data_2FC8
# 
_entry.id   2FC8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FC8         
RCSB  RCSB035706   
WWPDB D_1000035706 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      2FC9           'the different fragment of the same protein' unspecified 
TargetDB hsi002005757.2 .                                            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FC8 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dang, W.'                                               1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Shirouzu, M.'                                           5 
'Terada, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the RRM_1 domain of NCL protein' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dang, W.'     1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Shirouzu, M.' 5 
primary 'Terada, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'NCL protein' 
_entity.formula_weight             10604.348 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RRM_1 domain, residues 8-96' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEID
GNKVTLDWAKPKGEGGSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEID
GNKVTLDWAKPKGEGGSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002005757.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   ASN n 
1 10  ALA n 
1 11  ARG n 
1 12  SER n 
1 13  GLN n 
1 14  PRO n 
1 15  SER n 
1 16  LYS n 
1 17  THR n 
1 18  LEU n 
1 19  PHE n 
1 20  VAL n 
1 21  LYS n 
1 22  GLY n 
1 23  LEU n 
1 24  SER n 
1 25  GLU n 
1 26  ASP n 
1 27  THR n 
1 28  THR n 
1 29  GLU n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  LYS n 
1 34  GLU n 
1 35  SER n 
1 36  PHE n 
1 37  ASP n 
1 38  GLY n 
1 39  SER n 
1 40  VAL n 
1 41  ARG n 
1 42  ALA n 
1 43  ARG n 
1 44  ILE n 
1 45  VAL n 
1 46  THR n 
1 47  ASP n 
1 48  ARG n 
1 49  GLU n 
1 50  THR n 
1 51  GLY n 
1 52  SER n 
1 53  SER n 
1 54  LYS n 
1 55  GLY n 
1 56  PHE n 
1 57  GLY n 
1 58  PHE n 
1 59  VAL n 
1 60  ASP n 
1 61  PHE n 
1 62  ASN n 
1 63  SER n 
1 64  GLU n 
1 65  GLU n 
1 66  ASP n 
1 67  ALA n 
1 68  LYS n 
1 69  ALA n 
1 70  ALA n 
1 71  LYS n 
1 72  GLU n 
1 73  ALA n 
1 74  MET n 
1 75  GLU n 
1 76  ASP n 
1 77  GLY n 
1 78  GLU n 
1 79  ILE n 
1 80  ASP n 
1 81  GLY n 
1 82  ASN n 
1 83  LYS n 
1 84  VAL n 
1 85  THR n 
1 86  LEU n 
1 87  ASP n 
1 88  TRP n 
1 89  ALA n 
1 90  LYS n 
1 91  PRO n 
1 92  LYS n 
1 93  GLY n 
1 94  GLU n 
1 95  GLY n 
1 96  GLY n 
1 97  SER n 
1 98  GLY n 
1 99  PRO n 
1 100 SER n 
1 101 SER n 
1 102 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'CELL-FREE SYNTHESIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050516-05 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9BQ02_HUMAN 
_struct_ref.pdbx_db_accession          Q9BQ02 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLD
WAKPKGEGG
;
_struct_ref.pdbx_align_begin           336 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FC8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 96 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9BQ02 
_struct_ref_seq.db_align_beg                  336 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  424 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FC8 GLY A 1   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 1   1  
1 2FC8 SER A 2   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 2   2  
1 2FC8 SER A 3   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 3   3  
1 2FC8 GLY A 4   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 4   4  
1 2FC8 SER A 5   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 5   5  
1 2FC8 SER A 6   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 6   6  
1 2FC8 GLY A 7   ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 7   7  
1 2FC8 SER A 97  ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 97  8  
1 2FC8 GLY A 98  ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 98  9  
1 2FC8 PRO A 99  ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 99  10 
1 2FC8 SER A 100 ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 100 11 
1 2FC8 SER A 101 ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 101 12 
1 2FC8 GLY A 102 ? UNP Q9BQ02 ? ? 'EXPRESSION TAG' 102 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90 %H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2FC8 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2FC8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2FC8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker       1 
processing           NMRPipe 20031121 Delaglio,F.  2 
'data analysis'      NMRView 5.0.4    Johnson,B.A. 3 
'data analysis'      Kujira  0.9321   Kobayashi,N. 4 
'structure solution' CYANA   2.0.17   Guntert,P.   5 
refinement           CYANA   2.0.17   Guntert,P.   6 
# 
_exptl.entry_id          2FC8 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2FC8 
_struct.title                     'Solution structure of the RRM_1 domain of NCL protein' 
_struct.pdbx_descriptor           'NCL protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FC8 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            
;structure genomics, RRM_1 domain, NCL protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 29 ? SER A 35 ? GLU A 29 SER A 35 1 ? 7  
HELX_P HELX_P2 2 GLU A 64 ? MET A 74 ? GLU A 64 MET A 74 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 41 ? VAL A 45 ? ARG A 41 VAL A 45 
A 2 PHE A 56 ? ASP A 60 ? PHE A 56 ASP A 60 
A 3 LEU A 18 ? LYS A 21 ? LEU A 18 LYS A 21 
A 4 THR A 85 ? TRP A 88 ? THR A 85 TRP A 88 
B 1 GLU A 78 ? ILE A 79 ? GLU A 78 ILE A 79 
B 2 ASN A 82 ? LYS A 83 ? ASN A 82 LYS A 83 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 43 ? N ARG A 43 O PHE A 58 ? O PHE A 58 
A 2 3 O GLY A 57 ? O GLY A 57 N VAL A 20 ? N VAL A 20 
A 3 4 N PHE A 19 ? N PHE A 19 O ASP A 87 ? O ASP A 87 
B 1 2 N ILE A 79 ? N ILE A 79 O ASN A 82 ? O ASN A 82 
# 
_database_PDB_matrix.entry_id          2FC8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FC8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 18.347  -4.737  21.647  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 19.089  -4.736  20.399  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 18.701  -5.887  19.493  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 18.588  -5.720  18.279  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 18.828  -4.738  22.501  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 18.903  -3.806  19.883  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 20.144  -4.808  20.621  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 18.498  -7.061  20.084  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 18.126  -8.246  19.320  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 17.098  -7.901  18.247  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 15.918  -7.709  18.540  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 17.565  -9.323  20.252  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 17.830  -10.621 19.749  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 18.603  -7.131  21.056  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 19.016  -8.625  18.841  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 18.021  -9.227  21.225  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 16.495  -9.196  20.341  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 18.317  -11.125 20.405  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 17.557  -7.823  17.001  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 16.679  -7.497  15.883  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 17.017  -8.348  14.662  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 18.181  -8.484  14.289  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 16.795  -6.013  15.532  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 16.344  -5.199  16.602  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 18.508  -7.987  16.831  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 15.665  -7.709  16.185  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 17.827  -5.774  15.325  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 16.195  -5.804  14.659  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 16.904  -5.339  17.369  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 15.988  -8.918  14.043  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 16.194  -9.748  12.871  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 14.959  -10.545 12.499  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 14.305  -11.127 13.364  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 15.080  -8.774  14.385  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 16.466  -9.116  12.039  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 17.005  -10.435 13.068  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 14.639  -10.569 11.209  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 13.470  -11.295 10.726  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 13.813  -12.108 9.481   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 14.870  -11.925 8.878   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 12.331  -10.322 10.416  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 12.745  -9.329  9.493   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 15.200  -10.084 10.568  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 13.153  -11.970 11.506  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 11.501  -10.867 9.992   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 12.016  -9.839  11.330  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 12.447  -8.468  9.795   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 12.910  -13.006 9.102   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 13.117  -13.851 7.931   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 11.845  -13.938 7.093   1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 10.740  -14.022 7.627   1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 13.557  -15.252 8.358   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 12.659  -15.802 9.307   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 12.086  -13.105 9.624   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 13.897  -13.404 7.334   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 13.586  -15.897 7.493   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 14.541  -15.198 8.801   1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 11.773  -15.472 9.138   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 12.010  -13.918 5.773   1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 10.869  -13.995 4.881   1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 9.918   -12.827 5.053   1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 10.278  -11.780 5.591   1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 12.915  -13.850 5.403   1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 11.223  -14.011 3.861   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 10.333  -14.912 5.079   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . PRO A 1 8   ? 8.672   -13.000 4.588   1.00 0.00 ? 8   PRO A N    1  
ATOM 67    C CA   . PRO A 1 8   ? 7.641   -11.961 4.681   1.00 0.00 ? 8   PRO A CA   1  
ATOM 68    C C    . PRO A 1 8   ? 7.179   -11.730 6.116   1.00 0.00 ? 8   PRO A C    1  
ATOM 69    O O    . PRO A 1 8   ? 6.614   -10.685 6.435   1.00 0.00 ? 8   PRO A O    1  
ATOM 70    C CB   . PRO A 1 8   ? 6.496   -12.521 3.834   1.00 0.00 ? 8   PRO A CB   1  
ATOM 71    C CG   . PRO A 1 8   ? 6.687   -13.998 3.867   1.00 0.00 ? 8   PRO A CG   1  
ATOM 72    C CD   . PRO A 1 8   ? 8.173   -14.222 3.936   1.00 0.00 ? 8   PRO A CD   1  
ATOM 73    H HA   . PRO A 1 8   ? 7.981   -11.027 4.259   1.00 0.00 ? 8   PRO A HA   1  
ATOM 74    H HB2  . PRO A 1 8   ? 5.549   -12.235 4.269   1.00 0.00 ? 8   PRO A HB2  1  
ATOM 75    H HB3  . PRO A 1 8   ? 6.567   -12.137 2.827   1.00 0.00 ? 8   PRO A HB3  1  
ATOM 76    H HG2  . PRO A 1 8   ? 6.205   -14.412 4.739   1.00 0.00 ? 8   PRO A HG2  1  
ATOM 77    H HG3  . PRO A 1 8   ? 6.284   -14.441 2.968   1.00 0.00 ? 8   PRO A HG3  1  
ATOM 78    H HD2  . PRO A 1 8   ? 8.395   -15.095 4.531   1.00 0.00 ? 8   PRO A HD2  1  
ATOM 79    H HD3  . PRO A 1 8   ? 8.586   -14.325 2.943   1.00 0.00 ? 8   PRO A HD3  1  
ATOM 80    N N    . ASN A 1 9   ? 7.423   -12.713 6.977   1.00 0.00 ? 9   ASN A N    1  
ATOM 81    C CA   . ASN A 1 9   ? 7.031   -12.616 8.378   1.00 0.00 ? 9   ASN A CA   1  
ATOM 82    C C    . ASN A 1 9   ? 5.519   -12.754 8.531   1.00 0.00 ? 9   ASN A C    1  
ATOM 83    O O    . ASN A 1 9   ? 4.915   -12.139 9.409   1.00 0.00 ? 9   ASN A O    1  
ATOM 84    C CB   . ASN A 1 9   ? 7.494   -11.283 8.968   1.00 0.00 ? 9   ASN A CB   1  
ATOM 85    C CG   . ASN A 1 9   ? 7.688   -11.351 10.470  1.00 0.00 ? 9   ASN A CG   1  
ATOM 86    O OD1  . ASN A 1 9   ? 6.836   -11.867 11.194  1.00 0.00 ? 9   ASN A OD1  1  
ATOM 87    N ND2  . ASN A 1 9   ? 8.813   -10.830 10.946  1.00 0.00 ? 9   ASN A ND2  1  
ATOM 88    H H    . ASN A 1 9   ? 7.877   -13.523 6.662   1.00 0.00 ? 9   ASN A H    1  
ATOM 89    H HA   . ASN A 1 9   ? 7.510   -13.422 8.913   1.00 0.00 ? 9   ASN A HA   1  
ATOM 90    H HB2  . ASN A 1 9   ? 8.435   -11.004 8.516   1.00 0.00 ? 9   ASN A HB2  1  
ATOM 91    H HB3  . ASN A 1 9   ? 6.757   -10.524 8.752   1.00 0.00 ? 9   ASN A HB3  1  
ATOM 92    H HD21 . ASN A 1 9   ? 9.446   -10.436 10.310  1.00 0.00 ? 9   ASN A HD21 1  
ATOM 93    H HD22 . ASN A 1 9   ? 8.964   -10.862 11.914  1.00 0.00 ? 9   ASN A HD22 1  
ATOM 94    N N    . ALA A 1 10  ? 4.914   -13.567 7.670   1.00 0.00 ? 10  ALA A N    1  
ATOM 95    C CA   . ALA A 1 10  ? 3.474   -13.788 7.711   1.00 0.00 ? 10  ALA A CA   1  
ATOM 96    C C    . ALA A 1 10  ? 3.134   -15.244 7.414   1.00 0.00 ? 10  ALA A C    1  
ATOM 97    O O    . ALA A 1 10  ? 4.001   -16.028 7.025   1.00 0.00 ? 10  ALA A O    1  
ATOM 98    C CB   . ALA A 1 10  ? 2.771   -12.868 6.724   1.00 0.00 ? 10  ALA A CB   1  
ATOM 99    H H    . ALA A 1 10  ? 5.450   -14.029 6.992   1.00 0.00 ? 10  ALA A H    1  
ATOM 100   H HA   . ALA A 1 10  ? 3.127   -13.543 8.704   1.00 0.00 ? 10  ALA A HA   1  
ATOM 101   H HB1  . ALA A 1 10  ? 2.672   -11.884 7.158   1.00 0.00 ? 10  ALA A HB1  1  
ATOM 102   H HB2  . ALA A 1 10  ? 3.351   -12.804 5.815   1.00 0.00 ? 10  ALA A HB2  1  
ATOM 103   H HB3  . ALA A 1 10  ? 1.792   -13.263 6.499   1.00 0.00 ? 10  ALA A HB3  1  
ATOM 104   N N    . ARG A 1 11  ? 1.868   -15.601 7.600   1.00 0.00 ? 11  ARG A N    1  
ATOM 105   C CA   . ARG A 1 11  ? 1.414   -16.965 7.354   1.00 0.00 ? 11  ARG A CA   1  
ATOM 106   C C    . ARG A 1 11  ? 1.501   -17.307 5.870   1.00 0.00 ? 11  ARG A C    1  
ATOM 107   O O    . ARG A 1 11  ? 2.062   -18.336 5.492   1.00 0.00 ? 11  ARG A O    1  
ATOM 108   C CB   . ARG A 1 11  ? -0.024  -17.143 7.845   1.00 0.00 ? 11  ARG A CB   1  
ATOM 109   C CG   . ARG A 1 11  ? -0.121  -17.598 9.292   1.00 0.00 ? 11  ARG A CG   1  
ATOM 110   C CD   . ARG A 1 11  ? -1.390  -17.085 9.954   1.00 0.00 ? 11  ARG A CD   1  
ATOM 111   N NE   . ARG A 1 11  ? -1.806  -17.930 11.071  1.00 0.00 ? 11  ARG A NE   1  
ATOM 112   C CZ   . ARG A 1 11  ? -2.209  -19.188 10.930  1.00 0.00 ? 11  ARG A CZ   1  
ATOM 113   N NH1  . ARG A 1 11  ? -2.250  -19.744 9.728   1.00 0.00 ? 11  ARG A NH1  1  
ATOM 114   N NH2  . ARG A 1 11  ? -2.571  -19.892 11.995  1.00 0.00 ? 11  ARG A NH2  1  
ATOM 115   H H    . ARG A 1 11  ? 1.223   -14.932 7.911   1.00 0.00 ? 11  ARG A H    1  
ATOM 116   H HA   . ARG A 1 11  ? 2.058   -17.633 7.904   1.00 0.00 ? 11  ARG A HA   1  
ATOM 117   H HB2  . ARG A 1 11  ? -0.544  -16.201 7.752   1.00 0.00 ? 11  ARG A HB2  1  
ATOM 118   H HB3  . ARG A 1 11  ? -0.515  -17.878 7.226   1.00 0.00 ? 11  ARG A HB3  1  
ATOM 119   H HG2  . ARG A 1 11  ? -0.124  -18.678 9.321   1.00 0.00 ? 11  ARG A HG2  1  
ATOM 120   H HG3  . ARG A 1 11  ? 0.734   -17.224 9.835   1.00 0.00 ? 11  ARG A HG3  1  
ATOM 121   H HD2  . ARG A 1 11  ? -1.211  -16.085 10.319  1.00 0.00 ? 11  ARG A HD2  1  
ATOM 122   H HD3  . ARG A 1 11  ? -2.180  -17.063 9.218   1.00 0.00 ? 11  ARG A HD3  1  
ATOM 123   H HE   . ARG A 1 11  ? -1.783  -17.539 11.968  1.00 0.00 ? 11  ARG A HE   1  
ATOM 124   H HH11 . ARG A 1 11  ? -1.977  -19.216 8.924   1.00 0.00 ? 11  ARG A HH11 1  
ATOM 125   H HH12 . ARG A 1 11  ? -2.553  -20.692 9.625   1.00 0.00 ? 11  ARG A HH12 1  
ATOM 126   H HH21 . ARG A 1 11  ? -2.540  -19.476 12.903  1.00 0.00 ? 11  ARG A HH21 1  
ATOM 127   H HH22 . ARG A 1 11  ? -2.874  -20.838 11.889  1.00 0.00 ? 11  ARG A HH22 1  
ATOM 128   N N    . SER A 1 12  ? 0.943   -16.439 5.033   1.00 0.00 ? 12  SER A N    1  
ATOM 129   C CA   . SER A 1 12  ? 0.954   -16.651 3.590   1.00 0.00 ? 12  SER A CA   1  
ATOM 130   C C    . SER A 1 12  ? 1.912   -15.682 2.906   1.00 0.00 ? 12  SER A C    1  
ATOM 131   O O    . SER A 1 12  ? 2.373   -14.716 3.513   1.00 0.00 ? 12  SER A O    1  
ATOM 132   C CB   . SER A 1 12  ? -0.455  -16.483 3.018   1.00 0.00 ? 12  SER A CB   1  
ATOM 133   O OG   . SER A 1 12  ? -0.958  -15.183 3.274   1.00 0.00 ? 12  SER A OG   1  
ATOM 134   H H    . SER A 1 12  ? 0.510   -15.637 5.395   1.00 0.00 ? 12  SER A H    1  
ATOM 135   H HA   . SER A 1 12  ? 1.289   -17.661 3.407   1.00 0.00 ? 12  SER A HA   1  
ATOM 136   H HB2  . SER A 1 12  ? -0.429  -16.642 1.951   1.00 0.00 ? 12  SER A HB2  1  
ATOM 137   H HB3  . SER A 1 12  ? -1.115  -17.207 3.474   1.00 0.00 ? 12  SER A HB3  1  
ATOM 138   H HG   . SER A 1 12  ? -1.291  -15.140 4.173   1.00 0.00 ? 12  SER A HG   1  
ATOM 139   N N    . GLN A 1 13  ? 2.207   -15.948 1.637   1.00 0.00 ? 13  GLN A N    1  
ATOM 140   C CA   . GLN A 1 13  ? 3.111   -15.099 0.870   1.00 0.00 ? 13  GLN A CA   1  
ATOM 141   C C    . GLN A 1 13  ? 2.606   -13.661 0.829   1.00 0.00 ? 13  GLN A C    1  
ATOM 142   O O    . GLN A 1 13  ? 1.405   -13.398 0.893   1.00 0.00 ? 13  GLN A O    1  
ATOM 143   C CB   . GLN A 1 13  ? 3.265   -15.639 -0.553  1.00 0.00 ? 13  GLN A CB   1  
ATOM 144   C CG   . GLN A 1 13  ? 2.119   -15.257 -1.476  1.00 0.00 ? 13  GLN A CG   1  
ATOM 145   C CD   . GLN A 1 13  ? 0.859   -16.054 -1.200  1.00 0.00 ? 13  GLN A CD   1  
ATOM 146   O OE1  . GLN A 1 13  ? 0.821   -17.268 -1.402  1.00 0.00 ? 13  GLN A OE1  1  
ATOM 147   N NE2  . GLN A 1 13  ? -0.183  -15.373 -0.736  1.00 0.00 ? 13  GLN A NE2  1  
ATOM 148   H H    . GLN A 1 13  ? 1.808   -16.732 1.208   1.00 0.00 ? 13  GLN A H    1  
ATOM 149   H HA   . GLN A 1 13  ? 4.074   -15.116 1.357   1.00 0.00 ? 13  GLN A HA   1  
ATOM 150   H HB2  . GLN A 1 13  ? 4.182   -15.253 -0.975  1.00 0.00 ? 13  GLN A HB2  1  
ATOM 151   H HB3  . GLN A 1 13  ? 3.323   -16.716 -0.513  1.00 0.00 ? 13  GLN A HB3  1  
ATOM 152   H HG2  . GLN A 1 13  ? 1.899   -14.209 -1.342  1.00 0.00 ? 13  GLN A HG2  1  
ATOM 153   H HG3  . GLN A 1 13  ? 2.422   -15.433 -2.497  1.00 0.00 ? 13  GLN A HG3  1  
ATOM 154   H HE21 . GLN A 1 13  ? -0.081  -14.408 -0.601  1.00 0.00 ? 13  GLN A HE21 1  
ATOM 155   H HE22 . GLN A 1 13  ? -1.010  -15.863 -0.550  1.00 0.00 ? 13  GLN A HE22 1  
ATOM 156   N N    . PRO A 1 14  ? 3.542   -12.707 0.722   1.00 0.00 ? 14  PRO A N    1  
ATOM 157   C CA   . PRO A 1 14  ? 3.215   -11.279 0.671   1.00 0.00 ? 14  PRO A CA   1  
ATOM 158   C C    . PRO A 1 14  ? 2.528   -10.888 -0.633  1.00 0.00 ? 14  PRO A C    1  
ATOM 159   O O    . PRO A 1 14  ? 2.318   -11.726 -1.510  1.00 0.00 ? 14  PRO A O    1  
ATOM 160   C CB   . PRO A 1 14  ? 4.582   -10.598 0.780   1.00 0.00 ? 14  PRO A CB   1  
ATOM 161   C CG   . PRO A 1 14  ? 5.549   -11.605 0.260   1.00 0.00 ? 14  PRO A CG   1  
ATOM 162   C CD   . PRO A 1 14  ? 4.993   -12.949 0.642   1.00 0.00 ? 14  PRO A CD   1  
ATOM 163   H HA   . PRO A 1 14  ? 2.596   -10.983 1.505   1.00 0.00 ? 14  PRO A HA   1  
ATOM 164   H HB2  . PRO A 1 14  ? 4.587   -9.698  0.180   1.00 0.00 ? 14  PRO A HB2  1  
ATOM 165   H HB3  . PRO A 1 14  ? 4.784   -10.351 1.811   1.00 0.00 ? 14  PRO A HB3  1  
ATOM 166   H HG2  . PRO A 1 14  ? 5.626   -11.521 -0.813  1.00 0.00 ? 14  PRO A HG2  1  
ATOM 167   H HG3  . PRO A 1 14  ? 6.515   -11.456 0.720   1.00 0.00 ? 14  PRO A HG3  1  
ATOM 168   H HD2  . PRO A 1 14  ? 5.220   -13.681 -0.119  1.00 0.00 ? 14  PRO A HD2  1  
ATOM 169   H HD3  . PRO A 1 14  ? 5.384   -13.262 1.598   1.00 0.00 ? 14  PRO A HD3  1  
ATOM 170   N N    . SER A 1 15  ? 2.180   -9.611  -0.754  1.00 0.00 ? 15  SER A N    1  
ATOM 171   C CA   . SER A 1 15  ? 1.512   -9.110  -1.950  1.00 0.00 ? 15  SER A CA   1  
ATOM 172   C C    . SER A 1 15  ? 2.454   -8.233  -2.770  1.00 0.00 ? 15  SER A C    1  
ATOM 173   O O    . SER A 1 15  ? 3.407   -7.661  -2.241  1.00 0.00 ? 15  SER A O    1  
ATOM 174   C CB   . SER A 1 15  ? 0.261   -8.317  -1.567  1.00 0.00 ? 15  SER A CB   1  
ATOM 175   O OG   . SER A 1 15  ? -0.692  -8.331  -2.615  1.00 0.00 ? 15  SER A OG   1  
ATOM 176   H H    . SER A 1 15  ? 2.374   -8.992  -0.019  1.00 0.00 ? 15  SER A H    1  
ATOM 177   H HA   . SER A 1 15  ? 1.220   -9.961  -2.547  1.00 0.00 ? 15  SER A HA   1  
ATOM 178   H HB2  . SER A 1 15  ? -0.184  -8.754  -0.686  1.00 0.00 ? 15  SER A HB2  1  
ATOM 179   H HB3  . SER A 1 15  ? 0.537   -7.293  -1.361  1.00 0.00 ? 15  SER A HB3  1  
ATOM 180   H HG   . SER A 1 15  ? -0.307  -7.941  -3.404  1.00 0.00 ? 15  SER A HG   1  
ATOM 181   N N    . LYS A 1 16  ? 2.178   -8.131  -4.065  1.00 0.00 ? 16  LYS A N    1  
ATOM 182   C CA   . LYS A 1 16  ? 2.998   -7.324  -4.961  1.00 0.00 ? 16  LYS A CA   1  
ATOM 183   C C    . LYS A 1 16  ? 2.595   -5.854  -4.890  1.00 0.00 ? 16  LYS A C    1  
ATOM 184   O O    . LYS A 1 16  ? 3.429   -4.962  -5.047  1.00 0.00 ? 16  LYS A O    1  
ATOM 185   C CB   . LYS A 1 16  ? 2.869   -7.830  -6.399  1.00 0.00 ? 16  LYS A CB   1  
ATOM 186   C CG   . LYS A 1 16  ? 3.464   -9.211  -6.613  1.00 0.00 ? 16  LYS A CG   1  
ATOM 187   C CD   . LYS A 1 16  ? 3.410   -9.621  -8.076  1.00 0.00 ? 16  LYS A CD   1  
ATOM 188   C CE   . LYS A 1 16  ? 3.365   -11.133 -8.229  1.00 0.00 ? 16  LYS A CE   1  
ATOM 189   N NZ   . LYS A 1 16  ? 1.967   -11.648 -8.238  1.00 0.00 ? 16  LYS A NZ   1  
ATOM 190   H H    . LYS A 1 16  ? 1.404   -8.611  -4.429  1.00 0.00 ? 16  LYS A H    1  
ATOM 191   H HA   . LYS A 1 16  ? 4.026   -7.418  -4.646  1.00 0.00 ? 16  LYS A HA   1  
ATOM 192   H HB2  . LYS A 1 16  ? 1.822   -7.867  -6.663  1.00 0.00 ? 16  LYS A HB2  1  
ATOM 193   H HB3  . LYS A 1 16  ? 3.373   -7.138  -7.058  1.00 0.00 ? 16  LYS A HB3  1  
ATOM 194   H HG2  . LYS A 1 16  ? 4.495   -9.203  -6.291  1.00 0.00 ? 16  LYS A HG2  1  
ATOM 195   H HG3  . LYS A 1 16  ? 2.907   -9.928  -6.027  1.00 0.00 ? 16  LYS A HG3  1  
ATOM 196   H HD2  . LYS A 1 16  ? 2.525   -9.198  -8.527  1.00 0.00 ? 16  LYS A HD2  1  
ATOM 197   H HD3  . LYS A 1 16  ? 4.289   -9.243  -8.579  1.00 0.00 ? 16  LYS A HD3  1  
ATOM 198   H HE2  . LYS A 1 16  ? 3.844   -11.403 -9.157  1.00 0.00 ? 16  LYS A HE2  1  
ATOM 199   H HE3  . LYS A 1 16  ? 3.899   -11.582 -7.404  1.00 0.00 ? 16  LYS A HE3  1  
ATOM 200   H HZ1  . LYS A 1 16  ? 1.335   -10.973 -7.761  1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 201   H HZ2  . LYS A 1 16  ? 1.919   -12.561 -7.743  1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 202   H HZ3  . LYS A 1 16  ? 1.641   -11.779 -9.217  1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 203   N N    . THR A 1 17  ? 1.310   -5.608  -4.652  1.00 0.00 ? 17  THR A N    1  
ATOM 204   C CA   . THR A 1 17  ? 0.797   -4.247  -4.560  1.00 0.00 ? 17  THR A CA   1  
ATOM 205   C C    . THR A 1 17  ? 0.672   -3.804  -3.107  1.00 0.00 ? 17  THR A C    1  
ATOM 206   O O    . THR A 1 17  ? 0.092   -4.508  -2.280  1.00 0.00 ? 17  THR A O    1  
ATOM 207   C CB   . THR A 1 17  ? -0.577  -4.118  -5.244  1.00 0.00 ? 17  THR A CB   1  
ATOM 208   O OG1  . THR A 1 17  ? -0.571  -4.820  -6.492  1.00 0.00 ? 17  THR A OG1  1  
ATOM 209   C CG2  . THR A 1 17  ? -0.929  -2.657  -5.481  1.00 0.00 ? 17  THR A CG2  1  
ATOM 210   H H    . THR A 1 17  ? 0.694   -6.361  -4.536  1.00 0.00 ? 17  THR A H    1  
ATOM 211   H HA   . THR A 1 17  ? 1.491   -3.594  -5.068  1.00 0.00 ? 17  THR A HA   1  
ATOM 212   H HB   . THR A 1 17  ? -1.327  -4.553  -4.598  1.00 0.00 ? 17  THR A HB   1  
ATOM 213   H HG1  . THR A 1 17  ? -0.880  -5.719  -6.355  1.00 0.00 ? 17  THR A HG1  1  
ATOM 214   H HG21 . THR A 1 17  ? -2.001  -2.550  -5.543  1.00 0.00 ? 17  THR A HG21 1  
ATOM 215   H HG22 . THR A 1 17  ? -0.479  -2.323  -6.404  1.00 0.00 ? 17  THR A HG22 1  
ATOM 216   H HG23 . THR A 1 17  ? -0.555  -2.060  -4.662  1.00 0.00 ? 17  THR A HG23 1  
ATOM 217   N N    . LEU A 1 18  ? 1.219   -2.632  -2.802  1.00 0.00 ? 18  LEU A N    1  
ATOM 218   C CA   . LEU A 1 18  ? 1.168   -2.093  -1.448  1.00 0.00 ? 18  LEU A CA   1  
ATOM 219   C C    . LEU A 1 18  ? 0.022   -1.098  -1.300  1.00 0.00 ? 18  LEU A C    1  
ATOM 220   O O    . LEU A 1 18  ? -0.125  -0.180  -2.108  1.00 0.00 ? 18  LEU A O    1  
ATOM 221   C CB   . LEU A 1 18  ? 2.494   -1.417  -1.096  1.00 0.00 ? 18  LEU A CB   1  
ATOM 222   C CG   . LEU A 1 18  ? 3.562   -2.316  -0.472  1.00 0.00 ? 18  LEU A CG   1  
ATOM 223   C CD1  . LEU A 1 18  ? 4.906   -1.607  -0.441  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 224   C CD2  . LEU A 1 18  ? 3.148   -2.740  0.930   1.00 0.00 ? 18  LEU A CD2  1  
ATOM 225   H H    . LEU A 1 18  ? 1.667   -2.116  -3.504  1.00 0.00 ? 18  LEU A H    1  
ATOM 226   H HA   . LEU A 1 18  ? 1.003   -2.917  -0.769  1.00 0.00 ? 18  LEU A HA   1  
ATOM 227   H HB2  . LEU A 1 18  ? 2.903   -1.000  -2.004  1.00 0.00 ? 18  LEU A HB2  1  
ATOM 228   H HB3  . LEU A 1 18  ? 2.283   -0.619  -0.399  1.00 0.00 ? 18  LEU A HB3  1  
ATOM 229   H HG   . LEU A 1 18  ? 3.669   -3.208  -1.073  1.00 0.00 ? 18  LEU A HG   1  
ATOM 230   H HD11 . LEU A 1 18  ? 5.219   -1.384  -1.450  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 231   H HD12 . LEU A 1 18  ? 5.639   -2.245  0.030   1.00 0.00 ? 18  LEU A HD12 1  
ATOM 232   H HD13 . LEU A 1 18  ? 4.816   -0.688  0.119   1.00 0.00 ? 18  LEU A HD13 1  
ATOM 233   H HD21 . LEU A 1 18  ? 3.180   -1.884  1.588   1.00 0.00 ? 18  LEU A HD21 1  
ATOM 234   H HD22 . LEU A 1 18  ? 3.828   -3.497  1.293   1.00 0.00 ? 18  LEU A HD22 1  
ATOM 235   H HD23 . LEU A 1 18  ? 2.145   -3.137  0.905   1.00 0.00 ? 18  LEU A HD23 1  
ATOM 236   N N    . PHE A 1 19  ? -0.787  -1.284  -0.262  1.00 0.00 ? 19  PHE A N    1  
ATOM 237   C CA   . PHE A 1 19  ? -1.920  -0.402  -0.008  1.00 0.00 ? 19  PHE A CA   1  
ATOM 238   C C    . PHE A 1 19  ? -1.483  0.830   0.779   1.00 0.00 ? 19  PHE A C    1  
ATOM 239   O O    . PHE A 1 19  ? -0.991  0.721   1.902   1.00 0.00 ? 19  PHE A O    1  
ATOM 240   C CB   . PHE A 1 19  ? -3.014  -1.149  0.758   1.00 0.00 ? 19  PHE A CB   1  
ATOM 241   C CG   . PHE A 1 19  ? -4.219  -0.304  1.059   1.00 0.00 ? 19  PHE A CG   1  
ATOM 242   C CD1  . PHE A 1 19  ? -4.952  0.271   0.033   1.00 0.00 ? 19  PHE A CD1  1  
ATOM 243   C CD2  . PHE A 1 19  ? -4.619  -0.086  2.367   1.00 0.00 ? 19  PHE A CD2  1  
ATOM 244   C CE1  . PHE A 1 19  ? -6.060  1.049   0.308   1.00 0.00 ? 19  PHE A CE1  1  
ATOM 245   C CE2  . PHE A 1 19  ? -5.727  0.692   2.648   1.00 0.00 ? 19  PHE A CE2  1  
ATOM 246   C CZ   . PHE A 1 19  ? -6.449  1.259   1.616   1.00 0.00 ? 19  PHE A CZ   1  
ATOM 247   H H    . PHE A 1 19  ? -0.618  -2.034  0.347   1.00 0.00 ? 19  PHE A H    1  
ATOM 248   H HA   . PHE A 1 19  ? -2.313  -0.084  -0.961  1.00 0.00 ? 19  PHE A HA   1  
ATOM 249   H HB2  . PHE A 1 19  ? -3.340  -1.995  0.171   1.00 0.00 ? 19  PHE A HB2  1  
ATOM 250   H HB3  . PHE A 1 19  ? -2.610  -1.500  1.696   1.00 0.00 ? 19  PHE A HB3  1  
ATOM 251   H HD1  . PHE A 1 19  ? -4.650  0.107   -0.991  1.00 0.00 ? 19  PHE A HD1  1  
ATOM 252   H HD2  . PHE A 1 19  ? -4.054  -0.529  3.175   1.00 0.00 ? 19  PHE A HD2  1  
ATOM 253   H HE1  . PHE A 1 19  ? -6.624  1.491   -0.500  1.00 0.00 ? 19  PHE A HE1  1  
ATOM 254   H HE2  . PHE A 1 19  ? -6.028  0.853   3.672   1.00 0.00 ? 19  PHE A HE2  1  
ATOM 255   H HZ   . PHE A 1 19  ? -7.315  1.867   1.833   1.00 0.00 ? 19  PHE A HZ   1  
ATOM 256   N N    . VAL A 1 20  ? -1.667  2.003   0.181   1.00 0.00 ? 20  VAL A N    1  
ATOM 257   C CA   . VAL A 1 20  ? -1.294  3.257   0.825   1.00 0.00 ? 20  VAL A CA   1  
ATOM 258   C C    . VAL A 1 20  ? -2.527  4.044   1.253   1.00 0.00 ? 20  VAL A C    1  
ATOM 259   O O    . VAL A 1 20  ? -3.292  4.525   0.415   1.00 0.00 ? 20  VAL A O    1  
ATOM 260   C CB   . VAL A 1 20  ? -0.436  4.133   -0.107  1.00 0.00 ? 20  VAL A CB   1  
ATOM 261   C CG1  . VAL A 1 20  ? -0.052  5.432   0.585   1.00 0.00 ? 20  VAL A CG1  1  
ATOM 262   C CG2  . VAL A 1 20  ? 0.802   3.374   -0.561  1.00 0.00 ? 20  VAL A CG2  1  
ATOM 263   H H    . VAL A 1 20  ? -2.065  2.026   -0.714  1.00 0.00 ? 20  VAL A H    1  
ATOM 264   H HA   . VAL A 1 20  ? -0.708  3.020   1.702   1.00 0.00 ? 20  VAL A HA   1  
