9.893   -3.955  -7.621  1.00 0.00 ? 27  SER A HG   14 
ATOM   8936  N  N    . ALA A 1 28 ? 8.141   -7.487  -8.088  1.00 0.00 ? 28  ALA A N    14 
ATOM   8937  C  CA   . ALA A 1 28 ? 8.788   -8.787  -8.209  1.00 0.00 ? 28  ALA A CA   14 
ATOM   8938  C  C    . ALA A 1 28 ? 7.769   -9.882  -8.510  1.00 0.00 ? 28  ALA A C    14 
ATOM   8939  O  O    . ALA A 1 28 ? 7.881   -10.589 -9.511  1.00 0.00 ? 28  ALA A O    14 
ATOM   8940  C  CB   . ALA A 1 28 ? 9.558   -9.115  -6.938  1.00 0.00 ? 28  ALA A CB   14 
ATOM   8941  H  H    . ALA A 1 28 ? 7.702   -7.248  -7.245  1.00 0.00 ? 28  ALA A H    14 
ATOM   8942  H  HA   . ALA A 1 28 ? 9.495   -8.734  -9.025  1.00 0.00 ? 28  ALA A HA   14 
ATOM   8943  H  HB1  . ALA A 1 28 ? 9.173   -8.520  -6.122  1.00 0.00 ? 28  ALA A HB1  14 
ATOM   8944  H  HB2  . ALA A 1 28 ? 9.440   -10.163 -6.706  1.00 0.00 ? 28  ALA A HB2  14 
ATOM   8945  H  HB3  . ALA A 1 28 ? 10.604  -8.893  -7.084  1.00 0.00 ? 28  ALA A HB3  14 
ATOM   8946  N  N    . TYR A 1 29 ? 6.777   -10.015 -7.637  1.00 0.00 ? 29  TYR A N    14 
ATOM   8947  C  CA   . TYR A 1 29 ? 5.740   -11.026 -7.808  1.00 0.00 ? 29  TYR A CA   14 
ATOM   8948  C  C    . TYR A 1 29 ? 5.143   -10.962 -9.210  1.00 0.00 ? 29  TYR A C    14 
ATOM   8949  O  O    . TYR A 1 29 ? 5.079   -11.968 -9.916  1.00 0.00 ? 29  TYR A O    14 
ATOM   8950  C  CB   . TYR A 1 29 ? 4.638   -10.838 -6.763  1.00 0.00 ? 29  TYR A CB   14 
ATOM   8951  C  CG   . TYR A 1 29 ? 5.138   -10.902 -5.338  1.00 0.00 ? 29  TYR A CG   14 
ATOM   8952  C  CD1  . TYR A 1 29 ? 5.718   -9.793  -4.734  1.00 0.00 ? 29  TYR A CD1  14 
ATOM   8953  C  CD2  . TYR A 1 29 ? 5.030   -12.071 -4.595  1.00 0.00 ? 29  TYR A CD2  14 
ATOM   8954  C  CE1  . TYR A 1 29 ? 6.177   -9.848  -3.432  1.00 0.00 ? 29  TYR A CE1  14 
ATOM   8955  C  CE2  . TYR A 1 29 ? 5.484   -12.134 -3.292  1.00 0.00 ? 29  TYR A CE2  14 
ATOM   8956  C  CZ   . TYR A 1 29 ? 6.057   -11.020 -2.715  1.00 0.00 ? 29  TYR A CZ   14 
ATOM   8957  O  OH   . TYR A 1 29 ? 6.512   -11.077 -1.417  1.00 0.00 ? 29  TYR A OH   14 
ATOM   8958  H  H    . TYR A 1 29 ? 6.742   -9.422  -6.858  1.00 0.00 ? 29  TYR A H    14 
ATOM   8959  H  HA   . TYR A 1 29 ? 6.195   -11.996 -7.666  1.00 0.00 ? 29  TYR A HA   14 
ATOM   8960  H  HB2  . TYR A 1 29 ? 4.175   -9.875  -6.909  1.00 0.00 ? 29  TYR A HB2  14 
ATOM   8961  H  HB3  . TYR A 1 29 ? 3.896   -11.613 -6.890  1.00 0.00 ? 29  TYR A HB3  14 
ATOM   8962  H  HD1  . TYR A 1 29 ? 5.810   -8.877  -5.298  1.00 0.00 ? 29  TYR A HD1  14 
ATOM   8963  H  HD2  . TYR A 1 29 ? 4.580   -12.942 -5.049  1.00 0.00 ? 29  TYR A HD2  14 
ATOM   8964  H  HE1  . TYR A 1 29 ? 6.625   -8.975  -2.980  1.00 0.00 ? 29  TYR A HE1  14 
ATOM   8965  H  HE2  . TYR A 1 29 ? 5.391   -13.052 -2.730  1.00 0.00 ? 29  TYR A HE2  14 
ATOM   8966  H  HH   . TYR A 1 29 ? 6.967   -10.260 -1.201  1.00 0.00 ? 29  TYR A HH   14 
ATOM   8967  N  N    . GLY A 1 30 ? 4.707   -9.771  -9.607  1.00 0.00 ? 30  GLY A N    14 
ATOM   8968  C  CA   . GLY A 1 30 ? 4.121   -9.596  -10.923 1.00 0.00 ? 30  GLY A CA   14 
ATOM   8969  C  C    . GLY A 1 30 ? 2.652   -9.226  -10.860 1.00 0.00 ? 30  GLY A C    14 
ATOM   8970  O  O    . GLY A 1 30 ? 2.138   -8.545  -11.747 1.00 0.00 ? 30  GLY A O    14 
ATOM   8971  H  H    . GLY A 1 30 ? 4.784   -9.004  -9.001  1.00 0.00 ? 30  GLY A H    14 
ATOM   8972  H  HA2  . GLY A 1 30 ? 4.656   -8.815  -11.443 1.00 0.00 ? 30  GLY A HA2  14 
ATOM   8973  H  HA3  . GLY A 1 30 ? 4.224   -10.518 -11.476 1.00 0.00 ? 30  GLY A HA3  14 
ATOM   8974  N  N    . TRP A 1 31 ? 1.976   -9.676  -9.809  1.00 0.00 ? 31  TRP A N    14 
ATOM   8975  C  CA   . TRP A 1 31 ? 0.556   -9.390  -9.635  1.00 0.00 ? 31  TRP A CA   14 
ATOM   8976  C  C    . TRP A 1 31 ? 0.341   -8.359  -8.533  1.00 0.00 ? 31  TRP A C    14 
ATOM   8977  O  O    . TRP A 1 31 ? 1.199   -8.168  -7.670  1.00 0.00 ? 31  TRP A O    14 
ATOM   8978  C  CB   . TRP A 1 31 ? -0.207  -10.673 -9.306  1.00 0.00 ? 31  TRP A CB   14 
ATOM   8979  C  CG   . TRP A 1 31 ? -0.320  -10.937 -7.834  1.00 0.00 ? 31  TRP A CG   14 
ATOM   8980  C  CD1  . TRP A 1 31 ? 0.613   -11.531 -7.034  1.00 0.00 ? 31  TRP A CD1  14 
ATOM   8981  C  CD2  . TRP A 1 31 ? -1.431  -10.616 -6.990  1.00 0.00 ? 31  TRP A CD2  14 
ATOM   8982  N  NE1  . TRP A 1 31 ? 0.149   -11.599 -5.742  1.00 0.00 ? 31  TRP A NE1  14 
ATOM   8983  C  CE2  . TRP A 1 31 ? -1.102  -11.044 -5.688  1.00 0.00 ? 31  TRP A CE2  14 
ATOM   8984  C  CE3  . TRP A 1 31 ? -2.670  -10.008 -7.205  1.00 0.00 ? 31  TRP A CE3  14 
ATOM   8985  C  CZ2  . TRP A 1 31 ? -1.968  -10.883 -4.611  1.00 0.00 ? 31  TRP A CZ2  14 
ATOM   8986  C  CZ3  . TRP A 1 31 ? -3.529  -9.849  -6.134  1.00 0.00 ? 31  TRP A CZ3  14 
ATOM   8987  C  CH2  . TRP A 1 31 ? -3.175  -10.284 -4.850  1.00 0.00 ? 31  TRP A CH2  14 
ATOM   8988  H  H    . TRP A 1 31 ? 2.442   -10.214 -9.135  1.00 0.00 ? 31  TRP A H    14 
ATOM   8989  H  HA   . TRP A 1 31 ? 0.183   -8.988  -10.565 1.00 0.00 ? 31  TRP A HA   14 
ATOM   8990  H  HB2  . TRP A 1 31 ? -1.206  -10.605 -9.710  1.00 0.00 ? 31  TRP A HB2  14 
ATOM   8991  H  HB3  . TRP A 1 31 ? 0.303   -11.512 -9.757  1.00 0.00 ? 31  TRP A HB3  14 
ATOM   8992  H  HD1  . TRP A 1 31 ? 1.570   -11.891 -7.380  1.00 0.00 ? 31  TRP A HD1  14 
ATOM   8993  H  HE1  . TRP A 1 31 ? 0.637   -11.982 -4.983  1.00 0.00 ? 31  TRP A HE1  14 
ATOM   8994  H  HE3  . TRP A 1 31 ? -2.962  -9.666  -8.187  1.00 0.00 ? 31  TRP A HE3  14 
ATOM   8995  H  HZ2  . TRP A 1 31 ? -1.709  -11.212 -3.615  1.00 0.00 ? 31  TRP A HZ2  14 
ATOM   8996  H  HZ3  . TRP A 1 31 ? -4.492  -9.381  -6.282  1.00 0.00 ? 31  TRP A HZ3  14 
ATOM   8997  H  HH2  . TRP A 1 31 ? -3.877  -10.140 -4.044  1.00 0.00 ? 31  TRP A HH2  14 
ATOM   8998  N  N    . CYS A 1 32 ? -0.810  -7.695  -8.566  1.00 0.00 ? 32  CYS A N    14 
ATOM   8999  C  CA   . CYS A 1 32 ? -1.139  -6.682  -7.570  1.00 0.00 ? 32  CYS A CA   14 
ATOM   9000  C  C    . CYS A 1 32 ? -2.636  -6.672  -7.278  1.00 0.00 ? 32  CYS A C    14 
ATOM   9001  O  O    . CYS A 1 32 ? -3.471  -6.722  -8.183  1.00 0.00 ? 32  CYS A O    14 
ATOM   9002  C  CB   . CYS A 1 32 ? -0.692  -5.300  -8.050  1.00 0.00 ? 32  CYS A CB   14 
ATOM   9003  S  SG   . CYS A 1 32 ? -0.964  -3.968  -6.838  1.00 0.00 ? 32  CYS A SG   14 
ATOM   9004  H  H    . CYS A 1 32 ? -1.455  -7.891  -9.279  1.00 0.00 ? 32  CYS A H    14 
ATOM   9005  H  HA   . CYS A 1 32 ? -0.610  -6.926  -6.661  1.00 0.00 ? 32  CYS A HA   14 
ATOM   9006  H  HB2  . CYS A 1 32 ? 0.365   -5.329  -8.274  1.00 0.00 ? 32  CYS A HB2  14 
ATOM   9007  H  HB3  . CYS A 1 32 ? -1.237  -5.046  -8.947  1.00 0.00 ? 32  CYS A HB3  14 
ATOM   9008  N  N    . PRO A 1 33 ? -2.987  -6.605  -5.985  1.00 0.00 ? 33  PRO A N    14 
ATOM   9009  C  CA   . PRO A 1 33 ? -4.385  -6.586  -5.544  1.00 0.00 ? 33  PRO A CA   14 
ATOM   9010  C  C    . PRO A 1 33 ? -5.088  -5.281  -5.904  1.00 0.00 ? 33  PRO A C    14 
ATOM   9011  O  O    . PRO A 1 33 ? -6.284  -5.120  -5.656  1.00 0.00 ? 33  PRO A O    14 
ATOM   9012  C  CB   . PRO A 1 33 ? -4.280  -6.735  -4.025  1.00 0.00 ? 33  PRO A CB   14 
ATOM   9013  C  CG   . PRO A 1 33 ? -2.929  -6.206  -3.685  1.00 0.00 ? 33  PRO A CG   14 
ATOM   9014  C  CD   . PRO A 1 33 ? -2.046  -6.543  -4.855  1.00 0.00 ? 33  PRO A CD   14 
ATOM   9015  H  HA   . PRO A 1 33 ? -4.941  -7.417  -5.952  1.00 0.00 ? 33  PRO A HA   14 
ATOM   9016  H  HB2  . PRO A 1 33 ? -5.061  -6.160  -3.549  1.00 0.00 ? 33  PRO A HB2  14 
ATOM   9017  H  HB3  . PRO A 1 33 ? -4.375  -7.776  -3.754  1.00 0.00 ? 33  PRO A HB3  14 
ATOM   9018  H  HG2  . PRO A 1 33 ? -2.977  -5.137  -3.547  1.00 0.00 ? 33  PRO A HG2  14 
ATOM   9019  H  HG3  . PRO A 1 33 ? -2.562  -6.685  -2.789  1.00 0.00 ? 33  PRO A HG3  14 
ATOM   9020  H  HD2  . PRO A 1 33 ? -1.310  -5.767  -5.008  1.00 0.00 ? 33  PRO A HD2  14 
ATOM   9021  H  HD3  . PRO A 1 33 ? -1.565  -7.497  -4.702  1.00 0.00 ? 33  PRO A HD3  14 
ATOM   9022  N  N    . LEU A 1 34 ? -4.340  -4.353  -6.490  1.00 0.00 ? 34  LEU A N    14 
ATOM   9023  C  CA   . LEU A 1 34 ? -4.892  -3.062  -6.884  1.00 0.00 ? 34  LEU A CA   14 
ATOM   9024  C  C    . LEU A 1 34 ? -4.974  -2.946  -8.403  1.00 0.00 ? 34  LEU A C    14 
ATOM   9025  O  O    . LEU A 1 34 ? -5.761  -2.164  -8.934  1.00 0.00 ? 34  LEU A O    14 
ATOM   9026  C  CB   . LEU A 1 34 ? -4.037  -1.926  -6.320  1.00 0.00 ? 34  LEU A CB   14 
ATOM   9027  C  CG   . LEU A 1 34 ? -4.183  -1.656  -4.822  1.00 0.00 ? 34  LEU A CG   14 
ATOM   9028  C  CD1  . LEU A 1 34 ? -3.212  -0.573  -4.378  1.00 0.00 ? 34  LEU A CD1  14 
ATOM   9029  C  CD2  . LEU A 1 34 ? -5.614  -1.262  -4.488  1.00 0.00 ? 34  LEU A CD2  14 
ATOM   9030  H  H    . LEU A 1 34 ? -3.394  -4.539  -6.661  1.00 0.00 ? 34  LEU A H    14 
ATOM   9031  H  HA   . LEU A 1 34 ? -5.889  -2.989  -6.475  1.00 0.00 ? 34  LEU A HA   14 
ATOM   9032  H  HB2  . LEU A 1 34 ? -3.003  -2.163  -6.515  1.00 0.00 ? 34  LEU A HB2  14 
ATOM   9033  H  HB3  . LEU A 1 34 ? -4.302  -1.020  -6.848  1.00 0.00 ? 34  LEU A HB3  14 
ATOM   9034  H  HG   . LEU A 1 34 ? -3.947  -2.559  -4.276  1.00 0.00 ? 34  LEU A HG   14 
ATOM   9035  H  HD11 . LEU A 1 34 ? -2.228  -0.791  -4.766  1.00 0.00 ? 34  LEU A HD11 14 
ATOM   9036  H  HD12 . LEU A 1 34 ? -3.175  -0.543  -3.299  1.00 0.00 ? 34  LEU A HD12 14 
ATOM   9037  H  HD13 . LEU A 1 34 ? -3.544  0.384   -4.753  1.00 0.00 ? 34  LEU A HD13 14 
ATOM   9038  H  HD21 . LEU A 1 34 ? -6.043  -0.724  -5.321  1.00 0.00 ? 34  LEU A HD21 14 
ATOM   9039  H  HD22 . LEU A 1 34 ? -5.617  -0.630  -3.611  1.00 0.00 ? 34  LEU A HD22 14 
ATOM   9040  H  HD23 . LEU A 1 34 ? -6.196  -2.150  -4.294  1.00 0.00 ? 34  LEU A HD23 14 
ATOM   9041  N  N    . GLY A 1 35 ? -4.157  -3.733  -9.097  1.00 0.00 ? 35  GLY A N    14 
ATOM   9042  C  CA   . GLY A 1 35 ? -4.155  -3.705  -10.548 1.00 0.00 ? 35  GLY A CA   14 
ATOM   9043  C  C    . GLY A 1 35 ? -3.632  -2.394  -11.101 1.00 0.00 ? 35  GLY A C    14 
ATOM   9044  O  O    . GLY A 1 35 ? -2.663  -1.826  -10.599 1.00 0.00 ? 35  GLY A O    14 
ATOM   9045  H  H    . GLY A 1 35 ? -3.551  -4.337  -8.619  1.00 0.00 ? 35  GLY A H    14 
ATOM   9046  H  HA2  . GLY A 1 35 ? -3.535  -4.510  -10.911 1.00 0.00 ? 35  GLY A HA2  14 
ATOM   9047  H  HA3  . GLY A 1 35 ? -5.165  -3.854  -10.901 1.00 0.00 ? 35  GLY A HA3  14 
ATOM   9048  N  N    . PRO A 1 36 ? -4.282  -1.895  -12.163 1.00 0.00 ? 36  PRO A N    14 
ATOM   9049  C  CA   . PRO A 1 36 ? -3.893  -0.638  -12.810 1.00 0.00 ? 36  PRO A CA   14 
ATOM   9050  C  C    . PRO A 1 36 ? -4.185  0.577   -11.937 1.00 0.00 ? 36  PRO A C    14 
ATOM   9051  O  O    . PRO A 1 36 ? -3.422  1.543   -11.926 1.00 0.00 ? 36  PRO A O    14 
ATOM   9052  C  CB   . PRO A 1 36 ? -4.756  -0.608  -14.074 1.00 0.00 ? 36  PRO A CB   14 
ATOM   9053  C  CG   . PRO A 1 36 ? -5.942  -1.445  -13.743 1.00 0.00 ? 36  PRO A CG   14 
ATOM   9054  C  CD   . PRO A 1 36 ? -5.446  -2.519  -12.815 1.00 0.00 ? 36  PRO A CD   14 
ATOM   9055  H  HA   . PRO A 1 36 ? -2.849  -0.639  -13.085 1.00 0.00 ? 36  PRO A HA   14 
ATOM   9056  H  HB2  . PRO A 1 36 ? -5.039  0.412   -14.295 1.00 0.00 ? 36  PRO A HB2  14 
ATOM   9057  H  HB3  . PRO A 1 36 ? -4.200  -1.020  -14.903 1.00 0.00 ? 36  PRO A HB3  14 
ATOM   9058  H  HG2  . PRO A 1 36 ? -6.692  -0.843  -13.253 1.00 0.00 ? 36  PRO A HG2  14 
ATOM   9059  H  HG3  . PRO A 1 36 ? -6.343  -1.886  -14.644 1.00 0.00 ? 36  PRO A HG3  14 
ATOM   9060  H  HD2  . PRO A 1 36 ? -6.205  -2.771  -12.089 1.00 0.00 ? 36  PRO A HD2  14 
ATOM   9061  H  HD3  . PRO A 1 36 ? -5.150  -3.394  -13.374 1.00 0.00 ? 36  PRO A HD3  14 
ATOM   9062  N  N    . GLN A 1 37 ? -5.294  0.522   -11.206 1.00 0.00 ? 37  GLN A N    14 
ATOM   9063  C  CA   . GLN A 1 37 ? -5.686  1.620   -10.330 1.00 0.00 ? 37  GLN A CA   14 
ATOM   9064  C  C    . GLN A 1 37 ? -4.614  1.887   -9.278  1.00 0.00 ? 37  GLN A C    14 
ATOM   9065  O  O    . GLN A 1 37 ? -4.494  3.001   -8.768  1.00 0.00 ? 37  GLN A O    14 
ATOM   9066  C  CB   . GLN A 1 37 ? -7.019  1.305   -9.648  1.00 0.00 ? 37  GLN A CB   14 
ATOM   9067  C  CG   . GLN A 1 37 ? -8.233  1.716   -10.466 1.00 0.00 ? 37  GLN A CG   14 
ATOM   9068  C  CD   . GLN A 1 37 ? -9.489  1.836   -9.625  1.00 0.00 ? 37  GLN A CD   14 
ATOM   9069  O  OE1  . GLN A 1 37 ? -9.844  2.925   -9.171  1.00 0.00 ? 37  GLN A OE1  14 
ATOM   9070  N  NE2  . GLN A 1 37 ? -10.170 0.716   -9.414  1.00 0.00 ? 37  GLN A NE2  14 
ATOM   9071  H  H    . GLN A 1 37 ? -5.862  -0.274  -11.258 1.00 0.00 ? 37  GLN A H    14 
ATOM   9072  H  HA   . GLN A 1 37 ? -5.804  2.504   -10.938 1.00 0.00 ? 37  GLN A HA   14 
ATOM   9073  H  HB2  . GLN A 1 37 ? -7.075  0.242   -9.468  1.00 0.00 ? 37  GLN A HB2  14 
ATOM   9074  H  HB3  . GLN A 1 37 ? -7.057  1.825   -8.702  1.00 0.00 ? 37  GLN A HB3  14 
ATOM   9075  H  HG2  . GLN A 1 37 ? -8.034  2.672   -10.926 1.00 0.00 ? 37  GLN A HG2  14 
ATOM   9076  H  HG3  . GLN A 1 37 ? -8.400  0.976   -11.234 1.00 0.00 ? 37  GLN A HG3  14 
ATOM   9077  H  HE21 . GLN A 1 37 ? -9.827  -0.114  -9.807  1.00 0.00 ? 37  GLN A HE21 14 
ATOM   9078  H  HE22 . GLN A 1 37 ? -10.985 0.765   -8.874  1.00 0.00 ? 37  GLN A HE22 14 
ATOM   9079  N  N    . CYS A 1 38 ? -3.837  0.857   -8.958  1.00 0.00 ? 38  CYS A N    14 
ATOM   9080  C  CA   . CYS A 1 38 ? -2.775  0.980   -7.967  1.00 0.00 ? 38  CYS A CA   14 
ATOM   9081  C  C    . CYS A 1 38 ? -2.046  2.312   -8.113  1.00 0.00 ? 38  CYS A C    14 
ATOM   9082  O  O    . CYS A 1 38 ? -1.676  2.730   -9.210  1.00 0.00 ? 38  CYS A O    14 
ATOM   9083  C  CB   . CYS A 1 38 ? -1.782  -0.176  -8.108  1.00 0.00 ? 38  CYS A CB   14 
ATOM   9084  S  SG   . CYS A 1 38 ? -0.512  -0.228  -6.803  1.00 0.00 ? 38  CYS A SG   14 
ATOM   9085  H  H    . CYS A 1 38 ? -3.982  -0.006  -9.400  1.00 0.00 ? 38  CYS A H    14 
ATOM   9086  H  HA   . CYS A 1 38 ? -3.228  0.936   -6.989  1.00 0.00 ? 38  CYS A HA   14 
ATOM   9087  H  HB2  . CYS A 1 38 ? -2.322  -1.111  -8.077  1.00 0.00 ? 38  CYS A HB2  14 
ATOM   9088  H  HB3  . CYS A 1 38 ? -1.275  -0.091  -9.058  1.00 0.00 ? 38  CYS A HB3  14 
ATOM   9089  N  N    . PRO A 1 39 ? -1.833  2.997   -6.979  1.00 0.00 ? 39  PRO A N    14 
ATOM   9090  C  CA   . PRO A 1 39 ? -1.146  4.291   -6.953  1.00 0.00 ? 39  PRO A CA   14 
ATOM   9091  C  C    . PRO A 1 39 ? 0.340   4.166   -7.271  1.00 0.00 ? 39  PRO A C    14 
ATOM   9092  O  O    . PRO A 1 39 ? 1.016   5.163   -7.520  1.00 0.00 ? 39  PRO A O    14 
ATOM   9093  C  CB   . PRO A 1 39 ? -1.346  4.770   -5.513  1.00 0.00 ? 39  PRO A CB   14 
ATOM   9094  C  CG   . PRO A 1 39 ? -1.540  3.523   -4.722  1.00 0.00 ? 39  PRO A CG   14 
ATOM   9095  C  CD   . PRO A 1 39 ? -2.247  2.559   -5.635  1.00 0.00 ? 39  PRO A CD   14 
ATOM   9096  H  HA   . PRO A 1 39 ? -1.601  4.996   -7.635  1.00 0.00 ? 39  PRO A HA   14 
ATOM   9097  H  HB2  . PRO A 1 39 ? -0.471  5.314   -5.187  1.00 0.00 ? 39  PRO A HB2  14 
ATOM   9098  H  HB3  . PRO A 1 39 ? -2.215  5.410   -5.460  1.00 0.00 ? 39  PRO A HB3  14 
ATOM   9099  H  HG2  . PRO A 1 39 ? -0.582  3.124   -4.425  1.00 0.00 ? 39  PRO A HG2  14 
ATOM   9100  H  HG3  . PRO A 1 39 ? -2.147  3.730   -3.853  1.00 0.00 ? 39  PRO A HG3  14 
ATOM   9101  H  HD2  . PRO A 1 39 ? -1.922  1.548   -5.441  1.00 0.00 ? 39  PRO A HD2  14 
ATOM   9102  H  HD3  . PRO A 1 39 ? -3.317  2.643   -5.516  1.00 0.00 ? 39  PRO A HD3  14 
ATOM   9103  N  N    . GLN A 1 40 ? 0.840   2.935   -7.261  1.00 0.00 ? 40  GLN A N    14 
ATOM   9104  C  CA   . GLN A 1 40 ? 2.247   2.680   -7.548  1.00 0.00 ? 40  GLN A CA   14 
ATOM   9105  C  C    . GLN A 1 40 ? 2.425   2.152   -8.968  1.00 0.00 ? 40  GLN A C    14 
ATOM   9106  O  O    . GLN A 1 40 ? 1.532   1.509   -9.519  1.00 0.00 ? 40  GLN A O    14 
ATOM   9107  C  CB   . GLN A 1 40 ? 2.821   1.680   -6.544  1.00 0.00 ? 40  GLN A CB   14 
ATOM   9108  C  CG   . GLN A 1 40 ? 2.955   2.239   -5.137  1.00 0.00 ? 40  GLN A CG   14 
ATOM   9109  C  CD   . GLN A 1 40 ? 3.201   1.160   -4.101  1.00 0.00 ? 40  GLN A CD   14 
ATOM   9110  O  OE1  . GLN A 1 40 ? 2.271   0.487   -3.656  1.00 0.00 ? 40  GLN A OE1  14 
ATOM   9111  N  NE2  . GLN A 1 40 ? 4.459   0.989   -3.711  1.00 0.00 ? 40  GLN A NE2  14 
ATOM   9112  H  H    . GLN A 1 40 ? 0.250   2.180   -7.055  1.00 0.00 ? 40  GLN A H    14 
ATOM   9113  H  HA   . GLN A 1 40 ? 2.778   3.615   -7.456  1.00 0.00 ? 40  GLN A HA   14 
ATOM   9114  H  HB2  . GLN A 1 40 ? 2.176   0.815   -6.505  1.00 0.00 ? 40  GLN A HB2  14 
ATOM   9115  H  HB3  . GLN A 1 40 ? 3.801   1.373   -6.880  1.00 0.00 ? 40  GLN A HB3  14 
ATOM   9116  H  HG2  . GLN A 1 40 ? 3.783   2.932   -5.116  1.00 0.00 ? 40  GLN A HG2  14 
ATOM   9117  H  HG3  . GLN A 1 40 ? 2.044   2.760   -4.883  1.00 0.00 ? 40  GLN A HG3  14 
ATOM   9118  H  HE21 . GLN A 1 40 ? 5.148   1.563   -4.108  1.00 0.00 ? 40  GLN A HE21 14 
ATOM   9119  H  HE22 . GLN A 1 40 ? 4.646   0.299   -3.042  1.00 0.00 ? 40  GLN A HE22 14 
ATOM   9120  N  N    . SER A 1 41 ? 3.585   2.430   -9.556  1.00 0.00 ? 41  SER A N    14 
ATOM   9121  C  CA   . SER A 1 41 ? 3.879   1.987   -10.914 1.00 0.00 ? 41  SER A CA   14 
ATOM   9122  C  C    . SER A 1 41 ? 4.272   0.513   -10.931 1.00 0.00 ? 41  SER A C    14 
ATOM   9123  O  O    . SER A 1 41 ? 4.865   0.005   -9.979  1.00 0.00 ? 41  SER A O    14 
ATOM   9124  C  CB   . SER A 1 41 ? 5.002   2.833   -11.517 1.00 0.00 ? 41  SER A CB   14 
ATOM   9125  O  OG   . SER A 1 41 ? 4.864   2.936   -12.923 1.00 0.00 ? 41  SER A OG   14 
ATOM   9126  H  H    . SER A 1 41 ? 4.257   2.948   -9.065  1.00 0.00 ? 41  SER A H    14 
ATOM   9127  H  HA   . SER A 1 41 ? 2.985   2.116   -11.506 1.00 0.00 ? 41  SER A HA   14 
ATOM   9128  H  HB2  . SER A 1 41 ? 4.971   3.824   -11.091 1.00 0.00 ? 41  SER A HB2  14 
ATOM   9129  H  HB3  . SER A 1 41 ? 5.954   2.374   -11.293 1.00 0.00 ? 41  SER A HB3  14 
ATOM   9130  H  HG   . SER A 1 41 ? 4.374   2.179   -13.253 1.00 0.00 ? 41  SER A HG   14 
ATOM   9131  N  N    . HIS A 1 42 ? 3.936   -0.170  -12.021 1.00 0.00 ? 42  HIS A N    14 
ATOM   9132  C  CA   . HIS A 1 42 ? 4.253   -1.586  -12.164 1.00 0.00 ? 42  HIS A CA   14 
ATOM   9133  C  C    . HIS A 1 42 ? 5.211   -1.813  -13.330 1.00 0.00 ? 42  HIS A C    14 
ATOM   9134  O  O    . HIS A 1 42 ? 4.916   -2.579  -14.248 1.00 0.00 ? 42  HIS A O    14 
ATOM   9135  C  CB   . HIS A 1 42 ? 2.975   -2.398  -12.374 1.00 0.00 ? 42  HIS A CB   14 
ATOM   9136  C  CG   . HIS A 1 42 ? 2.097   -2.457  -11.162 1.00 0.00 ? 42  HIS A CG   14 
ATOM   9137  N  ND1  . HIS A 1 42 ? 0.724   -2.570  -11.231 1.00 0.00 ? 42  HIS A ND1  14 
ATOM   9138  C  CD2  . HIS A 1 42 ? 2.404   -2.420  -9.844  1.00 0.00 ? 42  HIS A CD2  14 
ATOM   9139  C  CE1  . HIS A 1 42 ? 0.225   -2.598  -10.009 1.00 0.00 ? 42  HIS A CE1  14 
ATOM   9140  N  NE2  . HIS A 1 42 ? 1.223   -2.509  -9.148  1.00 0.00 ? 42  HIS A NE2  14 
ATOM   9141  H  H    . HIS A 1 42 ? 3.464   0.290   -12.746 1.00 0.00 ? 42  HIS A H    14 
ATOM   9142  H  HA   . HIS A 1 42 ? 4.731   -1.913  -11.253 1.00 0.00 ? 42  HIS A HA   14 
ATOM   9143  H  HB2  . HIS A 1 42 ? 2.403   -1.956  -13.176 1.00 0.00 ? 42  HIS A HB2  14 
ATOM   9144  H  HB3  . HIS A 1 42 ? 3.239   -3.411  -12.643 1.00 0.00 ? 42  HIS A HB3  14 
ATOM   9145  H  HD1  . HIS A 1 42 ? 0.195   -2.620  -12.054 1.00 0.00 ? 42  HIS A HD1  14 
ATOM   9146  H  HD2  . HIS A 1 42 ? 3.394   -2.336  -9.418  1.00 0.00 ? 42  HIS A HD2  14 
ATOM   9147  H  HE1  . HIS A 1 42 ? -0.821  -2.680  -9.755  1.00 0.00 ? 42  HIS A HE1  14 
ATOM   9148  N  N    . ASP A 1 43 ? 6.357   -1.143  -13.286 1.00 0.00 ? 43  ASP A N    14 
ATOM   9149  C  CA   . ASP A 1 43 ? 7.359   -1.272  -14.339 1.00 0.00 ? 43  ASP A CA   14 
ATOM   9150  C  C    . ASP A 1 43 ? 8.064   -2.621  -14.255 1.00 0.00 ? 43  ASP A C    14 
ATOM   9151  O  O    . ASP A 1 43 ? 8.773   -2.903  -13.288 1.00 0.00 ? 43  ASP A O    14 
ATOM   9152  C  CB   . ASP A 1 43 ? 8.382   -0.140  -14.239 1.00 0.00 ? 43  ASP A CB   14 
ATOM   9153  C  CG   . ASP A 1 43 ? 9.214   0.001   -15.499 1.00 0.00 ? 43  ASP A CG   14 
ATOM   9154  O  OD1  . ASP A 1 43 ? 8.632   0.289   -16.565 1.00 0.00 ? 43  ASP A OD1  14 
ATOM   9155  O  OD2  . ASP A 1 43 ? 10.448  -0.178  -15.418 1.00 0.00 ? 43  ASP A OD2  14 
ATOM   9156  H  H    . ASP A 1 43 ? 6.534   -0.547  -12.528 1.00 0.00 ? 43  ASP A H    14 
ATOM   9157  H  HA   . ASP A 1 43 ? 6.852   -1.203  -15.289 1.00 0.00 ? 43  ASP A HA   14 
ATOM   9158  H  HB2  . ASP A 1 43 ? 7.863   0.792   -14.067 1.00 0.00 ? 43  ASP A HB2  14 
ATOM   9159  H  HB3  . ASP A 1 43 ? 9.046   -0.336  -13.410 1.00 0.00 ? 43  ASP A HB3  14 
ATOM   9160  N  N    . ILE A 1 44 ? 7.865   -3.452  -15.273 1.00 0.00 ? 44  ILE A N    14 
ATOM   9161  C  CA   . ILE A 1 44 ? 8.483   -4.771  -15.314 1.00 0.00 ? 44  ILE A CA   14 
ATOM   9162  C  C    . ILE A 1 44 ? 9.843   -4.721  -16.000 1.00 0.00 ? 44  ILE A C    14 
ATOM   9163  O  O    . ILE A 1 44 ? 9.931   -4.723  -17.228 1.00 0.00 ? 44  ILE A O    14 
ATOM   9164  C  CB   . ILE A 1 44 ? 7.588   -5.789  -16.046 1.00 0.00 ? 44  ILE A CB   14 
ATOM   9165  C  CG1  . ILE A 1 44 ? 6.233   -5.907  -15.346 1.00 0.00 ? 44  ILE A CG1  14 
ATOM   9166  C  CG2  . ILE A 1 44 ? 8.275   -7.145  -16.115 1.00 0.00 ? 44  ILE A CG2  14 
ATOM   9167  C  CD1  . ILE A 1 44 ? 6.331   -6.396  -13.918 1.00 0.00 ? 44  ILE A CD1  14 
ATOM   9168  H  H    . ILE A 1 44 ? 7.290   -3.170  -16.014 1.00 0.00 ? 44  ILE A H    14 
ATOM   9169  H  HA   . ILE A 1 44 ? 8.617   -5.108  -14.296 1.00 0.00 ? 44  ILE A HA   14 
ATOM   9170  H  HB   . ILE A 1 44 ? 7.435   -5.439  -17.056 1.00 0.00 ? 44  ILE A HB   14 
ATOM   9171  H  HG12 . ILE A 1 44 ? 5.756   -4.940  -15.333 1.00 0.00 ? 44  ILE A HG12 14 
ATOM   9172  H  HG13 . ILE A 1 44 ? 5.613   -6.602  -15.894 1.00 0.00 ? 44  ILE A HG13 14 
ATOM   9173  H  HG21 . ILE A 1 44 ? 8.921   -7.264  -15.258 1.00 0.00 ? 44  ILE A HG21 14 
ATOM   9174  H  HG22 . ILE A 1 44 ? 7.530   -7.926  -16.114 1.00 0.00 ? 44  ILE A HG22 14 
ATOM   9175  H  HG23 . ILE A 1 44 ? 8.861   -7.207  -17.019 1.00 0.00 ? 44  ILE A HG23 14 
ATOM   9176  H  HD11 . ILE A 1 44 ? 5.639   -7.211  -13.768 1.00 0.00 ? 44  ILE A HD11 14 
ATOM   9177  H  HD12 . ILE A 1 44 ? 7.337   -6.734  -13.721 1.00 0.00 ? 44  ILE A HD12 14 
ATOM   9178  H  HD13 . ILE A 1 44 ? 6.085   -5.588  -13.244 1.00 0.00 ? 44  ILE A HD13 14 
ATOM   9179  N  N    . SER A 1 45 ? 10.903  -4.677  -15.198 1.00 0.00 ? 45  SER A N    14 
ATOM   9180  C  CA   . SER A 1 45 ? 12.260  -4.623  -15.728 1.00 0.00 ? 45  SER A CA   14 
ATOM   9181  C  C    . SER A 1 45 ? 12.777  -6.025  -16.039 1.00 0.00 ? 45  SER A C    14 
ATOM   9182  O  O    . SER A 1 45 ? 13.104  -6.338  -17.183 1.00 0.00 ? 45  SER A O    14 
ATOM   9183  C  CB   . SER A 1 45 ? 13.193  -3.933  -14.731 1.00 0.00 ? 45  SER A CB   14 
ATOM   9184  O  OG   . SER A 1 45 ? 13.071  -2.524  -14.810 1.00 0.00 ? 45  SER A OG   14 
ATOM   9185  H  H    . SER A 1 45 ? 10.768  -4.677  -14.227 1.00 0.00 ? 45  SER A H    14 
ATOM   9186  H  HA   . SER A 1 45 ? 12.237  -4.050  -16.643 1.00 0.00 ? 45  SER A HA   14 
ATOM   9187  H  HB2  . SER A 1 45 ? 12.942  -4.249  -13.730 1.00 0.00 ? 45  SER A HB2  14 
ATOM   9188  H  HB3  . SER A 1 45 ? 14.215  -4.207  -14.949 1.00 0.00 ? 45  SER A HB3  14 
ATOM   9189  H  HG   . SER A 1 45 ? 12.197  -2.296  -15.137 1.00 0.00 ? 45  SER A HG   14 
ATOM   9190  N  N    . GLY A 1 46 ? 12.848  -6.865  -15.011 1.00 0.00 ? 46  GLY A N    14 
ATOM   9191  C  CA   . GLY A 1 46 ? 13.326  -8.223  -15.194 1.00 0.00 ? 46  GLY A CA   14 
ATOM   9192  C  C    . GLY A 1 46 ? 14.039  -8.757  -13.967 1.00 0.00 ? 46  GLY A C    14 
ATOM   9193  O  O    . GLY A 1 46 ? 14.413  -8.007  -13.065 1.00 0.00 ? 46  GLY A O    14 
ATOM   9194  H  H    . GLY A 1 46 ? 12.574  -6.559  -14.121 1.00 0.00 ? 46  GLY A H    14 
ATOM   9195  H  HA2  . GLY A 1 46 ? 12.485  -8.862  -15.415 1.00 0.00 ? 46  GLY A HA2  14 
ATOM   9196  H  HA3  . GLY A 1 46 ? 14.010  -8.242  -16.029 1.00 0.00 ? 46  GLY A HA3  14 
ATOM   9197  N  N    . PRO A 1 47 ? 14.234  -10.083 -13.921 1.00 0.00 ? 47  PRO A N    14 
ATOM   9198  C  CA   . PRO A 1 47 ? 14.906  -10.746 -12.800 1.00 0.00 ? 47  PRO A CA   14 
ATOM   9199  C  C    . PRO A 1 47 ? 16.396  -10.427 -12.747 1.00 0.00 ? 47  PRO A C    14 
ATOM   9200  O  O    . PRO A 1 47 ? 17.027  -10.537 -11.695 1.00 0.00 ? 47  PRO A O    14 
ATOM   9201  C  CB   . PRO A 1 47 ? 14.688  -12.234 -13.086 1.00 0.00 ? 47  PRO A CB   14 
ATOM   9202  C  CG   . PRO A 1 47 ? 14.501  -12.313 -14.562 1.00 0.00 ? 47  PRO A CG   14 
ATOM   9203  C  CD   . PRO A 1 47 ? 13.813  -11.037 -14.961 1.00 0.00 ? 47  PRO A CD   14 
ATOM   9204  H  HA   . PRO A 1 47 ? 14.449  -10.489 -11.855 1.00 0.00 ? 47  PRO A HA   14 
ATOM   9205  H  HB2  . PRO A 1 47 ? 15.554  -12.796 -12.766 1.00 0.00 ? 47  PRO A HB2  14 
ATOM   9206  H  HB3  . PRO A 1 47 ? 13.812  -12.581 -12.559 1.00 0.00 ? 47  PRO A HB3  14 
ATOM   9207  H  HG2  . PRO A 1 47 ? 15.461  -12.390 -15.050 1.00 0.00 ? 47  PRO A HG2  14 
ATOM   9208  H  HG3  . PRO A 1 47 ? 13.884  -13.164 -14.809 1.00 0.00 ? 47  PRO A HG3  14 
ATOM   9209  H  HD2  . PRO A 1 47 ? 14.148  -10.717 -15.937 1.00 0.00 ? 47  PRO A HD2  14 
ATOM   9210  H  HD3  . PRO A 1 47 ? 12.741  -11.168 -14.953 1.00 0.00 ? 47  PRO A HD3  14 
ATOM   9211  N  N    . SER A 1 48 ? 16.953  -10.030 -13.886 1.00 0.00 ? 48  SER A N    14 
ATOM   9212  C  CA   . SER A 1 48 ? 18.370  -9.697  -13.970 1.00 0.00 ? 48  SER A CA   14 
ATOM   9213  C  C    . SER A 1 48 ? 18.613  -8.249  -13.557 1.00 0.00 ? 48  SER A C    14 
ATOM   9214  O  O    . SER A 1 48 ? 17.949  -7.333  -14.043 1.00 0.00 ? 48  SER A O    14 
ATOM   9215  C  CB   . SER A 1 48 ? 18.887  -9.928  -15.391 1.00 0.00 ? 48  SER A CB   14 
ATOM   9216  O  OG   . SER A 1 48 ? 18.251  -9.061  -16.313 1.00 0.00 ? 48  SER A OG   14 
ATOM   9217  H  H    . SER A 1 48 ? 16.397  -9.961  -14.691 1.00 0.00 ? 48  SER A H    14 
ATOM   9218  H  HA   . SER A 1 48 ? 18.903  -10.347 -13.291 1.00 0.00 ? 48  SER A HA   14 
ATOM   9219  H  HB2  . SER A 1 48 ? 19.951  -9.746  -15.418 1.00 0.00 ? 48  SER A HB2  14 
ATOM   9220  H  HB3  . SER A 1 48 ? 18.690  -10.950 -15.681 1.00 0.00 ? 48  SER A HB3  14 
ATOM   9221  H  HG   . SER A 1 48 ? 17.950  -8.272  -15.855 1.00 0.00 ? 48  SER A HG   14 
ATOM   9222  N  N    . SER A 1 49 ? 19.570  -8.049  -12.656 1.00 0.00 ? 49  SER A N    14 
ATOM   9223  C  CA   . SER A 1 49 ? 19.900  -6.713  -12.174 1.00 0.00 ? 49  SER A CA   14 
ATOM   9224  C  C    . SER A 1 49 ? 20.716  -5.947  -13.211 1.00 0.00 ? 49  SER A C    14 
ATOM   9225  O  O    . SER A 1 49 ? 20.720  -4.717  -13.230 1.00 0.00 ? 49  SER A O    14 
ATOM   9226  C  CB   . SER A 1 49 ? 20.677  -6.800  -10.859 1.00 0.00 ? 49  SER A CB   14 
ATOM   9227  O  OG   . SER A 1 49 ? 21.877  -7.535  -11.024 1.00 0.00 ? 49  SER A OG   14 
ATOM   9228  H  H    . SER A 1 49 ? 20.065  -8.820  -12.306 1.00 0.00 ? 49  SER A H    14 
ATOM   9229  H  HA   . SER A 1 49 ? 18.974  -6.185  -12.001 1.00 0.00 ? 49  SER A HA   14 
ATOM   9230  H  HB2  . SER A 1 49 ? 20.923  -5.804  -10.523 1.00 0.00 ? 49  SER A HB2  14 