ATOM 265   H HB   . VAL A 1 20  ? -1.024  4.376   -0.980  1.00 0.00 ? 20  VAL A HB   1  
ATOM 266   H HG11 . VAL A 1 20  ? 0.821   5.850   0.105   1.00 0.00 ? 20  VAL A HG11 1  
ATOM 267   H HG12 . VAL A 1 20  ? -0.872  6.132   0.517   1.00 0.00 ? 20  VAL A HG12 1  
ATOM 268   H HG13 . VAL A 1 20  ? 0.169   5.235   1.623   1.00 0.00 ? 20  VAL A HG13 1  
ATOM 269   H HG21 . VAL A 1 20  ? 1.414   4.019   -1.173  1.00 0.00 ? 20  VAL A HG21 1  
ATOM 270   H HG22 . VAL A 1 20  ? 1.367   3.057   0.304   1.00 0.00 ? 20  VAL A HG22 1  
ATOM 271   H HG23 . VAL A 1 20  ? 0.505   2.509   -1.133  1.00 0.00 ? 20  VAL A HG23 1  
ATOM 272   N N    . LYS A 1 21  ? -2.716  4.174   2.561   1.00 0.00 ? 21  LYS A N    1  
ATOM 273   C CA   . LYS A 1 21  ? -3.855  4.905   3.102   1.00 0.00 ? 21  LYS A CA   1  
ATOM 274   C C    . LYS A 1 21  ? -3.392  6.070   3.970   1.00 0.00 ? 21  LYS A C    1  
ATOM 275   O O    . LYS A 1 21  ? -2.434  5.947   4.732   1.00 0.00 ? 21  LYS A O    1  
ATOM 276   C CB   . LYS A 1 21  ? -4.746  3.968   3.921   1.00 0.00 ? 21  LYS A CB   1  
ATOM 277   C CG   . LYS A 1 21  ? -4.170  3.616   5.282   1.00 0.00 ? 21  LYS A CG   1  
ATOM 278   C CD   . LYS A 1 21  ? -5.159  2.822   6.118   1.00 0.00 ? 21  LYS A CD   1  
ATOM 279   C CE   . LYS A 1 21  ? -4.746  2.781   7.581   1.00 0.00 ? 21  LYS A CE   1  
ATOM 280   N NZ   . LYS A 1 21  ? -4.760  4.136   8.199   1.00 0.00 ? 21  LYS A NZ   1  
ATOM 281   H H    . LYS A 1 21  ? -2.071  3.768   3.179   1.00 0.00 ? 21  LYS A H    1  
ATOM 282   H HA   . LYS A 1 21  ? -4.424  5.294   2.272   1.00 0.00 ? 21  LYS A HA   1  
ATOM 283   H HB2  . LYS A 1 21  ? -5.705  4.442   4.071   1.00 0.00 ? 21  LYS A HB2  1  
ATOM 284   H HB3  . LYS A 1 21  ? -4.890  3.052   3.367   1.00 0.00 ? 21  LYS A HB3  1  
ATOM 285   H HG2  . LYS A 1 21  ? -3.277  3.024   5.143   1.00 0.00 ? 21  LYS A HG2  1  
ATOM 286   H HG3  . LYS A 1 21  ? -3.921  4.529   5.804   1.00 0.00 ? 21  LYS A HG3  1  
ATOM 287   H HD2  . LYS A 1 21  ? -6.133  3.284   6.044   1.00 0.00 ? 21  LYS A HD2  1  
ATOM 288   H HD3  . LYS A 1 21  ? -5.209  1.811   5.739   1.00 0.00 ? 21  LYS A HD3  1  
ATOM 289   H HE2  . LYS A 1 21  ? -5.431  2.144   8.118   1.00 0.00 ? 21  LYS A HE2  1  
ATOM 290   H HE3  . LYS A 1 21  ? -3.748  2.374   7.649   1.00 0.00 ? 21  LYS A HE3  1  
ATOM 291   H HZ1  . LYS A 1 21  ? -3.872  4.302   8.715   1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 292   H HZ2  . LYS A 1 21  ? -5.554  4.217   8.865   1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 293   H HZ3  . LYS A 1 21  ? -4.862  4.864   7.464   1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 294   N N    . GLY A 1 22  ? -4.080  7.202   3.850   1.00 0.00 ? 22  GLY A N    1  
ATOM 295   C CA   . GLY A 1 22  ? -3.724  8.373   4.630   1.00 0.00 ? 22  GLY A CA   1  
ATOM 296   C C    . GLY A 1 22  ? -3.096  9.463   3.786   1.00 0.00 ? 22  GLY A C    1  
ATOM 297   O O    . GLY A 1 22  ? -2.189  10.164  4.238   1.00 0.00 ? 22  GLY A O    1  
ATOM 298   H H    . GLY A 1 22  ? -4.835  7.242   3.226   1.00 0.00 ? 22  GLY A H    1  
ATOM 299   H HA2  . GLY A 1 22  ? -4.615  8.763   5.099   1.00 0.00 ? 22  GLY A HA2  1  
ATOM 300   H HA3  . GLY A 1 22  ? -3.024  8.080   5.399   1.00 0.00 ? 22  GLY A HA3  1  
ATOM 301   N N    . LEU A 1 23  ? -3.576  9.608   2.556   1.00 0.00 ? 23  LEU A N    1  
ATOM 302   C CA   . LEU A 1 23  ? -3.054  10.620  1.645   1.00 0.00 ? 23  LEU A CA   1  
ATOM 303   C C    . LEU A 1 23  ? -3.915  11.879  1.678   1.00 0.00 ? 23  LEU A C    1  
ATOM 304   O O    . LEU A 1 23  ? -4.940  11.923  2.358   1.00 0.00 ? 23  LEU A O    1  
ATOM 305   C CB   . LEU A 1 23  ? -2.992  10.069  0.219   1.00 0.00 ? 23  LEU A CB   1  
ATOM 306   C CG   . LEU A 1 23  ? -2.087  8.855   0.008   1.00 0.00 ? 23  LEU A CG   1  
ATOM 307   C CD1  . LEU A 1 23  ? -2.276  8.285   -1.390  1.00 0.00 ? 23  LEU A CD1  1  
ATOM 308   C CD2  . LEU A 1 23  ? -0.631  9.228   0.241   1.00 0.00 ? 23  LEU A CD2  1  
ATOM 309   H H    . LEU A 1 23  ? -4.298  9.020   2.252   1.00 0.00 ? 23  LEU A H    1  
ATOM 310   H HA   . LEU A 1 23  ? -2.055  10.873  1.968   1.00 0.00 ? 23  LEU A HA   1  
ATOM 311   H HB2  . LEU A 1 23  ? -3.993  9.789   -0.071  1.00 0.00 ? 23  LEU A HB2  1  
ATOM 312   H HB3  . LEU A 1 23  ? -2.641  10.861  -0.426  1.00 0.00 ? 23  LEU A HB3  1  
ATOM 313   H HG   . LEU A 1 23  ? -2.354  8.086   0.720   1.00 0.00 ? 23  LEU A HG   1  
ATOM 314   H HD11 . LEU A 1 23  ? -1.315  8.190   -1.873  1.00 0.00 ? 23  LEU A HD11 1  
ATOM 315   H HD12 . LEU A 1 23  ? -2.905  8.947   -1.966  1.00 0.00 ? 23  LEU A HD12 1  
ATOM 316   H HD13 . LEU A 1 23  ? -2.743  7.313   -1.322  1.00 0.00 ? 23  LEU A HD13 1  
ATOM 317   H HD21 . LEU A 1 23  ? -0.542  9.762   1.175   1.00 0.00 ? 23  LEU A HD21 1  
ATOM 318   H HD22 . LEU A 1 23  ? -0.287  9.857   -0.567  1.00 0.00 ? 23  LEU A HD22 1  
ATOM 319   H HD23 . LEU A 1 23  ? -0.031  8.331   0.280   1.00 0.00 ? 23  LEU A HD23 1  
ATOM 320   N N    . SER A 1 24  ? -3.492  12.899  0.939   1.00 0.00 ? 24  SER A N    1  
ATOM 321   C CA   . SER A 1 24  ? -4.223  14.159  0.885   1.00 0.00 ? 24  SER A CA   1  
ATOM 322   C C    . SER A 1 24  ? -5.100  14.226  -0.362  1.00 0.00 ? 24  SER A C    1  
ATOM 323   O O    . SER A 1 24  ? -4.699  13.789  -1.439  1.00 0.00 ? 24  SER A O    1  
ATOM 324   C CB   . SER A 1 24  ? -3.250  15.339  0.901   1.00 0.00 ? 24  SER A CB   1  
ATOM 325   O OG   . SER A 1 24  ? -3.897  16.529  1.318   1.00 0.00 ? 24  SER A OG   1  
ATOM 326   H H    . SER A 1 24  ? -2.667  12.802  0.419   1.00 0.00 ? 24  SER A H    1  
ATOM 327   H HA   . SER A 1 24  ? -4.855  14.213  1.759   1.00 0.00 ? 24  SER A HA   1  
ATOM 328   H HB2  . SER A 1 24  ? -2.441  15.126  1.583   1.00 0.00 ? 24  SER A HB2  1  
ATOM 329   H HB3  . SER A 1 24  ? -2.853  15.489  -0.093  1.00 0.00 ? 24  SER A HB3  1  
ATOM 330   H HG   . SER A 1 24  ? -3.836  17.188  0.623   1.00 0.00 ? 24  SER A HG   1  
ATOM 331   N N    . GLU A 1 25  ? -6.300  14.776  -0.205  1.00 0.00 ? 25  GLU A N    1  
ATOM 332   C CA   . GLU A 1 25  ? -7.235  14.899  -1.317  1.00 0.00 ? 25  GLU A CA   1  
ATOM 333   C C    . GLU A 1 25  ? -6.518  15.364  -2.581  1.00 0.00 ? 25  GLU A C    1  
ATOM 334   O O    . GLU A 1 25  ? -6.989  15.134  -3.695  1.00 0.00 ? 25  GLU A O    1  
ATOM 335   C CB   . GLU A 1 25  ? -8.356  15.879  -0.964  1.00 0.00 ? 25  GLU A CB   1  
ATOM 336   C CG   . GLU A 1 25  ? -9.229  15.415  0.190   1.00 0.00 ? 25  GLU A CG   1  
ATOM 337   C CD   . GLU A 1 25  ? -10.406 14.576  -0.270  1.00 0.00 ? 25  GLU A CD   1  
ATOM 338   O OE1  . GLU A 1 25  ? -11.382 15.157  -0.789  1.00 0.00 ? 25  GLU A OE1  1  
ATOM 339   O OE2  . GLU A 1 25  ? -10.350 13.339  -0.110  1.00 0.00 ? 25  GLU A OE2  1  
ATOM 340   H H    . GLU A 1 25  ? -6.563  15.106  0.680   1.00 0.00 ? 25  GLU A H    1  
ATOM 341   H HA   . GLU A 1 25  ? -7.664  13.926  -1.499  1.00 0.00 ? 25  GLU A HA   1  
ATOM 342   H HB2  . GLU A 1 25  ? -7.917  16.829  -0.698  1.00 0.00 ? 25  GLU A HB2  1  
ATOM 343   H HB3  . GLU A 1 25  ? -8.985  16.014  -1.832  1.00 0.00 ? 25  GLU A HB3  1  
ATOM 344   H HG2  . GLU A 1 25  ? -8.628  14.825  0.865   1.00 0.00 ? 25  GLU A HG2  1  
ATOM 345   H HG3  . GLU A 1 25  ? -9.606  16.283  0.711   1.00 0.00 ? 25  GLU A HG3  1  
ATOM 346   N N    . ASP A 1 26  ? -5.376  16.019  -2.400  1.00 0.00 ? 26  ASP A N    1  
ATOM 347   C CA   . ASP A 1 26  ? -4.593  16.516  -3.525  1.00 0.00 ? 26  ASP A CA   1  
ATOM 348   C C    . ASP A 1 26  ? -3.570  15.478  -3.976  1.00 0.00 ? 26  ASP A C    1  
ATOM 349   O O    . ASP A 1 26  ? -3.240  15.387  -5.159  1.00 0.00 ? 26  ASP A O    1  
ATOM 350   C CB   . ASP A 1 26  ? -3.884  17.817  -3.146  1.00 0.00 ? 26  ASP A CB   1  
ATOM 351   C CG   . ASP A 1 26  ? -4.777  19.031  -3.311  1.00 0.00 ? 26  ASP A CG   1  
ATOM 352   O OD1  . ASP A 1 26  ? -5.794  19.122  -2.593  1.00 0.00 ? 26  ASP A OD1  1  
ATOM 353   O OD2  . ASP A 1 26  ? -4.458  19.891  -4.160  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 354   H H    . ASP A 1 26  ? -5.052  16.171  -1.487  1.00 0.00 ? 26  ASP A H    1  
ATOM 355   H HA   . ASP A 1 26  ? -5.272  16.711  -4.341  1.00 0.00 ? 26  ASP A HA   1  
ATOM 356   H HB2  . ASP A 1 26  ? -3.572  17.761  -2.113  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 357   H HB3  . ASP A 1 26  ? -3.015  17.942  -3.774  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 358   N N    . THR A 1 27  ? -3.069  14.696  -3.024  1.00 0.00 ? 27  THR A N    1  
ATOM 359   C CA   . THR A 1 27  ? -2.082  13.666  -3.322  1.00 0.00 ? 27  THR A CA   1  
ATOM 360   C C    . THR A 1 27  ? -2.393  12.972  -4.643  1.00 0.00 ? 27  THR A C    1  
ATOM 361   O O    . THR A 1 27  ? -3.418  12.303  -4.780  1.00 0.00 ? 27  THR A O    1  
ATOM 362   C CB   . THR A 1 27  ? -2.018  12.609  -2.203  1.00 0.00 ? 27  THR A CB   1  
ATOM 363   O OG1  . THR A 1 27  ? -1.536  13.205  -0.994  1.00 0.00 ? 27  THR A OG1  1  
ATOM 364   C CG2  . THR A 1 27  ? -1.112  11.454  -2.602  1.00 0.00 ? 27  THR A CG2  1  
ATOM 365   H H    . THR A 1 27  ? -3.371  14.816  -2.100  1.00 0.00 ? 27  THR A H    1  
ATOM 366   H HA   . THR A 1 27  ? -1.115  14.142  -3.395  1.00 0.00 ? 27  THR A HA   1  
ATOM 367   H HB   . THR A 1 27  ? -3.013  12.224  -2.035  1.00 0.00 ? 27  THR A HB   1  
ATOM 368   H HG1  . THR A 1 27  ? -1.688  14.153  -1.021  1.00 0.00 ? 27  THR A HG1  1  
ATOM 369   H HG21 . THR A 1 27  ? -0.798  11.579  -3.627  1.00 0.00 ? 27  THR A HG21 1  
ATOM 370   H HG22 . THR A 1 27  ? -1.649  10.523  -2.500  1.00 0.00 ? 27  THR A HG22 1  
ATOM 371   H HG23 . THR A 1 27  ? -0.244  11.440  -1.960  1.00 0.00 ? 27  THR A HG23 1  
ATOM 372   N N    . THR A 1 28  ? -1.501  13.135  -5.616  1.00 0.00 ? 28  THR A N    1  
ATOM 373   C CA   . THR A 1 28  ? -1.680  12.525  -6.927  1.00 0.00 ? 28  THR A CA   1  
ATOM 374   C C    . THR A 1 28  ? -0.834  11.264  -7.068  1.00 0.00 ? 28  THR A C    1  
ATOM 375   O O    . THR A 1 28  ? 0.176   11.105  -6.383  1.00 0.00 ? 28  THR A O    1  
ATOM 376   C CB   . THR A 1 28  ? -1.313  13.504  -8.058  1.00 0.00 ? 28  THR A CB   1  
ATOM 377   O OG1  . THR A 1 28  ? 0.039   13.949  -7.901  1.00 0.00 ? 28  THR A OG1  1  
ATOM 378   C CG2  . THR A 1 28  ? -2.249  14.703  -8.060  1.00 0.00 ? 28  THR A CG2  1  
ATOM 379   H H    . THR A 1 28  ? -0.704  13.679  -5.446  1.00 0.00 ? 28  THR A H    1  
ATOM 380   H HA   . THR A 1 28  ? -2.722  12.261  -7.033  1.00 0.00 ? 28  THR A HA   1  
ATOM 381   H HB   . THR A 1 28  ? -1.408  12.991  -9.004  1.00 0.00 ? 28  THR A HB   1  
ATOM 382   H HG1  . THR A 1 28  ? 0.612   13.190  -7.765  1.00 0.00 ? 28  THR A HG1  1  
ATOM 383   H HG21 . THR A 1 28  ? -2.162  15.230  -7.121  1.00 0.00 ? 28  THR A HG21 1  
ATOM 384   H HG22 . THR A 1 28  ? -3.267  14.365  -8.190  1.00 0.00 ? 28  THR A HG22 1  
ATOM 385   H HG23 . THR A 1 28  ? -1.983  15.365  -8.870  1.00 0.00 ? 28  THR A HG23 1  
ATOM 386   N N    . GLU A 1 29  ? -1.253  10.372  -7.959  1.00 0.00 ? 29  GLU A N    1  
ATOM 387   C CA   . GLU A 1 29  ? -0.532  9.125   -8.188  1.00 0.00 ? 29  GLU A CA   1  
ATOM 388   C C    . GLU A 1 29  ? 0.951   9.391   -8.428  1.00 0.00 ? 29  GLU A C    1  
ATOM 389   O O    . GLU A 1 29  ? 1.794   8.531   -8.174  1.00 0.00 ? 29  GLU A O    1  
ATOM 390   C CB   . GLU A 1 29  ? -1.128  8.378   -9.384  1.00 0.00 ? 29  GLU A CB   1  
ATOM 391   C CG   . GLU A 1 29  ? -2.619  8.117   -9.257  1.00 0.00 ? 29  GLU A CG   1  
ATOM 392   C CD   . GLU A 1 29  ? -3.264  7.762   -10.583 1.00 0.00 ? 29  GLU A CD   1  
ATOM 393   O OE1  . GLU A 1 29  ? -3.698  8.690   -11.298 1.00 0.00 ? 29  GLU A OE1  1  
ATOM 394   O OE2  . GLU A 1 29  ? -3.334  6.558   -10.905 1.00 0.00 ? 29  GLU A OE2  1  
ATOM 395   H H    . GLU A 1 29  ? -2.066  10.556  -8.474  1.00 0.00 ? 29  GLU A H    1  
ATOM 396   H HA   . GLU A 1 29  ? -0.638  8.514   -7.305  1.00 0.00 ? 29  GLU A HA   1  
ATOM 397   H HB2  . GLU A 1 29  ? -0.959  8.961   -10.277 1.00 0.00 ? 29  GLU A HB2  1  
ATOM 398   H HB3  . GLU A 1 29  ? -0.625  7.428   -9.485  1.00 0.00 ? 29  GLU A HB3  1  
ATOM 399   H HG2  . GLU A 1 29  ? -2.772  7.299   -8.570  1.00 0.00 ? 29  GLU A HG2  1  
ATOM 400   H HG3  . GLU A 1 29  ? -3.095  9.006   -8.868  1.00 0.00 ? 29  GLU A HG3  1  
ATOM 401   N N    . GLU A 1 30  ? 1.261   10.587  -8.919  1.00 0.00 ? 30  GLU A N    1  
ATOM 402   C CA   . GLU A 1 30  ? 2.642   10.965  -9.194  1.00 0.00 ? 30  GLU A CA   1  
ATOM 403   C C    . GLU A 1 30  ? 3.467   10.984  -7.911  1.00 0.00 ? 30  GLU A C    1  
ATOM 404   O O    . GLU A 1 30  ? 4.514   10.343  -7.822  1.00 0.00 ? 30  GLU A O    1  
ATOM 405   C CB   . GLU A 1 30  ? 2.693   12.338  -9.868  1.00 0.00 ? 30  GLU A CB   1  
ATOM 406   C CG   . GLU A 1 30  ? 2.635   12.275  -11.385 1.00 0.00 ? 30  GLU A CG   1  
ATOM 407   C CD   . GLU A 1 30  ? 1.220   12.132  -11.909 1.00 0.00 ? 30  GLU A CD   1  
ATOM 408   O OE1  . GLU A 1 30  ? 0.532   11.171  -11.503 1.00 0.00 ? 30  GLU A OE1  1  
ATOM 409   O OE2  . GLU A 1 30  ? 0.800   12.979  -12.724 1.00 0.00 ? 30  GLU A OE2  1  
ATOM 410   H H    . GLU A 1 30  ? 0.543   11.230  -9.101  1.00 0.00 ? 30  GLU A H    1  
ATOM 411   H HA   . GLU A 1 30  ? 3.059   10.230  -9.865  1.00 0.00 ? 30  GLU A HA   1  
ATOM 412   H HB2  . GLU A 1 30  ? 1.858   12.928  -9.520  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 413   H HB3  . GLU A 1 30  ? 3.612   12.830  -9.584  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 414   H HG2  . GLU A 1 30  ? 3.062   13.182  -11.787 1.00 0.00 ? 30  GLU A HG2  1  
ATOM 415   H HG3  . GLU A 1 30  ? 3.215   11.427  -11.719 1.00 0.00 ? 30  GLU A HG3  1  
ATOM 416   N N    . THR A 1 31  ? 2.987   11.726  -6.917  1.00 0.00 ? 31  THR A N    1  
ATOM 417   C CA   . THR A 1 31  ? 3.679   11.831  -5.639  1.00 0.00 ? 31  THR A CA   1  
ATOM 418   C C    . THR A 1 31  ? 3.629   10.512  -4.876  1.00 0.00 ? 31  THR A C    1  
ATOM 419   O O    . THR A 1 31  ? 4.485   10.237  -4.034  1.00 0.00 ? 31  THR A O    1  
ATOM 420   C CB   . THR A 1 31  ? 3.073   12.942  -4.761  1.00 0.00 ? 31  THR A CB   1  
ATOM 421   O OG1  . THR A 1 31  ? 3.949   13.236  -3.667  1.00 0.00 ? 31  THR A OG1  1  
ATOM 422   C CG2  . THR A 1 31  ? 1.710   12.527  -4.228  1.00 0.00 ? 31  THR A CG2  1  
ATOM 423   H H    . THR A 1 31  ? 2.147   12.214  -7.048  1.00 0.00 ? 31  THR A H    1  
ATOM 424   H HA   . THR A 1 31  ? 4.711   12.082  -5.838  1.00 0.00 ? 31  THR A HA   1  
ATOM 425   H HB   . THR A 1 31  ? 2.952   13.831  -5.364  1.00 0.00 ? 31  THR A HB   1  
ATOM 426   H HG1  . THR A 1 31  ? 3.432   13.532  -2.914  1.00 0.00 ? 31  THR A HG1  1  
ATOM 427   H HG21 . THR A 1 31  ? 1.750   12.456  -3.151  1.00 0.00 ? 31  THR A HG21 1  
ATOM 428   H HG22 . THR A 1 31  ? 1.438   11.567  -4.643  1.00 0.00 ? 31  THR A HG22 1  
ATOM 429   H HG23 . THR A 1 31  ? 0.973   13.263  -4.512  1.00 0.00 ? 31  THR A HG23 1  
ATOM 430   N N    . LEU A 1 32  ? 2.623   9.699   -5.176  1.00 0.00 ? 32  LEU A N    1  
ATOM 431   C CA   . LEU A 1 32  ? 2.462   8.406   -4.518  1.00 0.00 ? 32  LEU A CA   1  
ATOM 432   C C    . LEU A 1 32  ? 3.464   7.392   -5.059  1.00 0.00 ? 32  LEU A C    1  
ATOM 433   O O    . LEU A 1 32  ? 4.003   6.576   -4.311  1.00 0.00 ? 32  LEU A O    1  
ATOM 434   C CB   . LEU A 1 32  ? 1.037   7.887   -4.714  1.00 0.00 ? 32  LEU A CB   1  
ATOM 435   C CG   . LEU A 1 32  ? 0.694   6.580   -3.998  1.00 0.00 ? 32  LEU A CG   1  
ATOM 436   C CD1  . LEU A 1 32  ? 0.748   6.768   -2.490  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 437   C CD2  . LEU A 1 32  ? -0.677  6.080   -4.427  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 438   H H    . LEU A 1 32  ? 1.973   9.972   -5.855  1.00 0.00 ? 32  LEU A H    1  
ATOM 439   H HA   . LEU A 1 32  ? 2.643   8.547   -3.463  1.00 0.00 ? 32  LEU A HA   1  
ATOM 440   H HB2  . LEU A 1 32  ? 0.356   8.646   -4.360  1.00 0.00 ? 32  LEU A HB2  1  
ATOM 441   H HB3  . LEU A 1 32  ? 0.884   7.735   -5.773  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 442   H HG   . LEU A 1 32  ? 1.424   5.828   -4.266  1.00 0.00 ? 32  LEU A HG   1  
ATOM 443   H HD11 . LEU A 1 32  ? 1.624   6.276   -2.096  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 444   H HD12 . LEU A 1 32  ? -0.137  6.340   -2.042  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 445   H HD13 . LEU A 1 32  ? 0.793   7.822   -2.260  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 446   H HD21 . LEU A 1 32  ? -0.634  5.014   -4.597  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 447   H HD22 . LEU A 1 32  ? -0.973  6.578   -5.339  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 448   H HD23 . LEU A 1 32  ? -1.397  6.292   -3.650  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 449   N N    . LYS A 1 33  ? 3.711   7.449   -6.363  1.00 0.00 ? 33  LYS A N    1  
ATOM 450   C CA   . LYS A 1 33  ? 4.652   6.538   -7.005  1.00 0.00 ? 33  LYS A CA   1  
ATOM 451   C C    . LYS A 1 33  ? 6.074   6.790   -6.515  1.00 0.00 ? 33  LYS A C    1  
ATOM 452   O O    . LYS A 1 33  ? 6.700   5.913   -5.921  1.00 0.00 ? 33  LYS A O    1  
ATOM 453   C CB   . LYS A 1 33  ? 4.589   6.696   -8.526  1.00 0.00 ? 33  LYS A CB   1  
ATOM 454   C CG   . LYS A 1 33  ? 5.381   5.641   -9.280  1.00 0.00 ? 33  LYS A CG   1  
ATOM 455   C CD   . LYS A 1 33  ? 5.886   6.170   -10.612 1.00 0.00 ? 33  LYS A CD   1  
ATOM 456   C CE   . LYS A 1 33  ? 7.008   5.305   -11.165 1.00 0.00 ? 33  LYS A CE   1  
ATOM 457   N NZ   . LYS A 1 33  ? 7.915   6.078   -12.058 1.00 0.00 ? 33  LYS A NZ   1  
ATOM 458   H H    . LYS A 1 33  ? 3.250   8.122   -6.908  1.00 0.00 ? 33  LYS A H    1  
ATOM 459   H HA   . LYS A 1 33  ? 4.367   5.530   -6.744  1.00 0.00 ? 33  LYS A HA   1  
ATOM 460   H HB2  . LYS A 1 33  ? 3.558   6.635   -8.840  1.00 0.00 ? 33  LYS A HB2  1  
ATOM 461   H HB3  . LYS A 1 33  ? 4.980   7.668   -8.791  1.00 0.00 ? 33  LYS A HB3  1  
ATOM 462   H HG2  . LYS A 1 33  ? 6.227   5.342   -8.680  1.00 0.00 ? 33  LYS A HG2  1  
ATOM 463   H HG3  . LYS A 1 33  ? 4.744   4.787   -9.460  1.00 0.00 ? 33  LYS A HG3  1  
ATOM 464   H HD2  . LYS A 1 33  ? 5.070   6.177   -11.319 1.00 0.00 ? 33  LYS A HD2  1  
ATOM 465   H HD3  . LYS A 1 33  ? 6.254   7.177   -10.473 1.00 0.00 ? 33  LYS A HD3  1  
ATOM 466   H HE2  . LYS A 1 33  ? 7.580   4.909   -10.340 1.00 0.00 ? 33  LYS A HE2  1  
ATOM 467   H HE3  . LYS A 1 33  ? 6.573   4.490   -11.726 1.00 0.00 ? 33  LYS A HE3  1  
ATOM 468   H HZ1  . LYS A 1 33  ? 7.478   6.198   -12.994 1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 469   H HZ2  . LYS A 1 33  ? 8.818   5.575   -12.172 1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 470   H HZ3  . LYS A 1 33  ? 8.102   7.017   -11.652 1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 471   N N    . GLU A 1 34  ? 6.577   7.995   -6.767  1.00 0.00 ? 34  GLU A N    1  
ATOM 472   C CA   . GLU A 1 34  ? 7.926   8.361   -6.350  1.00 0.00 ? 34  GLU A CA   1  
ATOM 473   C C    . GLU A 1 34  ? 8.160   7.998   -4.887  1.00 0.00 ? 34  GLU A C    1  
ATOM 474   O O    . GLU A 1 34  ? 9.205   7.453   -4.531  1.00 0.00 ? 34  GLU A O    1  
ATOM 475   C CB   . GLU A 1 34  ? 8.159   9.859   -6.559  1.00 0.00 ? 34  GLU A CB   1  
ATOM 476   C CG   . GLU A 1 34  ? 8.115   10.284  -8.017  1.00 0.00 ? 34  GLU A CG   1  
ATOM 477   C CD   . GLU A 1 34  ? 8.991   9.419   -8.903  1.00 0.00 ? 34  GLU A CD   1  
ATOM 478   O OE1  . GLU A 1 34  ? 8.605   8.262   -9.170  1.00 0.00 ? 34  GLU A OE1  1  
ATOM 479   O OE2  . GLU A 1 34  ? 10.062  9.899   -9.330  1.00 0.00 ? 34  GLU A OE2  1  
ATOM 480   H H    . GLU A 1 34  ? 6.029   8.652   -7.244  1.00 0.00 ? 34  GLU A H    1  
ATOM 481   H HA   . GLU A 1 34  ? 8.623   7.809   -6.962  1.00 0.00 ? 34  GLU A HA   1  
ATOM 482   H HB2  . GLU A 1 34  ? 7.399   10.408  -6.022  1.00 0.00 ? 34  GLU A HB2  1  
ATOM 483   H HB3  . GLU A 1 34  ? 9.128   10.119  -6.159  1.00 0.00 ? 34  GLU A HB3  1  
ATOM 484   H HG2  . GLU A 1 34  ? 7.097   10.216  -8.369  1.00 0.00 ? 34  GLU A HG2  1  
ATOM 485   H HG3  . GLU A 1 34  ? 8.453   11.307  -8.091  1.00 0.00 ? 34  GLU A HG3  1  
ATOM 486   N N    . SER A 1 35  ? 7.181   8.305   -4.042  1.00 0.00 ? 35  SER A N    1  
ATOM 487   C CA   . SER A 1 35  ? 7.281   8.016   -2.617  1.00 0.00 ? 35  SER A CA   1  
ATOM 488   C C    . SER A 1 35  ? 8.024   6.704   -2.380  1.00 0.00 ? 35  SER A C    1  
ATOM 489   O O    . SER A 1 35  ? 8.788   6.574   -1.423  1.00 0.00 ? 35  SER A O    1  
ATOM 490   C CB   . SER A 1 35  ? 5.888   7.947   -1.989  1.00 0.00 ? 35  SER A CB   1  
ATOM 491   O OG   . SER A 1 35  ? 5.340   9.243   -1.821  1.00 0.00 ? 35  SER A OG   1  
ATOM 492   H H    . SER A 1 35  ? 6.372   8.739   -4.387  1.00 0.00 ? 35  SER A H    1  
ATOM 493   H HA   . SER A 1 35  ? 7.836   8.818   -2.154  1.00 0.00 ? 35  SER A HA   1  
ATOM 494   H HB2  . SER A 1 35  ? 5.235   7.374   -2.630  1.00 0.00 ? 35  SER A HB2  1  
ATOM 495   H HB3  . SER A 1 35  ? 5.955   7.468   -1.023  1.00 0.00 ? 35  SER A HB3  1  
ATOM 496   H HG   . SER A 1 35  ? 4.398   9.218   -2.003  1.00 0.00 ? 35  SER A HG   1  
ATOM 497   N N    . PHE A 1 36  ? 7.792   5.734   -3.258  1.00 0.00 ? 36  PHE A N    1  
ATOM 498   C CA   . PHE A 1 36  ? 8.438   4.431   -3.145  1.00 0.00 ? 36  PHE A CA   1  
ATOM 499   C C    . PHE A 1 36  ? 9.530   4.272   -4.199  1.00 0.00 ? 36  PHE A C    1  
ATOM 500   O O    . PHE A 1 36  ? 9.245   4.029   -5.372  1.00 0.00 ? 36  PHE A O    1  
ATOM 501   C CB   . PHE A 1 36  ? 7.404   3.312   -3.293  1.00 0.00 ? 36  PHE A CB   1  
ATOM 502   C CG   . PHE A 1 36  ? 6.203   3.484   -2.407  1.00 0.00 ? 36  PHE A CG   1  
ATOM 503   C CD1  . PHE A 1 36  ? 5.158   4.309   -2.789  1.00 0.00 ? 36  PHE A CD1  1  
ATOM 504   C CD2  . PHE A 1 36  ? 6.120   2.822   -1.193  1.00 0.00 ? 36  PHE A CD2  1  
ATOM 505   C CE1  . PHE A 1 36  ? 4.052   4.470   -1.976  1.00 0.00 ? 36  PHE A CE1  1  
ATOM 506   C CE2  . PHE A 1 36  ? 5.017   2.978   -0.376  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 507   C CZ   . PHE A 1 36  ? 3.981   3.803   -0.768  1.00 0.00 ? 36  PHE A CZ   1  
ATOM 508   H H    . PHE A 1 36  ? 7.173   5.898   -4.000  1.00 0.00 ? 36  PHE A H    1  
ATOM 509   H HA   . PHE A 1 36  ? 8.887   4.368   -2.166  1.00 0.00 ? 36  PHE A HA   1  
ATOM 510   H HB2  . PHE A 1 36  ? 7.060   3.282   -4.315  1.00 0.00 ? 36  PHE A HB2  1  
ATOM 511   H HB3  . PHE A 1 36  ? 7.868   2.369   -3.045  1.00 0.00 ? 36  PHE A HB3  1  
ATOM 512   H HD1  . PHE A 1 36  ? 5.211   4.831   -3.733  1.00 0.00 ? 36  PHE A HD1  1  
ATOM 513   H HD2  . PHE A 1 36  ? 6.931   2.176   -0.886  1.00 0.00 ? 36  PHE A HD2  1  
ATOM 514   H HE1  . PHE A 1 36  ? 3.243   5.116   -2.285  1.00 0.00 ? 36  PHE A HE1  1  
ATOM 515   H HE2  . PHE A 1 36  ? 4.965   2.455   0.567   1.00 0.00 ? 36  PHE A HE2  1  
ATOM 516   H HZ   . PHE A 1 36  ? 3.118   3.928   -0.131  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 517   N N    . ASP A 1 37  ? 10.780  4.411   -3.772  1.00 0.00 ? 37  ASP A N    1  
ATOM 518   C CA   . ASP A 1 37  ? 11.916  4.283   -4.677  1.00 0.00 ? 37  ASP A CA   1  
ATOM 519   C C    . ASP A 1 37  ? 12.080  2.839   -5.142  1.00 0.00 ? 37  ASP A C    1  
ATOM 520   O O    . ASP A 1 37  ? 12.659  2.012   -4.440  1.00 0.00 ? 37  ASP A O    1  
ATOM 521   C CB   . ASP A 1 37  ? 13.198  4.759   -3.992  1.00 0.00 ? 37  ASP A CB   1  
ATOM 522   C CG   . ASP A 1 37  ? 13.393  6.258   -4.107  1.00 0.00 ? 37  ASP A CG   1  
ATOM 523   O OD1  . ASP A 1 37  ? 12.648  7.006   -3.440  1.00 0.00 ? 37  ASP A OD1  1  
ATOM 524   O OD2  . ASP A 1 37  ? 14.290  6.683   -4.864  1.00 0.00 ? 37  ASP A OD2  1  
ATOM 525   H H    . ASP A 1 37  ? 10.943  4.604   -2.825  1.00 0.00 ? 37  ASP A H    1  
ATOM 526   H HA   . ASP A 1 37  ? 11.726  4.906   -5.538  1.00 0.00 ? 37  ASP A HA   1  
ATOM 527   H HB2  . ASP A 1 37  ? 13.156  4.500   -2.944  1.00 0.00 ? 37  ASP A HB2  1  
ATOM 528   H HB3  . ASP A 1 37  ? 14.045  4.267   -4.447  1.00 0.00 ? 37  ASP A HB3  1  
ATOM 529   N N    . GLY A 1 38  ? 11.564  2.544   -6.332  1.00 0.00 ? 38  GLY A N    1  
ATOM 530   C CA   . GLY A 1 38  ? 11.662  1.200   -6.870  1.00 0.00 ? 38  GLY A CA   1  
ATOM 531   C C    . GLY A 1 38  ? 10.407  0.778   -7.609  1.00 0.00 ? 38  GLY A C    1  
ATOM 532   O O    . GLY A 1 38  ? 10.479  0.067   -8.612  1.00 0.00 ? 38  GLY A O    1  
ATOM 533   H H    . GLY A 1 38  ? 11.113  3.245   -6.848  1.00 0.00 ? 38  GLY A H    1  
ATOM 534   H HA2  . GLY A 1 38  ? 12.499  1.156   -7.550  1.00 0.00 ? 38  GLY A HA2  1  
ATOM 535   H HA3  . GLY A 1 38  ? 11.835  0.510   -6.057  1.00 0.00 ? 38  GLY A HA3  1  
ATOM 536   N N    . SER A 1 39  ? 9.254   1.216   -7.113  1.00 0.00 ? 39  SER A N    1  
ATOM 537   C CA   . SER A 1 39  ? 7.978   0.875   -7.730  1.00 0.00 ? 39  SER A CA   1  
ATOM 538   C C    . SER A 1 39  ? 8.013   1.138   -9.233  1.00 0.00 ? 39  SER A C    1  
ATOM 539   O O    . SER A 1 39  ? 8.910   1.816   -9.735  1.00 0.00 ? 39  SER A O    1  
ATOM 540   C CB   . SER A 1 39  ? 6.846   1.678   -7.087  1.00 0.00 ? 39  SER A CB   1  
ATOM 541   O OG   . SER A 1 39  ? 6.928   3.048   -7.438  1.00 0.00 ? 39  SER A OG   1  
ATOM 542   H H    . SER A 1 39  ? 9.263   1.780   -6.311  1.00 0.00 ? 39  SER A H    1  
ATOM 543   H HA   . SER A 1 39  ? 7.801   -0.177  -7.565  1.00 0.00 ? 39  SER A HA   1  
ATOM 544   H HB2  . SER A 1 39  ? 5.896   1.289   -7.422  1.00 0.00 ? 39  SER A HB2  1  
ATOM 545   H HB3  . SER A 1 39  ? 6.911   1.590   -6.012  1.00 0.00 ? 39  SER A HB3  1  
ATOM 546   H HG   . SER A 1 39  ? 7.728   3.427   -7.065  1.00 0.00 ? 39  SER A HG   1  
ATOM 547   N N    . VAL A 1 40  ? 7.031   0.597   -9.945  1.00 0.00 ? 40  VAL A N    1  
ATOM 548   C CA   . VAL A 1 40  ? 6.947   0.773   -11.390 1.00 0.00 ? 40  VAL A CA   1  
ATOM 549   C C    . VAL A 1 40  ? 5.786   1.687   -11.766 1.00 0.00 ? 40  VAL A C    1  
ATOM 550   O O    . VAL A 1 40  ? 5.850   2.412   -12.759 1.00 0.00 ? 40  VAL A O    1  
ATOM 551   C CB   . VAL A 1 40  ? 6.778   -0.577  -12.111 1.00 0.00 ? 40  VAL A CB   1  
ATOM 552   C CG1  . VAL A 1 40  ? 7.980   -1.474  -11.856 1.00 0.00 ? 40  VAL A CG1  1  
ATOM 553   C CG2  . VAL A 1 40  ? 5.491   -1.259  -11.670 1.00 0.00 ? 40  VAL A CG2  1  
ATOM 554   H H    . VAL A 1 40  ? 6.345   0.067   -9.488  1.00 0.00 ? 40  VAL A H    1  
ATOM 555   H HA   . VAL A 1 40  ? 7.870   1.223   -11.725 1.00 0.00 ? 40  VAL A HA   1  
ATOM 556   H HB   . VAL A 1 40  ? 6.715   -0.390  -13.173 1.00 0.00 ? 40  VAL A HB   1  
ATOM 557   H HG11 . VAL A 1 40  ? 8.019   -1.734  -10.809 1.00 0.00 ? 40  VAL A HG11 1  
ATOM 558   H HG12 . VAL A 1 40  ? 7.891   -2.373  -12.448 1.00 0.00 ? 40  VAL A HG12 1  
ATOM 559   H HG13 . VAL A 1 40  ? 8.884   -0.950  -12.130 1.00 0.00 ? 40  VAL A HG13 1  
ATOM 560   H HG21 . VAL A 1 40  ? 5.154   -0.823  -10.741 1.00 0.00 ? 40  VAL A HG21 1  
ATOM 561   H HG22 . VAL A 1 40  ? 4.733   -1.122  -12.427 1.00 0.00 ? 40  VAL A HG22 1  
ATOM 562   H HG23 . VAL A 1 40  ? 5.672   -2.314  -11.529 1.00 0.00 ? 40  VAL A HG23 1  
ATOM 563   N N    . ARG A 1 41  ? 4.726   1.647   -10.966 1.00 0.00 ? 41  ARG A N    1  
ATOM 564   C CA   . ARG A 1 41  ? 3.549   2.471   -11.215 1.00 0.00 ? 41  ARG A CA   1  
ATOM 565   C C    . ARG A 1 41  ? 2.792   2.744   -9.919  1.00 0.00 ? 41  ARG A C    1  
ATOM 566   O O    . ARG A 1 41  ? 3.069   2.134   -8.887  1.00 0.00 ? 41  ARG A O    1  
ATOM 567   C CB   . ARG A 1 41  ? 2.625   1.786   -12.224 1.00 0.00 ? 41  ARG A CB   1  
ATOM 568   C CG   . ARG A 1 41  ? 3.229   1.655   -13.612 1.00 0.00 ? 41  ARG A CG   1  
ATOM 569   C CD   . ARG A 1 41  ? 2.185   1.237   -14.636 1.00 0.00 ? 41  ARG A CD   1  
ATOM 570   N NE   . ARG A 1 41  ? 2.701   1.301   -16.001 1.00 0.00 ? 41  ARG A NE   1  
ATOM 571   C CZ   . ARG A 1 41  ? 1.928   1.437   -17.073 1.00 0.00 ? 41  ARG A CZ   1  
ATOM 572   N NH1  . ARG A 1 41  ? 0.612   1.523   -16.939 1.00 0.00 ? 41  ARG A NH1  1  
ATOM 573   N NH2  . ARG A 1 41  ? 2.472   1.488   -18.282 1.00 0.00 ? 41  ARG A NH2  1  
ATOM 574   H H    . ARG A 1 41  ? 4.734   1.048   -10.190 1.00 0.00 ? 41  ARG A H    1  
ATOM 575   H HA   . ARG A 1 41  ? 3.884   3.411   -11.628 1.00 0.00 ? 41  ARG A HA   1  
ATOM 576   H HB2  . ARG A 1 41  ? 2.388   0.796   -11.863 1.00 0.00 ? 41  ARG A HB2  1  
ATOM 577   H HB3  . ARG A 1 41  ? 1.713   2.358   -12.304 1.00 0.00 ? 41  ARG A HB3  1  
ATOM 578   H HG2  . ARG A 1 41  ? 3.644   2.608   -13.906 1.00 0.00 ? 41  ARG A HG2  1  
ATOM 579   H HG3  . ARG A 1 41  ? 4.012   0.912   -13.585 1.00 0.00 ? 41  ARG A HG3  1  
ATOM 580   H HD2  . ARG A 1 41  ? 1.878   0.223   -14.425 1.00 0.00 ? 41  ARG A HD2  1  
ATOM 581   H HD3  . ARG A 1 41  ? 1.334   1.895   -14.552 1.00 0.00 ? 41  ARG A HD3  1  
ATOM 582   H HE   . ARG A 1 41  ? 3.671   1.239   -16.123 1.00 0.00 ? 41  ARG A HE   1  
ATOM 583   H HH11 . ARG A 1 41  ? 0.200   1.486   -16.029 1.00 0.00 ? 41  ARG A HH11 1  
ATOM 584   H HH12 . ARG A 1 41  ? 0.033   1.627   -17.748 1.00 0.00 ? 41  ARG A HH12 1  
ATOM 585   H HH21 . ARG A 1 41  ? 3.464   1.423   -18.387 1.00 0.00 ? 41  ARG A HH21 1  
ATOM 586   H HH22 . ARG A 1 41  ? 1.890   1.590   -19.088 1.00 0.00 ? 41  ARG A HH22 1  
ATOM 587   N N    . ALA A 1 42  ? 1.836   3.665   -9.981  1.00 0.00 ? 42  ALA A N    1  
ATOM 588   C CA   . ALA A 1 42  ? 1.039   4.018   -8.813  1.00 0.00 ? 42  ALA A CA   1  
ATOM 589   C C    . ALA A 1 42  ? -0.412  4.286   -9.199  1.00 0.00 ? 42  ALA A C    1  
ATOM 590   O O    . ALA A 1 42  ? -0.696  4.732   -10.311 1.00 0.00 ? 42  ALA A O    1  
ATOM 591   C CB   . ALA A 1 42  ? 1.634   5.232   -8.115  1.00 0.00 ? 42  ALA A CB   1  
ATOM 592   H H    . ALA A 1 42  ? 1.662   4.117   -10.833 1.00 0.00 ? 42  ALA A H    1  
ATOM 593   H HA   . ALA A 1 42  ? 1.069   3.186   -8.124  1.00 0.00 ? 42  ALA A HA   1  
ATOM 594   H HB1  . ALA A 1 42  ? 1.635   6.072   -8.794  1.00 0.00 ? 42  ALA A HB1  1  
ATOM 595   H HB2  . ALA A 1 42  ? 1.042   5.472   -7.244  1.00 0.00 ? 42  ALA A HB2  1  
ATOM 596   H HB3  . ALA A 1 42  ? 2.647   5.012   -7.812  1.00 0.00 ? 42  ALA A HB3  1  
ATOM 597   N N    . ARG A 1 43  ? -1.326  4.010   -8.275  1.00 0.00 ? 43  ARG A N    1  
ATOM 598   C CA   . ARG A 1 43  ? -2.748  4.219   -8.520  1.00 0.00 ? 43  ARG A CA   1  
ATOM 599   C C    . ARG A 1 43  ? -3.413  4.893   -7.324  1.00 0.00 ? 43  ARG A C    1  
ATOM 600   O O    . ARG A 1 43  ? -3.000  4.698   -6.180  1.00 0.00 ? 43  ARG A O    1  
ATOM 601   C CB   . ARG A 1 43  ? -3.438  2.886   -8.817  1.00 0.00 ? 43  ARG A CB   1  
ATOM 602   C CG   . ARG A 1 43  ? -2.745  2.068   -9.894  1.00 0.00 ? 43  ARG A CG   1  
ATOM 603   C CD   . ARG A 1 43  ? -3.284  2.398   -11.277 1.00 0.00 ? 43  ARG A CD   1  
ATOM 604   N NE   . ARG A 1 43  ? -4.617  1.842   -11.492 1.00 0.00 ? 43  ARG A NE   1  
ATOM 605   C CZ   . ARG A 1 43  ? -5.451  2.275   -12.431 1.00 0.00 ? 43  ARG A CZ   1  
ATOM 606   N NH1  . ARG A 1 43  ? -5.091  3.264   -13.237 1.00 0.00 ? 43  ARG A NH1  1  
ATOM 607   N NH2  . ARG A 1 43  ? -6.648  1.719   -12.564 1.00 0.00 ? 43  ARG A NH2  1  
ATOM 608   H H    . ARG A 1 43  ? -1.038  3.656   -7.408  1.00 0.00 ? 43  ARG A H    1  
ATOM 609   H HA   . ARG A 1 43  ? -2.845  4.864   -9.381  1.00 0.00 ? 43  ARG A HA   1  
ATOM 610   H HB2  . ARG A 1 43  ? -3.465  2.299   -7.911  1.00 0.00 ? 43  ARG A HB2  1  
ATOM 611   H HB3  . ARG A 1 43  ? -4.449  3.083   -9.139  1.00 0.00 ? 43  ARG A HB3  1  
ATOM 612   H HG2  . ARG A 1 43  ? -1.687  2.283   -9.871  1.00 0.00 ? 43  ARG A HG2  1  
ATOM 613   H HG3  . ARG A 1 43  ? -2.906  1.019   -9.694  1.00 0.00 ? 43  ARG A HG3  1  
ATOM 614   H HD2  . ARG A 1 43  ? -3.330  3.471   -11.384 1.00 0.00 ? 43  ARG A HD2  1  
ATOM 615   H HD3  . ARG A 1 43  ? -2.611  1.991   -12.017 1.00 0.00 ? 43  ARG A HD3  1  
ATOM 616   H HE   . ARG A 1 43  ? -4.904  1.111   -10.907 1.00 0.00 ? 43  ARG A HE   1  
ATOM 617   H HH11 . ARG A 1 43  ? -4.189  3.684   -13.139 1.00 0.00 ? 43  ARG A HH11 1  
ATOM 618   H HH12 . ARG A 1 43  ? -5.720  3.588   -13.944 1.00 0.00 ? 43  ARG A HH12 1  
ATOM 619   H HH21 . ARG A 1 43  ? -6.923  0.973   -11.958 1.00 0.00 ? 43  ARG A HH21 1  
ATOM 620   H HH22 . ARG A 1 43  ? -7.275  2.046   -13.271 1.00 0.00 ? 43  ARG A HH22 1  
ATOM 621   N N    . ILE A 1 44  ? -4.443  5.688   -7.595  1.00 0.00 ? 44  ILE A N    1  
ATOM 622   C CA   . ILE A 1 44  ? -5.164  6.390   -6.541  1.00 0.00 ? 44  ILE A CA   1  
ATOM 623   C C    . ILE A 1 44  ? -6.671  6.300   -6.753  1.00 0.00 ? 44  ILE A C    1  
ATOM 624   O O    . ILE A 1 44  ? -7.164  6.474   -7.868  1.00 0.00 ? 44  ILE A O    1  
ATOM 625   C CB   . ILE A 1 44  ? -4.754  7.873   -6.470  1.00 0.00 ? 44  ILE A CB   1  
ATOM 626   C CG1  . ILE A 1 44  ? -3.366  8.011   -5.841  1.00 0.00 ? 44  ILE A CG1  1  
ATOM 627   C CG2  . ILE A 1 44  ? -5.782  8.669   -5.680  1.00 0.00 ? 44  ILE A CG2  1  
ATOM 628   C CD1  . ILE A 1 44  ? -2.815  9.419   -5.897  1.00 0.00 ? 44  ILE A CD1  1  
ATOM 629   H H    . ILE A 1 44  ? -4.724  5.803   -8.527  1.00 0.00 ? 44  ILE A H    1  
ATOM 630   H HA   . ILE A 1 44  ? -4.915  5.923   -5.599  1.00 0.00 ? 44  ILE A HA   1  
ATOM 631   H HB   . ILE A 1 44  ? -4.727  8.264   -7.476  1.00 0.00 ? 44  ILE A HB   1  
ATOM 632   H HG12 . ILE A 1 44  ? -3.417  7.717   -4.805  1.00 0.00 ? 44  ILE A HG12 1  
ATOM 633   H HG13 . ILE A 1 44  ? -2.677  7.363   -6.362  1.00 0.00 ? 44  ILE A HG13 1  
ATOM 634   H HG21 . ILE A 1 44  ? -6.439  9.187   -6.364  1.00 0.00 ? 44  ILE A HG21 1  
ATOM 635   H HG22 . ILE A 1 44  ? -6.362  7.997   -5.065  1.00 0.00 ? 44  ILE A HG22 1  
ATOM 636   H HG23 . ILE A 1 44  ? -5.277  9.387   -5.053  1.00 0.00 ? 44  ILE A HG23 1  
ATOM 637   H HD11 . ILE A 1 44  ? -3.188  9.986   -5.057  1.00 0.00 ? 44  ILE A HD11 1  
ATOM 638   H HD12 . ILE A 1 44  ? -1.737  9.386   -5.861  1.00 0.00 ? 44  ILE A HD12 1  
ATOM 639   H HD13 . ILE A 1 44  ? -3.130  9.892   -6.817  1.00 0.00 ? 44  ILE A HD13 1  
ATOM 640   N N    . VAL A 1 45  ? -7.400  6.029   -5.675  1.00 0.00 ? 45  VAL A N    1  
ATOM 641   C CA   . VAL A 1 45  ? -8.852  5.919   -5.741  1.00 0.00 ? 45  VAL A CA   1  
ATOM 642   C C    . VAL A 1 45  ? -9.508  7.295   -5.738  1.00 0.00 ? 45  VAL A C    1  
ATOM 643   O O    . VAL A 1 45  ? -8.953  8.259   -5.210  1.00 0.00 ? 45  VAL A O    1  
ATOM 644   C CB   . VAL A 1 45  ? -9.407  5.096   -4.563  1.00 0.00 ? 45  VAL A CB   1  
ATOM 645   C CG1  . VAL A 1 45  ? -8.630  3.797   -4.407  1.00 0.00 ? 45  VAL A CG1  1  
ATOM 646   C CG2  . VAL A 1 45  ? -9.366  5.909   -3.279  1.00 0.00 ? 45  VAL A CG2  1  
ATOM 647   H H    . VAL A 1 45  ? -6.950  5.900   -4.814  1.00 0.00 ? 45  VAL A H    1  
ATOM 648   H HA   . VAL A 1 45  ? -9.107  5.411   -6.660  1.00 0.00 ? 45  VAL A HA   1  
ATOM 649   H HB   . VAL A 1 45  ? -10.437 4.849   -4.776  1.00 0.00 ? 45  VAL A HB   1  
ATOM 650   H HG11 . VAL A 1 45  ? -8.266  3.478   -5.372  1.00 0.00 ? 45  VAL A HG11 1  
ATOM 651   H HG12 . VAL A 1 45  ? -7.796  3.955   -3.739  1.00 0.00 ? 45  VAL A HG12 1  
ATOM 652   H HG13 . VAL A 1 45  ? -9.280  3.037   -3.998  1.00 0.00 ? 45  VAL A HG13 1  
ATOM 653   H HG21 . VAL A 1 45  ? -8.734  5.412   -2.558  1.00 0.00 ? 45  VAL A HG21 1  
ATOM 654   H HG22 . VAL A 1 45  ? -8.969  6.892   -3.487  1.00 0.00 ? 45  VAL A HG22 1  
ATOM 655   H HG23 . VAL A 1 45  ? -10.365 6.002   -2.879  1.00 0.00 ? 45  VAL A HG23 1  
ATOM 656   N N    . THR A 1 46  ? -10.695 7.380   -6.332  1.00 0.00 ? 46  THR A N    1  
ATOM 657   C CA   . THR A 1 46  ? -11.427 8.639   -6.399  1.00 0.00 ? 46  THR A CA   1  
ATOM 658   C C    . THR A 1 46  ? -12.912 8.425   -6.129  1.00 0.00 ? 46  THR A C    1  
ATOM 659   O O    . THR A 1 46  ? -13.476 7.392   -6.490  1.00 0.00 ? 46  THR A O    1  
ATOM 660   C CB   . THR A 1 46  ? -11.258 9.314   -7.773  1.00 0.00 ? 46  THR A CB   1  
ATOM 661   O OG1  . THR A 1 46  ? -11.528 8.373   -8.818  1.00 0.00 ? 46  THR A OG1  1  
ATOM 662   C CG2  . THR A 1 46  ? -9.851  9.870   -7.934  1.00 0.00 ? 46  THR A CG2  1  
ATOM 663   H H    . THR A 1 46  ? -11.085 6.577   -6.735  1.00 0.00 ? 46  THR A H    1  
ATOM 664   H HA   . THR A 1 46  ? -11.025 9.299   -5.645  1.00 0.00 ? 46  THR A HA   1  
ATOM 665   H HB   . THR A 1 46  ? -11.962 10.131  -7.845  1.00 0.00 ? 46  THR A HB   1  
ATOM 666   H HG1  . THR A 1 46  ? -12.165 7.724   -8.509  1.00 0.00 ? 46  THR A HG1  1  
ATOM 667   H HG21 . THR A 1 46  ? -9.434  10.080  -6.961  1.00 0.00 ? 46  THR A HG21 1  
ATOM 668   H HG22 . THR A 1 46  ? -9.888  10.779  -8.515  1.00 0.00 ? 46  THR A HG22 1  
ATOM 669   H HG23 . THR A 1 46  ? -9.234  9.143   -8.441  1.00 0.00 ? 46  THR A HG23 1  
ATOM 670   N N    . ASP A 1 47  ? -13.540 9.408   -5.494  1.00 0.00 ? 47  ASP A N    1  
ATOM 671   C CA   . ASP A 1 47  ? -14.961 9.329   -5.177  1.00 0.00 ? 47  ASP A CA   1  
ATOM 672   C C    . ASP A 1 47  ? -15.809 9.524   -6.430  1.00 0.00 ? 47  ASP A C    1  
ATOM 673   O O    . ASP A 1 47  ? -15.387 10.183  -7.381  1.00 0.00 ? 47  ASP A O    1  
ATOM 674   C CB   . ASP A 1 47  ? -15.331 10.378  -4.128  1.00 0.00 ? 47  ASP A CB   1  
ATOM 675   C CG   . ASP A 1 47  ? -16.789 10.300  -3.720  1.00 0.00 ? 47  ASP A CG   1  
ATOM 676   O OD1  . ASP A 1 47  ? -17.358 9.189   -3.761  1.00 0.00 ? 47  ASP A OD1  1  
ATOM 677   O OD2  . ASP A 1 47  ? -17.362 11.350  -3.360  1.00 0.00 ? 47  ASP A OD2  1  
ATOM 678   H H    . ASP A 1 47  ? -13.036 10.207  -5.232  1.00 0.00 ? 47  ASP A H    1  
ATOM 679   H HA   . ASP A 1 47  ? -15.157 8.346   -4.775  1.00 0.00 ? 47  ASP A HA   1  
ATOM 680   H HB2  . ASP A 1 47  ? -14.722 10.228  -3.248  1.00 0.00 ? 47  ASP A HB2  1  
ATOM 681   H HB3  . ASP A 1 47  ? -15.140 11.362  -4.529  1.00 0.00 ? 47  ASP A HB3  1  
ATOM 682   N N    . ARG A 1 48  ? -17.006 8.947   -6.425  1.00 0.00 ? 48  ARG A N    1  
ATOM 683   C CA   . ARG A 1 48  ? -17.912 9.056   -7.562  1.00 0.00 ? 48  ARG A CA   1  
ATOM 684   C C    . ARG A 1 48  ? -18.887 10.214  -7.371  1.00 0.00 ? 48  ARG A C    1  
ATOM 685   O O    . ARG A 1 48  ? -19.484 10.700  -8.331  1.00 0.00 ? 48  ARG A O    1  
ATOM 686   C CB   . ARG A 1 48  ? -18.685 7.750   -7.752  1.00 0.00 ? 48  ARG A CB   1  
ATOM 687   C CG   . ARG A 1 48  ? -19.598 7.753   -8.968  1.00 0.00 ? 48  ARG A CG   1  
ATOM 688   C CD   . ARG A 1 48  ? -18.815 7.533   -10.252 1.00 0.00 ? 48  ARG A CD   1  
ATOM 689   N NE   . ARG A 1 48  ? -19.590 7.896   -11.435 1.00 0.00 ? 48  ARG A NE   1  
ATOM 690   C CZ   . ARG A 1 48  ? -19.064 8.025   -12.648 1.00 0.00 ? 48  ARG A CZ   1  
ATOM 691   N NH1  . ARG A 1 48  ? -17.768 7.821   -12.837 1.00 0.00 ? 48  ARG A NH1  1  
ATOM 692   N NH2  . ARG A 1 48  ? -19.835 8.358   -13.675 1.00 0.00 ? 48  ARG A NH2  1  
ATOM 693   H H    . ARG A 1 48  ? -17.287 8.435   -5.638  1.00 0.00 ? 48  ARG A H    1  
ATOM 694   H HA   . ARG A 1 48  ? -17.317 9.243   -8.443  1.00 0.00 ? 48  ARG A HA   1  
ATOM 695   H HB2  . ARG A 1 48  ? -17.979 6.939   -7.862  1.00 0.00 ? 48  ARG A HB2  1  
ATOM 696   H HB3  . ARG A 1 48  ? -19.290 7.573   -6.876  1.00 0.00 ? 48  ARG A HB3  1  
ATOM 697   H HG2  . ARG A 1 48  ? -20.325 6.962   -8.863  1.00 0.00 ? 48  ARG A HG2  1  
ATOM 698   H HG3  . ARG A 1 48  ? -20.104 8.706   -9.023  1.00 0.00 ? 48  ARG A HG3  1  
ATOM 699   H HD2  . ARG A 1 48  ? -17.920 8.137   -10.221 1.00 0.00 ? 48  ARG A HD2  1  
ATOM 700   H HD3  . ARG A 1 48  ? -18.542 6.490   -10.318 1.00 0.00 ? 48  ARG A HD3  1  
ATOM 701   H HE   . ARG A 1 48  ? -20.550 8.051   -11.318 1.00 0.00 ? 48  ARG A HE   1  
ATOM 702   H HH11 . ARG A 1 48  ? -17.185 7.569   -12.065 1.00 0.00 ? 48  ARG A HH11 1  
ATOM 703   H HH12 . ARG A 1 48  ? -17.374 7.917   -13.752 1.00 0.00 ? 48  ARG A HH12 1  
ATOM 704   H HH21 . ARG A 1 48  ? -20.813 8.512   -13.537 1.00 0.00 ? 48  ARG A HH21 1  
ATOM 705   H HH22 . ARG A 1 48  ? -19.439 8.455   -14.588 1.00 0.00 ? 48  ARG A HH22 1  
ATOM 706   N N    . GLU A 1 49  ? -19.044 10.649  -6.125  1.00 0.00 ? 49  GLU A N    1  
ATOM 707   C CA   . GLU A 1 49  ? -19.948 11.749  -5.809  1.00 0.00 ? 49  GLU A CA   1  
ATOM 708   C C    . GLU A 1 49  ? -19.250 13.095  -5.982  1.00 0.00 ? 49  GLU A C    1  
ATOM 709   O O    . GLU A 1 49  ? -19.733 13.971  -6.700  1.00 0.00 ? 49  GLU A O    1  
ATOM 710   C CB   . GLU A 1 49  ? -20.471 11.614  -4.377  1.00 0.00 ? 49  GLU A CB   1  
ATOM 711   C CG   . GLU A 1 49  ? -21.358 12.767  -3.941  1.00 0.00 ? 49  GLU A CG   1  
ATOM 712   C CD   . GLU A 1 49  ? -21.463 12.885  -2.433  1.00 0.00 ? 49  GLU A CD   1  
ATOM 713   O OE1  . GLU A 1 49  ? -22.280 12.152  -1.837  1.00 0.00 ? 49  GLU A OE1  1  
ATOM 714   O OE2  . GLU A 1 49  ? -20.730 13.711  -1.850  1.00 0.00 ? 49  GLU A OE2  1  
ATOM 715   H H    . GLU A 1 49  ? -18.541 10.221  -5.401  1.00 0.00 ? 49  GLU A H    1  
ATOM 716   H HA   . GLU A 1 49  ? -20.782 11.699  -6.492  1.00 0.00 ? 49  GLU A HA   1  
ATOM 717   H HB2  . GLU A 1 49  ? -21.040 10.699  -4.299  1.00 0.00 ? 49  GLU A HB2  1  
ATOM 718   H HB3  . GLU A 1 49  ? -19.628 11.561  -3.703  1.00 0.00 ? 49  GLU A HB3  1  
ATOM 719   H HG2  . GLU A 1 49  ? -20.949 13.687  -4.331  1.00 0.00 ? 49  GLU A HG2  1  
ATOM 720   H HG3  . GLU A 1 49  ? -22.348 12.616  -4.346  1.00 0.00 ? 49  GLU A HG3  1  
ATOM 721   N N    . THR A 1 50  ? -18.109 13.252  -5.318  1.00 0.00 ? 50  THR A N    1  
ATOM 722   C CA   . THR A 1 50  ? -17.344 14.490  -5.397  1.00 0.00 ? 50  THR A CA   1  
ATOM 723   C C    . THR A 1 50  ? -16.380 14.468  -6.578  1.00 0.00 ? 50  THR A C    1  
ATOM 724   O O    . THR A 1 50  ? -16.161 15.486  -7.231  1.00 0.00 ? 50  THR A O    1  
ATOM 725   C CB   . THR A 1 50  ? -16.546 14.740  -4.103  1.00 0.00 ? 50  THR A CB   1  
ATOM 726   O OG1  . THR A 1 50  ? -15.695 13.622  -3.828  1.00 0.00 ? 50  THR A OG1  1  
ATOM 727   C CG2  . THR A 1 50  ? -17.482 14.973  -2.926  1.00 0.00 ? 50  THR A CG2  1  
ATOM 728   H H    . THR A 1 50  ? -17.775 12.517  -4.763  1.00 0.00 ? 50  THR A H    1  
ATOM 729   H HA   . THR A 1 50  ? -18.041 15.305  -5.528  1.00 0.00 ? 50  THR A HA   1  
ATOM 730   H HB   . THR A 1 50  ? -15.936 15.622  -4.239  1.00 0.00 ? 50  THR A HB   1  
ATOM 731   H HG1  . THR A 1 50  ? -16.233 12.843  -3.663  1.00 0.00 ? 50  THR A HG1  1  
ATOM 732   H HG21 . THR A 1 50  ? -16.908 15.286  -2.067  1.00 0.00 ? 50  THR A HG21 1  
ATOM 733   H HG22 . THR A 1 50  ? -18.005 14.057  -2.696  1.00 0.00 ? 50  THR A HG22 1  
ATOM 734   H HG23 . THR A 1 50  ? -18.196 15.741  -3.182  1.00 0.00 ? 50  THR A HG23 1  
ATOM 735   N N    . GLY A 1 51  ? -15.808 13.298  -6.847  1.00 0.00 ? 51  GLY A N    1  
ATOM 736   C CA   . GLY A 1 51  ? -14.875 13.165  -7.950  1.00 0.00 ? 51  GLY A CA   1  
ATOM 737   C C    . GLY A 1 51  ? -13.479 13.634  -7.589  1.00 0.00 ? 51  GLY A C    1  
ATOM 738   O O    . GLY A 1 51  ? -12.736 14.111  -8.446  1.00 0.00 ? 51  GLY A O    1  
ATOM 739   H H    . GLY A 1 51  ? -16.021 12.519  -6.291  1.00 0.00 ? 51  GLY A H    1  
ATOM 740   H HA2  . GLY A 1 51  ? -14.830 12.128  -8.247  1.00 0.00 ? 51  GLY A HA2  1  
ATOM 741   H HA3  . GLY A 1 51  ? -15.235 13.752  -8.783  1.00 0.00 ? 51  GLY A HA3  1  
ATOM 742   N N    . SER A 1 52  ? -13.122 13.498  -6.316  1.00 0.00 ? 52  SER A N    1  
ATOM 743   C CA   . SER A 1 52  ? -11.808 13.916  -5.842  1.00 0.00 ? 52  SER A CA   1  
ATOM 744   C C    . SER A 1 52  ? -11.083 12.759  -5.161  1.00 0.00 ? 52  SER A C    1  
ATOM 745   O O    . SER A 1 52  ? -11.712 11.842  -4.635  1.00 0.00 ? 52  SER A O    1  
ATOM 746   C CB   . SER A 1 52  ? -11.943 15.091  -4.871  1.00 0.00 ? 52  SER A CB   1  
ATOM 747   O OG   . SER A 1 52  ? -10.796 15.922  -4.913  1.00 0.00 ? 52  SER A OG   1  
ATOM 748   H H    . SER A 1 52  ? -13.759 13.110  -5.680  1.00 0.00 ? 52  SER A H    1  
ATOM 749   H HA   . SER A 1 52  ? -11.232 14.233  -6.699  1.00 0.00 ? 52  SER A HA   1  
ATOM 750   H HB2  . SER A 1 52  ? -12.808 15.678  -5.139  1.00 0.00 ? 52  SER A HB2  1  
ATOM 751   H HB3  . SER A 1 52  ? -12.062 14.712  -3.866  1.00 0.00 ? 52  SER A HB3  1  
ATOM 752   H HG   . SER A 1 52  ? -10.412 15.982  -4.036  1.00 0.00 ? 52  SER A HG   1  
ATOM 753   N N    . SER A 1 53  ? -9.755  12.811  -5.177  1.00 0.00 ? 53  SER A N    1  
ATOM 754   C CA   . SER A 1 53  ? -8.942  11.766  -4.565  1.00 0.00 ? 53  SER A CA   1  
ATOM 755   C C    . SER A 1 53  ? -9.413  11.474  -3.143  1.00 0.00 ? 53  SER A C    1  
ATOM 756   O O    . SER A 1 53  ? -9.281  12.310  -2.248  1.00 0.00 ? 53  SER A O    1  
ATOM 757   C CB   . SER A 1 53  ? -7.469  12.179  -4.551  1.00 0.00 ? 53  SER A CB   1  
ATOM 758   O OG   . SER A 1 53  ? -6.636  11.084  -4.214  1.00 0.00 ? 53  SER A OG   1  
ATOM 759   H H    . SER A 1 53  ? -9.311  13.569  -5.612  1.00 0.00 ? 53  SER A H    1  
ATOM 760   H HA   . SER A 1 53  ? -9.051  10.871  -5.158  1.00 0.00 ? 53  SER A HA   1  
ATOM 761   H HB2  . SER A 1 53  ? -7.190  12.540  -5.529  1.00 0.00 ? 53  SER A HB2  1  
ATOM 762   H HB3  . SER A 1 53  ? -7.325  12.964  -3.823  1.00 0.00 ? 53  SER A HB3  1  
ATOM 763   H HG   . SER A 1 53  ? -6.402  11.133  -3.284  1.00 0.00 ? 53  SER A HG   1  
ATOM 764   N N    . LYS A 1 54  ? -9.964  10.282  -2.943  1.00 0.00 ? 54  LYS A N    1  
ATOM 765   C CA   . LYS A 1 54  ? -10.455 9.877   -1.631  1.00 0.00 ? 54  LYS A CA   1  
ATOM 766   C C    . LYS A 1 54  ? -9.383  10.075  -0.564  1.00 0.00 ? 54  LYS A C    1  
ATOM 767   O O    . LYS A 1 54  ? -9.653  10.617  0.507   1.00 0.00 ? 54  LYS A O    1  
ATOM 768   C CB   . LYS A 1 54  ? -10.896 8.411   -1.659  1.00 0.00 ? 54  LYS A CB   1  
ATOM 769   C CG   . LYS A 1 54  ? -12.069 8.148   -2.588  1.00 0.00 ? 54  LYS A CG   1  
ATOM 770   C CD   . LYS A 1 54  ? -13.398 8.358   -1.882  1.00 0.00 ? 54  LYS A CD   1  
ATOM 771   C CE   . LYS A 1 54  ? -13.694 7.232   -0.903  1.00 0.00 ? 54  LYS A CE   1  
ATOM 772   N NZ   . LYS A 1 54  ? -14.989 7.437   -0.197  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 773   H H    . LYS A 1 54  ? -10.042 9.659   -3.696  1.00 0.00 ? 54  LYS A H    1  
ATOM 774   H HA   . LYS A 1 54  ? -11.306 10.495  -1.389  1.00 0.00 ? 54  LYS A HA   1  
ATOM 775   H HB2  . LYS A 1 54  ? -10.064 7.804   -1.983  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 776   H HB3  . LYS A 1 54  ? -11.181 8.114   -0.660  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 777   H HG2  . LYS A 1 54  ? -12.010 8.822   -3.429  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 778   H HG3  . LYS A 1 54  ? -12.016 7.127   -2.939  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 779   H HD2  . LYS A 1 54  ? -13.364 9.291   -1.339  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 780   H HD3  . LYS A 1 54  ? -14.186 8.398   -2.620  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 781   H HE2  . LYS A 1 54  ? -13.734 6.301   -1.447  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 782   H HE3  . LYS A 1 54  ? -12.898 7.188   -0.174  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 783   H HZ1  . LYS A 1 54  ? -15.286 6.554   0.266   1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 784   H HZ2  . LYS A 1 54  ? -15.723 7.725   -0.874  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 785   H HZ3  . LYS A 1 54  ? -14.888 8.178   0.526   1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 786   N N    . GLY A 1 55  ? -8.166  9.632   -0.865  1.00 0.00 ? 55  GLY A N    1  
ATOM 787   C CA   . GLY A 1 55  ? -7.072  9.772   0.079   1.00 0.00 ? 55  GLY A CA   1  
ATOM 788   C C    . GLY A 1 55  ? -6.310  8.477   0.279   1.00 0.00 ? 55  GLY A C    1  
ATOM 789   O O    . GLY A 1 55  ? -5.670  8.278   1.312   1.00 0.00 ? 55  GLY A O    1  
ATOM 790   H H    . GLY A 1 55  ? -8.009  9.208   -1.734  1.00 0.00 ? 55  GLY A H    1  
ATOM 791   H HA2  . GLY A 1 55  ? -6.390  10.526  -0.286  1.00 0.00 ? 55  GLY A HA2  1  
ATOM 792   H HA3  . GLY A 1 55  ? -7.471  10.092  1.030   1.00 0.00 ? 55  GLY A HA3  1  
ATOM 793   N N    . PHE A 1 56  ? -6.380  7.592   -0.710  1.00 0.00 ? 56  PHE A N    1  
ATOM 794   C CA   . PHE A 1 56  ? -5.694  6.307   -0.636  1.00 0.00 ? 56  PHE A CA   1  
ATOM 795   C C    . PHE A 1 56  ? -5.616  5.653   -2.012  1.00 0.00 ? 56  PHE A C    1  
ATOM 796   O O    . PHE A 1 56  ? -6.473  5.875   -2.867  1.00 0.00 ? 56  PHE A O    1  
ATOM 797   C CB   . PHE A 1 56  ? -6.412  5.377   0.343   1.00 0.00 ? 56  PHE A CB   1  
ATOM 798   C CG   . PHE A 1 56  ? -7.909  5.411   0.215   1.00 0.00 ? 56  PHE A CG   1  
ATOM 799   C CD1  . PHE A 1 56  ? -8.640  6.456   0.756   1.00 0.00 ? 56  PHE A CD1  1  
ATOM 800   C CD2  . PHE A 1 56  ? -8.583  4.398   -0.447  1.00 0.00 ? 56  PHE A CD2  1  
ATOM 801   C CE1  . PHE A 1 56  ? -10.017 6.489   0.639   1.00 0.00 ? 56  PHE A CE1  1  
ATOM 802   C CE2  . PHE A 1 56  ? -9.960  4.426   -0.567  1.00 0.00 ? 56  PHE A CE2  1  
ATOM 803   C CZ   . PHE A 1 56  ? -10.678 5.473   -0.024  1.00 0.00 ? 56  PHE A CZ   1  
ATOM 804   H H    . PHE A 1 56  ? -6.907  7.808   -1.508  1.00 0.00 ? 56  PHE A H    1  
ATOM 805   H HA   . PHE A 1 56  ? -4.692  6.488   -0.279  1.00 0.00 ? 56  PHE A HA   1  
ATOM 806   H HB2  . PHE A 1 56  ? -6.088  4.362   0.168   1.00 0.00 ? 56  PHE A HB2  1  
ATOM 807   H HB3  . PHE A 1 56  ? -6.158  5.663   1.353   1.00 0.00 ? 56  PHE A HB3  1  
ATOM 808   H HD1  . PHE A 1 56  ? -8.125  7.252   1.273   1.00 0.00 ? 56  PHE A HD1  1  
ATOM 809   H HD2  . PHE A 1 56  ? -8.023  3.577   -0.873  1.00 0.00 ? 56  PHE A HD2  1  
ATOM 810   H HE1  . PHE A 1 56  ? -10.575 7.309   1.065   1.00 0.00 ? 56  PHE A HE1  1  
ATOM 811   H HE2  . PHE A 1 56  ? -10.473 3.630   -1.086  1.00 0.00 ? 56  PHE A HE2  1  
ATOM 812   H HZ   . PHE A 1 56  ? -11.753 5.497   -0.115  1.00 0.00 ? 56  PHE A HZ   1  
ATOM 813   N N    . GLY A 1 57  ? -4.580  4.845   -2.219  1.00 0.00 ? 57  GLY A N    1  
ATOM 814   C CA   . GLY A 1 57  ? -4.408  4.171   -3.493  1.00 0.00 ? 57  GLY A CA   1  
ATOM 815   C C    . GLY A 1 57  ? -3.600  2.895   -3.369  1.00 0.00 ? 57  GLY A C    1  
ATOM 816   O O    . GLY A 1 57  ? -3.712  2.174   -2.376  1.00 0.00 ? 57  GLY A O    1  
ATOM 817   H H    . GLY A 1 57  ? -3.928  4.706   -1.501  1.00 0.00 ? 57  GLY A H    1  
ATOM 818   H HA2  . GLY A 1 57  ? -5.380  3.931   -3.895  1.00 0.00 ? 57  GLY A HA2  1  
ATOM 819   H HA3  . GLY A 1 57  ? -3.902  4.839   -4.175  1.00 0.00 ? 57  GLY A HA3  1  
ATOM 820   N N    . PHE A 1 58  ? -2.783  2.612   -4.379  1.00 0.00 ? 58  PHE A N    1  
ATOM 821   C CA   . PHE A 1 58  ? -1.955  1.412   -4.380  1.00 0.00 ? 58  PHE A CA   1  
ATOM 822   C C    . PHE A 1 58  ? -0.695  1.622   -5.215  1.00 0.00 ? 58  PHE A C    1  
ATOM 823   O O    . PHE A 1 58  ? -0.663  2.467   -6.110  1.00 0.00 ? 58  PHE A O    1  
ATOM 824   C CB   . PHE A 1 58  ? -2.747  0.220   -4.921  1.00 0.00 ? 58  PHE A CB   1  
ATOM 825   C CG   . PHE A 1 58  ? -4.053  -0.003  -4.213  1.00 0.00 ? 58  PHE A CG   1  
ATOM 826   C CD1  . PHE A 1 58  ? -5.102  0.889   -4.370  1.00 0.00 ? 58  PHE A CD1  1  
ATOM 827   C CD2  . PHE A 1 58  ? -4.231  -1.104  -3.391  1.00 0.00 ? 58  PHE A CD2  1  
ATOM 828   C CE1  . PHE A 1 58  ? -6.305  0.686   -3.719  1.00 0.00 ? 58  PHE A CE1  1  
ATOM 829   C CE2  . PHE A 1 58  ? -5.432  -1.312  -2.738  1.00 0.00 ? 58  PHE A CE2  1  
ATOM 830   C CZ   . PHE A 1 58  ? -6.470  -0.416  -2.903  1.00 0.00 ? 58  PHE A CZ   1  
ATOM 831   H H    . PHE A 1 58  ? -2.738  3.226   -5.142  1.00 0.00 ? 58  PHE A H    1  
ATOM 832   H HA   . PHE A 1 58  ? -1.667  1.209   -3.360  1.00 0.00 ? 58  PHE A HA   1  
ATOM 833   H HB2  . PHE A 1 58  ? -2.961  0.384   -5.966  1.00 0.00 ? 58  PHE A HB2  1  
ATOM 834   H HB3  . PHE A 1 58  ? -2.154  -0.675  -4.815  1.00 0.00 ? 58  PHE A HB3  1  
ATOM 835   H HD1  . PHE A 1 58  ? -4.975  1.750   -5.009  1.00 0.00 ? 58  PHE A HD1  1  
ATOM 836   H HD2  . PHE A 1 58  ? -3.419  -1.805  -3.261  1.00 0.00 ? 58  PHE A HD2  1  
ATOM 837   H HE1  . PHE A 1 58  ? -7.115  1.387   -3.850  1.00 0.00 ? 58  PHE A HE1  1  
ATOM 838   H HE2  . PHE A 1 58  ? -5.557  -2.174  -2.100  1.00 0.00 ? 58  PHE A HE2  1  
ATOM 839   H HZ   . PHE A 1 58  ? -7.408  -0.576  -2.393  1.00 0.00 ? 58  PHE A HZ   1  
ATOM 840   N N    . VAL A 1 59  ? 0.342   0.846   -4.916  1.00 0.00 ? 59  VAL A N    1  
ATOM 841   C CA   . VAL A 1 59  ? 1.604   0.945   -5.638  1.00 0.00 ? 59  VAL A CA   1  
ATOM 842   C C    . VAL A 1 59  ? 2.022   -0.408  -6.202  1.00 0.00 ? 59  VAL A C    1  
ATOM 843   O O    . VAL A 1 59  ? 2.385   -1.318  -5.456  1.00 0.00 ? 59  VAL A O    1  
ATOM 844   C CB   . VAL A 1 59  ? 2.729   1.481   -4.733  1.00 0.00 ? 59  VAL A CB   1  
ATOM 845   C CG1  . VAL A 1 59  ? 4.065   1.440   -5.459  1.00 0.00 ? 59  VAL A CG1  1  
ATOM 846   C CG2  . VAL A 1 59  ? 2.409   2.893   -4.266  1.00 0.00 ? 59  VAL A CG2  1  
ATOM 847   H H    . VAL A 1 59  ? 0.255   0.191   -4.192  1.00 0.00 ? 59  VAL A H    1  
ATOM 848   H HA   . VAL A 1 59  ? 1.468   1.638   -6.456  1.00 0.00 ? 59  VAL A HA   1  
ATOM 849   H HB   . VAL A 1 59  ? 2.797   0.844   -3.863  1.00 0.00 ? 59  VAL A HB   1  
ATOM 850   H HG11 . VAL A 1 59  ? 4.081   2.201   -6.225  1.00 0.00 ? 59  VAL A HG11 1  
ATOM 851   H HG12 . VAL A 1 59  ? 4.864   1.619   -4.754  1.00 0.00 ? 59  VAL A HG12 1  
ATOM 852   H HG13 . VAL A 1 59  ? 4.197   0.469   -5.913  1.00 0.00 ? 59  VAL A HG13 1  
ATOM 853   H HG21 . VAL A 1 59  ? 2.001   3.460   -5.090  1.00 0.00 ? 59  VAL A HG21 1  
ATOM 854   H HG22 . VAL A 1 59  ? 1.687   2.853   -3.464  1.00 0.00 ? 59  VAL A HG22 1  
ATOM 855   H HG23 . VAL A 1 59  ? 3.312   3.369   -3.914  1.00 0.00 ? 59  VAL A HG23 1  
ATOM 856   N N    . ASP A 1 60  ? 1.969   -0.534  -7.523  1.00 0.00 ? 60  ASP A N    1  
ATOM 857   C CA   . ASP A 1 60  ? 2.344   -1.777  -8.189  1.00 0.00 ? 60  ASP A CA   1  
ATOM 858   C C    . ASP A 1 60  ? 3.861   -1.931  -8.237  1.00 0.00 ? 60  ASP A C    1  
ATOM 859   O O    . ASP A 1 60  ? 4.584   -0.976  -8.521  1.00 0.00 ? 60  ASP A O    1  
ATOM 860   C CB   . ASP A 1 60  ? 1.770   -1.815  -9.606  1.00 0.00 ? 60  ASP A CB   1  
ATOM 861   C CG   . ASP A 1 60  ? 0.256   -1.897  -9.615  1.00 0.00 ? 60  ASP A CG   1  
ATOM 862   O OD1  . ASP A 1 60  ? -0.369  -1.427  -8.642  1.00 0.00 ? 60  ASP A OD1  1  
ATOM 863   O OD2  . ASP A 1 60  ? -0.303  -2.433  -10.595 1.00 0.00 ? 60  ASP A OD2  1  
ATOM 864   H H    . ASP A 1 60  ? 1.671   0.227   -8.065  1.00 0.00 ? 60  ASP A H    1  
ATOM 865   H HA   . ASP A 1 60  ? 1.929   -2.596  -7.620  1.00 0.00 ? 60  ASP A HA   1  
ATOM 866   H HB2  . ASP A 1 60  ? 2.066   -0.918  -10.132 1.00 0.00 ? 60  ASP A HB2  1  
ATOM 867   H HB3  . ASP A 1 60  ? 2.163   -2.677  -10.124 1.00 0.00 ? 60  ASP A HB3  1  
ATOM 868   N N    . PHE A 1 61  ? 4.337   -3.140  -7.957  1.00 0.00 ? 61  PHE A N    1  
ATOM 869   C CA   . PHE A 1 61  ? 5.768   -3.419  -7.966  1.00 0.00 ? 61  PHE A CA   1  
ATOM 870   C C    . PHE A 1 61  ? 6.081   -4.622  -8.851  1.00 0.00 ? 61  PHE A C    1  
ATOM 871   O O    . PHE A 1 61  ? 5.218   -5.460  -9.107  1.00 0.00 ? 61  PHE A O    1  
ATOM 872   C CB   . PHE A 1 61  ? 6.268   -3.674  -6.543  1.00 0.00 ? 61  PHE A CB   1  
ATOM 873   C CG   . PHE A 1 61  ? 6.280   -2.444  -5.682  1.00 0.00 ? 61  PHE A CG   1  
ATOM 874   C CD1  . PHE A 1 61  ? 5.159   -2.082  -4.953  1.00 0.00 ? 61  PHE A CD1  1  
ATOM 875   C CD2  . PHE A 1 61  ? 7.412   -1.649  -5.602  1.00 0.00 ? 61  PHE A CD2  1  
ATOM 876   C CE1  . PHE A 1 61  ? 5.166   -0.950  -4.161  1.00 0.00 ? 61  PHE A CE1  1  
ATOM 877   C CE2  . PHE A 1 61  ? 7.426   -0.516  -4.810  1.00 0.00 ? 61  PHE A CE2  1  
ATOM 878   C CZ   . PHE A 1 61  ? 6.301   -0.166  -4.088  1.00 0.00 ? 61  PHE A CZ   1  
ATOM 879   H H    . PHE A 1 61  ? 3.710   -3.862  -7.738  1.00 0.00 ? 61  PHE A H    1  
ATOM 880   H HA   . PHE A 1 61  ? 6.271   -2.553  -8.366  1.00 0.00 ? 61  PHE A HA   1  
ATOM 881   H HB2  . PHE A 1 61  ? 5.629   -4.404  -6.070  1.00 0.00 ? 61  PHE A HB2  1  
ATOM 882   H HB3  . PHE A 1 61  ? 7.276   -4.059  -6.588  1.00 0.00 ? 61  PHE A HB3  1  
ATOM 883   H HD1  . PHE A 1 61  ? 4.270   -2.694  -5.008  1.00 0.00 ? 61  PHE A HD1  1  
ATOM 884   H HD2  . PHE A 1 61  ? 8.292   -1.922  -6.166  1.00 0.00 ? 61  PHE A HD2  1  
ATOM 885   H HE1  . PHE A 1 61  ? 4.286   -0.679  -3.597  1.00 0.00 ? 61  PHE A HE1  1  
ATOM 886   H HE2  . PHE A 1 61  ? 8.315   0.095   -4.756  1.00 0.00 ? 61  PHE A HE2  1  
ATOM 887   H HZ   . PHE A 1 61  ? 6.310   0.719   -3.470  1.00 0.00 ? 61  PHE A HZ   1  
ATOM 888   N N    . ASN A 1 62  ? 7.324   -4.699  -9.316  1.00 0.00 ? 62  ASN A N    1  
ATOM 889   C CA   . ASN A 1 62  ? 7.753   -5.799  -10.173 1.00 0.00 ? 62  ASN A CA   1  
ATOM 890   C C    . ASN A 1 62  ? 7.549   -7.142  -9.479  1.00 0.00 ? 62  ASN A C    1  
ATOM 891   O O    . ASN A 1 62  ? 7.201   -8.135  -10.117 1.00 0.00 ? 62  ASN A O    1  
ATOM 892   C CB   . ASN A 1 62  ? 9.224   -5.629  -10.558 1.00 0.00 ? 62  ASN A CB   1  
ATOM 893   C CG   . ASN A 1 62  ? 10.067  -5.114  -9.408  1.00 0.00 ? 62  ASN A CG   1  
ATOM 894   O OD1  . ASN A 1 62  ? 10.561  -5.890  -8.590  1.00 0.00 ? 62  ASN A OD1  1  
ATOM 895   N ND2  . ASN A 1 62  ? 10.234  -3.798  -9.340  1.00 0.00 ? 62  ASN A ND2  1  
ATOM 896   H H    . ASN A 1 62  ? 7.968   -4.001  -9.077  1.00 0.00 ? 62  ASN A H    1  
ATOM 897   H HA   . ASN A 1 62  ? 7.151   -5.774  -11.069 1.00 0.00 ? 62  ASN A HA   1  
ATOM 898   H HB2  . ASN A 1 62  ? 9.621   -6.585  -10.870 1.00 0.00 ? 62  ASN A HB2  1  
ATOM 899   H HB3  . ASN A 1 62  ? 9.298   -4.929  -11.377 1.00 0.00 ? 62  ASN A HB3  1  
ATOM 900   H HD21 . ASN A 1 62  ? 9.810   -3.241  -10.026 1.00 0.00 ? 62  ASN A HD21 1  
ATOM 901   H HD22 . ASN A 1 62  ? 10.775  -3.438  -8.606  1.00 0.00 ? 62  ASN A HD22 1  
ATOM 902   N N    . SER A 1 63  ? 7.767   -7.163  -8.168  1.00 0.00 ? 63  SER A N    1  
ATOM 903   C CA   . SER A 1 63  ? 7.610   -8.384  -7.386  1.00 0.00 ? 63  SER A CA   1  
ATOM 904   C C    . SER A 1 63  ? 7.404   -8.061  -5.910  1.00 0.00 ? 63  SER A C    1  
ATOM 905   O O    . SER A 1 63  ? 7.791   -6.993  -5.437  1.00 0.00 ? 63  SER A O    1  
ATOM 906   C CB   . SER A 1 63  ? 8.834   -9.285  -7.558  1.00 0.00 ? 63  SER A CB   1  
ATOM 907   O OG   . SER A 1 63  ? 8.895   -9.819  -8.869  1.00 0.00 ? 63  SER A OG   1  
ATOM 908   H H    . SER A 1 63  ? 8.042   -6.338  -7.716  1.00 0.00 ? 63  SER A H    1  