ATOM   9231  H  HB3  . SER A 1 49 ? 20.067  -7.291  -10.115 1.00 0.00 ? 49  SER A HB3  14 
ATOM   9232  H  HG   . SER A 1 49 ? 22.436  -7.095  -11.669 1.00 0.00 ? 49  SER A HG   14 
ATOM   9233  N  N    . GLY A 1 50 ? 21.408  -6.686  -14.074 1.00 0.00 ? 50  GLY A N    14 
ATOM   9234  C  CA   . GLY A 1 50 ? 22.219  -6.061  -15.102 1.00 0.00 ? 50  GLY A CA   14 
ATOM   9235  C  C    . GLY A 1 50 ? 22.380  -6.940  -16.327 1.00 0.00 ? 50  GLY A C    14 
ATOM   9236  O  O    . GLY A 1 50 ? 22.385  -6.419  -17.441 1.00 0.00 ? 50  GLY A O    14 
ATOM   9237  H  H    . GLY A 1 50 ? 21.367  -7.664  -14.011 1.00 0.00 ? 50  GLY A H    14 
ATOM   9238  H  HA2  . GLY A 1 50 ? 21.754  -5.132  -15.397 1.00 0.00 ? 50  GLY A HA2  14 
ATOM   9239  H  HA3  . GLY A 1 50 ? 23.196  -5.849  -14.694 1.00 0.00 ? 50  GLY A HA3  14 
HETATM 9240  ZN ZN   . ZN  B 2 .  ? 0.495   -2.304  -7.243  1.00 0.00 ? 201 ZN  A ZN   14 
ATOM   9241  N  N    . GLY A 1 1  ? 43.189  3.279   0.965   1.00 0.00 ? 1   GLY A N    15 
ATOM   9242  C  CA   . GLY A 1 1  ? 42.277  4.246   0.382   1.00 0.00 ? 1   GLY A CA   15 
ATOM   9243  C  C    . GLY A 1 1  ? 43.003  5.374   -0.325  1.00 0.00 ? 1   GLY A C    15 
ATOM   9244  O  O    . GLY A 1 1  ? 44.159  5.665   -0.020  1.00 0.00 ? 1   GLY A O    15 
ATOM   9245  H  H1   . GLY A 1 1  ? 43.995  3.011   0.475   1.00 0.00 ? 1   GLY A H1   15 
ATOM   9246  H  HA2  . GLY A 1 1  ? 41.640  3.741   -0.328  1.00 0.00 ? 1   GLY A HA2  15 
ATOM   9247  H  HA3  . GLY A 1 1  ? 41.665  4.664   1.167   1.00 0.00 ? 1   GLY A HA3  15 
ATOM   9248  N  N    . SER A 1 2  ? 42.323  6.009   -1.274  1.00 0.00 ? 2   SER A N    15 
ATOM   9249  C  CA   . SER A 1 2  ? 42.912  7.108   -2.031  1.00 0.00 ? 2   SER A CA   15 
ATOM   9250  C  C    . SER A 1 2  ? 41.864  7.785   -2.909  1.00 0.00 ? 2   SER A C    15 
ATOM   9251  O  O    . SER A 1 2  ? 40.895  7.157   -3.336  1.00 0.00 ? 2   SER A O    15 
ATOM   9252  C  CB   . SER A 1 2  ? 44.066  6.598   -2.896  1.00 0.00 ? 2   SER A CB   15 
ATOM   9253  O  OG   . SER A 1 2  ? 43.601  5.705   -3.893  1.00 0.00 ? 2   SER A OG   15 
ATOM   9254  H  H    . SER A 1 2  ? 41.404  5.731   -1.472  1.00 0.00 ? 2   SER A H    15 
ATOM   9255  H  HA   . SER A 1 2  ? 43.294  7.830   -1.325  1.00 0.00 ? 2   SER A HA   15 
ATOM   9256  H  HB2  . SER A 1 2  ? 44.549  7.435   -3.377  1.00 0.00 ? 2   SER A HB2  15 
ATOM   9257  H  HB3  . SER A 1 2  ? 44.779  6.081   -2.271  1.00 0.00 ? 2   SER A HB3  15 
ATOM   9258  H  HG   . SER A 1 2  ? 42.782  5.297   -3.601  1.00 0.00 ? 2   SER A HG   15 
ATOM   9259  N  N    . SER A 1 3  ? 42.066  9.072   -3.174  1.00 0.00 ? 3   SER A N    15 
ATOM   9260  C  CA   . SER A 1 3  ? 41.138  9.838   -3.998  1.00 0.00 ? 3   SER A CA   15 
ATOM   9261  C  C    . SER A 1 3  ? 41.882  10.875  -4.834  1.00 0.00 ? 3   SER A C    15 
ATOM   9262  O  O    . SER A 1 3  ? 42.949  11.350  -4.448  1.00 0.00 ? 3   SER A O    15 
ATOM   9263  C  CB   . SER A 1 3  ? 40.093  10.528  -3.119  1.00 0.00 ? 3   SER A CB   15 
ATOM   9264  O  OG   . SER A 1 3  ? 39.384  11.514  -3.849  1.00 0.00 ? 3   SER A OG   15 
ATOM   9265  H  H    . SER A 1 3  ? 42.857  9.518   -2.805  1.00 0.00 ? 3   SER A H    15 
ATOM   9266  H  HA   . SER A 1 3  ? 40.638  9.148   -4.662  1.00 0.00 ? 3   SER A HA   15 
ATOM   9267  H  HB2  . SER A 1 3  ? 39.391  9.794   -2.754  1.00 0.00 ? 3   SER A HB2  15 
ATOM   9268  H  HB3  . SER A 1 3  ? 40.587  11.002  -2.283  1.00 0.00 ? 3   SER A HB3  15 
ATOM   9269  H  HG   . SER A 1 3  ? 38.456  11.488  -3.606  1.00 0.00 ? 3   SER A HG   15 
ATOM   9270  N  N    . GLY A 1 4  ? 41.308  11.222  -5.982  1.00 0.00 ? 4   GLY A N    15 
ATOM   9271  C  CA   . GLY A 1 4  ? 41.930  12.200  -6.856  1.00 0.00 ? 4   GLY A CA   15 
ATOM   9272  C  C    . GLY A 1 4  ? 41.741  11.871  -8.323  1.00 0.00 ? 4   GLY A C    15 
ATOM   9273  O  O    . GLY A 1 4  ? 40.735  11.275  -8.708  1.00 0.00 ? 4   GLY A O    15 
ATOM   9274  H  H    . GLY A 1 4  ? 40.457  10.811  -6.239  1.00 0.00 ? 4   GLY A H    15 
ATOM   9275  H  HA2  . GLY A 1 4  ? 41.498  13.170  -6.657  1.00 0.00 ? 4   GLY A HA2  15 
ATOM   9276  H  HA3  . GLY A 1 4  ? 42.988  12.237  -6.640  1.00 0.00 ? 4   GLY A HA3  15 
ATOM   9277  N  N    . SER A 1 5  ? 42.710  12.260  -9.145  1.00 0.00 ? 5   SER A N    15 
ATOM   9278  C  CA   . SER A 1 5  ? 42.643  12.007  -10.580 1.00 0.00 ? 5   SER A CA   15 
ATOM   9279  C  C    . SER A 1 5  ? 41.994  10.656  -10.863 1.00 0.00 ? 5   SER A C    15 
ATOM   9280  O  O    . SER A 1 5  ? 41.092  10.551  -11.694 1.00 0.00 ? 5   SER A O    15 
ATOM   9281  C  CB   . SER A 1 5  ? 44.044  12.051  -11.193 1.00 0.00 ? 5   SER A CB   15 
ATOM   9282  O  OG   . SER A 1 5  ? 44.878  11.053  -10.631 1.00 0.00 ? 5   SER A OG   15 
ATOM   9283  H  H    . SER A 1 5  ? 43.487  12.732  -8.778  1.00 0.00 ? 5   SER A H    15 
ATOM   9284  H  HA   . SER A 1 5  ? 42.040  12.784  -11.026 1.00 0.00 ? 5   SER A HA   15 
ATOM   9285  H  HB2  . SER A 1 5  ? 43.974  11.887  -12.257 1.00 0.00 ? 5   SER A HB2  15 
ATOM   9286  H  HB3  . SER A 1 5  ? 44.485  13.020  -11.006 1.00 0.00 ? 5   SER A HB3  15 
ATOM   9287  H  HG   . SER A 1 5  ? 45.051  11.261  -9.710  1.00 0.00 ? 5   SER A HG   15 
ATOM   9288  N  N    . SER A 1 6  ? 42.460  9.625   -10.166 1.00 0.00 ? 6   SER A N    15 
ATOM   9289  C  CA   . SER A 1 6  ? 41.928  8.279   -10.345 1.00 0.00 ? 6   SER A CA   15 
ATOM   9290  C  C    . SER A 1 6  ? 42.408  7.353   -9.231  1.00 0.00 ? 6   SER A C    15 
ATOM   9291  O  O    . SER A 1 6  ? 43.229  7.737   -8.400  1.00 0.00 ? 6   SER A O    15 
ATOM   9292  C  CB   . SER A 1 6  ? 42.347  7.719   -11.705 1.00 0.00 ? 6   SER A CB   15 
ATOM   9293  O  OG   . SER A 1 6  ? 43.712  7.338   -11.702 1.00 0.00 ? 6   SER A OG   15 
ATOM   9294  H  H    . SER A 1 6  ? 43.180  9.773   -9.518  1.00 0.00 ? 6   SER A H    15 
ATOM   9295  H  HA   . SER A 1 6  ? 40.851  8.340   -10.307 1.00 0.00 ? 6   SER A HA   15 
ATOM   9296  H  HB2  . SER A 1 6  ? 41.745  6.853   -11.936 1.00 0.00 ? 6   SER A HB2  15 
ATOM   9297  H  HB3  . SER A 1 6  ? 42.198  8.474   -12.464 1.00 0.00 ? 6   SER A HB3  15 
ATOM   9298  H  HG   . SER A 1 6  ? 44.189  7.849   -12.360 1.00 0.00 ? 6   SER A HG   15 
ATOM   9299  N  N    . GLY A 1 7  ? 41.888  6.129   -9.222  1.00 0.00 ? 7   GLY A N    15 
ATOM   9300  C  CA   . GLY A 1 7  ? 42.274  5.167   -8.207  1.00 0.00 ? 7   GLY A CA   15 
ATOM   9301  C  C    . GLY A 1 7  ? 41.080  4.478   -7.577  1.00 0.00 ? 7   GLY A C    15 
ATOM   9302  O  O    . GLY A 1 7  ? 40.632  3.436   -8.057  1.00 0.00 ? 7   GLY A O    15 
ATOM   9303  H  H    . GLY A 1 7  ? 41.237  5.878   -9.911  1.00 0.00 ? 7   GLY A H    15 
ATOM   9304  H  HA2  . GLY A 1 7  ? 42.911  4.420   -8.658  1.00 0.00 ? 7   GLY A HA2  15 
ATOM   9305  H  HA3  . GLY A 1 7  ? 42.829  5.679   -7.434  1.00 0.00 ? 7   GLY A HA3  15 
ATOM   9306  N  N    . CYS A 1 8  ? 40.565  5.058   -6.499  1.00 0.00 ? 8   CYS A N    15 
ATOM   9307  C  CA   . CYS A 1 8  ? 39.417  4.492   -5.801  1.00 0.00 ? 8   CYS A CA   15 
ATOM   9308  C  C    . CYS A 1 8  ? 38.134  5.224   -6.181  1.00 0.00 ? 8   CYS A C    15 
ATOM   9309  O  O    . CYS A 1 8  ? 37.789  6.244   -5.582  1.00 0.00 ? 8   CYS A O    15 
ATOM   9310  C  CB   . CYS A 1 8  ? 39.629  4.561   -4.288  1.00 0.00 ? 8   CYS A CB   15 
ATOM   9311  S  SG   . CYS A 1 8  ? 38.624  3.388   -3.348  1.00 0.00 ? 8   CYS A SG   15 
ATOM   9312  H  H    . CYS A 1 8  ? 40.966  5.887   -6.164  1.00 0.00 ? 8   CYS A H    15 
ATOM   9313  H  HA   . CYS A 1 8  ? 39.327  3.458   -6.097  1.00 0.00 ? 8   CYS A HA   15 
ATOM   9314  H  HB2  . CYS A 1 8  ? 40.666  4.354   -4.068  1.00 0.00 ? 8   CYS A HB2  15 
ATOM   9315  H  HB3  . CYS A 1 8  ? 39.385  5.554   -3.943  1.00 0.00 ? 8   CYS A HB3  15 
ATOM   9316  H  HG   . CYS A 1 8  ? 37.450  3.280   -3.951  1.00 0.00 ? 8   CYS A HG   15 
ATOM   9317  N  N    . CYS A 1 9  ? 37.433  4.700   -7.179  1.00 0.00 ? 9   CYS A N    15 
ATOM   9318  C  CA   . CYS A 1 9  ? 36.189  5.306   -7.641  1.00 0.00 ? 9   CYS A CA   15 
ATOM   9319  C  C    . CYS A 1 9  ? 34.990  4.443   -7.261  1.00 0.00 ? 9   CYS A C    15 
ATOM   9320  O  O    . CYS A 1 9  ? 34.932  3.259   -7.597  1.00 0.00 ? 9   CYS A O    15 
ATOM   9321  C  CB   . CYS A 1 9  ? 36.227  5.507   -9.157  1.00 0.00 ? 9   CYS A CB   15 
ATOM   9322  S  SG   . CYS A 1 9  ? 37.253  6.897   -9.691  1.00 0.00 ? 9   CYS A SG   15 
ATOM   9323  H  H    . CYS A 1 9  ? 37.759  3.886   -7.618  1.00 0.00 ? 9   CYS A H    15 
ATOM   9324  H  HA   . CYS A 1 9  ? 36.091  6.267   -7.161  1.00 0.00 ? 9   CYS A HA   15 
ATOM   9325  H  HB2  . CYS A 1 9  ? 36.617  4.614   -9.621  1.00 0.00 ? 9   CYS A HB2  15 
ATOM   9326  H  HB3  . CYS A 1 9  ? 35.223  5.681   -9.515  1.00 0.00 ? 9   CYS A HB3  15 
ATOM   9327  H  HG   . CYS A 1 9  ? 38.214  6.420   -10.469 1.00 0.00 ? 9   CYS A HG   15 
ATOM   9328  N  N    . LEU A 1 10 ? 34.036  5.042   -6.557  1.00 0.00 ? 10  LEU A N    15 
ATOM   9329  C  CA   . LEU A 1 10 ? 32.838  4.328   -6.129  1.00 0.00 ? 10  LEU A CA   15 
ATOM   9330  C  C    . LEU A 1 10 ? 31.578  5.098   -6.514  1.00 0.00 ? 10  LEU A C    15 
ATOM   9331  O  O    . LEU A 1 10 ? 31.582  6.323   -6.632  1.00 0.00 ? 10  LEU A O    15 
ATOM   9332  C  CB   . LEU A 1 10 ? 32.868  4.102   -4.617  1.00 0.00 ? 10  LEU A CB   15 
ATOM   9333  C  CG   . LEU A 1 10 ? 33.088  5.346   -3.756  1.00 0.00 ? 10  LEU A CG   15 
ATOM   9334  C  CD1  . LEU A 1 10 ? 31.812  6.169   -3.671  1.00 0.00 ? 10  LEU A CD1  15 
ATOM   9335  C  CD2  . LEU A 1 10 ? 33.566  4.956   -2.365  1.00 0.00 ? 10  LEU A CD2  15 
ATOM   9336  H  H    . LEU A 1 10 ? 34.138  5.987   -6.320  1.00 0.00 ? 10  LEU A H    15 
ATOM   9337  H  HA   . LEU A 1 10 ? 32.827  3.371   -6.628  1.00 0.00 ? 10  LEU A HA   15 
ATOM   9338  H  HB2  . LEU A 1 10 ? 31.925  3.663   -4.329  1.00 0.00 ? 10  LEU A HB2  15 
ATOM   9339  H  HB3  . LEU A 1 10 ? 33.667  3.406   -4.403  1.00 0.00 ? 10  LEU A HB3  15 
ATOM   9340  H  HG   . LEU A 1 10 ? 33.851  5.962   -4.212  1.00 0.00 ? 10  LEU A HG   15 
ATOM   9341  H  HD11 . LEU A 1 10 ? 32.009  7.175   -4.008  1.00 0.00 ? 10  LEU A HD11 15 
ATOM   9342  H  HD12 . LEU A 1 10 ? 31.466  6.193   -2.648  1.00 0.00 ? 10  LEU A HD12 15 
ATOM   9343  H  HD13 . LEU A 1 10 ? 31.053  5.721   -4.296  1.00 0.00 ? 10  LEU A HD13 15 
ATOM   9344  H  HD21 . LEU A 1 10 ? 33.329  3.918   -2.182  1.00 0.00 ? 10  LEU A HD21 15 
ATOM   9345  H  HD22 . LEU A 1 10 ? 33.074  5.573   -1.628  1.00 0.00 ? 10  LEU A HD22 15 
ATOM   9346  H  HD23 . LEU A 1 10 ? 34.635  5.098   -2.299  1.00 0.00 ? 10  LEU A HD23 15 
ATOM   9347  N  N    . PRO A 1 11 ? 30.474  4.364   -6.713  1.00 0.00 ? 11  PRO A N    15 
ATOM   9348  C  CA   . PRO A 1 11 ? 29.185  4.956   -7.085  1.00 0.00 ? 11  PRO A CA   15 
ATOM   9349  C  C    . PRO A 1 11 ? 28.566  5.759   -5.945  1.00 0.00 ? 11  PRO A C    15 
ATOM   9350  O  O    . PRO A 1 11 ? 28.604  5.360   -4.781  1.00 0.00 ? 11  PRO A O    15 
ATOM   9351  C  CB   . PRO A 1 11 ? 28.317  3.740   -7.415  1.00 0.00 ? 11  PRO A CB   15 
ATOM   9352  C  CG   . PRO A 1 11 ? 28.919  2.622   -6.636  1.00 0.00 ? 11  PRO A CG   15 
ATOM   9353  C  CD   . PRO A 1 11 ? 30.396  2.898   -6.589  1.00 0.00 ? 11  PRO A CD   15 
ATOM   9354  H  HA   . PRO A 1 11 ? 29.275  5.585   -7.958  1.00 0.00 ? 11  PRO A HA   15 
ATOM   9355  H  HB2  . PRO A 1 11 ? 27.297  3.929   -7.113  1.00 0.00 ? 11  PRO A HB2  15 
ATOM   9356  H  HB3  . PRO A 1 11 ? 28.353  3.545   -8.477  1.00 0.00 ? 11  PRO A HB3  15 
ATOM   9357  H  HG2  . PRO A 1 11 ? 28.508  2.607   -5.638  1.00 0.00 ? 11  PRO A HG2  15 
ATOM   9358  H  HG3  . PRO A 1 11 ? 28.730  1.683   -7.136  1.00 0.00 ? 11  PRO A HG3  15 
ATOM   9359  H  HD2  . PRO A 1 11 ? 30.812  2.568   -5.649  1.00 0.00 ? 11  PRO A HD2  15 
ATOM   9360  H  HD3  . PRO A 1 11 ? 30.897  2.416   -7.415  1.00 0.00 ? 11  PRO A HD3  15 
ATOM   9361  N  N    . PRO A 1 12 ? 27.981  6.917   -6.286  1.00 0.00 ? 12  PRO A N    15 
ATOM   9362  C  CA   . PRO A 1 12 ? 27.341  7.799   -5.305  1.00 0.00 ? 12  PRO A CA   15 
ATOM   9363  C  C    . PRO A 1 12 ? 26.056  7.202   -4.740  1.00 0.00 ? 12  PRO A C    15 
ATOM   9364  O  O    . PRO A 1 12 ? 25.098  6.962   -5.474  1.00 0.00 ? 12  PRO A O    15 
ATOM   9365  C  CB   . PRO A 1 12 ? 27.034  9.063   -6.111  1.00 0.00 ? 12  PRO A CB   15 
ATOM   9366  C  CG   . PRO A 1 12 ? 26.929  8.596   -7.522  1.00 0.00 ? 12  PRO A CG   15 
ATOM   9367  C  CD   . PRO A 1 12 ? 27.898  7.454   -7.654  1.00 0.00 ? 12  PRO A CD   15 
ATOM   9368  H  HA   . PRO A 1 12 ? 28.011  8.041   -4.493  1.00 0.00 ? 12  PRO A HA   15 
ATOM   9369  H  HB2  . PRO A 1 12 ? 26.106  9.496   -5.767  1.00 0.00 ? 12  PRO A HB2  15 
ATOM   9370  H  HB3  . PRO A 1 12 ? 27.837  9.775   -5.991  1.00 0.00 ? 12  PRO A HB3  15 
ATOM   9371  H  HG2  . PRO A 1 12 ? 25.923  8.259   -7.723  1.00 0.00 ? 12  PRO A HG2  15 
ATOM   9372  H  HG3  . PRO A 1 12 ? 27.199  9.396   -8.195  1.00 0.00 ? 12  PRO A HG3  15 
ATOM   9373  H  HD2  . PRO A 1 12 ? 27.515  6.711   -8.338  1.00 0.00 ? 12  PRO A HD2  15 
ATOM   9374  H  HD3  . PRO A 1 12 ? 28.862  7.813   -7.985  1.00 0.00 ? 12  PRO A HD3  15 
ATOM   9375  N  N    . ALA A 1 13 ? 26.044  6.966   -3.432  1.00 0.00 ? 13  ALA A N    15 
ATOM   9376  C  CA   . ALA A 1 13 ? 24.876  6.400   -2.769  1.00 0.00 ? 13  ALA A CA   15 
ATOM   9377  C  C    . ALA A 1 13 ? 23.914  7.496   -2.321  1.00 0.00 ? 13  ALA A C    15 
ATOM   9378  O  O    . ALA A 1 13 ? 24.054  8.052   -1.231  1.00 0.00 ? 13  ALA A O    15 
ATOM   9379  C  CB   . ALA A 1 13 ? 25.303  5.551   -1.581  1.00 0.00 ? 13  ALA A CB   15 
ATOM   9380  H  H    . ALA A 1 13 ? 26.839  7.179   -2.901  1.00 0.00 ? 13  ALA A H    15 
ATOM   9381  H  HA   . ALA A 1 13 ? 24.369  5.758   -3.476  1.00 0.00 ? 13  ALA A HA   15 
ATOM   9382  H  HB1  . ALA A 1 13 ? 24.428  5.124   -1.112  1.00 0.00 ? 13  ALA A HB1  15 
ATOM   9383  H  HB2  . ALA A 1 13 ? 25.953  4.759   -1.920  1.00 0.00 ? 13  ALA A HB2  15 
ATOM   9384  H  HB3  . ALA A 1 13 ? 25.828  6.169   -0.868  1.00 0.00 ? 13  ALA A HB3  15 
ATOM   9385  N  N    . THR A 1 14 ? 22.937  7.803   -3.169  1.00 0.00 ? 14  THR A N    15 
ATOM   9386  C  CA   . THR A 1 14 ? 21.954  8.834   -2.861  1.00 0.00 ? 14  THR A CA   15 
ATOM   9387  C  C    . THR A 1 14 ? 20.535  8.326   -3.092  1.00 0.00 ? 14  THR A C    15 
ATOM   9388  O  O    . THR A 1 14 ? 20.315  7.402   -3.876  1.00 0.00 ? 14  THR A O    15 
ATOM   9389  C  CB   . THR A 1 14 ? 22.180  10.098  -3.711  1.00 0.00 ? 14  THR A CB   15 
ATOM   9390  O  OG1  . THR A 1 14 ? 22.039  9.785   -5.102  1.00 0.00 ? 14  THR A OG1  15 
ATOM   9391  C  CG2  . THR A 1 14 ? 23.561  10.682  -3.456  1.00 0.00 ? 14  THR A CG2  15 
ATOM   9392  H  H    . THR A 1 14 ? 22.879  7.325   -4.022  1.00 0.00 ? 14  THR A H    15 
ATOM   9393  H  HA   . THR A 1 14 ? 22.066  9.101   -1.820  1.00 0.00 ? 14  THR A HA   15 
ATOM   9394  H  HB   . THR A 1 14 ? 21.438  10.834  -3.438  1.00 0.00 ? 14  THR A HB   15 
ATOM   9395  H  HG1  . THR A 1 14 ? 22.392  10.505  -5.629  1.00 0.00 ? 14  THR A HG1  15 
ATOM   9396  H  HG21 . THR A 1 14 ? 24.241  9.891   -3.179  1.00 0.00 ? 14  THR A HG21 15 
ATOM   9397  H  HG22 . THR A 1 14 ? 23.504  11.405  -2.655  1.00 0.00 ? 14  THR A HG22 15 
ATOM   9398  H  HG23 . THR A 1 14 ? 23.918  11.166  -4.353  1.00 0.00 ? 14  THR A HG23 15 
ATOM   9399  N  N    . HIS A 1 15 ? 19.574  8.937   -2.406  1.00 0.00 ? 15  HIS A N    15 
ATOM   9400  C  CA   . HIS A 1 15 ? 18.175  8.547   -2.538  1.00 0.00 ? 15  HIS A CA   15 
ATOM   9401  C  C    . HIS A 1 15 ? 17.301  9.757   -2.853  1.00 0.00 ? 15  HIS A C    15 
ATOM   9402  O  O    . HIS A 1 15 ? 17.327  10.757  -2.135  1.00 0.00 ? 15  HIS A O    15 
ATOM   9403  C  CB   . HIS A 1 15 ? 17.688  7.872   -1.255  1.00 0.00 ? 15  HIS A CB   15 
ATOM   9404  C  CG   . HIS A 1 15 ? 18.121  6.444   -1.128  1.00 0.00 ? 15  HIS A CG   15 
ATOM   9405  N  ND1  . HIS A 1 15 ? 17.280  5.378   -1.375  1.00 0.00 ? 15  HIS A ND1  15 
ATOM   9406  C  CD2  . HIS A 1 15 ? 19.314  5.907   -0.781  1.00 0.00 ? 15  HIS A CD2  15 
ATOM   9407  C  CE1  . HIS A 1 15 ? 17.937  4.249   -1.182  1.00 0.00 ? 15  HIS A CE1  15 
ATOM   9408  N  NE2  . HIS A 1 15 ? 19.174  4.542   -0.822  1.00 0.00 ? 15  HIS A NE2  15 
ATOM   9409  H  H    . HIS A 1 15 ? 19.812  9.666   -1.797  1.00 0.00 ? 15  HIS A H    15 
ATOM   9410  H  HA   . HIS A 1 15 ? 18.102  7.844   -3.354  1.00 0.00 ? 15  HIS A HA   15 
ATOM   9411  H  HB2  . HIS A 1 15 ? 18.075  8.412   -0.403  1.00 0.00 ? 15  HIS A HB2  15 
ATOM   9412  H  HB3  . HIS A 1 15 ? 16.608  7.896   -1.230  1.00 0.00 ? 15  HIS A HB3  15 
ATOM   9413  H  HD1  . HIS A 1 15 ? 16.342  5.441   -1.648  1.00 0.00 ? 15  HIS A HD1  15 
ATOM   9414  H  HD2  . HIS A 1 15 ? 20.210  6.452   -0.519  1.00 0.00 ? 15  HIS A HD2  15 
ATOM   9415  H  HE1  . HIS A 1 15 ? 17.534  3.254   -1.300  1.00 0.00 ? 15  HIS A HE1  15 
ATOM   9416  N  N    . ARG A 1 16 ? 16.530  9.660   -3.931  1.00 0.00 ? 16  ARG A N    15 
ATOM   9417  C  CA   . ARG A 1 16 ? 15.650  10.747  -4.341  1.00 0.00 ? 16  ARG A CA   15 
ATOM   9418  C  C    . ARG A 1 16 ? 14.206  10.267  -4.451  1.00 0.00 ? 16  ARG A C    15 
ATOM   9419  O  O    . ARG A 1 16 ? 13.932  9.125   -4.820  1.00 0.00 ? 16  ARG A O    15 
ATOM   9420  C  CB   . ARG A 1 16 ? 16.110  11.325  -5.681  1.00 0.00 ? 16  ARG A CB   15 
ATOM   9421  C  CG   . ARG A 1 16 ? 17.190  12.386  -5.549  1.00 0.00 ? 16  ARG A CG   15 
ATOM   9422  C  CD   . ARG A 1 16 ? 16.591  13.776  -5.409  1.00 0.00 ? 16  ARG A CD   15 
ATOM   9423  N  NE   . ARG A 1 16 ? 17.618  14.814  -5.383  1.00 0.00 ? 16  ARG A NE   15 
ATOM   9424  C  CZ   . ARG A 1 16 ? 18.284  15.162  -4.288  1.00 0.00 ? 16  ARG A CZ   15 
ATOM   9425  N  NH1  . ARG A 1 16 ? 18.032  14.558  -3.135  1.00 0.00 ? 16  ARG A NH1  15 
ATOM   9426  N  NH2  . ARG A 1 16 ? 19.204  16.117  -4.344  1.00 0.00 ? 16  ARG A NH2  15 
ATOM   9427  H  H    . ARG A 1 16 ? 16.553  8.837   -4.463  1.00 0.00 ? 16  ARG A H    15 
ATOM   9428  H  HA   . ARG A 1 16 ? 15.704  11.520  -3.589  1.00 0.00 ? 16  ARG A HA   15 
ATOM   9429  H  HB2  . ARG A 1 16 ? 16.497  10.523  -6.292  1.00 0.00 ? 16  ARG A HB2  15 
ATOM   9430  H  HB3  . ARG A 1 16 ? 15.260  11.768  -6.179  1.00 0.00 ? 16  ARG A HB3  15 
ATOM   9431  H  HG2  . ARG A 1 16 ? 17.786  12.173  -4.673  1.00 0.00 ? 16  ARG A HG2  15 
ATOM   9432  H  HG3  . ARG A 1 16 ? 17.817  12.359  -6.428  1.00 0.00 ? 16  ARG A HG3  15 
ATOM   9433  H  HD2  . ARG A 1 16 ? 15.933  13.956  -6.246  1.00 0.00 ? 16  ARG A HD2  15 
ATOM   9434  H  HD3  . ARG A 1 16 ? 16.026  13.819  -4.491  1.00 0.00 ? 16  ARG A HD3  15 
ATOM   9435  H  HE   . ARG A 1 16 ? 17.821  15.274  -6.224  1.00 0.00 ? 16  ARG A HE   15 
ATOM   9436  H  HH11 . ARG A 1 16 ? 17.339  13.838  -3.090  1.00 0.00 ? 16  ARG A HH11 15 
ATOM   9437  H  HH12 . ARG A 1 16 ? 18.535  14.821  -2.311  1.00 0.00 ? 16  ARG A HH12 15 
ATOM   9438  H  HH21 . ARG A 1 16 ? 19.397  16.574  -5.211  1.00 0.00 ? 16  ARG A HH21 15 
ATOM   9439  H  HH22 . ARG A 1 16 ? 19.704  16.378  -3.519  1.00 0.00 ? 16  ARG A HH22 15 
ATOM   9440  N  N    . PRO A 1 17 ? 13.259  11.158  -4.123  1.00 0.00 ? 17  PRO A N    15 
ATOM   9441  C  CA   . PRO A 1 17 ? 11.827  10.848  -4.176  1.00 0.00 ? 17  PRO A CA   15 
ATOM   9442  C  C    . PRO A 1 17 ? 11.321  10.690  -5.606  1.00 0.00 ? 17  PRO A C    15 
ATOM   9443  O  O    . PRO A 1 17 ? 10.845  11.648  -6.216  1.00 0.00 ? 17  PRO A O    15 
ATOM   9444  C  CB   . PRO A 1 17 ? 11.176  12.062  -3.509  1.00 0.00 ? 17  PRO A CB   15 
ATOM   9445  C  CG   . PRO A 1 17 ? 12.150  13.172  -3.709  1.00 0.00 ? 17  PRO A CG   15 
ATOM   9446  C  CD   . PRO A 1 17 ? 13.513  12.538  -3.674  1.00 0.00 ? 17  PRO A CD   15 
ATOM   9447  H  HA   . PRO A 1 17 ? 11.593  9.957   -3.612  1.00 0.00 ? 17  PRO A HA   15 
ATOM   9448  H  HB2  . PRO A 1 17 ? 10.230  12.274  -3.988  1.00 0.00 ? 17  PRO A HB2  15 
ATOM   9449  H  HB3  . PRO A 1 17 ? 11.018  11.860  -2.461  1.00 0.00 ? 17  PRO A HB3  15 
ATOM   9450  H  HG2  . PRO A 1 17 ? 11.979  13.642  -4.665  1.00 0.00 ? 17  PRO A HG2  15 
ATOM   9451  H  HG3  . PRO A 1 17 ? 12.052  13.893  -2.912  1.00 0.00 ? 17  PRO A HG3  15 
ATOM   9452  H  HD2  . PRO A 1 17 ? 14.183  13.046  -4.352  1.00 0.00 ? 17  PRO A HD2  15 
ATOM   9453  H  HD3  . PRO A 1 17 ? 13.909  12.549  -2.670  1.00 0.00 ? 17  PRO A HD3  15 
ATOM   9454  N  N    . HIS A 1 18 ? 11.427  9.475   -6.135  1.00 0.00 ? 18  HIS A N    15 
ATOM   9455  C  CA   . HIS A 1 18 ? 10.978  9.192   -7.494  1.00 0.00 ? 18  HIS A CA   15 
ATOM   9456  C  C    . HIS A 1 18 ? 9.455   9.199   -7.576  1.00 0.00 ? 18  HIS A C    15 
ATOM   9457  O  O    . HIS A 1 18 ? 8.758   8.774   -6.654  1.00 0.00 ? 18  HIS A O    15 
ATOM   9458  C  CB   . HIS A 1 18 ? 11.520  7.841   -7.961  1.00 0.00 ? 18  HIS A CB   15 
ATOM   9459  C  CG   . HIS A 1 18 ? 13.011  7.729   -7.868  1.00 0.00 ? 18  HIS A CG   15 
ATOM   9460  N  ND1  . HIS A 1 18 ? 13.863  8.202   -8.843  1.00 0.00 ? 18  HIS A ND1  15 
ATOM   9461  C  CD2  . HIS A 1 18 ? 13.800  7.194   -6.907  1.00 0.00 ? 18  HIS A CD2  15 
ATOM   9462  C  CE1  . HIS A 1 18 ? 15.113  7.962   -8.486  1.00 0.00 ? 18  HIS A CE1  15 
ATOM   9463  N  NE2  . HIS A 1 18 ? 15.101  7.351   -7.315  1.00 0.00 ? 18  HIS A NE2  15 
ATOM   9464  H  H    . HIS A 1 18 ? 11.815  8.753   -5.600  1.00 0.00 ? 18  HIS A H    15 
ATOM   9465  H  HA   . HIS A 1 18 ? 11.364  9.967   -8.139  1.00 0.00 ? 18  HIS A HA   15 
ATOM   9466  H  HB2  . HIS A 1 18 ? 11.090  7.059   -7.353  1.00 0.00 ? 18  HIS A HB2  15 
ATOM   9467  H  HB3  . HIS A 1 18 ? 11.238  7.684   -8.993  1.00 0.00 ? 18  HIS A HB3  15 
ATOM   9468  H  HD1  . HIS A 1 18 ? 13.593  8.647   -9.673  1.00 0.00 ? 18  HIS A HD1  15 
ATOM   9469  H  HD2  . HIS A 1 18 ? 13.468  6.728   -5.990  1.00 0.00 ? 18  HIS A HD2  15 
ATOM   9470  H  HE1  . HIS A 1 18 ? 15.993  8.221   -9.054  1.00 0.00 ? 18  HIS A HE1  15 
ATOM   9471  N  N    . PRO A 1 19 ? 8.924   9.693   -8.705  1.00 0.00 ? 19  PRO A N    15 
ATOM   9472  C  CA   . PRO A 1 19 ? 7.478   9.767   -8.933  1.00 0.00 ? 19  PRO A CA   15 
ATOM   9473  C  C    . PRO A 1 19 ? 6.850   8.390   -9.124  1.00 0.00 ? 19  PRO A C    15 
ATOM   9474  O  O    . PRO A 1 19 ? 7.543   7.416   -9.422  1.00 0.00 ? 19  PRO A O    15 
ATOM   9475  C  CB   . PRO A 1 19 ? 7.364   10.590  -10.219 1.00 0.00 ? 19  PRO A CB   15 
ATOM   9476  C  CG   . PRO A 1 19 ? 8.659   10.375  -10.923 1.00 0.00 ? 19  PRO A CG   15 
ATOM   9477  C  CD   . PRO A 1 19 ? 9.695   10.217  -9.844  1.00 0.00 ? 19  PRO A CD   15 
ATOM   9478  H  HA   . PRO A 1 19 ? 6.975   10.282  -8.128  1.00 0.00 ? 19  PRO A HA   15 
ATOM   9479  H  HB2  . PRO A 1 19 ? 6.530   10.232  -10.806 1.00 0.00 ? 19  PRO A HB2  15 
ATOM   9480  H  HB3  . PRO A 1 19 ? 7.217   11.631  -9.972  1.00 0.00 ? 19  PRO A HB3  15 
ATOM   9481  H  HG2  . PRO A 1 19 ? 8.605   9.481   -11.525 1.00 0.00 ? 19  PRO A HG2  15 
ATOM   9482  H  HG3  . PRO A 1 19 ? 8.888   11.231  -11.539 1.00 0.00 ? 19  PRO A HG3  15 
ATOM   9483  H  HD2  . PRO A 1 19 ? 10.455  9.514   -10.152 1.00 0.00 ? 19  PRO A HD2  15 
ATOM   9484  H  HD3  . PRO A 1 19 ? 10.138  11.172  -9.603  1.00 0.00 ? 19  PRO A HD3  15 
ATOM   9485  N  N    . THR A 1 20 ? 5.534   8.316   -8.953  1.00 0.00 ? 20  THR A N    15 
ATOM   9486  C  CA   . THR A 1 20 ? 4.813   7.059   -9.106  1.00 0.00 ? 20  THR A CA   15 
ATOM   9487  C  C    . THR A 1 20 ? 5.662   5.879   -8.646  1.00 0.00 ? 20  THR A C    15 
ATOM   9488  O  O    . THR A 1 20 ? 5.835   4.905   -9.378  1.00 0.00 ? 20  THR A O    15 
ATOM   9489  C  CB   . THR A 1 20 ? 4.386   6.831   -10.568 1.00 0.00 ? 20  THR A CB   15 
ATOM   9490  O  OG1  . THR A 1 20 ? 3.686   5.587   -10.685 1.00 0.00 ? 20  THR A OG1  15 
ATOM   9491  C  CG2  . THR A 1 20 ? 5.596   6.827   -11.491 1.00 0.00 ? 20  THR A CG2  15 
ATOM   9492  H  H    . THR A 1 20 ? 5.038   9.127   -8.717  1.00 0.00 ? 20  THR A H    15 
ATOM   9493  H  HA   . THR A 1 20 ? 3.923   7.109   -8.496  1.00 0.00 ? 20  THR A HA   15 
ATOM   9494  H  HB   . THR A 1 20 ? 3.728   7.635   -10.865 1.00 0.00 ? 20  THR A HB   15 
ATOM   9495  H  HG1  . THR A 1 20 ? 4.053   4.953   -10.065 1.00 0.00 ? 20  THR A HG1  15 
ATOM   9496  H  HG21 . THR A 1 20 ? 6.133   7.757   -11.384 1.00 0.00 ? 20  THR A HG21 15 
ATOM   9497  H  HG22 . THR A 1 20 ? 5.268   6.715   -12.513 1.00 0.00 ? 20  THR A HG22 15 
ATOM   9498  H  HG23 . THR A 1 20 ? 6.244   6.004   -11.229 1.00 0.00 ? 20  THR A HG23 15 
ATOM   9499  N  N    . SER A 1 21 ? 6.188   5.973   -7.429  1.00 0.00 ? 21  SER A N    15 
ATOM   9500  C  CA   . SER A 1 21 ? 7.021   4.914   -6.873  1.00 0.00 ? 21  SER A CA   15 
ATOM   9501  C  C    . SER A 1 21 ? 6.552   3.544   -7.354  1.00 0.00 ? 21  SER A C    15 
ATOM   9502  O  O    . SER A 1 21 ? 5.354   3.306   -7.509  1.00 0.00 ? 21  SER A O    15 
ATOM   9503  C  CB   . SER A 1 21 ? 6.996   4.966   -5.344  1.00 0.00 ? 21  SER A CB   15 
ATOM   9504  O  OG   . SER A 1 21 ? 8.089   4.252   -4.791  1.00 0.00 ? 21  SER A OG   15 
ATOM   9505  H  H    . SER A 1 21 ? 6.013   6.775   -6.894  1.00 0.00 ? 21  SER A H    15 
ATOM   9506  H  HA   . SER A 1 21 ? 8.033   5.074   -7.213  1.00 0.00 ? 21  SER A HA   15 
ATOM   9507  H  HB2  . SER A 1 21 ? 7.053   5.994   -5.020  1.00 0.00 ? 21  SER A HB2  15 
ATOM   9508  H  HB3  . SER A 1 21 ? 6.076   4.526   -4.986  1.00 0.00 ? 21  SER A HB3  15 
ATOM   9509  H  HG   . SER A 1 21 ? 7.855   3.325   -4.705  1.00 0.00 ? 21  SER A HG   15 
ATOM   9510  N  N    . ILE A 1 22 ? 7.504   2.648   -7.588  1.00 0.00 ? 22  ILE A N    15 
ATOM   9511  C  CA   . ILE A 1 22 ? 7.190   1.302   -8.050  1.00 0.00 ? 22  ILE A CA   15 
ATOM   9512  C  C    . ILE A 1 22 ? 6.547   0.476   -6.941  1.00 0.00 ? 22  ILE A C    15 
ATOM   9513  O  O    . ILE A 1 22 ? 6.949   0.556   -5.780  1.00 0.00 ? 22  ILE A O    15 
ATOM   9514  C  CB   . ILE A 1 22 ? 8.448   0.571   -8.556  1.00 0.00 ? 22  ILE A CB   15 
ATOM   9515  C  CG1  . ILE A 1 22 ? 8.864   1.115   -9.924  1.00 0.00 ? 22  ILE A CG1  15 
ATOM   9516  C  CG2  . ILE A 1 22 ? 8.197   -0.927  -8.629  1.00 0.00 ? 22  ILE A CG2  15 
ATOM   9517  C  CD1  . ILE A 1 22 ? 9.414   2.523   -9.873  1.00 0.00 ? 22  ILE A CD1  15 
ATOM   9518  H  H    . ILE A 1 22 ? 8.441   2.897   -7.446  1.00 0.00 ? 22  ILE A H    15 
ATOM   9519  H  HA   . ILE A 1 22 ? 6.492   1.386   -8.871  1.00 0.00 ? 22  ILE A HA   15 
ATOM   9520  H  HB   . ILE A 1 22 ? 9.245   0.744   -7.850  1.00 0.00 ? 22  ILE A HB   15 
ATOM   9521  H  HG12 . ILE A 1 22 ? 9.627   0.477   -10.341 1.00 0.00 ? 22  ILE A HG12 15 
ATOM   9522  H  HG13 . ILE A 1 22 ? 8.005   1.117   -10.579 1.00 0.00 ? 22  ILE A HG13 15 
ATOM   9523  H  HG21 . ILE A 1 22 ? 8.587   -1.402  -7.741  1.00 0.00 ? 22  ILE A HG21 15 
ATOM   9524  H  HG22 . ILE A 1 22 ? 7.135   -1.111  -8.697  1.00 0.00 ? 22  ILE A HG22 15 
ATOM   9525  H  HG23 . ILE A 1 22 ? 8.689   -1.333  -9.500  1.00 0.00 ? 22  ILE A HG23 15 
ATOM   9526  H  HD11 . ILE A 1 22 ? 8.615   3.229   -10.047 1.00 0.00 ? 22  ILE A HD11 15 
ATOM   9527  H  HD12 . ILE A 1 22 ? 9.851   2.705   -8.903  1.00 0.00 ? 22  ILE A HD12 15 
ATOM   9528  H  HD13 . ILE A 1 22 ? 10.170  2.642   -10.636 1.00 0.00 ? 22  ILE A HD13 15 
ATOM   9529  N  N    . CYS A 1 23 ? 5.547   -0.319  -7.306  1.00 0.00 ? 23  CYS A N    15 
ATOM   9530  C  CA   . CYS A 1 23 ? 4.849   -1.163  -6.344  1.00 0.00 ? 23  CYS A CA   15 
ATOM   9531  C  C    . CYS A 1 23 ? 5.805   -2.167  -5.706  1.00 0.00 ? 23  CYS A C    15 
ATOM   9532  O  O    . CYS A 1 23 ? 6.976   -2.245  -6.076  1.00 0.00 ? 23  CYS A O    15 
ATOM   9533  C  CB   . CYS A 1 23 ? 3.695   -1.901  -7.024  1.00 0.00 ? 23  CYS A CB   15 
ATOM   9534  S  SG   . CYS A 1 23 ? 2.318   -2.318  -5.907  1.00 0.00 ? 23  CYS A SG   15 
ATOM   9535  H  H    . CYS A 1 23 ? 5.272   -0.340  -8.248  1.00 0.00 ? 23  CYS A H    15 
ATOM   9536  H  HA   . CYS A 1 23 ? 4.450   -0.523  -5.571  1.00 0.00 ? 23  CYS A HA   15 
ATOM   9537  H  HB2  . CYS A 1 23 ? 3.298   -1.283  -7.816  1.00 0.00 ? 23  CYS A HB2  15 
ATOM   9538  H  HB3  . CYS A 1 23 ? 4.067   -2.823  -7.446  1.00 0.00 ? 23  CYS A HB3  15 
ATOM   9539  N  N    . ASP A 1 24 ? 5.296   -2.932  -4.747  1.00 0.00 ? 24  ASP A N    15 
ATOM   9540  C  CA   . ASP A 1 24 ? 6.103   -3.932  -4.058  1.00 0.00 ? 24  ASP A CA   15 
ATOM   9541  C  C    . ASP A 1 24 ? 5.726   -5.340  -4.510  1.00 0.00 ? 24  ASP A C    15 
ATOM   9542  O  O    . ASP A 1 24 ? 6.559   -6.246  -4.510  1.00 0.00 ? 24  ASP A O    15 
ATOM   9543  C  CB   . ASP A 1 24 ? 5.929   -3.805  -2.544  1.00 0.00 ? 24  ASP A CB   15 
ATOM   9544  C  CG   . ASP A 1 24 ? 6.587   -2.558  -1.988  1.00 0.00 ? 24  ASP A CG   15 
ATOM   9545  O  OD1  . ASP A 1 24 ? 7.833   -2.479  -2.020  1.00 0.00 ? 24  ASP A OD1  15 
ATOM   9546  O  OD2  . ASP A 1 24 ? 5.856   -1.660  -1.520  1.00 0.00 ? 24  ASP A OD2  15 
ATOM   9547  H  H    . ASP A 1 24 ? 4.355   -2.822  -4.496  1.00 0.00 ? 24  ASP A H    15 
ATOM   9548  H  HA   . ASP A 1 24 ? 7.138   -3.753  -4.308  1.00 0.00 ? 24  ASP A HA   15 
ATOM   9549  H  HB2  . ASP A 1 24 ? 4.874   -3.767  -2.311  1.00 0.00 ? 24  ASP A HB2  15 
ATOM   9550  H  HB3  . ASP A 1 24 ? 6.368   -4.667  -2.064  1.00 0.00 ? 24  ASP A HB3  15 
ATOM   9551  N  N    . ASN A 1 25 ? 4.466   -5.515  -4.892  1.00 0.00 ? 25  ASN A N    15 
ATOM   9552  C  CA   . ASN A 1 25 ? 3.978   -6.813  -5.344  1.00 0.00 ? 25  ASN A CA   15 
ATOM   9553  C  C    . ASN A 1 25 ? 4.342   -7.051  -6.807  1.00 0.00 ? 25  ASN A C    15 
ATOM   9554  O  O    . ASN A 1 25 ? 5.201   -7.877  -7.117  1.00 0.00 ? 25  ASN A O    15 
ATOM   9555  C  CB   . ASN A 1 25 ? 2.461   -6.902  -5.164  1.00 0.00 ? 25  ASN A CB   15 
ATOM   9556  C  CG   . ASN A 1 25 ? 2.065   -7.184  -3.727  1.00 0.00 ? 25  ASN A CG   15 
ATOM   9557  O  OD1  . ASN A 1 25 ? 2.821   -6.903  -2.797  1.00 0.00 ? 25  ASN A OD1  15 
ATOM   9558  N  ND2  . ASN A 1 25 ? 0.876   -7.744  -3.540  1.00 0.00 ? 25  ASN A ND2  15 
ATOM   9559  H  H    . ASN A 1 25 ? 3.849   -4.754  -4.869  1.00 0.00 ? 25  ASN A H    15 
ATOM   9560  H  HA   . ASN A 1 25 ? 4.449   -7.573  -4.740  1.00 0.00 ? 25  ASN A HA   15 
ATOM   9561  H  HB2  . ASN A 1 25 ? 2.013   -5.965  -5.462  1.00 0.00 ? 25  ASN A HB2  15 
ATOM   9562  H  HB3  . ASN A 1 25 ? 2.076   -7.695  -5.787  1.00 0.00 ? 25  ASN A HB3  15 
ATOM   9563  H  HD21 . ASN A 1 25 ? 0.327   -7.940  -4.329  1.00 0.00 ? 25  ASN A HD21 15 
ATOM   9564  H  HD22 . ASN A 1 25 ? 0.594   -7.937  -2.622  1.00 0.00 ? 25  ASN A HD22 15 
ATOM   9565  N  N    . PHE A 1 26 ? 3.683   -6.322  -7.701  1.00 0.00 ? 26  PHE A N    15 
ATOM   9566  C  CA   . PHE A 1 26 ? 3.936   -6.454  -9.131  1.00 0.00 ? 26  PHE A CA   15 
ATOM   9567  C  C    . PHE A 1 26 ? 5.425   -6.311  -9.435  1.00 0.00 ? 26  PHE A C    15 
ATOM   9568  O  O    . PHE A 1 26 ? 5.934   -6.899  -10.389 1.00 0.00 ? 26  PHE A O    15 
ATOM   9569  C  CB   . PHE A 1 26 ? 3.141   -5.405  -9.911  1.00 0.00 ? 26  PHE A CB   15 
ATOM   9570  C  CG   . PHE A 1 26 ? 2.752   -5.851  -11.291 1.00 0.00 ? 26  PHE A CG   15 
ATOM   9571  C  CD1  . PHE A 1 26 ? 3.714   -6.037  -12.270 1.00 0.00 ? 26  PHE A CD1  15 
ATOM   9572  C  CD2  . PHE A 1 26 ? 1.423   -6.085  -11.609 1.00 0.00 ? 26  PHE A CD2  15 
ATOM   9573  C  CE1  . PHE A 1 26 ? 3.358   -6.447  -13.542 1.00 0.00 ? 26  PHE A CE1  15 
ATOM   9574  C  CE2  . PHE A 1 26 ? 1.061   -6.495  -12.878 1.00 0.00 ? 26  PHE A CE2  15 
ATOM   9575  C  CZ   . PHE A 1 26 ? 2.030   -6.677  -13.845 1.00 0.00 ? 26  PHE A CZ   15 
ATOM   9576  H  H    . PHE A 1 26 ? 3.009   -5.681  -7.392  1.00 0.00 ? 26  PHE A H    15 
ATOM   9577  H  HA   . PHE A 1 26 ? 3.612   -7.438  -9.435  1.00 0.00 ? 26  PHE A HA   15 
ATOM   9578  H  HB2  . PHE A 1 26 ? 2.236   -5.174  -9.369  1.00 0.00 ? 26  PHE A HB2  15 
ATOM   9579  H  HB3  . PHE A 1 26 ? 3.737   -4.510  -10.006 1.00 0.00 ? 26  PHE A HB3  15 
ATOM   9580  H  HD1  . PHE A 1 26 ? 4.752   -5.859  -12.034 1.00 0.00 ? 26  PHE A HD1  15 
ATOM   9581  H  HD2  . PHE A 1 26 ? 0.664   -5.942  -10.852 1.00 0.00 ? 26  PHE A HD2  15 
ATOM   9582  H  HE1  . PHE A 1 26 ? 4.117   -6.589  -14.296 1.00 0.00 ? 26  PHE A HE1  15 
ATOM   9583  H  HE2  . PHE A 1 26 ? 0.022   -6.674  -13.112 1.00 0.00 ? 26  PHE A HE2  15 
ATOM   9584  H  HZ   . PHE A 1 26 ? 1.749   -6.997  -14.838 1.00 0.00 ? 26  PHE A HZ   15 
ATOM   9585  N  N    . SER A 1 27 ? 6.116   -5.523  -8.618  1.00 0.00 ? 27  SER A N    15 
ATOM   9586  C  CA   . SER A 1 27 ? 7.545   -5.298  -8.801  1.00 0.00 ? 27  SER A CA   15 
ATOM   9587  C  C    . SER A 1 27 ? 8.278   -6.616  -9.029  1.00 0.00 ? 27  SER A C    15 
ATOM   9588  O  O    . SER A 1 27 ? 8.840   -6.850  -10.098 1.00 0.00 ? 27  SER A O    15 
ATOM   9589  C  CB   . SER A 1 27 ? 8.130   -4.580  -7.583  1.00 0.00 ? 27  SER A CB   15 
ATOM   9590  O  OG   . SER A 1 27 ? 9.538   -4.729  -7.530  1.00 0.00 ? 27  SER A OG   15 
ATOM   9591  H  H    . SER A 1 27 ? 5.653   -5.081  -7.875  1.00 0.00 ? 27  SER A H    15 
ATOM   9592  H  HA   . SER A 1 27 ? 7.673   -4.673  -9.672  1.00 0.00 ? 27  SER A HA   15 
ATOM   9593  H  HB2  . SER A 1 27 ? 7.893   -3.528  -7.640  1.00 0.00 ? 27  SER A HB2  15 
ATOM   9594  H  HB3  . SER A 1 27 ? 7.701   -4.997  -6.683  1.00 0.00 ? 27  SER A HB3  15 
ATOM   9595  H  HG   . SER A 1 27 ? 9.764   -5.421  -6.905  1.00 0.00 ? 27  SER A HG   15 
ATOM   9596  N  N    . ALA A 1 28 ? 8.268   -7.475  -8.014  1.00 0.00 ? 28  ALA A N    15 
ATOM   9597  C  CA   . ALA A 1 28 ? 8.930   -8.770  -8.103  1.00 0.00 ? 28  ALA A CA   15 
ATOM   9598  C  C    . ALA A 1 28 ? 7.930   -9.877  -8.419  1.00 0.00 ? 28  ALA A C    15 
ATOM   9599  O  O    . ALA A 1 28 ? 8.096   -10.620 -9.387  1.00 0.00 ? 28  ALA A O    15 
ATOM   9600  C  CB   . ALA A 1 28 ? 9.667   -9.077  -6.807  1.00 0.00 ? 28  ALA A CB   15 
ATOM   9601  H  H    . ALA A 1 28 ? 7.804   -7.231  -7.186  1.00 0.00 ? 28  ALA A H    15 
ATOM   9602  H  HA   . ALA A 1 28 ? 9.659   -8.719  -8.899  1.00 0.00 ? 28  ALA A HA   15 
ATOM   9603  H  HB1  . ALA A 1 28 ? 9.340   -8.392  -6.038  1.00 0.00 ? 28  ALA A HB1  15 
ATOM   9604  H  HB2  . ALA A 1 28 ? 9.452   -10.090 -6.503  1.00 0.00 ? 28  ALA A HB2  15 
ATOM   9605  H  HB3  . ALA A 1 28 ? 10.729  -8.964  -6.963  1.00 0.00 ? 28  ALA A HB3  15 
ATOM   9606  N  N    . TYR A 1 29 ? 6.891   -9.982  -7.598  1.00 0.00 ? 29  TYR A N    15 
ATOM   9607  C  CA   . TYR A 1 29 ? 5.865   -11.000 -7.788  1.00 0.00 ? 29  TYR A CA   15 
ATOM   9608  C  C    . TYR A 1 29 ? 5.289   -10.935 -9.199  1.00 0.00 ? 29  TYR A C    15 
ATOM   9609  O  O    . TYR A 1 29 ? 5.213   -11.944 -9.899  1.00 0.00 ? 29  TYR A O    15 
ATOM   9610  C  CB   . TYR A 1 29 ? 4.747   -10.826 -6.760  1.00 0.00 ? 29  TYR A CB   15 
ATOM   9611  C  CG   . TYR A 1 29 ? 5.227   -10.889 -5.327  1.00 0.00 ? 29  TYR A CG   15 
ATOM   9612  C  CD1  . TYR A 1 29 ? 5.789   -9.777  -4.712  1.00 0.00 ? 29  TYR A CD1  15 
ATOM   9613  C  CD2  . TYR A 1 29 ? 5.117   -12.061 -4.588  1.00 0.00 ? 29  TYR A CD2  15 
ATOM   9614  C  CE1  . TYR A 1 29 ? 6.229   -9.830  -3.404  1.00 0.00 ? 29  TYR A CE1  15 
ATOM   9615  C  CE2  . TYR A 1 29 ? 5.553   -12.123 -3.279  1.00 0.00 ? 29  TYR A CE2  15 
ATOM   9616  C  CZ   . TYR A 1 29 ? 6.109   -11.005 -2.691  1.00 0.00 ? 29  TYR A CZ   15 
ATOM   9617  O  OH   . TYR A 1 29 ? 6.545   -11.062 -1.387  1.00 0.00 ? 29  TYR A OH   15 
ATOM   9618  H  H    . TYR A 1 29 ? 6.813   -9.360  -6.844  1.00 0.00 ? 29  TYR A H    15 
ATOM   9619  H  HA   . TYR A 1 29 ? 6.326   -11.966 -7.644  1.00 0.00 ? 29  TYR A HA   15 
ATOM   9620  H  HB2  . TYR A 1 29 ? 4.275   -9.867  -6.909  1.00 0.00 ? 29  TYR A HB2  15 
ATOM   9621  H  HB3  . TYR A 1 29 ? 4.014   -11.608 -6.899  1.00 0.00 ? 29  TYR A HB3  15 
ATOM   9622  H  HD1  . TYR A 1 29 ? 5.881   -8.858  -5.273  1.00 0.00 ? 29  TYR A HD1  15 
ATOM   9623  H  HD2  . TYR A 1 29 ? 4.681   -12.934 -5.051  1.00 0.00 ? 29  TYR A HD2  15 
ATOM   9624  H  HE1  . TYR A 1 29 ? 6.663   -8.955  -2.944  1.00 0.00 ? 29  TYR A HE1  15 
ATOM   9625  H  HE2  . TYR A 1 29 ? 5.459   -13.043 -2.720  1.00 0.00 ? 29  TYR A HE2  15 
ATOM   9626  H  HH   . TYR A 1 29 ? 5.884   -11.503 -0.848  1.00 0.00 ? 29  TYR A HH   15 
ATOM   9627  N  N    . GLY A 1 30 ? 4.883   -9.737  -9.611  1.00 0.00 ? 30  GLY A N    15 
ATOM   9628  C  CA   . GLY A 1 30 ? 4.318   -9.561  -10.936 1.00 0.00 ? 30  GLY A CA   15 
ATOM   9629  C  C    . GLY A 1 30 ? 2.849   -9.191  -10.896 1.00 0.00 ? 30  GLY A C    15 
ATOM   9630  O  O    . GLY A 1 30 ? 2.361   -8.465  -11.762 1.00 0.00 ? 30  GLY A O    15 
ATOM   9631  H  H    . GLY A 1 30 ? 4.968   -8.968  -9.010  1.00 0.00 ? 30  GLY A H    15 
ATOM   9632  H  HA2  . GLY A 1 30 ? 4.862   -8.779  -11.446 1.00 0.00 ? 30  GLY A HA2  15 
ATOM   9633  H  HA3  . GLY A 1 30 ? 4.431   -10.482 -11.489 1.00 0.00 ? 30  GLY A HA3  15 
ATOM   9634  N  N    . TRP A 1 31 ? 2.142   -9.693  -9.890  1.00 0.00 ? 31  TRP A N    15 
ATOM   9635  C  CA   . TRP A 1 31 ? 0.718   -9.413  -9.742  1.00 0.00 ? 31  TRP A CA   15 
ATOM   9636  C  C    . TRP A 1 31 ? 0.480   -8.363  -8.662  1.00 0.00 ? 31  TRP A C    15 
ATOM   9637  O  O    . TRP A 1 31 ? 1.325   -8.149  -7.793  1.00 0.00 ? 31  TRP A O    15 
ATOM   9638  C  CB   . TRP A 1 31 ? -0.042  -10.695 -9.401  1.00 0.00 ? 31  TRP A CB   15 
ATOM   9639  C  CG   . TRP A 1 31 ? -0.172  -10.934 -7.927  1.00 0.00 ? 31  TRP A CG   15 
ATOM   9640  C  CD1  . TRP A 1 31 ? 0.750   -11.520 -7.107  1.00 0.00 ? 31  TRP A CD1  15 
ATOM   9641  C  CD2  . TRP A 1 31 ? -1.290  -10.595 -7.099  1.00 0.00 ? 31  TRP A CD2  15 
ATOM   9642  N  NE1  . TRP A 1 31 ? 0.272   -11.566 -5.820  1.00 0.00 ? 31  TRP A NE1  15 
ATOM   9643  C  CE2  . TRP A 1 31 ? -0.977  -11.004 -5.788  1.00 0.00 ? 31  TRP A CE2  15 
ATOM   9644  C  CE3  . TRP A 1 31 ? -2.524  -9.985  -7.337  1.00 0.00 ? 31  TRP A CE3  15 
ATOM   9645  C  CZ2  . TRP A 1 31 ? -1.854  -10.822 -4.722  1.00 0.00 ? 31  TRP A CZ2  15 
ATOM   9646  C  CZ3  . TRP A 1 31 ? -3.394  -9.805  -6.278  1.00 0.00 ? 31  TRP A CZ3  15 
ATOM   9647  C  CH2  . TRP A 1 31 ? -3.055  -10.221 -4.984  1.00 0.00 ? 31  TRP A CH2  15 
ATOM   9648  H  H    . TRP A 1 31 ? 2.587   -10.266 -9.231  1.00 0.00 ? 31  TRP A H    15 
ATOM   9649  H  HA   . TRP A 1 31 ? 0.357   -9.031  -10.685 1.00 0.00 ? 31  TRP A HA   15 
ATOM   9650  H  HB2  . TRP A 1 31 ? -1.036  -10.639 -9.818  1.00 0.00 ? 31  TRP A HB2  15 
ATOM   9651  H  HB3  . TRP A 1 31 ? 0.478   -11.539 -9.832  1.00 0.00 ? 31  TRP A HB3  15 
ATOM   9652  H  HD1  . TRP A 1 31 ? 1.708   -11.890 -7.437  1.00 0.00 ? 31  TRP A HD1  15 
ATOM   9653  H  HE1  . TRP A 1 31 ? 0.750   -11.939 -5.049  1.00 0.00 ? 31  TRP A HE1  15 
ATOM   9654  H  HE3  . TRP A 1 31 ? -2.803  -9.657  -8.328  1.00 0.00 ? 31  TRP A HE3  15 
ATOM   9655  H  HZ2  . TRP A 1 31 ? -1.607  -11.137 -3.719  1.00 0.00 ? 31  TRP A HZ2  15 
ATOM   9656  H  HZ3  . TRP A 1 31 ? -4.353  -9.335  -6.443  1.00 0.00 ? 31  TRP A HZ3  15 
ATOM   9657  H  HH2  . TRP A 1 31 ? -3.765  -10.061 -4.187  1.00 0.00 ? 31  TRP A HH2  15 
ATOM   9658  N  N    . CYS A 1 32 ? -0.676  -7.710  -8.723  1.00 0.00 ? 32  CYS A N    15 
ATOM   9659  C  CA   . CYS A 1 32 ? -1.026  -6.682  -7.750  1.00 0.00 ? 32  CYS A CA   15 
ATOM   9660  C  C    . CYS A 1 32 ? -2.528  -6.678  -7.479  1.00 0.00 ? 32  CYS A C    15 
ATOM   9661  O  O    . CYS A 1 32 ? -3.349  -6.762  -8.392  1.00 0.00 ? 32  CYS A O    15 
ATOM   9662  C  CB   . CYS A 1 32 ? -0.583  -5.306  -8.250  1.00 0.00 ? 32  CYS A CB   15 
ATOM   9663  S  SG   . CYS A 1 32 ? -0.962  -3.941  -7.104  1.00 0.00 ? 32  CYS A SG   15 
ATOM   9664  H  H    . CYS A 1 32 ? -1.310  -7.925  -9.440  1.00 0.00 ? 32  CYS A H    15 
ATOM   9665  H  HA   . CYS A 1 32 ? -0.507  -6.905  -6.830  1.00 0.00 ? 32  CYS A HA   15 
ATOM   9666  H  HB2  . CYS A 1 32 ? 0.486   -5.315  -8.407  1.00 0.00 ? 32  CYS A HB2  15 
ATOM   9667  H  HB3  . CYS A 1 32 ? -1.078  -5.095  -9.187  1.00 0.00 ? 32  CYS A HB3  15 
ATOM   9668  N  N    . PRO A 1 33 ? -2.896  -6.578  -6.193  1.00 0.00 ? 33  PRO A N    15 
ATOM   9669  C  CA   . PRO A 1 33 ? -4.300  -6.560  -5.771  1.00 0.00 ? 33  PRO A CA   15 
ATOM   9670  C  C    . PRO A 1 33 ? -5.011  -5.274  -6.177  1.00 0.00 ? 33  PRO A C    15 
ATOM   9671  O  O    . PRO A 1 33 ? -6.233  -5.248  -6.327  1.00 0.00 ? 33  PRO A O    15 
ATOM   9672  C  CB   . PRO A 1 33 ? -4.214  -6.666  -4.247  1.00 0.00 ? 33  PRO A CB   15 
ATOM   9673  C  CG   . PRO A 1 33 ? -2.873  -6.114  -3.904  1.00 0.00 ? 33  PRO A CG   15 
ATOM   9674  C  CD   . PRO A 1 33 ? -1.972  -6.475  -5.052  1.00 0.00 ? 33  PRO A CD   15 
ATOM   9675  H  HA   . PRO A 1 33 ? -4.843  -7.409  -6.163  1.00 0.00 ? 33  PRO A HA   15 
ATOM   9676  H  HB2  . PRO A 1 33 ? -5.008  -6.085  -3.798  1.00 0.00 ? 33  PRO A HB2  15 
ATOM   9677  H  HB3  . PRO A 1 33 ? -4.304  -7.699  -3.948  1.00 0.00 ? 33  PRO A HB3  15 
ATOM   9678  H  HG2  . PRO A 1 33 ? -2.934  -5.042  -3.798  1.00 0.00 ? 33  PRO A HG2  15 
ATOM   9679  H  HG3  . PRO A 1 33 ? -2.514  -6.564  -2.990  1.00 0.00 ? 33  PRO A HG3  15 
ATOM   9680  H  HD2  . PRO A 1 33 ? -1.241  -5.697  -5.217  1.00 0.00 ? 33  PRO A HD2  15 
ATOM   9681  H  HD3  . PRO A 1 33 ? -1.483  -7.420  -4.866  1.00 0.00 ? 33  PRO A HD3  15 
ATOM   9682  N  N    . LEU A 1 34 ? -4.239  -4.207  -6.354  1.00 0.00 ? 34  LEU A N    15 
ATOM   9683  C  CA   . LEU A 1 34 ? -4.795  -2.916  -6.743  1.00 0.00 ? 34  LEU A CA   15 
ATOM   9684  C  C    . LEU A 1 34 ? -4.957  -2.827  -8.257  1.00 0.00 ? 34  LEU A C    15 
ATOM   9685  O  O    . LEU A 1 34 ? -5.741  -2.025  -8.762  1.00 0.00 ? 34  LEU A O    15 
ATOM   9686  C  CB   . LEU A 1 34 ? -3.896  -1.781  -6.248  1.00 0.00 ? 34  LEU A CB   15 
ATOM   9687  C  CG   . LEU A 1 34 ? -3.975  -1.467  -4.753  1.00 0.00 ? 34  LEU A CG   15 
ATOM   9688  C  CD1  . LEU A 1 34 ? -3.019  -0.341  -4.394  1.00 0.00 ? 34  LEU A CD1  15 
ATOM   9689  C  CD2  . LEU A 1 34 ? -5.399  -1.108  -4.358  1.00 0.00 ? 34  LEU A CD2  15 
ATOM   9690  H  H    . LEU A 1 34 ? -3.272  -4.289  -6.220  1.00 0.00 ? 34  LEU A H    15 
ATOM   9691  H  HA   . LEU A 1 34 ? -5.767  -2.822  -6.283  1.00 0.00 ? 34  LEU A HA   15 
ATOM   9692  H  HB2  . LEU A 1 34 ? -2.875  -2.044  -6.477  1.00 0.00 ? 34  LEU A HB2  15 
ATOM   9693  H  HB3  . LEU A 1 34 ? -4.166  -0.886  -6.789  1.00 0.00 ? 34  LEU A HB3  15 
ATOM   9694  H  HG   . LEU A 1 34 ? -3.682  -2.344  -4.192  1.00 0.00 ? 34  LEU A HG   15 
ATOM   9695  H  HD11 . LEU A 1 34 ? -2.644  0.115   -5.297  1.00 0.00 ? 34  LEU A HD11 15 
ATOM   9696  H  HD12 . LEU A 1 34 ? -2.194  -0.737  -3.821  1.00 0.00 ? 34  LEU A HD12 15 
ATOM   9697  H  HD13 . LEU A 1 34 ? -3.541  0.400   -3.806  1.00 0.00 ? 34  LEU A HD13 15 
ATOM   9698  H  HD21 . LEU A 1 34 ? -5.988  -2.009  -4.276  1.00 0.00 ? 34  LEU A HD21 15 
ATOM   9699  H  HD22 . LEU A 1 34 ? -5.830  -0.463  -5.111  1.00 0.00 ? 34  LEU A HD22 15 
ATOM   9700  H  HD23 . LEU A 1 34 ? -5.390  -0.596  -3.407  1.00 0.00 ? 34  LEU A HD23 15 
ATOM   9701  N  N    . GLY A 1 35 ? -4.211  -3.660  -8.977  1.00 0.00 ? 35  GLY A N    15 
ATOM   9702  C  CA   . GLY A 1 35 ? -4.288  -3.661  -10.426 1.00 0.00 ? 35  GLY A CA   15 
ATOM   9703  C  C    . GLY A 1 35 ? -3.783  -2.367  -11.035 1.00 0.00 ? 35  GLY A C    15 
ATOM   9704  O  O    . GLY A 1 35 ? -2.775  -1.806  -10.604 1.00 0.00 ? 35  GLY A O    15 
ATOM   9705  H  H    . GLY A 1 35 ? -3.603  -4.278  -8.521  1.00 0.00 ? 35  GLY A H    15 
ATOM   9706  H  HA2  . GLY A 1 35 ? -3.697  -4.480  -10.807 1.00 0.00 ? 35  GLY A HA2  15 
ATOM   9707  H  HA3  . GLY A 1 35 ? -5.317  -3.805  -10.720 1.00 0.00 ? 35  GLY A HA3  15 
ATOM   9708  N  N    . PRO A 1 36 ? -4.491  -1.876  -12.062 1.00 0.00 ? 36  PRO A N    15 
ATOM   9709  C  CA   . PRO A 1 36 ? -4.127  -0.636  -12.754 1.00 0.00 ? 36  PRO A CA   15 
ATOM   9710  C  C    . PRO A 1 36 ? -4.346  0.598   -11.885 1.00 0.00 ? 36  PRO A C    15 
ATOM   9711  O  O    . PRO A 1 36 ? -3.549  1.535   -11.910 1.00 0.00 ? 36  PRO A O    15 
ATOM   9712  C  CB   . PRO A 1 36 ? -5.067  -0.613  -13.961 1.00 0.00 ? 36  PRO A CB   15 
ATOM   9713  C  CG   . PRO A 1 36 ? -6.242  -1.427  -13.542 1.00 0.00 ? 36  PRO A CG   15 
ATOM   9714  C  CD   . PRO A 1 36 ? -5.702  -2.493  -12.628 1.00 0.00 ? 36  PRO A CD   15 
ATOM   9715  H  HA   . PRO A 1 36 ? -3.102  -0.657  -13.094 1.00 0.00 ? 36  PRO A HA   15 
ATOM   9716  H  HB2  . PRO A 1 36 ? -5.350  0.407   -14.181 1.00 0.00 ? 36  PRO A HB2  15 
ATOM   9717  H  HB3  . PRO A 1 36 ? -4.571  -1.048  -14.816 1.00 0.00 ? 36  PRO A HB3  15 
ATOM   9718  H  HG2  . PRO A 1 36 ? -6.950  -0.805  -13.015 1.00 0.00 ? 36  PRO A HG2  15 
ATOM   9719  H  HG3  . PRO A 1 36 ? -6.705  -1.876  -14.408 1.00 0.00 ? 36  PRO A HG3  15 
ATOM   9720  H  HD2  . PRO A 1 36 ? -6.417  -2.721  -11.851 1.00 0.00 ? 36  PRO A HD2  15 
ATOM   9721  H  HD3  . PRO A 1 36 ? -5.455  -3.382  -13.190 1.00 0.00 ? 36  PRO A HD3  15 
ATOM   9722  N  N    . GLN A 1 37 ? -5.431  0.591   -11.117 1.00 0.00 ? 37  GLN A N    15 
ATOM   9723  C  CA   . GLN A 1 37 ? -5.754  1.710   -10.241 1.00 0.00 ? 37  GLN A CA   15 
ATOM   9724  C  C    . GLN A 1 37 ? -4.608  1.994   -9.275  1.00 0.00 ? 37  GLN A C    15 
ATOM   9725  O  O    . GLN A 1 37 ? -4.444  3.120   -8.804  1.00 0.00 ? 37  GLN A O    15 
ATOM   9726  C  CB   . GLN A 1 37 ? -7.036  1.420   -9.458  1.00 0.00 ? 37  GLN A CB   15 
ATOM   9727  C  CG   . GLN A 1 37 ? -8.303  1.816   -10.198 1.00 0.00 ? 37  GLN A CG   15 
ATOM   9728  C  CD   . GLN A 1 37 ? -9.516  1.031   -9.739  1.00 0.00 ? 37  GLN A CD   15 
ATOM   9729  O  OE1  . GLN A 1 37 ? -9.439  0.238   -8.800  1.00 0.00 ? 37  GLN A OE1  15 
ATOM   9730  N  NE2  . GLN A 1 37 ? -10.647 1.249   -10.400 1.00 0.00 ? 37  GLN A NE2  15 
ATOM   9731  H  H    . GLN A 1 37 ? -6.028  -0.185  -11.141 1.00 0.00 ? 37  GLN A H    15 
ATOM   9732  H  HA   . GLN A 1 37 ? -5.911  2.581   -10.860 1.00 0.00 ? 37  GLN A HA   15 
ATOM   9733  H  HB2  . GLN A 1 37 ? -7.083  0.362   -9.248  1.00 0.00 ? 37  GLN A HB2  15 
ATOM   9734  H  HB3  . GLN A 1 37 ? -7.005  1.962   -8.525  1.00 0.00 ? 37  GLN A HB3  15 
ATOM   9735  H  HG2  . GLN A 1 37 ? -8.489  2.867   -10.029 1.00 0.00 ? 37  GLN A HG2  15 
ATOM   9736  H  HG3  . GLN A 1 37 ? -8.158  1.642   -11.254 1.00 0.00 ? 37  GLN A HG3  15 
ATOM   9737  H  HE21 . GLN A 1 37 ? -10.634 1.894   -11.139 1.00 0.00 ? 37  GLN A HE21 15 
ATOM   9738  H  HE22 . GLN A 1 37 ? -11.446 0.754   -10.126 1.00 0.00 ? 37  GLN A HE22 15 
ATOM   9739  N  N    . CYS A 1 38 ? -3.818  0.966   -8.984  1.00 0.00 ? 38  CYS A N    15 
ATOM   9740  C  CA   . CYS A 1 38 ? -2.687  1.104   -8.074  1.00 0.00 ? 38  CYS A CA   15 
ATOM   9741  C  C    . CYS A 1 38 ? -1.913  2.388   -8.359  1.00 0.00 ? 38  CYS A C    15 
ATOM   9742  O  O    . CYS A 1 38 ? -1.616  2.722   -9.507  1.00 0.00 ? 38  CYS A O    15 
ATOM   9743  C  CB   . CYS A 1 38 ? -1.756  -0.104  -8.197  1.00 0.00 ? 38  CYS A CB   15 
ATOM   9744  S  SG   . CYS A 1 38 ? -0.437  -0.156  -6.943  1.00 0.00 ? 38  CYS A SG   15 
ATOM   9745  H  H    . CYS A 1 38 ? -3.999  0.093   -9.392  1.00 0.00 ? 38  CYS A H    15 
ATOM   9746  H  HA   . CYS A 1 38 ? -3.074  1.148   -7.068  1.00 0.00 ? 38  CYS A HA   15 
ATOM   9747  H  HB2  . CYS A 1 38 ? -2.339  -1.009  -8.099  1.00 0.00 ? 38  CYS A HB2  15 
ATOM   9748  H  HB3  . CYS A 1 38 ? -1.286  -0.089  -9.170  1.00 0.00 ? 38  CYS A HB3  15 
ATOM   9749  N  N    . PRO A 1 39 ? -1.576  3.125   -7.291  1.00 0.00 ? 39  PRO A N    15 
ATOM   9750  C  CA   . PRO A 1 39 ? -0.831  4.383   -7.400  1.00 0.00 ? 39  PRO A CA   15 
ATOM   9751  C  C    . PRO A 1 39 ? 0.616   4.165   -7.827  1.00 0.00 ? 39  PRO A C    15 
ATOM   9752  O  O    . PRO A 1 39 ? 1.175   4.958   -8.584  1.00 0.00 ? 39  PRO A O    15 
ATOM   9753  C  CB   . PRO A 1 39 ? -0.890  4.954   -5.981  1.00 0.00 ? 39  PRO A CB   15 
ATOM   9754  C  CG   . PRO A 1 39 ? -1.074  3.766   -5.102  1.00 0.00 ? 39  PRO A CG   15 
ATOM   9755  C  CD   . PRO A 1 39 ? -1.897  2.788   -5.894  1.00 0.00 ? 39  PRO A CD   15 
ATOM   9756  H  HA   . PRO A 1 39 ? -1.308  5.069   -8.085  1.00 0.00 ? 39  PRO A HA   15 
ATOM   9757  H  HB2  . PRO A 1 39 ? 0.033   5.471   -5.760  1.00 0.00 ? 39  PRO A HB2  15 
ATOM   9758  H  HB3  . PRO A 1 39 ? -1.721  5.639   -5.898  1.00 0.00 ? 39  PRO A HB3  15 
ATOM   9759  H  HG2  . PRO A 1 39 ? -0.114  3.337   -4.858  1.00 0.00 ? 39  PRO A HG2  15 
ATOM   9760  H  HG3  . PRO A 1 39 ? -1.597  4.053   -4.202  1.00 0.00 ? 39  PRO A HG3  15 
ATOM   9761  H  HD2  . PRO A 1 39 ? -1.603  1.774   -5.665  1.00 0.00 ? 39  PRO A HD2  15 
ATOM   9762  H  HD3  . PRO A 1 39 ? -2.949  2.932   -5.695  1.00 0.00 ? 39  PRO A HD3  15 
ATOM   9763  N  N    . GLN A 1 40 ? 1.216   3.085   -7.337  1.00 0.00 ? 40  GLN A N    15 
ATOM   9764  C  CA   . GLN A 1 40 ? 2.599   2.763   -7.669  1.00 0.00 ? 40  GLN A CA   15 
ATOM   9765  C  C    . GLN A 1 40 ? 2.718   2.301   -9.118  1.00 0.00 ? 40  GLN A C    15 
ATOM   9766  O  O    . GLN A 1 40 ? 1.714   2.052   -9.785  1.00 0.00 ? 40  GLN A O    15 
ATOM   9767  C  CB   . GLN A 1 40 ? 3.132   1.679   -6.731  1.00 0.00 ? 40  GLN A CB   15 
ATOM   9768  C  CG   . GLN A 1 40 ? 2.967   2.016   -5.257  1.00 0.00 ? 40  GLN A CG   15 
ATOM   9769  C  CD   . GLN A 1 40 ? 3.870   3.150   -4.813  1.00 0.00 ? 40  GLN A CD   15 
ATOM   9770  O  OE1  . GLN A 1 40 ? 3.811   4.254   -5.355  1.00 0.00 ? 40  GLN A OE1  15 
ATOM   9771  N  NE2  . GLN A 1 40 ? 4.712   2.883   -3.822  1.00 0.00 ? 40  GLN A NE2  15 
ATOM   9772  H  H    . GLN A 1 40 ? 0.717   2.491   -6.739  1.00 0.00 ? 40  GLN A H    15 
ATOM   9773  H  HA   . GLN A 1 40 ? 3.187   3.659   -7.541  1.00 0.00 ? 40  GLN A HA   15 
ATOM   9774  H  HB2  . GLN A 1 40 ? 2.606   0.757   -6.929  1.00 0.00 ? 40  GLN A HB2  15 
ATOM   9775  H  HB3  . GLN A 1 40 ? 4.184   1.534   -6.929  1.00 0.00 ? 40  GLN A HB3  15 
ATOM   9776  H  HG2  . GLN A 1 40 ? 1.942   2.302   -5.079  1.00 0.00 ? 40  GLN A HG2  15 
ATOM   9777  H  HG3  . GLN A 1 40 ? 3.202   1.138   -4.673  1.00 0.00 ? 40  GLN A HG3  15 
ATOM   9778  H  HE21 . GLN A 1 40 ? 4.704   1.980   -3.438  1.00 0.00 ? 40  GLN A HE21 15 
ATOM   9779  H  HE22 . GLN A 1 40 ? 5.307   3.597   -3.515  1.00 0.00 ? 40  GLN A HE22 15 
ATOM   9780  N  N    . SER A 1 41 ? 3.952   2.189   -9.599  1.00 0.00 ? 41  SER A N    15 
ATOM   9781  C  CA   . SER A 1 41 ? 4.202   1.762   -10.970 1.00 0.00 ? 41  SER A CA   15 
ATOM   9782  C  C    . SER A 1 41 ? 4.572   0.282   -11.019 1.00 0.00 ? 41  SER A C    15 
ATOM   9783  O  O    . SER A 1 41 ? 5.207   -0.241  -10.103 1.00 0.00 ? 41  SER A O    15 
ATOM   9784  C  CB   . SER A 1 41 ? 5.321   2.599   -11.592 1.00 0.00 ? 41  SER A CB   15 
ATOM   9785  O  OG   . SER A 1 41 ? 5.377   2.413   -12.996 1.00 0.00 ? 41  SER A OG   15 
ATOM   9786  H  H    . SER A 1 41 ? 4.712   2.402   -9.018  1.00 0.00 ? 41  SER A H    15 
ATOM   9787  H  HA   . SER A 1 41 ? 3.294   1.913   -11.535 1.00 0.00 ? 41  SER A HA   15 
ATOM   9788  H  HB2  . SER A 1 41 ? 5.142   3.644   -11.386 1.00 0.00 ? 41  SER A HB2  15 
ATOM   9789  H  HB3  . SER A 1 41 ? 6.268   2.305   -11.163 1.00 0.00 ? 41  SER A HB3  15 
ATOM   9790  H  HG   . SER A 1 41 ? 4.869   3.101   -13.431 1.00 0.00 ? 41  SER A HG   15 
ATOM   9791  N  N    . HIS A 1 42 ? 4.168   -0.387  -12.094 1.00 0.00 ? 42  HIS A N    15 
ATOM   9792  C  CA   . HIS A 1 42 ? 4.457   -1.807  -12.264 1.00 0.00 ? 42  HIS A CA   15 
ATOM   9793  C  C    . HIS A 1 42 ? 5.393   -2.033  -13.447 1.00 0.00 ? 42  HIS A C    15 
ATOM   9794  O  O    . HIS A 1 42 ? 4.967   -2.478  -14.513 1.00 0.00 ? 42  HIS A O    15 
ATOM   9795  C  CB   . HIS A 1 42 ? 3.161   -2.592  -12.467 1.00 0.00 ? 42  HIS A CB   15 
ATOM   9796  C  CG   . HIS A 1 42 ? 2.236   -2.536  -11.290 1.00 0.00 ? 42  HIS A CG   15 
ATOM   9797  N  ND1  . HIS A 1 42 ? 0.864   -2.612  -11.406 1.00 0.00 ? 42  HIS A ND1  15 
ATOM   9798  C  CD2  . HIS A 1 42 ? 2.494   -2.414  -9.967  1.00 0.00 ? 42  HIS A CD2  15 
ATOM   9799  C  CE1  . HIS A 1 42 ? 0.318   -2.536  -10.206 1.00 0.00 ? 42  HIS A CE1  15 
ATOM   9800  N  NE2  . HIS A 1 42 ? 1.286   -2.416  -9.315  1.00 0.00 ? 42  HIS A NE2  15 
ATOM   9801  H  H    . HIS A 1 42 ? 3.665   0.085   -12.790 1.00 0.00 ? 42  HIS A H    15 
ATOM   9802  H  HA   . HIS A 1 42 ? 4.942   -2.156  -11.365 1.00 0.00 ? 42  HIS A HA   15 
ATOM   9803  H  HB2  . HIS A 1 42 ? 2.635   -2.190  -13.321 1.00 0.00 ? 42  HIS A HB2  15 
ATOM   9804  H  HB3  . HIS A 1 42 ? 3.401   -3.629  -12.653 1.00 0.00 ? 42  HIS A HB3  15 
ATOM   9805  H  HD1  . HIS A 1 42 ? 0.365   -2.705  -12.244 1.00 0.00 ? 42  HIS A HD1  15 
ATOM   9806  H  HD2  . HIS A 1 42 ? 3.469   -2.329  -9.508  1.00 0.00 ? 42  HIS A HD2  15 
ATOM   9807  H  HE1  . HIS A 1 42 ? -0.739  -2.568  -9.989  1.00 0.00 ? 42  HIS A HE1  15 
ATOM   9808  N  N    . ASP A 1 43 ? 6.670   -1.724  -13.252 1.00 0.00 ? 43  ASP A N    15 
ATOM   9809  C  CA   . ASP A 1 43 ? 7.667   -1.893  -14.303 1.00 0.00 ? 43  ASP A CA   15 
ATOM   9810  C  C    . ASP A 1 43 ? 8.481   -3.164  -14.080 1.00 0.00 ? 43  ASP A C    15 
ATOM   9811  O  O    . ASP A 1 43 ? 9.184   -3.295  -13.077 1.00 0.00 ? 43  ASP A O    15 
ATOM   9812  C  CB   . ASP A 1 43 ? 8.597   -0.680  -14.354 1.00 0.00 ? 43  ASP A CB   15 
ATOM   9813  C  CG   . ASP A 1 43 ? 8.018   0.459   -15.169 1.00 0.00 ? 43  ASP A CG   15 
ATOM   9814  O  OD1  . ASP A 1 43 ? 6.901   0.913   -14.844 1.00 0.00 ? 43  ASP A OD1  15 
ATOM   9815  O  OD2  . ASP A 1 43 ? 8.682   0.897   -16.133 1.00 0.00 ? 43  ASP A OD2  15 
ATOM   9816  H  H    . ASP A 1 43 ? 6.950   -1.373  -12.380 1.00 0.00 ? 43  ASP A H    15 
ATOM   9817  H  HA   . ASP A 1 43 ? 7.146   -1.975  -15.244 1.00 0.00 ? 43  ASP A HA   15 
ATOM   9818  H  HB2  . ASP A 1 43 ? 8.772   -0.326  -13.348 1.00 0.00 ? 43  ASP A HB2  15 
ATOM   9819  H  HB3  . ASP A 1 43 ? 9.538   -0.974  -14.796 1.00 0.00 ? 43  ASP A HB3  15 
ATOM   9820  N  N    . ILE A 1 44 ? 8.380   -4.098  -15.019 1.00 0.00 ? 44  ILE A N    15 
ATOM   9821  C  CA   . ILE A 1 44 ? 9.106   -5.358  -14.925 1.00 0.00 ? 44  ILE A CA   15 
ATOM   9822  C  C    . ILE A 1 44 ? 10.546  -5.200  -15.402 1.00 0.00 ? 44  ILE A C    15 