ATOM 909   H HA   . SER A 1 63  ? 6.737   -8.903  -7.754  1.00 0.00 ? 63  SER A HA   1  
ATOM 910   H HB2  . SER A 1 63  ? 9.729   -8.710  -7.374  1.00 0.00 ? 63  SER A HB2  1  
ATOM 911   H HB3  . SER A 1 63  ? 8.779   -10.101 -6.851  1.00 0.00 ? 63  SER A HB3  1  
ATOM 912   H HG   . SER A 1 63  ? 9.462   -9.268  -9.413  1.00 0.00 ? 63  SER A HG   1  
ATOM 913   N N    . GLU A 1 64  ? 6.792   -8.994  -5.186  1.00 0.00 ? 64  GLU A N    1  
ATOM 914   C CA   . GLU A 1 64  ? 6.534   -8.808  -3.763  1.00 0.00 ? 64  GLU A CA   1  
ATOM 915   C C    . GLU A 1 64  ? 7.782   -8.303  -3.045  1.00 0.00 ? 64  GLU A C    1  
ATOM 916   O O    . GLU A 1 64  ? 7.701   -7.437  -2.174  1.00 0.00 ? 64  GLU A O    1  
ATOM 917   C CB   . GLU A 1 64  ? 6.065   -10.121 -3.132  1.00 0.00 ? 64  GLU A CB   1  
ATOM 918   C CG   . GLU A 1 64  ? 4.627   -10.479 -3.467  1.00 0.00 ? 64  GLU A CG   1  
ATOM 919   C CD   . GLU A 1 64  ? 4.385   -11.976 -3.473  1.00 0.00 ? 64  GLU A CD   1  
ATOM 920   O OE1  . GLU A 1 64  ? 4.820   -12.652 -2.518  1.00 0.00 ? 64  GLU A OE1  1  
ATOM 921   O OE2  . GLU A 1 64  ? 3.759   -12.471 -4.434  1.00 0.00 ? 64  GLU A OE2  1  
ATOM 922   H H    . GLU A 1 64  ? 6.507   -9.825  -5.620  1.00 0.00 ? 64  GLU A H    1  
ATOM 923   H HA   . GLU A 1 64  ? 5.751   -8.072  -3.661  1.00 0.00 ? 64  GLU A HA   1  
ATOM 924   H HB2  . GLU A 1 64  ? 6.704   -10.921 -3.477  1.00 0.00 ? 64  GLU A HB2  1  
ATOM 925   H HB3  . GLU A 1 64  ? 6.153   -10.041 -2.058  1.00 0.00 ? 64  GLU A HB3  1  
ATOM 926   H HG2  . GLU A 1 64  ? 3.977   -10.028 -2.733  1.00 0.00 ? 64  GLU A HG2  1  
ATOM 927   H HG3  . GLU A 1 64  ? 4.391   -10.087 -4.445  1.00 0.00 ? 64  GLU A HG3  1  
ATOM 928   N N    . GLU A 1 65  ? 8.934   -8.850  -3.418  1.00 0.00 ? 65  GLU A N    1  
ATOM 929   C CA   . GLU A 1 65  ? 10.199  -8.456  -2.808  1.00 0.00 ? 65  GLU A CA   1  
ATOM 930   C C    . GLU A 1 65  ? 10.386  -6.943  -2.874  1.00 0.00 ? 65  GLU A C    1  
ATOM 931   O O    . GLU A 1 65  ? 10.460  -6.270  -1.846  1.00 0.00 ? 65  GLU A O    1  
ATOM 932   C CB   . GLU A 1 65  ? 11.367  -9.156  -3.506  1.00 0.00 ? 65  GLU A CB   1  
ATOM 933   C CG   . GLU A 1 65  ? 11.664  -10.541 -2.954  1.00 0.00 ? 65  GLU A CG   1  
ATOM 934   C CD   . GLU A 1 65  ? 12.721  -11.274 -3.756  1.00 0.00 ? 65  GLU A CD   1  
ATOM 935   O OE1  . GLU A 1 65  ? 12.382  -11.813 -4.831  1.00 0.00 ? 65  GLU A OE1  1  
ATOM 936   O OE2  . GLU A 1 65  ? 13.887  -11.308 -3.310  1.00 0.00 ? 65  GLU A OE2  1  
ATOM 937   H H    . GLU A 1 65  ? 8.934   -9.536  -4.118  1.00 0.00 ? 65  GLU A H    1  
ATOM 938   H HA   . GLU A 1 65  ? 10.177  -8.759  -1.772  1.00 0.00 ? 65  GLU A HA   1  
ATOM 939   H HB2  . GLU A 1 65  ? 11.139  -9.251  -4.557  1.00 0.00 ? 65  GLU A HB2  1  
ATOM 940   H HB3  . GLU A 1 65  ? 12.254  -8.549  -3.393  1.00 0.00 ? 65  GLU A HB3  1  
ATOM 941   H HG2  . GLU A 1 65  ? 12.010  -10.442 -1.936  1.00 0.00 ? 65  GLU A HG2  1  
ATOM 942   H HG3  . GLU A 1 65  ? 10.754  -11.123 -2.969  1.00 0.00 ? 65  GLU A HG3  1  
ATOM 943   N N    . ASP A 1 66  ? 10.463  -6.415  -4.091  1.00 0.00 ? 66  ASP A N    1  
ATOM 944   C CA   . ASP A 1 66  ? 10.641  -4.982  -4.292  1.00 0.00 ? 66  ASP A CA   1  
ATOM 945   C C    . ASP A 1 66  ? 9.633   -4.187  -3.467  1.00 0.00 ? 66  ASP A C    1  
ATOM 946   O O    . ASP A 1 66  ? 9.975   -3.171  -2.862  1.00 0.00 ? 66  ASP A O    1  
ATOM 947   C CB   . ASP A 1 66  ? 10.494  -4.631  -5.774  1.00 0.00 ? 66  ASP A CB   1  
ATOM 948   C CG   . ASP A 1 66  ? 11.813  -4.700  -6.518  1.00 0.00 ? 66  ASP A CG   1  
ATOM 949   O OD1  . ASP A 1 66  ? 12.416  -5.793  -6.557  1.00 0.00 ? 66  ASP A OD1  1  
ATOM 950   O OD2  . ASP A 1 66  ? 12.243  -3.661  -7.062  1.00 0.00 ? 66  ASP A OD2  1  
ATOM 951   H H    . ASP A 1 66  ? 10.397  -7.003  -4.872  1.00 0.00 ? 66  ASP A H    1  
ATOM 952   H HA   . ASP A 1 66  ? 11.637  -4.722  -3.967  1.00 0.00 ? 66  ASP A HA   1  
ATOM 953   H HB2  . ASP A 1 66  ? 9.806   -5.324  -6.235  1.00 0.00 ? 66  ASP A HB2  1  
ATOM 954   H HB3  . ASP A 1 66  ? 10.103  -3.628  -5.863  1.00 0.00 ? 66  ASP A HB3  1  
ATOM 955   N N    . ALA A 1 67  ? 8.390   -4.658  -3.447  1.00 0.00 ? 67  ALA A N    1  
ATOM 956   C CA   . ALA A 1 67  ? 7.334   -3.992  -2.696  1.00 0.00 ? 67  ALA A CA   1  
ATOM 957   C C    . ALA A 1 67  ? 7.688   -3.899  -1.215  1.00 0.00 ? 67  ALA A C    1  
ATOM 958   O O    . ALA A 1 67  ? 7.671   -2.817  -0.629  1.00 0.00 ? 67  ALA A O    1  
ATOM 959   C CB   . ALA A 1 67  ? 6.013   -4.726  -2.880  1.00 0.00 ? 67  ALA A CB   1  
ATOM 960   H H    . ALA A 1 67  ? 8.180   -5.472  -3.949  1.00 0.00 ? 67  ALA A H    1  
ATOM 961   H HA   . ALA A 1 67  ? 7.221   -2.993  -3.092  1.00 0.00 ? 67  ALA A HA   1  
ATOM 962   H HB1  . ALA A 1 67  ? 5.928   -5.061  -3.903  1.00 0.00 ? 67  ALA A HB1  1  
ATOM 963   H HB2  . ALA A 1 67  ? 5.980   -5.577  -2.217  1.00 0.00 ? 67  ALA A HB2  1  
ATOM 964   H HB3  . ALA A 1 67  ? 5.196   -4.058  -2.650  1.00 0.00 ? 67  ALA A HB3  1  
ATOM 965   N N    . LYS A 1 68  ? 8.007   -5.041  -0.616  1.00 0.00 ? 68  LYS A N    1  
ATOM 966   C CA   . LYS A 1 68  ? 8.366   -5.089  0.797   1.00 0.00 ? 68  LYS A CA   1  
ATOM 967   C C    . LYS A 1 68  ? 9.507   -4.123  1.102   1.00 0.00 ? 68  LYS A C    1  
ATOM 968   O O    . LYS A 1 68  ? 9.370   -3.232  1.940   1.00 0.00 ? 68  LYS A O    1  
ATOM 969   C CB   . LYS A 1 68  ? 8.769   -6.511  1.193   1.00 0.00 ? 68  LYS A CB   1  
ATOM 970   C CG   . LYS A 1 68  ? 9.017   -6.681  2.682   1.00 0.00 ? 68  LYS A CG   1  
ATOM 971   C CD   . LYS A 1 68  ? 9.362   -8.119  3.030   1.00 0.00 ? 68  LYS A CD   1  
ATOM 972   C CE   . LYS A 1 68  ? 9.265   -8.369  4.527   1.00 0.00 ? 68  LYS A CE   1  
ATOM 973   N NZ   . LYS A 1 68  ? 7.860   -8.282  5.014   1.00 0.00 ? 68  LYS A NZ   1  
ATOM 974   H H    . LYS A 1 68  ? 8.003   -5.872  -1.136  1.00 0.00 ? 68  LYS A H    1  
ATOM 975   H HA   . LYS A 1 68  ? 7.500   -4.797  1.370   1.00 0.00 ? 68  LYS A HA   1  
ATOM 976   H HB2  . LYS A 1 68  ? 7.982   -7.190  0.901   1.00 0.00 ? 68  LYS A HB2  1  
ATOM 977   H HB3  . LYS A 1 68  ? 9.675   -6.776  0.667   1.00 0.00 ? 68  LYS A HB3  1  
ATOM 978   H HG2  . LYS A 1 68  ? 9.837   -6.043  2.976   1.00 0.00 ? 68  LYS A HG2  1  
ATOM 979   H HG3  . LYS A 1 68  ? 8.125   -6.394  3.221   1.00 0.00 ? 68  LYS A HG3  1  
ATOM 980   H HD2  . LYS A 1 68  ? 8.676   -8.778  2.521   1.00 0.00 ? 68  LYS A HD2  1  
ATOM 981   H HD3  . LYS A 1 68  ? 10.372  -8.326  2.705   1.00 0.00 ? 68  LYS A HD3  1  
ATOM 982   H HE2  . LYS A 1 68  ? 9.650   -9.354  4.741   1.00 0.00 ? 68  LYS A HE2  1  
ATOM 983   H HE3  . LYS A 1 68  ? 9.861   -7.630  5.042   1.00 0.00 ? 68  LYS A HE3  1  
ATOM 984   H HZ1  . LYS A 1 68  ? 7.499   -7.314  4.893   1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 985   H HZ2  . LYS A 1 68  ? 7.815   -8.533  6.022   1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 986   H HZ3  . LYS A 1 68  ? 7.255   -8.936  4.477   1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 987   N N    . ALA A 1 69  ? 10.630  -4.305  0.416   1.00 0.00 ? 69  ALA A N    1  
ATOM 988   C CA   . ALA A 1 69  ? 11.792  -3.447  0.611   1.00 0.00 ? 69  ALA A CA   1  
ATOM 989   C C    . ALA A 1 69  ? 11.399  -1.974  0.577   1.00 0.00 ? 69  ALA A C    1  
ATOM 990   O O    . ALA A 1 69  ? 12.042  -1.136  1.208   1.00 0.00 ? 69  ALA A O    1  
ATOM 991   C CB   . ALA A 1 69  ? 12.847  -3.738  -0.446  1.00 0.00 ? 69  ALA A CB   1  
ATOM 992   H H    . ALA A 1 69  ? 10.678  -5.033  -0.239  1.00 0.00 ? 69  ALA A H    1  
ATOM 993   H HA   . ALA A 1 69  ? 12.216  -3.674  1.579   1.00 0.00 ? 69  ALA A HA   1  
ATOM 994   H HB1  . ALA A 1 69  ? 13.498  -4.526  -0.097  1.00 0.00 ? 69  ALA A HB1  1  
ATOM 995   H HB2  . ALA A 1 69  ? 12.363  -4.048  -1.361  1.00 0.00 ? 69  ALA A HB2  1  
ATOM 996   H HB3  . ALA A 1 69  ? 13.427  -2.846  -0.630  1.00 0.00 ? 69  ALA A HB3  1  
ATOM 997   N N    . ALA A 1 70  ? 10.339  -1.666  -0.163  1.00 0.00 ? 70  ALA A N    1  
ATOM 998   C CA   . ALA A 1 70  ? 9.860   -0.294  -0.277  1.00 0.00 ? 70  ALA A CA   1  
ATOM 999   C C    . ALA A 1 70  ? 8.935   0.062   0.881   1.00 0.00 ? 70  ALA A C    1  
ATOM 1000  O O    . ALA A 1 70  ? 8.830   1.226   1.271   1.00 0.00 ? 70  ALA A O    1  
ATOM 1001  C CB   . ALA A 1 70  ? 9.146   -0.094  -1.606  1.00 0.00 ? 70  ALA A CB   1  
ATOM 1002  H H    . ALA A 1 70  ? 9.868   -2.379  -0.643  1.00 0.00 ? 70  ALA A H    1  
ATOM 1003  H HA   . ALA A 1 70  ? 10.718  0.362   -0.255  1.00 0.00 ? 70  ALA A HA   1  
ATOM 1004  H HB1  . ALA A 1 70  ? 8.156   0.301   -1.426  1.00 0.00 ? 70  ALA A HB1  1  
ATOM 1005  H HB2  . ALA A 1 70  ? 9.706   0.601   -2.214  1.00 0.00 ? 70  ALA A HB2  1  
ATOM 1006  H HB3  . ALA A 1 70  ? 9.069   -1.040  -2.119  1.00 0.00 ? 70  ALA A HB3  1  
ATOM 1007  N N    . LYS A 1 71  ? 8.264   -0.946  1.428   1.00 0.00 ? 71  LYS A N    1  
ATOM 1008  C CA   . LYS A 1 71  ? 7.347   -0.739  2.543   1.00 0.00 ? 71  LYS A CA   1  
ATOM 1009  C C    . LYS A 1 71  ? 8.101   -0.298  3.793   1.00 0.00 ? 71  LYS A C    1  
ATOM 1010  O O    . LYS A 1 71  ? 7.704   0.653   4.465   1.00 0.00 ? 71  LYS A O    1  
ATOM 1011  C CB   . LYS A 1 71  ? 6.566   -2.023  2.832   1.00 0.00 ? 71  LYS A CB   1  
ATOM 1012  C CG   . LYS A 1 71  ? 5.820   -1.997  4.155   1.00 0.00 ? 71  LYS A CG   1  
ATOM 1013  C CD   . LYS A 1 71  ? 4.579   -2.872  4.113   1.00 0.00 ? 71  LYS A CD   1  
ATOM 1014  C CE   . LYS A 1 71  ? 4.931   -4.345  4.255   1.00 0.00 ? 71  LYS A CE   1  
ATOM 1015  N NZ   . LYS A 1 71  ? 5.377   -4.679  5.636   1.00 0.00 ? 71  LYS A NZ   1  
ATOM 1016  H H    . LYS A 1 71  ? 8.389   -1.851  1.074   1.00 0.00 ? 71  LYS A H    1  
ATOM 1017  H HA   . LYS A 1 71  ? 6.653   0.039   2.263   1.00 0.00 ? 71  LYS A HA   1  
ATOM 1018  H HB2  . LYS A 1 71  ? 5.848   -2.179  2.041   1.00 0.00 ? 71  LYS A HB2  1  
ATOM 1019  H HB3  . LYS A 1 71  ? 7.256   -2.854  2.849   1.00 0.00 ? 71  LYS A HB3  1  
ATOM 1020  H HG2  . LYS A 1 71  ? 6.475   -2.356  4.935   1.00 0.00 ? 71  LYS A HG2  1  
ATOM 1021  H HG3  . LYS A 1 71  ? 5.525   -0.980  4.371   1.00 0.00 ? 71  LYS A HG3  1  
ATOM 1022  H HD2  . LYS A 1 71  ? 3.923   -2.592  4.924   1.00 0.00 ? 71  LYS A HD2  1  
ATOM 1023  H HD3  . LYS A 1 71  ? 4.074   -2.721  3.170   1.00 0.00 ? 71  LYS A HD3  1  
ATOM 1024  H HE2  . LYS A 1 71  ? 4.060   -4.935  4.015   1.00 0.00 ? 71  LYS A HE2  1  
ATOM 1025  H HE3  . LYS A 1 71  ? 5.726   -4.580  3.562   1.00 0.00 ? 71  LYS A HE3  1  
ATOM 1026  H HZ1  . LYS A 1 71  ? 4.990   -5.601  5.923   1.00 0.00 ? 71  LYS A HZ1  1  
ATOM 1027  H HZ2  . LYS A 1 71  ? 5.045   -3.954  6.303   1.00 0.00 ? 71  LYS A HZ2  1  
ATOM 1028  H HZ3  . LYS A 1 71  ? 6.415   -4.723  5.675   1.00 0.00 ? 71  LYS A HZ3  1  
ATOM 1029  N N    . GLU A 1 72  ? 9.192   -0.995  4.098   1.00 0.00 ? 72  GLU A N    1  
ATOM 1030  C CA   . GLU A 1 72  ? 10.001  -0.673  5.267   1.00 0.00 ? 72  GLU A CA   1  
ATOM 1031  C C    . GLU A 1 72  ? 10.542  0.751   5.180   1.00 0.00 ? 72  GLU A C    1  
ATOM 1032  O O    . GLU A 1 72  ? 10.638  1.453   6.186   1.00 0.00 ? 72  GLU A O    1  
ATOM 1033  C CB   . GLU A 1 72  ? 11.160  -1.663  5.401   1.00 0.00 ? 72  GLU A CB   1  
ATOM 1034  C CG   . GLU A 1 72  ? 10.719  -3.117  5.424   1.00 0.00 ? 72  GLU A CG   1  
ATOM 1035  C CD   . GLU A 1 72  ? 11.655  -3.998  6.230   1.00 0.00 ? 72  GLU A CD   1  
ATOM 1036  O OE1  . GLU A 1 72  ? 12.861  -4.030  5.908   1.00 0.00 ? 72  GLU A OE1  1  
ATOM 1037  O OE2  . GLU A 1 72  ? 11.181  -4.654  7.180   1.00 0.00 ? 72  GLU A OE2  1  
ATOM 1038  H H    . GLU A 1 72  ? 9.458   -1.743  3.523   1.00 0.00 ? 72  GLU A H    1  
ATOM 1039  H HA   . GLU A 1 72  ? 9.370   -0.753  6.139   1.00 0.00 ? 72  GLU A HA   1  
ATOM 1040  H HB2  . GLU A 1 72  ? 11.833  -1.526  4.568   1.00 0.00 ? 72  GLU A HB2  1  
ATOM 1041  H HB3  . GLU A 1 72  ? 11.691  -1.456  6.318   1.00 0.00 ? 72  GLU A HB3  1  
ATOM 1042  H HG2  . GLU A 1 72  ? 9.733   -3.174  5.859   1.00 0.00 ? 72  GLU A HG2  1  
ATOM 1043  H HG3  . GLU A 1 72  ? 10.686  -3.486  4.410   1.00 0.00 ? 72  GLU A HG3  1  
ATOM 1044  N N    . ALA A 1 73  ? 10.894  1.170   3.969   1.00 0.00 ? 73  ALA A N    1  
ATOM 1045  C CA   . ALA A 1 73  ? 11.424  2.510   3.749   1.00 0.00 ? 73  ALA A CA   1  
ATOM 1046  C C    . ALA A 1 73  ? 10.379  3.573   4.072   1.00 0.00 ? 73  ALA A C    1  
ATOM 1047  O O    . ALA A 1 73  ? 10.638  4.497   4.842   1.00 0.00 ? 73  ALA A O    1  
ATOM 1048  C CB   . ALA A 1 73  ? 11.904  2.659   2.313   1.00 0.00 ? 73  ALA A CB   1  
ATOM 1049  H H    . ALA A 1 73  ? 10.794  0.565   3.205   1.00 0.00 ? 73  ALA A H    1  
ATOM 1050  H HA   . ALA A 1 73  ? 12.274  2.645   4.402   1.00 0.00 ? 73  ALA A HA   1  
ATOM 1051  H HB1  . ALA A 1 73  ? 12.951  2.925   2.310   1.00 0.00 ? 73  ALA A HB1  1  
ATOM 1052  H HB2  . ALA A 1 73  ? 11.768  1.724   1.790   1.00 0.00 ? 73  ALA A HB2  1  
ATOM 1053  H HB3  . ALA A 1 73  ? 11.334  3.433   1.821   1.00 0.00 ? 73  ALA A HB3  1  
ATOM 1054  N N    . MET A 1 74  ? 9.199   3.436   3.478   1.00 0.00 ? 74  MET A N    1  
ATOM 1055  C CA   . MET A 1 74  ? 8.115   4.386   3.703   1.00 0.00 ? 74  MET A CA   1  
ATOM 1056  C C    . MET A 1 74  ? 7.284   3.983   4.918   1.00 0.00 ? 74  MET A C    1  
ATOM 1057  O O    . MET A 1 74  ? 6.248   4.586   5.199   1.00 0.00 ? 74  MET A O    1  
ATOM 1058  C CB   . MET A 1 74  ? 7.220   4.475   2.465   1.00 0.00 ? 74  MET A CB   1  
ATOM 1059  C CG   . MET A 1 74  ? 7.700   5.491   1.441   1.00 0.00 ? 74  MET A CG   1  
ATOM 1060  S SD   . MET A 1 74  ? 7.493   7.192   2.001   1.00 0.00 ? 74  MET A SD   1  
ATOM 1061  C CE   . MET A 1 74  ? 5.707   7.324   2.034   1.00 0.00 ? 74  MET A CE   1  
ATOM 1062  H H    . MET A 1 74  ? 9.052   2.679   2.873   1.00 0.00 ? 74  MET A H    1  
ATOM 1063  H HA   . MET A 1 74  ? 8.556   5.353   3.888   1.00 0.00 ? 74  MET A HA   1  
ATOM 1064  H HB2  . MET A 1 74  ? 7.185   3.506   1.990   1.00 0.00 ? 74  MET A HB2  1  
ATOM 1065  H HB3  . MET A 1 74  ? 6.224   4.752   2.775   1.00 0.00 ? 74  MET A HB3  1  
ATOM 1066  H HG2  . MET A 1 74  ? 8.747   5.317   1.244   1.00 0.00 ? 74  MET A HG2  1  
ATOM 1067  H HG3  . MET A 1 74  ? 7.137   5.355   0.530   1.00 0.00 ? 74  MET A HG3  1  
ATOM 1068  H HE1  . MET A 1 74  ? 5.424   8.272   2.464   1.00 0.00 ? 74  MET A HE1  1  
ATOM 1069  H HE2  . MET A 1 74  ? 5.323   7.256   1.027   1.00 0.00 ? 74  MET A HE2  1  
ATOM 1070  H HE3  . MET A 1 74  ? 5.299   6.521   2.631   1.00 0.00 ? 74  MET A HE3  1  
ATOM 1071  N N    . GLU A 1 75  ? 7.745   2.962   5.633   1.00 0.00 ? 75  GLU A N    1  
ATOM 1072  C CA   . GLU A 1 75  ? 7.042   2.480   6.816   1.00 0.00 ? 75  GLU A CA   1  
ATOM 1073  C C    . GLU A 1 75  ? 6.485   3.644   7.630   1.00 0.00 ? 75  GLU A C    1  
ATOM 1074  O O    . GLU A 1 75  ? 5.292   3.689   7.933   1.00 0.00 ? 75  GLU A O    1  
ATOM 1075  C CB   . GLU A 1 75  ? 7.978   1.637   7.685   1.00 0.00 ? 75  GLU A CB   1  
ATOM 1076  C CG   . GLU A 1 75  ? 9.180   2.407   8.207   1.00 0.00 ? 75  GLU A CG   1  
ATOM 1077  C CD   . GLU A 1 75  ? 10.279  1.495   8.718   1.00 0.00 ? 75  GLU A CD   1  
ATOM 1078  O OE1  . GLU A 1 75  ? 9.955   0.483   9.373   1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1079  O OE2  . GLU A 1 75  ? 11.464  1.795   8.461   1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1080  H H    . GLU A 1 75  ? 8.576   2.522   5.358   1.00 0.00 ? 75  GLU A H    1  
ATOM 1081  H HA   . GLU A 1 75  ? 6.221   1.862   6.485   1.00 0.00 ? 75  GLU A HA   1  
ATOM 1082  H HB2  . GLU A 1 75  ? 7.423   1.260   8.530   1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1083  H HB3  . GLU A 1 75  ? 8.338   0.803   7.101   1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1084  H HG2  . GLU A 1 75  ? 9.579   3.013   7.407   1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1085  H HG3  . GLU A 1 75  ? 8.858   3.046   9.016   1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1086  N N    . ASP A 1 76  ? 7.356   4.583   7.981   1.00 0.00 ? 76  ASP A N    1  
ATOM 1087  C CA   . ASP A 1 76  ? 6.953   5.748   8.760   1.00 0.00 ? 76  ASP A CA   1  
ATOM 1088  C C    . ASP A 1 76  ? 7.032   7.018   7.918   1.00 0.00 ? 76  ASP A C    1  
ATOM 1089  O O    . ASP A 1 76  ? 7.210   8.115   8.446   1.00 0.00 ? 76  ASP A O    1  
ATOM 1090  C CB   . ASP A 1 76  ? 7.834   5.888   10.002  1.00 0.00 ? 76  ASP A CB   1  
ATOM 1091  C CG   . ASP A 1 76  ? 7.440   7.074   10.860  1.00 0.00 ? 76  ASP A CG   1  
ATOM 1092  O OD1  . ASP A 1 76  ? 6.320   7.062   11.410  1.00 0.00 ? 76  ASP A OD1  1  
ATOM 1093  O OD2  . ASP A 1 76  ? 8.253   8.015   10.981  1.00 0.00 ? 76  ASP A OD2  1  
ATOM 1094  H H    . ASP A 1 76  ? 8.294   4.490   7.710   1.00 0.00 ? 76  ASP A H    1  
ATOM 1095  H HA   . ASP A 1 76  ? 5.930   5.601   9.071   1.00 0.00 ? 76  ASP A HA   1  
ATOM 1096  H HB2  . ASP A 1 76  ? 7.749   4.992   10.599  1.00 0.00 ? 76  ASP A HB2  1  
ATOM 1097  H HB3  . ASP A 1 76  ? 8.862   6.015   9.694   1.00 0.00 ? 76  ASP A HB3  1  
ATOM 1098  N N    . GLY A 1 77  ? 6.901   6.861   6.604   1.00 0.00 ? 77  GLY A N    1  
ATOM 1099  C CA   . GLY A 1 77  ? 6.962   8.003   5.711   1.00 0.00 ? 77  GLY A CA   1  
ATOM 1100  C C    . GLY A 1 77  ? 5.630   8.717   5.592   1.00 0.00 ? 77  GLY A C    1  
ATOM 1101  O O    . GLY A 1 77  ? 4.580   8.132   5.850   1.00 0.00 ? 77  GLY A O    1  
ATOM 1102  H H    . GLY A 1 77  ? 6.761   5.962   6.239   1.00 0.00 ? 77  GLY A H    1  
ATOM 1103  H HA2  . GLY A 1 77  ? 7.700   8.698   6.082   1.00 0.00 ? 77  GLY A HA2  1  
ATOM 1104  H HA3  . GLY A 1 77  ? 7.263   7.663   4.731   1.00 0.00 ? 77  GLY A HA3  1  
ATOM 1105  N N    . GLU A 1 78  ? 5.675   9.987   5.200   1.00 0.00 ? 78  GLU A N    1  
ATOM 1106  C CA   . GLU A 1 78  ? 4.462   10.783  5.050   1.00 0.00 ? 78  GLU A CA   1  
ATOM 1107  C C    . GLU A 1 78  ? 4.442   11.495  3.701   1.00 0.00 ? 78  GLU A C    1  
ATOM 1108  O O    . GLU A 1 78  ? 5.289   12.344  3.423   1.00 0.00 ? 78  GLU A O    1  
ATOM 1109  C CB   . GLU A 1 78  ? 4.354   11.807  6.182   1.00 0.00 ? 78  GLU A CB   1  
ATOM 1110  C CG   . GLU A 1 78  ? 5.580   12.694  6.319   1.00 0.00 ? 78  GLU A CG   1  
ATOM 1111  C CD   . GLU A 1 78  ? 5.567   13.515  7.594   1.00 0.00 ? 78  GLU A CD   1  
ATOM 1112  O OE1  . GLU A 1 78  ? 5.993   12.990  8.643   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1113  O OE2  . GLU A 1 78  ? 5.130   14.684  7.541   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1114  H H    . GLU A 1 78  ? 6.543   10.398  5.009   1.00 0.00 ? 78  GLU A H    1  
ATOM 1115  H HA   . GLU A 1 78  ? 3.617   10.112  5.103   1.00 0.00 ? 78  GLU A HA   1  
ATOM 1116  H HB2  . GLU A 1 78  ? 3.497   12.438  6.000   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1117  H HB3  . GLU A 1 78  ? 4.211   11.281  7.114   1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1118  H HG2  . GLU A 1 78  ? 6.462   12.071  6.320   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1119  H HG3  . GLU A 1 78  ? 5.618   13.367  5.475   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1120  N N    . ILE A 1 79  ? 3.470   11.142  2.867   1.00 0.00 ? 79  ILE A N    1  
ATOM 1121  C CA   . ILE A 1 79  ? 3.339   11.747  1.547   1.00 0.00 ? 79  ILE A CA   1  
ATOM 1122  C C    . ILE A 1 79  ? 2.605   13.082  1.625   1.00 0.00 ? 79  ILE A C    1  
ATOM 1123  O O    . ILE A 1 79  ? 1.615   13.216  2.344   1.00 0.00 ? 79  ILE A O    1  
ATOM 1124  C CB   . ILE A 1 79  ? 2.590   10.818  0.574   1.00 0.00 ? 79  ILE A CB   1  
ATOM 1125  C CG1  . ILE A 1 79  ? 3.187   9.410   0.616   1.00 0.00 ? 79  ILE A CG1  1  
ATOM 1126  C CG2  . ILE A 1 79  ? 2.642   11.379  -0.840  1.00 0.00 ? 79  ILE A CG2  1  
ATOM 1127  C CD1  . ILE A 1 79  ? 2.463   8.420   -0.269  1.00 0.00 ? 79  ILE A CD1  1  
ATOM 1128  H H    . ILE A 1 79  ? 2.825   10.459  3.146   1.00 0.00 ? 79  ILE A H    1  
ATOM 1129  H HA   . ILE A 1 79  ? 4.333   11.917  1.159   1.00 0.00 ? 79  ILE A HA   1  
ATOM 1130  H HB   . ILE A 1 79  ? 1.556   10.773  0.879   1.00 0.00 ? 79  ILE A HB   1  
ATOM 1131  H HG12 . ILE A 1 79  ? 4.215   9.452   0.294   1.00 0.00 ? 79  ILE A HG12 1  
ATOM 1132  H HG13 . ILE A 1 79  ? 3.146   9.041   1.631   1.00 0.00 ? 79  ILE A HG13 1  
ATOM 1133  H HG21 . ILE A 1 79  ? 1.669   11.758  -1.113  1.00 0.00 ? 79  ILE A HG21 1  
ATOM 1134  H HG22 . ILE A 1 79  ? 3.364   12.181  -0.882  1.00 0.00 ? 79  ILE A HG22 1  
ATOM 1135  H HG23 . ILE A 1 79  ? 2.931   10.598  -1.527  1.00 0.00 ? 79  ILE A HG23 1  
ATOM 1136  H HD11 . ILE A 1 79  ? 3.151   8.020   -0.999  1.00 0.00 ? 79  ILE A HD11 1  
ATOM 1137  H HD12 . ILE A 1 79  ? 2.070   7.616   0.335   1.00 0.00 ? 79  ILE A HD12 1  
ATOM 1138  H HD13 . ILE A 1 79  ? 1.650   8.919   -0.777  1.00 0.00 ? 79  ILE A HD13 1  
ATOM 1139  N N    . ASP A 1 80  ? 3.097   14.065  0.879   1.00 0.00 ? 80  ASP A N    1  
ATOM 1140  C CA   . ASP A 1 80  ? 2.487   15.389  0.861   1.00 0.00 ? 80  ASP A CA   1  
ATOM 1141  C C    . ASP A 1 80  ? 2.271   15.908  2.279   1.00 0.00 ? 80  ASP A C    1  
ATOM 1142  O O    . ASP A 1 80  ? 1.206   16.432  2.604   1.00 0.00 ? 80  ASP A O    1  
ATOM 1143  C CB   . ASP A 1 80  ? 1.155   15.350  0.111   1.00 0.00 ? 80  ASP A CB   1  
ATOM 1144  C CG   . ASP A 1 80  ? 1.326   15.542  -1.383  1.00 0.00 ? 80  ASP A CG   1  
ATOM 1145  O OD1  . ASP A 1 80  ? 1.431   16.706  -1.823  1.00 0.00 ? 80  ASP A OD1  1  
ATOM 1146  O OD2  . ASP A 1 80  ? 1.354   14.529  -2.113  1.00 0.00 ? 80  ASP A OD2  1  
ATOM 1147  H H    . ASP A 1 80  ? 3.889   13.896  0.327   1.00 0.00 ? 80  ASP A H    1  
ATOM 1148  H HA   . ASP A 1 80  ? 3.160   16.058  0.346   1.00 0.00 ? 80  ASP A HA   1  
ATOM 1149  H HB2  . ASP A 1 80  ? 0.682   14.393  0.279   1.00 0.00 ? 80  ASP A HB2  1  
ATOM 1150  H HB3  . ASP A 1 80  ? 0.514   16.135  0.486   1.00 0.00 ? 80  ASP A HB3  1  
ATOM 1151  N N    . GLY A 1 81  ? 3.289   15.756  3.121   1.00 0.00 ? 81  GLY A N    1  
ATOM 1152  C CA   . GLY A 1 81  ? 3.189   16.213  4.495   1.00 0.00 ? 81  GLY A CA   1  
ATOM 1153  C C    . GLY A 1 81  ? 2.082   15.515  5.260   1.00 0.00 ? 81  GLY A C    1  
ATOM 1154  O O    . GLY A 1 81  ? 1.519   16.074  6.199   1.00 0.00 ? 81  GLY A O    1  
ATOM 1155  H H    . GLY A 1 81  ? 4.114   15.330  2.807   1.00 0.00 ? 81  GLY A H    1  
ATOM 1156  H HA2  . GLY A 1 81  ? 4.129   16.027  4.994   1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1157  H HA3  . GLY A 1 81  ? 2.997   17.275  4.496   1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1158  N N    . ASN A 1 82  ? 1.767   14.289  4.854   1.00 0.00 ? 82  ASN A N    1  
ATOM 1159  C CA   . ASN A 1 82  ? 0.717   13.514  5.506   1.00 0.00 ? 82  ASN A CA   1  
ATOM 1160  C C    . ASN A 1 82  ? 1.179   12.083  5.766   1.00 0.00 ? 82  ASN A C    1  
ATOM 1161  O O    . ASN A 1 82  ? 1.723   11.424  4.880   1.00 0.00 ? 82  ASN A O    1  
ATOM 1162  C CB   . ASN A 1 82  ? -0.548  13.506  4.647   1.00 0.00 ? 82  ASN A CB   1  
ATOM 1163  C CG   . ASN A 1 82  ? -1.388  14.753  4.843   1.00 0.00 ? 82  ASN A CG   1  
ATOM 1164  O OD1  . ASN A 1 82  ? -1.116  15.565  5.726   1.00 0.00 ? 82  ASN A OD1  1  
ATOM 1165  N ND2  . ASN A 1 82  ? -2.416  14.909  4.016   1.00 0.00 ? 82  ASN A ND2  1  
ATOM 1166  H H    . ASN A 1 82  ? 2.252   13.895  4.099   1.00 0.00 ? 82  ASN A H    1  
ATOM 1167  H HA   . ASN A 1 82  ? 0.496   13.986  6.452   1.00 0.00 ? 82  ASN A HA   1  
ATOM 1168  H HB2  . ASN A 1 82  ? -0.268  13.444  3.605   1.00 0.00 ? 82  ASN A HB2  1  
ATOM 1169  H HB3  . ASN A 1 82  ? -1.147  12.645  4.906   1.00 0.00 ? 82  ASN A HB3  1  
ATOM 1170  H HD21 . ASN A 1 82  ? -2.573  14.221  3.336   1.00 0.00 ? 82  ASN A HD21 1  
ATOM 1171  H HD22 . ASN A 1 82  ? -2.976  15.707  4.120   1.00 0.00 ? 82  ASN A HD22 1  
ATOM 1172  N N    . LYS A 1 83  ? 0.957   11.608  6.987   1.00 0.00 ? 83  LYS A N    1  
ATOM 1173  C CA   . LYS A 1 83  ? 1.347   10.255  7.364   1.00 0.00 ? 83  LYS A CA   1  
ATOM 1174  C C    . LYS A 1 83  ? 0.542   9.219   6.586   1.00 0.00 ? 83  LYS A C    1  
ATOM 1175  O O    . LYS A 1 83  ? -0.683  9.302   6.507   1.00 0.00 ? 83  LYS A O    1  
ATOM 1176  C CB   . LYS A 1 83  ? 1.150   10.045  8.867   1.00 0.00 ? 83  LYS A CB   1  
ATOM 1177  C CG   . LYS A 1 83  ? -0.306  10.075  9.299   1.00 0.00 ? 83  LYS A CG   1  
ATOM 1178  C CD   . LYS A 1 83  ? -0.443  9.950   10.807  1.00 0.00 ? 83  LYS A CD   1  
ATOM 1179  C CE   . LYS A 1 83  ? -0.150  8.534   11.278  1.00 0.00 ? 83  LYS A CE   1  
ATOM 1180  N NZ   . LYS A 1 83  ? -1.326  7.637   11.106  1.00 0.00 ? 83  LYS A NZ   1  
ATOM 1181  H H    . LYS A 1 83  ? 0.519   12.182  7.650   1.00 0.00 ? 83  LYS A H    1  
ATOM 1182  H HA   . LYS A 1 83  ? 2.393   10.133  7.127   1.00 0.00 ? 83  LYS A HA   1  
ATOM 1183  H HB2  . LYS A 1 83  ? 1.566   9.088   9.143   1.00 0.00 ? 83  LYS A HB2  1  
ATOM 1184  H HB3  . LYS A 1 83  ? 1.677   10.824  9.399   1.00 0.00 ? 83  LYS A HB3  1  
ATOM 1185  H HG2  . LYS A 1 83  ? -0.747  11.009  8.985   1.00 0.00 ? 83  LYS A HG2  1  
ATOM 1186  H HG3  . LYS A 1 83  ? -0.828  9.252   8.830   1.00 0.00 ? 83  LYS A HG3  1  
ATOM 1187  H HD2  . LYS A 1 83  ? 0.253   10.626  11.281  1.00 0.00 ? 83  LYS A HD2  1  
ATOM 1188  H HD3  . LYS A 1 83  ? -1.453  10.212  11.091  1.00 0.00 ? 83  LYS A HD3  1  
ATOM 1189  H HE2  . LYS A 1 83  ? 0.678   8.142   10.706  1.00 0.00 ? 83  LYS A HE2  1  
ATOM 1190  H HE3  . LYS A 1 83  ? 0.119   8.565   12.324  1.00 0.00 ? 83  LYS A HE3  1  
ATOM 1191  H HZ1  . LYS A 1 83  ? -1.300  7.190   10.167  1.00 0.00 ? 83  LYS A HZ1  1  
ATOM 1192  H HZ2  . LYS A 1 83  ? -2.207  8.182   11.193  1.00 0.00 ? 83  LYS A HZ2  1  
ATOM 1193  H HZ3  . LYS A 1 83  ? -1.317  6.892   11.832  1.00 0.00 ? 83  LYS A HZ3  1  
ATOM 1194  N N    . VAL A 1 84  ? 1.239   8.243   6.013   1.00 0.00 ? 84  VAL A N    1  
ATOM 1195  C CA   . VAL A 1 84  ? 0.589   7.189   5.243   1.00 0.00 ? 84  VAL A CA   1  
ATOM 1196  C C    . VAL A 1 84  ? 0.890   5.814   5.830   1.00 0.00 ? 84  VAL A C    1  
ATOM 1197  O O    . VAL A 1 84  ? 1.974   5.578   6.364   1.00 0.00 ? 84  VAL A O    1  
ATOM 1198  C CB   . VAL A 1 84  ? 1.034   7.215   3.769   1.00 0.00 ? 84  VAL A CB   1  
ATOM 1199  C CG1  . VAL A 1 84  ? 0.700   8.556   3.134   1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1200  C CG2  . VAL A 1 84  ? 2.522   6.919   3.657   1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1201  H H    . VAL A 1 84  ? 2.214   8.230   6.112   1.00 0.00 ? 84  VAL A H    1  
ATOM 1202  H HA   . VAL A 1 84  ? -0.477  7.359   5.279   1.00 0.00 ? 84  VAL A HA   1  
ATOM 1203  H HB   . VAL A 1 84  ? 0.494   6.446   3.237   1.00 0.00 ? 84  VAL A HB   1  
ATOM 1204  H HG11 . VAL A 1 84  ? 0.957   9.352   3.818   1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1205  H HG12 . VAL A 1 84  ? 1.261   8.671   2.218   1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1206  H HG13 . VAL A 1 84  ? -0.357  8.598   2.917   1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1207  H HG21 . VAL A 1 84  ? 2.746   6.001   4.180   1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1208  H HG22 . VAL A 1 84  ? 2.791   6.814   2.615   1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1209  H HG23 . VAL A 1 84  ? 3.085   7.729   4.094   1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1210  N N    . THR A 1 85  ? -0.077  4.908   5.726   1.00 0.00 ? 85  THR A N    1  
ATOM 1211  C CA   . THR A 1 85  ? 0.084   3.556   6.246   1.00 0.00 ? 85  THR A CA   1  
ATOM 1212  C C    . THR A 1 85  ? 0.139   2.535   5.115   1.00 0.00 ? 85  THR A C    1  
ATOM 1213  O O    . THR A 1 85  ? -0.810  2.398   4.342   1.00 0.00 ? 85  THR A O    1  
ATOM 1214  C CB   . THR A 1 85  ? -1.063  3.183   7.204   1.00 0.00 ? 85  THR A CB   1  
ATOM 1215  O OG1  . THR A 1 85  ? -0.994  3.987   8.387   1.00 0.00 ? 85  THR A OG1  1  
ATOM 1216  C CG2  . THR A 1 85  ? -0.995  1.711   7.581   1.00 0.00 ? 85  THR A CG2  1  
ATOM 1217  H H    . THR A 1 85  ? -0.918  5.156   5.289   1.00 0.00 ? 85  THR A H    1  
ATOM 1218  H HA   . THR A 1 85  ? 1.012   3.519   6.797   1.00 0.00 ? 85  THR A HA   1  
ATOM 1219  H HB   . THR A 1 85  ? -2.003  3.369   6.706   1.00 0.00 ? 85  THR A HB   1  
ATOM 1220  H HG1  . THR A 1 85  ? -1.695  3.729   8.991   1.00 0.00 ? 85  THR A HG1  1  
ATOM 1221  H HG21 . THR A 1 85  ? -1.761  1.490   8.310   1.00 0.00 ? 85  THR A HG21 1  
ATOM 1222  H HG22 . THR A 1 85  ? -0.025  1.490   8.001   1.00 0.00 ? 85  THR A HG22 1  
ATOM 1223  H HG23 . THR A 1 85  ? -1.153  1.106   6.701   1.00 0.00 ? 85  THR A HG23 1  
ATOM 1224  N N    . LEU A 1 86  ? 1.254   1.819   5.025   1.00 0.00 ? 86  LEU A N    1  
ATOM 1225  C CA   . LEU A 1 86  ? 1.432   0.808   3.988   1.00 0.00 ? 86  LEU A CA   1  
ATOM 1226  C C    . LEU A 1 86  ? 1.031   -0.572  4.498   1.00 0.00 ? 86  LEU A C    1  
ATOM 1227  O O    . LEU A 1 86  ? 1.523   -1.031  5.528   1.00 0.00 ? 86  LEU A O    1  
ATOM 1228  C CB   . LEU A 1 86  ? 2.887   0.786   3.514   1.00 0.00 ? 86  LEU A CB   1  