ATOM   9823  O  O    . ILE A 1 44 ? 10.825  -5.265  -16.599 1.00 0.00 ? 44  ILE A O    15 
ATOM   9824  C  CB   . ILE A 1 44 ? 8.423   -6.465  -15.750 1.00 0.00 ? 44  ILE A CB   15 
ATOM   9825  C  CG1  . ILE A 1 44 ? 6.991   -6.688  -15.258 1.00 0.00 ? 44  ILE A CG1  15 
ATOM   9826  C  CG2  . ILE A 1 44 ? 9.224   -7.756  -15.670 1.00 0.00 ? 44  ILE A CG2  15 
ATOM   9827  C  CD1  . ILE A 1 44 ? 6.912   -7.144  -13.817 1.00 0.00 ? 44  ILE A CD1  15 
ATOM   9828  H  H    . ILE A 1 44 ? 7.804   -3.935  -15.795 1.00 0.00 ? 44  ILE A H    15 
ATOM   9829  H  HA   . ILE A 1 44 ? 9.113   -5.662  -13.888 1.00 0.00 ? 44  ILE A HA   15 
ATOM   9830  H  HB   . ILE A 1 44 ? 8.396   -6.150  -16.782 1.00 0.00 ? 44  ILE A HB   15 
ATOM   9831  H  HG12 . ILE A 1 44 ? 6.440   -5.766  -15.344 1.00 0.00 ? 44  ILE A HG12 15 
ATOM   9832  H  HG13 . ILE A 1 44 ? 6.521   -7.443  -15.872 1.00 0.00 ? 44  ILE A HG13 15 
ATOM   9833  H  HG21 . ILE A 1 44 ? 10.193  -7.607  -16.122 1.00 0.00 ? 44  ILE A HG21 15 
ATOM   9834  H  HG22 . ILE A 1 44 ? 9.350   -8.037  -14.635 1.00 0.00 ? 44  ILE A HG22 15 
ATOM   9835  H  HG23 . ILE A 1 44 ? 8.698   -8.539  -16.195 1.00 0.00 ? 44  ILE A HG23 15 
ATOM   9836  H  HD11 . ILE A 1 44 ? 6.364   -6.415  -13.238 1.00 0.00 ? 44  ILE A HD11 15 
ATOM   9837  H  HD12 . ILE A 1 44 ? 6.408   -8.097  -13.768 1.00 0.00 ? 44  ILE A HD12 15 
ATOM   9838  H  HD13 . ILE A 1 44 ? 7.910   -7.244  -13.416 1.00 0.00 ? 44  ILE A HD13 15 
ATOM   9839  N  N    . SER A 1 45 ? 11.457  -4.994  -14.456 1.00 0.00 ? 45  SER A N    15 
ATOM   9840  C  CA   . SER A 1 45 ? 12.869  -4.824  -14.779 1.00 0.00 ? 45  SER A CA   15 
ATOM   9841  C  C    . SER A 1 45 ? 13.431  -6.082  -15.434 1.00 0.00 ? 45  SER A C    15 
ATOM   9842  O  O    . SER A 1 45 ? 14.080  -6.016  -16.477 1.00 0.00 ? 45  SER A O    15 
ATOM   9843  C  CB   . SER A 1 45 ? 13.667  -4.493  -13.516 1.00 0.00 ? 45  SER A CB   15 
ATOM   9844  O  OG   . SER A 1 45 ? 13.469  -5.476  -12.516 1.00 0.00 ? 45  SER A OG   15 
ATOM   9845  H  H    . SER A 1 45 ? 11.172  -4.952  -13.519 1.00 0.00 ? 45  SER A H    15 
ATOM   9846  H  HA   . SER A 1 45 ? 12.954  -4.002  -15.474 1.00 0.00 ? 45  SER A HA   15 
ATOM   9847  H  HB2  . SER A 1 45 ? 14.717  -4.449  -13.759 1.00 0.00 ? 45  SER A HB2  15 
ATOM   9848  H  HB3  . SER A 1 45 ? 13.345  -3.535  -13.132 1.00 0.00 ? 45  SER A HB3  15 
ATOM   9849  H  HG   . SER A 1 45 ? 12.575  -5.820  -12.576 1.00 0.00 ? 45  SER A HG   15 
ATOM   9850  N  N    . GLY A 1 46 ? 13.177  -7.230  -14.812 1.00 0.00 ? 46  GLY A N    15 
ATOM   9851  C  CA   . GLY A 1 46 ? 13.664  -8.488  -15.347 1.00 0.00 ? 46  GLY A CA   15 
ATOM   9852  C  C    . GLY A 1 46 ? 15.122  -8.734  -15.012 1.00 0.00 ? 46  GLY A C    15 
ATOM   9853  O  O    . GLY A 1 46 ? 15.924  -7.806  -14.913 1.00 0.00 ? 46  GLY A O    15 
ATOM   9854  H  H    . GLY A 1 46 ? 12.654  -7.222  -13.983 1.00 0.00 ? 46  GLY A H    15 
ATOM   9855  H  HA2  . GLY A 1 46 ? 13.071  -9.293  -14.942 1.00 0.00 ? 46  GLY A HA2  15 
ATOM   9856  H  HA3  . GLY A 1 46 ? 13.551  -8.476  -16.421 1.00 0.00 ? 46  GLY A HA3  15 
ATOM   9857  N  N    . PRO A 1 47 ? 15.483  -10.013 -14.829 1.00 0.00 ? 47  PRO A N    15 
ATOM   9858  C  CA   . PRO A 1 47 ? 16.855  -10.409 -14.499 1.00 0.00 ? 47  PRO A CA   15 
ATOM   9859  C  C    . PRO A 1 47 ? 17.814  -10.203 -15.666 1.00 0.00 ? 47  PRO A C    15 
ATOM   9860  O  O    . PRO A 1 47 ? 18.909  -9.666  -15.494 1.00 0.00 ? 47  PRO A O    15 
ATOM   9861  C  CB   . PRO A 1 47 ? 16.725  -11.899 -14.170 1.00 0.00 ? 47  PRO A CB   15 
ATOM   9862  C  CG   . PRO A 1 47 ? 15.516  -12.347 -14.916 1.00 0.00 ? 47  PRO A CG   15 
ATOM   9863  C  CD   . PRO A 1 47 ? 14.579  -11.171 -14.932 1.00 0.00 ? 47  PRO A CD   15 
ATOM   9864  H  HA   . PRO A 1 47 ? 17.223  -9.879  -13.633 1.00 0.00 ? 47  PRO A HA   15 
ATOM   9865  H  HB2  . PRO A 1 47 ? 17.611  -12.422 -14.501 1.00 0.00 ? 47  PRO A HB2  15 
ATOM   9866  H  HB3  . PRO A 1 47 ? 16.601  -12.027 -13.105 1.00 0.00 ? 47  PRO A HB3  15 
ATOM   9867  H  HG2  . PRO A 1 47 ? 15.788  -12.623 -15.924 1.00 0.00 ? 47  PRO A HG2  15 
ATOM   9868  H  HG3  . PRO A 1 47 ? 15.060  -13.183 -14.407 1.00 0.00 ? 47  PRO A HG3  15 
ATOM   9869  H  HD2  . PRO A 1 47 ? 14.021  -11.145 -15.856 1.00 0.00 ? 47  PRO A HD2  15 
ATOM   9870  H  HD3  . PRO A 1 47 ? 13.908  -11.212 -14.086 1.00 0.00 ? 47  PRO A HD3  15 
ATOM   9871  N  N    . SER A 1 48 ? 17.397  -10.633 -16.852 1.00 0.00 ? 48  SER A N    15 
ATOM   9872  C  CA   . SER A 1 48 ? 18.222  -10.498 -18.047 1.00 0.00 ? 48  SER A CA   15 
ATOM   9873  C  C    . SER A 1 48 ? 17.422  -9.884  -19.193 1.00 0.00 ? 48  SER A C    15 
ATOM   9874  O  O    . SER A 1 48 ? 17.646  -8.736  -19.575 1.00 0.00 ? 48  SER A O    15 
ATOM   9875  C  CB   . SER A 1 48 ? 18.774  -11.861 -18.468 1.00 0.00 ? 48  SER A CB   15 
ATOM   9876  O  OG   . SER A 1 48 ? 19.741  -12.328 -17.543 1.00 0.00 ? 48  SER A OG   15 
ATOM   9877  H  H    . SER A 1 48 ? 16.515  -11.053 -16.925 1.00 0.00 ? 48  SER A H    15 
ATOM   9878  H  HA   . SER A 1 48 ? 19.047  -9.843  -17.809 1.00 0.00 ? 48  SER A HA   15 
ATOM   9879  H  HB2  . SER A 1 48 ? 17.965  -12.575 -18.516 1.00 0.00 ? 48  SER A HB2  15 
ATOM   9880  H  HB3  . SER A 1 48 ? 19.236  -11.774 -19.441 1.00 0.00 ? 48  SER A HB3  15 
ATOM   9881  H  HG   . SER A 1 48 ? 20.399  -11.644 -17.396 1.00 0.00 ? 48  SER A HG   15 
ATOM   9882  N  N    . SER A 1 49 ? 16.488  -10.659 -19.735 1.00 0.00 ? 49  SER A N    15 
ATOM   9883  C  CA   . SER A 1 49 ? 15.657  -10.194 -20.840 1.00 0.00 ? 49  SER A CA   15 
ATOM   9884  C  C    . SER A 1 49 ? 14.178  -10.414 -20.536 1.00 0.00 ? 49  SER A C    15 
ATOM   9885  O  O    . SER A 1 49 ? 13.414  -10.850 -21.396 1.00 0.00 ? 49  SER A O    15 
ATOM   9886  C  CB   . SER A 1 49 ? 16.037  -10.919 -22.132 1.00 0.00 ? 49  SER A CB   15 
ATOM   9887  O  OG   . SER A 1 49 ? 17.423  -10.793 -22.399 1.00 0.00 ? 49  SER A OG   15 
ATOM   9888  H  H    . SER A 1 49 ? 16.357  -11.565 -19.386 1.00 0.00 ? 49  SER A H    15 
ATOM   9889  H  HA   . SER A 1 49 ? 15.833  -9.136  -20.965 1.00 0.00 ? 49  SER A HA   15 
ATOM   9890  H  HB2  . SER A 1 49 ? 15.795  -11.967 -22.039 1.00 0.00 ? 49  SER A HB2  15 
ATOM   9891  H  HB3  . SER A 1 49 ? 15.483  -10.494 -22.957 1.00 0.00 ? 49  SER A HB3  15 
ATOM   9892  H  HG   . SER A 1 49 ? 17.760  -10.000 -21.975 1.00 0.00 ? 49  SER A HG   15 
ATOM   9893  N  N    . GLY A 1 50 ? 13.781  -10.108 -19.305 1.00 0.00 ? 50  GLY A N    15 
ATOM   9894  C  CA   . GLY A 1 50 ? 12.396  -10.279 -18.908 1.00 0.00 ? 50  GLY A CA   15 
ATOM   9895  C  C    . GLY A 1 50 ? 11.434  -9.566  -19.838 1.00 0.00 ? 50  GLY A C    15 
ATOM   9896  O  O    . GLY A 1 50 ? 10.274  -9.383  -19.474 1.00 0.00 ? 50  GLY A O    15 
ATOM   9897  H  H    . GLY A 1 50 ? 14.435  -9.764  -18.660 1.00 0.00 ? 50  GLY A H    15 
ATOM   9898  H  HA2  . GLY A 1 50 ? 12.161  -11.333 -18.903 1.00 0.00 ? 50  GLY A HA2  15 
ATOM   9899  H  HA3  . GLY A 1 50 ? 12.269  -9.887  -17.909 1.00 0.00 ? 50  GLY A HA3  15 
HETATM 9900  ZN ZN   . ZN  B 2 .  ? 0.517   -2.247  -7.421  1.00 0.00 ? 201 ZN  A ZN   15 
ATOM   9901  N  N    . GLY A 1 1  ? 5.302   20.218  -13.106 1.00 0.00 ? 1   GLY A N    16 
ATOM   9902  C  CA   . GLY A 1 1  ? 6.148   21.375  -13.337 1.00 0.00 ? 1   GLY A CA   16 
ATOM   9903  C  C    . GLY A 1 1  ? 5.347   22.636  -13.596 1.00 0.00 ? 1   GLY A C    16 
ATOM   9904  O  O    . GLY A 1 1  ? 4.122   22.591  -13.699 1.00 0.00 ? 1   GLY A O    16 
ATOM   9905  H  H1   . GLY A 1 1  ? 4.335   20.286  -13.245 1.00 0.00 ? 1   GLY A H1   16 
ATOM   9906  H  HA2  . GLY A 1 1  ? 6.773   21.529  -12.469 1.00 0.00 ? 1   GLY A HA2  16 
ATOM   9907  H  HA3  . GLY A 1 1  ? 6.778   21.181  -14.192 1.00 0.00 ? 1   GLY A HA3  16 
ATOM   9908  N  N    . SER A 1 2  ? 6.041   23.765  -13.699 1.00 0.00 ? 2   SER A N    16 
ATOM   9909  C  CA   . SER A 1 2  ? 5.386   25.045  -13.942 1.00 0.00 ? 2   SER A CA   16 
ATOM   9910  C  C    . SER A 1 2  ? 5.341   25.358  -15.435 1.00 0.00 ? 2   SER A C    16 
ATOM   9911  O  O    . SER A 1 2  ? 6.319   25.149  -16.154 1.00 0.00 ? 2   SER A O    16 
ATOM   9912  C  CB   . SER A 1 2  ? 6.116   26.165  -13.197 1.00 0.00 ? 2   SER A CB   16 
ATOM   9913  O  OG   . SER A 1 2  ? 6.213   25.877  -11.813 1.00 0.00 ? 2   SER A OG   16 
ATOM   9914  H  H    . SER A 1 2  ? 7.017   23.736  -13.608 1.00 0.00 ? 2   SER A H    16 
ATOM   9915  H  HA   . SER A 1 2  ? 4.375   24.976  -13.570 1.00 0.00 ? 2   SER A HA   16 
ATOM   9916  H  HB2  . SER A 1 2  ? 7.111   26.273  -13.600 1.00 0.00 ? 2   SER A HB2  16 
ATOM   9917  H  HB3  . SER A 1 2  ? 5.573   27.090  -13.323 1.00 0.00 ? 2   SER A HB3  16 
ATOM   9918  H  HG   . SER A 1 2  ? 6.581   26.635  -11.353 1.00 0.00 ? 2   SER A HG   16 
ATOM   9919  N  N    . SER A 1 3  ? 4.199   25.859  -15.894 1.00 0.00 ? 3   SER A N    16 
ATOM   9920  C  CA   . SER A 1 3  ? 4.024   26.198  -17.301 1.00 0.00 ? 3   SER A CA   16 
ATOM   9921  C  C    . SER A 1 3  ? 4.412   27.649  -17.564 1.00 0.00 ? 3   SER A C    16 
ATOM   9922  O  O    . SER A 1 3  ? 5.263   27.933  -18.406 1.00 0.00 ? 3   SER A O    16 
ATOM   9923  C  CB   . SER A 1 3  ? 2.573   25.961  -17.727 1.00 0.00 ? 3   SER A CB   16 
ATOM   9924  O  OG   . SER A 1 3  ? 2.397   26.233  -19.107 1.00 0.00 ? 3   SER A OG   16 
ATOM   9925  H  H    . SER A 1 3  ? 3.456   26.003  -15.271 1.00 0.00 ? 3   SER A H    16 
ATOM   9926  H  HA   . SER A 1 3  ? 4.669   25.554  -17.880 1.00 0.00 ? 3   SER A HA   16 
ATOM   9927  H  HB2  . SER A 1 3  ? 2.309   24.932  -17.539 1.00 0.00 ? 3   SER A HB2  16 
ATOM   9928  H  HB3  . SER A 1 3  ? 1.924   26.610  -17.158 1.00 0.00 ? 3   SER A HB3  16 
ATOM   9929  H  HG   . SER A 1 3  ? 3.001   25.692  -19.620 1.00 0.00 ? 3   SER A HG   16 
ATOM   9930  N  N    . GLY A 1 4  ? 3.782   28.565  -16.835 1.00 0.00 ? 4   GLY A N    16 
ATOM   9931  C  CA   . GLY A 1 4  ? 4.074   29.977  -17.003 1.00 0.00 ? 4   GLY A CA   16 
ATOM   9932  C  C    . GLY A 1 4  ? 4.924   30.531  -15.877 1.00 0.00 ? 4   GLY A C    16 
ATOM   9933  O  O    . GLY A 1 4  ? 5.975   29.977  -15.553 1.00 0.00 ? 4   GLY A O    16 
ATOM   9934  H  H    . GLY A 1 4  ? 3.112   28.280  -16.178 1.00 0.00 ? 4   GLY A H    16 
ATOM   9935  H  HA2  . GLY A 1 4  ? 4.597   30.116  -17.937 1.00 0.00 ? 4   GLY A HA2  16 
ATOM   9936  H  HA3  . GLY A 1 4  ? 3.143   30.524  -17.038 1.00 0.00 ? 4   GLY A HA3  16 
ATOM   9937  N  N    . SER A 1 5  ? 4.471   31.629  -15.280 1.00 0.00 ? 5   SER A N    16 
ATOM   9938  C  CA   . SER A 1 5  ? 5.201   32.261  -14.188 1.00 0.00 ? 5   SER A CA   16 
ATOM   9939  C  C    . SER A 1 5  ? 5.587   31.235  -13.126 1.00 0.00 ? 5   SER A C    16 
ATOM   9940  O  O    . SER A 1 5  ? 4.763   30.427  -12.700 1.00 0.00 ? 5   SER A O    16 
ATOM   9941  C  CB   . SER A 1 5  ? 4.357   33.371  -13.557 1.00 0.00 ? 5   SER A CB   16 
ATOM   9942  O  OG   . SER A 1 5  ? 3.105   32.872  -13.119 1.00 0.00 ? 5   SER A OG   16 
ATOM   9943  H  H    . SER A 1 5  ? 3.627   32.024  -15.584 1.00 0.00 ? 5   SER A H    16 
ATOM   9944  H  HA   . SER A 1 5  ? 6.101   32.694  -14.597 1.00 0.00 ? 5   SER A HA   16 
ATOM   9945  H  HB2  . SER A 1 5  ? 4.883   33.783  -12.710 1.00 0.00 ? 5   SER A HB2  16 
ATOM   9946  H  HB3  . SER A 1 5  ? 4.186   34.148  -14.288 1.00 0.00 ? 5   SER A HB3  16 
ATOM   9947  H  HG   . SER A 1 5  ? 3.242   32.089  -12.581 1.00 0.00 ? 5   SER A HG   16 
ATOM   9948  N  N    . SER A 1 6  ? 6.847   31.275  -12.704 1.00 0.00 ? 6   SER A N    16 
ATOM   9949  C  CA   . SER A 1 6  ? 7.345   30.347  -11.696 1.00 0.00 ? 6   SER A CA   16 
ATOM   9950  C  C    . SER A 1 6  ? 7.974   31.100  -10.528 1.00 0.00 ? 6   SER A C    16 
ATOM   9951  O  O    . SER A 1 6  ? 8.927   31.857  -10.704 1.00 0.00 ? 6   SER A O    16 
ATOM   9952  C  CB   . SER A 1 6  ? 8.369   29.392  -12.312 1.00 0.00 ? 6   SER A CB   16 
ATOM   9953  O  OG   . SER A 1 6  ? 8.615   28.288  -11.459 1.00 0.00 ? 6   SER A OG   16 
ATOM   9954  H  H    . SER A 1 6  ? 7.457   31.943  -13.083 1.00 0.00 ? 6   SER A H    16 
ATOM   9955  H  HA   . SER A 1 6  ? 6.506   29.774  -11.330 1.00 0.00 ? 6   SER A HA   16 
ATOM   9956  H  HB2  . SER A 1 6  ? 7.994   29.026  -13.256 1.00 0.00 ? 6   SER A HB2  16 
ATOM   9957  H  HB3  . SER A 1 6  ? 9.297   29.921  -12.475 1.00 0.00 ? 6   SER A HB3  16 
ATOM   9958  H  HG   . SER A 1 6  ? 9.314   28.511  -10.840 1.00 0.00 ? 6   SER A HG   16 
ATOM   9959  N  N    . GLY A 1 7  ? 7.431   30.886  -9.333  1.00 0.00 ? 7   GLY A N    16 
ATOM   9960  C  CA   . GLY A 1 7  ? 7.951   31.552  -8.152  1.00 0.00 ? 7   GLY A CA   16 
ATOM   9961  C  C    . GLY A 1 7  ? 8.778   30.626  -7.282  1.00 0.00 ? 7   GLY A C    16 
ATOM   9962  O  O    . GLY A 1 7  ? 10.007  30.709  -7.269  1.00 0.00 ? 7   GLY A O    16 
ATOM   9963  H  H    . GLY A 1 7  ? 6.672   30.272  -9.252  1.00 0.00 ? 7   GLY A H    16 
ATOM   9964  H  HA2  . GLY A 1 7  ? 8.566   32.383  -8.463  1.00 0.00 ? 7   GLY A HA2  16 
ATOM   9965  H  HA3  . GLY A 1 7  ? 7.122   31.928  -7.571  1.00 0.00 ? 7   GLY A HA3  16 
ATOM   9966  N  N    . CYS A 1 8  ? 8.104   29.744  -6.553  1.00 0.00 ? 8   CYS A N    16 
ATOM   9967  C  CA   . CYS A 1 8  ? 8.785   28.801  -5.673  1.00 0.00 ? 8   CYS A CA   16 
ATOM   9968  C  C    . CYS A 1 8  ? 9.892   28.063  -6.419  1.00 0.00 ? 8   CYS A C    16 
ATOM   9969  O  O    . CYS A 1 8  ? 9.755   27.750  -7.603  1.00 0.00 ? 8   CYS A O    16 
ATOM   9970  C  CB   . CYS A 1 8  ? 7.785   27.797  -5.096  1.00 0.00 ? 8   CYS A CB   16 
ATOM   9971  S  SG   . CYS A 1 8  ? 6.896   28.396  -3.640  1.00 0.00 ? 8   CYS A SG   16 
ATOM   9972  H  H    . CYS A 1 8  ? 7.126   29.727  -6.606  1.00 0.00 ? 8   CYS A H    16 
ATOM   9973  H  HA   . CYS A 1 8  ? 9.226   29.362  -4.864  1.00 0.00 ? 8   CYS A HA   16 
ATOM   9974  H  HB2  . CYS A 1 8  ? 7.052   27.556  -5.851  1.00 0.00 ? 8   CYS A HB2  16 
ATOM   9975  H  HB3  . CYS A 1 8  ? 8.312   26.898  -4.814  1.00 0.00 ? 8   CYS A HB3  16 
ATOM   9976  H  HG   . CYS A 1 8  ? 7.733   29.130  -2.923  1.00 0.00 ? 8   CYS A HG   16 
ATOM   9977  N  N    . CYS A 1 9  ? 10.988  27.789  -5.721  1.00 0.00 ? 9   CYS A N    16 
ATOM   9978  C  CA   . CYS A 1 9  ? 12.120  27.089  -6.318  1.00 0.00 ? 9   CYS A CA   16 
ATOM   9979  C  C    . CYS A 1 9  ? 11.712  25.698  -6.791  1.00 0.00 ? 9   CYS A C    16 
ATOM   9980  O  O    . CYS A 1 9  ? 10.597  25.244  -6.529  1.00 0.00 ? 9   CYS A O    16 
ATOM   9981  C  CB   . CYS A 1 9  ? 13.268  26.984  -5.313  1.00 0.00 ? 9   CYS A CB   16 
ATOM   9982  S  SG   . CYS A 1 9  ? 12.922  25.900  -3.908  1.00 0.00 ? 9   CYS A SG   16 
ATOM   9983  H  H    . CYS A 1 9  ? 11.038  28.063  -4.781  1.00 0.00 ? 9   CYS A H    16 
ATOM   9984  H  HA   . CYS A 1 9  ? 12.451  27.663  -7.170  1.00 0.00 ? 9   CYS A HA   16 
ATOM   9985  H  HB2  . CYS A 1 9  ? 14.143  26.598  -5.817  1.00 0.00 ? 9   CYS A HB2  16 
ATOM   9986  H  HB3  . CYS A 1 9  ? 13.489  27.967  -4.926  1.00 0.00 ? 9   CYS A HB3  16 
ATOM   9987  H  HG   . CYS A 1 9  ? 12.220  24.868  -4.351  1.00 0.00 ? 9   CYS A HG   16 
ATOM   9988  N  N    . LEU A 1 10 ? 12.620  25.026  -7.489  1.00 0.00 ? 10  LEU A N    16 
ATOM   9989  C  CA   . LEU A 1 10 ? 12.355  23.686  -8.001  1.00 0.00 ? 10  LEU A CA   16 
ATOM   9990  C  C    . LEU A 1 10 ? 12.954  22.624  -7.083  1.00 0.00 ? 10  LEU A C    16 
ATOM   9991  O  O    . LEU A 1 10 ? 14.041  22.789  -6.529  1.00 0.00 ? 10  LEU A O    16 
ATOM   9992  C  CB   . LEU A 1 10 ? 12.923  23.536  -9.413  1.00 0.00 ? 10  LEU A CB   16 
ATOM   9993  C  CG   . LEU A 1 10 ? 11.998  23.952  -10.557 1.00 0.00 ? 10  LEU A CG   16 
ATOM   9994  C  CD1  . LEU A 1 10 ? 10.731  23.111  -10.552 1.00 0.00 ? 10  LEU A CD1  16 
ATOM   9995  C  CD2  . LEU A 1 10 ? 11.659  25.432  -10.456 1.00 0.00 ? 10  LEU A CD2  16 
ATOM   9996  H  H    . LEU A 1 10 ? 13.490  25.440  -7.666  1.00 0.00 ? 10  LEU A H    16 
ATOM   9997  H  HA   . LEU A 1 10 ? 11.284  23.551  -8.036  1.00 0.00 ? 10  LEU A HA   16 
ATOM   9998  H  HB2  . LEU A 1 10 ? 13.817  24.137  -9.475  1.00 0.00 ? 10  LEU A HB2  16 
ATOM   9999  H  HB3  . LEU A 1 10 ? 13.180  22.496  -9.556  1.00 0.00 ? 10  LEU A HB3  16 
ATOM   10000 H  HG   . LEU A 1 10 ? 12.504  23.787  -11.498 1.00 0.00 ? 10  LEU A HG   16 
ATOM   10001 H  HD11 . LEU A 1 10 ? 10.169  23.301  -11.453 1.00 0.00 ? 10  LEU A HD11 16 
ATOM   10002 H  HD12 . LEU A 1 10 ? 10.131  23.370  -9.692  1.00 0.00 ? 10  LEU A HD12 16 
ATOM   10003 H  HD13 . LEU A 1 10 ? 10.994  22.065  -10.504 1.00 0.00 ? 10  LEU A HD13 16 
ATOM   10004 H  HD21 . LEU A 1 10 ? 11.754  25.754  -9.429  1.00 0.00 ? 10  LEU A HD21 16 
ATOM   10005 H  HD22 . LEU A 1 10 ? 10.644  25.592  -10.791 1.00 0.00 ? 10  LEU A HD22 16 
ATOM   10006 H  HD23 . LEU A 1 10 ? 12.337  26.000  -11.076 1.00 0.00 ? 10  LEU A HD23 16 
ATOM   10007 N  N    . PRO A 1 11 ? 12.230  21.507  -6.920  1.00 0.00 ? 11  PRO A N    16 
ATOM   10008 C  CA   . PRO A 1 11 ? 12.671  20.395  -6.072  1.00 0.00 ? 11  PRO A CA   16 
ATOM   10009 C  C    . PRO A 1 11 ? 13.864  19.653  -6.665  1.00 0.00 ? 11  PRO A C    16 
ATOM   10010 O  O    . PRO A 1 11 ? 14.140  19.727  -7.863  1.00 0.00 ? 11  PRO A O    16 
ATOM   10011 C  CB   . PRO A 1 11 ? 11.445  19.481  -6.020  1.00 0.00 ? 11  PRO A CB   16 
ATOM   10012 C  CG   . PRO A 1 11 ? 10.693  19.784  -7.269  1.00 0.00 ? 11  PRO A CG   16 
ATOM   10013 C  CD   . PRO A 1 11 ? 10.925  21.243  -7.549  1.00 0.00 ? 11  PRO A CD   16 
ATOM   10014 H  HA   . PRO A 1 11 ? 12.916  20.730  -5.075  1.00 0.00 ? 11  PRO A HA   16 
ATOM   10015 H  HB2  . PRO A 1 11 ? 11.764  18.448  -5.990  1.00 0.00 ? 11  PRO A HB2  16 
ATOM   10016 H  HB3  . PRO A 1 11 ? 10.859  19.708  -5.142  1.00 0.00 ? 11  PRO A HB3  16 
ATOM   10017 H  HG2  . PRO A 1 11 ? 11.071  19.181  -8.081  1.00 0.00 ? 11  PRO A HG2  16 
ATOM   10018 H  HG3  . PRO A 1 11 ? 9.640   19.595  -7.119  1.00 0.00 ? 11  PRO A HG3  16 
ATOM   10019 H  HD2  . PRO A 1 11 ? 10.968  21.421  -8.614  1.00 0.00 ? 11  PRO A HD2  16 
ATOM   10020 H  HD3  . PRO A 1 11 ? 10.150  21.842  -7.095  1.00 0.00 ? 11  PRO A HD3  16 
ATOM   10021 N  N    . PRO A 1 12 ? 14.591  18.919  -5.809  1.00 0.00 ? 12  PRO A N    16 
ATOM   10022 C  CA   . PRO A 1 12 ? 15.765  18.148  -6.226  1.00 0.00 ? 12  PRO A CA   16 
ATOM   10023 C  C    . PRO A 1 12 ? 15.395  16.949  -7.092  1.00 0.00 ? 12  PRO A C    16 
ATOM   10024 O  O    . PRO A 1 12 ? 14.453  16.218  -6.786  1.00 0.00 ? 12  PRO A O    16 
ATOM   10025 C  CB   . PRO A 1 12 ? 16.373  17.683  -4.900  1.00 0.00 ? 12  PRO A CB   16 
ATOM   10026 C  CG   . PRO A 1 12 ? 15.230  17.665  -3.945  1.00 0.00 ? 12  PRO A CG   16 
ATOM   10027 C  CD   . PRO A 1 12 ? 14.320  18.785  -4.367  1.00 0.00 ? 12  PRO A CD   16 
ATOM   10028 H  HA   . PRO A 1 12 ? 16.478  18.765  -6.753  1.00 0.00 ? 12  PRO A HA   16 
ATOM   10029 H  HB2  . PRO A 1 12 ? 16.801  16.698  -5.024  1.00 0.00 ? 12  PRO A HB2  16 
ATOM   10030 H  HB3  . PRO A 1 12 ? 17.138  18.377  -4.587  1.00 0.00 ? 12  PRO A HB3  16 
ATOM   10031 H  HG2  . PRO A 1 12 ? 14.715  16.719  -4.007  1.00 0.00 ? 12  PRO A HG2  16 
ATOM   10032 H  HG3  . PRO A 1 12 ? 15.589  17.833  -2.940  1.00 0.00 ? 12  PRO A HG3  16 
ATOM   10033 H  HD2  . PRO A 1 12 ? 13.288  18.519  -4.192  1.00 0.00 ? 12  PRO A HD2  16 
ATOM   10034 H  HD3  . PRO A 1 12 ? 14.572  19.694  -3.842  1.00 0.00 ? 12  PRO A HD3  16 
ATOM   10035 N  N    . ALA A 1 13 ? 16.141  16.753  -8.174  1.00 0.00 ? 13  ALA A N    16 
ATOM   10036 C  CA   . ALA A 1 13 ? 15.892  15.641  -9.082  1.00 0.00 ? 13  ALA A CA   16 
ATOM   10037 C  C    . ALA A 1 13 ? 15.838  14.317  -8.328  1.00 0.00 ? 13  ALA A C    16 
ATOM   10038 O  O    . ALA A 1 13 ? 16.280  14.224  -7.182  1.00 0.00 ? 13  ALA A O    16 
ATOM   10039 C  CB   . ALA A 1 13 ? 16.962  15.592  -10.163 1.00 0.00 ? 13  ALA A CB   16 
ATOM   10040 H  H    . ALA A 1 13 ? 16.878  17.370  -8.364  1.00 0.00 ? 13  ALA A H    16 
ATOM   10041 H  HA   . ALA A 1 13 ? 14.938  15.809  -9.562  1.00 0.00 ? 13  ALA A HA   16 
ATOM   10042 H  HB1  . ALA A 1 13 ? 16.785  16.381  -10.879 1.00 0.00 ? 13  ALA A HB1  16 
ATOM   10043 H  HB2  . ALA A 1 13 ? 17.934  15.726  -9.712  1.00 0.00 ? 13  ALA A HB2  16 
ATOM   10044 H  HB3  . ALA A 1 13 ? 16.925  14.636  -10.663 1.00 0.00 ? 13  ALA A HB3  16 
ATOM   10045 N  N    . THR A 1 14 ? 15.293  13.293  -8.977  1.00 0.00 ? 14  THR A N    16 
ATOM   10046 C  CA   . THR A 1 14 ? 15.180  11.974  -8.367  1.00 0.00 ? 14  THR A CA   16 
ATOM   10047 C  C    . THR A 1 14 ? 16.164  10.992  -8.992  1.00 0.00 ? 14  THR A C    16 
ATOM   10048 O  O    . THR A 1 14 ? 16.343  10.968  -10.210 1.00 0.00 ? 14  THR A O    16 
ATOM   10049 C  CB   . THR A 1 14 ? 13.753  11.411  -8.506  1.00 0.00 ? 14  THR A CB   16 
ATOM   10050 O  OG1  . THR A 1 14 ? 12.807  12.331  -7.950  1.00 0.00 ? 14  THR A OG1  16 
ATOM   10051 C  CG2  . THR A 1 14 ? 13.631  10.066  -7.807  1.00 0.00 ? 14  THR A CG2  16 
ATOM   10052 H  H    . THR A 1 14 ? 14.959  13.429  -9.888  1.00 0.00 ? 14  THR A H    16 
ATOM   10053 H  HA   . THR A 1 14 ? 15.404  12.073  -7.314  1.00 0.00 ? 14  THR A HA   16 
ATOM   10054 H  HB   . THR A 1 14 ? 13.537  11.275  -9.556  1.00 0.00 ? 14  THR A HB   16 
ATOM   10055 H  HG1  . THR A 1 14 ? 12.031  11.851  -7.651  1.00 0.00 ? 14  THR A HG1  16 
ATOM   10056 H  HG21 . THR A 1 14 ? 12.703  9.594   -8.093  1.00 0.00 ? 14  THR A HG21 16 
ATOM   10057 H  HG22 . THR A 1 14 ? 13.646  10.213  -6.737  1.00 0.00 ? 14  THR A HG22 16 
ATOM   10058 H  HG23 . THR A 1 14 ? 14.459  9.435   -8.094  1.00 0.00 ? 14  THR A HG23 16 
ATOM   10059 N  N    . HIS A 1 15 ? 16.801  10.183  -8.151  1.00 0.00 ? 15  HIS A N    16 
ATOM   10060 C  CA   . HIS A 1 15 ? 17.767  9.198   -8.622  1.00 0.00 ? 15  HIS A CA   16 
ATOM   10061 C  C    . HIS A 1 15 ? 17.087  8.140   -9.487  1.00 0.00 ? 15  HIS A C    16 
ATOM   10062 O  O    . HIS A 1 15 ? 17.457  7.938   -10.643 1.00 0.00 ? 15  HIS A O    16 
ATOM   10063 C  CB   . HIS A 1 15 ? 18.467  8.531   -7.437  1.00 0.00 ? 15  HIS A CB   16 
ATOM   10064 C  CG   . HIS A 1 15 ? 19.731  7.819   -7.811  1.00 0.00 ? 15  HIS A CG   16 
ATOM   10065 N  ND1  . HIS A 1 15 ? 19.781  6.831   -8.771  1.00 0.00 ? 15  HIS A ND1  16 
ATOM   10066 C  CD2  . HIS A 1 15 ? 20.995  7.958   -7.350  1.00 0.00 ? 15  HIS A CD2  16 
ATOM   10067 C  CE1  . HIS A 1 15 ? 21.022  6.391   -8.883  1.00 0.00 ? 15  HIS A CE1  16 
ATOM   10068 N  NE2  . HIS A 1 15 ? 21.779  7.059   -8.031  1.00 0.00 ? 15  HIS A NE2  16 
ATOM   10069 H  H    . HIS A 1 15 ? 16.616  10.250  -7.191  1.00 0.00 ? 15  HIS A H    16 
ATOM   10070 H  HA   . HIS A 1 15 ? 18.503  9.714   -9.220  1.00 0.00 ? 15  HIS A HA   16 
ATOM   10071 H  HB2  . HIS A 1 15 ? 18.716  9.285   -6.705  1.00 0.00 ? 15  HIS A HB2  16 
ATOM   10072 H  HB3  . HIS A 1 15 ? 17.798  7.810   -6.991  1.00 0.00 ? 15  HIS A HB3  16 
ATOM   10073 H  HD1  . HIS A 1 15 ? 19.021  6.499   -9.292  1.00 0.00 ? 15  HIS A HD1  16 
ATOM   10074 H  HD2  . HIS A 1 15 ? 21.328  8.648   -6.586  1.00 0.00 ? 15  HIS A HD2  16 
ATOM   10075 H  HE1  . HIS A 1 15 ? 21.361  5.618   -9.555  1.00 0.00 ? 15  HIS A HE1  16 
ATOM   10076 N  N    . ARG A 1 16 ? 16.092  7.468   -8.917  1.00 0.00 ? 16  ARG A N    16 
ATOM   10077 C  CA   . ARG A 1 16 ? 15.362  6.430   -9.635  1.00 0.00 ? 16  ARG A CA   16 
ATOM   10078 C  C    . ARG A 1 16 ? 15.234  6.780   -11.115 1.00 0.00 ? 16  ARG A C    16 
ATOM   10079 O  O    . ARG A 1 16 ? 15.124  7.946   -11.496 1.00 0.00 ? 16  ARG A O    16 
ATOM   10080 C  CB   . ARG A 1 16 ? 13.973  6.238   -9.024  1.00 0.00 ? 16  ARG A CB   16 
ATOM   10081 C  CG   . ARG A 1 16 ? 13.950  5.264   -7.858  1.00 0.00 ? 16  ARG A CG   16 
ATOM   10082 C  CD   . ARG A 1 16 ? 12.749  5.503   -6.956  1.00 0.00 ? 16  ARG A CD   16 
ATOM   10083 N  NE   . ARG A 1 16 ? 12.386  4.307   -6.200  1.00 0.00 ? 16  ARG A NE   16 
ATOM   10084 C  CZ   . ARG A 1 16 ? 11.496  4.304   -5.213  1.00 0.00 ? 16  ARG A CZ   16 
ATOM   10085 N  NH1  . ARG A 1 16 ? 10.882  5.426   -4.866  1.00 0.00 ? 16  ARG A NH1  16 
ATOM   10086 N  NH2  . ARG A 1 16 ? 11.219  3.175   -4.573  1.00 0.00 ? 16  ARG A NH2  16 
ATOM   10087 H  H    . ARG A 1 16 ? 15.843  7.674   -7.992  1.00 0.00 ? 16  ARG A H    16 
ATOM   10088 H  HA   . ARG A 1 16 ? 15.917  5.509   -9.542  1.00 0.00 ? 16  ARG A HA   16 
ATOM   10089 H  HB2  . ARG A 1 16 ? 13.611  7.194   -8.673  1.00 0.00 ? 16  ARG A HB2  16 
ATOM   10090 H  HB3  . ARG A 1 16 ? 13.305  5.868   -9.787  1.00 0.00 ? 16  ARG A HB3  16 
ATOM   10091 H  HG2  . ARG A 1 16 ? 13.902  4.256   -8.243  1.00 0.00 ? 16  ARG A HG2  16 
ATOM   10092 H  HG3  . ARG A 1 16 ? 14.854  5.388   -7.280  1.00 0.00 ? 16  ARG A HG3  16 
ATOM   10093 H  HD2  . ARG A 1 16 ? 12.988  6.296   -6.263  1.00 0.00 ? 16  ARG A HD2  16 
ATOM   10094 H  HD3  . ARG A 1 16 ? 11.910  5.800   -7.567  1.00 0.00 ? 16  ARG A HD3  16 
ATOM   10095 H  HE   . ARG A 1 16 ? 12.828  3.467   -6.440  1.00 0.00 ? 16  ARG A HE   16 
ATOM   10096 H  HH11 . ARG A 1 16 ? 11.088  6.277   -5.348  1.00 0.00 ? 16  ARG A HH11 16 
ATOM   10097 H  HH12 . ARG A 1 16 ? 10.211  5.420   -4.124  1.00 0.00 ? 16  ARG A HH12 16 
ATOM   10098 H  HH21 . ARG A 1 16 ? 11.680  2.327   -4.832  1.00 0.00 ? 16  ARG A HH21 16 
ATOM   10099 H  HH22 . ARG A 1 16 ? 10.550  3.173   -3.831  1.00 0.00 ? 16  ARG A HH22 16 
ATOM   10100 N  N    . PRO A 1 17 ? 15.250  5.747   -11.971 1.00 0.00 ? 17  PRO A N    16 
ATOM   10101 C  CA   . PRO A 1 17 ? 15.137  5.920   -13.422 1.00 0.00 ? 17  PRO A CA   16 
ATOM   10102 C  C    . PRO A 1 17 ? 13.745  6.376   -13.845 1.00 0.00 ? 17  PRO A C    16 
ATOM   10103 O  O    . PRO A 1 17 ? 13.600  7.295   -14.652 1.00 0.00 ? 17  PRO A O    16 
ATOM   10104 C  CB   . PRO A 1 17 ? 15.430  4.521   -13.970 1.00 0.00 ? 17  PRO A CB   16 
ATOM   10105 C  CG   . PRO A 1 17 ? 15.064  3.596   -12.861 1.00 0.00 ? 17  PRO A CG   16 
ATOM   10106 C  CD   . PRO A 1 17 ? 15.378  4.331   -11.588 1.00 0.00 ? 17  PRO A CD   16 
ATOM   10107 H  HA   . PRO A 1 17 ? 15.872  6.617   -13.797 1.00 0.00 ? 17  PRO A HA   16 
ATOM   10108 H  HB2  . PRO A 1 17 ? 14.828  4.342   -14.850 1.00 0.00 ? 17  PRO A HB2  16 
ATOM   10109 H  HB3  . PRO A 1 17 ? 16.477  4.441   -14.221 1.00 0.00 ? 17  PRO A HB3  16 
ATOM   10110 H  HG2  . PRO A 1 17 ? 14.012  3.362   -12.910 1.00 0.00 ? 17  PRO A HG2  16 
ATOM   10111 H  HG3  . PRO A 1 17 ? 15.654  2.693   -12.927 1.00 0.00 ? 17  PRO A HG3  16 
ATOM   10112 H  HD2  . PRO A 1 17 ? 14.665  4.074   -10.818 1.00 0.00 ? 17  PRO A HD2  16 
ATOM   10113 H  HD3  . PRO A 1 17 ? 16.384  4.110   -11.262 1.00 0.00 ? 17  PRO A HD3  16 
ATOM   10114 N  N    . HIS A 1 18 ? 12.722  5.730   -13.295 1.00 0.00 ? 18  HIS A N    16 
ATOM   10115 C  CA   . HIS A 1 18 ? 11.341  6.071   -13.615 1.00 0.00 ? 18  HIS A CA   16 
ATOM   10116 C  C    . HIS A 1 18 ? 10.865  7.253   -12.777 1.00 0.00 ? 18  HIS A C    16 
ATOM   10117 O  O    . HIS A 1 18 ? 11.174  7.369   -11.591 1.00 0.00 ? 18  HIS A O    16 
ATOM   10118 C  CB   . HIS A 1 18 ? 10.429  4.866   -13.382 1.00 0.00 ? 18  HIS A CB   16 