ATOM 1229  C CG   . LEU A 1 86  ? 3.639   2.115   3.595   1.00 0.00 ? 86  LEU A CG   1  
ATOM 1230  C CD1  . LEU A 1 86  ? 5.137   1.889   3.456   1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1231  C CD2  . LEU A 1 86  ? 3.141   3.076   2.526   1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1232  H H    . LEU A 1 86  ? 1.975   1.973   5.669   1.00 0.00 ? 86  LEU A H    1  
ATOM 1233  H HA   . LEU A 1 86  ? 0.795   1.071   3.156   1.00 0.00 ? 86  LEU A HA   1  
ATOM 1234  H HB2  . LEU A 1 86  ? 3.420   0.067   4.117   1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1235  H HB3  . LEU A 1 86  ? 2.893   0.464   2.483   1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1236  H HG   . LEU A 1 86  ? 3.458   2.565   4.562   1.00 0.00 ? 86  LEU A HG   1  
ATOM 1237  H HD11 . LEU A 1 86  ? 5.465   2.239   2.490   1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1238  H HD12 . LEU A 1 86  ? 5.352   0.835   3.550   1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1239  H HD13 . LEU A 1 86  ? 5.656   2.433   4.232   1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1240  H HD21 . LEU A 1 86  ? 2.255   3.580   2.880   1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1241  H HD22 . LEU A 1 86  ? 2.906   2.524   1.627   1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1242  H HD23 . LEU A 1 86  ? 3.909   3.804   2.311   1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1243  N N    . ASP A 1 87  ? 0.135   -1.228  3.769   1.00 0.00 ? 87  ASP A N    1  
ATOM 1244  C CA   . ASP A 1 87  ? -0.331  -2.558  4.146   1.00 0.00 ? 87  ASP A CA   1  
ATOM 1245  C C    . ASP A 1 87  ? -0.546  -3.428  2.912   1.00 0.00 ? 87  ASP A C    1  
ATOM 1246  O O    . ASP A 1 87  ? -0.960  -2.940  1.860   1.00 0.00 ? 87  ASP A O    1  
ATOM 1247  C CB   . ASP A 1 87  ? -1.629  -2.459  4.948   1.00 0.00 ? 87  ASP A CB   1  
ATOM 1248  C CG   . ASP A 1 87  ? -1.883  -3.691  5.794   1.00 0.00 ? 87  ASP A CG   1  
ATOM 1249  O OD1  . ASP A 1 87  ? -1.185  -3.864  6.815   1.00 0.00 ? 87  ASP A OD1  1  
ATOM 1250  O OD2  . ASP A 1 87  ? -2.780  -4.482  5.435   1.00 0.00 ? 87  ASP A OD2  1  
ATOM 1251  H H    . ASP A 1 87  ? -0.221  -0.809  2.958   1.00 0.00 ? 87  ASP A H    1  
ATOM 1252  H HA   . ASP A 1 87  ? 0.429   -3.013  4.763   1.00 0.00 ? 87  ASP A HA   1  
ATOM 1253  H HB2  . ASP A 1 87  ? -1.576  -1.601  5.603   1.00 0.00 ? 87  ASP A HB2  1  
ATOM 1254  H HB3  . ASP A 1 87  ? -2.457  -2.335  4.266   1.00 0.00 ? 87  ASP A HB3  1  
ATOM 1255  N N    . TRP A 1 88  ? -0.262  -4.719  3.047   1.00 0.00 ? 88  TRP A N    1  
ATOM 1256  C CA   . TRP A 1 88  ? -0.424  -5.657  1.942   1.00 0.00 ? 88  TRP A CA   1  
ATOM 1257  C C    . TRP A 1 88  ? -1.890  -5.782  1.544   1.00 0.00 ? 88  TRP A C    1  
ATOM 1258  O O    . TRP A 1 88  ? -2.723  -6.220  2.338   1.00 0.00 ? 88  TRP A O    1  
ATOM 1259  C CB   . TRP A 1 88  ? 0.132   -7.029  2.326   1.00 0.00 ? 88  TRP A CB   1  
ATOM 1260  C CG   . TRP A 1 88  ? 1.595   -7.007  2.653   1.00 0.00 ? 88  TRP A CG   1  
ATOM 1261  C CD1  . TRP A 1 88  ? 2.170   -7.305  3.855   1.00 0.00 ? 88  TRP A CD1  1  
ATOM 1262  C CD2  . TRP A 1 88  ? 2.666   -6.669  1.766   1.00 0.00 ? 88  TRP A CD2  1  
ATOM 1263  N NE1  . TRP A 1 88  ? 3.535   -7.171  3.769   1.00 0.00 ? 88  TRP A NE1  1  
ATOM 1264  C CE2  . TRP A 1 88  ? 3.864   -6.783  2.497   1.00 0.00 ? 88  TRP A CE2  1  
ATOM 1265  C CE3  . TRP A 1 88  ? 2.730   -6.282  0.424   1.00 0.00 ? 88  TRP A CE3  1  
ATOM 1266  C CZ2  . TRP A 1 88  ? 5.109   -6.523  1.930   1.00 0.00 ? 88  TRP A CZ2  1  
ATOM 1267  C CZ3  . TRP A 1 88  ? 3.966   -6.024  -0.137  1.00 0.00 ? 88  TRP A CZ3  1  
ATOM 1268  C CH2  . TRP A 1 88  ? 5.142   -6.146  0.615   1.00 0.00 ? 88  TRP A CH2  1  
ATOM 1269  H H    . TRP A 1 88  ? 0.064   -5.049  3.911   1.00 0.00 ? 88  TRP A H    1  
ATOM 1270  H HA   . TRP A 1 88  ? 0.135   -5.275  1.100   1.00 0.00 ? 88  TRP A HA   1  
ATOM 1271  H HB2  . TRP A 1 88  ? -0.398  -7.396  3.193   1.00 0.00 ? 88  TRP A HB2  1  
ATOM 1272  H HB3  . TRP A 1 88  ? -0.016  -7.712  1.502   1.00 0.00 ? 88  TRP A HB3  1  
ATOM 1273  H HD1  . TRP A 1 88  ? 1.621   -7.598  4.736   1.00 0.00 ? 88  TRP A HD1  1  
ATOM 1274  H HE1  . TRP A 1 88  ? 4.170   -7.330  4.499   1.00 0.00 ? 88  TRP A HE1  1  
ATOM 1275  H HE3  . TRP A 1 88  ? 1.834   -6.183  -0.172  1.00 0.00 ? 88  TRP A HE3  1  
ATOM 1276  H HZ2  . TRP A 1 88  ? 6.025   -6.613  2.496   1.00 0.00 ? 88  TRP A HZ2  1  
ATOM 1277  H HZ3  . TRP A 1 88  ? 4.035   -5.724  -1.172  1.00 0.00 ? 88  TRP A HZ3  1  
ATOM 1278  H HH2  . TRP A 1 88  ? 6.086   -5.934  0.136   1.00 0.00 ? 88  TRP A HH2  1  
ATOM 1279  N N    . ALA A 1 89  ? -2.200  -5.394  0.312   1.00 0.00 ? 89  ALA A N    1  
ATOM 1280  C CA   . ALA A 1 89  ? -3.566  -5.465  -0.192  1.00 0.00 ? 89  ALA A CA   1  
ATOM 1281  C C    . ALA A 1 89  ? -4.104  -6.890  -0.118  1.00 0.00 ? 89  ALA A C    1  
ATOM 1282  O O    . ALA A 1 89  ? -3.942  -7.675  -1.052  1.00 0.00 ? 89  ALA A O    1  
ATOM 1283  C CB   . ALA A 1 89  ? -3.629  -4.948  -1.621  1.00 0.00 ? 89  ALA A CB   1  
ATOM 1284  H H    . ALA A 1 89  ? -1.492  -5.053  -0.274  1.00 0.00 ? 89  ALA A H    1  
ATOM 1285  H HA   . ALA A 1 89  ? -4.182  -4.826  0.424   1.00 0.00 ? 89  ALA A HA   1  
ATOM 1286  H HB1  . ALA A 1 89  ? -4.380  -4.174  -1.690  1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1287  H HB2  . ALA A 1 89  ? -2.668  -4.543  -1.900  1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1288  H HB3  . ALA A 1 89  ? -3.886  -5.759  -2.286  1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1289  N N    . LYS A 1 90  ? -4.745  -7.218  0.999   1.00 0.00 ? 90  LYS A N    1  
ATOM 1290  C CA   . LYS A 1 90  ? -5.309  -8.548  1.195   1.00 0.00 ? 90  LYS A CA   1  
ATOM 1291  C C    . LYS A 1 90  ? -6.740  -8.461  1.715   1.00 0.00 ? 90  LYS A C    1  
ATOM 1292  O O    . LYS A 1 90  ? -7.070  -7.631  2.562   1.00 0.00 ? 90  LYS A O    1  
ATOM 1293  C CB   . LYS A 1 90  ? -4.448  -9.350  2.174   1.00 0.00 ? 90  LYS A CB   1  
ATOM 1294  C CG   . LYS A 1 90  ? -4.596  -10.854 2.023   1.00 0.00 ? 90  LYS A CG   1  
ATOM 1295  C CD   . LYS A 1 90  ? -3.623  -11.603 2.919   1.00 0.00 ? 90  LYS A CD   1  
ATOM 1296  C CE   . LYS A 1 90  ? -3.984  -13.076 3.025   1.00 0.00 ? 90  LYS A CE   1  
ATOM 1297  N NZ   . LYS A 1 90  ? -4.987  -13.326 4.097   1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1298  H H    . LYS A 1 90  ? -4.842  -6.548  1.708   1.00 0.00 ? 90  LYS A H    1  
ATOM 1299  H HA   . LYS A 1 90  ? -5.315  -9.050  0.240   1.00 0.00 ? 90  LYS A HA   1  
ATOM 1300  H HB2  . LYS A 1 90  ? -3.411  -9.094  2.016   1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1301  H HB3  . LYS A 1 90  ? -4.726  -9.081  3.183   1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1302  H HG2  . LYS A 1 90  ? -5.604  -11.136 2.289   1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1303  H HG3  . LYS A 1 90  ? -4.404  -11.124 0.994   1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1304  H HD2  . LYS A 1 90  ? -2.629  -11.516 2.508   1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1305  H HD3  . LYS A 1 90  ? -3.646  -11.164 3.906   1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1306  H HE2  . LYS A 1 90  ? -4.392  -13.403 2.080   1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1307  H HE3  . LYS A 1 90  ? -3.088  -13.638 3.244   1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1308  H HZ1  . LYS A 1 90  ? -5.141  -14.349 4.211   1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1309  H HZ2  . LYS A 1 90  ? -5.892  -12.876 3.852   1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1310  H HZ3  . LYS A 1 90  ? -4.650  -12.935 5.000   1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1311  N N    . PRO A 1 91  ? -7.613  -9.339  1.198   1.00 0.00 ? 91  PRO A N    1  
ATOM 1312  C CA   . PRO A 1 91  ? -9.023  -9.383  1.597   1.00 0.00 ? 91  PRO A CA   1  
ATOM 1313  C C    . PRO A 1 91  ? -9.206  -9.891  3.023   1.00 0.00 ? 91  PRO A C    1  
ATOM 1314  O O    . PRO A 1 91  ? -8.236  -10.063 3.761   1.00 0.00 ? 91  PRO A O    1  
ATOM 1315  C CB   . PRO A 1 91  ? -9.644  -10.361 0.596   1.00 0.00 ? 91  PRO A CB   1  
ATOM 1316  C CG   . PRO A 1 91  ? -8.514  -11.230 0.164   1.00 0.00 ? 91  PRO A CG   1  
ATOM 1317  C CD   . PRO A 1 91  ? -7.290  -10.358 0.184   1.00 0.00 ? 91  PRO A CD   1  
ATOM 1318  H HA   . PRO A 1 91  ? -9.493  -8.416  1.497   1.00 0.00 ? 91  PRO A HA   1  
ATOM 1319  H HB2  . PRO A 1 91  ? -10.421 -10.933 1.084   1.00 0.00 ? 91  PRO A HB2  1  
ATOM 1320  H HB3  . PRO A 1 91  ? -10.062 -9.813  -0.235  1.00 0.00 ? 91  PRO A HB3  1  
ATOM 1321  H HG2  . PRO A 1 91  ? -8.400  -12.053 0.853   1.00 0.00 ? 91  PRO A HG2  1  
ATOM 1322  H HG3  . PRO A 1 91  ? -8.696  -11.597 -0.835  1.00 0.00 ? 91  PRO A HG3  1  
ATOM 1323  H HD2  . PRO A 1 91  ? -6.423  -10.931 0.477   1.00 0.00 ? 91  PRO A HD2  1  
ATOM 1324  H HD3  . PRO A 1 91  ? -7.135  -9.903  -0.783  1.00 0.00 ? 91  PRO A HD3  1  
ATOM 1325  N N    . LYS A 1 92  ? -10.456 -10.130 3.404   1.00 0.00 ? 92  LYS A N    1  
ATOM 1326  C CA   . LYS A 1 92  ? -10.768 -10.620 4.741   1.00 0.00 ? 92  LYS A CA   1  
ATOM 1327  C C    . LYS A 1 92  ? -11.782 -11.759 4.681   1.00 0.00 ? 92  LYS A C    1  
ATOM 1328  O O    . LYS A 1 92  ? -11.534 -12.851 5.190   1.00 0.00 ? 92  LYS A O    1  
ATOM 1329  C CB   . LYS A 1 92  ? -11.312 -9.484  5.610   1.00 0.00 ? 92  LYS A CB   1  
ATOM 1330  C CG   . LYS A 1 92  ? -11.441 -9.849  7.079   1.00 0.00 ? 92  LYS A CG   1  
ATOM 1331  C CD   . LYS A 1 92  ? -10.081 -10.051 7.724   1.00 0.00 ? 92  LYS A CD   1  
ATOM 1332  C CE   . LYS A 1 92  ? -10.210 -10.396 9.200   1.00 0.00 ? 92  LYS A CE   1  
ATOM 1333  N NZ   . LYS A 1 92  ? -8.887  -10.682 9.821   1.00 0.00 ? 92  LYS A NZ   1  
ATOM 1334  H H    . LYS A 1 92  ? -11.188 -9.973  2.770   1.00 0.00 ? 92  LYS A H    1  
ATOM 1335  H HA   . LYS A 1 92  ? -9.854  -10.991 5.180   1.00 0.00 ? 92  LYS A HA   1  
ATOM 1336  H HB2  . LYS A 1 92  ? -10.650 -8.635  5.528   1.00 0.00 ? 92  LYS A HB2  1  
ATOM 1337  H HB3  . LYS A 1 92  ? -12.289 -9.203  5.243   1.00 0.00 ? 92  LYS A HB3  1  
ATOM 1338  H HG2  . LYS A 1 92  ? -11.958 -9.053  7.594   1.00 0.00 ? 92  LYS A HG2  1  
ATOM 1339  H HG3  . LYS A 1 92  ? -12.010 -10.764 7.164   1.00 0.00 ? 92  LYS A HG3  1  
ATOM 1340  H HD2  . LYS A 1 92  ? -9.569  -10.858 7.221   1.00 0.00 ? 92  LYS A HD2  1  
ATOM 1341  H HD3  . LYS A 1 92  ? -9.506  -9.141  7.625   1.00 0.00 ? 92  LYS A HD3  1  
ATOM 1342  H HE2  . LYS A 1 92  ? -10.666 -9.563  9.713   1.00 0.00 ? 92  LYS A HE2  1  
ATOM 1343  H HE3  . LYS A 1 92  ? -10.840 -11.268 9.298   1.00 0.00 ? 92  LYS A HE3  1  
ATOM 1344  H HZ1  . LYS A 1 92  ? -9.018  -11.072 10.776  1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 1345  H HZ2  . LYS A 1 92  ? -8.329  -9.807  9.890   1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 1346  H HZ3  . LYS A 1 92  ? -8.363  -11.370 9.245   1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 1347  N N    . GLY A 1 93  ? -12.924 -11.495 4.054   1.00 0.00 ? 93  GLY A N    1  
ATOM 1348  C CA   . GLY A 1 93  ? -13.957 -12.508 3.937   1.00 0.00 ? 93  GLY A CA   1  
ATOM 1349  C C    . GLY A 1 93  ? -15.332 -11.977 4.294   1.00 0.00 ? 93  GLY A C    1  
ATOM 1350  O O    . GLY A 1 93  ? -15.550 -10.767 4.315   1.00 0.00 ? 93  GLY A O    1  
ATOM 1351  H H    . GLY A 1 93  ? -13.067 -10.606 3.667   1.00 0.00 ? 93  GLY A H    1  
ATOM 1352  H HA2  . GLY A 1 93  ? -13.976 -12.872 2.921   1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1353  H HA3  . GLY A 1 93  ? -13.718 -13.327 4.599   1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1354  N N    . GLU A 1 94  ? -16.261 -12.886 4.573   1.00 0.00 ? 94  GLU A N    1  
ATOM 1355  C CA   . GLU A 1 94  ? -17.622 -12.502 4.928   1.00 0.00 ? 94  GLU A CA   1  
ATOM 1356  C C    . GLU A 1 94  ? -17.694 -12.032 6.378   1.00 0.00 ? 94  GLU A C    1  
ATOM 1357  O O    . GLU A 1 94  ? -18.769 -11.719 6.888   1.00 0.00 ? 94  GLU A O    1  
ATOM 1358  C CB   . GLU A 1 94  ? -18.580 -13.676 4.713   1.00 0.00 ? 94  GLU A CB   1  
ATOM 1359  C CG   . GLU A 1 94  ? -18.212 -14.915 5.511   1.00 0.00 ? 94  GLU A CG   1  
ATOM 1360  C CD   . GLU A 1 94  ? -19.372 -15.881 5.656   1.00 0.00 ? 94  GLU A CD   1  
ATOM 1361  O OE1  . GLU A 1 94  ? -20.135 -15.749 6.636   1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1362  O OE2  . GLU A 1 94  ? -19.516 -16.770 4.791   1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1363  H H    . GLU A 1 94  ? -16.026 -13.837 4.539   1.00 0.00 ? 94  GLU A H    1  
ATOM 1364  H HA   . GLU A 1 94  ? -17.915 -11.688 4.283   1.00 0.00 ? 94  GLU A HA   1  
ATOM 1365  H HB2  . GLU A 1 94  ? -19.575 -13.370 4.999   1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1366  H HB3  . GLU A 1 94  ? -18.581 -13.936 3.665   1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1367  H HG2  . GLU A 1 94  ? -17.401 -15.423 5.011   1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1368  H HG3  . GLU A 1 94  ? -17.890 -14.611 6.497   1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1369  N N    . GLY A 1 95  ? -16.540 -11.985 7.037   1.00 0.00 ? 95  GLY A N    1  
ATOM 1370  C CA   . GLY A 1 95  ? -16.494 -11.553 8.422   1.00 0.00 ? 95  GLY A CA   1  
ATOM 1371  C C    . GLY A 1 95  ? -15.167 -11.870 9.084   1.00 0.00 ? 95  GLY A C    1  
ATOM 1372  O O    . GLY A 1 95  ? -14.372 -10.972 9.358   1.00 0.00 ? 95  GLY A O    1  
ATOM 1373  H H    . GLY A 1 95  ? -15.714 -12.247 6.579   1.00 0.00 ? 95  GLY A H    1  
ATOM 1374  H HA2  . GLY A 1 95  ? -16.658 -10.487 8.460   1.00 0.00 ? 95  GLY A HA2  1  
ATOM 1375  H HA3  . GLY A 1 95  ? -17.283 -12.049 8.968   1.00 0.00 ? 95  GLY A HA3  1  
ATOM 1376  N N    . GLY A 1 96  ? -14.928 -13.152 9.343   1.00 0.00 ? 96  GLY A N    1  
ATOM 1377  C CA   . GLY A 1 96  ? -13.689 -13.562 9.977   1.00 0.00 ? 96  GLY A CA   1  
ATOM 1378  C C    . GLY A 1 96  ? -13.489 -15.064 9.942   1.00 0.00 ? 96  GLY A C    1  
ATOM 1379  O O    . GLY A 1 96  ? -13.553 -15.730 10.976  1.00 0.00 ? 96  GLY A O    1  
ATOM 1380  H H    . GLY A 1 96  ? -15.599 -13.825 9.103   1.00 0.00 ? 96  GLY A H    1  
ATOM 1381  H HA2  . GLY A 1 96  ? -12.863 -13.087 9.469   1.00 0.00 ? 96  GLY A HA2  1  
ATOM 1382  H HA3  . GLY A 1 96  ? -13.700 -13.236 11.007  1.00 0.00 ? 96  GLY A HA3  1  
ATOM 1383  N N    . SER A 1 97  ? -13.248 -15.600 8.750   1.00 0.00 ? 97  SER A N    1  
ATOM 1384  C CA   . SER A 1 97  ? -13.044 -17.034 8.584   1.00 0.00 ? 97  SER A CA   1  
ATOM 1385  C C    . SER A 1 97  ? -11.676 -17.321 7.972   1.00 0.00 ? 97  SER A C    1  
ATOM 1386  O O    . SER A 1 97  ? -11.306 -16.742 6.951   1.00 0.00 ? 97  SER A O    1  
ATOM 1387  C CB   . SER A 1 97  ? -14.144 -17.628 7.702   1.00 0.00 ? 97  SER A CB   1  
ATOM 1388  O OG   . SER A 1 97  ? -15.429 -17.298 8.199   1.00 0.00 ? 97  SER A OG   1  
ATOM 1389  H H    . SER A 1 97  ? -13.209 -15.017 7.963   1.00 0.00 ? 97  SER A H    1  
ATOM 1390  H HA   . SER A 1 97  ? -13.091 -17.491 9.561   1.00 0.00 ? 97  SER A HA   1  
ATOM 1391  H HB2  . SER A 1 97  ? -14.048 -17.240 6.700   1.00 0.00 ? 97  SER A HB2  1  
ATOM 1392  H HB3  . SER A 1 97  ? -14.044 -18.704 7.683   1.00 0.00 ? 97  SER A HB3  1  
ATOM 1393  H HG   . SER A 1 97  ? -16.029 -18.033 8.049   1.00 0.00 ? 97  SER A HG   1  
ATOM 1394  N N    . GLY A 1 98  ? -10.928 -18.219 8.606   1.00 0.00 ? 98  GLY A N    1  
ATOM 1395  C CA   . GLY A 1 98  ? -9.609  -18.568 8.111   1.00 0.00 ? 98  GLY A CA   1  
ATOM 1396  C C    . GLY A 1 98  ? -8.649  -18.935 9.226   1.00 0.00 ? 98  GLY A C    1  
ATOM 1397  O O    . GLY A 1 98  ? -8.522  -20.099 9.606   1.00 0.00 ? 98  GLY A O    1  
ATOM 1398  H H    . GLY A 1 98  ? -11.274 -18.648 9.416   1.00 0.00 ? 98  GLY A H    1  
ATOM 1399  H HA2  . GLY A 1 98  ? -9.699  -19.406 7.437   1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1400  H HA3  . GLY A 1 98  ? -9.206  -17.725 7.569   1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1401  N N    . PRO A 1 99  ? -7.952  -17.926 9.768   1.00 0.00 ? 99  PRO A N    1  
ATOM 1402  C CA   . PRO A 1 99  ? -6.986  -18.124 10.852  1.00 0.00 ? 99  PRO A CA   1  
ATOM 1403  C C    . PRO A 1 99  ? -7.660  -18.495 12.169  1.00 0.00 ? 99  PRO A C    1  
ATOM 1404  O O    . PRO A 1 99  ? -8.440  -17.716 12.719  1.00 0.00 ? 99  PRO A O    1  
ATOM 1405  C CB   . PRO A 1 99  ? -6.298  -16.761 10.969  1.00 0.00 ? 99  PRO A CB   1  
ATOM 1406  C CG   . PRO A 1 99  ? -7.295  -15.788 10.442  1.00 0.00 ? 99  PRO A CG   1  
ATOM 1407  C CD   . PRO A 1 99  ? -8.052  -16.513 9.364   1.00 0.00 ? 99  PRO A CD   1  
ATOM 1408  H HA   . PRO A 1 99  ? -6.254  -18.878 10.600  1.00 0.00 ? 99  PRO A HA   1  
ATOM 1409  H HB2  . PRO A 1 99  ? -6.060  -16.563 12.004  1.00 0.00 ? 99  PRO A HB2  1  
ATOM 1410  H HB3  . PRO A 1 99  ? -5.394  -16.759 10.379  1.00 0.00 ? 99  PRO A HB3  1  
ATOM 1411  H HG2  . PRO A 1 99  ? -7.965  -15.485 11.232  1.00 0.00 ? 99  PRO A HG2  1  
ATOM 1412  H HG3  . PRO A 1 99  ? -6.787  -14.929 10.029  1.00 0.00 ? 99  PRO A HG3  1  
ATOM 1413  H HD2  . PRO A 1 99  ? -9.083  -16.190 9.344   1.00 0.00 ? 99  PRO A HD2  1  
ATOM 1414  H HD3  . PRO A 1 99  ? -7.586  -16.354 8.403   1.00 0.00 ? 99  PRO A HD3  1  
ATOM 1415  N N    . SER A 1 100 ? -7.356  -19.688 12.670  1.00 0.00 ? 100 SER A N    1  
ATOM 1416  C CA   . SER A 1 100 ? -7.936  -20.163 13.920  1.00 0.00 ? 100 SER A CA   1  
ATOM 1417  C C    . SER A 1 100 ? -7.044  -21.220 14.565  1.00 0.00 ? 100 SER A C    1  
ATOM 1418  O O    . SER A 1 100 ? -6.034  -21.629 13.994  1.00 0.00 ? 100 SER A O    1  
ATOM 1419  C CB   . SER A 1 100 ? -9.332  -20.737 13.674  1.00 0.00 ? 100 SER A CB   1  
ATOM 1420  O OG   . SER A 1 100 ? -10.314 -19.716 13.691  1.00 0.00 ? 100 SER A OG   1  
ATOM 1421  H H    . SER A 1 100 ? -6.728  -20.263 12.184  1.00 0.00 ? 100 SER A H    1  
ATOM 1422  H HA   . SER A 1 100 ? -8.016  -19.319 14.590  1.00 0.00 ? 100 SER A HA   1  
ATOM 1423  H HB2  . SER A 1 100 ? -9.353  -21.224 12.711  1.00 0.00 ? 100 SER A HB2  1  
ATOM 1424  H HB3  . SER A 1 100 ? -9.563  -21.457 14.446  1.00 0.00 ? 100 SER A HB3  1  
ATOM 1425  H HG   . SER A 1 100 ? -10.935 -19.881 14.404  1.00 0.00 ? 100 SER A HG   1  
ATOM 1426  N N    . SER A 1 101 ? -7.427  -21.658 15.761  1.00 0.00 ? 101 SER A N    1  
ATOM 1427  C CA   . SER A 1 101 ? -6.661  -22.664 16.487  1.00 0.00 ? 101 SER A CA   1  
ATOM 1428  C C    . SER A 1 101 ? -7.346  -24.026 16.412  1.00 0.00 ? 101 SER A C    1  
ATOM 1429  O O    . SER A 1 101 ? -6.767  -24.999 15.934  1.00 0.00 ? 101 SER A O    1  
ATOM 1430  C CB   . SER A 1 101 ? -6.488  -22.247 17.948  1.00 0.00 ? 101 SER A CB   1  
ATOM 1431  O OG   . SER A 1 101 ? -5.960  -23.310 18.723  1.00 0.00 ? 101 SER A OG   1  
ATOM 1432  H H    . SER A 1 101 ? -8.242  -21.293 16.165  1.00 0.00 ? 101 SER A H    1  
ATOM 1433  H HA   . SER A 1 101 ? -5.689  -22.738 16.024  1.00 0.00 ? 101 SER A HA   1  
ATOM 1434  H HB2  . SER A 1 101 ? -5.811  -21.408 18.003  1.00 0.00 ? 101 SER A HB2  1  
ATOM 1435  H HB3  . SER A 1 101 ? -7.448  -21.963 18.355  1.00 0.00 ? 101 SER A HB3  1  
ATOM 1436  H HG   . SER A 1 101 ? -5.001  -23.293 18.679  1.00 0.00 ? 101 SER A HG   1  
ATOM 1437  N N    . GLY A 1 102 ? -8.586  -24.085 16.891  1.00 0.00 ? 102 GLY A N    1  
ATOM 1438  C CA   . GLY A 1 102 ? -9.330  -25.330 16.870  1.00 0.00 ? 102 GLY A CA   1  
ATOM 1439  C C    . GLY A 1 102 ? -10.685 -25.184 16.206  1.00 0.00 ? 102 GLY A C    1  
ATOM 1440  O O    . GLY A 1 102 ? -10.863 -24.349 15.320  1.00 0.00 ? 102 GLY A O    1  
ATOM 1441  H H    . GLY A 1 102 ? -8.998  -23.276 17.261  1.00 0.00 ? 102 GLY A H    1  
ATOM 1442  H HA2  . GLY A 1 102 ? -8.756  -26.071 16.334  1.00 0.00 ? 102 GLY A HA2  1  
ATOM 1443  H HA3  . GLY A 1 102 ? -9.475  -25.667 17.886  1.00 0.00 ? 102 GLY A HA3  1  
ATOM 1444  N N    . GLY A 1 1   ? 6.280   -14.366 20.895  1.00 0.00 ? 1   GLY A N    2  
ATOM 1445  C CA   . GLY A 1 1   ? 6.996   -14.249 22.152  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1446  C C    . GLY A 1 1   ? 8.410   -14.787 22.066  1.00 0.00 ? 1   GLY A C    2  
ATOM 1447  O O    . GLY A 1 1   ? 9.366   -14.021 21.946  1.00 0.00 ? 1   GLY A O    2  
ATOM 1448  H H1   . GLY A 1 1   ? 6.744   -14.698 20.098  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1449  H HA2  . GLY A 1 1   ? 7.034   -13.209 22.437  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1450  H HA3  . GLY A 1 1   ? 6.460   -14.801 22.911  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1451  N N    . SER A 1 2   ? 8.545   -16.108 22.129  1.00 0.00 ? 2   SER A N    2  
ATOM 1452  C CA   . SER A 1 2   ? 9.854   -16.746 22.063  1.00 0.00 ? 2   SER A CA   2  
ATOM 1453  C C    . SER A 1 2   ? 10.337  -16.848 20.619  1.00 0.00 ? 2   SER A C    2  
ATOM 1454  O O    . SER A 1 2   ? 11.430  -16.393 20.285  1.00 0.00 ? 2   SER A O    2  
ATOM 1455  C CB   . SER A 1 2   ? 9.798   -18.139 22.693  1.00 0.00 ? 2   SER A CB   2  
ATOM 1456  O OG   . SER A 1 2   ? 9.489   -18.062 24.074  1.00 0.00 ? 2   SER A OG   2  
ATOM 1457  H H    . SER A 1 2   ? 7.745   -16.665 22.225  1.00 0.00 ? 2   SER A H    2  
ATOM 1458  H HA   . SER A 1 2   ? 10.549  -16.136 22.620  1.00 0.00 ? 2   SER A HA   2  
ATOM 1459  H HB2  . SER A 1 2   ? 9.038   -18.725 22.199  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1460  H HB3  . SER A 1 2   ? 10.757  -18.623 22.577  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1461  H HG   . SER A 1 2   ? 9.514   -18.942 24.458  1.00 0.00 ? 2   SER A HG   2  
ATOM 1462  N N    . SER A 1 3   ? 9.512   -17.450 19.767  1.00 0.00 ? 3   SER A N    2  
ATOM 1463  C CA   . SER A 1 3   ? 9.855   -17.616 18.360  1.00 0.00 ? 3   SER A CA   2  
ATOM 1464  C C    . SER A 1 3   ? 9.761   -16.286 17.617  1.00 0.00 ? 3   SER A C    2  
ATOM 1465  O O    . SER A 1 3   ? 8.669   -15.773 17.377  1.00 0.00 ? 3   SER A O    2  
ATOM 1466  C CB   . SER A 1 3   ? 8.931   -18.645 17.706  1.00 0.00 ? 3   SER A CB   2  
ATOM 1467  O OG   . SER A 1 3   ? 9.402   -19.964 17.922  1.00 0.00 ? 3   SER A OG   2  
ATOM 1468  H H    . SER A 1 3   ? 8.654   -17.792 20.095  1.00 0.00 ? 3   SER A H    2  
ATOM 1469  H HA   . SER A 1 3   ? 10.873  -17.973 18.306  1.00 0.00 ? 3   SER A HA   2  
ATOM 1470  H HB2  . SER A 1 3   ? 7.941   -18.555 18.128  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1471  H HB3  . SER A 1 3   ? 8.887   -18.460 16.642  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1472  H HG   . SER A 1 3   ? 8.702   -20.590 17.724  1.00 0.00 ? 3   SER A HG   2  
ATOM 1473  N N    . GLY A 1 4   ? 10.915  -15.734 17.256  1.00 0.00 ? 4   GLY A N    2  
ATOM 1474  C CA   . GLY A 1 4   ? 10.942  -14.469 16.545  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1475  C C    . GLY A 1 4   ? 11.546  -14.596 15.161  1.00 0.00 ? 4   GLY A C    2  
ATOM 1476  O O    . GLY A 1 4   ? 12.651  -14.112 14.911  1.00 0.00 ? 4   GLY A O    2  
ATOM 1477  H H    . GLY A 1 4   ? 11.756  -16.189 17.475  1.00 0.00 ? 4   GLY A H    2  
ATOM 1478  H HA2  . GLY A 1 4   ? 9.933   -14.099 16.454  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1479  H HA3  . GLY A 1 4   ? 11.525  -13.761 17.116  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1480  N N    . SER A 1 5   ? 10.821  -15.249 14.258  1.00 0.00 ? 5   SER A N    2  
ATOM 1481  C CA   . SER A 1 5   ? 11.295  -15.442 12.892  1.00 0.00 ? 5   SER A CA   2  
ATOM 1482  C C    . SER A 1 5   ? 10.898  -14.264 12.008  1.00 0.00 ? 5   SER A C    2  
ATOM 1483  O O    . SER A 1 5   ? 9.975   -13.516 12.329  1.00 0.00 ? 5   SER A O    2  
ATOM 1484  C CB   . SER A 1 5   ? 10.730  -16.741 12.314  1.00 0.00 ? 5   SER A CB   2  
ATOM 1485  O OG   . SER A 1 5   ? 9.375   -16.583 11.932  1.00 0.00 ? 5   SER A OG   2  
ATOM 1486  H H    . SER A 1 5   ? 9.948   -15.611 14.518  1.00 0.00 ? 5   SER A H    2  
ATOM 1487  H HA   . SER A 1 5   ? 12.372  -15.509 12.921  1.00 0.00 ? 5   SER A HA   2  
ATOM 1488  H HB2  . SER A 1 5   ? 11.305  -17.025 11.445  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1489  H HB3  . SER A 1 5   ? 10.794  -17.521 13.059  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1490  H HG   . SER A 1 5   ? 9.327   -16.059 11.129  1.00 0.00 ? 5   SER A HG   2  
ATOM 1491  N N    . SER A 1 6   ? 11.604  -14.105 10.892  1.00 0.00 ? 6   SER A N    2  
ATOM 1492  C CA   . SER A 1 6   ? 11.329  -13.016 9.962   1.00 0.00 ? 6   SER A CA   2  
ATOM 1493  C C    . SER A 1 6   ? 10.975  -13.558 8.581   1.00 0.00 ? 6   SER A C    2  
ATOM 1494  O O    . SER A 1 6   ? 11.238  -14.719 8.271   1.00 0.00 ? 6   SER A O    2  
ATOM 1495  C CB   . SER A 1 6   ? 12.539  -12.085 9.863   1.00 0.00 ? 6   SER A CB   2  
ATOM 1496  O OG   . SER A 1 6   ? 13.703  -12.800 9.486   1.00 0.00 ? 6   SER A OG   2  
ATOM 1497  H H    . SER A 1 6   ? 12.328  -14.735 10.692  1.00 0.00 ? 6   SER A H    2  
ATOM 1498  H HA   . SER A 1 6   ? 10.487  -12.459 10.344  1.00 0.00 ? 6   SER A HA   2  
ATOM 1499  H HB2  . SER A 1 6   ? 12.344  -11.323 9.124   1.00 0.00 ? 6   SER A HB2  2  
ATOM 1500  H HB3  . SER A 1 6   ? 12.711  -11.620 10.823  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1501  H HG   . SER A 1 6   ? 13.451  -13.645 9.107   1.00 0.00 ? 6   SER A HG   2  
ATOM 1502  N N    . GLY A 1 7   ? 10.375  -12.707 7.754   1.00 0.00 ? 7   GLY A N    2  
ATOM 1503  C CA   . GLY A 1 7   ? 9.994   -13.117 6.415   1.00 0.00 ? 7   GLY A CA   2  
ATOM 1504  C C    . GLY A 1 7   ? 8.541   -12.812 6.107   1.00 0.00 ? 7   GLY A C    2  
ATOM 1505  O O    . GLY A 1 7   ? 7.665   -12.932 6.963   1.00 0.00 ? 7   GLY A O    2  
ATOM 1506  H H    . GLY A 1 7   ? 10.190  -11.793 8.056   1.00 0.00 ? 7   GLY A H    2  
ATOM 1507  H HA2  . GLY A 1 7   ? 10.619  -12.602 5.701   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1508  H HA3  . GLY A 1 7   ? 10.155  -14.181 6.318   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1509  N N    . PRO A 1 8   ? 8.270   -12.407 4.857   1.00 0.00 ? 8   PRO A N    2  
ATOM 1510  C CA   . PRO A 1 8   ? 6.914   -12.075 4.410   1.00 0.00 ? 8   PRO A CA   2  
ATOM 1511  C C    . PRO A 1 8   ? 6.019   -13.305 4.310   1.00 0.00 ? 8   PRO A C    2  
ATOM 1512  O O    . PRO A 1 8   ? 4.843   -13.201 3.965   1.00 0.00 ? 8   PRO A O    2  
ATOM 1513  C CB   . PRO A 1 8   ? 7.138   -11.462 3.025   1.00 0.00 ? 8   PRO A CB   2  
ATOM 1514  C CG   . PRO A 1 8   ? 8.424   -12.049 2.555   1.00 0.00 ? 8   PRO A CG   2  
ATOM 1515  C CD   . PRO A 1 8   ? 9.266   -12.242 3.785   1.00 0.00 ? 8   PRO A CD   2  
ATOM 1516  H HA   . PRO A 1 8   ? 6.450   -11.345 5.058   1.00 0.00 ? 8   PRO A HA   2  
ATOM 1517  H HB2  . PRO A 1 8   ? 6.318   -11.730 2.374   1.00 0.00 ? 8   PRO A HB2  2  
ATOM 1518  H HB3  . PRO A 1 8   ? 7.202   -10.388 3.109   1.00 0.00 ? 8   PRO A HB3  2  
ATOM 1519  H HG2  . PRO A 1 8   ? 8.240   -12.998 2.073   1.00 0.00 ? 8   PRO A HG2  2  
ATOM 1520  H HG3  . PRO A 1 8   ? 8.910   -11.368 1.872   1.00 0.00 ? 8   PRO A HG3  2  
ATOM 1521  H HD2  . PRO A 1 8   ? 9.878   -13.127 3.689   1.00 0.00 ? 8   PRO A HD2  2  
ATOM 1522  H HD3  . PRO A 1 8   ? 9.881   -11.372 3.962   1.00 0.00 ? 8   PRO A HD3  2  
ATOM 1523  N N    . ASN A 1 9   ? 6.584   -14.469 4.615   1.00 0.00 ? 9   ASN A N    2  
ATOM 1524  C CA   . ASN A 1 9   ? 5.836   -15.719 4.560   1.00 0.00 ? 9   ASN A CA   2  
ATOM 1525  C C    . ASN A 1 9   ? 5.728   -16.351 5.944   1.00 0.00 ? 9   ASN A C    2  
ATOM 1526  O O    . ASN A 1 9   ? 5.888   -17.561 6.100   1.00 0.00 ? 9   ASN A O    2  
ATOM 1527  C CB   . ASN A 1 9   ? 6.506   -16.696 3.592   1.00 0.00 ? 9   ASN A CB   2  
ATOM 1528  C CG   . ASN A 1 9   ? 5.689   -17.956 3.383   1.00 0.00 ? 9   ASN A CG   2  
ATOM 1529  O OD1  . ASN A 1 9   ? 6.058   -19.034 3.850   1.00 0.00 ? 9   ASN A OD1  2  
ATOM 1530  N ND2  . ASN A 1 9   ? 4.571   -17.826 2.678   1.00 0.00 ? 9   ASN A ND2  2  
ATOM 1531  H H    . ASN A 1 9   ? 7.526   -14.487 4.884   1.00 0.00 ? 9   ASN A H    2  
ATOM 1532  H HA   . ASN A 1 9   ? 4.842   -15.496 4.200   1.00 0.00 ? 9   ASN A HA   2  
ATOM 1533  H HB2  . ASN A 1 9   ? 6.637   -16.212 2.635   1.00 0.00 ? 9   ASN A HB2  2  
ATOM 1534  H HB3  . ASN A 1 9   ? 7.473   -16.976 3.984   1.00 0.00 ? 9   ASN A HB3  2  
ATOM 1535  H HD21 . ASN A 1 9   ? 4.340   -16.937 2.336   1.00 0.00 ? 9   ASN A HD21 2  
ATOM 1536  H HD22 . ASN A 1 9   ? 4.023   -18.625 2.528   1.00 0.00 ? 9   ASN A HD22 2  
ATOM 1537  N N    . ALA A 1 10  ? 5.455   -15.522 6.947   1.00 0.00 ? 10  ALA A N    2  
ATOM 1538  C CA   . ALA A 1 10  ? 5.323   -16.000 8.318   1.00 0.00 ? 10  ALA A CA   2  
ATOM 1539  C C    . ALA A 1 10  ? 3.860   -16.047 8.744   1.00 0.00 ? 10  ALA A C    2  
ATOM 1540  O O    . ALA A 1 10  ? 3.402   -17.035 9.318   1.00 0.00 ? 10  ALA A O    2  
ATOM 1541  C CB   . ALA A 1 10  ? 6.122   -15.116 9.264   1.00 0.00 ? 10  ALA A CB   2  
ATOM 1542  H H    . ALA A 1 10  ? 5.338   -14.568 6.760   1.00 0.00 ? 10  ALA A H    2  