ATOM   10119 C  CG   . HIS A 1 18 ? 10.741  3.698   -14.267 1.00 0.00 ? 18  HIS A CG   16 
ATOM   10120 N  ND1  . HIS A 1 18 ? 11.466  2.605   -13.842 1.00 0.00 ? 18  HIS A ND1  16 
ATOM   10121 C  CD2  . HIS A 1 18 ? 10.421  3.456   -15.559 1.00 0.00 ? 18  HIS A CD2  16 
ATOM   10122 C  CE1  . HIS A 1 18 ? 11.579  1.741   -14.835 1.00 0.00 ? 18  HIS A CE1  16 
ATOM   10123 N  NE2  . HIS A 1 18 ? 10.954  2.234   -15.889 1.00 0.00 ? 18  HIS A NE2  16 
ATOM   10124 H  H    . HIS A 1 18 ? 12.901  5.006   -12.659 1.00 0.00 ? 18  HIS A H    16 
ATOM   10125 H  HA   . HIS A 1 18 ? 11.300  6.345   -14.658 1.00 0.00 ? 18  HIS A HA   16 
ATOM   10126 H  HB2  . HIS A 1 18 ? 10.528  4.540   -12.357 1.00 0.00 ? 18  HIS A HB2  16 
ATOM   10127 H  HB3  . HIS A 1 18 ? 9.404   5.157   -13.565 1.00 0.00 ? 18  HIS A HB3  16 
ATOM   10128 H  HD1  . HIS A 1 18 ? 11.842  2.481   -12.946 1.00 0.00 ? 18  HIS A HD1  16 
ATOM   10129 H  HD2  . HIS A 1 18 ? 9.852   4.104   -16.212 1.00 0.00 ? 18  HIS A HD2  16 
ATOM   10130 H  HE1  . HIS A 1 18 ? 12.095  0.794   -14.794 1.00 0.00 ? 18  HIS A HE1  16 
ATOM   10131 N  N    . PRO A 1 19 ? 10.095  8.153   -13.406 1.00 0.00 ? 19  PRO A N    16 
ATOM   10132 C  CA   . PRO A 1 19 ? 9.560   9.343   -12.737 1.00 0.00 ? 19  PRO A CA   16 
ATOM   10133 C  C    . PRO A 1 19 ? 8.487   8.998   -11.710 1.00 0.00 ? 19  PRO A C    16 
ATOM   10134 O  O    . PRO A 1 19 ? 8.012   9.866   -10.977 1.00 0.00 ? 19  PRO A O    16 
ATOM   10135 C  CB   . PRO A 1 19 ? 8.958   10.156  -13.886 1.00 0.00 ? 19  PRO A CB   16 
ATOM   10136 C  CG   . PRO A 1 19 ? 8.635   9.148   -14.934 1.00 0.00 ? 19  PRO A CG   16 
ATOM   10137 C  CD   . PRO A 1 19 ? 9.686   8.079   -14.819 1.00 0.00 ? 19  PRO A CD   16 
ATOM   10138 H  HA   . PRO A 1 19 ? 10.343  9.915   -12.260 1.00 0.00 ? 19  PRO A HA   16 
ATOM   10139 H  HB2  . PRO A 1 19 ? 8.071   10.668  -13.542 1.00 0.00 ? 19  PRO A HB2  16 
ATOM   10140 H  HB3  . PRO A 1 19 ? 9.681   10.875  -14.240 1.00 0.00 ? 19  PRO A HB3  16 
ATOM   10141 H  HG2  . PRO A 1 19 ? 7.655   8.732   -14.754 1.00 0.00 ? 19  PRO A HG2  16 
ATOM   10142 H  HG3  . PRO A 1 19 ? 8.675   9.608   -15.910 1.00 0.00 ? 19  PRO A HG3  16 
ATOM   10143 H  HD2  . PRO A 1 19 ? 9.266   7.111   -15.048 1.00 0.00 ? 19  PRO A HD2  16 
ATOM   10144 H  HD3  . PRO A 1 19 ? 10.518  8.295   -15.472 1.00 0.00 ? 19  PRO A HD3  16 
ATOM   10145 N  N    . THR A 1 20 ? 8.110   7.724   -11.660 1.00 0.00 ? 20  THR A N    16 
ATOM   10146 C  CA   . THR A 1 20 ? 7.093   7.264   -10.723 1.00 0.00 ? 20  THR A CA   16 
ATOM   10147 C  C    . THR A 1 20 ? 7.624   6.137   -9.845  1.00 0.00 ? 20  THR A C    16 
ATOM   10148 O  O    . THR A 1 20 ? 8.523   5.398   -10.244 1.00 0.00 ? 20  THR A O    16 
ATOM   10149 C  CB   . THR A 1 20 ? 5.831   6.776   -11.459 1.00 0.00 ? 20  THR A CB   16 
ATOM   10150 O  OG1  . THR A 1 20 ? 4.864   6.304   -10.513 1.00 0.00 ? 20  THR A OG1  16 
ATOM   10151 C  CG2  . THR A 1 20 ? 6.172   5.664   -12.440 1.00 0.00 ? 20  THR A CG2  16 
ATOM   10152 H  H    . THR A 1 20 ? 8.526   7.080   -12.270 1.00 0.00 ? 20  THR A H    16 
ATOM   10153 H  HA   . THR A 1 20 ? 6.817   8.098   -10.094 1.00 0.00 ? 20  THR A HA   16 
ATOM   10154 H  HB   . THR A 1 20 ? 5.410   7.605   -12.009 1.00 0.00 ? 20  THR A HB   16 
ATOM   10155 H  HG1  . THR A 1 20 ? 5.229   5.562   -10.026 1.00 0.00 ? 20  THR A HG1  16 
ATOM   10156 H  HG21 . THR A 1 20 ? 5.273   5.338   -12.941 1.00 0.00 ? 20  THR A HG21 16 
ATOM   10157 H  HG22 . THR A 1 20 ? 6.609   4.834   -11.905 1.00 0.00 ? 20  THR A HG22 16 
ATOM   10158 H  HG23 . THR A 1 20 ? 6.877   6.033   -13.169 1.00 0.00 ? 20  THR A HG23 16 
ATOM   10159 N  N    . SER A 1 21 ? 7.060   6.010   -8.648  1.00 0.00 ? 21  SER A N    16 
ATOM   10160 C  CA   . SER A 1 21 ? 7.480   4.974   -7.711  1.00 0.00 ? 21  SER A CA   16 
ATOM   10161 C  C    . SER A 1 21 ? 6.903   3.618   -8.107  1.00 0.00 ? 21  SER A C    16 
ATOM   10162 O  O    . SER A 1 21 ? 5.692   3.474   -8.280  1.00 0.00 ? 21  SER A O    16 
ATOM   10163 C  CB   . SER A 1 21 ? 7.041   5.333   -6.290  1.00 0.00 ? 21  SER A CB   16 
ATOM   10164 O  OG   . SER A 1 21 ? 7.944   6.246   -5.692  1.00 0.00 ? 21  SER A OG   16 
ATOM   10165 H  H    . SER A 1 21 ? 6.348   6.631   -8.387  1.00 0.00 ? 21  SER A H    16 
ATOM   10166 H  HA   . SER A 1 21 ? 8.558   4.916   -7.742  1.00 0.00 ? 21  SER A HA   16 
ATOM   10167 H  HB2  . SER A 1 21 ? 6.061   5.784   -6.322  1.00 0.00 ? 21  SER A HB2  16 
ATOM   10168 H  HB3  . SER A 1 21 ? 7.004   4.435   -5.691  1.00 0.00 ? 21  SER A HB3  16 
ATOM   10169 H  HG   . SER A 1 21 ? 8.636   5.760   -5.238  1.00 0.00 ? 21  SER A HG   16 
ATOM   10170 N  N    . ILE A 1 22 ? 7.778   2.629   -8.249  1.00 0.00 ? 22  ILE A N    16 
ATOM   10171 C  CA   . ILE A 1 22 ? 7.356   1.284   -8.623  1.00 0.00 ? 22  ILE A CA   16 
ATOM   10172 C  C    . ILE A 1 22 ? 6.680   0.575   -7.455  1.00 0.00 ? 22  ILE A C    16 
ATOM   10173 O  O    . ILE A 1 22 ? 7.022   0.802   -6.294  1.00 0.00 ? 22  ILE A O    16 
ATOM   10174 C  CB   . ILE A 1 22 ? 8.547   0.435   -9.105  1.00 0.00 ? 22  ILE A CB   16 
ATOM   10175 C  CG1  . ILE A 1 22 ? 9.093   0.985   -10.424 1.00 0.00 ? 22  ILE A CG1  16 
ATOM   10176 C  CG2  . ILE A 1 22 ? 8.129   -1.020  -9.264  1.00 0.00 ? 22  ILE A CG2  16 
ATOM   10177 C  CD1  . ILE A 1 22 ? 9.612   2.402   -10.319 1.00 0.00 ? 22  ILE A CD1  16 
ATOM   10178 H  H    . ILE A 1 22 ? 8.729   2.806   -8.098  1.00 0.00 ? 22  ILE A H    16 
ATOM   10179 H  HA   . ILE A 1 22 ? 6.649   1.372   -9.436  1.00 0.00 ? 22  ILE A HA   16 
ATOM   10180 H  HB   . ILE A 1 22 ? 9.321   0.482   -8.355  1.00 0.00 ? 22  ILE A HB   16 
ATOM   10181 H  HG12 . ILE A 1 22 ? 9.905   0.359   -10.760 1.00 0.00 ? 22  ILE A HG12 16 
ATOM   10182 H  HG13 . ILE A 1 22 ? 8.306   0.973   -11.164 1.00 0.00 ? 22  ILE A HG13 16 
ATOM   10183 H  HG21 . ILE A 1 22 ? 7.724   -1.382  -8.331  1.00 0.00 ? 22  ILE A HG21 16 
ATOM   10184 H  HG22 . ILE A 1 22 ? 7.377   -1.096  -10.035 1.00 0.00 ? 22  ILE A HG22 16 
ATOM   10185 H  HG23 . ILE A 1 22 ? 8.988   -1.613  -9.539  1.00 0.00 ? 22  ILE A HG23 16 
ATOM   10186 H  HD11 . ILE A 1 22 ? 10.172  2.513   -9.402  1.00 0.00 ? 22  ILE A HD11 16 
ATOM   10187 H  HD12 . ILE A 1 22 ? 10.253  2.614   -11.161 1.00 0.00 ? 22  ILE A HD12 16 
ATOM   10188 H  HD13 . ILE A 1 22 ? 8.780   3.091   -10.318 1.00 0.00 ? 22  ILE A HD13 16 
ATOM   10189 N  N    . CYS A 1 23 ? 5.718   -0.286  -7.770  1.00 0.00 ? 23  CYS A N    16 
ATOM   10190 C  CA   . CYS A 1 23 ? 4.993   -1.031  -6.748  1.00 0.00 ? 23  CYS A CA   16 
ATOM   10191 C  C    . CYS A 1 23 ? 5.927   -1.978  -6.000  1.00 0.00 ? 23  CYS A C    16 
ATOM   10192 O  O    . CYS A 1 23 ? 7.091   -2.138  -6.369  1.00 0.00 ? 23  CYS A O    16 
ATOM   10193 C  CB   . CYS A 1 23 ? 3.846   -1.822  -7.380  1.00 0.00 ? 23  CYS A CB   16 
ATOM   10194 S  SG   . CYS A 1 23 ? 2.501   -2.235  -6.223  1.00 0.00 ? 23  CYS A SG   16 
ATOM   10195 H  H    . CYS A 1 23 ? 5.489   -0.424  -8.714  1.00 0.00 ? 23  CYS A H    16 
ATOM   10196 H  HA   . CYS A 1 23 ? 4.584   -0.320  -6.046  1.00 0.00 ? 23  CYS A HA   16 
ATOM   10197 H  HB2  . CYS A 1 23 ? 3.420   -1.241  -8.185  1.00 0.00 ? 23  CYS A HB2  16 
ATOM   10198 H  HB3  . CYS A 1 23 ? 4.234   -2.748  -7.778  1.00 0.00 ? 23  CYS A HB3  16 
ATOM   10199 N  N    . ASP A 1 24 ? 5.409   -2.602  -4.948  1.00 0.00 ? 24  ASP A N    16 
ATOM   10200 C  CA   . ASP A 1 24 ? 6.195   -3.534  -4.148  1.00 0.00 ? 24  ASP A CA   16 
ATOM   10201 C  C    . ASP A 1 24 ? 5.804   -4.977  -4.454  1.00 0.00 ? 24  ASP A C    16 
ATOM   10202 O  O    . ASP A 1 24 ? 6.608   -5.895  -4.297  1.00 0.00 ? 24  ASP A O    16 
ATOM   10203 C  CB   . ASP A 1 24 ? 6.006   -3.247  -2.658  1.00 0.00 ? 24  ASP A CB   16 
ATOM   10204 C  CG   . ASP A 1 24 ? 7.220   -3.633  -1.835  1.00 0.00 ? 24  ASP A CG   16 
ATOM   10205 O  OD1  . ASP A 1 24 ? 8.336   -3.197  -2.185  1.00 0.00 ? 24  ASP A OD1  16 
ATOM   10206 O  OD2  . ASP A 1 24 ? 7.053   -4.371  -0.842  1.00 0.00 ? 24  ASP A OD2  16 
ATOM   10207 H  H    . ASP A 1 24 ? 4.475   -2.432  -4.704  1.00 0.00 ? 24  ASP A H    16 
ATOM   10208 H  HA   . ASP A 1 24 ? 7.235   -3.395  -4.403  1.00 0.00 ? 24  ASP A HA   16 
ATOM   10209 H  HB2  . ASP A 1 24 ? 5.824   -2.190  -2.522  1.00 0.00 ? 24  ASP A HB2  16 
ATOM   10210 H  HB3  . ASP A 1 24 ? 5.155   -3.804  -2.295  1.00 0.00 ? 24  ASP A HB3  16 
ATOM   10211 N  N    . ASN A 1 25 ? 4.564   -5.168  -4.891  1.00 0.00 ? 25  ASN A N    16 
ATOM   10212 C  CA   . ASN A 1 25 ? 4.065   -6.499  -5.217  1.00 0.00 ? 25  ASN A CA   16 
ATOM   10213 C  C    . ASN A 1 25 ? 4.383   -6.859  -6.665  1.00 0.00 ? 25  ASN A C    16 
ATOM   10214 O  O    . ASN A 1 25 ? 5.233   -7.710  -6.932  1.00 0.00 ? 25  ASN A O    16 
ATOM   10215 C  CB   . ASN A 1 25 ? 2.555   -6.573  -4.982  1.00 0.00 ? 25  ASN A CB   16 
ATOM   10216 C  CG   . ASN A 1 25 ? 2.099   -7.964  -4.585  1.00 0.00 ? 25  ASN A CG   16 
ATOM   10217 O  OD1  . ASN A 1 25 ? 2.903   -8.892  -4.500  1.00 0.00 ? 25  ASN A OD1  16 
ATOM   10218 N  ND2  . ASN A 1 25 ? 0.802   -8.114  -4.341  1.00 0.00 ? 25  ASN A ND2  16 
ATOM   10219 H  H    . ASN A 1 25 ? 3.969   -4.396  -4.996  1.00 0.00 ? 25  ASN A H    16 
ATOM   10220 H  HA   . ASN A 1 25 ? 4.557   -7.206  -4.566  1.00 0.00 ? 25  ASN A HA   16 
ATOM   10221 H  HB2  . ASN A 1 25 ? 2.286   -5.888  -4.191  1.00 0.00 ? 25  ASN A HB2  16 
ATOM   10222 H  HB3  . ASN A 1 25 ? 2.041   -6.290  -5.888  1.00 0.00 ? 25  ASN A HB3  16 
ATOM   10223 H  HD21 . ASN A 1 25 ? 0.220   -7.330  -4.429  1.00 0.00 ? 25  ASN A HD21 16 
ATOM   10224 H  HD22 . ASN A 1 25 ? 0.480   -9.002  -4.082  1.00 0.00 ? 25  ASN A HD22 16 
ATOM   10225 N  N    . PHE A 1 26 ? 3.696   -6.206  -7.597  1.00 0.00 ? 26  PHE A N    16 
ATOM   10226 C  CA   . PHE A 1 26 ? 3.905   -6.458  -9.018  1.00 0.00 ? 26  PHE A CA   16 
ATOM   10227 C  C    . PHE A 1 26 ? 5.382   -6.335  -9.380  1.00 0.00 ? 26  PHE A C    16 
ATOM   10228 O  O    . PHE A 1 26 ? 5.849   -6.946  -10.341 1.00 0.00 ? 26  PHE A O    16 
ATOM   10229 C  CB   . PHE A 1 26 ? 3.079   -5.480  -9.857  1.00 0.00 ? 26  PHE A CB   16 
ATOM   10230 C  CG   . PHE A 1 26 ? 2.710   -6.016  -11.211 1.00 0.00 ? 26  PHE A CG   16 
ATOM   10231 C  CD1  . PHE A 1 26 ? 3.680   -6.215  -12.180 1.00 0.00 ? 26  PHE A CD1  16 
ATOM   10232 C  CD2  . PHE A 1 26 ? 1.393   -6.321  -11.514 1.00 0.00 ? 26  PHE A CD2  16 
ATOM   10233 C  CE1  . PHE A 1 26 ? 3.343   -6.707  -13.426 1.00 0.00 ? 26  PHE A CE1  16 
ATOM   10234 C  CE2  . PHE A 1 26 ? 1.050   -6.814  -12.759 1.00 0.00 ? 26  PHE A CE2  16 
ATOM   10235 C  CZ   . PHE A 1 26 ? 2.026   -7.008  -13.716 1.00 0.00 ? 26  PHE A CZ   16 
ATOM   10236 H  H    . PHE A 1 26 ? 3.032   -5.540  -7.321  1.00 0.00 ? 26  PHE A H    16 
ATOM   10237 H  HA   . PHE A 1 26 ? 3.578   -7.464  -9.227  1.00 0.00 ? 26  PHE A HA   16 
ATOM   10238 H  HB2  . PHE A 1 26 ? 2.165   -5.249  -9.331  1.00 0.00 ? 26  PHE A HB2  16 
ATOM   10239 H  HB3  . PHE A 1 26 ? 3.646   -4.573  -10.001 1.00 0.00 ? 26  PHE A HB3  16 
ATOM   10240 H  HD1  . PHE A 1 26 ? 4.710   -5.981  -11.955 1.00 0.00 ? 26  PHE A HD1  16 
ATOM   10241 H  HD2  . PHE A 1 26 ? 0.628   -6.170  -10.765 1.00 0.00 ? 26  PHE A HD2  16 
ATOM   10242 H  HE1  . PHE A 1 26 ? 4.108   -6.858  -14.173 1.00 0.00 ? 26  PHE A HE1  16 
ATOM   10243 H  HE2  . PHE A 1 26 ? 0.019   -7.048  -12.981 1.00 0.00 ? 26  PHE A HE2  16 
ATOM   10244 H  HZ   . PHE A 1 26 ? 1.760   -7.392  -14.689 1.00 0.00 ? 26  PHE A HZ   16 
ATOM   10245 N  N    . SER A 1 27 ? 6.112   -5.540  -8.605  1.00 0.00 ? 27  SER A N    16 
ATOM   10246 C  CA   . SER A 1 27 ? 7.535   -5.332  -8.846  1.00 0.00 ? 27  SER A CA   16 
ATOM   10247 C  C    . SER A 1 27 ? 8.266   -6.666  -8.963  1.00 0.00 ? 27  SER A C    16 
ATOM   10248 O  O    . SER A 1 27 ? 8.800   -7.003  -10.019 1.00 0.00 ? 27  SER A O    16 
ATOM   10249 C  CB   . SER A 1 27 ? 8.148   -4.499  -7.719  1.00 0.00 ? 27  SER A CB   16 
ATOM   10250 O  OG   . SER A 1 27 ? 9.545   -4.719  -7.625  1.00 0.00 ? 27  SER A OG   16 
ATOM   10251 H  H    . SER A 1 27 ? 5.682   -5.079  -7.854  1.00 0.00 ? 27  SER A H    16 
ATOM   10252 H  HA   . SER A 1 27 ? 7.638   -4.796  -9.777  1.00 0.00 ? 27  SER A HA   16 
ATOM   10253 H  HB2  . SER A 1 27 ? 7.974   -3.451  -7.914  1.00 0.00 ? 27  SER A HB2  16 
ATOM   10254 H  HB3  . SER A 1 27 ? 7.688   -4.772  -6.781  1.00 0.00 ? 27  SER A HB3  16 
ATOM   10255 H  HG   . SER A 1 27 ? 9.972   -3.927  -7.290  1.00 0.00 ? 27  SER A HG   16 
ATOM   10256 N  N    . ALA A 1 28 ? 8.285   -7.421  -7.869  1.00 0.00 ? 28  ALA A N    16 
ATOM   10257 C  CA   . ALA A 1 28 ? 8.948   -8.719  -7.848  1.00 0.00 ? 28  ALA A CA   16 
ATOM   10258 C  C    . ALA A 1 28 ? 7.950   -9.849  -8.077  1.00 0.00 ? 28  ALA A C    16 
ATOM   10259 O  O    . ALA A 1 28 ? 8.059   -10.600 -9.047  1.00 0.00 ? 28  ALA A O    16 
ATOM   10260 C  CB   . ALA A 1 28 ? 9.679   -8.917  -6.529  1.00 0.00 ? 28  ALA A CB   16 
ATOM   10261 H  H    . ALA A 1 28 ? 7.841   -7.098  -7.058  1.00 0.00 ? 28  ALA A H    16 
ATOM   10262 H  HA   . ALA A 1 28 ? 9.680   -8.733  -8.643  1.00 0.00 ? 28  ALA A HA   16 
ATOM   10263 H  HB1  . ALA A 1 28 ? 9.506   -9.921  -6.169  1.00 0.00 ? 28  ALA A HB1  16 
ATOM   10264 H  HB2  . ALA A 1 28 ? 10.738  -8.765  -6.678  1.00 0.00 ? 28  ALA A HB2  16 
ATOM   10265 H  HB3  . ALA A 1 28 ? 9.312   -8.206  -5.804  1.00 0.00 ? 28  ALA A HB3  16 
ATOM   10266 N  N    . TYR A 1 29 ? 6.978   -9.965  -7.179  1.00 0.00 ? 29  TYR A N    16 
ATOM   10267 C  CA   . TYR A 1 29 ? 5.963   -11.006 -7.281  1.00 0.00 ? 29  TYR A CA   16 
ATOM   10268 C  C    . TYR A 1 29 ? 5.426   -11.105 -8.706  1.00 0.00 ? 29  TYR A C    16 
ATOM   10269 O  O    . TYR A 1 29 ? 5.415   -12.180 -9.304  1.00 0.00 ? 29  TYR A O    16 
ATOM   10270 C  CB   . TYR A 1 29 ? 4.815   -10.725 -6.310  1.00 0.00 ? 29  TYR A CB   16 
ATOM   10271 C  CG   . TYR A 1 29 ? 5.255   -10.611 -4.868  1.00 0.00 ? 29  TYR A CG   16 
ATOM   10272 C  CD1  . TYR A 1 29 ? 5.801   -9.431  -4.379  1.00 0.00 ? 29  TYR A CD1  16 
ATOM   10273 C  CD2  . TYR A 1 29 ? 5.124   -11.684 -3.995  1.00 0.00 ? 29  TYR A CD2  16 
ATOM   10274 C  CE1  . TYR A 1 29 ? 6.206   -9.324  -3.062  1.00 0.00 ? 29  TYR A CE1  16 
ATOM   10275 C  CE2  . TYR A 1 29 ? 5.525   -11.585 -2.677  1.00 0.00 ? 29  TYR A CE2  16 
ATOM   10276 C  CZ   . TYR A 1 29 ? 6.065   -10.403 -2.215  1.00 0.00 ? 29  TYR A CZ   16 
ATOM   10277 O  OH   . TYR A 1 29 ? 6.466   -10.299 -0.903  1.00 0.00 ? 29  TYR A OH   16 
ATOM   10278 H  H    . TYR A 1 29 ? 6.944   -9.336  -6.428  1.00 0.00 ? 29  TYR A H    16 
ATOM   10279 H  HA   . TYR A 1 29 ? 6.423   -11.946 -7.016  1.00 0.00 ? 29  TYR A HA   16 
ATOM   10280 H  HB2  . TYR A 1 29 ? 4.339   -9.796  -6.585  1.00 0.00 ? 29  TYR A HB2  16 
ATOM   10281 H  HB3  . TYR A 1 29 ? 4.093   -11.526 -6.375  1.00 0.00 ? 29  TYR A HB3  16 
ATOM   10282 H  HD1  . TYR A 1 29 ? 5.910   -8.588  -5.045  1.00 0.00 ? 29  TYR A HD1  16 
ATOM   10283 H  HD2  . TYR A 1 29 ? 4.700   -12.609 -4.359  1.00 0.00 ? 29  TYR A HD2  16 
ATOM   10284 H  HE1  . TYR A 1 29 ? 6.629   -8.398  -2.701  1.00 0.00 ? 29  TYR A HE1  16 
ATOM   10285 H  HE2  . TYR A 1 29 ? 5.415   -12.430 -2.013  1.00 0.00 ? 29  TYR A HE2  16 
ATOM   10286 H  HH   . TYR A 1 29 ? 7.222   -9.711  -0.845  1.00 0.00 ? 29  TYR A HH   16 
ATOM   10287 N  N    . GLY A 1 30 ? 4.981   -9.973  -9.244  1.00 0.00 ? 30  GLY A N    16 
ATOM   10288 C  CA   . GLY A 1 30 ? 4.449   -9.953  -10.594 1.00 0.00 ? 30  GLY A CA   16 
ATOM   10289 C  C    . GLY A 1 30 ? 2.946   -9.763  -10.622 1.00 0.00 ? 30  GLY A C    16 
ATOM   10290 O  O    . GLY A 1 30 ? 2.324   -9.834  -11.682 1.00 0.00 ? 30  GLY A O    16 
ATOM   10291 H  H    . GLY A 1 30 ? 5.014   -9.146  -8.720  1.00 0.00 ? 30  GLY A H    16 
ATOM   10292 H  HA2  . GLY A 1 30 ? 4.914   -9.146  -11.140 1.00 0.00 ? 30  GLY A HA2  16 
ATOM   10293 H  HA3  . GLY A 1 30 ? 4.691   -10.888 -11.078 1.00 0.00 ? 30  GLY A HA3  16 
ATOM   10294 N  N    . TRP A 1 31 ? 2.360   -9.521  -9.455  1.00 0.00 ? 31  TRP A N    16 
ATOM   10295 C  CA   . TRP A 1 31 ? 0.919   -9.322  -9.350  1.00 0.00 ? 31  TRP A CA   16 
ATOM   10296 C  C    . TRP A 1 31 ? 0.588   -8.302  -8.267  1.00 0.00 ? 31  TRP A C    16 
ATOM   10297 O  O    . TRP A 1 31 ? 1.367   -8.095  -7.336  1.00 0.00 ? 31  TRP A O    16 
ATOM   10298 C  CB   . TRP A 1 31 ? 0.221   -10.649 -9.048  1.00 0.00 ? 31  TRP A CB   16 
ATOM   10299 C  CG   . TRP A 1 31 ? 0.002   -10.886 -7.585  1.00 0.00 ? 31  TRP A CG   16 
ATOM   10300 C  CD1  . TRP A 1 31 ? 0.885   -11.442 -6.703  1.00 0.00 ? 31  TRP A CD1  16 
ATOM   10301 C  CD2  . TRP A 1 31 ? -1.176  -10.576 -6.833  1.00 0.00 ? 31  TRP A CD2  16 
ATOM   10302 N  NE1  . TRP A 1 31 ? 0.327   -11.496 -5.449  1.00 0.00 ? 31  TRP A NE1  16 
ATOM   10303 C  CE2  . TRP A 1 31 ? -0.937  -10.970 -5.502  1.00 0.00 ? 31  TRP A CE2  16 
ATOM   10304 C  CE3  . TRP A 1 31 ? -2.409  -10.002 -7.153  1.00 0.00 ? 31  TRP A CE3  16 
ATOM   10305 C  CZ2  . TRP A 1 31 ? -1.886  -10.808 -4.496  1.00 0.00 ? 31  TRP A CZ2  16 
ATOM   10306 C  CZ3  . TRP A 1 31 ? -3.350  -9.842  -6.154  1.00 0.00 ? 31  TRP A CZ3  16 
ATOM   10307 C  CH2  . TRP A 1 31 ? -3.084  -10.244 -4.838  1.00 0.00 ? 31  TRP A CH2  16 
ATOM   10308 H  H    . TRP A 1 31 ? 2.909   -9.476  -8.644  1.00 0.00 ? 31  TRP A H    16 
ATOM   10309 H  HA   . TRP A 1 31 ? 0.567   -8.949  -10.300 1.00 0.00 ? 31  TRP A HA   16 
ATOM   10310 H  HB2  . TRP A 1 31 ? -0.743  -10.661 -9.535  1.00 0.00 ? 31  TRP A HB2  16 
ATOM   10311 H  HB3  . TRP A 1 31 ? 0.823   -11.460 -9.432  1.00 0.00 ? 31  TRP A HB3  16 
ATOM   10312 H  HD1  . TRP A 1 31 ? 1.873   -11.786 -6.969  1.00 0.00 ? 31  TRP A HD1  16 
ATOM   10313 H  HE1  . TRP A 1 31 ? 0.764   -11.852 -4.647  1.00 0.00 ? 31  TRP A HE1  16 
ATOM   10314 H  HE3  . TRP A 1 31 ? -2.632  -9.686  -8.162  1.00 0.00 ? 31  TRP A HE3  16 
ATOM   10315 H  HZ2  . TRP A 1 31 ? -1.696  -11.112 -3.476  1.00 0.00 ? 31  TRP A HZ2  16 
ATOM   10316 H  HZ3  . TRP A 1 31 ? -4.309  -9.401  -6.383  1.00 0.00 ? 31  TRP A HZ3  16 
ATOM   10317 H  HH2  . TRP A 1 31 ? -3.848  -10.100 -4.090  1.00 0.00 ? 31  TRP A HH2  16 
ATOM   10318 N  N    . CYS A 1 32 ? -0.572  -7.666  -8.393  1.00 0.00 ? 32  CYS A N    16 
ATOM   10319 C  CA   . CYS A 1 32 ? -1.006  -6.666  -7.425  1.00 0.00 ? 32  CYS A CA   16 
ATOM   10320 C  C    . CYS A 1 32 ? -2.523  -6.693  -7.259  1.00 0.00 ? 32  CYS A C    16 
ATOM   10321 O  O    . CYS A 1 32 ? -3.278  -6.745  -8.230  1.00 0.00 ? 32  CYS A O    16 
ATOM   10322 C  CB   . CYS A 1 32 ? -0.555  -5.272  -7.864  1.00 0.00 ? 32  CYS A CB   16 
ATOM   10323 S  SG   . CYS A 1 32 ? -0.847  -3.971  -6.622  1.00 0.00 ? 32  CYS A SG   16 
ATOM   10324 H  H    . CYS A 1 32 ? -1.151  -7.874  -9.158  1.00 0.00 ? 32  CYS A H    16 
ATOM   10325 H  HA   . CYS A 1 32 ? -0.549  -6.902  -6.477  1.00 0.00 ? 32  CYS A HA   16 
ATOM   10326 H  HB2  . CYS A 1 32 ? 0.505   -5.293  -8.071  1.00 0.00 ? 32  CYS A HB2  16 
ATOM   10327 H  HB3  . CYS A 1 32 ? -1.087  -4.995  -8.762  1.00 0.00 ? 32  CYS A HB3  16 
ATOM   10328 N  N    . PRO A 1 33 ? -2.981  -6.656  -5.999  1.00 0.00 ? 33  PRO A N    16 
ATOM   10329 C  CA   . PRO A 1 33 ? -4.410  -6.675  -5.675  1.00 0.00 ? 33  PRO A CA   16 
ATOM   10330 C  C    . PRO A 1 33 ? -5.111  -5.379  -6.071  1.00 0.00 ? 33  PRO A C    16 
ATOM   10331 O  O    . PRO A 1 33 ? -6.332  -5.263  -5.958  1.00 0.00 ? 33  PRO A O    16 
ATOM   10332 C  CB   . PRO A 1 33 ? -4.427  -6.849  -4.154  1.00 0.00 ? 33  PRO A CB   16 
ATOM   10333 C  CG   . PRO A 1 33 ? -3.122  -6.297  -3.695  1.00 0.00 ? 33  PRO A CG   16 
ATOM   10334 C  CD   . PRO A 1 33 ? -2.138  -6.594  -4.793  1.00 0.00 ? 33  PRO A CD   16 
ATOM   10335 H  HA   . PRO A 1 33 ? -4.912  -7.511  -6.140  1.00 0.00 ? 33  PRO A HA   16 
ATOM   10336 H  HB2  . PRO A 1 33 ? -5.259  -6.299  -3.736  1.00 0.00 ? 33  PRO A HB2  16 
ATOM   10337 H  HB3  . PRO A 1 33 ? -4.521  -7.896  -3.909  1.00 0.00 ? 33  PRO A HB3  16 
ATOM   10338 H  HG2  . PRO A 1 33 ? -3.206  -5.232  -3.545  1.00 0.00 ? 33  PRO A HG2  16 
ATOM   10339 H  HG3  . PRO A 1 33 ? -2.819  -6.784  -2.780  1.00 0.00 ? 33  PRO A HG3  16 
ATOM   10340 H  HD2  . PRO A 1 33 ? -1.410  -5.800  -4.872  1.00 0.00 ? 33  PRO A HD2  16 
ATOM   10341 H  HD3  . PRO A 1 33 ? -1.649  -7.541  -4.616  1.00 0.00 ? 33  PRO A HD3  16 
ATOM   10342 N  N    . LEU A 1 34 ? -4.332  -4.409  -6.534  1.00 0.00 ? 34  LEU A N    16 
ATOM   10343 C  CA   . LEU A 1 34 ? -4.878  -3.121  -6.947  1.00 0.00 ? 34  LEU A CA   16 
ATOM   10344 C  C    . LEU A 1 34 ? -5.052  -3.064  -8.462  1.00 0.00 ? 34  LEU A C    16 
ATOM   10345 O  O    . LEU A 1 34 ? -5.874  -2.305  -8.974  1.00 0.00 ? 34  LEU A O    16 
ATOM   10346 C  CB   . LEU A 1 34 ? -3.964  -1.985  -6.485  1.00 0.00 ? 34  LEU A CB   16 
ATOM   10347 C  CG   . LEU A 1 34 ? -3.968  -1.688  -4.985  1.00 0.00 ? 34  LEU A CG   16 
ATOM   10348 C  CD1  . LEU A 1 34 ? -2.952  -0.606  -4.652  1.00 0.00 ? 34  LEU A CD1  16 
ATOM   10349 C  CD2  . LEU A 1 34 ? -5.359  -1.275  -4.527  1.00 0.00 ? 34  LEU A CD2  16 
ATOM   10350 H  H    . LEU A 1 34 ? -3.366  -4.560  -6.600  1.00 0.00 ? 34  LEU A H    16 
ATOM   10351 H  HA   . LEU A 1 34 ? -5.845  -3.006  -6.481  1.00 0.00 ? 34  LEU A HA   16 
ATOM   10352 H  HB2  . LEU A 1 34 ? -2.954  -2.237  -6.769  1.00 0.00 ? 34  LEU A HB2  16 
ATOM   10353 H  HB3  . LEU A 1 34 ? -4.268  -1.085  -7.002  1.00 0.00 ? 34  LEU A HB3  16 
ATOM   10354 H  HG   . LEU A 1 34 ? -3.690  -2.584  -4.447  1.00 0.00 ? 34  LEU A HG   16 
ATOM   10355 H  HD11 . LEU A 1 34 ? -3.252  0.323   -5.111  1.00 0.00 ? 34  LEU A HD11 16 
ATOM   10356 H  HD12 . LEU A 1 34 ? -1.982  -0.896  -5.027  1.00 0.00 ? 34  LEU A HD12 16 
ATOM   10357 H  HD13 . LEU A 1 34 ? -2.900  -0.479  -3.580  1.00 0.00 ? 34  LEU A HD13 16 
ATOM   10358 H  HD21 . LEU A 1 34 ? -5.934  -2.157  -4.285  1.00 0.00 ? 34  LEU A HD21 16 
ATOM   10359 H  HD22 . LEU A 1 34 ? -5.852  -0.730  -5.319  1.00 0.00 ? 34  LEU A HD22 16 
ATOM   10360 H  HD23 . LEU A 1 34 ? -5.278  -0.647  -3.653  1.00 0.00 ? 34  LEU A HD23 16 
ATOM   10361 N  N    . GLY A 1 35 ? -4.274  -3.875  -9.173  1.00 0.00 ? 35  GLY A N    16 
ATOM   10362 C  CA   . GLY A 1 35 ? -4.360  -3.903  -10.621 1.00 0.00 ? 35  GLY A CA   16 
ATOM   10363 C  C    . GLY A 1 35 ? -3.914  -2.599  -11.254 1.00 0.00 ? 35  GLY A C    16 
ATOM   10364 O  O    . GLY A 1 35 ? -2.909  -2.006  -10.862 1.00 0.00 ? 35  GLY A O    16 
ATOM   10365 H  H    . GLY A 1 35 ? -3.637  -4.458  -8.710  1.00 0.00 ? 35  GLY A H    16 
ATOM   10366 H  HA2  . GLY A 1 35 ? -3.736  -4.702  -10.992 1.00 0.00 ? 35  GLY A HA2  16 
ATOM   10367 H  HA3  . GLY A 1 35 ? -5.383  -4.096  -10.906 1.00 0.00 ? 35  GLY A HA3  16 
ATOM   10368 N  N    . PRO A 1 36 ? -4.672  -2.135  -12.258 1.00 0.00 ? 36  PRO A N    16 
ATOM   10369 C  CA   . PRO A 1 36 ? -4.368  -0.889  -12.968 1.00 0.00 ? 36  PRO A CA   16 
ATOM   10370 C  C    . PRO A 1 36 ? -4.593  0.344   -12.099 1.00 0.00 ? 36  PRO A C    16 
ATOM   10371 O  O    . PRO A 1 36 ? -3.815  1.296   -12.145 1.00 0.00 ? 36  PRO A O    16 
ATOM   10372 C  CB   . PRO A 1 36 ? -5.350  -0.901  -14.143 1.00 0.00 ? 36  PRO A CB   16 
ATOM   10373 C  CG   . PRO A 1 36 ? -6.485  -1.746  -13.678 1.00 0.00 ? 36  PRO A CG   16 
ATOM   10374 C  CD   . PRO A 1 36 ? -5.884  -2.790  -12.778 1.00 0.00 ? 36  PRO A CD   16 
ATOM   10375 H  HA   . PRO A 1 36 ? -3.355  -0.883  -13.344 1.00 0.00 ? 36  PRO A HA   16 
ATOM   10376 H  HB2  . PRO A 1 36 ? -5.670  0.109   -14.358 1.00 0.00 ? 36  PRO A HB2  16 
ATOM   10377 H  HB3  . PRO A 1 36 ? -4.872  -1.326  -15.012 1.00 0.00 ? 36  PRO A HB3  16 
ATOM   10378 H  HG2  . PRO A 1 36 ? -7.193  -1.142  -13.130 1.00 0.00 ? 36  PRO A HG2  16 
ATOM   10379 H  HG3  . PRO A 1 36 ? -6.965  -2.214  -14.525 1.00 0.00 ? 36  PRO A HG3  16 
ATOM   10380 H  HD2  . PRO A 1 36 ? -6.564  -3.034  -11.976 1.00 0.00 ? 36  PRO A HD2  16 
ATOM   10381 H  HD3  . PRO A 1 36 ? -5.631  -3.675  -13.343 1.00 0.00 ? 36  PRO A HD3  16 
ATOM   10382 N  N    . GLN A 1 37 ? -5.660  0.317   -11.307 1.00 0.00 ? 37  GLN A N    16 
ATOM   10383 C  CA   . GLN A 1 37 ? -5.986  1.433   -10.428 1.00 0.00 ? 37  GLN A CA   16 
ATOM   10384 C  C    . GLN A 1 37 ? -4.825  1.743   -9.488  1.00 0.00 ? 37  GLN A C    16 
ATOM   10385 O  O    . GLN A 1 37 ? -4.682  2.869   -9.011  1.00 0.00 ? 37  GLN A O    16 
ATOM   10386 C  CB   . GLN A 1 37 ? -7.244  1.120   -9.616  1.00 0.00 ? 37  GLN A CB   16 
ATOM   10387 C  CG   . GLN A 1 37 ? -8.535  1.500   -10.325 1.00 0.00 ? 37  GLN A CG   16 
ATOM   10388 C  CD   . GLN A 1 37 ? -8.934  2.941   -10.078 1.00 0.00 ? 37  GLN A CD   16 
ATOM   10389 O  OE1  . GLN A 1 37 ? -9.145  3.709   -11.017 1.00 0.00 ? 37  GLN A OE1  16 
ATOM   10390 N  NE2  . GLN A 1 37 ? -9.040  3.317   -8.809  1.00 0.00 ? 37  GLN A NE2  16 
ATOM   10391 H  H    . GLN A 1 37 ? -6.241  -0.471  -11.315 1.00 0.00 ? 37  GLN A H    16 
ATOM   10392 H  HA   . GLN A 1 37 ? -6.173  2.298   -11.046 1.00 0.00 ? 37  GLN A HA   16 
ATOM   10393 H  HB2  . GLN A 1 37 ? -7.270  0.061   -9.409  1.00 0.00 ? 37  GLN A HB2  16 
ATOM   10394 H  HB3  . GLN A 1 37 ? -7.200  1.661   -8.682  1.00 0.00 ? 37  GLN A HB3  16 
ATOM   10395 H  HG2  . GLN A 1 37 ? -8.403  1.356   -11.387 1.00 0.00 ? 37  GLN A HG2  16 
ATOM   10396 H  HG3  . GLN A 1 37 ? -9.327  0.856   -9.971  1.00 0.00 ? 37  GLN A HG3  16 
ATOM   10397 H  HE21 . GLN A 1 37 ? -8.856  2.652   -8.112  1.00 0.00 ? 37  GLN A HE21 16 
ATOM   10398 H  HE22 . GLN A 1 37 ? -9.296  4.243   -8.620  1.00 0.00 ? 37  GLN A HE22 16 
ATOM   10399 N  N    . CYS A 1 38 ? -3.998  0.737   -9.226  1.00 0.00 ? 38  CYS A N    16 
ATOM   10400 C  CA   . CYS A 1 38 ? -2.850  0.900   -8.343  1.00 0.00 ? 38  CYS A CA   16 
ATOM   10401 C  C    . CYS A 1 38 ? -2.141  2.225   -8.611  1.00 0.00 ? 38  CYS A C    16 
ATOM   10402 O  O    . CYS A 1 38 ? -1.903  2.609   -9.756  1.00 0.00 ? 38  CYS A O    16 
ATOM   10403 C  CB   . CYS A 1 38 ? -1.870  -0.261  -8.525  1.00 0.00 ? 38  CYS A CB   16 
ATOM   10404 S  SG   . CYS A 1 38 ? -0.457  -0.229  -7.376  1.00 0.00 ? 38  CYS A SG   16 
ATOM   10405 H  H    . CYS A 1 38 ? -4.164  -0.139  -9.636  1.00 0.00 ? 38  CYS A H    16 
ATOM   10406 H  HA   . CYS A 1 38 ? -3.210  0.899   -7.325  1.00 0.00 ? 38  CYS A HA   16 
ATOM   10407 H  HB2  . CYS A 1 38 ? -2.395  -1.192  -8.373  1.00 0.00 ? 38  CYS A HB2  16 
ATOM   10408 H  HB3  . CYS A 1 38 ? -1.477  -0.235  -9.531  1.00 0.00 ? 38  CYS A HB3  16 
ATOM   10409 N  N    . PRO A 1 39 ? -1.796  2.941   -7.530  1.00 0.00 ? 39  PRO A N    16 
ATOM   10410 C  CA   . PRO A 1 39 ? -1.110  4.233   -7.623  1.00 0.00 ? 39  PRO A CA   16 
ATOM   10411 C  C    . PRO A 1 39 ? 0.328   4.091   -8.110  1.00 0.00 ? 39  PRO A C    16 
ATOM   10412 O  O    . PRO A 1 39 ? 0.852   4.975   -8.788  1.00 0.00 ? 39  PRO A O    16 
ATOM   10413 C  CB   . PRO A 1 39 ? -1.138  4.753   -6.184  1.00 0.00 ? 39  PRO A CB   16 
ATOM   10414 C  CG   . PRO A 1 39 ? -1.238  3.529   -5.340  1.00 0.00 ? 39  PRO A CG   16 