ATOM 1543  H HA   . ALA A 1 10  ? 5.733   -16.998 8.364   1.00 0.00 ? 10  ALA A HA   2  
ATOM 1544  H HB1  . ALA A 1 10  ? 6.162   -14.111 8.869   1.00 0.00 ? 10  ALA A HB1  2  
ATOM 1545  H HB2  . ALA A 1 10  ? 5.647   -15.104 10.233  1.00 0.00 ? 10  ALA A HB2  2  
ATOM 1546  H HB3  . ALA A 1 10  ? 7.125   -15.505 9.359   1.00 0.00 ? 10  ALA A HB3  2  
ATOM 1547  N N    . ARG A 1 11  ? 3.131   -14.972 8.461   1.00 0.00 ? 11  ARG A N    2  
ATOM 1548  C CA   . ARG A 1 11  ? 1.719   -14.891 8.817   1.00 0.00 ? 11  ARG A CA   2  
ATOM 1549  C C    . ARG A 1 11  ? 0.840   -14.942 7.571   1.00 0.00 ? 11  ARG A C    2  
ATOM 1550  O O    . ARG A 1 11  ? -0.159  -15.660 7.533   1.00 0.00 ? 11  ARG A O    2  
ATOM 1551  C CB   . ARG A 1 11  ? 1.442   -13.605 9.598   1.00 0.00 ? 11  ARG A CB   2  
ATOM 1552  C CG   . ARG A 1 11  ? 0.280   -13.722 10.571  1.00 0.00 ? 11  ARG A CG   2  
ATOM 1553  C CD   . ARG A 1 11  ? 0.171   -12.491 11.458  1.00 0.00 ? 11  ARG A CD   2  
ATOM 1554  N NE   . ARG A 1 11  ? 1.096   -12.547 12.587  1.00 0.00 ? 11  ARG A NE   2  
ATOM 1555  C CZ   . ARG A 1 11  ? 0.977   -11.789 13.672  1.00 0.00 ? 11  ARG A CZ   2  
ATOM 1556  N NH1  . ARG A 1 11  ? -0.022  -10.924 13.775  1.00 0.00 ? 11  ARG A NH1  2  
ATOM 1557  N NH2  . ARG A 1 11  ? 1.859   -11.897 14.657  1.00 0.00 ? 11  ARG A NH2  2  
ATOM 1558  H H    . ARG A 1 11  ? 3.552   -14.216 8.002   1.00 0.00 ? 11  ARG A H    2  
ATOM 1559  H HA   . ARG A 1 11  ? 1.486   -15.739 9.443   1.00 0.00 ? 11  ARG A HA   2  
ATOM 1560  H HB2  . ARG A 1 11  ? 2.327   -13.340 10.159  1.00 0.00 ? 11  ARG A HB2  2  
ATOM 1561  H HB3  . ARG A 1 11  ? 1.219   -12.814 8.898   1.00 0.00 ? 11  ARG A HB3  2  
ATOM 1562  H HG2  . ARG A 1 11  ? -0.637  -13.830 10.011  1.00 0.00 ? 11  ARG A HG2  2  
ATOM 1563  H HG3  . ARG A 1 11  ? 0.430   -14.591 11.193  1.00 0.00 ? 11  ARG A HG3  2  
ATOM 1564  H HD2  . ARG A 1 11  ? 0.392   -11.616 10.866  1.00 0.00 ? 11  ARG A HD2  2  
ATOM 1565  H HD3  . ARG A 1 11  ? -0.839  -12.425 11.835  1.00 0.00 ? 11  ARG A HD3  2  
ATOM 1566  H HE   . ARG A 1 11  ? 1.841   -13.179 12.532  1.00 0.00 ? 11  ARG A HE   2  
ATOM 1567  H HH11 . ARG A 1 11  ? -0.688  -10.841 13.034  1.00 0.00 ? 11  ARG A HH11 2  
ATOM 1568  H HH12 . ARG A 1 11  ? -0.109  -10.356 14.593  1.00 0.00 ? 11  ARG A HH12 2  
ATOM 1569  H HH21 . ARG A 1 11  ? 2.614   -12.549 14.584  1.00 0.00 ? 11  ARG A HH21 2  
ATOM 1570  H HH22 . ARG A 1 11  ? 1.769   -11.327 15.473  1.00 0.00 ? 11  ARG A HH22 2  
ATOM 1571  N N    . SER A 1 12  ? 1.219   -14.174 6.554   1.00 0.00 ? 12  SER A N    2  
ATOM 1572  C CA   . SER A 1 12  ? 0.463   -14.128 5.308   1.00 0.00 ? 12  SER A CA   2  
ATOM 1573  C C    . SER A 1 12  ? 1.358   -13.711 4.145   1.00 0.00 ? 12  SER A C    2  
ATOM 1574  O O    . SER A 1 12  ? 2.235   -12.861 4.297   1.00 0.00 ? 12  SER A O    2  
ATOM 1575  C CB   . SER A 1 12  ? -0.713  -13.158 5.436   1.00 0.00 ? 12  SER A CB   2  
ATOM 1576  O OG   . SER A 1 12  ? -0.280  -11.891 5.900   1.00 0.00 ? 12  SER A OG   2  
ATOM 1577  H H    . SER A 1 12  ? 2.025   -13.624 6.645   1.00 0.00 ? 12  SER A H    2  
ATOM 1578  H HA   . SER A 1 12  ? 0.081   -15.120 5.116   1.00 0.00 ? 12  SER A HA   2  
ATOM 1579  H HB2  . SER A 1 12  ? -1.180  -13.034 4.471   1.00 0.00 ? 12  SER A HB2  2  
ATOM 1580  H HB3  . SER A 1 12  ? -1.432  -13.559 6.136   1.00 0.00 ? 12  SER A HB3  2  
ATOM 1581  H HG   . SER A 1 12  ? -0.973  -11.243 5.754   1.00 0.00 ? 12  SER A HG   2  
ATOM 1582  N N    . GLN A 1 13  ? 1.129   -14.316 2.984   1.00 0.00 ? 13  GLN A N    2  
ATOM 1583  C CA   . GLN A 1 13  ? 1.914   -14.008 1.795   1.00 0.00 ? 13  GLN A CA   2  
ATOM 1584  C C    . GLN A 1 13  ? 1.793   -12.532 1.430   1.00 0.00 ? 13  GLN A C    2  
ATOM 1585  O O    . GLN A 1 13  ? 0.748   -11.907 1.609   1.00 0.00 ? 13  GLN A O    2  
ATOM 1586  C CB   . GLN A 1 13  ? 1.460   -14.875 0.619   1.00 0.00 ? 13  GLN A CB   2  
ATOM 1587  C CG   . GLN A 1 13  ? 0.082   -14.511 0.091   1.00 0.00 ? 13  GLN A CG   2  
ATOM 1588  C CD   . GLN A 1 13  ? -0.611  -15.678 -0.584  1.00 0.00 ? 13  GLN A CD   2  
ATOM 1589  O OE1  . GLN A 1 13  ? -0.179  -16.148 -1.637  1.00 0.00 ? 13  GLN A OE1  2  
ATOM 1590  N NE2  . GLN A 1 13  ? -1.694  -16.154 0.021   1.00 0.00 ? 13  GLN A NE2  2  
ATOM 1591  H H    . GLN A 1 13  ? 0.415   -14.985 2.926   1.00 0.00 ? 13  GLN A H    2  
ATOM 1592  H HA   . GLN A 1 13  ? 2.948   -14.228 2.014   1.00 0.00 ? 13  GLN A HA   2  
ATOM 1593  H HB2  . GLN A 1 13  ? 2.171   -14.769 -0.187  1.00 0.00 ? 13  GLN A HB2  2  
ATOM 1594  H HB3  . GLN A 1 13  ? 1.439   -15.908 0.936   1.00 0.00 ? 13  GLN A HB3  2  
ATOM 1595  H HG2  . GLN A 1 13  ? -0.530  -14.178 0.916   1.00 0.00 ? 13  GLN A HG2  2  
ATOM 1596  H HG3  . GLN A 1 13  ? 0.186   -13.709 -0.625  1.00 0.00 ? 13  GLN A HG3  2  
ATOM 1597  H HE21 . GLN A 1 13  ? -1.981  -15.729 0.857   1.00 0.00 ? 13  GLN A HE21 2  
ATOM 1598  H HE22 . GLN A 1 13  ? -2.162  -16.907 -0.394  1.00 0.00 ? 13  GLN A HE22 2  
ATOM 1599  N N    . PRO A 1 14  ? 2.887   -11.960 0.905   1.00 0.00 ? 14  PRO A N    2  
ATOM 1600  C CA   . PRO A 1 14  ? 2.928   -10.551 0.503   1.00 0.00 ? 14  PRO A CA   2  
ATOM 1601  C C    . PRO A 1 14  ? 2.073   -10.274 -0.728  1.00 0.00 ? 14  PRO A C    2  
ATOM 1602  O O    . PRO A 1 14  ? 1.345   -11.147 -1.199  1.00 0.00 ? 14  PRO A O    2  
ATOM 1603  C CB   . PRO A 1 14  ? 4.408   -10.314 0.191   1.00 0.00 ? 14  PRO A CB   2  
ATOM 1604  C CG   . PRO A 1 14  ? 4.939   -11.659 -0.170  1.00 0.00 ? 14  PRO A CG   2  
ATOM 1605  C CD   . PRO A 1 14  ? 4.168   -12.646 0.663   1.00 0.00 ? 14  PRO A CD   2  
ATOM 1606  H HA   . PRO A 1 14  ? 2.620   -9.900  1.308   1.00 0.00 ? 14  PRO A HA   2  
ATOM 1607  H HB2  . PRO A 1 14  ? 4.498   -9.619  -0.632  1.00 0.00 ? 14  PRO A HB2  2  
ATOM 1608  H HB3  . PRO A 1 14  ? 4.904   -9.915  1.063   1.00 0.00 ? 14  PRO A HB3  2  
ATOM 1609  H HG2  . PRO A 1 14  ? 4.778   -11.847 -1.220  1.00 0.00 ? 14  PRO A HG2  2  
ATOM 1610  H HG3  . PRO A 1 14  ? 5.992   -11.713 0.066   1.00 0.00 ? 14  PRO A HG3  2  
ATOM 1611  H HD2  . PRO A 1 14  ? 4.016   -13.564 0.115   1.00 0.00 ? 14  PRO A HD2  2  
ATOM 1612  H HD3  . PRO A 1 14  ? 4.683   -12.839 1.592   1.00 0.00 ? 14  PRO A HD3  2  
ATOM 1613  N N    . SER A 1 15  ? 2.167   -9.053  -1.246  1.00 0.00 ? 15  SER A N    2  
ATOM 1614  C CA   . SER A 1 15  ? 1.399   -8.660  -2.422  1.00 0.00 ? 15  SER A CA   2  
ATOM 1615  C C    . SER A 1 15  ? 2.196   -7.694  -3.293  1.00 0.00 ? 15  SER A C    2  
ATOM 1616  O O    . SER A 1 15  ? 2.831   -6.766  -2.792  1.00 0.00 ? 15  SER A O    2  
ATOM 1617  C CB   . SER A 1 15  ? 0.078   -8.014  -2.001  1.00 0.00 ? 15  SER A CB   2  
ATOM 1618  O OG   . SER A 1 15  ? -0.946  -8.985  -1.872  1.00 0.00 ? 15  SER A OG   2  
ATOM 1619  H H    . SER A 1 15  ? 2.766   -8.401  -0.825  1.00 0.00 ? 15  SER A H    2  
ATOM 1620  H HA   . SER A 1 15  ? 1.188   -9.552  -2.993  1.00 0.00 ? 15  SER A HA   2  
ATOM 1621  H HB2  . SER A 1 15  ? 0.209   -7.518  -1.051  1.00 0.00 ? 15  SER A HB2  2  
ATOM 1622  H HB3  . SER A 1 15  ? -0.219  -7.291  -2.747  1.00 0.00 ? 15  SER A HB3  2  
ATOM 1623  H HG   . SER A 1 15  ? -1.800  -8.547  -1.845  1.00 0.00 ? 15  SER A HG   2  
ATOM 1624  N N    . LYS A 1 16  ? 2.159   -7.920  -4.602  1.00 0.00 ? 16  LYS A N    2  
ATOM 1625  C CA   . LYS A 1 16  ? 2.876   -7.071  -5.546  1.00 0.00 ? 16  LYS A CA   2  
ATOM 1626  C C    . LYS A 1 16  ? 2.422   -5.620  -5.425  1.00 0.00 ? 16  LYS A C    2  
ATOM 1627  O O    . LYS A 1 16  ? 3.214   -4.693  -5.604  1.00 0.00 ? 16  LYS A O    2  
ATOM 1628  C CB   . LYS A 1 16  ? 2.658   -7.567  -6.977  1.00 0.00 ? 16  LYS A CB   2  
ATOM 1629  C CG   . LYS A 1 16  ? 3.488   -8.789  -7.331  1.00 0.00 ? 16  LYS A CG   2  
ATOM 1630  C CD   . LYS A 1 16  ? 3.424   -9.096  -8.817  1.00 0.00 ? 16  LYS A CD   2  
ATOM 1631  C CE   . LYS A 1 16  ? 2.227   -9.971  -9.155  1.00 0.00 ? 16  LYS A CE   2  
ATOM 1632  N NZ   . LYS A 1 16  ? 0.951   -9.204  -9.121  1.00 0.00 ? 16  LYS A NZ   2  
ATOM 1633  H H    . LYS A 1 16  ? 1.635   -8.677  -4.942  1.00 0.00 ? 16  LYS A H    2  
ATOM 1634  H HA   . LYS A 1 16  ? 3.928   -7.128  -5.311  1.00 0.00 ? 16  LYS A HA   2  
ATOM 1635  H HB2  . LYS A 1 16  ? 1.615   -7.817  -7.104  1.00 0.00 ? 16  LYS A HB2  2  
ATOM 1636  H HB3  . LYS A 1 16  ? 2.914   -6.773  -7.664  1.00 0.00 ? 16  LYS A HB3  2  
ATOM 1637  H HG2  . LYS A 1 16  ? 4.516   -8.606  -7.056  1.00 0.00 ? 16  LYS A HG2  2  
ATOM 1638  H HG3  . LYS A 1 16  ? 3.112   -9.640  -6.780  1.00 0.00 ? 16  LYS A HG3  2  
ATOM 1639  H HD2  . LYS A 1 16  ? 3.342   -8.168  -9.364  1.00 0.00 ? 16  LYS A HD2  2  
ATOM 1640  H HD3  . LYS A 1 16  ? 4.329   -9.610  -9.109  1.00 0.00 ? 16  LYS A HD3  2  
ATOM 1641  H HE2  . LYS A 1 16  ? 2.364   -10.381 -10.144 1.00 0.00 ? 16  LYS A HE2  2  
ATOM 1642  H HE3  . LYS A 1 16  ? 2.172   -10.776 -8.436  1.00 0.00 ? 16  LYS A HE3  2  
ATOM 1643  H HZ1  . LYS A 1 16  ? 1.118   -8.221  -9.420  1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 1644  H HZ2  . LYS A 1 16  ? 0.562   -9.200  -8.157  1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 1645  H HZ3  . LYS A 1 16  ? 0.256   -9.637  -9.763  1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 1646  N N    . THR A 1 17  ? 1.143   -5.428  -5.120  1.00 0.00 ? 17  THR A N    2  
ATOM 1647  C CA   . THR A 1 17  ? 0.584   -4.089  -4.975  1.00 0.00 ? 17  THR A CA   2  
ATOM 1648  C C    . THR A 1 17  ? 0.436   -3.711  -3.505  1.00 0.00 ? 17  THR A C    2  
ATOM 1649  O O    . THR A 1 17  ? -0.176  -4.441  -2.724  1.00 0.00 ? 17  THR A O    2  
ATOM 1650  C CB   . THR A 1 17  ? -0.790  -3.976  -5.663  1.00 0.00 ? 17  THR A CB   2  
ATOM 1651  O OG1  . THR A 1 17  ? -0.737  -4.574  -6.963  1.00 0.00 ? 17  THR A OG1  2  
ATOM 1652  C CG2  . THR A 1 17  ? -1.215  -2.521  -5.785  1.00 0.00 ? 17  THR A CG2  2  
ATOM 1653  H H    . THR A 1 17  ? 0.561   -6.206  -4.990  1.00 0.00 ? 17  THR A H    2  
ATOM 1654  H HA   . THR A 1 17  ? 1.260   -3.393  -5.449  1.00 0.00 ? 17  THR A HA   2  
ATOM 1655  H HB   . THR A 1 17  ? -1.520  -4.500  -5.063  1.00 0.00 ? 17  THR A HB   2  
ATOM 1656  H HG1  . THR A 1 17  ? -0.462  -3.917  -7.607  1.00 0.00 ? 17  THR A HG1  2  
ATOM 1657  H HG21 . THR A 1 17  ? -0.880  -1.973  -4.917  1.00 0.00 ? 17  THR A HG21 2  
ATOM 1658  H HG22 . THR A 1 17  ? -2.291  -2.465  -5.853  1.00 0.00 ? 17  THR A HG22 2  
ATOM 1659  H HG23 . THR A 1 17  ? -0.776  -2.091  -6.673  1.00 0.00 ? 17  THR A HG23 2  
ATOM 1660  N N    . LEU A 1 18  ? 1.000   -2.567  -3.134  1.00 0.00 ? 18  LEU A N    2  
ATOM 1661  C CA   . LEU A 1 18  ? 0.930   -2.092  -1.757  1.00 0.00 ? 18  LEU A CA   2  
ATOM 1662  C C    . LEU A 1 18  ? -0.203  -1.086  -1.585  1.00 0.00 ? 18  LEU A C    2  
ATOM 1663  O O    . LEU A 1 18  ? -0.337  -0.146  -2.369  1.00 0.00 ? 18  LEU A O    2  
ATOM 1664  C CB   . LEU A 1 18  ? 2.259   -1.454  -1.348  1.00 0.00 ? 18  LEU A CB   2  
ATOM 1665  C CG   . LEU A 1 18  ? 3.354   -2.419  -0.891  1.00 0.00 ? 18  LEU A CG   2  
ATOM 1666  C CD1  . LEU A 1 18  ? 4.721   -1.758  -0.985  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 1667  C CD2  . LEU A 1 18  ? 3.086   -2.896  0.529   1.00 0.00 ? 18  LEU A CD2  2  
ATOM 1668  H H    . LEU A 1 18  ? 1.474   -2.029  -3.801  1.00 0.00 ? 18  LEU A H    2  
ATOM 1669  H HA   . LEU A 1 18  ? 0.739   -2.943  -1.121  1.00 0.00 ? 18  LEU A HA   2  
ATOM 1670  H HB2  . LEU A 1 18  ? 2.637   -0.904  -2.197  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 1671  H HB3  . LEU A 1 18  ? 2.061   -0.769  -0.537  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 1672  H HG   . LEU A 1 18  ? 3.357   -3.284  -1.541  1.00 0.00 ? 18  LEU A HG   2  
ATOM 1673  H HD11 . LEU A 1 18  ? 5.209   -1.804  -0.023  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 1674  H HD12 . LEU A 1 18  ? 4.602   -0.726  -1.280  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 1675  H HD13 . LEU A 1 18  ? 5.321   -2.275  -1.719  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 1676  H HD21 . LEU A 1 18  ? 3.121   -2.053  1.203   1.00 0.00 ? 18  LEU A HD21 2  
ATOM 1677  H HD22 . LEU A 1 18  ? 3.839   -3.617  0.814   1.00 0.00 ? 18  LEU A HD22 2  
ATOM 1678  H HD23 . LEU A 1 18  ? 2.110   -3.355  0.576   1.00 0.00 ? 18  LEU A HD23 2  
ATOM 1679  N N    . PHE A 1 19  ? -1.016  -1.288  -0.553  1.00 0.00 ? 19  PHE A N    2  
ATOM 1680  C CA   . PHE A 1 19  ? -2.138  -0.398  -0.277  1.00 0.00 ? 19  PHE A CA   2  
ATOM 1681  C C    . PHE A 1 19  ? -1.684  0.815   0.529   1.00 0.00 ? 19  PHE A C    2  
ATOM 1682  O O    . PHE A 1 19  ? -1.178  0.680   1.644   1.00 0.00 ? 19  PHE A O    2  
ATOM 1683  C CB   . PHE A 1 19  ? -3.236  -1.147  0.481   1.00 0.00 ? 19  PHE A CB   2  
ATOM 1684  C CG   . PHE A 1 19  ? -4.441  -0.302  0.780   1.00 0.00 ? 19  PHE A CG   2  
ATOM 1685  C CD1  . PHE A 1 19  ? -5.207  0.224   -0.248  1.00 0.00 ? 19  PHE A CD1  2  
ATOM 1686  C CD2  . PHE A 1 19  ? -4.808  -0.033  2.089   1.00 0.00 ? 19  PHE A CD2  2  
ATOM 1687  C CE1  . PHE A 1 19  ? -6.316  1.002   0.024   1.00 0.00 ? 19  PHE A CE1  2  
ATOM 1688  C CE2  . PHE A 1 19  ? -5.917  0.744   2.367   1.00 0.00 ? 19  PHE A CE2  2  
ATOM 1689  C CZ   . PHE A 1 19  ? -6.672  1.262   1.333   1.00 0.00 ? 19  PHE A CZ   2  
ATOM 1690  H H    . PHE A 1 19  ? -0.858  -2.055  0.037   1.00 0.00 ? 19  PHE A H    2  
ATOM 1691  H HA   . PHE A 1 19  ? -2.532  -0.060  -1.223  1.00 0.00 ? 19  PHE A HA   2  
ATOM 1692  H HB2  . PHE A 1 19  ? -3.561  -1.990  -0.110  1.00 0.00 ? 19  PHE A HB2  2  
ATOM 1693  H HB3  . PHE A 1 19  ? -2.837  -1.502  1.419   1.00 0.00 ? 19  PHE A HB3  2  
ATOM 1694  H HD1  . PHE A 1 19  ? -4.930  0.021   -1.273  1.00 0.00 ? 19  PHE A HD1  2  
ATOM 1695  H HD2  . PHE A 1 19  ? -4.218  -0.439  2.899   1.00 0.00 ? 19  PHE A HD2  2  
ATOM 1696  H HE1  . PHE A 1 19  ? -6.905  1.406   -0.786  1.00 0.00 ? 19  PHE A HE1  2  
ATOM 1697  H HE2  . PHE A 1 19  ? -6.192  0.945   3.392   1.00 0.00 ? 19  PHE A HE2  2  
ATOM 1698  H HZ   . PHE A 1 19  ? -7.538  1.870   1.548   1.00 0.00 ? 19  PHE A HZ   2  
ATOM 1699  N N    . VAL A 1 20  ? -1.867  2.001   -0.043  1.00 0.00 ? 20  VAL A N    2  
ATOM 1700  C CA   . VAL A 1 20  ? -1.478  3.239   0.622   1.00 0.00 ? 20  VAL A CA   2  
ATOM 1701  C C    . VAL A 1 20  ? -2.701  4.042   1.048   1.00 0.00 ? 20  VAL A C    2  
ATOM 1702  O O    . VAL A 1 20  ? -3.446  4.552   0.211   1.00 0.00 ? 20  VAL A O    2  
ATOM 1703  C CB   . VAL A 1 20  ? -0.596  4.112   -0.291  1.00 0.00 ? 20  VAL A CB   2  
ATOM 1704  C CG1  . VAL A 1 20  ? -0.208  5.401   0.417   1.00 0.00 ? 20  VAL A CG1  2  
ATOM 1705  C CG2  . VAL A 1 20  ? 0.640   3.343   -0.731  1.00 0.00 ? 20  VAL A CG2  2  
ATOM 1706  H H    . VAL A 1 20  ? -2.276  2.044   -0.933  1.00 0.00 ? 20  VAL A H    2  
ATOM 1707  H HA   . VAL A 1 20  ? -0.905  2.980   1.500   1.00 0.00 ? 20  VAL A HA   2  
ATOM 1708  H HB   . VAL A 1 20  ? -1.168  4.369   -1.171  1.00 0.00 ? 20  VAL A HB   2  
ATOM 1709  H HG11 . VAL A 1 20  ? -0.185  5.233   1.484   1.00 0.00 ? 20  VAL A HG11 2  
ATOM 1710  H HG12 . VAL A 1 20  ? 0.769   5.717   0.080   1.00 0.00 ? 20  VAL A HG12 2  
ATOM 1711  H HG13 . VAL A 1 20  ? -0.933  6.169   0.190   1.00 0.00 ? 20  VAL A HG13 2  
ATOM 1712  H HG21 . VAL A 1 20  ? 1.242   3.968   -1.374  1.00 0.00 ? 20  VAL A HG21 2  
ATOM 1713  H HG22 . VAL A 1 20  ? 1.217   3.059   0.137   1.00 0.00 ? 20  VAL A HG22 2  
ATOM 1714  H HG23 . VAL A 1 20  ? 0.340   2.456   -1.269  1.00 0.00 ? 20  VAL A HG23 2  
ATOM 1715  N N    . LYS A 1 21  ? -2.904  4.152   2.357   1.00 0.00 ? 21  LYS A N    2  
ATOM 1716  C CA   . LYS A 1 21  ? -4.036  4.895   2.897   1.00 0.00 ? 21  LYS A CA   2  
ATOM 1717  C C    . LYS A 1 21  ? -3.561  6.049   3.774   1.00 0.00 ? 21  LYS A C    2  
ATOM 1718  O O    . LYS A 1 21  ? -2.528  5.954   4.435   1.00 0.00 ? 21  LYS A O    2  
ATOM 1719  C CB   . LYS A 1 21  ? -4.943  3.965   3.706   1.00 0.00 ? 21  LYS A CB   2  
ATOM 1720  C CG   . LYS A 1 21  ? -4.335  3.518   5.024   1.00 0.00 ? 21  LYS A CG   2  
ATOM 1721  C CD   . LYS A 1 21  ? -5.314  2.684   5.834   1.00 0.00 ? 21  LYS A CD   2  
ATOM 1722  C CE   . LYS A 1 21  ? -4.834  2.498   7.266   1.00 0.00 ? 21  LYS A CE   2  
ATOM 1723  N NZ   . LYS A 1 21  ? -5.943  2.093   8.174   1.00 0.00 ? 21  LYS A NZ   2  
ATOM 1724  H H    . LYS A 1 21  ? -2.275  3.723   2.975   1.00 0.00 ? 21  LYS A H    2  
ATOM 1725  H HA   . LYS A 1 21  ? -4.596  5.297   2.066   1.00 0.00 ? 21  LYS A HA   2  
ATOM 1726  H HB2  . LYS A 1 21  ? -5.869  4.480   3.917   1.00 0.00 ? 21  LYS A HB2  2  
ATOM 1727  H HB3  . LYS A 1 21  ? -5.156  3.086   3.115   1.00 0.00 ? 21  LYS A HB3  2  
ATOM 1728  H HG2  . LYS A 1 21  ? -3.456  2.925   4.821   1.00 0.00 ? 21  LYS A HG2  2  
ATOM 1729  H HG3  . LYS A 1 21  ? -4.059  4.391   5.597   1.00 0.00 ? 21  LYS A HG3  2  
ATOM 1730  H HD2  . LYS A 1 21  ? -6.271  3.183   5.850   1.00 0.00 ? 21  LYS A HD2  2  
ATOM 1731  H HD3  . LYS A 1 21  ? -5.418  1.714   5.370   1.00 0.00 ? 21  LYS A HD3  2  
ATOM 1732  H HE2  . LYS A 1 21  ? -4.072  1.734   7.280   1.00 0.00 ? 21  LYS A HE2  2  
ATOM 1733  H HE3  . LYS A 1 21  ? -4.416  3.430   7.616   1.00 0.00 ? 21  LYS A HE3  2  
ATOM 1734  H HZ1  . LYS A 1 21  ? -6.736  1.710   7.620   1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 1735  H HZ2  . LYS A 1 21  ? -6.278  2.914   8.717   1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 1736  H HZ3  . LYS A 1 21  ? -5.613  1.363   8.837   1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 1737  N N    . GLY A 1 22  ? -4.323  7.138   3.776   1.00 0.00 ? 22  GLY A N    2  
ATOM 1738  C CA   . GLY A 1 22  ? -3.964  8.294   4.576   1.00 0.00 ? 22  GLY A CA   2  
ATOM 1739  C C    . GLY A 1 22  ? -3.289  9.378   3.760   1.00 0.00 ? 22  GLY A C    2  
ATOM 1740  O O    . GLY A 1 22  ? -2.306  9.975   4.200   1.00 0.00 ? 22  GLY A O    2  
ATOM 1741  H H    . GLY A 1 22  ? -5.136  7.157   3.228   1.00 0.00 ? 22  GLY A H    2  
ATOM 1742  H HA2  . GLY A 1 22  ? -4.859  8.700   5.025   1.00 0.00 ? 22  GLY A HA2  2  
ATOM 1743  H HA3  . GLY A 1 22  ? -3.292  7.979   5.361   1.00 0.00 ? 22  GLY A HA3  2  
ATOM 1744  N N    . LEU A 1 23  ? -3.815  9.632   2.567   1.00 0.00 ? 23  LEU A N    2  
ATOM 1745  C CA   . LEU A 1 23  ? -3.255  10.651  1.685   1.00 0.00 ? 23  LEU A CA   2  
ATOM 1746  C C    . LEU A 1 23  ? -4.138  11.894  1.662   1.00 0.00 ? 23  LEU A C    2  
ATOM 1747  O O    . LEU A 1 23  ? -5.262  11.880  2.163   1.00 0.00 ? 23  LEU A O    2  
ATOM 1748  C CB   . LEU A 1 23  ? -3.097  10.096  0.268   1.00 0.00 ? 23  LEU A CB   2  
ATOM 1749  C CG   . LEU A 1 23  ? -2.203  8.864   0.125   1.00 0.00 ? 23  LEU A CG   2  
ATOM 1750  C CD1  . LEU A 1 23  ? -2.344  8.260   -1.263  1.00 0.00 ? 23  LEU A CD1  2  
ATOM 1751  C CD2  . LEU A 1 23  ? -0.751  9.224   0.407   1.00 0.00 ? 23  LEU A CD2  2  
ATOM 1752  H H    . LEU A 1 23  ? -4.598  9.123   2.271   1.00 0.00 ? 23  LEU A H    2  
ATOM 1753  H HA   . LEU A 1 23  ? -2.282  10.921  2.068   1.00 0.00 ? 23  LEU A HA   2  
ATOM 1754  H HB2  . LEU A 1 23  ? -4.079  9.835   -0.096  1.00 0.00 ? 23  LEU A HB2  2  
ATOM 1755  H HB3  . LEU A 1 23  ? -2.683  10.881  -0.349  1.00 0.00 ? 23  LEU A HB3  2  
ATOM 1756  H HG   . LEU A 1 23  ? -2.509  8.119   0.846   1.00 0.00 ? 23  LEU A HG   2  
ATOM 1757  H HD11 . LEU A 1 23  ? -2.738  7.258   -1.181  1.00 0.00 ? 23  LEU A HD11 2  
ATOM 1758  H HD12 . LEU A 1 23  ? -1.377  8.228   -1.742  1.00 0.00 ? 23  LEU A HD12 2  
ATOM 1759  H HD13 . LEU A 1 23  ? -3.018  8.865   -1.852  1.00 0.00 ? 23  LEU A HD13 2  
ATOM 1760  H HD21 . LEU A 1 23  ? -0.677  9.686   1.380   1.00 0.00 ? 23  LEU A HD21 2  
ATOM 1761  H HD22 . LEU A 1 23  ? -0.399  9.915   -0.346  1.00 0.00 ? 23  LEU A HD22 2  
ATOM 1762  H HD23 . LEU A 1 23  ? -0.148  8.329   0.385   1.00 0.00 ? 23  LEU A HD23 2  
ATOM 1763  N N    . SER A 1 24  ? -3.621  12.969  1.074   1.00 0.00 ? 24  SER A N    2  
ATOM 1764  C CA   . SER A 1 24  ? -4.362  14.222  0.985   1.00 0.00 ? 24  SER A CA   2  
ATOM 1765  C C    . SER A 1 24  ? -5.219  14.259  -0.276  1.00 0.00 ? 24  SER A C    2  
ATOM 1766  O O    . SER A 1 24  ? -4.796  13.808  -1.340  1.00 0.00 ? 24  SER A O    2  
ATOM 1767  C CB   . SER A 1 24  ? -3.398  15.410  0.995   1.00 0.00 ? 24  SER A CB   2  
ATOM 1768  O OG   . SER A 1 24  ? -4.100  16.635  1.115   1.00 0.00 ? 24  SER A OG   2  
ATOM 1769  H H    . SER A 1 24  ? -2.720  12.918  0.692   1.00 0.00 ? 24  SER A H    2  
ATOM 1770  H HA   . SER A 1 24  ? -5.008  14.287  1.848   1.00 0.00 ? 24  SER A HA   2  
ATOM 1771  H HB2  . SER A 1 24  ? -2.720  15.314  1.830   1.00 0.00 ? 24  SER A HB2  2  
ATOM 1772  H HB3  . SER A 1 24  ? -2.834  15.420  0.073   1.00 0.00 ? 24  SER A HB3  2  
ATOM 1773  H HG   . SER A 1 24  ? -4.863  16.513  1.684   1.00 0.00 ? 24  SER A HG   2  
ATOM 1774  N N    . GLU A 1 25  ? -6.427  14.800  -0.147  1.00 0.00 ? 25  GLU A N    2  
ATOM 1775  C CA   . GLU A 1 25  ? -7.345  14.895  -1.276  1.00 0.00 ? 25  GLU A CA   2  
ATOM 1776  C C    . GLU A 1 25  ? -6.613  15.348  -2.536  1.00 0.00 ? 25  GLU A C    2  
ATOM 1777  O O    . GLU A 1 25  ? -7.062  15.093  -3.653  1.00 0.00 ? 25  GLU A O    2  
ATOM 1778  C CB   . GLU A 1 25  ? -8.483  15.866  -0.957  1.00 0.00 ? 25  GLU A CB   2  
ATOM 1779  C CG   . GLU A 1 25  ? -9.299  15.468  0.262   1.00 0.00 ? 25  GLU A CG   2  
ATOM 1780  C CD   . GLU A 1 25  ? -10.614 16.218  0.353   1.00 0.00 ? 25  GLU A CD   2  
ATOM 1781  O OE1  . GLU A 1 25  ? -11.439 16.083  -0.574  1.00 0.00 ? 25  GLU A OE1  2  
ATOM 1782  O OE2  . GLU A 1 25  ? -10.817 16.941  1.351   1.00 0.00 ? 25  GLU A OE2  2  
ATOM 1783  H H    . GLU A 1 25  ? -6.707  15.142  0.727   1.00 0.00 ? 25  GLU A H    2  
ATOM 1784  H HA   . GLU A 1 25  ? -7.760  13.913  -1.449  1.00 0.00 ? 25  GLU A HA   2  
ATOM 1785  H HB2  . GLU A 1 25  ? -8.064  16.846  -0.780  1.00 0.00 ? 25  GLU A HB2  2  
ATOM 1786  H HB3  . GLU A 1 25  ? -9.146  15.917  -1.807  1.00 0.00 ? 25  GLU A HB3  2  
ATOM 1787  H HG2  . GLU A 1 25  ? -9.509  14.410  0.208   1.00 0.00 ? 25  GLU A HG2  2  
ATOM 1788  H HG3  . GLU A 1 25  ? -8.721  15.675  1.150   1.00 0.00 ? 25  GLU A HG3  2  
ATOM 1789  N N    . ASP A 1 26  ? -5.484  16.022  -2.346  1.00 0.00 ? 26  ASP A N    2  
ATOM 1790  C CA   . ASP A 1 26  ? -4.688  16.511  -3.467  1.00 0.00 ? 26  ASP A CA   2  
ATOM 1791  C C    . ASP A 1 26  ? -3.677  15.460  -3.915  1.00 0.00 ? 26  ASP A C    2  
ATOM 1792  O O    . ASP A 1 26  ? -3.358  15.355  -5.100  1.00 0.00 ? 26  ASP A O    2  
ATOM 1793  C CB   . ASP A 1 26  ? -3.963  17.801  -3.080  1.00 0.00 ? 26  ASP A CB   2  
ATOM 1794  C CG   . ASP A 1 26  ? -4.907  18.854  -2.533  1.00 0.00 ? 26  ASP A CG   2  
ATOM 1795  O OD1  . ASP A 1 26  ? -6.066  18.911  -2.996  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 1796  O OD2  . ASP A 1 26  ? -4.488  19.619  -1.640  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 1797  H H    . ASP A 1 26  ? -5.177  16.193  -1.431  1.00 0.00 ? 26  ASP A H    2  
ATOM 1798  H HA   . ASP A 1 26  ? -5.360  16.718  -4.285  1.00 0.00 ? 26  ASP A HA   2  
ATOM 1799  H HB2  . ASP A 1 26  ? -3.225  17.579  -2.324  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 1800  H HB3  . ASP A 1 26  ? -3.470  18.204  -3.952  1.00 0.00 ? 26  ASP A HB3  2  
ATOM 1801  N N    . THR A 1 27  ? -3.176  14.683  -2.960  1.00 0.00 ? 27  THR A N    2  
ATOM 1802  C CA   . THR A 1 27  ? -2.200  13.642  -3.256  1.00 0.00 ? 27  THR A CA   2  
ATOM 1803  C C    . THR A 1 27  ? -2.470  13.005  -4.614  1.00 0.00 ? 27  THR A C    2  
ATOM 1804  O O    . THR A 1 27  ? -3.499  12.359  -4.816  1.00 0.00 ? 27  THR A O    2  
ATOM 1805  C CB   . THR A 1 27  ? -2.205  12.544  -2.176  1.00 0.00 ? 27  THR A CB   2  
ATOM 1806  O OG1  . THR A 1 27  ? -1.878  13.108  -0.902  1.00 0.00 ? 27  THR A OG1  2  
ATOM 1807  C CG2  . THR A 1 27  ? -1.212  11.443  -2.519  1.00 0.00 ? 27  THR A CG2  2  
ATOM 1808  H H    . THR A 1 27  ? -3.469  14.815  -2.035  1.00 0.00 ? 27  THR A H    2  
ATOM 1809  H HA   . THR A 1 27  ? -1.220  14.098  -3.271  1.00 0.00 ? 27  THR A HA   2  
ATOM 1810  H HB   . THR A 1 27  ? -3.195  12.113  -2.127  1.00 0.00 ? 27  THR A HB   2  
ATOM 1811  H HG1  . THR A 1 27  ? -0.926  13.087  -0.777  1.00 0.00 ? 27  THR A HG1  2  
ATOM 1812  H HG21 . THR A 1 27  ? -1.462  10.549  -1.967  1.00 0.00 ? 27  THR A HG21 2  
ATOM 1813  H HG22 . THR A 1 27  ? -0.215  11.763  -2.255  1.00 0.00 ? 27  THR A HG22 2  
ATOM 1814  H HG23 . THR A 1 27  ? -1.255  11.237  -3.577  1.00 0.00 ? 27  THR A HG23 2  
ATOM 1815  N N    . THR A 1 28  ? -1.539  13.189  -5.545  1.00 0.00 ? 28  THR A N    2  
ATOM 1816  C CA   . THR A 1 28  ? -1.677  12.632  -6.885  1.00 0.00 ? 28  THR A CA   2  
ATOM 1817  C C    . THR A 1 28  ? -0.813  11.389  -7.056  1.00 0.00 ? 28  THR A C    2  
ATOM 1818  O O    . THR A 1 28  ? 0.211   11.237  -6.389  1.00 0.00 ? 28  THR A O    2  
ATOM 1819  C CB   . THR A 1 28  ? -1.293  13.663  -7.964  1.00 0.00 ? 28  THR A CB   2  
ATOM 1820  O OG1  . THR A 1 28  ? 0.047   14.119  -7.750  1.00 0.00 ? 28  THR A OG1  2  
ATOM 1821  C CG2  . THR A 1 28  ? -2.247  14.848  -7.945  1.00 0.00 ? 28  THR A CG2  2  
ATOM 1822  H H    . THR A 1 28  ? -0.741  13.713  -5.324  1.00 0.00 ? 28  THR A H    2  
ATOM 1823  H HA   . THR A 1 28  ? -2.713  12.361  -7.028  1.00 0.00 ? 28  THR A HA   2  
ATOM 1824  H HB   . THR A 1 28  ? -1.353  13.187  -8.932  1.00 0.00 ? 28  THR A HB   2  
ATOM 1825  H HG1  . THR A 1 28  ? 0.257   14.806  -8.388  1.00 0.00 ? 28  THR A HG1  2  
ATOM 1826  H HG21 . THR A 1 28  ? -2.005  15.518  -8.756  1.00 0.00 ? 28  THR A HG21 2  
ATOM 1827  H HG22 . THR A 1 28  ? -2.152  15.371  -7.005  1.00 0.00 ? 28  THR A HG22 2  
ATOM 1828  H HG23 . THR A 1 28  ? -3.261  14.495  -8.059  1.00 0.00 ? 28  THR A HG23 2  
ATOM 1829  N N    . GLU A 1 29  ? -1.231  10.501  -7.953  1.00 0.00 ? 29  GLU A N    2  
ATOM 1830  C CA   . GLU A 1 29  ? -0.493  9.270   -8.210  1.00 0.00 ? 29  GLU A CA   2  
ATOM 1831  C C    . GLU A 1 29  ? 0.988   9.560   -8.435  1.00 0.00 ? 29  GLU A C    2  
ATOM 1832  O O    . GLU A 1 29  ? 1.843   8.716   -8.170  1.00 0.00 ? 29  GLU A O    2  
ATOM 1833  C CB   . GLU A 1 29  ? -1.073  8.546   -9.427  1.00 0.00 ? 29  GLU A CB   2  
ATOM 1834  C CG   . GLU A 1 29  ? -2.551  8.222   -9.295  1.00 0.00 ? 29  GLU A CG   2  
ATOM 1835  C CD   . GLU A 1 29  ? -3.237  8.069   -10.639 1.00 0.00 ? 29  GLU A CD   2  
ATOM 1836  O OE1  . GLU A 1 29  ? -3.405  9.091   -11.338 1.00 0.00 ? 29  GLU A OE1  2  
ATOM 1837  O OE2  . GLU A 1 29  ? -3.606  6.930   -10.991 1.00 0.00 ? 29  GLU A OE2  2  
ATOM 1838  H H    . GLU A 1 29  ? -2.055  10.678  -8.453  1.00 0.00 ? 29  GLU A H    2  
ATOM 1839  H HA   . GLU A 1 29  ? -0.595  8.635   -7.343  1.00 0.00 ? 29  GLU A HA   2  
ATOM 1840  H HB2  . GLU A 1 29  ? -0.938  9.169   -10.299 1.00 0.00 ? 29  GLU A HB2  2  
ATOM 1841  H HB3  . GLU A 1 29  ? -0.534  7.621   -9.570  1.00 0.00 ? 29  GLU A HB3  2  
ATOM 1842  H HG2  . GLU A 1 29  ? -2.657  7.298   -8.748  1.00 0.00 ? 29  GLU A HG2  2  
ATOM 1843  H HG3  . GLU A 1 29  ? -3.034  9.020   -8.750  1.00 0.00 ? 29  GLU A HG3  2  
ATOM 1844  N N    . GLU A 1 30  ? 1.282   10.760  -8.927  1.00 0.00 ? 30  GLU A N    2  
ATOM 1845  C CA   . GLU A 1 30  ? 2.659   11.161  -9.189  1.00 0.00 ? 30  GLU A CA   2  
ATOM 1846  C C    . GLU A 1 30  ? 3.480   11.162  -7.902  1.00 0.00 ? 30  GLU A C    2  
ATOM 1847  O O    . GLU A 1 30  ? 4.555   10.564  -7.837  1.00 0.00 ? 30  GLU A O    2  
ATOM 1848  C CB   . GLU A 1 30  ? 2.696   12.549  -9.831  1.00 0.00 ? 30  GLU A CB   2  
ATOM 1849  C CG   . GLU A 1 30  ? 2.642   12.519  -11.350 1.00 0.00 ? 30  GLU A CG   2  
ATOM 1850  C CD   . GLU A 1 30  ? 2.339   13.878  -11.950 1.00 0.00 ? 30  GLU A CD   2  
ATOM 1851  O OE1  . GLU A 1 30  ? 3.283   14.679  -12.114 1.00 0.00 ? 30  GLU A OE1  2  
ATOM 1852  O OE2  . GLU A 1 30  ? 1.157   14.140  -12.256 1.00 0.00 ? 30  GLU A OE2  2  
ATOM 1853  H H    . GLU A 1 30  ? 0.556   11.390  -9.118  1.00 0.00 ? 30  GLU A H    2  
ATOM 1854  H HA   . GLU A 1 30  ? 3.088   10.446  -9.874  1.00 0.00 ? 30  GLU A HA   2  
ATOM 1855  H HB2  . GLU A 1 30  ? 1.854   13.121  -9.473  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 1856  H HB3  . GLU A 1 30  ? 3.609   13.045  -9.535  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 1857  H HG2  . GLU A 1 30  ? 3.597   12.182  -11.725 1.00 0.00 ? 30  GLU A HG2  2  
ATOM 1858  H HG3  . GLU A 1 30  ? 1.872   11.826  -11.656 1.00 0.00 ? 30  GLU A HG3  2  
ATOM 1859  N N    . THR A 1 31  ? 2.966   11.839  -6.880  1.00 0.00 ? 31  THR A N    2  
ATOM 1860  C CA   . THR A 1 31  ? 3.650   11.920  -5.596  1.00 0.00 ? 31  THR A CA   2  
ATOM 1861  C C    . THR A 1 31  ? 3.538   10.607  -4.829  1.00 0.00 ? 31  THR A C    2  
ATOM 1862  O O    . THR A 1 31  ? 4.289   10.363  -3.883  1.00 0.00 ? 31  THR A O    2  
ATOM 1863  C CB   . THR A 1 31  ? 3.082   13.058  -4.728  1.00 0.00 ? 31  THR A CB   2  
ATOM 1864  O OG1  . THR A 1 31  ? 4.045   13.450  -3.743  1.00 0.00 ? 31  THR A OG1  2  
ATOM 1865  C CG2  . THR A 1 31  ? 1.795   12.626  -4.042  1.00 0.00 ? 31  THR A CG2  2  
ATOM 1866  H H    . THR A 1 31  ? 2.106   12.294  -6.994  1.00 0.00 ? 31  THR A H    2  
ATOM 1867  H HA   . THR A 1 31  ? 4.693   12.127  -5.786  1.00 0.00 ? 31  THR A HA   2  
ATOM 1868  H HB   . THR A 1 31  ? 2.866   13.904  -5.365  1.00 0.00 ? 31  THR A HB   2  
ATOM 1869  H HG1  . THR A 1 31  ? 3.995   12.855  -2.991  1.00 0.00 ? 31  THR A HG1  2  
ATOM 1870  H HG21 . THR A 1 31  ? 1.444   11.704  -4.483  1.00 0.00 ? 31  THR A HG21 2  
ATOM 1871  H HG22 . THR A 1 31  ? 1.045   13.393  -4.166  1.00 0.00 ? 31  THR A HG22 2  
ATOM 1872  H HG23 . THR A 1 31  ? 1.982   12.472  -2.990  1.00 0.00 ? 31  THR A HG23 2  
ATOM 1873  N N    . LEU A 1 32  ? 2.598   9.765   -5.242  1.00 0.00 ? 32  LEU A N    2  
ATOM 1874  C CA   . LEU A 1 32  ? 2.388   8.475   -4.594  1.00 0.00 ? 32  LEU A CA   2  
ATOM 1875  C C    . LEU A 1 32  ? 3.394   7.444   -5.094  1.00 0.00 ? 32  LEU A C    2  
ATOM 1876  O O    . LEU A 1 32  ? 3.870   6.602   -4.331  1.00 0.00 ? 32  LEU A O    2  
ATOM 1877  C CB   . LEU A 1 32  ? 0.963   7.979   -4.849  1.00 0.00 ? 32  LEU A CB   2  
ATOM 1878  C CG   . LEU A 1 32  ? 0.560   6.695   -4.124  1.00 0.00 ? 32  LEU A CG   2  
ATOM 1879  C CD1  . LEU A 1 32  ? 0.584   6.902   -2.617  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 1880  C CD2  . LEU A 1 32  ? -0.818  6.236   -4.579  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 1881  H H    . LEU A 1 32  ? 2.031   10.015  -6.000  1.00 0.00 ? 32  LEU A H    2  
ATOM 1882  H HA   . LEU A 1 32  ? 2.528   8.611   -3.532  1.00 0.00 ? 32  LEU A HA   2  
ATOM 1883  H HB2  . LEU A 1 32  ? 0.283   8.759   -4.544  1.00 0.00 ? 32  LEU A HB2  2  
ATOM 1884  H HB3  . LEU A 1 32  ? 0.859   7.808   -5.911  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 1885  H HG   . LEU A 1 32  ? 1.269   5.915   -4.364  1.00 0.00 ? 32  LEU A HG   2  
ATOM 1886  H HD11 . LEU A 1 32  ? 0.568   7.959   -2.399  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 1887  H HD12 . LEU A 1 32  ? 1.481   6.464   -2.208  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 1888  H HD13 . LEU A 1 32  ? -0.281  6.430   -2.175  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 1889  H HD21 . LEU A 1 32  ? -1.082  6.745   -5.495  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 1890  H HD22 . LEU A 1 32  ? -1.546  6.470   -3.815  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 1891  H HD23 . LEU A 1 32  ? -0.804  5.170   -4.750  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 1892  N N    . LYS A 1 33  ? 3.717   7.516   -6.381  1.00 0.00 ? 33  LYS A N    2  
ATOM 1893  C CA   . LYS A 1 33  ? 4.670   6.592   -6.985  1.00 0.00 ? 33  LYS A CA   2  
ATOM 1894  C C    . LYS A 1 33  ? 6.089   6.888   -6.512  1.00 0.00 ? 33  LYS A C    2  
ATOM 1895  O O    . LYS A 1 33  ? 6.791   5.999   -6.032  1.00 0.00 ? 33  LYS A O    2  
ATOM 1896  C CB   . LYS A 1 33  ? 4.601   6.680   -8.511  1.00 0.00 ? 33  LYS A CB   2  
ATOM 1897  C CG   . LYS A 1 33  ? 5.293   5.528   -9.219  1.00 0.00 ? 33  LYS A CG   2  
ATOM 1898  C CD   . LYS A 1 33  ? 5.847   5.955   -10.568 1.00 0.00 ? 33  LYS A CD   2  
ATOM 1899  C CE   . LYS A 1 33  ? 7.039   5.103   -10.976 1.00 0.00 ? 33  LYS A CE   2  
ATOM 1900  N NZ   . LYS A 1 33  ? 8.321   5.663   -10.466 1.00 0.00 ? 33  LYS A NZ   2  
ATOM 1901  H H    . LYS A 1 33  ? 3.304   8.209   -6.939  1.00 0.00 ? 33  LYS A H    2  
ATOM 1902  H HA   . LYS A 1 33  ? 4.402   5.592   -6.678  1.00 0.00 ? 33  LYS A HA   2  
ATOM 1903  H HB2  . LYS A 1 33  ? 3.564   6.690   -8.812  1.00 0.00 ? 33  LYS A HB2  2  
ATOM 1904  H HB3  . LYS A 1 33  ? 5.067   7.602   -8.828  1.00 0.00 ? 33  LYS A HB3  2  
ATOM 1905  H HG2  . LYS A 1 33  ? 6.107   5.176   -8.603  1.00 0.00 ? 33  LYS A HG2  2  
ATOM 1906  H HG3  . LYS A 1 33  ? 4.580   4.729   -9.369  1.00 0.00 ? 33  LYS A HG3  2  
ATOM 1907  H HD2  . LYS A 1 33  ? 5.073   5.852   -11.314 1.00 0.00 ? 33  LYS A HD2  2  
ATOM 1908  H HD3  . LYS A 1 33  ? 6.157   6.988   -10.509 1.00 0.00 ? 33  LYS A HD3  2  
ATOM 1909  H HE2  . LYS A 1 33  ? 6.907   4.108   -10.578 1.00 0.00 ? 33  LYS A HE2  2  
ATOM 1910  H HE3  . LYS A 1 33  ? 7.079   5.056   -12.054 1.00 0.00 ? 33  LYS A HE3  2  
ATOM 1911  H HZ1  . LYS A 1 33  ? 8.626   6.457   -11.065 1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 1912  H HZ2  . LYS A 1 33  ? 9.060   4.931   -10.478 1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 1913  H HZ3  . LYS A 1 33  ? 8.201   6.003   -9.491  1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 1914  N N    . GLU A 1 34  ? 6.505   8.144   -6.649  1.00 0.00 ? 34  GLU A N    2  
ATOM 1915  C CA   . GLU A 1 34  ? 7.840   8.556   -6.235  1.00 0.00 ? 34  GLU A CA   2  
ATOM 1916  C C    . GLU A 1 34  ? 8.092   8.194   -4.774  1.00 0.00 ? 34  GLU A C    2  
ATOM 1917  O O    . GLU A 1 34  ? 9.164   7.702   -4.421  1.00 0.00 ? 34  GLU A O    2  
ATOM 1918  C CB   . GLU A 1 34  ? 8.020   10.062  -6.437  1.00 0.00 ? 34  GLU A CB   2  
ATOM 1919  C CG   . GLU A 1 34  ? 7.951   10.492  -7.893  1.00 0.00 ? 34  GLU A CG   2  
ATOM 1920  C CD   . GLU A 1 34  ? 8.644   11.818  -8.143  1.00 0.00 ? 34  GLU A CD   2  
ATOM 1921  O OE1  . GLU A 1 34  ? 9.829   11.946  -7.771  1.00 0.00 ? 34  GLU A OE1  2  
ATOM 1922  O OE2  . GLU A 1 34  ? 8.002   12.726  -8.709  1.00 0.00 ? 34  GLU A OE2  2  
ATOM 1923  H H    . GLU A 1 34  ? 5.898   8.808   -7.039  1.00 0.00 ? 34  GLU A H    2  
ATOM 1924  H HA   . GLU A 1 34  ? 8.555   8.031   -6.851  1.00 0.00 ? 34  GLU A HA   2  
ATOM 1925  H HB2  . GLU A 1 34  ? 7.245   10.581  -5.892  1.00 0.00 ? 34  GLU A HB2  2  
ATOM 1926  H HB3  . GLU A 1 34  ? 8.982   10.353  -6.043  1.00 0.00 ? 34  GLU A HB3  2  
ATOM 1927  H HG2  . GLU A 1 34  ? 8.423   9.736   -8.502  1.00 0.00 ? 34  GLU A HG2  2  
ATOM 1928  H HG3  . GLU A 1 34  ? 6.913   10.586  -8.178  1.00 0.00 ? 34  GLU A HG3  2  
ATOM 1929  N N    . SER A 1 35  ? 7.097   8.443   -3.929  1.00 0.00 ? 35  SER A N    2  
ATOM 1930  C CA   . SER A 1 35  ? 7.211   8.149   -2.505  1.00 0.00 ? 35  SER A CA   2  
ATOM 1931  C C    . SER A 1 35  ? 7.964   6.841   -2.279  1.00 0.00 ? 35  SER A C    2  
ATOM 1932  O O    . SER A 1 35  ? 8.651   6.673   -1.272  1.00 0.00 ? 35  SER A O    2  
ATOM 1933  C CB   . SER A 1 35  ? 5.823   8.068   -1.866  1.00 0.00 ? 35  SER A CB   2  
ATOM 1934  O OG   . SER A 1 35  ? 5.351   9.355   -1.507  1.00 0.00 ? 35  SER A OG   2  
ATOM 1935  H H    . SER A 1 35  ? 6.267   8.836   -4.271  1.00 0.00 ? 35  SER A H    2  
ATOM 1936  H HA   . SER A 1 35  ? 7.764   8.953   -2.043  1.00 0.00 ? 35  SER A HA   2  
ATOM 1937  H HB2  . SER A 1 35  ? 5.132   7.627   -2.568  1.00 0.00 ? 35  SER A HB2  2  
ATOM 1938  H HB3  . SER A 1 35  ? 5.874   7.455   -0.978  1.00 0.00 ? 35  SER A HB3  2  
ATOM 1939  H HG   . SER A 1 35  ? 5.684   10.004  -2.132  1.00 0.00 ? 35  SER A HG   2  
ATOM 1940  N N    . PHE A 1 36  ? 7.829   5.917   -3.225  1.00 0.00 ? 36  PHE A N    2  
ATOM 1941  C CA   . PHE A 1 36  ? 8.495   4.623   -3.131  1.00 0.00 ? 36  PHE A CA   2  
ATOM 1942  C C    . PHE A 1 36  ? 9.619   4.514   -4.158  1.00 0.00 ? 36  PHE A C    2  
ATOM 1943  O O    . PHE A 1 36  ? 9.369   4.355   -5.352  1.00 0.00 ? 36  PHE A O    2  
ATOM 1944  C CB   . PHE A 1 36  ? 7.488   3.491   -3.338  1.00 0.00 ? 36  PHE A CB   2  
ATOM 1945  C CG   . PHE A 1 36  ? 6.235   3.646   -2.523  1.00 0.00 ? 36  PHE A CG   2  
ATOM 1946  C CD1  . PHE A 1 36  ? 5.204   4.461   -2.962  1.00 0.00 ? 36  PHE A CD1  2  
ATOM 1947  C CD2  . PHE A 1 36  ? 6.089   2.977   -1.318  1.00 0.00 ? 36  PHE A CD2  2  
ATOM 1948  C CE1  . PHE A 1 36  ? 4.051   4.606   -2.213  1.00 0.00 ? 36  PHE A CE1  2  
ATOM 1949  C CE2  . PHE A 1 36  ? 4.939   3.118   -0.566  1.00 0.00 ? 36  PHE A CE2  2  
ATOM 1950  C CZ   . PHE A 1 36  ? 3.918   3.933   -1.014  1.00 0.00 ? 36  PHE A CZ   2  
ATOM 1951  H H    . PHE A 1 36  ? 7.268   6.110   -4.005  1.00 0.00 ? 36  PHE A H    2  
ATOM 1952  H HA   . PHE A 1 36  ? 8.919   4.541   -2.142  1.00 0.00 ? 36  PHE A HA   2  
ATOM 1953  H HB2  . PHE A 1 36  ? 7.203   3.457   -4.379  1.00 0.00 ? 36  PHE A HB2  2  
ATOM 1954  H HB3  . PHE A 1 36  ? 7.949   2.554   -3.064  1.00 0.00 ? 36  PHE A HB3  2  
ATOM 1955  H HD1  . PHE A 1 36  ? 5.306   4.987   -3.899  1.00 0.00 ? 36  PHE A HD1  2  
ATOM 1956  H HD2  . PHE A 1 36  ? 6.888   2.339   -0.966  1.00 0.00 ? 36  PHE A HD2  2  
ATOM 1957  H HE1  . PHE A 1 36  ? 3.254   5.243   -2.567  1.00 0.00 ? 36  PHE A HE1  2  
ATOM 1958  H HE2  . PHE A 1 36  ? 4.838   2.591   0.371   1.00 0.00 ? 36  PHE A HE2  2  
ATOM 1959  H HZ   . PHE A 1 36  ? 3.018   4.045   -0.428  1.00 0.00 ? 36  PHE A HZ   2  
ATOM 1960  N N    . ASP A 1 37  ? 10.856  4.601   -3.683  1.00 0.00 ? 37  ASP A N    2  
ATOM 1961  C CA   . ASP A 1 37  ? 12.019  4.511   -4.558  1.00 0.00 ? 37  ASP A CA   2  
ATOM 1962  C C    . ASP A 1 37  ? 12.177  3.097   -5.109  1.00 0.00 ? 37  ASP A C    2  
ATOM 1963  O O    . ASP A 1 37  ? 12.939  2.293   -4.574  1.00 0.00 ? 37  ASP A O    2  
ATOM 1964  C CB   . ASP A 1 37  ? 13.285  4.922   -3.804  1.00 0.00 ? 37  ASP A CB   2  
ATOM 1965  C CG   . ASP A 1 37  ? 13.517  6.420   -3.838  1.00 0.00 ? 37  ASP A CG   2  
ATOM 1966  O OD1  . ASP A 1 37  ? 13.283  7.034   -4.900  1.00 0.00 ? 37  ASP A OD1  2  
ATOM 1967  O OD2  . ASP A 1 37  ? 13.933  6.978   -2.801  1.00 0.00 ? 37  ASP A OD2  2  
ATOM 1968  H H    . ASP A 1 37  ? 10.991  4.727   -2.720  1.00 0.00 ? 37  ASP A H    2  
ATOM 1969  H HA   . ASP A 1 37  ? 11.866  5.190   -5.383  1.00 0.00 ? 37  ASP A HA   2  
ATOM 1970  H HB2  . ASP A 1 37  ? 13.198  4.613   -2.773  1.00 0.00 ? 37  ASP A HB2  2  
ATOM 1971  H HB3  . ASP A 1 37  ? 14.137  4.433   -4.252  1.00 0.00 ? 37  ASP A HB3  2  
ATOM 1972  N N    . GLY A 1 38  ? 11.449  2.800   -6.181  1.00 0.00 ? 38  GLY A N    2  
ATOM 1973  C CA   . GLY A 1 38  ? 11.522  1.482   -6.785  1.00 0.00 ? 38  GLY A CA   2  
ATOM 1974  C C    . GLY A 1 38  ? 10.266  1.128   -7.557  1.00 0.00 ? 38  GLY A C    2  
ATOM 1975  O O    . GLY A 1 38  ? 10.336  0.506   -8.617  1.00 0.00 ? 38  GLY A O    2  
ATOM 1976  H H    . GLY A 1 38  ? 10.858  3.481   -6.565  1.00 0.00 ? 38  GLY A H    2  
ATOM 1977  H HA2  . GLY A 1 38  ? 12.366  1.453   -7.458  1.00 0.00 ? 38  GLY A HA2  2  
ATOM 1978  H HA3  . GLY A 1 38  ? 11.670  0.749   -6.006  1.00 0.00 ? 38  GLY A HA3  2  
ATOM 1979  N N    . SER A 1 39  ? 9.115   1.525   -7.025  1.00 0.00 ? 39  SER A N    2  
ATOM 1980  C CA   . SER A 1 39  ? 7.837   1.241   -7.668  1.00 0.00 ? 39  SER A CA   2  
ATOM 1981  C C    . SER A 1 39  ? 7.887   1.588   -9.153  1.00 0.00 ? 39  SER A C    2  
ATOM 1982  O O    . SER A 1 39  ? 8.751   2.346   -9.596  1.00 0.00 ? 39  SER A O    2  
ATOM 1983  C CB   . SER A 1 39  ? 6.714   2.025   -6.987  1.00 0.00 ? 39  SER A CB   2  
ATOM 1984  O OG   . SER A 1 39  ? 6.820   3.411   -7.262  1.00 0.00 ? 39  SER A OG   2  
ATOM 1985  H H    . SER A 1 39  ? 9.125   2.018   -6.178  1.00 0.00 ? 39  SER A H    2  
ATOM 1986  H HA   . SER A 1 39  ? 7.641   0.184   -7.564  1.00 0.00 ? 39  SER A HA   2  
ATOM 1987  H HB2  . SER A 1 39  ? 5.761   1.670   -7.349  1.00 0.00 ? 39  SER A HB2  2  
ATOM 1988  H HB3  . SER A 1 39  ? 6.772   1.876   -5.918  1.00 0.00 ? 39  SER A HB3  2  
ATOM 1989  H HG   . SER A 1 39  ? 6.864   3.899   -6.436  1.00 0.00 ? 39  SER A HG   2  
ATOM 1990  N N    . VAL A 1 40  ? 6.955   1.029   -9.917  1.00 0.00 ? 40  VAL A N    2  
ATOM 1991  C CA   . VAL A 1 40  ? 6.891   1.279   -11.352 1.00 0.00 ? 40  VAL A CA   2  
ATOM 1992  C C    . VAL A 1 40  ? 5.657   2.099   -11.712 1.00 0.00 ? 40  VAL A C    2  
ATOM 1993  O O    . VAL A 1 40  ? 5.695   2.929   -12.621 1.00 0.00 ? 40  VAL A O    2  
ATOM 1994  C CB   . VAL A 1 40  ? 6.870   -0.038  -12.151 1.00 0.00 ? 40  VAL A CB   2  
ATOM 1995  C CG1  . VAL A 1 40  ? 8.247   -0.684  -12.152 1.00 0.00 ? 40  VAL A CG1  2  
ATOM 1996  C CG2  . VAL A 1 40  ? 5.826   -0.988  -11.585 1.00 0.00 ? 40  VAL A CG2  2  
ATOM 1997  H H    . VAL A 1 40  ? 6.294   0.433   -9.506  1.00 0.00 ? 40  VAL A H    2  
ATOM 1998  H HA   . VAL A 1 40  ? 7.775   1.833   -11.634 1.00 0.00 ? 40  VAL A HA   2  
ATOM 1999  H HB   . VAL A 1 40  ? 6.603   0.189   -13.173 1.00 0.00 ? 40  VAL A HB   2  
ATOM 2000  H HG11 . VAL A 1 40  ? 9.002   0.078   -12.272 1.00 0.00 ? 40  VAL A HG11 2  
ATOM 2001  H HG12 . VAL A 1 40  ? 8.402   -1.202  -11.216 1.00 0.00 ? 40  VAL A HG12 2  
ATOM 2002  H HG13 . VAL A 1 40  ? 8.313   -1.388  -12.968 1.00 0.00 ? 40  VAL A HG13 2  
ATOM 2003  H HG21 . VAL A 1 40  ? 4.874   -0.481  -11.524 1.00 0.00 ? 40  VAL A HG21 2  
ATOM 2004  H HG22 . VAL A 1 40  ? 5.734   -1.849  -12.230 1.00 0.00 ? 40  VAL A HG22 2  
ATOM 2005  H HG23 . VAL A 1 40  ? 6.127   -1.308  -10.598 1.00 0.00 ? 40  VAL A HG23 2  
ATOM 2006  N N    . ARG A 1 41  ? 4.565   1.861   -10.994 1.00 0.00 ? 41  ARG A N    2  
ATOM 2007  C CA   . ARG A 1 41  ? 3.319   2.577   -11.238 1.00 0.00 ? 41  ARG A CA   2  
ATOM 2008  C C    . ARG A 1 41  ? 2.559   2.806   -9.935  1.00 0.00 ? 41  ARG A C    2  
ATOM 2009  O O    . ARG A 1 41  ? 2.783   2.112   -8.944  1.00 0.00 ? 41  ARG A O    2  
ATOM 2010  C CB   . ARG A 1 41  ? 2.443   1.799   -12.221 1.00 0.00 ? 41  ARG A CB   2  
ATOM 2011  C CG   . ARG A 1 41  ? 3.104   1.559   -13.569 1.00 0.00 ? 41  ARG A CG   2  
ATOM 2012  C CD   . ARG A 1 41  ? 2.138   0.929   -14.560 1.00 0.00 ? 41  ARG A CD   2  
ATOM 2013  N NE   . ARG A 1 41  ? 2.786   0.610   -15.829 1.00 0.00 ? 41  ARG A NE   2  
ATOM 2014  C CZ   . ARG A 1 41  ? 2.256   -0.195  -16.743 1.00 0.00 ? 41  ARG A CZ   2  
ATOM 2015  N NH1  . ARG A 1 41  ? 1.075   -0.759  -16.529 1.00 0.00 ? 41  ARG A NH1  2  
ATOM 2016  N NH2  . ARG A 1 41  ? 2.907   -0.437  -17.873 1.00 0.00 ? 41  ARG A NH2  2  
ATOM 2017  H H    . ARG A 1 41  ? 4.597   1.187   -10.283 1.00 0.00 ? 41  ARG A H    2  
ATOM 2018  H HA   . ARG A 1 41  ? 3.566   3.535   -11.670 1.00 0.00 ? 41  ARG A HA   2  
ATOM 2019  H HB2  . ARG A 1 41  ? 2.200   0.839   -11.789 1.00 0.00 ? 41  ARG A HB2  2  
ATOM 2020  H HB3  . ARG A 1 41  ? 1.530   2.351   -12.386 1.00 0.00 ? 41  ARG A HB3  2  
ATOM 2021  H HG2  . ARG A 1 41  ? 3.444   2.504   -13.966 1.00 0.00 ? 41  ARG A HG2  2  
ATOM 2022  H HG3  . ARG A 1 41  ? 3.948   0.899   -13.432 1.00 0.00 ? 41  ARG A HG3  2  
ATOM 2023  H HD2  . ARG A 1 41  ? 1.743   0.021   -14.129 1.00 0.00 ? 41  ARG A HD2  2  
ATOM 2024  H HD3  . ARG A 1 41  ? 1.329   1.621   -14.743 1.00 0.00 ? 41  ARG A HD3  2  
ATOM 2025  H HE   . ARG A 1 41  ? 3.660   1.016   -16.007 1.00 0.00 ? 41  ARG A HE   2  
ATOM 2026  H HH11 . ARG A 1 41  ? 0.582   -0.578  -15.679 1.00 0.00 ? 41  ARG A HH11 2  
ATOM 2027  H HH12 . ARG A 1 41  ? 0.678   -1.364  -17.219 1.00 0.00 ? 41  ARG A HH12 2  
ATOM 2028  H HH21 . ARG A 1 41  ? 3.797   -0.013  -18.038 1.00 0.00 ? 41  ARG A HH21 2  
ATOM 2029  H HH22 . ARG A 1 41  ? 2.508   -1.043  -18.560 1.00 0.00 ? 41  ARG A HH22 2  
ATOM 2030  N N    . ALA A 1 42  ? 1.660   3.785   -9.944  1.00 0.00 ? 42  ALA A N    2  
ATOM 2031  C CA   . ALA A 1 42  ? 0.866   4.105   -8.764  1.00 0.00 ? 42  ALA A CA   2  
ATOM 2032  C C    . ALA A 1 42  ? -0.568  4.457   -9.146  1.00 0.00 ? 42  ALA A C    2  
ATOM 2033  O O    . ALA A 1 42  ? -0.823  4.962   -10.239 1.00 0.00 ? 42  ALA A O    2  
ATOM 2034  C CB   . ALA A 1 42  ? 1.505   5.250   -7.993  1.00 0.00 ? 42  ALA A CB   2  
ATOM 2035  H H    . ALA A 1 42  ? 1.526   4.303   -10.765 1.00 0.00 ? 42  ALA A H    2  
ATOM 2036  H HA   . ALA A 1 42  ? 0.855   3.235   -8.124  1.00 0.00 ? 42  ALA A HA   2  
ATOM 2037  H HB1  . ALA A 1 42  ? 1.556   6.125   -8.625  1.00 0.00 ? 42  ALA A HB1  2  
ATOM 2038  H HB2  . ALA A 1 42  ? 0.911   5.471   -7.119  1.00 0.00 ? 42  ALA A HB2  2  
ATOM 2039  H HB3  . ALA A 1 42  ? 2.502   4.967   -7.690  1.00 0.00 ? 42  ALA A HB3  2  
ATOM 2040  N N    . ARG A 1 43  ? -1.500  4.185   -8.238  1.00 0.00 ? 43  ARG A N    2  
ATOM 2041  C CA   . ARG A 1 43  ? -2.909  4.472   -8.481  1.00 0.00 ? 43  ARG A CA   2  
ATOM 2042  C C    . ARG A 1 43  ? -3.552  5.115   -7.256  1.00 0.00 ? 43  ARG A C    2  
ATOM 2043  O O    . ARG A 1 43  ? -3.117  4.892   -6.126  1.00 0.00 ? 43  ARG A O    2  
ATOM 2044  C CB   . ARG A 1 43  ? -3.656  3.188   -8.848  1.00 0.00 ? 43  ARG A CB   2  
ATOM 2045  C CG   . ARG A 1 43  ? -3.010  2.410   -9.983  1.00 0.00 ? 43  ARG A CG   2  
ATOM 2046  C CD   . ARG A 1 43  ? -3.549  2.848   -11.336 1.00 0.00 ? 43  ARG A CD   2  
ATOM 2047  N NE   . ARG A 1 43  ? -4.731  2.085   -11.727 1.00 0.00 ? 43  ARG A NE   2  
ATOM 2048  C CZ   . ARG A 1 43  ? -4.676  0.902   -12.328 1.00 0.00 ? 43  ARG A CZ   2  
ATOM 2049  N NH1  . ARG A 1 43  ? -3.503  0.349   -12.604 1.00 0.00 ? 43  ARG A NH1  2  
ATOM 2050  N NH2  . ARG A 1 43  ? -5.795  0.268   -12.653 1.00 0.00 ? 43  ARG A NH2  2  
ATOM 2051  H H    . ARG A 1 43  ? -1.234  3.782   -7.385  1.00 0.00 ? 43  ARG A H    2  
ATOM 2052  H HA   . ARG A 1 43  ? -2.969  5.162   -9.309  1.00 0.00 ? 43  ARG A HA   2  
ATOM 2053  H HB2  . ARG A 1 43  ? -3.696  2.548   -7.979  1.00 0.00 ? 43  ARG A HB2  2  
ATOM 2054  H HB3  . ARG A 1 43  ? -4.662  3.444   -9.143  1.00 0.00 ? 43  ARG A HB3  2  
ATOM 2055  H HG2  . ARG A 1 43  ? -1.944  2.579   -9.961  1.00 0.00 ? 43  ARG A HG2  2  
ATOM 2056  H HG3  . ARG A 1 43  ? -3.213  1.359   -9.847  1.00 0.00 ? 43  ARG A HG3  2  
ATOM 2057  H HD2  . ARG A 1 43  ? -3.810  3.895   -11.283 1.00 0.00 ? 43  ARG A HD2  2  
ATOM 2058  H HD3  . ARG A 1 43  ? -2.778  2.706   -12.078 1.00 0.00 ? 43  ARG A HD3  2  
ATOM 2059  H HE   . ARG A 1 43  ? -5.608  2.475   -11.532 1.00 0.00 ? 43  ARG A HE   2  
ATOM 2060  H HH11 . ARG A 1 43  ? -2.657  0.823   -12.359 1.00 0.00 ? 43  ARG A HH11 2  
ATOM 2061  H HH12 . ARG A 1 43  ? -3.464  -0.543  -13.056 1.00 0.00 ? 43  ARG A HH12 2  
ATOM 2062  H HH21 . ARG A 1 43  ? -6.682  0.682   -12.446 1.00 0.00 ? 43  ARG A HH21 2  
ATOM 2063  H HH22 . ARG A 1 43  ? -5.753  -0.622  -13.105 1.00 0.00 ? 43  ARG A HH22 2  
ATOM 2064  N N    . ILE A 1 44  ? -4.587  5.914   -7.489  1.00 0.00 ? 44  ILE A N    2  
ATOM 2065  C CA   . ILE A 1 44  ? -5.290  6.589   -6.405  1.00 0.00 ? 44  ILE A CA   2  
ATOM 2066  C C    . ILE A 1 44  ? -6.801  6.507   -6.594  1.00 0.00 ? 44  ILE A C    2  
ATOM 2067  O O    . ILE A 1 44  ? -7.321  6.813   -7.667  1.00 0.00 ? 44  ILE A O    2  
ATOM 2068  C CB   . ILE A 1 44  ? -4.876  8.069   -6.301  1.00 0.00 ? 44  ILE A CB   2  
ATOM 2069  C CG1  . ILE A 1 44  ? -3.387  8.183   -5.968  1.00 0.00 ? 44  ILE A CG1  2  
ATOM 2070  C CG2  . ILE A 1 44  ? -5.715  8.781   -5.251  1.00 0.00 ? 44  ILE A CG2  2  
ATOM 2071  C CD1  . ILE A 1 44  ? -2.935  9.600   -5.695  1.00 0.00 ? 44  ILE A CD1  2  
ATOM 2072  H H    . ILE A 1 44  ? -4.887  6.052   -8.412  1.00 0.00 ? 44  ILE A H    2  
ATOM 2073  H HA   . ILE A 1 44  ? -5.026  6.097   -5.480  1.00 0.00 ? 44  ILE A HA   2  
ATOM 2074  H HB   . ILE A 1 44  ? -5.062  8.539   -7.255  1.00 0.00 ? 44  ILE A HB   2  
ATOM 2075  H HG12 . ILE A 1 44  ? -3.175  7.593   -5.091  1.00 0.00 ? 44  ILE A HG12 2  
ATOM 2076  H HG13 . ILE A 1 44  ? -2.810  7.804   -6.800  1.00 0.00 ? 44  ILE A HG13 2  
ATOM 2077  H HG21 . ILE A 1 44  ? -5.088  9.056   -4.415  1.00 0.00 ? 44  ILE A HG21 2  
ATOM 2078  H HG22 . ILE A 1 44  ? -6.151  9.670   -5.681  1.00 0.00 ? 44  ILE A HG22 2  
ATOM 2079  H HG23 . ILE A 1 44  ? -6.501  8.123   -4.910  1.00 0.00 ? 44  ILE A HG23 2  
ATOM 2080  H HD11 . ILE A 1 44  ? -3.244  9.892   -4.702  1.00 0.00 ? 44  ILE A HD11 2  
ATOM 2081  H HD12 . ILE A 1 44  ? -1.860  9.657   -5.771  1.00 0.00 ? 44  ILE A HD12 2  
ATOM 2082  H HD13 . ILE A 1 44  ? -3.383  10.266  -6.420  1.00 0.00 ? 44  ILE A HD13 2  
ATOM 2083  N N    . VAL A 1 45  ? -7.502  6.094   -5.543  1.00 0.00 ? 45  VAL A N    2  
ATOM 2084  C CA   . VAL A 1 45  ? -8.954  5.975   -5.591  1.00 0.00 ? 45  VAL A CA   2  
ATOM 2085  C C    . VAL A 1 45  ? -9.618  7.348   -5.600  1.00 0.00 ? 45  VAL A C    2  
ATOM 2086  O O    . VAL A 1 45  ? -9.060  8.324   -5.099  1.00 0.00 ? 45  VAL A O    2  
ATOM 2087  C CB   . VAL A 1 45  ? -9.491  5.165   -4.396  1.00 0.00 ? 45  VAL A CB   2  
ATOM 2088  C CG1  . VAL A 1 45  ? -8.593  3.971   -4.114  1.00 0.00 ? 45  VAL A CG1  2  
ATOM 2089  C CG2  . VAL A 1 45  ? -9.616  6.051   -3.166  1.00 0.00 ? 45  VAL A CG2  2  
ATOM 2090  H H    . VAL A 1 45  ? -7.031  5.865   -4.714  1.00 0.00 ? 45  VAL A H    2  
ATOM 2091  H HA   . VAL A 1 45  ? -9.216  5.453   -6.500  1.00 0.00 ? 45  VAL A HA   2  
ATOM 2092  H HB   . VAL A 1 45  ? -10.474 4.797   -4.650  1.00 0.00 ? 45  VAL A HB   2  
ATOM 2093  H HG11 . VAL A 1 45  ? -8.219  3.574   -5.046  1.00 0.00 ? 45  VAL A HG11 2  
ATOM 2094  H HG12 . VAL A 1 45  ? -7.764  4.281   -3.495  1.00 0.00 ? 45  VAL A HG12 2  
ATOM 2095  H HG13 . VAL A 1 45  ? -9.160  3.208   -3.600  1.00 0.00 ? 45  VAL A HG13 2  
ATOM 2096  H HG21 . VAL A 1 45  ? -10.659 6.265   -2.981  1.00 0.00 ? 45  VAL A HG21 2  
ATOM 2097  H HG22 . VAL A 1 45  ? -9.196  5.542   -2.310  1.00 0.00 ? 45  VAL A HG22 2  
ATOM 2098  H HG23 . VAL A 1 45  ? -9.083  6.975   -3.331  1.00 0.00 ? 45  VAL A HG23 2  
ATOM 2099  N N    . THR A 1 46  ? -10.816 7.416   -6.174  1.00 0.00 ? 46  THR A N    2  
ATOM 2100  C CA   . THR A 1 46  ? -11.557 8.668   -6.249  1.00 0.00 ? 46  THR A CA   2  
ATOM 2101  C C    . THR A 1 46  ? -13.049 8.438   -6.040  1.00 0.00 ? 46  THR A C    2  
ATOM 2102  O O    . THR A 1 46  ? -13.566 7.358   -6.325  1.00 0.00 ? 46  THR A O    2  
ATOM 2103  C CB   . THR A 1 46  ? -11.342 9.367   -7.605  1.00 0.00 ? 46  THR A CB   2  
ATOM 2104  O OG1  . THR A 1 46  ? -11.688 8.480   -8.674  1.00 0.00 ? 46  THR A OG1  2  
ATOM 2105  C CG2  . THR A 1 46  ? -9.897  9.816   -7.760  1.00 0.00 ? 46  THR A CG2  2  
ATOM 2106  H H    . THR A 1 46  ? -11.209 6.603   -6.556  1.00 0.00 ? 46  THR A H    2  
ATOM 2107  H HA   . THR A 1 46  ? -11.190 9.320   -5.470  1.00 0.00 ? 46  THR A HA   2  
ATOM 2108  H HB   . THR A 1 46  ? -11.980 10.238  -7.649  1.00 0.00 ? 46  THR A HB   2  
ATOM 2109  H HG1  . THR A 1 46  ? -12.368 7.870   -8.377  1.00 0.00 ? 46  THR A HG1  2  
ATOM 2110  H HG21 . THR A 1 46  ? -9.254  8.949   -7.805  1.00 0.00 ? 46  THR A HG21 2  
ATOM 2111  H HG22 . THR A 1 46  ? -9.617  10.428  -6.916  1.00 0.00 ? 46  THR A HG22 2  
ATOM 2112  H HG23 . THR A 1 46  ? -9.793  10.387  -8.670  1.00 0.00 ? 46  THR A HG23 2  
ATOM 2113  N N    . ASP A 1 47  ? -13.736 9.459   -5.542  1.00 0.00 ? 47  ASP A N    2  
ATOM 2114  C CA   . ASP A 1 47  ? -15.171 9.369   -5.296  1.00 0.00 ? 47  ASP A CA   2  
ATOM 2115  C C    . ASP A 1 47  ? -15.949 9.385   -6.608  1.00 0.00 ? 47  ASP A C    2  
ATOM 2116  O O    . ASP A 1 47  ? -15.449 9.850   -7.632  1.00 0.00 ? 47  ASP A O    2  
ATOM 2117  C CB   . ASP A 1 47  ? -15.631 10.521  -4.401  1.00 0.00 ? 47  ASP A CB   2  
ATOM 2118  C CG   . ASP A 1 47  ? -17.023 10.301  -3.844  1.00 0.00 ? 47  ASP A CG   2  
ATOM 2119  O OD1  . ASP A 1 47  ? -17.217 9.314   -3.104  1.00 0.00 ? 47  ASP A OD1  2  
ATOM 2120  O OD2  . ASP A 1 47  ? -17.920 11.116  -4.149  1.00 0.00 ? 47  ASP A OD2  2  
ATOM 2121  H H    . ASP A 1 47  ? -13.268 10.295  -5.335  1.00 0.00 ? 47  ASP A H    2  
ATOM 2122  H HA   . ASP A 1 47  ? -15.362 8.434   -4.790  1.00 0.00 ? 47  ASP A HA   2  
ATOM 2123  H HB2  . ASP A 1 47  ? -14.944 10.622  -3.573  1.00 0.00 ? 47  ASP A HB2  2  
ATOM 2124  H HB3  . ASP A 1 47  ? -15.632 11.435  -4.976  1.00 0.00 ? 47  ASP A HB3  2  
ATOM 2125  N N    . ARG A 1 48  ? -17.175 8.873   -6.569  1.00 0.00 ? 48  ARG A N    2  
ATOM 2126  C CA   . ARG A 1 48  ? -18.021 8.827   -7.755  1.00 0.00 ? 48  ARG A CA   2  
ATOM 2127  C C    . ARG A 1 48  ? -18.933 10.049  -7.821  1.00 0.00 ? 48  ARG A C    2  
ATOM 2128  O O    . ARG A 1 48  ? -19.521 10.341  -8.862  1.00 0.00 ? 48  ARG A O    2  
ATOM 2129  C CB   . ARG A 1 48  ? -18.862 7.549   -7.758  1.00 0.00 ? 48  ARG A CB   2  
ATOM 2130  C CG   . ARG A 1 48  ? -20.021 7.580   -6.776  1.00 0.00 ? 48  ARG A CG   2  
ATOM 2131  C CD   . ARG A 1 48  ? -20.575 6.187   -6.522  1.00 0.00 ? 48  ARG A CD   2  
ATOM 2132  N NE   . ARG A 1 48  ? -19.661 5.372   -5.726  1.00 0.00 ? 48  ARG A NE   2  
ATOM 2133  C CZ   . ARG A 1 48  ? -19.967 4.166   -5.261  1.00 0.00 ? 48  ARG A CZ   2  
ATOM 2134  N NH1  . ARG A 1 48  ? -21.157 3.637   -5.512  1.00 0.00 ? 48  ARG A NH1  2  
ATOM 2135  N NH2  . ARG A 1 48  ? -19.081 3.485   -4.544  1.00 0.00 ? 48  ARG A NH2  2  
ATOM 2136  H H    . ARG A 1 48  ? -17.518 8.517   -5.723  1.00 0.00 ? 48  ARG A H    2  
ATOM 2137  H HA   . ARG A 1 48  ? -17.378 8.826   -8.622  1.00 0.00 ? 48  ARG A HA   2  
ATOM 2138  H HB2  . ARG A 1 48  ? -19.264 7.398   -8.750  1.00 0.00 ? 48  ARG A HB2  2  
ATOM 2139  H HB3  . ARG A 1 48  ? -18.227 6.714   -7.505  1.00 0.00 ? 48  ARG A HB3  2  
ATOM 2140  H HG2  . ARG A 1 48  ? -19.677 7.995   -5.840  1.00 0.00 ? 48  ARG A HG2  2  
ATOM 2141  H HG3  . ARG A 1 48  ? -20.807 8.202   -7.180  1.00 0.00 ? 48  ARG A HG3  2  
ATOM 2142  H HD2  . ARG A 1 48  ? -21.513 6.277   -5.995  1.00 0.00 ? 48  ARG A HD2  2  
ATOM 2143  H HD3  . ARG A 1 48  ? -20.741 5.702   -7.472  1.00 0.00 ? 48  ARG A HD3  2  
ATOM 2144  H HE   . ARG A 1 48  ? -18.776 5.743   -5.529  1.00 0.00 ? 48  ARG A HE   2  
ATOM 2145  H HH11 . ARG A 1 48  ? -21.825 4.147   -6.053  1.00 0.00 ? 48  ARG A HH11 2  
ATOM 2146  H HH12 . ARG A 1 48  ? -21.384 2.728   -5.162  1.00 0.00 ? 48  ARG A HH12 2  
ATOM 2147  H HH21 . ARG A 1 48  ? -18.183 3.880   -4.354  1.00 0.00 ? 48  ARG A HH21 2  
ATOM 2148  H HH22 . ARG A 1 48  ? -19.312 2.578   -4.195  1.00 0.00 ? 48  ARG A HH22 2  
ATOM 2149  N N    . GLU A 1 49  ? -19.046 10.757  -6.702  1.00 0.00 ? 49  GLU A N    2  
ATOM 2150  C CA   . GLU A 1 49  ? -19.887 11.946  -6.632  1.00 0.00 ? 49  GLU A CA   2  
ATOM 2151  C C    . GLU A 1 49  ? -19.047 13.215  -6.753  1.00 0.00 ? 49  GLU A C    2  
ATOM 2152  O O    . GLU A 1 49  ? -19.331 14.085  -7.577  1.00 0.00 ? 49  GLU A O    2  
ATOM 2153  C CB   . GLU A 1 49  ? -20.674 11.965  -5.320  1.00 0.00 ? 49  GLU A CB   2  
ATOM 2154  C CG   . GLU A 1 49  ? -21.695 13.088  -5.240  1.00 0.00 ? 49  GLU A CG   2  
ATOM 2155  C CD   . GLU A 1 49  ? -22.651 12.924  -4.074  1.00 0.00 ? 49  GLU A CD   2  
ATOM 2156  O OE1  . GLU A 1 49  ? -22.195 12.523  -2.983  1.00 0.00 ? 49  GLU A OE1  2  
ATOM 2157  O OE2  . GLU A 1 49  ? -23.857 13.198  -4.253  1.00 0.00 ? 49  GLU A OE2  2  
ATOM 2158  H H    . GLU A 1 49  ? -18.552 10.474  -5.904  1.00 0.00 ? 49  GLU A H    2  
ATOM 2159  H HA   . GLU A 1 49  ? -20.582 11.909  -7.458  1.00 0.00 ? 49  GLU A HA   2  
ATOM 2160  H HB2  . GLU A 1 49  ? -21.194 11.025  -5.213  1.00 0.00 ? 49  GLU A HB2  2  
ATOM 2161  H HB3  . GLU A 1 49  ? -19.981 12.079  -4.501  1.00 0.00 ? 49  GLU A HB3  2  
ATOM 2162  H HG2  . GLU A 1 49  ? -21.172 14.026  -5.127  1.00 0.00 ? 49  GLU A HG2  2  
ATOM 2163  H HG3  . GLU A 1 49  ? -22.267 13.104  -6.156  1.00 0.00 ? 49  GLU A HG3  2  
ATOM 2164  N N    . THR A 1 50  ? -18.012 13.313  -5.925  1.00 0.00 ? 50  THR A N    2  
ATOM 2165  C CA   . THR A 1 50  ? -17.132 14.475  -5.936  1.00 0.00 ? 50  THR A CA   2  
ATOM 2166  C C    . THR A 1 50  ? -16.044 14.330  -6.994  1.00 0.00 ? 50  THR A C    2  
ATOM 2167  O O    . THR A 1 50  ? -15.548 15.321  -7.528  1.00 0.00 ? 50  THR A O    2  
ATOM 2168  C CB   . THR A 1 50  ? -16.470 14.692  -4.562  1.00 0.00 ? 50  THR A CB   2  
ATOM 2169  O OG1  . THR A 1 50  ? -15.608 13.591  -4.255  1.00 0.00 ? 50  THR A OG1  2  
ATOM 2170  C CG2  . THR A 1 50  ? -17.522 14.839  -3.473  1.00 0.00 ? 50  THR A CG2  2  
ATOM 2171  H H    . THR A 1 50  ? -17.838 12.587  -5.291  1.00 0.00 ? 50  THR A H    2  
ATOM 2172  H HA   . THR A 1 50  ? -17.730 15.344  -6.166  1.00 0.00 ? 50  THR A HA   2  
ATOM 2173  H HB   . THR A 1 50  ? -15.884 15.599  -4.602  1.00 0.00 ? 50  THR A HB   2  
ATOM 2174  H HG1  . THR A 1 50  ? -14.991 13.456  -4.978  1.00 0.00 ? 50  THR A HG1  2  
ATOM 2175  H HG21 . THR A 1 50  ? -18.049 13.904  -3.352  1.00 0.00 ? 50  THR A HG21 2  
ATOM 2176  H HG22 . THR A 1 50  ? -18.221 15.614  -3.750  1.00 0.00 ? 50  THR A HG22 2  
ATOM 2177  H HG23 . THR A 1 50  ? -17.041 15.104  -2.543  1.00 0.00 ? 50  THR A HG23 2  
ATOM 2178  N N    . GLY A 1 51  ? -15.678 13.087  -7.294  1.00 0.00 ? 51  GLY A N    2  
ATOM 2179  C CA   . GLY A 1 51  ? -14.651 12.835  -8.288  1.00 0.00 ? 51  GLY A CA   2  
ATOM 2180  C C    . GLY A 1 51  ? -13.290 13.345  -7.857  1.00 0.00 ? 51  GLY A C    2  
ATOM 2181  O O    . GLY A 1 51  ? -12.561 13.937  -8.653  1.00 0.00 ? 51  GLY A O    2  
ATOM 2182  H H    . GLY A 1 51  ? -16.109 12.335  -6.836  1.00 0.00 ? 51  GLY A H    2  
ATOM 2183  H HA2  . GLY A 1 51  ? -14.587 11.772  -8.462  1.00 0.00 ? 51  GLY A HA2  2  
ATOM 2184  H HA3  . GLY A 1 51  ? -14.930 13.325  -9.209  1.00 0.00 ? 51  GLY A HA3  2  
ATOM 2185  N N    . SER A 1 52  ? -12.947 13.116  -6.593  1.00 0.00 ? 52  SER A N    2  
ATOM 2186  C CA   . SER A 1 52  ? -11.666 13.561  -6.056  1.00 0.00 ? 52  SER A CA   2  
ATOM 2187  C C    . SER A 1 52  ? -10.979 12.436  -5.288  1.00 0.00 ? 52  SER A C    2  