ATOM   10415 C  CD   . PRO A 1 39 ? -2.049  2.543   -6.135  1.00 0.00 ? 39  PRO A CD   16 
ATOM   10416 H  HA   . PRO A 1 39 ? -1.641  4.919   -8.266  1.00 0.00 ? 39  PRO A HA   16 
ATOM   10417 H  HB2  . PRO A 1 39 ? -0.230  5.302   -5.979  1.00 0.00 ? 39  PRO A HB2  16 
ATOM   10418 H  HB3  . PRO A 1 39 ? -1.993  5.398   -6.047  1.00 0.00 ? 39  PRO A HB3  16 
ATOM   10419 H  HG2  . PRO A 1 39 ? -0.252  3.135   -5.147  1.00 0.00 ? 39  PRO A HG2  16 
ATOM   10420 H  HG3  . PRO A 1 39 ? -1.739  3.763   -4.412  1.00 0.00 ? 39  PRO A HG3  16 
ATOM   10421 H  HD2  . PRO A 1 39 ? -1.704  1.537   -5.952  1.00 0.00 ? 39  PRO A HD2  16 
ATOM   10422 H  HD3  . PRO A 1 39 ? -3.097  2.635   -5.893  1.00 0.00 ? 39  PRO A HD3  16 
ATOM   10423 N  N    . GLN A 1 40 ? 0.960   2.976   -7.760  1.00 0.00 ? 40  GLN A N    16 
ATOM   10424 C  CA   . GLN A 1 40 ? 2.338   2.720   -8.162  1.00 0.00 ? 40  GLN A CA   16 
ATOM   10425 C  C    . GLN A 1 40 ? 2.387   1.947   -9.476  1.00 0.00 ? 40  GLN A C    16 
ATOM   10426 O  O    . GLN A 1 40 ? 1.490   1.161   -9.778  1.00 0.00 ? 40  GLN A O    16 
ATOM   10427 C  CB   . GLN A 1 40 ? 3.074   1.942   -7.070  1.00 0.00 ? 40  GLN A CB   16 
ATOM   10428 C  CG   . GLN A 1 40 ? 3.105   2.656   -5.729  1.00 0.00 ? 40  GLN A CG   16 
ATOM   10429 C  CD   . GLN A 1 40 ? 4.350   2.336   -4.925  1.00 0.00 ? 40  GLN A CD   16 
ATOM   10430 O  OE1  . GLN A 1 40 ? 5.263   3.156   -4.821  1.00 0.00 ? 40  GLN A OE1  16 
ATOM   10431 N  NE2  . GLN A 1 40 ? 4.393   1.139   -4.351  1.00 0.00 ? 40  GLN A NE2  16 
ATOM   10432 H  H    . GLN A 1 40 ? 0.489   2.309   -7.218  1.00 0.00 ? 40  GLN A H    16 
ATOM   10433 H  HA   . GLN A 1 40 ? 2.825   3.674   -8.302  1.00 0.00 ? 40  GLN A HA   16 
ATOM   10434 H  HB2  . GLN A 1 40 ? 2.588   0.987   -6.935  1.00 0.00 ? 40  GLN A HB2  16 
ATOM   10435 H  HB3  . GLN A 1 40 ? 4.093   1.776   -7.388  1.00 0.00 ? 40  GLN A HB3  16 
ATOM   10436 H  HG2  . GLN A 1 40 ? 3.071   3.722   -5.902  1.00 0.00 ? 40  GLN A HG2  16 
ATOM   10437 H  HG3  . GLN A 1 40 ? 2.238   2.358   -5.157  1.00 0.00 ? 40  GLN A HG3  16 
ATOM   10438 H  HE21 . GLN A 1 40 ? 3.629   0.538   -4.479  1.00 0.00 ? 40  GLN A HE21 16 
ATOM   10439 H  HE22 . GLN A 1 40 ? 5.186   0.906   -3.827  1.00 0.00 ? 40  GLN A HE22 16 
ATOM   10440 N  N    . SER A 1 41 ? 3.441   2.177   -10.253 1.00 0.00 ? 41  SER A N    16 
ATOM   10441 C  CA   . SER A 1 41 ? 3.605   1.505   -11.536 1.00 0.00 ? 41  SER A CA   16 
ATOM   10442 C  C    . SER A 1 41 ? 3.933   0.028   -11.338 1.00 0.00 ? 41  SER A C    16 
ATOM   10443 O  O    . SER A 1 41 ? 4.304   -0.397  -10.243 1.00 0.00 ? 41  SER A O    16 
ATOM   10444 C  CB   . SER A 1 41 ? 4.711   2.179   -12.351 1.00 0.00 ? 41  SER A CB   16 
ATOM   10445 O  OG   . SER A 1 41 ? 4.471   2.048   -13.742 1.00 0.00 ? 41  SER A OG   16 
ATOM   10446 H  H    . SER A 1 41 ? 4.123   2.815   -9.956  1.00 0.00 ? 41  SER A H    16 
ATOM   10447 H  HA   . SER A 1 41 ? 2.673   1.585   -12.074 1.00 0.00 ? 41  SER A HA   16 
ATOM   10448 H  HB2  . SER A 1 41 ? 4.748   3.229   -12.102 1.00 0.00 ? 41  SER A HB2  16 
ATOM   10449 H  HB3  . SER A 1 41 ? 5.659   1.719   -12.116 1.00 0.00 ? 41  SER A HB3  16 
ATOM   10450 H  HG   . SER A 1 41 ? 3.948   2.792   -14.049 1.00 0.00 ? 41  SER A HG   16 
ATOM   10451 N  N    . HIS A 1 42 ? 3.794   -0.751  -12.406 1.00 0.00 ? 42  HIS A N    16 
ATOM   10452 C  CA   . HIS A 1 42 ? 4.075   -2.181  -12.351 1.00 0.00 ? 42  HIS A CA   16 
ATOM   10453 C  C    . HIS A 1 42 ? 5.111   -2.572  -13.402 1.00 0.00 ? 42  HIS A C    16 
ATOM   10454 O  O    . HIS A 1 42 ? 4.765   -2.904  -14.535 1.00 0.00 ? 42  HIS A O    16 
ATOM   10455 C  CB   . HIS A 1 42 ? 2.791   -2.984  -12.562 1.00 0.00 ? 42  HIS A CB   16 
ATOM   10456 C  CG   . HIS A 1 42 ? 1.857   -2.938  -11.392 1.00 0.00 ? 42  HIS A CG   16 
ATOM   10457 N  ND1  . HIS A 1 42 ? 0.492   -3.093  -11.511 1.00 0.00 ? 42  HIS A ND1  16 
ATOM   10458 C  CD2  . HIS A 1 42 ? 2.099   -2.754  -10.073 1.00 0.00 ? 42  HIS A CD2  16 
ATOM   10459 C  CE1  . HIS A 1 42 ? -0.065  -3.005  -10.317 1.00 0.00 ? 42  HIS A CE1  16 
ATOM   10460 N  NE2  . HIS A 1 42 ? 0.888   -2.800  -9.426  1.00 0.00 ? 42  HIS A NE2  16 
ATOM   10461 H  H    . HIS A 1 42 ? 3.495   -0.355  -13.251 1.00 0.00 ? 42  HIS A H    16 
ATOM   10462 H  HA   . HIS A 1 42 ? 4.472   -2.404  -11.373 1.00 0.00 ? 42  HIS A HA   16 
ATOM   10463 H  HB2  . HIS A 1 42 ? 2.265   -2.591  -13.420 1.00 0.00 ? 42  HIS A HB2  16 
ATOM   10464 H  HB3  . HIS A 1 42 ? 3.045   -4.018  -12.744 1.00 0.00 ? 42  HIS A HB3  16 
ATOM   10465 H  HD1  . HIS A 1 42 ? 0.004   -3.243  -12.348 1.00 0.00 ? 42  HIS A HD1  16 
ATOM   10466 H  HD2  . HIS A 1 42 ? 3.065   -2.599  -9.613  1.00 0.00 ? 42  HIS A HD2  16 
ATOM   10467 H  HE1  . HIS A 1 42 ? -1.120  -3.087  -10.104 1.00 0.00 ? 42  HIS A HE1  16 
ATOM   10468 N  N    . ASP A 1 43 ? 6.381   -2.529  -13.017 1.00 0.00 ? 43  ASP A N    16 
ATOM   10469 C  CA   . ASP A 1 43 ? 7.468   -2.878  -13.925 1.00 0.00 ? 43  ASP A CA   16 
ATOM   10470 C  C    . ASP A 1 43 ? 8.097   -4.211  -13.531 1.00 0.00 ? 43  ASP A C    16 
ATOM   10471 O  O    . ASP A 1 43 ? 8.216   -4.527  -12.347 1.00 0.00 ? 43  ASP A O    16 
ATOM   10472 C  CB   . ASP A 1 43 ? 8.531   -1.779  -13.929 1.00 0.00 ? 43  ASP A CB   16 
ATOM   10473 C  CG   . ASP A 1 43 ? 9.890   -2.290  -14.365 1.00 0.00 ? 43  ASP A CG   16 
ATOM   10474 O  OD1  . ASP A 1 43 ? 9.994   -2.804  -15.498 1.00 0.00 ? 43  ASP A OD1  16 
ATOM   10475 O  OD2  . ASP A 1 43 ? 10.849  -2.176  -13.574 1.00 0.00 ? 43  ASP A OD2  16 
ATOM   10476 H  H    . ASP A 1 43 ? 6.594   -2.256  -12.099 1.00 0.00 ? 43  ASP A H    16 
ATOM   10477 H  HA   . ASP A 1 43 ? 7.054   -2.970  -14.917 1.00 0.00 ? 43  ASP A HA   16 
ATOM   10478 H  HB2  . ASP A 1 43 ? 8.227   -0.996  -14.608 1.00 0.00 ? 43  ASP A HB2  16 
ATOM   10479 H  HB3  . ASP A 1 43 ? 8.622   -1.372  -12.933 1.00 0.00 ? 43  ASP A HB3  16 
ATOM   10480 N  N    . ILE A 1 44 ? 8.498   -4.988  -14.531 1.00 0.00 ? 44  ILE A N    16 
ATOM   10481 C  CA   . ILE A 1 44 ? 9.115   -6.286  -14.289 1.00 0.00 ? 44  ILE A CA   16 
ATOM   10482 C  C    . ILE A 1 44 ? 10.544  -6.324  -14.821 1.00 0.00 ? 44  ILE A C    16 
ATOM   10483 O  O    . ILE A 1 44 ? 10.765  -6.396  -16.030 1.00 0.00 ? 44  ILE A O    16 
ATOM   10484 C  CB   . ILE A 1 44 ? 8.307   -7.424  -14.940 1.00 0.00 ? 44  ILE A CB   16 
ATOM   10485 C  CG1  . ILE A 1 44 ? 6.873   -7.429  -14.409 1.00 0.00 ? 44  ILE A CG1  16 
ATOM   10486 C  CG2  . ILE A 1 44 ? 8.978   -8.765  -14.683 1.00 0.00 ? 44  ILE A CG2  16 
ATOM   10487 C  CD1  . ILE A 1 44 ? 6.787   -7.543  -12.903 1.00 0.00 ? 44  ILE A CD1  16 
ATOM   10488 H  H    . ILE A 1 44 ? 8.377   -4.681  -15.454 1.00 0.00 ? 44  ILE A H    16 
ATOM   10489 H  HA   . ILE A 1 44 ? 9.136   -6.452  -13.222 1.00 0.00 ? 44  ILE A HA   16 
ATOM   10490 H  HB   . ILE A 1 44 ? 8.288   -7.258  -16.007 1.00 0.00 ? 44  ILE A HB   16 
ATOM   10491 H  HG12 . ILE A 1 44 ? 6.384   -6.513  -14.700 1.00 0.00 ? 44  ILE A HG12 16 
ATOM   10492 H  HG13 . ILE A 1 44 ? 6.341   -8.267  -14.836 1.00 0.00 ? 44  ILE A HG13 16 
ATOM   10493 H  HG21 . ILE A 1 44 ? 8.379   -9.341  -13.993 1.00 0.00 ? 44  ILE A HG21 16 
ATOM   10494 H  HG22 . ILE A 1 44 ? 9.072   -9.305  -15.613 1.00 0.00 ? 44  ILE A HG22 16 
ATOM   10495 H  HG23 . ILE A 1 44 ? 9.958   -8.603  -14.260 1.00 0.00 ? 44  ILE A HG23 16 
ATOM   10496 H  HD11 . ILE A 1 44 ? 7.272   -8.453  -12.582 1.00 0.00 ? 44  ILE A HD11 16 
ATOM   10497 H  HD12 . ILE A 1 44 ? 7.275   -6.694  -12.448 1.00 0.00 ? 44  ILE A HD12 16 
ATOM   10498 H  HD13 . ILE A 1 44 ? 5.749   -7.565  -12.602 1.00 0.00 ? 44  ILE A HD13 16 
ATOM   10499 N  N    . SER A 1 45 ? 11.510  -6.276  -13.910 1.00 0.00 ? 45  SER A N    16 
ATOM   10500 C  CA   . SER A 1 45 ? 12.919  -6.302  -14.288 1.00 0.00 ? 45  SER A CA   16 
ATOM   10501 C  C    . SER A 1 45 ? 13.157  -5.489  -15.556 1.00 0.00 ? 45  SER A C    16 
ATOM   10502 O  O    . SER A 1 45 ? 13.904  -5.902  -16.441 1.00 0.00 ? 45  SER A O    16 
ATOM   10503 C  CB   . SER A 1 45 ? 13.386  -7.744  -14.497 1.00 0.00 ? 45  SER A CB   16 
ATOM   10504 O  OG   . SER A 1 45 ? 13.880  -8.300  -13.292 1.00 0.00 ? 45  SER A OG   16 
ATOM   10505 H  H    . SER A 1 45 ? 11.270  -6.218  -12.961 1.00 0.00 ? 45  SER A H    16 
ATOM   10506 H  HA   . SER A 1 45 ? 13.486  -5.863  -13.481 1.00 0.00 ? 45  SER A HA   16 
ATOM   10507 H  HB2  . SER A 1 45 ? 12.556  -8.341  -14.842 1.00 0.00 ? 45  SER A HB2  16 
ATOM   10508 H  HB3  . SER A 1 45 ? 14.173  -7.760  -15.237 1.00 0.00 ? 45  SER A HB3  16 
ATOM   10509 H  HG   . SER A 1 45 ? 14.613  -7.770  -12.971 1.00 0.00 ? 45  SER A HG   16 
ATOM   10510 N  N    . GLY A 1 46 ? 12.513  -4.328  -15.637 1.00 0.00 ? 46  GLY A N    16 
ATOM   10511 C  CA   . GLY A 1 46 ? 12.667  -3.474  -16.800 1.00 0.00 ? 46  GLY A CA   16 
ATOM   10512 C  C    . GLY A 1 46 ? 11.618  -3.744  -17.861 1.00 0.00 ? 46  GLY A C    16 
ATOM   10513 O  O    . GLY A 1 46 ? 10.631  -4.441  -17.624 1.00 0.00 ? 46  GLY A O    16 
ATOM   10514 H  H    . GLY A 1 46 ? 11.929  -4.049  -14.900 1.00 0.00 ? 46  GLY A H    16 
ATOM   10515 H  HA2  . GLY A 1 46 ? 12.591  -2.443  -16.489 1.00 0.00 ? 46  GLY A HA2  16 
ATOM   10516 H  HA3  . GLY A 1 46 ? 13.645  -3.640  -17.228 1.00 0.00 ? 46  GLY A HA3  16 
ATOM   10517 N  N    . PRO A 1 47 ? 11.825  -3.183  -19.061 1.00 0.00 ? 47  PRO A N    16 
ATOM   10518 C  CA   . PRO A 1 47 ? 10.900  -3.353  -20.185 1.00 0.00 ? 47  PRO A CA   16 
ATOM   10519 C  C    . PRO A 1 47 ? 10.913  -4.773  -20.738 1.00 0.00 ? 47  PRO A C    16 
ATOM   10520 O  O    . PRO A 1 47 ? 11.640  -5.074  -21.685 1.00 0.00 ? 47  PRO A O    16 
ATOM   10521 C  CB   . PRO A 1 47 ? 11.427  -2.367  -21.230 1.00 0.00 ? 47  PRO A CB   16 
ATOM   10522 C  CG   . PRO A 1 47 ? 12.873  -2.210  -20.908 1.00 0.00 ? 47  PRO A CG   16 
ATOM   10523 C  CD   . PRO A 1 47 ? 12.980  -2.340  -19.413 1.00 0.00 ? 47  PRO A CD   16 
ATOM   10524 H  HA   . PRO A 1 47 ? 9.890   -3.084  -19.911 1.00 0.00 ? 47  PRO A HA   16 
ATOM   10525 H  HB2  . PRO A 1 47 ? 11.285  -2.777  -22.220 1.00 0.00 ? 47  PRO A HB2  16 
ATOM   10526 H  HB3  . PRO A 1 47 ? 10.900  -1.429  -21.144 1.00 0.00 ? 47  PRO A HB3  16 
ATOM   10527 H  HG2  . PRO A 1 47 ? 13.444  -2.985  -21.394 1.00 0.00 ? 47  PRO A HG2  16 
ATOM   10528 H  HG3  . PRO A 1 47 ? 13.215  -1.235  -21.224 1.00 0.00 ? 47  PRO A HG3  16 
ATOM   10529 H  HD2  . PRO A 1 47 ? 13.907  -2.823  -19.142 1.00 0.00 ? 47  PRO A HD2  16 
ATOM   10530 H  HD3  . PRO A 1 47 ? 12.906  -1.370  -18.944 1.00 0.00 ? 47  PRO A HD3  16 
ATOM   10531 N  N    . SER A 1 48 ? 10.105  -5.644  -20.141 1.00 0.00 ? 48  SER A N    16 
ATOM   10532 C  CA   . SER A 1 48 ? 10.027  -7.035  -20.572 1.00 0.00 ? 48  SER A CA   16 
ATOM   10533 C  C    . SER A 1 48 ? 8.583   -7.435  -20.855 1.00 0.00 ? 48  SER A C    16 
ATOM   10534 O  O    . SER A 1 48 ? 7.777   -7.585  -19.936 1.00 0.00 ? 48  SER A O    16 
ATOM   10535 C  CB   . SER A 1 48 ? 10.625  -7.955  -19.507 1.00 0.00 ? 48  SER A CB   16 
ATOM   10536 O  OG   . SER A 1 48 ? 12.031  -7.801  -19.429 1.00 0.00 ? 48  SER A OG   16 
ATOM   10537 H  H    . SER A 1 48 ? 9.550   -5.343  -19.391 1.00 0.00 ? 48  SER A H    16 
ATOM   10538 H  HA   . SER A 1 48 ? 10.600  -7.132  -21.482 1.00 0.00 ? 48  SER A HA   16 
ATOM   10539 H  HB2  . SER A 1 48 ? 10.195  -7.716  -18.546 1.00 0.00 ? 48  SER A HB2  16 
ATOM   10540 H  HB3  . SER A 1 48 ? 10.400  -8.983  -19.756 1.00 0.00 ? 48  SER A HB3  16 
ATOM   10541 H  HG   . SER A 1 48 ? 12.423  -8.605  -19.081 1.00 0.00 ? 48  SER A HG   16 
ATOM   10542 N  N    . SER A 1 49 ? 8.262   -7.607  -22.134 1.00 0.00 ? 49  SER A N    16 
ATOM   10543 C  CA   . SER A 1 49 ? 6.914   -7.987  -22.539 1.00 0.00 ? 49  SER A CA   16 
ATOM   10544 C  C    . SER A 1 49 ? 6.691   -9.484  -22.350 1.00 0.00 ? 49  SER A C    16 
ATOM   10545 O  O    . SER A 1 49 ? 5.665   -9.908  -21.820 1.00 0.00 ? 49  SER A O    16 
ATOM   10546 C  CB   . SER A 1 49 ? 6.672   -7.605  -24.001 1.00 0.00 ? 49  SER A CB   16 
ATOM   10547 O  OG   . SER A 1 49 ? 7.698   -8.112  -24.837 1.00 0.00 ? 49  SER A OG   16 
ATOM   10548 H  H    . SER A 1 49 ? 8.949   -7.473  -22.820 1.00 0.00 ? 49  SER A H    16 
ATOM   10549 H  HA   . SER A 1 49 ? 6.216   -7.449  -21.915 1.00 0.00 ? 49  SER A HA   16 
ATOM   10550 H  HB2  . SER A 1 49 ? 5.726   -8.012  -24.325 1.00 0.00 ? 49  SER A HB2  16 
ATOM   10551 H  HB3  . SER A 1 49 ? 6.650   -6.528  -24.090 1.00 0.00 ? 49  SER A HB3  16 
ATOM   10552 H  HG   . SER A 1 49 ? 8.108   -7.388  -25.316 1.00 0.00 ? 49  SER A HG   16 
ATOM   10553 N  N    . GLY A 1 50 ? 7.662   -10.281 -22.787 1.00 0.00 ? 50  GLY A N    16 
ATOM   10554 C  CA   . GLY A 1 50 ? 7.553   -11.722 -22.658 1.00 0.00 ? 50  GLY A CA   16 
ATOM   10555 C  C    . GLY A 1 50 ? 8.430   -12.461 -23.649 1.00 0.00 ? 50  GLY A C    16 
ATOM   10556 O  O    . GLY A 1 50 ? 8.693   -11.931 -24.728 1.00 0.00 ? 50  GLY A O    16 
ATOM   10557 H  H    . GLY A 1 50 ? 8.458   -9.887  -23.202 1.00 0.00 ? 50  GLY A H    16 
ATOM   10558 H  HA2  . GLY A 1 50 ? 7.842   -12.006 -21.656 1.00 0.00 ? 50  GLY A HA2  16 
ATOM   10559 H  HA3  . GLY A 1 50 ? 6.525   -12.011 -22.820 1.00 0.00 ? 50  GLY A HA3  16 
HETATM 10560 ZN ZN   . ZN  B 2 .  ? 0.517   -2.260  -7.483  1.00 0.00 ? 201 ZN  A ZN   16 
ATOM   10561 N  N    . GLY A 1 1  ? 28.616  15.515  10.150  1.00 0.00 ? 1   GLY A N    17 
ATOM   10562 C  CA   . GLY A 1 1  ? 27.234  15.854  9.865   1.00 0.00 ? 1   GLY A CA   17 
ATOM   10563 C  C    . GLY A 1 1  ? 26.368  14.628  9.653   1.00 0.00 ? 1   GLY A C    17 
ATOM   10564 O  O    . GLY A 1 1  ? 26.798  13.656  9.032   1.00 0.00 ? 1   GLY A O    17 
ATOM   10565 H  H1   . GLY A 1 1  ? 29.300  16.217  10.154  1.00 0.00 ? 1   GLY A H1   17 
ATOM   10566 H  HA2  . GLY A 1 1  ? 26.837  16.424  10.692  1.00 0.00 ? 1   GLY A HA2  17 
ATOM   10567 H  HA3  . GLY A 1 1  ? 27.201  16.462  8.973   1.00 0.00 ? 1   GLY A HA3  17 
ATOM   10568 N  N    . SER A 1 2  ? 25.144  14.673  10.170  1.00 0.00 ? 2   SER A N    17 
ATOM   10569 C  CA   . SER A 1 2  ? 24.218  13.555  10.039  1.00 0.00 ? 2   SER A CA   17 
ATOM   10570 C  C    . SER A 1 2  ? 23.910  13.274  8.571   1.00 0.00 ? 2   SER A C    17 
ATOM   10571 O  O    . SER A 1 2  ? 23.486  14.164  7.833   1.00 0.00 ? 2   SER A O    17 
ATOM   10572 C  CB   . SER A 1 2  ? 22.921  13.847  10.797  1.00 0.00 ? 2   SER A CB   17 
ATOM   10573 O  OG   . SER A 1 2  ? 22.256  14.974  10.253  1.00 0.00 ? 2   SER A OG   17 
ATOM   10574 H  H    . SER A 1 2  ? 24.859  15.476  10.654  1.00 0.00 ? 2   SER A H    17 
ATOM   10575 H  HA   . SER A 1 2  ? 24.687  12.682  10.469  1.00 0.00 ? 2   SER A HA   17 
ATOM   10576 H  HB2  . SER A 1 2  ? 22.267  12.991  10.730  1.00 0.00 ? 2   SER A HB2  17 
ATOM   10577 H  HB3  . SER A 1 2  ? 23.151  14.045  11.834  1.00 0.00 ? 2   SER A HB3  17 
ATOM   10578 H  HG   . SER A 1 2  ? 22.673  15.777  10.572  1.00 0.00 ? 2   SER A HG   17 
ATOM   10579 N  N    . SER A 1 3  ? 24.125  12.030  8.155   1.00 0.00 ? 3   SER A N    17 
ATOM   10580 C  CA   . SER A 1 3  ? 23.875  11.631  6.775   1.00 0.00 ? 3   SER A CA   17 
ATOM   10581 C  C    . SER A 1 3  ? 23.300  10.219  6.713   1.00 0.00 ? 3   SER A C    17 
ATOM   10582 O  O    . SER A 1 3  ? 23.807  9.302   7.358   1.00 0.00 ? 3   SER A O    17 
ATOM   10583 C  CB   . SER A 1 3  ? 25.166  11.705  5.958   1.00 0.00 ? 3   SER A CB   17 
ATOM   10584 O  OG   . SER A 1 3  ? 26.151  10.830  6.481   1.00 0.00 ? 3   SER A OG   17 
ATOM   10585 H  H    . SER A 1 3  ? 24.463  11.365  8.791   1.00 0.00 ? 3   SER A H    17 
ATOM   10586 H  HA   . SER A 1 3  ? 23.155  12.319  6.357   1.00 0.00 ? 3   SER A HA   17 
ATOM   10587 H  HB2  . SER A 1 3  ? 24.960  11.426  4.936   1.00 0.00 ? 3   SER A HB2  17 
ATOM   10588 H  HB3  . SER A 1 3  ? 25.549  12.715  5.985   1.00 0.00 ? 3   SER A HB3  17 
ATOM   10589 H  HG   . SER A 1 3  ? 26.860  10.728  5.842   1.00 0.00 ? 3   SER A HG   17 
ATOM   10590 N  N    . GLY A 1 4  ? 22.238  10.053  5.931   1.00 0.00 ? 4   GLY A N    17 
ATOM   10591 C  CA   . GLY A 1 4  ? 21.611  8.751   5.798   1.00 0.00 ? 4   GLY A CA   17 
ATOM   10592 C  C    . GLY A 1 4  ? 20.187  8.843   5.287   1.00 0.00 ? 4   GLY A C    17 
ATOM   10593 O  O    . GLY A 1 4  ? 19.960  8.993   4.086   1.00 0.00 ? 4   GLY A O    17 
ATOM   10594 H  H    . GLY A 1 4  ? 21.877  10.821  5.440   1.00 0.00 ? 4   GLY A H    17 
ATOM   10595 H  HA2  . GLY A 1 4  ? 22.191  8.152   5.112   1.00 0.00 ? 4   GLY A HA2  17 
ATOM   10596 H  HA3  . GLY A 1 4  ? 21.604  8.268   6.764   1.00 0.00 ? 4   GLY A HA3  17 
ATOM   10597 N  N    . SER A 1 5  ? 19.225  8.750   6.200   1.00 0.00 ? 5   SER A N    17 
ATOM   10598 C  CA   . SER A 1 5  ? 17.815  8.818   5.834   1.00 0.00 ? 5   SER A CA   17 
ATOM   10599 C  C    . SER A 1 5  ? 17.073  9.818   6.714   1.00 0.00 ? 5   SER A C    17 
ATOM   10600 O  O    . SER A 1 5  ? 15.962  9.553   7.173   1.00 0.00 ? 5   SER A O    17 
ATOM   10601 C  CB   . SER A 1 5  ? 17.168  7.437   5.955   1.00 0.00 ? 5   SER A CB   17 
ATOM   10602 O  OG   . SER A 1 5  ? 17.001  7.069   7.313   1.00 0.00 ? 5   SER A OG   17 
ATOM   10603 H  H    . SER A 1 5  ? 19.470  8.631   7.141   1.00 0.00 ? 5   SER A H    17 
ATOM   10604 H  HA   . SER A 1 5  ? 17.755  9.146   4.807   1.00 0.00 ? 5   SER A HA   17 
ATOM   10605 H  HB2  . SER A 1 5  ? 16.201  7.452   5.476   1.00 0.00 ? 5   SER A HB2  17 
ATOM   10606 H  HB3  . SER A 1 5  ? 17.798  6.704   5.470   1.00 0.00 ? 5   SER A HB3  17 
ATOM   10607 H  HG   . SER A 1 5  ? 17.656  7.521   7.850   1.00 0.00 ? 5   SER A HG   17 
ATOM   10608 N  N    . SER A 1 6  ? 17.696  10.970  6.946   1.00 0.00 ? 6   SER A N    17 
ATOM   10609 C  CA   . SER A 1 6  ? 17.097  12.010  7.774   1.00 0.00 ? 6   SER A CA   17 
ATOM   10610 C  C    . SER A 1 6  ? 15.632  12.222  7.406   1.00 0.00 ? 6   SER A C    17 
ATOM   10611 O  O    . SER A 1 6  ? 14.747  12.130  8.255   1.00 0.00 ? 6   SER A O    17 
ATOM   10612 C  CB   . SER A 1 6  ? 17.869  13.322  7.620   1.00 0.00 ? 6   SER A CB   17 
ATOM   10613 O  OG   . SER A 1 6  ? 17.664  14.168  8.737   1.00 0.00 ? 6   SER A OG   17 
ATOM   10614 H  H    . SER A 1 6  ? 18.580  11.122  6.552   1.00 0.00 ? 6   SER A H    17 
ATOM   10615 H  HA   . SER A 1 6  ? 17.155  11.687  8.803   1.00 0.00 ? 6   SER A HA   17 
ATOM   10616 H  HB2  . SER A 1 6  ? 18.924  13.108  7.533   1.00 0.00 ? 6   SER A HB2  17 
ATOM   10617 H  HB3  . SER A 1 6  ? 17.531  13.832  6.729   1.00 0.00 ? 6   SER A HB3  17 
ATOM   10618 H  HG   . SER A 1 6  ? 18.203  13.865  9.472   1.00 0.00 ? 6   SER A HG   17 
ATOM   10619 N  N    . GLY A 1 7  ? 15.384  12.507  6.131   1.00 0.00 ? 7   GLY A N    17 
ATOM   10620 C  CA   . GLY A 1 7  ? 14.026  12.728  5.671   1.00 0.00 ? 7   GLY A CA   17 
ATOM   10621 C  C    . GLY A 1 7  ? 13.795  14.153  5.210   1.00 0.00 ? 7   GLY A C    17 
ATOM   10622 O  O    . GLY A 1 7  ? 13.205  14.958  5.933   1.00 0.00 ? 7   GLY A O    17 
ATOM   10623 H  H    . GLY A 1 7  ? 16.130  12.567  5.498   1.00 0.00 ? 7   GLY A H    17 
ATOM   10624 H  HA2  . GLY A 1 7  ? 13.822  12.058  4.849   1.00 0.00 ? 7   GLY A HA2  17 
ATOM   10625 H  HA3  . GLY A 1 7  ? 13.344  12.508  6.479   1.00 0.00 ? 7   GLY A HA3  17 
ATOM   10626 N  N    . CYS A 1 8  ? 14.261  14.468  4.007   1.00 0.00 ? 8   CYS A N    17 
ATOM   10627 C  CA   . CYS A 1 8  ? 14.104  15.808  3.452   1.00 0.00 ? 8   CYS A CA   17 
ATOM   10628 C  C    . CYS A 1 8  ? 13.562  15.746  2.028   1.00 0.00 ? 8   CYS A C    17 
ATOM   10629 O  O    . CYS A 1 8  ? 12.724  16.559  1.636   1.00 0.00 ? 8   CYS A O    17 
ATOM   10630 C  CB   . CYS A 1 8  ? 15.441  16.550  3.471   1.00 0.00 ? 8   CYS A CB   17 
ATOM   10631 S  SG   . CYS A 1 8  ? 16.761  15.714  2.561   1.00 0.00 ? 8   CYS A SG   17 
ATOM   10632 H  H    . CYS A 1 8  ? 14.722  13.783  3.479   1.00 0.00 ? 8   CYS A H    17 
ATOM   10633 H  HA   . CYS A 1 8  ? 13.397  16.340  4.070   1.00 0.00 ? 8   CYS A HA   17 
ATOM   10634 H  HB2  . CYS A 1 8  ? 15.307  17.527  3.031   1.00 0.00 ? 8   CYS A HB2  17 
ATOM   10635 H  HB3  . CYS A 1 8  ? 15.766  16.665  4.494   1.00 0.00 ? 8   CYS A HB3  17 
ATOM   10636 H  HG   . CYS A 1 8  ? 16.431  15.703  1.279   1.00 0.00 ? 8   CYS A HG   17 
ATOM   10637 N  N    . CYS A 1 9  ? 14.047  14.778  1.258   1.00 0.00 ? 9   CYS A N    17 
ATOM   10638 C  CA   . CYS A 1 9  ? 13.613  14.612  -0.125  1.00 0.00 ? 9   CYS A CA   17 
ATOM   10639 C  C    . CYS A 1 9  ? 12.107  14.816  -0.251  1.00 0.00 ? 9   CYS A C    17 
ATOM   10640 O  O    . CYS A 1 9  ? 11.317  14.045  0.298   1.00 0.00 ? 9   CYS A O    17 
ATOM   10641 C  CB   . CYS A 1 9  ? 13.997  13.223  -0.638  1.00 0.00 ? 9   CYS A CB   17 
ATOM   10642 S  SG   . CYS A 1 9  ? 13.756  13.001  -2.417  1.00 0.00 ? 9   CYS A SG   17 
ATOM   10643 H  H    . CYS A 1 9  ? 14.712  14.161  1.627   1.00 0.00 ? 9   CYS A H    17 
ATOM   10644 H  HA   . CYS A 1 9  ? 14.115  15.359  -0.721  1.00 0.00 ? 9   CYS A HA   17 
ATOM   10645 H  HB2  . CYS A 1 9  ? 15.040  13.044  -0.424  1.00 0.00 ? 9   CYS A HB2  17 
ATOM   10646 H  HB3  . CYS A 1 9  ? 13.399  12.482  -0.129  1.00 0.00 ? 9   CYS A HB3  17 
ATOM   10647 H  HG   . CYS A 1 9  ? 12.786  13.816  -2.802  1.00 0.00 ? 9   CYS A HG   17 
ATOM   10648 N  N    . LEU A 1 10 ? 11.714  15.858  -0.975  1.00 0.00 ? 10  LEU A N    17 
ATOM   10649 C  CA   . LEU A 1 10 ? 10.302  16.165  -1.171  1.00 0.00 ? 10  LEU A CA   17 
ATOM   10650 C  C    . LEU A 1 10 ? 9.634   15.113  -2.051  1.00 0.00 ? 10  LEU A C    17 
ATOM   10651 O  O    . LEU A 1 10 ? 10.270  14.474  -2.889  1.00 0.00 ? 10  LEU A O    17 
ATOM   10652 C  CB   . LEU A 1 10 ? 10.143  17.549  -1.802  1.00 0.00 ? 10  LEU A CB   17 
ATOM   10653 C  CG   . LEU A 1 10 ? 10.831  17.755  -3.152  1.00 0.00 ? 10  LEU A CG   17 
ATOM   10654 C  CD1  . LEU A 1 10 ? 10.121  18.835  -3.953  1.00 0.00 ? 10  LEU A CD1  17 
ATOM   10655 C  CD2  . LEU A 1 10 ? 12.297  18.112  -2.954  1.00 0.00 ? 10  LEU A CD2  17 
ATOM   10656 H  H    . LEU A 1 10 ? 12.389  16.436  -1.387  1.00 0.00 ? 10  LEU A H    17 
ATOM   10657 H  HA   . LEU A 1 10 ? 9.824   16.162  -0.203  1.00 0.00 ? 10  LEU A HA   17 
ATOM   10658 H  HB2  . LEU A 1 10 ? 9.088   17.732  -1.937  1.00 0.00 ? 10  LEU A HB2  17 
ATOM   10659 H  HB3  . LEU A 1 10 ? 10.546  18.275  -1.110  1.00 0.00 ? 10  LEU A HB3  17 
ATOM   10660 H  HG   . LEU A 1 10 ? 10.783  16.835  -3.717  1.00 0.00 ? 10  LEU A HG   17 
ATOM   10661 H  HD11 . LEU A 1 10 ? 10.057  19.737  -3.364  1.00 0.00 ? 10  LEU A HD11 17 
ATOM   10662 H  HD12 . LEU A 1 10 ? 9.126   18.500  -4.207  1.00 0.00 ? 10  LEU A HD12 17 
ATOM   10663 H  HD13 . LEU A 1 10 ? 10.675  19.034  -4.859  1.00 0.00 ? 10  LEU A HD13 17 
ATOM   10664 H  HD21 . LEU A 1 10 ? 12.913  17.277  -3.254  1.00 0.00 ? 10  LEU A HD21 17 
ATOM   10665 H  HD22 . LEU A 1 10 ? 12.476  18.335  -1.912  1.00 0.00 ? 10  LEU A HD22 17 
ATOM   10666 H  HD23 . LEU A 1 10 ? 12.541  18.975  -3.555  1.00 0.00 ? 10  LEU A HD23 17 
ATOM   10667 N  N    . PRO A 1 11 ? 8.319   14.930  -1.860  1.00 0.00 ? 11  PRO A N    17 
ATOM   10668 C  CA   . PRO A 1 11 ? 7.535   13.959  -2.629  1.00 0.00 ? 11  PRO A CA   17 
ATOM   10669 C  C    . PRO A 1 11 ? 7.364   14.375  -4.086  1.00 0.00 ? 11  PRO A C    17 
ATOM   10670 O  O    . PRO A 1 11 ? 7.303   15.560  -4.415  1.00 0.00 ? 11  PRO A O    17 
ATOM   10671 C  CB   . PRO A 1 11 ? 6.181   13.949  -1.914  1.00 0.00 ? 11  PRO A CB   17 
ATOM   10672 C  CG   . PRO A 1 11 ? 6.089   15.284  -1.260  1.00 0.00 ? 11  PRO A CG   17 
ATOM   10673 C  CD   . PRO A 1 11 ? 7.496   15.657  -0.879  1.00 0.00 ? 11  PRO A CD   17 
ATOM   10674 H  HA   . PRO A 1 11 ? 7.973   12.972  -2.587  1.00 0.00 ? 11  PRO A HA   17 
ATOM   10675 H  HB2  . PRO A 1 11 ? 5.390   13.807  -2.637  1.00 0.00 ? 11  PRO A HB2  17 
ATOM   10676 H  HB3  . PRO A 1 11 ? 6.160   13.151  -1.187  1.00 0.00 ? 11  PRO A HB3  17 
ATOM   10677 H  HG2  . PRO A 1 11 ? 5.685   16.006  -1.953  1.00 0.00 ? 11  PRO A HG2  17 
ATOM   10678 H  HG3  . PRO A 1 11 ? 5.468   15.219  -0.379  1.00 0.00 ? 11  PRO A HG3  17 
ATOM   10679 H  HD2  . PRO A 1 11 ? 7.641   16.723  -0.968  1.00 0.00 ? 11  PRO A HD2  17 
ATOM   10680 H  HD3  . PRO A 1 11 ? 7.714   15.327  0.126   1.00 0.00 ? 11  PRO A HD3  17 
ATOM   10681 N  N    . PRO A 1 12 ? 7.285   13.379  -4.982  1.00 0.00 ? 12  PRO A N    17 
ATOM   10682 C  CA   . PRO A 1 12 ? 7.120   13.618  -6.419  1.00 0.00 ? 12  PRO A CA   17 
ATOM   10683 C  C    . PRO A 1 12 ? 5.738   14.166  -6.760  1.00 0.00 ? 12  PRO A C    17 
ATOM   10684 O  O    . PRO A 1 12 ? 4.721   13.616  -6.340  1.00 0.00 ? 12  PRO A O    17 
ATOM   10685 C  CB   . PRO A 1 12 ? 7.311   12.230  -7.033  1.00 0.00 ? 12  PRO A CB   17 
ATOM   10686 C  CG   . PRO A 1 12 ? 6.942   11.280  -5.946  1.00 0.00 ? 12  PRO A CG   17 
ATOM   10687 C  CD   . PRO A 1 12 ? 7.351   11.944  -4.660  1.00 0.00 ? 12  PRO A CD   17 
ATOM   10688 H  HA   . PRO A 1 12 ? 7.876   14.289  -6.799  1.00 0.00 ? 12  PRO A HA   17 
ATOM   10689 H  HB2  . PRO A 1 12 ? 6.662   12.120  -7.891  1.00 0.00 ? 12  PRO A HB2  17 
ATOM   10690 H  HB3  . PRO A 1 12 ? 8.340   12.104  -7.335  1.00 0.00 ? 12  PRO A HB3  17 
ATOM   10691 H  HG2  . PRO A 1 12 ? 5.877   11.106  -5.956  1.00 0.00 ? 12  PRO A HG2  17 
ATOM   10692 H  HG3  . PRO A 1 12 ? 7.477   10.351  -6.074  1.00 0.00 ? 12  PRO A HG3  17 
ATOM   10693 H  HD2  . PRO A 1 12 ? 6.659   11.694  -3.870  1.00 0.00 ? 12  PRO A HD2  17 
ATOM   10694 H  HD3  . PRO A 1 12 ? 8.356   11.656  -4.390  1.00 0.00 ? 12  PRO A HD3  17 
ATOM   10695 N  N    . ALA A 1 13 ? 5.710   15.253  -7.524  1.00 0.00 ? 13  ALA A N    17 
ATOM   10696 C  CA   . ALA A 1 13 ? 4.453   15.874  -7.923  1.00 0.00 ? 13  ALA A CA   17 
ATOM   10697 C  C    . ALA A 1 13 ? 4.088   15.501  -9.356  1.00 0.00 ? 13  ALA A C    17 
ATOM   10698 O  O    . ALA A 1 13 ? 4.954   15.419  -10.227 1.00 0.00 ? 13  ALA A O    17 
ATOM   10699 C  CB   . ALA A 1 13 ? 4.540   17.386  -7.775  1.00 0.00 ? 13  ALA A CB   17 
ATOM   10700 H  H    . ALA A 1 13 ? 6.555   15.646  -7.827  1.00 0.00 ? 13  ALA A H    17 
ATOM   10701 H  HA   . ALA A 1 13 ? 3.679   15.516  -7.260  1.00 0.00 ? 13  ALA A HA   17 
ATOM   10702 H  HB1  . ALA A 1 13 ? 4.351   17.852  -8.731  1.00 0.00 ? 13  ALA A HB1  17 
ATOM   10703 H  HB2  . ALA A 1 13 ? 3.804   17.720  -7.059  1.00 0.00 ? 13  ALA A HB2  17 
ATOM   10704 H  HB3  . ALA A 1 13 ? 5.527   17.657  -7.430  1.00 0.00 ? 13  ALA A HB3  17 
ATOM   10705 N  N    . THR A 1 14 ? 2.799   15.276  -9.594  1.00 0.00 ? 14  THR A N    17 
ATOM   10706 C  CA   . THR A 1 14 ? 2.320   14.910  -10.921 1.00 0.00 ? 14  THR A CA   17 
ATOM   10707 C  C    . THR A 1 14 ? 3.038   15.707  -12.004 1.00 0.00 ? 14  THR A C    17 
ATOM   10708 O  O    . THR A 1 14 ? 3.523   15.142  -12.985 1.00 0.00 ? 14  THR A O    17 
ATOM   10709 C  CB   . THR A 1 14 ? 0.802   15.139  -11.052 1.00 0.00 ? 14  THR A CB   17 
ATOM   10710 O  OG1  . THR A 1 14 ? 0.464   16.455  -10.600 1.00 0.00 ? 14  THR A OG1  17 
ATOM   10711 C  CG2  . THR A 1 14 ? 0.027   14.107  -10.247 1.00 0.00 ? 14  THR A CG2  17 
ATOM   10712 H  H    . THR A 1 14 ? 2.157   15.358  -8.858  1.00 0.00 ? 14  THR A H    17 
ATOM   10713 H  HA   . THR A 1 14 ? 2.518   13.859  -11.069 1.00 0.00 ? 14  THR A HA   17 
ATOM   10714 H  HB   . THR A 1 14 ? 0.528   15.042  -12.093 1.00 0.00 ? 14  THR A HB   17 
ATOM   10715 H  HG1  . THR A 1 14 ? -0.490  16.567  -10.625 1.00 0.00 ? 14  THR A HG1  17 
ATOM   10716 H  HG21 . THR A 1 14 ? 0.715   13.388  -9.826  1.00 0.00 ? 14  THR A HG21 17 
ATOM   10717 H  HG22 . THR A 1 14 ? -0.674  13.599  -10.892 1.00 0.00 ? 14  THR A HG22 17 
ATOM   10718 H  HG23 . THR A 1 14 ? -0.509  14.600  -9.450  1.00 0.00 ? 14  THR A HG23 17 
ATOM   10719 N  N    . HIS A 1 15 ? 3.104   17.022  -11.820 1.00 0.00 ? 15  HIS A N    17 
ATOM   10720 C  CA   . HIS A 1 15 ? 3.765   17.896  -12.782 1.00 0.00 ? 15  HIS A CA   17 
ATOM   10721 C  C    . HIS A 1 15 ? 5.245   17.547  -12.906 1.00 0.00 ? 15  HIS A C    17 
ATOM   10722 O  O    . HIS A 1 15 ? 5.779   17.449  -14.011 1.00 0.00 ? 15  HIS A O    17 
ATOM   10723 C  CB   . HIS A 1 15 ? 3.607   19.359  -12.366 1.00 0.00 ? 15  HIS A CB   17 
ATOM   10724 C  CG   . HIS A 1 15 ? 4.151   20.329  -13.369 1.00 0.00 ? 15  HIS A CG   17 
ATOM   10725 N  ND1  . HIS A 1 15 ? 5.475   20.710  -13.406 1.00 0.00 ? 15  HIS A ND1  17 
ATOM   10726 C  CD2  . HIS A 1 15 ? 3.541   20.995  -14.377 1.00 0.00 ? 15  HIS A CD2  17 
ATOM   10727 C  CE1  . HIS A 1 15 ? 5.656   21.570  -14.393 1.00 0.00 ? 15  HIS A CE1  17 
ATOM   10728 N  NE2  . HIS A 1 15 ? 4.498   21.760  -14.998 1.00 0.00 ? 15  HIS A NE2  17 
ATOM   10729 H  H    . HIS A 1 15 ? 2.698   17.413  -11.018 1.00 0.00 ? 15  HIS A H    17 
ATOM   10730 H  HA   . HIS A 1 15 ? 3.292   17.751  -13.741 1.00 0.00 ? 15  HIS A HA   17 
ATOM   10731 H  HB2  . HIS A 1 15 ? 2.558   19.576  -12.229 1.00 0.00 ? 15  HIS A HB2  17 
ATOM   10732 H  HB3  . HIS A 1 15 ? 4.127   19.519  -11.432 1.00 0.00 ? 15  HIS A HB3  17 
ATOM   10733 H  HD1  . HIS A 1 15 ? 6.178   20.398  -12.799 1.00 0.00 ? 15  HIS A HD1  17 
ATOM   10734 H  HD2  . HIS A 1 15 ? 2.495   20.938  -14.644 1.00 0.00 ? 15  HIS A HD2  17 
ATOM   10735 H  HE1  . HIS A 1 15 ? 6.592   22.038  -14.660 1.00 0.00 ? 15  HIS A HE1  17 
ATOM   10736 N  N    . ARG A 1 16 ? 5.901   17.361  -11.766 1.00 0.00 ? 16  ARG A N    17 
ATOM   10737 C  CA   . ARG A 1 16 ? 7.320   17.025  -11.747 1.00 0.00 ? 16  ARG A CA   17 
ATOM   10738 C  C    . ARG A 1 16 ? 7.587   15.752  -12.545 1.00 0.00 ? 16  ARG A C    17 
ATOM   10739 O  O    . ARG A 1 16 ? 6.844   14.773  -12.467 1.00 0.00 ? 16  ARG A O    17 
ATOM   10740 C  CB   . ARG A 1 16 ? 7.805   16.848  -10.307 1.00 0.00 ? 16  ARG A CB   17 
ATOM   10741 C  CG   . ARG A 1 16 ? 7.750   18.125  -9.485  1.00 0.00 ? 16  ARG A CG   17 
ATOM   10742 C  CD   . ARG A 1 16 ? 8.774   19.142  -9.965  1.00 0.00 ? 16  ARG A CD   17 
ATOM   10743 N  NE   . ARG A 1 16 ? 8.631   20.426  -9.283  1.00 0.00 ? 16  ARG A NE   17 
ATOM   10744 C  CZ   . ARG A 1 16 ? 9.116   20.672  -8.071  1.00 0.00 ? 16  ARG A CZ   17 
ATOM   10745 N  NH1  . ARG A 1 16 ? 9.771   19.728  -7.411  1.00 0.00 ? 16  ARG A NH1  17 
ATOM   10746 N  NH2  . ARG A 1 16 ? 8.946   21.866  -7.517  1.00 0.00 ? 16  ARG A NH2  17 
ATOM   10747 H  H    . ARG A 1 16 ? 5.421   17.453  -10.916 1.00 0.00 ? 16  ARG A H    17 
ATOM   10748 H  HA   . ARG A 1 16 ? 7.861   17.841  -12.202 1.00 0.00 ? 16  ARG A HA   17 
ATOM   10749 H  HB2  . ARG A 1 16 ? 7.190   16.106  -9.820  1.00 0.00 ? 16  ARG A HB2  17 
ATOM   10750 H  HB3  . ARG A 1 16 ? 8.828   16.502  -10.325 1.00 0.00 ? 16  ARG A HB3  17 
ATOM   10751 H  HG2  . ARG A 1 16 ? 6.763   18.556  -9.573  1.00 0.00 ? 16  ARG A HG2  17 
ATOM   10752 H  HG3  . ARG A 1 16 ? 7.949   17.886  -8.451  1.00 0.00 ? 16  ARG A HG3  17 
ATOM   10753 H  HD2  . ARG A 1 16 ? 9.763   18.753  -9.776  1.00 0.00 ? 16  ARG A HD2  17 
ATOM   10754 H  HD3  . ARG A 1 16 ? 8.643   19.292  -11.026 1.00 0.00 ? 16  ARG A HD3  17 
ATOM   10755 H  HE   . ARG A 1 16 ? 8.150   21.138  -9.753  1.00 0.00 ? 16  ARG A HE   17 
ATOM   10756 H  HH11 . ARG A 1 16 ? 9.902   18.828  -7.826  1.00 0.00 ? 16  ARG A HH11 17 
ATOM   10757 H  HH12 . ARG A 1 16 ? 10.136  19.916  -6.499  1.00 0.00 ? 16  ARG A HH12 17 
ATOM   10758 H  HH21 . ARG A 1 16 ? 8.452   22.581  -8.012  1.00 0.00 ? 16  ARG A HH21 17 
ATOM   10759 H  HH22 . ARG A 1 16 ? 9.311   22.051  -6.605  1.00 0.00 ? 16  ARG A HH22 17 
ATOM   10760 N  N    . PRO A 1 17 ? 8.674   15.763  -13.332 1.00 0.00 ? 17  PRO A N    17 
ATOM   10761 C  CA   . PRO A 1 17 ? 9.065   14.618  -14.159 1.00 0.00 ? 17  PRO A CA   17 
ATOM   10762 C  C    . PRO A 1 17 ? 9.561   13.442  -13.324 1.00 0.00 ? 17  PRO A C    17 
ATOM   10763 O  O    . PRO A 1 17 ? 9.945   12.404  -13.863 1.00 0.00 ? 17  PRO A O    17 
ATOM   10764 C  CB   . PRO A 1 17 ? 10.197  15.175  -15.024 1.00 0.00 ? 17  PRO A CB   17 
ATOM   10765 C  CG   . PRO A 1 17 ? 10.761  16.303  -14.230 1.00 0.00 ? 17  PRO A CG   17 
ATOM   10766 C  CD   . PRO A 1 17 ? 9.605   16.895  -13.474 1.00 0.00 ? 17  PRO A CD   17 
ATOM   10767 H  HA   . PRO A 1 17 ? 8.253   14.291  -14.792 1.00 0.00 ? 17  PRO A HA   17 
ATOM   10768 H  HB2  . PRO A 1 17 ? 10.935  14.404  -15.196 1.00 0.00 ? 17  PRO A HB2  17 
ATOM   10769 H  HB3  . PRO A 1 17 ? 9.800   15.518  -15.968 1.00 0.00 ? 17  PRO A HB3  17 
ATOM   10770 H  HG2  . PRO A 1 17 ? 11.508  15.931  -13.544 1.00 0.00 ? 17  PRO A HG2  17 
ATOM   10771 H  HG3  . PRO A 1 17 ? 11.192  17.039  -14.893 1.00 0.00 ? 17  PRO A HG3  17 
ATOM   10772 H  HD2  . PRO A 1 17 ? 9.929   17.252  -12.507 1.00 0.00 ? 17  PRO A HD2  17 
ATOM   10773 H  HD3  . PRO A 1 17 ? 9.154   17.696  -14.041 1.00 0.00 ? 17  PRO A HD3  17 
ATOM   10774 N  N    . HIS A 1 18 ? 9.551   13.613  -12.006 1.00 0.00 ? 18  HIS A N    17 
ATOM   10775 C  CA   . HIS A 1 18 ? 9.999   12.564  -11.096 1.00 0.00 ? 18  HIS A CA   17 
ATOM   10776 C  C    . HIS A 1 18 ? 9.073   11.354  -11.163 1.00 0.00 ? 18  HIS A C    17 
ATOM   10777 O  O    . HIS A 1 18 ? 7.851   11.481  -11.254 1.00 0.00 ? 18  HIS A O    17 
ATOM   10778 C  CB   . HIS A 1 18 ? 10.062  13.095  -9.664  1.00 0.00 ? 18  HIS A CB   17 
ATOM   10779 C  CG   . HIS A 1 18 ? 11.096  12.418  -8.818  1.00 0.00 ? 18  HIS A CG   17 
ATOM   10780 N  ND1  . HIS A 1 18 ? 12.418  12.807  -8.790  1.00 0.00 ? 18  HIS A ND1  17 
ATOM   10781 C  CD2  . HIS A 1 18 ? 10.995  11.371  -7.965  1.00 0.00 ? 18  HIS A CD2  17 
ATOM   10782 C  CE1  . HIS A 1 18 ? 13.087  12.028  -7.958  1.00 0.00 ? 18  HIS A CE1  17 
ATOM   10783 N  NE2  . HIS A 1 18 ? 12.246  11.149  -7.444  1.00 0.00 ? 18  HIS A NE2  17 
ATOM   10784 H  H    . HIS A 1 18 ? 9.233   14.463  -11.636 1.00 0.00 ? 18  HIS A H    17 
ATOM   10785 H  HA   . HIS A 1 18 ? 10.989  12.261  -11.402 1.00 0.00 ? 18  HIS A HA   17 
ATOM   10786 H  HB2  . HIS A 1 18 ? 10.293  14.150  -9.687  1.00 0.00 ? 18  HIS A HB2  17 
ATOM   10787 H  HB3  . HIS A 1 18 ? 9.100   12.953  -9.191  1.00 0.00 ? 18  HIS A HB3  17 
ATOM   10788 H  HD1  . HIS A 1 18 ? 12.809  13.543  -9.305  1.00 0.00 ? 18  HIS A HD1  17 
ATOM   10789 H  HD2  . HIS A 1 18 ? 10.098  10.814  -7.737  1.00 0.00 ? 18  HIS A HD2  17 
ATOM   10790 H  HE1  . HIS A 1 18 ? 14.141  12.098  -7.736  1.00 0.00 ? 18  HIS A HE1  17 
ATOM   10791 N  N    . PRO A 1 19 ? 9.665   10.151  -11.117 1.00 0.00 ? 19  PRO A N    17 
ATOM   10792 C  CA   . PRO A 1 19 ? 8.911   8.895   -11.171 1.00 0.00 ? 19  PRO A CA   17 
ATOM   10793 C  C    . PRO A 1 19 ? 8.098   8.652   -9.904  1.00 0.00 ? 19  PRO A C    17 
ATOM   10794 O  O    . PRO A 1 19 ? 8.128   9.455   -8.970  1.00 0.00 ? 19  PRO A O    17 
ATOM   10795 C  CB   . PRO A 1 19 ? 10.003  7.832   -11.317 1.00 0.00 ? 19  PRO A CB   17 
ATOM   10796 C  CG   . PRO A 1 19 ? 11.218  8.453   -10.720 1.00 0.00 ? 19  PRO A CG   17 
ATOM   10797 C  CD   . PRO A 1 19 ? 11.116  9.925   -11.008 1.00 0.00 ? 19  PRO A CD   17 
ATOM   10798 H  HA   . PRO A 1 19 ? 8.256   8.862   -12.029 1.00 0.00 ? 19  PRO A HA   17 
ATOM   10799 H  HB2  . PRO A 1 19 ? 9.712   6.938   -10.784 1.00 0.00 ? 19  PRO A HB2  17 
ATOM   10800 H  HB3  . PRO A 1 19 ? 10.149  7.604   -12.362 1.00 0.00 ? 19  PRO A HB3  17 
ATOM   10801 H  HG2  . PRO A 1 19 ? 11.233  8.279   -9.655  1.00 0.00 ? 19  PRO A HG2  17 
ATOM   10802 H  HG3  . PRO A 1 19 ? 12.104  8.042   -11.181 1.00 0.00 ? 19  PRO A HG3  17 
ATOM   10803 H  HD2  . PRO A 1 19 ? 11.535  10.499  -10.195 1.00 0.00 ? 19  PRO A HD2  17 
ATOM   10804 H  HD3  . PRO A 1 19 ? 11.613  10.163  -11.936 1.00 0.00 ? 19  PRO A HD3  17 
ATOM   10805 N  N    . THR A 1 20 ? 7.371   7.540   -9.877  1.00 0.00 ? 20  THR A N    17 
ATOM   10806 C  CA   . THR A 1 20 ? 6.549   7.191   -8.725  1.00 0.00 ? 20  THR A CA   17 
ATOM   10807 C  C    . THR A 1 20 ? 7.039   5.906   -8.068  1.00 0.00 ? 20  THR A C    17 
ATOM   10808 O  O    . THR A 1 20 ? 7.487   4.982   -8.747  1.00 0.00 ? 20  THR A O    17 
ATOM   10809 C  CB   . THR A 1 20 ? 5.070   7.020   -9.121  1.00 0.00 ? 20  THR A CB   17 
ATOM   10810 O  OG1  . THR A 1 20 ? 4.296   6.645   -7.976  1.00 0.00 ? 20  THR A OG1  17 
ATOM   10811 C  CG2  . THR A 1 20 ? 4.920   5.966   -10.208 1.00 0.00 ? 20  THR A CG2  17 
ATOM   10812 H  H    . THR A 1 20 ? 7.388   6.940   -10.652 1.00 0.00 ? 20  THR A H    17 
ATOM   10813 H  HA   . THR A 1 20 ? 6.617   7.999   -8.010  1.00 0.00 ? 20  THR A HA   17 
ATOM   10814 H  HB   . THR A 1 20 ? 4.703   7.962   -9.501  1.00 0.00 ? 20  THR A HB   17 
ATOM   10815 H  HG1  . THR A 1 20 ? 3.364   6.774   -8.163  1.00 0.00 ? 20  THR A HG1  17 
ATOM   10816 H  HG21 . THR A 1 20 ? 5.872   5.486   -10.378 1.00 0.00 ? 20  THR A HG21 17 
ATOM   10817 H  HG22 . THR A 1 20 ? 4.584   6.436   -11.120 1.00 0.00 ? 20  THR A HG22 17 
ATOM   10818 H  HG23 . THR A 1 20 ? 4.196   5.228   -9.895  1.00 0.00 ? 20  THR A HG23 17 
ATOM   10819 N  N    . SER A 1 21 ? 6.952   5.854   -6.742  1.00 0.00 ? 21  SER A N    17 
ATOM   10820 C  CA   . SER A 1 21 ? 7.391   4.683   -5.993  1.00 0.00 ? 21  SER A CA   17 
ATOM   10821 C  C    . SER A 1 21 ? 6.839   3.403   -6.614  1.00 0.00 ? 21  SER A C    17 
ATOM   10822 O  O    . SER A 1 21 ? 5.634   3.277   -6.836  1.00 0.00 ? 21  SER A O    17 
ATOM   10823 C  CB   . SER A 1 21 ? 6.944   4.788   -4.533  1.00 0.00 ? 21  SER A CB   17 
ATOM   10824 O  OG   . SER A 1 21 ? 7.509   5.928   -3.908  1.00 0.00 ? 21  SER A OG   17 
ATOM   10825 H  H    . SER A 1 21 ? 6.586   6.623   -6.257  1.00 0.00 ? 21  SER A H    17 
ATOM   10826 H  HA   . SER A 1 21 ? 8.469   4.651   -6.029  1.00 0.00 ? 21  SER A HA   17 
ATOM   10827 H  HB2  . SER A 1 21 ? 5.868   4.867   -4.493  1.00 0.00 ? 21  SER A HB2  17 
ATOM   10828 H  HB3  . SER A 1 21 ? 7.261   3.905   -3.998  1.00 0.00 ? 21  SER A HB3  17 
ATOM   10829 H  HG   . SER A 1 21 ? 6.830   6.595   -3.785  1.00 0.00 ? 21  SER A HG   17 
ATOM   10830 N  N    . ILE A 1 22 ? 7.729   2.456   -6.892  1.00 0.00 ? 22  ILE A N    17 
ATOM   10831 C  CA   . ILE A 1 22 ? 7.332   1.186   -7.486  1.00 0.00 ? 22  ILE A CA   17 
ATOM   10832 C  C    . ILE A 1 22 ? 6.640   0.293   -6.462  1.00 0.00 ? 22  ILE A C    17 
ATOM   10833 O  O    . ILE A 1 22 ? 6.989   0.296   -5.282  1.00 0.00 ? 22  ILE A O    17 
ATOM   10834 C  CB   . ILE A 1 22 ? 8.543   0.435   -8.070  1.00 0.00 ? 22  ILE A CB   17 
ATOM   10835 C  CG1  . ILE A 1 22 ? 9.025   1.118   -9.352  1.00 0.00 ? 22  ILE A CG1  17 
ATOM   10836 C  CG2  . ILE A 1 22 ? 8.185   -1.019  -8.340  1.00 0.00 ? 22  ILE A CG2  17 
ATOM   10837 C  CD1  . ILE A 1 22 ? 9.637   2.481   -9.117  1.00 0.00 ? 22  ILE A CD1  17 
ATOM   10838 H  H    . ILE A 1 22 ? 8.675   2.616   -6.692  1.00 0.00 ? 22  ILE A H    17 
ATOM   10839 H  HA   . ILE A 1 22 ? 6.642   1.396   -8.290  1.00 0.00 ? 22  ILE A HA   17 
ATOM   10840 H  HB   . ILE A 1 22 ? 9.338   0.455   -7.340  1.00 0.00 ? 22  ILE A HB   17 
ATOM   10841 H  HG12 . ILE A 1 22 ? 9.770   0.497   -9.825  1.00 0.00 ? 22  ILE A HG12 17 
ATOM   10842 H  HG13 . ILE A 1 22 ? 8.186   1.241   -10.022 1.00 0.00 ? 22  ILE A HG13 17 
ATOM   10843 H  HG21 . ILE A 1 22 ? 8.714   -1.363  -9.217  1.00 0.00 ? 22  ILE A HG21 17 
ATOM   10844 H  HG22 . ILE A 1 22 ? 8.468   -1.623  -7.491  1.00 0.00 ? 22  ILE A HG22 17 
ATOM   10845 H  HG23 . ILE A 1 22 ? 7.122   -1.103  -8.504  1.00 0.00 ? 22  ILE A HG23 17 
ATOM   10846 H  HD11 . ILE A 1 22 ? 10.281  2.442   -8.251  1.00 0.00 ? 22  ILE A HD11 17 
ATOM   10847 H  HD12 . ILE A 1 22 ? 10.213  2.771   -9.983  1.00 0.00 ? 22  ILE A HD12 17 
ATOM   10848 H  HD13 . ILE A 1 22 ? 8.852   3.204   -8.949  1.00 0.00 ? 22  ILE A HD13 17 
ATOM   10849 N  N    . CYS A 1 23 ? 5.656   -0.473  -6.923  1.00 0.00 ? 23  CYS A N    17 
ATOM   10850 C  CA   . CYS A 1 23 ? 4.914   -1.374  -6.049  1.00 0.00 ? 23  CYS A CA   17 
ATOM   10851 C  C    . CYS A 1 23 ? 5.840   -2.419  -5.433  1.00 0.00 ? 23  CYS A C    17 
ATOM   10852 O  O    . CYS A 1 23 ? 7.015   -2.511  -5.790  1.00 0.00 ? 23  CYS A O    17 
ATOM   10853 C  CB   . CYS A 1 23 ? 3.793   -2.065  -6.827  1.00 0.00 ? 23  CYS A CB   17 
ATOM   10854 S  SG   . CYS A 1 23 ? 2.394   -2.605  -5.793  1.00 0.00 ? 23  CYS A SG   17 
ATOM   10855 H  H    . CYS A 1 23 ? 5.423   -0.432  -7.875  1.00 0.00 ? 23  CYS A H    17 
ATOM   10856 H  HA   . CYS A 1 23 ? 4.480   -0.784  -5.256  1.00 0.00 ? 23  CYS A HA   17 
ATOM   10857 H  HB2  . CYS A 1 23 ? 3.407   -1.382  -7.570  1.00 0.00 ? 23  CYS A HB2  17 
ATOM   10858 H  HB3  . CYS A 1 23 ? 4.193   -2.938  -7.322  1.00 0.00 ? 23  CYS A HB3  17 
ATOM   10859 N  N    . ASP A 1 24 ? 5.302   -3.204  -4.506  1.00 0.00 ? 24  ASP A N    17 
ATOM   10860 C  CA   . ASP A 1 24 ? 6.078   -4.244  -3.841  1.00 0.00 ? 24  ASP A CA   17 
ATOM   10861 C  C    . ASP A 1 24 ? 5.665   -5.629  -4.331  1.00 0.00 ? 24  ASP A C    17 
ATOM   10862 O  O    . ASP A 1 24 ? 6.437   -6.583  -4.249  1.00 0.00 ? 24  ASP A O    17 
ATOM   10863 C  CB   . ASP A 1 24 ? 5.900   -4.153  -2.325  1.00 0.00 ? 24  ASP A CB   17 
ATOM   10864 C  CG   . ASP A 1 24 ? 6.712   -5.196  -1.582  1.00 0.00 ? 24  ASP A CG   17 
ATOM   10865 O  OD1  . ASP A 1 24 ? 7.764   -5.614  -2.109  1.00 0.00 ? 24  ASP A OD1  17 
ATOM   10866 O  OD2  . ASP A 1 24 ? 6.295   -5.594  -0.474  1.00 0.00 ? 24  ASP A OD2  17 
ATOM   10867 H  H    . ASP A 1 24 ? 4.360   -3.083  -4.265  1.00 0.00 ? 24  ASP A H    17 
ATOM   10868 H  HA   . ASP A 1 24 ? 7.119   -4.087  -4.082  1.00 0.00 ? 24  ASP A HA   17 
ATOM   10869 H  HB2  . ASP A 1 24 ? 6.214   -3.174  -1.990  1.00 0.00 ? 24  ASP A HB2  17 
ATOM   10870 H  HB3  . ASP A 1 24 ? 4.857   -4.294  -2.082  1.00 0.00 ? 24  ASP A HB3  17 
ATOM   10871 N  N    . ASN A 1 25 ? 4.442   -5.729  -4.841  1.00 0.00 ? 25  ASN A N    17 
ATOM   10872 C  CA   . ASN A 1 25 ? 3.925   -6.997  -5.343  1.00 0.00 ? 25  ASN A CA   17 
ATOM   10873 C  C    . ASN A 1 25 ? 4.250   -7.169  -6.824  1.00 0.00 ? 25  ASN A C    17 
ATOM   10874 O  O    . ASN A 1 25 ? 5.065   -8.012  -7.199  1.00 0.00 ? 25  ASN A O    17 
ATOM   10875 C  CB   . ASN A 1 25 ? 2.412   -7.077  -5.129  1.00 0.00 ? 25  ASN A CB   17 
ATOM   10876 C  CG   . ASN A 1 25 ? 2.050   -7.536  -3.730  1.00 0.00 ? 25  ASN A CG   17 
ATOM   10877 O  OD1  . ASN A 1 25 ? 2.330   -8.672  -3.345  1.00 0.00 ? 25  ASN A OD1  17 
ATOM   10878 N  ND2  . ASN A 1 25 ? 1.424   -6.653  -2.961  1.00 0.00 ? 25  ASN A ND2  17 
ATOM   10879 H  H    . ASN A 1 25 ? 3.873   -4.933  -4.880  1.00 0.00 ? 25  ASN A H    17 
ATOM   10880 H  HA   . ASN A 1 25 ? 4.401   -7.792  -4.788  1.00 0.00 ? 25  ASN A HA   17 
ATOM   10881 H  HB2  . ASN A 1 25 ? 1.981   -6.099  -5.289  1.00 0.00 ? 25  ASN A HB2  17 
ATOM   10882 H  HB3  . ASN A 1 25 ? 1.990   -7.772  -5.838  1.00 0.00 ? 25  ASN A HB3  17 
ATOM   10883 H  HD21 . ASN A 1 25 ? 1.234   -5.767  -3.333  1.00 0.00 ? 25  ASN A HD21 17 
ATOM   10884 H  HD22 . ASN A 1 25 ? 1.179   -6.924  -2.051  1.00 0.00 ? 25  ASN A HD22 17 
ATOM   10885 N  N    . PHE A 1 26 ? 3.607   -6.362  -7.662  1.00 0.00 ? 26  PHE A N    17 
ATOM   10886 C  CA   . PHE A 1 26 ? 3.826   -6.424  -9.103  1.00 0.00 ? 26  PHE A CA   17 
ATOM   10887 C  C    . PHE A 1 26 ? 5.308   -6.273  -9.434  1.00 0.00 ? 26  PHE A C    17 
ATOM   10888 O  O    . PHE A 1 26 ? 5.776   -6.751  -10.467 1.00 0.00 ? 26  PHE A O    17 
ATOM   10889 C  CB   . PHE A 1 26 ? 3.019   -5.334  -9.810  1.00 0.00 ? 26  PHE A CB   17 
ATOM   10890 C  CG   . PHE A 1 26 ? 2.587   -5.712  -11.198 1.00 0.00 ? 26  PHE A CG   17 
ATOM   10891 C  CD1  . PHE A 1 26 ? 3.507   -5.771  -12.233 1.00 0.00 ? 26  PHE A CD1  17 
ATOM   10892 C  CD2  . PHE A 1 26 ? 1.261   -6.011  -11.468 1.00 0.00 ? 26  PHE A CD2  17 
ATOM   10893 C  CE1  . PHE A 1 26 ? 3.112   -6.118  -13.511 1.00 0.00 ? 26  PHE A CE1  17 
ATOM   10894 C  CE2  . PHE A 1 26 ? 0.860   -6.360  -12.744 1.00 0.00 ? 26  PHE A CE2  17 
ATOM   10895 C  CZ   . PHE A 1 26 ? 1.787   -6.414  -13.766 1.00 0.00 ? 26  PHE A CZ   17 
ATOM   10896 H  H    . PHE A 1 26 ? 2.968   -5.710  -7.303  1.00 0.00 ? 26  PHE A H    17 
ATOM   10897 H  HA   . PHE A 1 26 ? 3.489   -7.390  -9.447  1.00 0.00 ? 26  PHE A HA   17 
ATOM   10898 H  HB2  . PHE A 1 26 ? 2.132   -5.121  -9.234  1.00 0.00 ? 26  PHE A HB2  17 
ATOM   10899 H  HB3  . PHE A 1 26 ? 3.621   -4.440  -9.881  1.00 0.00 ? 26  PHE A HB3  17 
ATOM   10900 H  HD1  . PHE A 1 26 ? 4.543   -5.541  -12.034 1.00 0.00 ? 26  PHE A HD1  17 
ATOM   10901 H  HD2  . PHE A 1 26 ? 0.535   -5.969  -10.668 1.00 0.00 ? 26  PHE A HD2  17 
ATOM   10902 H  HE1  . PHE A 1 26 ? 3.838   -6.161  -14.308 1.00 0.00 ? 26  PHE A HE1  17 
ATOM   10903 H  HE2  . PHE A 1 26 ? -0.177  -6.590  -12.940 1.00 0.00 ? 26  PHE A HE2  17 
ATOM   10904 H  HZ   . PHE A 1 26 ? 1.475   -6.686  -14.764 1.00 0.00 ? 26  PHE A HZ   17 
ATOM   10905 N  N    . SER A 1 27 ? 6.040   -5.604  -8.550  1.00 0.00 ? 27  SER A N    17 
ATOM   10906 C  CA   . SER A 1 27 ? 7.468   -5.385  -8.750  1.00 0.00 ? 27  SER A CA   17 
ATOM   10907 C  C    . SER A 1 27 ? 8.183   -6.699  -9.045  1.00 0.00 ? 27  SER A C    17 
ATOM   10908 O  O    . SER A 1 27 ? 8.723   -6.894  -10.134 1.00 0.00 ? 27  SER A O    17 
ATOM   10909 C  CB   . SER A 1 27 ? 8.082   -4.723  -7.514  1.00 0.00 ? 27  SER A CB   17 
ATOM   10910 O  OG   . SER A 1 27 ? 9.485   -4.917  -7.476  1.00 0.00 ? 27  SER A OG   17 
ATOM   10911 H  H    . SER A 1 27 ? 5.609   -5.246  -7.745  1.00 0.00 ? 27  SER A H    17 
ATOM   10912 H  HA   . SER A 1 27 ? 7.587   -4.725  -9.597  1.00 0.00 ? 27  SER A HA   17 
ATOM   10913 H  HB2  . SER A 1 27 ? 7.878   -3.664  -7.537  1.00 0.00 ? 27  SER A HB2  17 
ATOM   10914 H  HB3  . SER A 1 27 ? 7.646   -5.155  -6.625  1.00 0.00 ? 27  SER A HB3  17 
ATOM   10915 H  HG   . SER A 1 27 ? 9.928   -4.079  -7.623  1.00 0.00 ? 27  SER A HG   17 
ATOM   10916 N  N    . ALA A 1 28 ? 8.182   -7.599  -8.067  1.00 0.00 ? 28  ALA A N    17 
ATOM   10917 C  CA   . ALA A 1 28 ? 8.829   -8.896  -8.222  1.00 0.00 ? 28  ALA A CA   17 
ATOM   10918 C  C    . ALA A 1 28 ? 7.819   -9.969  -8.614  1.00 0.00 ? 28  ALA A C    17 
ATOM   10919 O  O    . ALA A 1 28 ? 7.956   -10.614 -9.654  1.00 0.00 ? 28  ALA A O    17 
ATOM   10920 C  CB   . ALA A 1 28 ? 9.543   -9.286  -6.936  1.00 0.00 ? 28  ALA A CB   17 
ATOM   10921 H  H    . ALA A 1 28 ? 7.735   -7.385  -7.222  1.00 0.00 ? 28  ALA A H    17 
ATOM   10922 H  HA   . ALA A 1 28 ? 9.569   -8.809  -9.004  1.00 0.00 ? 28  ALA A HA   17 
ATOM   10923 H  HB1  . ALA A 1 28 ? 9.321   -8.561  -6.167  1.00 0.00 ? 28  ALA A HB1  17 
ATOM   10924 H  HB2  . ALA A 1 28 ? 9.207   -10.262 -6.620  1.00 0.00 ? 28  ALA A HB2  17 
ATOM   10925 H  HB3  . ALA A 1 28 ? 10.609  -9.311  -7.111  1.00 0.00 ? 28  ALA A HB3  17 
ATOM   10926 N  N    . TYR A 1 29 ? 6.806   -10.157 -7.775  1.00 0.00 ? 29  TYR A N    17 
ATOM   10927 C  CA   . TYR A 1 29 ? 5.775   -11.155 -8.034  1.00 0.00 ? 29  TYR A CA   17 
ATOM   10928 C  C    . TYR A 1 29 ? 5.213   -11.006 -9.444  1.00 0.00 ? 29  TYR A C    17 
ATOM   10929 O  O    . TYR A 1 29 ? 5.184   -11.962 -10.217 1.00 0.00 ? 29  TYR A O    17 
ATOM   10930 C  CB   . TYR A 1 29 ? 4.647   -11.030 -7.008  1.00 0.00 ? 29  TYR A CB   17 
ATOM   10931 C  CG   . TYR A 1 29 ? 5.115   -11.147 -5.575  1.00 0.00 ? 29  TYR A CG   17 
ATOM   10932 C  CD1  . TYR A 1 29 ? 5.663   -10.057 -4.911  1.00 0.00 ? 29  TYR A CD1  17 
ATOM   10933 C  CD2  . TYR A 1 29 ? 5.010   -12.349 -4.885  1.00 0.00 ? 29  TYR A CD2  17 
ATOM   10934 C  CE1  . TYR A 1 29 ? 6.093   -10.160 -3.602  1.00 0.00 ? 29  TYR A CE1  17 
ATOM   10935 C  CE2  . TYR A 1 29 ? 5.436   -12.461 -3.576  1.00 0.00 ? 29  TYR A CE2  17 
ATOM   10936 C  CZ   . TYR A 1 29 ? 5.977   -11.364 -2.939  1.00 0.00 ? 29  TYR A CZ   17 
ATOM   10937 O  OH   . TYR A 1 29 ? 6.403   -11.470 -1.635  1.00 0.00 ? 29  TYR A OH   17 
ATOM   10938 H  H    . TYR A 1 29 ? 6.751   -9.613  -6.962  1.00 0.00 ? 29  TYR A H    17 
ATOM   10939 H  HA   . TYR A 1 29 ? 6.227   -12.131 -7.940  1.00 0.00 ? 29  TYR A HA   17 
ATOM   10940 H  HB2  . TYR A 1 29 ? 4.170   -10.069 -7.123  1.00 0.00 ? 29  TYR A HB2  17 
ATOM   10941 H  HB3  . TYR A 1 29 ? 3.921   -11.810 -7.185  1.00 0.00 ? 29  TYR A HB3  17 
ATOM   10942 H  HD1  . TYR A 1 29 ? 5.751   -9.115  -5.433  1.00 0.00 ? 29  TYR A HD1  17 
ATOM   10943 H  HD2  . TYR A 1 29 ? 4.585   -13.207 -5.387  1.00 0.00 ? 29  TYR A HD2  17 
ATOM   10944 H  HE1  . TYR A 1 29 ? 6.516   -9.301  -3.103  1.00 0.00 ? 29  TYR A HE1  17 
ATOM   10945 H  HE2  . TYR A 1 29 ? 5.346   -13.403 -3.056  1.00 0.00 ? 29  TYR A HE2  17 
ATOM   10946 H  HH   . TYR A 1 29 ? 5.873   -10.896 -1.077  1.00 0.00 ? 29  TYR A HH   17 
ATOM   10947 N  N    . GLY A 1 30 ? 4.769   -9.796  -9.773  1.00 0.00 ? 30  GLY A N    17 
ATOM   10948 C  CA   . GLY A 1 30 ? 4.214   -9.542  -11.089 1.00 0.00 ? 30  GLY A CA   17 
ATOM   10949 C  C    . GLY A 1 30 ? 2.744   -9.179  -11.039 1.00 0.00 ? 30  GLY A C    17 
ATOM   10950 O  O    . GLY A 1 30 ? 2.244   -8.463  -11.908 1.00 0.00 ? 30  GLY A O    17 
ATOM   10951 H  H    . GLY A 1 30 ? 4.817   -9.071  -9.115  1.00 0.00 ? 30  GLY A H    17 
ATOM   10952 H  HA2  . GLY A 1 30 ? 4.760   -8.730  -11.547 1.00 0.00 ? 30  GLY A HA2  17 
ATOM   10953 H  HA3  . GLY A 1 30 ? 4.334   -10.429 -11.695 1.00 0.00 ? 30  GLY A HA3  17 
ATOM   10954 N  N    . TRP A 1 31 ? 2.048   -9.674  -10.022 1.00 0.00 ? 31  TRP A N    17 
ATOM   10955 C  CA   . TRP A 1 31 ? 0.625   -9.398  -9.863  1.00 0.00 ? 31  TRP A CA   17 
ATOM   10956 C  C    . TRP A 1 31 ? 0.384   -8.422  -8.717  1.00 0.00 ? 31  TRP A C    17 
ATOM   10957 O  O    . TRP A 1 31 ? 1.226   -8.268  -7.832  1.00 0.00 ? 31  TRP A O    17 
ATOM   10958 C  CB   . TRP A 1 31 ? -0.142  -10.698 -9.612  1.00 0.00 ? 31  TRP A CB   17 
ATOM   10959 C  CG   . TRP A 1 31 ? -0.280  -11.035 -8.159  1.00 0.00 ? 31  TRP A CG   17 
ATOM   10960 C  CD1  . TRP A 1 31 ? 0.643   -11.663 -7.372  1.00 0.00 ? 31  TRP A CD1  17 
ATOM   10961 C  CD2  . TRP A 1 31 ? -1.408  -10.765 -7.319  1.00 0.00 ? 31  TRP A CD2  17 
ATOM   10962 N  NE1  . TRP A 1 31 ? 0.157   -11.799 -6.094  1.00 0.00 ? 31  TRP A NE1  17 
ATOM   10963 C  CE2  . TRP A 1 31 ? -1.099  -11.255 -6.035  1.00 0.00 ? 31  TRP A CE2  17 
ATOM   10964 C  CE3  . TRP A 1 31 ? -2.647  -10.154 -7.526  1.00 0.00 ? 31  TRP A CE3  17 
ATOM   10965 C  CZ2  . TRP A 1 31 ? -1.985  -11.154 -4.967  1.00 0.00 ? 31  TRP A CZ2  17 
ATOM   10966 C  CZ3  . TRP A 1 31 ? -3.527  -10.055 -6.465  1.00 0.00 ? 31  TRP A CZ3  17 
ATOM   10967 C  CH2  . TRP A 1 31 ? -3.192  -10.552 -5.198  1.00 0.00 ? 31  TRP A CH2  17 
ATOM   10968 H  H    . TRP A 1 31 ? 2.503   -10.238 -9.361  1.00 0.00 ? 31  TRP A H    17 
ATOM   10969 H  HA   . TRP A 1 31 ? 0.270   -8.953  -10.781 1.00 0.00 ? 31  TRP A HA   17 
ATOM   10970 H  HB2  . TRP A 1 31 ? -1.134  -10.609 -10.029 1.00 0.00 ? 31  TRP A HB2  17 
ATOM   10971 H  HB3  . TRP A 1 31 ? 0.377   -11.512 -10.097 1.00 0.00 ? 31  TRP A HB3  17 
ATOM   10972 H  HD1  . TRP A 1 31 ? 1.609   -11.999 -7.718  1.00 0.00 ? 31  TRP A HD1  17 
ATOM   10973 H  HE1  . TRP A 1 31 ? 0.634   -12.216 -5.346  1.00 0.00 ? 31  TRP A HE1  17 
ATOM   10974 H  HE3  . TRP A 1 31 ? -2.923  -9.765  -8.495  1.00 0.00 ? 31  TRP A HE3  17 
ATOM   10975 H  HZ2  . TRP A 1 31 ? -1.742  -11.532 -3.984  1.00 0.00 ? 31  TRP A HZ2  17 
ATOM   10976 H  HZ3  . TRP A 1 31 ? -4.490  -9.587  -6.606  1.00 0.00 ? 31  TRP A HZ3  17 
ATOM   10977 H  HH2  . TRP A 1 31 ? -3.910  -10.453 -4.399  1.00 0.00 ? 31  TRP A HH2  17 
ATOM   10978 N  N    . CYS A 1 32 ? -0.771  -7.765  -8.738  1.00 0.00 ? 32  CYS A N    17 
ATOM   10979 C  CA   . CYS A 1 32 ? -1.123  -6.803  -7.701  1.00 0.00 ? 32  CYS A CA   17 
ATOM   10980 C  C    . CYS A 1 32 ? -2.625  -6.815  -7.435  1.00 0.00 ? 32  CYS A C    17 
ATOM   10981 O  O    . CYS A 1 32 ? -3.444  -6.827  -8.355  1.00 0.00 ? 32  CYS A O    17 
ATOM   10982 C  CB   . CYS A 1 32 ? -0.678  -5.397  -8.108  1.00 0.00 ? 32  CYS A CB   17 
ATOM   10983 S  SG   . CYS A 1 32 ? -0.986  -4.124  -6.842  1.00 0.00 ? 32  CYS A SG   17 
ATOM   10984 H  H    . CYS A 1 32 ? -1.402  -7.930  -9.471  1.00 0.00 ? 32  CYS A H    17 
ATOM   10985 H  HA   . CYS A 1 32 ? -0.607  -7.086  -6.796  1.00 0.00 ? 32  CYS A HA   17 
ATOM   10986 H  HB2  . CYS A 1 32 ? 0.383   -5.408  -8.310  1.00 0.00 ? 32  CYS A HB2  17 
ATOM   10987 H  HB3  . CYS A 1 32 ? -1.206  -5.105  -9.004  1.00 0.00 ? 32  CYS A HB3  17 
ATOM   10988 N  N    . PRO A 1 33 ? -2.998  -6.813  -6.146  1.00 0.00 ? 33  PRO A N    17 
ATOM   10989 C  CA   . PRO A 1 33 ? -4.403  -6.823  -5.729  1.00 0.00 ? 33  PRO A CA   17 
ATOM   10990 C  C    . PRO A 1 33 ? -5.109  -5.507  -6.037  1.00 0.00 ? 33  PRO A C    17 
ATOM   10991 O  O    . PRO A 1 33 ? -6.299  -5.350  -5.760  1.00 0.00 ? 33  PRO A O    17 
ATOM   10992 C  CB   . PRO A 1 33 ? -4.322  -7.044  -4.216  1.00 0.00 ? 33  PRO A CB   17 
ATOM   10993 C  CG   . PRO A 1 33 ? -2.981  -6.524  -3.829  1.00 0.00 ? 33  PRO A CG   17 
ATOM   10994 C  CD   . PRO A 1 33 ? -2.076  -6.799  -4.998  1.00 0.00 ? 33  PRO A CD   17 
ATOM   10995 H  HA   . PRO A 1 33 ? -4.947  -7.638  -6.185  1.00 0.00 ? 33  PRO A HA   17 
ATOM   10996 H  HB2  . PRO A 1 33 ? -5.115  -6.498  -3.727  1.00 0.00 ? 33  PRO A HB2  17 
ATOM   10997 H  HB3  . PRO A 1 33 ? -4.415  -8.098  -3.997  1.00 0.00 ? 33  PRO A HB3  17 
ATOM   10998 H  HG2  . PRO A 1 33 ? -3.039  -5.463  -3.641  1.00 0.00 ? 33  PRO A HG2  17 
ATOM   10999 H  HG3  . PRO A 1 33 ? -2.626  -7.043  -2.951  1.00 0.00 ? 33  PRO A HG3  17 
ATOM   11000 H  HD2  . PRO A 1 33 ? -1.343  -6.012  -5.101  1.00 0.00 ? 33  PRO A HD2  17 
ATOM   11001 H  HD3  . PRO A 1 33 ? -1.591  -7.757  -4.883  1.00 0.00 ? 33  PRO A HD3  17 
ATOM   11002 N  N    . LEU A 1 34 ? -4.370  -4.565  -6.612  1.00 0.00 ? 34  LEU A N    17 
ATOM   11003 C  CA   . LEU A 1 34 ? -4.926  -3.262  -6.959  1.00 0.00 ? 34  LEU A CA   17 
ATOM   11004 C  C    . LEU A 1 34 ? -4.982  -3.079  -8.472  1.00 0.00 ? 34  LEU A C    17 
ATOM   11005 O  O    . LEU A 1 34 ? -5.714  -2.230  -8.979  1.00 0.00 ? 34  LEU A O    17 
ATOM   11006 C  CB   . LEU A 1 34 ? -4.091  -2.145  -6.330  1.00 0.00 ? 34  LEU A CB   17 
ATOM   11007 C  CG   . LEU A 1 34 ? -4.246  -1.961  -4.819  1.00 0.00 ? 34  LEU A CG   17 
ATOM   11008 C  CD1  . LEU A 1 34 ? -3.258  -0.927  -4.304  1.00 0.00 ? 34  LEU A CD1  17 
ATOM   11009 C  CD2  . LEU A 1 34 ? -5.672  -1.558  -4.475  1.00 0.00 ? 34  LEU A CD2  17 
ATOM   11010 H  H    . LEU A 1 34 ? -3.428  -4.749  -6.808  1.00 0.00 ? 34  LEU A H    17 
ATOM   11011 H  HA   . LEU A 1 34 ? -5.930  -3.215  -6.566  1.00 0.00 ? 34  LEU A HA   17 
ATOM   11012 H  HB2  . LEU A 1 34 ? -3.052  -2.355  -6.532  1.00 0.00 ? 34  LEU A HB2  17 
ATOM   11013 H  HB3  . LEU A 1 34 ? -4.369  -1.216  -6.807  1.00 0.00 ? 34  LEU A HB3  17 
ATOM   11014 H  HG   . LEU A 1 34 ? -4.034  -2.900  -4.325  1.00 0.00 ? 34  LEU A HG   17 
ATOM   11015 H  HD11 . LEU A 1 34 ? -3.775  -0.219  -3.673  1.00 0.00 ? 34  LEU A HD11 17 
ATOM   11016 H  HD12 . LEU A 1 34 ? -2.813  -0.407  -5.139  1.00 0.00 ? 34  LEU A HD12 17 
ATOM   11017 H  HD13 . LEU A 1 34 ? -2.485  -1.420  -3.733  1.00 0.00 ? 34  LEU A HD13 17 
ATOM   11018 H  HD21 . LEU A 1 34 ? -6.255  -2.443  -4.263  1.00 0.00 ? 34  LEU A HD21 17 
ATOM   11019 H  HD22 . LEU A 1 34 ? -6.110  -1.032  -5.311  1.00 0.00 ? 34  LEU A HD22 17 
ATOM   11020 H  HD23 . LEU A 1 34 ? -5.665  -0.915  -3.607  1.00 0.00 ? 34  LEU A HD23 17 
ATOM   11021 N  N    . GLY A 1 35 ? -4.203  -3.883  -9.190  1.00 0.00 ? 35  GLY A N    17 
ATOM   11022 C  CA   . GLY A 1 35 ? -4.180  -3.796  -10.638 1.00 0.00 ? 35  GLY A CA   17 
ATOM   11023 C  C    . GLY A 1 35 ? -3.666  -2.458  -11.130 1.00 0.00 ? 35  GLY A C    17 
ATOM   11024 O  O    . GLY A 1 35 ? -2.696  -1.910  -10.606 1.00 0.00 ? 35  GLY A O    17 
ATOM   11025 H  H    . GLY A 1 35 ? -3.639  -4.542  -8.732  1.00 0.00 ? 35  GLY A H    17 
ATOM   11026 H  HA2  . GLY A 1 35 ? -3.545  -4.578  -11.025 1.00 0.00 ? 35  GLY A HA2  17 
ATOM   11027 H  HA3  . GLY A 1 35 ? -5.183  -3.943  -11.012 1.00 0.00 ? 35  GLY A HA3  17 
ATOM   11028 N  N    . PRO A 1 36 ? -4.324  -1.910  -12.163 1.00 0.00 ? 36  PRO A N    17 
ATOM   11029 C  CA   . PRO A 1 36 ? -3.945  -0.621  -12.749 1.00 0.00 ? 36  PRO A CA   17 
ATOM   11030 C  C    . PRO A 1 36 ? -4.237  0.549   -11.816 1.00 0.00 ? 36  PRO A C    17 
ATOM   11031 O  O    . PRO A 1 36 ? -3.460  1.501   -11.738 1.00 0.00 ? 36  PRO A O    17 
ATOM   11032 C  CB   . PRO A 1 36 ? -4.815  -0.533  -14.005 1.00 0.00 ? 36  PRO A CB   17 
ATOM   11033 C  CG   . PRO A 1 36 ? -5.996  -1.391  -13.709 1.00 0.00 ? 36  PRO A CG   17 
ATOM   11034 C  CD   . PRO A 1 36 ? -5.489  -2.506  -12.837 1.00 0.00 ? 36  PRO A CD   17 
ATOM   11035 H  HA   . PRO A 1 36 ? -2.902  -0.604  -13.030 1.00 0.00 ? 36  PRO A HA   17 
ATOM   11036 H  HB2  . PRO A 1 36 ? -5.104  0.495   -14.174 1.00 0.00 ? 36  PRO A HB2  17 
ATOM   11037 H  HB3  . PRO A 1 36 ? -4.263  -0.902  -14.857 1.00 0.00 ? 36  PRO A HB3  17 
ATOM   11038 H  HG2  . PRO A 1 36 ? -6.745  -0.817  -13.185 1.00 0.00 ? 36  PRO A HG2  17 
ATOM   11039 H  HG3  . PRO A 1 36 ? -6.400  -1.788  -14.628 1.00 0.00 ? 36  PRO A HG3  17 
ATOM   11040 H  HD2  . PRO A 1 36 ? -6.243  -2.797  -12.120 1.00 0.00 ? 36  PRO A HD2  17 
ATOM   11041 H  HD3  . PRO A 1 36 ? -5.193  -3.352  -13.440 1.00 0.00 ? 36  PRO A HD3  17 
ATOM   11042 N  N    . GLN A 1 37 ? -5.360  0.470   -11.110 1.00 0.00 ? 37  GLN A N    17 
ATOM   11043 C  CA   . GLN A 1 37 ? -5.753  1.524   -10.182 1.00 0.00 ? 37  GLN A CA   17 
ATOM   11044 C  C    . GLN A 1 37 ? -4.671  1.757   -9.132  1.00 0.00 ? 37  GLN A C    17 
ATOM   11045 O  O    . GLN A 1 37 ? -4.573  2.842   -8.558  1.00 0.00 ? 37  GLN A O    17 
ATOM   11046 C  CB   . GLN A 1 37 ? -7.074  1.164   -9.498  1.00 0.00 ? 37  GLN A CB   17 
ATOM   11047 C  CG   . GLN A 1 37 ? -8.301  1.650   -10.252 1.00 0.00 ? 37  GLN A CG   17 
ATOM   11048 C  CD   . GLN A 1 37 ? -9.598  1.254   -9.573  1.00 0.00 ? 37  GLN A CD   17 
ATOM   11049 O  OE1  . GLN A 1 37 ? -9.649  1.092   -8.354  1.00 0.00 ? 37  GLN A OE1  17 
ATOM   11050 N  NE2  . GLN A 1 37 ? -10.654 1.095   -10.362 1.00 0.00 ? 37  GLN A NE2  17 
ATOM   11051 H  H    . GLN A 1 37 ? -5.937  -0.314  -11.215 1.00 0.00 ? 37  GLN A H    17 
ATOM   11052 H  HA   . GLN A 1 37 ? -5.889  2.432   -10.749 1.00 0.00 ? 37  GLN A HA   17 
ATOM   11053 H  HB2  . GLN A 1 37 ? -7.136  0.090   -9.406  1.00 0.00 ? 37  GLN A HB2  17 
ATOM   11054 H  HB3  . GLN A 1 37 ? -7.086  1.604   -8.512  1.00 0.00 ? 37  GLN A HB3  17 
ATOM   11055 H  HG2  . GLN A 1 37 ? -8.263  2.727   -10.319 1.00 0.00 ? 37  GLN A HG2  17 
ATOM   11056 H  HG3  . GLN A 1 37 ? -8.288  1.228   -11.246 1.00 0.00 ? 37  GLN A HG3  17 
ATOM   11057 H  HE21 . GLN A 1 37 ? -10.538 1.239   -11.325 1.00 0.00 ? 37  GLN A HE21 17 
ATOM   11058 H  HE22 . GLN A 1 37 ? -11.505 0.838   -9.950  1.00 0.00 ? 37  GLN A HE22 17 
ATOM   11059 N  N    . CYS A 1 38 ? -3.862  0.733   -8.887  1.00 0.00 ? 38  CYS A N    17 
ATOM   11060 C  CA   . CYS A 1 38 ? -2.787  0.825   -7.906  1.00 0.00 ? 38  CYS A CA   17 
ATOM   11061 C  C    . CYS A 1 38 ? -2.041  2.149   -8.040  1.00 0.00 ? 38  CYS A C    17 
ATOM   11062 O  O    . CYS A 1 38 ? -1.699  2.590   -9.138  1.00 0.00 ? 38  CYS A O    17 
ATOM   11063 C  CB   . CYS A 1 38 ? -1.812  -0.342  -8.076  1.00 0.00 ? 38  CYS A CB   17 
ATOM   11064 S  SG   . CYS A 1 38 ? -0.526  -0.430  -6.788  1.00 0.00 ? 38  CYS A SG   17 
ATOM   11065 H  H    . CYS A 1 38 ? -3.990  -0.107  -9.377  1.00 0.00 ? 38  CYS A H    17 
ATOM   11066 H  HA   . CYS A 1 38 ? -3.229  0.773   -6.923  1.00 0.00 ? 38  CYS A HA   17 
ATOM   11067 H  HB2  . CYS A 1 38 ? -2.365  -1.269  -8.050  1.00 0.00 ? 38  CYS A HB2  17 
ATOM   11068 H  HB3  . CYS A 1 38 ? -1.316  -0.251  -9.031  1.00 0.00 ? 38  CYS A HB3  17 
ATOM   11069 N  N    . PRO A 1 39 ? -1.781  2.800   -6.896  1.00 0.00 ? 39  PRO A N    17 
ATOM   11070 C  CA   . PRO A 1 39 ? -1.072  4.083   -6.859  1.00 0.00 ? 39  PRO A CA   17 
ATOM   11071 C  C    . PRO A 1 39 ? 0.401   3.942   -7.228  1.00 0.00 ? 39  PRO A C    17 
ATOM   11072 O  O    . PRO A 1 39 ? 1.009   4.872   -7.757  1.00 0.00 ? 39  PRO A O    17 
ATOM   11073 C  CB   . PRO A 1 39 ? -1.218  4.527   -5.401  1.00 0.00 ? 39  PRO A CB   17 
ATOM   11074 C  CG   . PRO A 1 39 ? -1.407  3.262   -4.637  1.00 0.00 ? 39  PRO A CG   17 
ATOM   11075 C  CD   . PRO A 1 39 ? -2.159  2.334   -5.552  1.00 0.00 ? 39  PRO A CD   17 
ATOM   11076 H  HA   . PRO A 1 39 ? -1.536  4.812   -7.507  1.00 0.00 ? 39  PRO A HA   17 
ATOM   11077 H  HB2  . PRO A 1 39 ? -0.324  5.047   -5.090  1.00 0.00 ? 39  PRO A HB2  17 
ATOM   11078 H  HB3  . PRO A 1 39 ? -2.073  5.178   -5.304  1.00 0.00 ? 39  PRO A HB3  17 
ATOM   11079 H  HG2  . PRO A 1 39 ? -0.447  2.840   -4.382  1.00 0.00 ? 39  PRO A HG2  17 
ATOM   11080 H  HG3  . PRO A 1 39 ? -1.983  3.455   -3.744  1.00 0.00 ? 39  PRO A HG3  17 
ATOM   11081 H  HD2  . PRO A 1 39 ? -1.844  1.313   -5.395  1.00 0.00 ? 39  PRO A HD2  17 
ATOM   11082 H  HD3  . PRO A 1 39 ? -3.223  2.431   -5.396  1.00 0.00 ? 39  PRO A HD3  17 
ATOM   11083 N  N    . GLN A 1 40 ? 0.968   2.774   -6.945  1.00 0.00 ? 40  GLN A N    17 
ATOM   11084 C  CA   . GLN A 1 40 ? 2.370   2.512   -7.248  1.00 0.00 ? 40  GLN A CA   17 
ATOM   11085 C  C    . GLN A 1 40 ? 2.535   2.020   -8.682  1.00 0.00 ? 40  GLN A C    17 
ATOM   11086 O  O    . GLN A 1 40 ? 1.611   1.454   -9.264  1.00 0.00 ? 40  GLN A O    17 
ATOM   11087 C  CB   . GLN A 1 40 ? 2.941   1.481   -6.273  1.00 0.00 ? 40  GLN A CB   17 
ATOM   11088 C  CG   . GLN A 1 40 ? 2.854   1.906   -4.817  1.00 0.00 ? 40  GLN A CG   17 
ATOM   11089 C  CD   . GLN A 1 40 ? 2.842   0.727   -3.863  1.00 0.00 ? 40  GLN A CD   17 
ATOM   11090 O  OE1  . GLN A 1 40 ? 1.856   -0.006  -3.777  1.00 0.00 ? 40  GLN A OE1  17 
ATOM   11091 N  NE2  . GLN A 1 40 ? 3.940   0.538   -3.142  1.00 0.00 ? 40  GLN A NE2  17 
ATOM   11092 H  H    . GLN A 1 40 ? 0.431   2.071   -6.523  1.00 0.00 ? 40  GLN A H    17 
ATOM   11093 H  HA   . GLN A 1 40 ? 2.912   3.439   -7.134  1.00 0.00 ? 40  GLN A HA   17 
ATOM   11094 H  HB2  . GLN A 1 40 ? 2.397   0.555   -6.389  1.00 0.00 ? 40  GLN A HB2  17 
ATOM   11095 H  HB3  . GLN A 1 40 ? 3.980   1.311   -6.514  1.00 0.00 ? 40  GLN A HB3  17 
ATOM   11096 H  HG2  . GLN A 1 40 ? 3.706   2.528   -4.585  1.00 0.00 ? 40  GLN A HG2  17 
ATOM   11097 H  HG3  . GLN A 1 40 ? 1.946   2.475   -4.675  1.00 0.00 ? 40  GLN A HG3  17 
ATOM   11098 H  HE21 . GLN A 1 40 ? 4.686   1.163   -3.263  1.00 0.00 ? 40  GLN A HE21 17 
ATOM   11099 H  HE22 . GLN A 1 40 ? 3.960   -0.216  -2.517  1.00 0.00 ? 40  GLN A HE22 17 
ATOM   11100 N  N    . SER A 1 41 ? 3.719   2.241   -9.246  1.00 0.00 ? 41  SER A N    17 
ATOM   11101 C  CA   . SER A 1 41 ? 4.004   1.824   -10.614 1.00 0.00 ? 41  SER A CA   17 
ATOM   11102 C  C    . SER A 1 41 ? 4.336   0.336   -10.670 1.00 0.00 ? 41  SER A C    17 
ATOM   11103 O  O    . SER A 1 41 ? 4.697   -0.270  -9.660  1.00 0.00 ? 41  SER A O    17 
ATOM   11104 C  CB   . SER A 1 41 ? 5.164   2.640   -11.187 1.00 0.00 ? 41  SER A CB   17 
ATOM   11105 O  OG   . SER A 1 41 ? 5.101   2.692   -12.601 1.00 0.00 ? 41  SER A OG   17 
ATOM   11106 H  H    . SER A 1 41 ? 4.416   2.698   -8.730  1.00 0.00 ? 41  SER A H    17 
ATOM   11107 H  HA   . SER A 1 41 ? 3.120   2.006   -11.206 1.00 0.00 ? 41  SER A HA   17 
ATOM   11108 H  HB2  . SER A 1 41 ? 5.120   3.646   -10.799 1.00 0.00 ? 41  SER A HB2  17 
ATOM   11109 H  HB3  . SER A 1 41 ? 6.099   2.182   -10.897 1.00 0.00 ? 41  SER A HB3  17 
ATOM   11110 H  HG   . SER A 1 41 ? 5.972   2.522   -12.968 1.00 0.00 ? 41  SER A HG   17 
ATOM   11111 N  N    . HIS A 1 42 ? 4.211   -0.247  -11.857 1.00 0.00 ? 42  HIS A N    17 
ATOM   11112 C  CA   . HIS A 1 42 ? 4.499   -1.665  -12.047 1.00 0.00 ? 42  HIS A CA   17 
ATOM   11113 C  C    . HIS A 1 42 ? 5.496   -1.870  -13.183 1.00 0.00 ? 42  HIS A C    17 
ATOM   11114 O  O    . HIS A 1 42 ? 5.117   -2.233  -14.297 1.00 0.00 ? 42  HIS A O    17 
ATOM   11115 C  CB   . HIS A 1 42 ? 3.210   -2.434  -12.339 1.00 0.00 ? 42  HIS A CB   17 
ATOM   11116 C  CG   . HIS A 1 42 ? 2.260   -2.471  -11.182 1.00 0.00 ? 42  HIS A CG   17 
ATOM   11117 N  ND1  . HIS A 1 42 ? 0.897   -2.617  -11.332 1.00 0.00 ? 42  HIS A ND1  17 
ATOM   11118 C  CD2  . HIS A 1 42 ? 2.483   -2.383  -9.850  1.00 0.00 ? 42  HIS A CD2  17 
ATOM   11119 C  CE1  . HIS A 1 42 ? 0.322   -2.615  -10.143 1.00 0.00 ? 42  HIS A CE1  17 
ATOM   11120 N  NE2  . HIS A 1 42 ? 1.263   -2.475  -9.226  1.00 0.00 ? 42  HIS A NE2  17 
ATOM   11121 H  H    . HIS A 1 42 ? 3.920   0.288   -12.624 1.00 0.00 ? 42  HIS A H    17 
ATOM   11122 H  HA   . HIS A 1 42 ? 4.932   -2.040  -11.132 1.00 0.00 ? 42  HIS A HA   17 
ATOM   11123 H  HB2  . HIS A 1 42 ? 2.702   -1.968  -13.170 1.00 0.00 ? 42  HIS A HB2  17 
ATOM   11124 H  HB3  . HIS A 1 42 ? 3.458   -3.453  -12.599 1.00 0.00 ? 42  HIS A HB3  17 
ATOM   11125 H  HD1  . HIS A 1 42 ? 0.421   -2.707  -12.184 1.00 0.00 ? 42  HIS A HD1  17 
ATOM   11126 H  HD2  . HIS A 1 42 ? 3.442   -2.262  -9.366  1.00 0.00 ? 42  HIS A HD2  17 
ATOM   11127 H  HE1  . HIS A 1 42 ? -0.736  -2.711  -9.951  1.00 0.00 ? 42  HIS A HE1  17 
ATOM   11128 N  N    . ASP A 1 43 ? 6.771   -1.634  -12.894 1.00 0.00 ? 43  ASP A N    17 
ATOM   11129 C  CA   . ASP A 1 43 ? 7.823   -1.793  -13.892 1.00 0.00 ? 43  ASP A CA   17 
ATOM   11130 C  C    . ASP A 1 43 ? 8.702   -2.997  -13.568 1.00 0.00 ? 43  ASP A C    17 
ATOM   11131 O  O    . ASP A 1 43 ? 9.609   -2.910  -12.739 1.00 0.00 ? 43  ASP A O    17 
ATOM   11132 C  CB   . ASP A 1 43 ? 8.679   -0.527  -13.968 1.00 0.00 ? 43  ASP A CB   17 
ATOM   11133 C  CG   . ASP A 1 43 ? 8.104   0.503   -14.920 1.00 0.00 ? 43  ASP A CG   17 
ATOM   11134 O  OD1  . ASP A 1 43 ? 7.275   1.324   -14.475 1.00 0.00 ? 43  ASP A OD1  17 
ATOM   11135 O  OD2  . ASP A 1 43 ? 8.482   0.488   -16.110 1.00 0.00 ? 43  ASP A OD2  17 
ATOM   11136 H  H    . ASP A 1 43 ? 7.011   -1.347  -11.988 1.00 0.00 ? 43  ASP A H    17 
ATOM   11137 H  HA   . ASP A 1 43 ? 7.351   -1.955  -14.849 1.00 0.00 ? 43  ASP A HA   17 
ATOM   11138 H  HB2  . ASP A 1 43 ? 8.743   -0.084  -12.985 1.00 0.00 ? 43  ASP A HB2  17 
ATOM   11139 H  HB3  . ASP A 1 43 ? 9.670   -0.791  -14.306 1.00 0.00 ? 43  ASP A HB3  17 
ATOM   11140 N  N    . ILE A 1 44 ? 8.426   -4.118  -14.224 1.00 0.00 ? 44  ILE A N    17 
ATOM   11141 C  CA   . ILE A 1 44 ? 9.192   -5.339  -14.006 1.00 0.00 ? 44  ILE A CA   17 
ATOM   11142 C  C    . ILE A 1 44 ? 10.357  -5.441  -14.985 1.00 0.00 ? 44  ILE A C    17 
ATOM   11143 O  O    . ILE A 1 44 ? 10.176  -5.815  -16.143 1.00 0.00 ? 44  ILE A O    17 
ATOM   11144 C  CB   . ILE A 1 44 ? 8.307   -6.592  -14.147 1.00 0.00 ? 44  ILE A CB   17 
ATOM   11145 C  CG1  . ILE A 1 44 ? 7.261   -6.633  -13.031 1.00 0.00 ? 44  ILE A CG1  17 
ATOM   11146 C  CG2  . ILE A 1 44 ? 9.162   -7.850  -14.126 1.00 0.00 ? 44  ILE A CG2  17 
ATOM   11147 C  CD1  . ILE A 1 44 ? 6.148   -7.626  -13.281 1.00 0.00 ? 44  ILE A CD1  17 
ATOM   11148 H  H    . ILE A 1 44 ? 7.691   -4.125  -14.872 1.00 0.00 ? 44  ILE A H    17 
ATOM   11149 H  HA   . ILE A 1 44 ? 9.583   -5.311  -12.999 1.00 0.00 ? 44  ILE A HA   17 
ATOM   11150 H  HB   . ILE A 1 44 ? 7.803   -6.544  -15.101 1.00 0.00 ? 44  ILE A HB   17 
ATOM   11151 H  HG12 . ILE A 1 44 ? 7.743   -6.903  -12.104 1.00 0.00 ? 44  ILE A HG12 17 
ATOM   11152 H  HG13 . ILE A 1 44 ? 6.816   -5.654  -12.928 1.00 0.00 ? 44  ILE A HG13 17 
ATOM   11153 H  HG21 . ILE A 1 44 ? 9.882   -7.809  -14.930 1.00 0.00 ? 44  ILE A HG21 17 
ATOM   11154 H  HG22 . ILE A 1 44 ? 9.681   -7.916  -13.182 1.00 0.00 ? 44  ILE A HG22 17 
ATOM   11155 H  HG23 . ILE A 1 44 ? 8.531   -8.717  -14.253 1.00 0.00 ? 44  ILE A HG23 17 
ATOM   11156 H  HD11 . ILE A 1 44 ? 5.226   -7.247  -12.867 1.00 0.00 ? 44  ILE A HD11 17 
ATOM   11157 H  HD12 . ILE A 1 44 ? 6.031   -7.776  -14.344 1.00 0.00 ? 44  ILE A HD12 17 
ATOM   11158 H  HD13 . ILE A 1 44 ? 6.393   -8.568  -12.810 1.00 0.00 ? 44  ILE A HD13 17 
ATOM   11159 N  N    . SER A 1 45 ? 11.552  -5.106  -14.510 1.00 0.00 ? 45  SER A N    17 
ATOM   11160 C  CA   . SER A 1 45 ? 12.747  -5.157  -15.344 1.00 0.00 ? 45  SER A CA   17 
ATOM   11161 C  C    . SER A 1 45 ? 14.007  -5.206  -14.485 1.00 0.00 ? 45  SER A C    17 
ATOM   11162 O  O    . SER A 1 45 ? 14.159  -4.433  -13.540 1.00 0.00 ? 45  SER A O    17 
ATOM   11163 C  CB   . SER A 1 45 ? 12.798  -3.943  -16.274 1.00 0.00 ? 45  SER A CB   17 
ATOM   11164 O  OG   . SER A 1 45 ? 13.129  -2.766  -15.559 1.00 0.00 ? 45  SER A OG   17 
ATOM   11165 H  H    . SER A 1 45 ? 11.631  -4.815  -13.577 1.00 0.00 ? 45  SER A H    17 
ATOM   11166 H  HA   . SER A 1 45 ? 12.697  -6.055  -15.941 1.00 0.00 ? 45  SER A HA   17 
ATOM   11167 H  HB2  . SER A 1 45 ? 13.544  -4.108  -17.037 1.00 0.00 ? 45  SER A HB2  17 
ATOM   11168 H  HB3  . SER A 1 45 ? 11.832  -3.809  -16.739 1.00 0.00 ? 45  SER A HB3  17 
ATOM   11169 H  HG   . SER A 1 45 ? 13.034  -2.004  -16.135 1.00 0.00 ? 45  SER A HG   17 
ATOM   11170 N  N    . GLY A 1 46 ? 14.909  -6.124  -14.821 1.00 0.00 ? 46  GLY A N    17 
ATOM   11171 C  CA   . GLY A 1 46 ? 16.144  -6.259  -14.071 1.00 0.00 ? 46  GLY A CA   17 
ATOM   11172 C  C    . GLY A 1 46 ? 15.903  -6.508  -12.595 1.00 0.00 ? 46  GLY A C    17 
ATOM   11173 O  O    . GLY A 1 46 ? 14.869  -7.043  -12.196 1.00 0.00 ? 46  GLY A O    17 
ATOM   11174 H  H    . GLY A 1 46 ? 14.734  -6.714  -15.583 1.00 0.00 ? 46  GLY A H    17 
ATOM   11175 H  HA2  . GLY A 1 46 ? 16.711  -7.084  -14.477 1.00 0.00 ? 46  GLY A HA2  17 
ATOM   11176 H  HA3  . GLY A 1 46 ? 16.720  -5.351  -14.181 1.00 0.00 ? 46  GLY A HA3  17 
ATOM   11177 N  N    . PRO A 1 47 ? 16.875  -6.116  -11.758 1.00 0.00 ? 47  PRO A N    17 
ATOM   11178 C  CA   . PRO A 1 47 ? 16.787  -6.291  -10.306 1.00 0.00 ? 47  PRO A CA   17 
ATOM   11179 C  C    . PRO A 1 47 ? 15.741  -5.379  -9.674  1.00 0.00 ? 47  PRO A C    17 
ATOM   11180 O  O    . PRO A 1 47 ? 15.126  -4.559  -10.356 1.00 0.00 ? 47  PRO A O    17 
ATOM   11181 C  CB   . PRO A 1 47 ? 18.188  -5.916  -9.817  1.00 0.00 ? 47  PRO A CB   17 
ATOM   11182 C  CG   . PRO A 1 47 ? 18.721  -5.000  -10.864 1.00 0.00 ? 47  PRO A CG   17 
ATOM   11183 C  CD   . PRO A 1 47 ? 18.135  -5.472  -12.165 1.00 0.00 ? 47  PRO A CD   17 
ATOM   11184 H  HA   . PRO A 1 47 ? 16.574  -7.317  -10.042 1.00 0.00 ? 47  PRO A HA   17 
ATOM   11185 H  HB2  . PRO A 1 47 ? 18.118  -5.423  -8.858  1.00 0.00 ? 47  PRO A HB2  17 
ATOM   11186 H  HB3  . PRO A 1 47 ? 18.792  -6.806  -9.727  1.00 0.00 ? 47  PRO A HB3  17 
ATOM   11187 H  HG2  . PRO A 1 47 ? 18.410  -3.987  -10.658 1.00 0.00 ? 47  PRO A HG2  17 
ATOM   11188 H  HG3  . PRO A 1 47 ? 19.799  -5.064  -10.893 1.00 0.00 ? 47  PRO A HG3  17 
ATOM   11189 H  HD2  . PRO A 1 47 ? 17.946  -4.634  -12.820 1.00 0.00 ? 47  PRO A HD2  17 
ATOM   11190 H  HD3  . PRO A 1 47 ? 18.795  -6.183  -12.641 1.00 0.00 ? 47  PRO A HD3  17 
ATOM   11191 N  N    . SER A 1 48 ? 15.544  -5.527  -8.368  1.00 0.00 ? 48  SER A N    17 
ATOM   11192 C  CA   . SER A 1 48 ? 14.569  -4.718  -7.645  1.00 0.00 ? 48  SER A CA   17 
ATOM   11193 C  C    . SER A 1 48 ? 15.267  -3.686  -6.765  1.00 0.00 ? 48  SER A C    17 
ATOM   11194 O  O    . SER A 1 48 ? 15.067  -2.481  -6.924  1.00 0.00 ? 48  SER A O    17 
ATOM   11195 C  CB   . SER A 1 48 ? 13.669  -5.610  -6.789  1.00 0.00 ? 48  SER A CB   17 
ATOM   11196 O  OG   . SER A 1 48 ? 12.643  -6.198  -7.570  1.00 0.00 ? 48  SER A OG   17 
ATOM   11197 H  H    . SER A 1 48 ? 16.065  -6.198  -7.879  1.00 0.00 ? 48  SER A H    17 
ATOM   11198 H  HA   . SER A 1 48 ? 13.962  -4.201  -8.374  1.00 0.00 ? 48  SER A HA   17 
ATOM   11199 H  HB2  . SER A 1 48 ? 14.261  -6.396  -6.346  1.00 0.00 ? 48  SER A HB2  17 
ATOM   11200 H  HB3  . SER A 1 48 ? 13.216  -5.016  -6.009  1.00 0.00 ? 48  SER A HB3  17 
ATOM   11201 H  HG   . SER A 1 48 ? 13.034  -6.761  -8.242  1.00 0.00 ? 48  SER A HG   17 
ATOM   11202 N  N    . SER A 1 49 ? 16.085  -4.167  -5.834  1.00 0.00 ? 49  SER A N    17 
ATOM   11203 C  CA   . SER A 1 49 ? 16.810  -3.287  -4.925  1.00 0.00 ? 49  SER A CA   17 
ATOM   11204 C  C    . SER A 1 49 ? 17.769  -2.383  -5.693  1.00 0.00 ? 49  SER A C    17 
ATOM   11205 O  O    . SER A 1 49 ? 18.216  -1.357  -5.182  1.00 0.00 ? 49  SER A O    17 
ATOM   11206 C  CB   . SER A 1 49 ? 17.583  -4.110  -3.893  1.00 0.00 ? 49  SER A CB   17 
ATOM   11207 O  OG   . SER A 1 49 ? 18.725  -4.715  -4.475  1.00 0.00 ? 49  SER A OG   17 
ATOM   11208 H  H    . SER A 1 49 ? 16.202  -5.137  -5.757  1.00 0.00 ? 49  SER A H    17 
ATOM   11209 H  HA   . SER A 1 49 ? 16.086  -2.671  -4.412  1.00 0.00 ? 49  SER A HA   17 
ATOM   11210 H  HB2  . SER A 1 49 ? 17.902  -3.466  -3.088  1.00 0.00 ? 49  SER A HB2  17 
ATOM   11211 H  HB3  . SER A 1 49 ? 16.941  -4.885  -3.501  1.00 0.00 ? 49  SER A HB3  17 
ATOM   11212 H  HG   . SER A 1 49 ? 18.576  -4.843  -5.415  1.00 0.00 ? 49  SER A HG   17 
ATOM   11213 N  N    . GLY A 1 50 ? 18.080  -2.772  -6.926  1.00 0.00 ? 50  GLY A N    17 
ATOM   11214 C  CA   . GLY A 1 50 ? 18.985  -1.986  -7.745  1.00 0.00 ? 50  GLY A CA   17 
ATOM   11215 C  C    . GLY A 1 50 ? 19.874  -2.849  -8.618  1.00 0.00 ? 50  GLY A C    17 
ATOM   11216 O  O    . GLY A 1 50 ? 20.981  -2.427  -8.947  1.00 0.00 ? 50  GLY A O    17 
ATOM   11217 H  H    . GLY A 1 50 ? 17.693  -3.599  -7.281  1.00 0.00 ? 50  GLY A H    17 
ATOM   11218 H  HA2  . GLY A 1 50 ? 18.403  -1.332  -8.377  1.00 0.00 ? 50  GLY A HA2  17 
ATOM   11219 H  HA3  . GLY A 1 50 ? 19.608  -1.386  -7.099  1.00 0.00 ? 50  GLY A HA3  17 
HETATM 11220 ZN ZN   . ZN  B 2 .  ? 0.588   -2.437  -7.290  1.00 0.00 ? 201 ZN  A ZN   17 
ATOM   11221 N  N    . GLY A 1 1  ? 8.710   26.919  -21.454 1.00 0.00 ? 1   GLY A N    18 
ATOM   11222 C  CA   . GLY A 1 1  ? 9.642   25.881  -21.855 1.00 0.00 ? 1   GLY A CA   18 
ATOM   11223 C  C    . GLY A 1 1  ? 11.007  26.050  -21.218 1.00 0.00 ? 1   GLY A C    18 
ATOM   11224 O  O    . GLY A 1 1  ? 11.130  26.640  -20.144 1.00 0.00 ? 1   GLY A O    18 
ATOM   11225 H  H1   . GLY A 1 1  ? 8.588   27.710  -22.020 1.00 0.00 ? 1   GLY A H1   18 
ATOM   11226 H  HA2  . GLY A 1 1  ? 9.239   24.921  -21.568 1.00 0.00 ? 1   GLY A HA2  18 
ATOM   11227 H  HA3  . GLY A 1 1  ? 9.753   25.908  -22.929 1.00 0.00 ? 1   GLY A HA3  18 
ATOM   11228 N  N    . SER A 1 2  ? 12.036  25.531  -21.880 1.00 0.00 ? 2   SER A N    18 
ATOM   11229 C  CA   . SER A 1 2  ? 13.399  25.622  -21.370 1.00 0.00 ? 2   SER A CA   18 
ATOM   11230 C  C    . SER A 1 2  ? 13.812  27.079  -21.183 1.00 0.00 ? 2   SER A C    18 
ATOM   11231 O  O    . SER A 1 2  ? 14.281  27.470  -20.114 1.00 0.00 ? 2   SER A O    18 
ATOM   11232 C  CB   . SER A 1 2  ? 14.371  24.923  -22.322 1.00 0.00 ? 2   SER A CB   18 
ATOM   11233 O  OG   . SER A 1 2  ? 15.518  24.461  -21.631 1.00 0.00 ? 2   SER A OG   18 
ATOM   11234 H  H    . SER A 1 2  ? 11.874  25.072  -22.731 1.00 0.00 ? 2   SER A H    18 
ATOM   11235 H  HA   . SER A 1 2  ? 13.428  25.126  -20.411 1.00 0.00 ? 2   SER A HA   18 
ATOM   11236 H  HB2  . SER A 1 2  ? 13.878  24.079  -22.780 1.00 0.00 ? 2   SER A HB2  18 
ATOM   11237 H  HB3  . SER A 1 2  ? 14.682  25.617  -23.089 1.00 0.00 ? 2   SER A HB3  18 
ATOM   11238 H  HG   . SER A 1 2  ? 16.309  24.779  -22.074 1.00 0.00 ? 2   SER A HG   18 
ATOM   11239 N  N    . SER A 1 3  ? 13.634  27.877  -22.231 1.00 0.00 ? 3   SER A N    18 
ATOM   11240 C  CA   . SER A 1 3  ? 13.991  29.290  -22.185 1.00 0.00 ? 3   SER A CA   18 
ATOM   11241 C  C    . SER A 1 3  ? 12.903  30.147  -22.824 1.00 0.00 ? 3   SER A C    18 
ATOM   11242 O  O    . SER A 1 3  ? 11.960  29.629  -23.421 1.00 0.00 ? 3   SER A O    18 
ATOM   11243 C  CB   . SER A 1 3  ? 15.325  29.524  -22.898 1.00 0.00 ? 3   SER A CB   18 
ATOM   11244 O  OG   . SER A 1 3  ? 16.413  29.100  -22.095 1.00 0.00 ? 3   SER A OG   18 
ATOM   11245 H  H    . SER A 1 3  ? 13.255  27.506  -23.055 1.00 0.00 ? 3   SER A H    18 
ATOM   11246 H  HA   . SER A 1 3  ? 14.093  29.573  -21.148 1.00 0.00 ? 3   SER A HA   18 
ATOM   11247 H  HB2  . SER A 1 3  ? 15.338  28.969  -23.823 1.00 0.00 ? 3   SER A HB2  18 
ATOM   11248 H  HB3  . SER A 1 3  ? 15.437  30.578  -23.108 1.00 0.00 ? 3   SER A HB3  18 
ATOM   11249 H  HG   . SER A 1 3  ? 17.051  29.812  -22.018 1.00 0.00 ? 3   SER A HG   18 
ATOM   11250 N  N    . GLY A 1 4  ? 13.042  31.463  -22.695 1.00 0.00 ? 4   GLY A N    18 
ATOM   11251 C  CA   . GLY A 1 4  ? 12.064  32.372  -23.264 1.00 0.00 ? 4   GLY A CA   18 
ATOM   11252 C  C    . GLY A 1 4  ? 11.462  33.299  -22.228 1.00 0.00 ? 4   GLY A C    18 
ATOM   11253 O  O    . GLY A 1 4  ? 10.261  33.246  -21.960 1.00 0.00 ? 4   GLY A O    18 
ATOM   11254 H  H    . GLY A 1 4  ? 13.815  31.820  -22.209 1.00 0.00 ? 4   GLY A H    18 
ATOM   11255 H  HA2  . GLY A 1 4  ? 12.543  32.965  -24.029 1.00 0.00 ? 4   GLY A HA2  18 
ATOM   11256 H  HA3  . GLY A 1 4  ? 11.272  31.793  -23.716 1.00 0.00 ? 4   GLY A HA3  18 
ATOM   11257 N  N    . SER A 1 5  ? 12.297  34.151  -21.641 1.00 0.00 ? 5   SER A N    18 
ATOM   11258 C  CA   . SER A 1 5  ? 11.841  35.090  -20.623 1.00 0.00 ? 5   SER A CA   18 
ATOM   11259 C  C    . SER A 1 5  ? 10.620  35.866  -21.109 1.00 0.00 ? 5   SER A C    18 
ATOM   11260 O  O    . SER A 1 5  ? 9.559   35.828  -20.487 1.00 0.00 ? 5   SER A O    18 
ATOM   11261 C  CB   . SER A 1 5  ? 12.964  36.061  -20.256 1.00 0.00 ? 5   SER A CB   18 
ATOM   11262 O  OG   . SER A 1 5  ? 13.811  35.510  -19.262 1.00 0.00 ? 5   SER A OG   18 
ATOM   11263 H  H    . SER A 1 5  ? 13.243  34.145  -21.897 1.00 0.00 ? 5   SER A H    18 
ATOM   11264 H  HA   . SER A 1 5  ? 11.566  34.522  -19.747 1.00 0.00 ? 5   SER A HA   18 
ATOM   11265 H  HB2  . SER A 1 5  ? 13.553  36.276  -21.134 1.00 0.00 ? 5   SER A HB2  18 
ATOM   11266 H  HB3  . SER A 1 5  ? 12.534  36.978  -19.878 1.00 0.00 ? 5   SER A HB3  18 
ATOM   11267 H  HG   . SER A 1 5  ? 13.321  34.866  -18.745 1.00 0.00 ? 5   SER A HG   18 
ATOM   11268 N  N    . SER A 1 6  ? 10.780  36.571  -22.224 1.00 0.00 ? 6   SER A N    18 
ATOM   11269 C  CA   . SER A 1 6  ? 9.694   37.360  -22.793 1.00 0.00 ? 6   SER A CA   18 
ATOM   11270 C  C    . SER A 1 6  ? 8.525   36.466  -23.194 1.00 0.00 ? 6   SER A C    18 
ATOM   11271 O  O    . SER A 1 6  ? 7.397   36.658  -22.742 1.00 0.00 ? 6   SER A O    18 
ATOM   11272 C  CB   . SER A 1 6  ? 10.189  38.148  -24.007 1.00 0.00 ? 6   SER A CB   18 
ATOM   11273 O  OG   . SER A 1 6  ? 9.423   39.325  -24.198 1.00 0.00 ? 6   SER A OG   18 
ATOM   11274 H  H    . SER A 1 6  ? 11.651  36.562  -22.674 1.00 0.00 ? 6   SER A H    18 
ATOM   11275 H  HA   . SER A 1 6  ? 9.358   38.054  -22.037 1.00 0.00 ? 6   SER A HA   18 
ATOM   11276 H  HB2  . SER A 1 6  ? 11.221  38.426  -23.857 1.00 0.00 ? 6   SER A HB2  18 
ATOM   11277 H  HB3  . SER A 1 6  ? 10.106  37.532  -24.891 1.00 0.00 ? 6   SER A HB3  18 
ATOM   11278 H  HG   . SER A 1 6  ? 9.850   40.061  -23.753 1.00 0.00 ? 6   SER A HG   18 
ATOM   11279 N  N    . GLY A 1 7  ? 8.804   35.486  -24.048 1.00 0.00 ? 7   GLY A N    18 
ATOM   11280 C  CA   . GLY A 1 7  ? 7.767   34.575  -24.497 1.00 0.00 ? 7   GLY A CA   18 
ATOM   11281 C  C    . GLY A 1 7  ? 8.223   33.699  -25.647 1.00 0.00 ? 7   GLY A C    18 
ATOM   11282 O  O    . GLY A 1 7  ? 8.585   34.200  -26.712 1.00 0.00 ? 7   GLY A O    18 
ATOM   11283 H  H    . GLY A 1 7  ? 9.722   35.380  -24.376 1.00 0.00 ? 7   GLY A H    18 
ATOM   11284 H  HA2  . GLY A 1 7  ? 7.475   33.944  -23.671 1.00 0.00 ? 7   GLY A HA2  18 
ATOM   11285 H  HA3  . GLY A 1 7  ? 6.911   35.152  -24.817 1.00 0.00 ? 7   GLY A HA3  18 
ATOM   11286 N  N    . CYS A 1 8  ? 8.206   32.389  -25.433 1.00 0.00 ? 8   CYS A N    18 
ATOM   11287 C  CA   . CYS A 1 8  ? 8.624   31.440  -26.460 1.00 0.00 ? 8   CYS A CA   18 
ATOM   11288 C  C    . CYS A 1 8  ? 7.611   30.309  -26.598 1.00 0.00 ? 8   CYS A C    18 
ATOM   11289 O  O    . CYS A 1 8  ? 6.972   29.910  -25.623 1.00 0.00 ? 8   CYS A O    18 
ATOM   11290 C  CB   . CYS A 1 8  ? 10.002  30.869  -26.126 1.00 0.00 ? 8   CYS A CB   18 
ATOM   11291 S  SG   . CYS A 1 8  ? 11.382  31.874  -26.723 1.00 0.00 ? 8   CYS A SG   18 
ATOM   11292 H  H    . CYS A 1 8  ? 7.907   32.050  -24.563 1.00 0.00 ? 8   CYS A H    18 
ATOM   11293 H  HA   . CYS A 1 8  ? 8.681   31.972  -27.397 1.00 0.00 ? 8   CYS A HA   18 
ATOM   11294 H  HB2  . CYS A 1 8  ? 10.099  30.785  -25.053 1.00 0.00 ? 8   CYS A HB2  18 
ATOM   11295 H  HB3  . CYS A 1 8  ? 10.093  29.888  -26.567 1.00 0.00 ? 8   CYS A HB3  18 
ATOM   11296 H  HG   . CYS A 1 8  ? 11.155  32.165  -27.995 1.00 0.00 ? 8   CYS A HG   18 
ATOM   11297 N  N    . CYS A 1 9  ? 7.468   29.796  -27.815 1.00 0.00 ? 9   CYS A N    18 
ATOM   11298 C  CA   . CYS A 1 9  ? 6.530   28.711  -28.083 1.00 0.00 ? 9   CYS A CA   18 
ATOM   11299 C  C    . CYS A 1 9  ? 7.267   27.457  -28.543 1.00 0.00 ? 9   CYS A C    18 
ATOM   11300 O  O    . CYS A 1 9  ? 7.572   27.302  -29.726 1.00 0.00 ? 9   CYS A O    18 
ATOM   11301 C  CB   . CYS A 1 9  ? 5.513   29.137  -29.142 1.00 0.00 ? 9   CYS A CB   18 
ATOM   11302 S  SG   . CYS A 1 9  ? 4.127   27.993  -29.337 1.00 0.00 ? 9   CYS A SG   18 
ATOM   11303 H  H    . CYS