ATOM 2188  O O    . SER A 1 52  ? -11.630 11.503  -4.818  1.00 0.00 ? 52  SER A O    2  
ATOM 2189  C CB   . SER A 1 52  ? -11.865 14.771  -5.142  1.00 0.00 ? 52  SER A CB   2  
ATOM 2190  O OG   . SER A 1 52  ? -10.640 15.445  -4.914  1.00 0.00 ? 52  SER A OG   2  
ATOM 2191  H H    . SER A 1 52  ? -13.571 12.639  -6.008  1.00 0.00 ? 52  SER A H    2  
ATOM 2192  H HA   . SER A 1 52  ? -11.040 13.848  -6.888  1.00 0.00 ? 52  SER A HA   2  
ATOM 2193  H HB2  . SER A 1 52  ? -12.558 15.458  -5.604  1.00 0.00 ? 52  SER A HB2  2  
ATOM 2194  H HB3  . SER A 1 52  ? -12.264 14.441  -4.194  1.00 0.00 ? 52  SER A HB3  2  
ATOM 2195  H HG   . SER A 1 52  ? -10.159 15.526  -5.741  1.00 0.00 ? 52  SER A HG   2  
ATOM 2196  N N    . SER A 1 53  ? -9.659  12.533  -5.163  1.00 0.00 ? 53  SER A N    2  
ATOM 2197  C CA   . SER A 1 53  ? -8.882  11.523  -4.455  1.00 0.00 ? 53  SER A CA   2  
ATOM 2198  C C    . SER A 1 53  ? -9.359  11.383  -3.013  1.00 0.00 ? 53  SER A C    2  
ATOM 2199  O O    . SER A 1 53  ? -9.063  12.224  -2.163  1.00 0.00 ? 53  SER A O    2  
ATOM 2200  C CB   . SER A 1 53  ? -7.395  11.883  -4.479  1.00 0.00 ? 53  SER A CB   2  
ATOM 2201  O OG   . SER A 1 53  ? -6.931  12.040  -5.809  1.00 0.00 ? 53  SER A OG   2  
ATOM 2202  H H    . SER A 1 53  ? -9.197  13.302  -5.560  1.00 0.00 ? 53  SER A H    2  
ATOM 2203  H HA   . SER A 1 53  ? -9.024  10.580  -4.962  1.00 0.00 ? 53  SER A HA   2  
ATOM 2204  H HB2  . SER A 1 53  ? -7.243  12.809  -3.946  1.00 0.00 ? 53  SER A HB2  2  
ATOM 2205  H HB3  . SER A 1 53  ? -6.829  11.096  -4.003  1.00 0.00 ? 53  SER A HB3  2  
ATOM 2206  H HG   . SER A 1 53  ? -7.474  11.516  -6.402  1.00 0.00 ? 53  SER A HG   2  
ATOM 2207  N N    . LYS A 1 54  ? -10.101 10.314  -2.743  1.00 0.00 ? 54  LYS A N    2  
ATOM 2208  C CA   . LYS A 1 54  ? -10.619 10.060  -1.404  1.00 0.00 ? 54  LYS A CA   2  
ATOM 2209  C C    . LYS A 1 54  ? -9.527  10.238  -0.354  1.00 0.00 ? 54  LYS A C    2  
ATOM 2210  O O    . LYS A 1 54  ? -9.738  10.885  0.671   1.00 0.00 ? 54  LYS A O    2  
ATOM 2211  C CB   . LYS A 1 54  ? -11.198 8.646   -1.318  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2212  C CG   . LYS A 1 54  ? -12.233 8.346   -2.388  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2213  C CD   . LYS A 1 54  ? -12.910 7.007   -2.150  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2214  C CE   . LYS A 1 54  ? -14.153 7.157   -1.286  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2215  N NZ   . LYS A 1 54  ? -13.812 7.288   0.158   1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2216  H H    . LYS A 1 54  ? -10.303 9.679   -3.462  1.00 0.00 ? 54  LYS A H    2  
ATOM 2217  H HA   . LYS A 1 54  ? -11.406 10.774  -1.212  1.00 0.00 ? 54  LYS A HA   2  
ATOM 2218  H HB2  . LYS A 1 54  ? -10.392 7.934   -1.417  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2219  H HB3  . LYS A 1 54  ? -11.663 8.518   -0.351  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2220  H HG2  . LYS A 1 54  ? -12.983 9.123   -2.379  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2221  H HG3  . LYS A 1 54  ? -11.745 8.326   -3.353  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2222  H HD2  . LYS A 1 54  ? -13.196 6.583   -3.101  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2223  H HD3  . LYS A 1 54  ? -12.214 6.345   -1.653  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2224  H HE2  . LYS A 1 54  ? -14.691 8.037   -1.601  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2225  H HE3  . LYS A 1 54  ? -14.777 6.286   -1.422  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2226  H HZ1  . LYS A 1 54  ? -14.404 6.646   0.724   1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2227  H HZ2  . LYS A 1 54  ? -13.977 8.264   0.477   1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2228  H HZ3  . LYS A 1 54  ? -12.812 7.048   0.313   1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2229  N N    . GLY A 1 55  ? -8.358  9.662   -0.619  1.00 0.00 ? 55  GLY A N    2  
ATOM 2230  C CA   . GLY A 1 55  ? -7.250  9.771   0.312   1.00 0.00 ? 55  GLY A CA   2  
ATOM 2231  C C    . GLY A 1 55  ? -6.500  8.463   0.475   1.00 0.00 ? 55  GLY A C    2  
ATOM 2232  O O    . GLY A 1 55  ? -5.958  8.180   1.544   1.00 0.00 ? 55  GLY A O    2  
ATOM 2233  H H    . GLY A 1 55  ? -8.248  9.159   -1.453  1.00 0.00 ? 55  GLY A H    2  
ATOM 2234  H HA2  . GLY A 1 55  ? -6.565  10.524  -0.047  1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2235  H HA3  . GLY A 1 55  ? -7.633  10.075  1.275   1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2236  N N    . PHE A 1 56  ? -6.470  7.664   -0.586  1.00 0.00 ? 56  PHE A N    2  
ATOM 2237  C CA   . PHE A 1 56  ? -5.783  6.378   -0.554  1.00 0.00 ? 56  PHE A CA   2  
ATOM 2238  C C    . PHE A 1 56  ? -5.730  5.755   -1.946  1.00 0.00 ? 56  PHE A C    2  
ATOM 2239  O O    . PHE A 1 56  ? -6.580  6.028   -2.793  1.00 0.00 ? 56  PHE A O    2  
ATOM 2240  C CB   . PHE A 1 56  ? -6.484  5.425   0.416   1.00 0.00 ? 56  PHE A CB   2  
ATOM 2241  C CG   . PHE A 1 56  ? -7.937  5.210   0.102   1.00 0.00 ? 56  PHE A CG   2  
ATOM 2242  C CD1  . PHE A 1 56  ? -8.874  6.188   0.393   1.00 0.00 ? 56  PHE A CD1  2  
ATOM 2243  C CD2  . PHE A 1 56  ? -8.365  4.031   -0.485  1.00 0.00 ? 56  PHE A CD2  2  
ATOM 2244  C CE1  . PHE A 1 56  ? -10.212 5.993   0.106   1.00 0.00 ? 56  PHE A CE1  2  
ATOM 2245  C CE2  . PHE A 1 56  ? -9.702  3.830   -0.775  1.00 0.00 ? 56  PHE A CE2  2  
ATOM 2246  C CZ   . PHE A 1 56  ? -10.626 4.813   -0.480  1.00 0.00 ? 56  PHE A CZ   2  
ATOM 2247  H H    . PHE A 1 56  ? -6.921  7.945   -1.409  1.00 0.00 ? 56  PHE A H    2  
ATOM 2248  H HA   . PHE A 1 56  ? -4.775  6.550   -0.212  1.00 0.00 ? 56  PHE A HA   2  
ATOM 2249  H HB2  . PHE A 1 56  ? -5.992  4.464   0.384   1.00 0.00 ? 56  PHE A HB2  2  
ATOM 2250  H HB3  . PHE A 1 56  ? -6.415  5.827   1.416   1.00 0.00 ? 56  PHE A HB3  2  
ATOM 2251  H HD1  . PHE A 1 56  ? -8.552  7.112   0.851   1.00 0.00 ? 56  PHE A HD1  2  
ATOM 2252  H HD2  . PHE A 1 56  ? -7.642  3.261   -0.717  1.00 0.00 ? 56  PHE A HD2  2  
ATOM 2253  H HE1  . PHE A 1 56  ? -10.932 6.763   0.337   1.00 0.00 ? 56  PHE A HE1  2  
ATOM 2254  H HE2  . PHE A 1 56  ? -10.022 2.906   -1.234  1.00 0.00 ? 56  PHE A HE2  2  
ATOM 2255  H HZ   . PHE A 1 56  ? -11.670 4.658   -0.706  1.00 0.00 ? 56  PHE A HZ   2  
ATOM 2256  N N    . GLY A 1 57  ? -4.724  4.917   -2.176  1.00 0.00 ? 57  GLY A N    2  
ATOM 2257  C CA   . GLY A 1 57  ? -4.578  4.269   -3.466  1.00 0.00 ? 57  GLY A CA   2  
ATOM 2258  C C    . GLY A 1 57  ? -3.788  2.978   -3.381  1.00 0.00 ? 57  GLY A C    2  
ATOM 2259  O O    . GLY A 1 57  ? -3.950  2.204   -2.437  1.00 0.00 ? 57  GLY A O    2  
ATOM 2260  H H    . GLY A 1 57  ? -4.076  4.737   -1.463  1.00 0.00 ? 57  GLY A H    2  
ATOM 2261  H HA2  . GLY A 1 57  ? -5.559  4.053   -3.862  1.00 0.00 ? 57  GLY A HA2  2  
ATOM 2262  H HA3  . GLY A 1 57  ? -4.070  4.944   -4.139  1.00 0.00 ? 57  GLY A HA3  2  
ATOM 2263  N N    . PHE A 1 58  ? -2.932  2.743   -4.369  1.00 0.00 ? 58  PHE A N    2  
ATOM 2264  C CA   . PHE A 1 58  ? -2.116  1.535   -4.403  1.00 0.00 ? 58  PHE A CA   2  
ATOM 2265  C C    . PHE A 1 58  ? -0.812  1.781   -5.157  1.00 0.00 ? 58  PHE A C    2  
ATOM 2266  O O    . PHE A 1 58  ? -0.709  2.713   -5.956  1.00 0.00 ? 58  PHE A O    2  
ATOM 2267  C CB   . PHE A 1 58  ? -2.890  0.390   -5.059  1.00 0.00 ? 58  PHE A CB   2  
ATOM 2268  C CG   . PHE A 1 58  ? -4.201  0.093   -4.390  1.00 0.00 ? 58  PHE A CG   2  
ATOM 2269  C CD1  . PHE A 1 58  ? -5.255  0.989   -4.474  1.00 0.00 ? 58  PHE A CD1  2  
ATOM 2270  C CD2  . PHE A 1 58  ? -4.381  -1.082  -3.679  1.00 0.00 ? 58  PHE A CD2  2  
ATOM 2271  C CE1  . PHE A 1 58  ? -6.463  0.718   -3.859  1.00 0.00 ? 58  PHE A CE1  2  
ATOM 2272  C CE2  . PHE A 1 58  ? -5.587  -1.359  -3.062  1.00 0.00 ? 58  PHE A CE2  2  
ATOM 2273  C CZ   . PHE A 1 58  ? -6.630  -0.458  -3.153  1.00 0.00 ? 58  PHE A CZ   2  
ATOM 2274  H H    . PHE A 1 58  ? -2.847  3.398   -5.094  1.00 0.00 ? 58  PHE A H    2  
ATOM 2275  H HA   . PHE A 1 58  ? -1.883  1.265   -3.385  1.00 0.00 ? 58  PHE A HA   2  
ATOM 2276  H HB2  . PHE A 1 58  ? -3.093  0.645   -6.088  1.00 0.00 ? 58  PHE A HB2  2  
ATOM 2277  H HB3  . PHE A 1 58  ? -2.288  -0.506  -5.026  1.00 0.00 ? 58  PHE A HB3  2  
ATOM 2278  H HD1  . PHE A 1 58  ? -5.127  1.908   -5.027  1.00 0.00 ? 58  PHE A HD1  2  
ATOM 2279  H HD2  . PHE A 1 58  ? -3.566  -1.788  -3.607  1.00 0.00 ? 58  PHE A HD2  2  
ATOM 2280  H HE1  . PHE A 1 58  ? -7.277  1.424   -3.932  1.00 0.00 ? 58  PHE A HE1  2  
ATOM 2281  H HE2  . PHE A 1 58  ? -5.713  -2.279  -2.511  1.00 0.00 ? 58  PHE A HE2  2  
ATOM 2282  H HZ   . PHE A 1 58  ? -7.572  -0.671  -2.672  1.00 0.00 ? 58  PHE A HZ   2  
ATOM 2283  N N    . VAL A 1 59  ? 0.182   0.938   -4.898  1.00 0.00 ? 59  VAL A N    2  
ATOM 2284  C CA   . VAL A 1 59  ? 1.480   1.062   -5.552  1.00 0.00 ? 59  VAL A CA   2  
ATOM 2285  C C    . VAL A 1 59  ? 1.912   -0.263  -6.170  1.00 0.00 ? 59  VAL A C    2  
ATOM 2286  O O    . VAL A 1 59  ? 2.113   -1.253  -5.466  1.00 0.00 ? 59  VAL A O    2  
ATOM 2287  C CB   . VAL A 1 59  ? 2.563   1.533   -4.564  1.00 0.00 ? 59  VAL A CB   2  
ATOM 2288  C CG1  . VAL A 1 59  ? 3.888   1.738   -5.283  1.00 0.00 ? 59  VAL A CG1  2  
ATOM 2289  C CG2  . VAL A 1 59  ? 2.125   2.809   -3.862  1.00 0.00 ? 59  VAL A CG2  2  
ATOM 2290  H H    . VAL A 1 59  ? 0.040   0.215   -4.252  1.00 0.00 ? 59  VAL A H    2  
ATOM 2291  H HA   . VAL A 1 59  ? 1.390   1.801   -6.335  1.00 0.00 ? 59  VAL A HA   2  
ATOM 2292  H HB   . VAL A 1 59  ? 2.700   0.764   -3.817  1.00 0.00 ? 59  VAL A HB   2  
ATOM 2293  H HG11 . VAL A 1 59  ? 3.846   2.649   -5.862  1.00 0.00 ? 59  VAL A HG11 2  
ATOM 2294  H HG12 . VAL A 1 59  ? 4.685   1.808   -4.557  1.00 0.00 ? 59  VAL A HG12 2  
ATOM 2295  H HG13 . VAL A 1 59  ? 4.073   0.902   -5.942  1.00 0.00 ? 59  VAL A HG13 2  
ATOM 2296  H HG21 . VAL A 1 59  ? 1.047   2.836   -3.806  1.00 0.00 ? 59  VAL A HG21 2  
ATOM 2297  H HG22 . VAL A 1 59  ? 2.537   2.831   -2.864  1.00 0.00 ? 59  VAL A HG22 2  
ATOM 2298  H HG23 . VAL A 1 59  ? 2.479   3.665   -4.416  1.00 0.00 ? 59  VAL A HG23 2  
ATOM 2299  N N    . ASP A 1 60  ? 2.054   -0.275  -7.491  1.00 0.00 ? 60  ASP A N    2  
ATOM 2300  C CA   . ASP A 1 60  ? 2.465   -1.478  -8.205  1.00 0.00 ? 60  ASP A CA   2  
ATOM 2301  C C    . ASP A 1 60  ? 3.970   -1.693  -8.087  1.00 0.00 ? 60  ASP A C    2  
ATOM 2302  O O    . ASP A 1 60  ? 4.747   -0.737  -8.094  1.00 0.00 ? 60  ASP A O    2  
ATOM 2303  C CB   . ASP A 1 60  ? 2.064   -1.385  -9.678  1.00 0.00 ? 60  ASP A CB   2  
ATOM 2304  C CG   . ASP A 1 60  ? 2.296   -2.684  -10.425 1.00 0.00 ? 60  ASP A CG   2  
ATOM 2305  O OD1  . ASP A 1 60  ? 3.360   -3.304  -10.220 1.00 0.00 ? 60  ASP A OD1  2  
ATOM 2306  O OD2  . ASP A 1 60  ? 1.413   -3.080  -11.214 1.00 0.00 ? 60  ASP A OD2  2  
ATOM 2307  H H    . ASP A 1 60  ? 1.879   0.546   -7.998  1.00 0.00 ? 60  ASP A H    2  
ATOM 2308  H HA   . ASP A 1 60  ? 1.958   -2.319  -7.757  1.00 0.00 ? 60  ASP A HA   2  
ATOM 2309  H HB2  . ASP A 1 60  ? 1.015   -1.136  -9.744  1.00 0.00 ? 60  ASP A HB2  2  
ATOM 2310  H HB3  . ASP A 1 60  ? 2.644   -0.608  -10.154 1.00 0.00 ? 60  ASP A HB3  2  
ATOM 2311  N N    . PHE A 1 61  ? 4.377   -2.954  -7.979  1.00 0.00 ? 61  PHE A N    2  
ATOM 2312  C CA   . PHE A 1 61  ? 5.789   -3.294  -7.858  1.00 0.00 ? 61  PHE A CA   2  
ATOM 2313  C C    . PHE A 1 61  ? 6.136   -4.497  -8.730  1.00 0.00 ? 61  PHE A C    2  
ATOM 2314  O O    . PHE A 1 61  ? 5.328   -5.410  -8.895  1.00 0.00 ? 61  PHE A O    2  
ATOM 2315  C CB   . PHE A 1 61  ? 6.141   -3.589  -6.398  1.00 0.00 ? 61  PHE A CB   2  
ATOM 2316  C CG   . PHE A 1 61  ? 6.230   -2.358  -5.542  1.00 0.00 ? 61  PHE A CG   2  
ATOM 2317  C CD1  . PHE A 1 61  ? 7.402   -1.621  -5.486  1.00 0.00 ? 61  PHE A CD1  2  
ATOM 2318  C CD2  . PHE A 1 61  ? 5.142   -1.939  -4.793  1.00 0.00 ? 61  PHE A CD2  2  
ATOM 2319  C CE1  . PHE A 1 61  ? 7.487   -0.487  -4.699  1.00 0.00 ? 61  PHE A CE1  2  
ATOM 2320  C CE2  . PHE A 1 61  ? 5.221   -0.806  -4.005  1.00 0.00 ? 61  PHE A CE2  2  
ATOM 2321  C CZ   . PHE A 1 61  ? 6.395   -0.080  -3.957  1.00 0.00 ? 61  PHE A CZ   2  
ATOM 2322  H H    . PHE A 1 61  ? 3.710   -3.672  -7.980  1.00 0.00 ? 61  PHE A H    2  
ATOM 2323  H HA   . PHE A 1 61  ? 6.364   -2.444  -8.193  1.00 0.00 ? 61  PHE A HA   2  
ATOM 2324  H HB2  . PHE A 1 61  ? 5.384   -4.232  -5.976  1.00 0.00 ? 61  PHE A HB2  2  
ATOM 2325  H HB3  . PHE A 1 61  ? 7.096   -4.091  -6.360  1.00 0.00 ? 61  PHE A HB3  2  
ATOM 2326  H HD1  . PHE A 1 61  ? 8.257   -1.938  -6.066  1.00 0.00 ? 61  PHE A HD1  2  
ATOM 2327  H HD2  . PHE A 1 61  ? 4.224   -2.506  -4.828  1.00 0.00 ? 61  PHE A HD2  2  
ATOM 2328  H HE1  . PHE A 1 61  ? 8.406   0.078   -4.664  1.00 0.00 ? 61  PHE A HE1  2  
ATOM 2329  H HE2  . PHE A 1 61  ? 4.367   -0.490  -3.426  1.00 0.00 ? 61  PHE A HE2  2  
ATOM 2330  H HZ   . PHE A 1 61  ? 6.460   0.805   -3.343  1.00 0.00 ? 61  PHE A HZ   2  
ATOM 2331  N N    . ASN A 1 62  ? 7.343   -4.489  -9.285  1.00 0.00 ? 62  ASN A N    2  
ATOM 2332  C CA   . ASN A 1 62  ? 7.798   -5.579  -10.141 1.00 0.00 ? 62  ASN A CA   2  
ATOM 2333  C C    . ASN A 1 62  ? 7.534   -6.932  -9.486  1.00 0.00 ? 62  ASN A C    2  
ATOM 2334  O O    . ASN A 1 62  ? 7.176   -7.899  -10.158 1.00 0.00 ? 62  ASN A O    2  
ATOM 2335  C CB   . ASN A 1 62  ? 9.290   -5.429  -10.445 1.00 0.00 ? 62  ASN A CB   2  
ATOM 2336  C CG   . ASN A 1 62  ? 9.665   -6.004  -11.797 1.00 0.00 ? 62  ASN A CG   2  
ATOM 2337  O OD1  . ASN A 1 62  ? 10.417  -6.974  -11.885 1.00 0.00 ? 62  ASN A OD1  2  
ATOM 2338  N ND2  . ASN A 1 62  ? 9.141   -5.404  -12.860 1.00 0.00 ? 62  ASN A ND2  2  
ATOM 2339  H H    . ASN A 1 62  ? 7.943   -3.733  -9.116  1.00 0.00 ? 62  ASN A H    2  
ATOM 2340  H HA   . ASN A 1 62  ? 7.244   -5.526  -11.067 1.00 0.00 ? 62  ASN A HA   2  
ATOM 2341  H HB2  . ASN A 1 62  ? 9.549   -4.380  -10.437 1.00 0.00 ? 62  ASN A HB2  2  
ATOM 2342  H HB3  . ASN A 1 62  ? 9.859   -5.942  -9.685  1.00 0.00 ? 62  ASN A HB3  2  
ATOM 2343  H HD21 . ASN A 1 62  ? 8.550   -4.636  -12.715 1.00 0.00 ? 62  ASN A HD21 2  
ATOM 2344  H HD22 . ASN A 1 62  ? 9.367   -5.756  -13.747 1.00 0.00 ? 62  ASN A HD22 2  
ATOM 2345  N N    . SER A 1 63  ? 7.713   -6.991  -8.171  1.00 0.00 ? 63  SER A N    2  
ATOM 2346  C CA   . SER A 1 63  ? 7.498   -8.225  -7.424  1.00 0.00 ? 63  SER A CA   2  
ATOM 2347  C C    . SER A 1 63  ? 7.320   -7.937  -5.937  1.00 0.00 ? 63  SER A C    2  
ATOM 2348  O O    . SER A 1 63  ? 7.822   -6.938  -5.424  1.00 0.00 ? 63  SER A O    2  
ATOM 2349  C CB   . SER A 1 63  ? 8.672   -9.183  -7.633  1.00 0.00 ? 63  SER A CB   2  
ATOM 2350  O OG   . SER A 1 63  ? 8.585   -9.831  -8.890  1.00 0.00 ? 63  SER A OG   2  
ATOM 2351  H H    . SER A 1 63  ? 7.999   -6.185  -7.691  1.00 0.00 ? 63  SER A H    2  
ATOM 2352  H HA   . SER A 1 63  ? 6.597   -8.687  -7.800  1.00 0.00 ? 63  SER A HA   2  
ATOM 2353  H HB2  . SER A 1 63  ? 9.597   -8.629  -7.590  1.00 0.00 ? 63  SER A HB2  2  
ATOM 2354  H HB3  . SER A 1 63  ? 8.665   -9.932  -6.854  1.00 0.00 ? 63  SER A HB3  2  
ATOM 2355  H HG   . SER A 1 63  ? 9.459   -10.121 -9.162  1.00 0.00 ? 63  SER A HG   2  
ATOM 2356  N N    . GLU A 1 64  ? 6.600   -8.820  -5.251  1.00 0.00 ? 64  GLU A N    2  
ATOM 2357  C CA   . GLU A 1 64  ? 6.355   -8.660  -3.823  1.00 0.00 ? 64  GLU A CA   2  
ATOM 2358  C C    . GLU A 1 64  ? 7.629   -8.240  -3.096  1.00 0.00 ? 64  GLU A C    2  
ATOM 2359  O O    . GLU A 1 64  ? 7.608   -7.342  -2.254  1.00 0.00 ? 64  GLU A O    2  
ATOM 2360  C CB   . GLU A 1 64  ? 5.820   -9.963  -3.226  1.00 0.00 ? 64  GLU A CB   2  
ATOM 2361  C CG   . GLU A 1 64  ? 4.355   -10.220 -3.540  1.00 0.00 ? 64  GLU A CG   2  
ATOM 2362  C CD   . GLU A 1 64  ? 3.991   -11.690 -3.460  1.00 0.00 ? 64  GLU A CD   2  
ATOM 2363  O OE1  . GLU A 1 64  ? 4.621   -12.496 -4.176  1.00 0.00 ? 64  GLU A OE1  2  
ATOM 2364  O OE2  . GLU A 1 64  ? 3.077   -12.033 -2.682  1.00 0.00 ? 64  GLU A OE2  2  
ATOM 2365  H H    . GLU A 1 64  ? 6.226   -9.596  -5.717  1.00 0.00 ? 64  GLU A H    2  
ATOM 2366  H HA   . GLU A 1 64  ? 5.612   -7.886  -3.699  1.00 0.00 ? 64  GLU A HA   2  
ATOM 2367  H HB2  . GLU A 1 64  ? 6.400   -10.787 -3.612  1.00 0.00 ? 64  GLU A HB2  2  
ATOM 2368  H HB3  . GLU A 1 64  ? 5.934   -9.926  -2.152  1.00 0.00 ? 64  GLU A HB3  2  
ATOM 2369  H HG2  . GLU A 1 64  ? 3.748   -9.675  -2.833  1.00 0.00 ? 64  GLU A HG2  2  
ATOM 2370  H HG3  . GLU A 1 64  ? 4.147   -9.866  -4.539  1.00 0.00 ? 64  GLU A HG3  2  
ATOM 2371  N N    . GLU A 1 65  ? 8.736   -8.896  -3.427  1.00 0.00 ? 65  GLU A N    2  
ATOM 2372  C CA   . GLU A 1 65  ? 10.019  -8.592  -2.804  1.00 0.00 ? 65  GLU A CA   2  
ATOM 2373  C C    . GLU A 1 65  ? 10.294  -7.091  -2.830  1.00 0.00 ? 65  GLU A C    2  
ATOM 2374  O O    . GLU A 1 65  ? 10.408  -6.452  -1.784  1.00 0.00 ? 65  GLU A O    2  
ATOM 2375  C CB   . GLU A 1 65  ? 11.148  -9.340  -3.517  1.00 0.00 ? 65  GLU A CB   2  
ATOM 2376  C CG   . GLU A 1 65  ? 11.221  -10.815 -3.158  1.00 0.00 ? 65  GLU A CG   2  
ATOM 2377  C CD   . GLU A 1 65  ? 12.043  -11.072 -1.910  1.00 0.00 ? 65  GLU A CD   2  
ATOM 2378  O OE1  . GLU A 1 65  ? 13.273  -11.248 -2.036  1.00 0.00 ? 65  GLU A OE1  2  
ATOM 2379  O OE2  . GLU A 1 65  ? 11.457  -11.096 -0.808  1.00 0.00 ? 65  GLU A OE2  2  
ATOM 2380  H H    . GLU A 1 65  ? 8.689   -9.602  -4.105  1.00 0.00 ? 65  GLU A H    2  
ATOM 2381  H HA   . GLU A 1 65  ? 9.975   -8.920  -1.777  1.00 0.00 ? 65  GLU A HA   2  
ATOM 2382  H HB2  . GLU A 1 65  ? 11.001  -9.257  -4.584  1.00 0.00 ? 65  GLU A HB2  2  
ATOM 2383  H HB3  . GLU A 1 65  ? 12.089  -8.881  -3.255  1.00 0.00 ? 65  GLU A HB3  2  
ATOM 2384  H HG2  . GLU A 1 65  ? 10.220  -11.183 -2.992  1.00 0.00 ? 65  GLU A HG2  2  
ATOM 2385  H HG3  . GLU A 1 65  ? 11.668  -11.351 -3.982  1.00 0.00 ? 65  GLU A HG3  2  
ATOM 2386  N N    . ASP A 1 66  ? 10.400  -6.536  -4.032  1.00 0.00 ? 66  ASP A N    2  
ATOM 2387  C CA   . ASP A 1 66  ? 10.661  -5.110  -4.196  1.00 0.00 ? 66  ASP A CA   2  
ATOM 2388  C C    . ASP A 1 66  ? 9.649   -4.279  -3.414  1.00 0.00 ? 66  ASP A C    2  
ATOM 2389  O O    . ASP A 1 66  ? 10.001  -3.277  -2.794  1.00 0.00 ? 66  ASP A O    2  
ATOM 2390  C CB   . ASP A 1 66  ? 10.618  -4.729  -5.676  1.00 0.00 ? 66  ASP A CB   2  
ATOM 2391  C CG   . ASP A 1 66  ? 11.748  -5.357  -6.469  1.00 0.00 ? 66  ASP A CG   2  
ATOM 2392  O OD1  . ASP A 1 66  ? 12.910  -5.265  -6.021  1.00 0.00 ? 66  ASP A OD1  2  
ATOM 2393  O OD2  . ASP A 1 66  ? 11.469  -5.942  -7.537  1.00 0.00 ? 66  ASP A OD2  2  
ATOM 2394  H H    . ASP A 1 66  ? 10.300  -7.098  -4.829  1.00 0.00 ? 66  ASP A H    2  
ATOM 2395  H HA   . ASP A 1 66  ? 11.649  -4.908  -3.810  1.00 0.00 ? 66  ASP A HA   2  
ATOM 2396  H HB2  . ASP A 1 66  ? 9.680   -5.058  -6.100  1.00 0.00 ? 66  ASP A HB2  2  
ATOM 2397  H HB3  . ASP A 1 66  ? 10.692  -3.655  -5.767  1.00 0.00 ? 66  ASP A HB3  2  
ATOM 2398  N N    . ALA A 1 67  ? 8.389   -4.703  -3.450  1.00 0.00 ? 67  ALA A N    2  
ATOM 2399  C CA   . ALA A 1 67  ? 7.326   -3.999  -2.745  1.00 0.00 ? 67  ALA A CA   2  
ATOM 2400  C C    . ALA A 1 67  ? 7.611   -3.931  -1.248  1.00 0.00 ? 67  ALA A C    2  
ATOM 2401  O O    . ALA A 1 67  ? 7.445   -2.885  -0.620  1.00 0.00 ? 67  ALA A O    2  
ATOM 2402  C CB   . ALA A 1 67  ? 5.987   -4.674  -2.999  1.00 0.00 ? 67  ALA A CB   2  
ATOM 2403  H H    . ALA A 1 67  ? 8.171   -5.509  -3.962  1.00 0.00 ? 67  ALA A H    2  
ATOM 2404  H HA   . ALA A 1 67  ? 7.274   -2.993  -3.137  1.00 0.00 ? 67  ALA A HA   2  
ATOM 2405  H HB1  . ALA A 1 67  ? 5.762   -5.345  -2.182  1.00 0.00 ? 67  ALA A HB1  2  
ATOM 2406  H HB2  . ALA A 1 67  ? 5.214   -3.924  -3.072  1.00 0.00 ? 67  ALA A HB2  2  
ATOM 2407  H HB3  . ALA A 1 67  ? 6.035   -5.233  -3.921  1.00 0.00 ? 67  ALA A HB3  2  
ATOM 2408  N N    . LYS A 1 68  ? 8.041   -5.053  -0.681  1.00 0.00 ? 68  LYS A N    2  
ATOM 2409  C CA   . LYS A 1 68  ? 8.350   -5.122  0.742   1.00 0.00 ? 68  LYS A CA   2  
ATOM 2410  C C    . LYS A 1 68  ? 9.465   -4.146  1.105   1.00 0.00 ? 68  LYS A C    2  
ATOM 2411  O O    . LYS A 1 68  ? 9.304   -3.307  1.990   1.00 0.00 ? 68  LYS A O    2  
ATOM 2412  C CB   . LYS A 1 68  ? 8.760   -6.546  1.128   1.00 0.00 ? 68  LYS A CB   2  
ATOM 2413  C CG   . LYS A 1 68  ? 8.879   -6.759  2.627   1.00 0.00 ? 68  LYS A CG   2  
ATOM 2414  C CD   . LYS A 1 68  ? 9.740   -7.969  2.951   1.00 0.00 ? 68  LYS A CD   2  
ATOM 2415  C CE   . LYS A 1 68  ? 10.363  -7.855  4.334   1.00 0.00 ? 68  LYS A CE   2  
ATOM 2416  N NZ   . LYS A 1 68  ? 11.442  -8.860  4.540   1.00 0.00 ? 68  LYS A NZ   2  
ATOM 2417  H H    . LYS A 1 68  ? 8.154   -5.855  -1.234  1.00 0.00 ? 68  LYS A H    2  
ATOM 2418  H HA   . LYS A 1 68  ? 7.460   -4.852  1.289   1.00 0.00 ? 68  LYS A HA   2  
ATOM 2419  H HB2  . LYS A 1 68  ? 8.023   -7.236  0.744   1.00 0.00 ? 68  LYS A HB2  2  
ATOM 2420  H HB3  . LYS A 1 68  ? 9.716   -6.767  0.676   1.00 0.00 ? 68  LYS A HB3  2  
ATOM 2421  H HG2  . LYS A 1 68  ? 9.326   -5.883  3.072   1.00 0.00 ? 68  LYS A HG2  2  
ATOM 2422  H HG3  . LYS A 1 68  ? 7.892   -6.911  3.039   1.00 0.00 ? 68  LYS A HG3  2  
ATOM 2423  H HD2  . LYS A 1 68  ? 9.126   -8.856  2.917   1.00 0.00 ? 68  LYS A HD2  2  
ATOM 2424  H HD3  . LYS A 1 68  ? 10.529  -8.045  2.215   1.00 0.00 ? 68  LYS A HD3  2  
ATOM 2425  H HE2  . LYS A 1 68  ? 10.778  -6.865  4.447   1.00 0.00 ? 68  LYS A HE2  2  
ATOM 2426  H HE3  . LYS A 1 68  ? 9.592   -8.009  5.075   1.00 0.00 ? 68  LYS A HE3  2  
ATOM 2427  H HZ1  . LYS A 1 68  ? 11.239  -9.434  5.383   1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 2428  H HZ2  . LYS A 1 68  ? 12.356  -8.381  4.674   1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 2429  H HZ3  . LYS A 1 68  ? 11.509  -9.488  3.714   1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 2430  N N    . ALA A 1 69  ? 10.594  -4.260  0.413   1.00 0.00 ? 69  ALA A N    2  
ATOM 2431  C CA   . ALA A 1 69  ? 11.733  -3.385  0.661   1.00 0.00 ? 69  ALA A CA   2  
ATOM 2432  C C    . ALA A 1 69  ? 11.310  -1.920  0.663   1.00 0.00 ? 69  ALA A C    2  
ATOM 2433  O O    . ALA A 1 69  ? 11.888  -1.098  1.374   1.00 0.00 ? 69  ALA A O    2  
ATOM 2434  C CB   . ALA A 1 69  ? 12.816  -3.622  -0.381  1.00 0.00 ? 69  ALA A CB   2  
ATOM 2435  H H    . ALA A 1 69  ? 10.662  -4.949  -0.280  1.00 0.00 ? 69  ALA A H    2  
ATOM 2436  H HA   . ALA A 1 69  ? 12.140  -3.633  1.630   1.00 0.00 ? 69  ALA A HA   2  
ATOM 2437  H HB1  . ALA A 1 69  ? 13.333  -4.544  -0.159  1.00 0.00 ? 69  ALA A HB1  2  
ATOM 2438  H HB2  . ALA A 1 69  ? 12.366  -3.688  -1.360  1.00 0.00 ? 69  ALA A HB2  2  
ATOM 2439  H HB3  . ALA A 1 69  ? 13.519  -2.802  -0.362  1.00 0.00 ? 69  ALA A HB3  2  
ATOM 2440  N N    . ALA A 1 70  ? 10.298  -1.600  -0.137  1.00 0.00 ? 70  ALA A N    2  
ATOM 2441  C CA   . ALA A 1 70  ? 9.797   -0.234  -0.226  1.00 0.00 ? 70  ALA A CA   2  
ATOM 2442  C C    . ALA A 1 70  ? 8.839   0.075   0.920   1.00 0.00 ? 70  ALA A C    2  
ATOM 2443  O O    . ALA A 1 70  ? 8.732   1.219   1.362   1.00 0.00 ? 70  ALA A O    2  
ATOM 2444  C CB   . ALA A 1 70  ? 9.110   -0.010  -1.565  1.00 0.00 ? 70  ALA A CB   2  
ATOM 2445  H H    . ALA A 1 70  ? 9.878   -2.300  -0.679  1.00 0.00 ? 70  ALA A H    2  
ATOM 2446  H HA   . ALA A 1 70  ? 10.642  0.436   -0.166  1.00 0.00 ? 70  ALA A HA   2  
ATOM 2447  H HB1  . ALA A 1 70  ? 8.102   -0.397  -1.520  1.00 0.00 ? 70  ALA A HB1  2  
ATOM 2448  H HB2  . ALA A 1 70  ? 9.081   1.047   -1.782  1.00 0.00 ? 70  ALA A HB2  2  
ATOM 2449  H HB3  . ALA A 1 70  ? 9.658   -0.523  -2.341  1.00 0.00 ? 70  ALA A HB3  2  
ATOM 2450  N N    . LYS A 1 71  ? 8.144   -0.952  1.398   1.00 0.00 ? 71  LYS A N    2  
ATOM 2451  C CA   . LYS A 1 71  ? 7.196   -0.791  2.493   1.00 0.00 ? 71  LYS A CA   2  
ATOM 2452  C C    . LYS A 1 71  ? 7.912   -0.387  3.778   1.00 0.00 ? 71  LYS A C    2  
ATOM 2453  O O    . LYS A 1 71  ? 7.485   0.534   4.473   1.00 0.00 ? 71  LYS A O    2  
ATOM 2454  C CB   . LYS A 1 71  ? 6.418   -2.091  2.717   1.00 0.00 ? 71  LYS A CB   2  
ATOM 2455  C CG   . LYS A 1 71  ? 5.615   -2.104  4.006   1.00 0.00 ? 71  LYS A CG   2  
ATOM 2456  C CD   . LYS A 1 71  ? 4.371   -2.968  3.878   1.00 0.00 ? 71  LYS A CD   2  
ATOM 2457  C CE   . LYS A 1 71  ? 4.707   -4.448  3.981   1.00 0.00 ? 71  LYS A CE   2  
ATOM 2458  N NZ   . LYS A 1 71  ? 5.201   -4.812  5.338   1.00 0.00 ? 71  LYS A NZ   2  
ATOM 2459  H H    . LYS A 1 71  ? 8.273   -1.841  1.004   1.00 0.00 ? 71  LYS A H    2  
ATOM 2460  H HA   . LYS A 1 71  ? 6.503   -0.010  2.220   1.00 0.00 ? 71  LYS A HA   2  
ATOM 2461  H HB2  . LYS A 1 71  ? 5.737   -2.235  1.891   1.00 0.00 ? 71  LYS A HB2  2  
ATOM 2462  H HB3  . LYS A 1 71  ? 7.118   -2.914  2.744   1.00 0.00 ? 71  LYS A HB3  2  
ATOM 2463  H HG2  . LYS A 1 71  ? 6.232   -2.497  4.800   1.00 0.00 ? 71  LYS A HG2  2  
ATOM 2464  H HG3  . LYS A 1 71  ? 5.318   -1.093  4.245   1.00 0.00 ? 71  LYS A HG3  2  
ATOM 2465  H HD2  . LYS A 1 71  ? 3.682   -2.711  4.669   1.00 0.00 ? 71  LYS A HD2  2  
ATOM 2466  H HD3  . LYS A 1 71  ? 3.909   -2.778  2.920   1.00 0.00 ? 71  LYS A HD3  2  
ATOM 2467  H HE2  . LYS A 1 71  ? 3.818   -5.021  3.765   1.00 0.00 ? 71  LYS A HE2  2  
ATOM 2468  H HE3  . LYS A 1 71  ? 5.471   -4.681  3.254   1.00 0.00 ? 71  LYS A HE3  2  
ATOM 2469  H HZ1  . LYS A 1 71  ? 6.090   -4.311  5.540   1.00 0.00 ? 71  LYS A HZ1  2  
ATOM 2470  H HZ2  . LYS A 1 71  ? 5.372   -5.836  5.393   1.00 0.00 ? 71  LYS A HZ2  2  
ATOM 2471  H HZ3  . LYS A 1 71  ? 4.497   -4.549  6.057   1.00 0.00 ? 71  LYS A HZ3  2  
ATOM 2472  N N    . GLU A 1 72  ? 9.002   -1.082  4.086   1.00 0.00 ? 72  GLU A N    2  
ATOM 2473  C CA   . GLU A 1 72  ? 9.777   -0.794  5.288   1.00 0.00 ? 72  GLU A CA   2  
ATOM 2474  C C    . GLU A 1 72  ? 10.331  0.627   5.249   1.00 0.00 ? 72  GLU A C    2  
ATOM 2475  O O    . GLU A 1 72  ? 10.360  1.321   6.265   1.00 0.00 ? 72  GLU A O    2  
ATOM 2476  C CB   . GLU A 1 72  ? 10.923  -1.797  5.435   1.00 0.00 ? 72  GLU A CB   2  
ATOM 2477  C CG   . GLU A 1 72  ? 10.478  -3.247  5.349   1.00 0.00 ? 72  GLU A CG   2  
ATOM 2478  C CD   . GLU A 1 72  ? 11.355  -4.176  6.166   1.00 0.00 ? 72  GLU A CD   2  
ATOM 2479  O OE1  . GLU A 1 72  ? 12.529  -4.368  5.787   1.00 0.00 ? 72  GLU A OE1  2  
ATOM 2480  O OE2  . GLU A 1 72  ? 10.867  -4.711  7.183   1.00 0.00 ? 72  GLU A OE2  2  
ATOM 2481  H H    . GLU A 1 72  ? 9.292   -1.806  3.492   1.00 0.00 ? 72  GLU A H    2  
ATOM 2482  H HA   . GLU A 1 72  ? 9.118   -0.887  6.137   1.00 0.00 ? 72  GLU A HA   2  
ATOM 2483  H HB2  . GLU A 1 72  ? 11.646  -1.616  4.654   1.00 0.00 ? 72  GLU A HB2  2  
ATOM 2484  H HB3  . GLU A 1 72  ? 11.397  -1.644  6.394   1.00 0.00 ? 72  GLU A HB3  2  
ATOM 2485  H HG2  . GLU A 1 72  ? 9.464   -3.321  5.712   1.00 0.00 ? 72  GLU A HG2  2  
ATOM 2486  H HG3  . GLU A 1 72  ? 10.512  -3.560  4.315   1.00 0.00 ? 72  GLU A HG3  2  
ATOM 2487  N N    . ALA A 1 73  ? 10.772  1.053   4.070   1.00 0.00 ? 73  ALA A N    2  
ATOM 2488  C CA   . ALA A 1 73  ? 11.324  2.391   3.898   1.00 0.00 ? 73  ALA A CA   2  
ATOM 2489  C C    . ALA A 1 73  ? 10.285  3.459   4.221   1.00 0.00 ? 73  ALA A C    2  
ATOM 2490  O O    . ALA A 1 73  ? 10.537  4.362   5.018   1.00 0.00 ? 73  ALA A O    2  
ATOM 2491  C CB   . ALA A 1 73  ? 11.844  2.569   2.479   1.00 0.00 ? 73  ALA A CB   2  
ATOM 2492  H H    . ALA A 1 73  ? 10.722  0.453   3.297   1.00 0.00 ? 73  ALA A H    2  
ATOM 2493  H HA   . ALA A 1 73  ? 12.158  2.497   4.577   1.00 0.00 ? 73  ALA A HA   2  
ATOM 2494  H HB1  . ALA A 1 73  ? 12.760  3.141   2.502   1.00 0.00 ? 73  ALA A HB1  2  
ATOM 2495  H HB2  . ALA A 1 73  ? 12.034  1.600   2.042   1.00 0.00 ? 73  ALA A HB2  2  
ATOM 2496  H HB3  . ALA A 1 73  ? 11.107  3.092   1.889   1.00 0.00 ? 73  ALA A HB3  2  
ATOM 2497  N N    . MET A 1 74  ? 9.117   3.350   3.596   1.00 0.00 ? 74  MET A N    2  
ATOM 2498  C CA   . MET A 1 74  ? 8.040   4.308   3.818   1.00 0.00 ? 74  MET A CA   2  
ATOM 2499  C C    . MET A 1 74  ? 7.157   3.872   4.983   1.00 0.00 ? 74  MET A C    2  
ATOM 2500  O O    . MET A 1 74  ? 6.105   4.461   5.229   1.00 0.00 ? 74  MET A O    2  
ATOM 2501  C CB   . MET A 1 74  ? 7.195   4.460   2.552   1.00 0.00 ? 74  MET A CB   2  
ATOM 2502  C CG   . MET A 1 74  ? 7.712   5.527   1.601   1.00 0.00 ? 74  MET A CG   2  
ATOM 2503  S SD   . MET A 1 74  ? 7.411   7.200   2.203   1.00 0.00 ? 74  MET A SD   2  
ATOM 2504  C CE   . MET A 1 74  ? 5.622   7.259   2.158   1.00 0.00 ? 74  MET A CE   2  
ATOM 2505  H H    . MET A 1 74  ? 8.975   2.608   2.971   1.00 0.00 ? 74  MET A H    2  
ATOM 2506  H HA   . MET A 1 74  ? 8.488   5.260   4.057   1.00 0.00 ? 74  MET A HA   2  
ATOM 2507  H HB2  . MET A 1 74  ? 7.181   3.517   2.027   1.00 0.00 ? 74  MET A HB2  2  
ATOM 2508  H HB3  . MET A 1 74  ? 6.186   4.720   2.835   1.00 0.00 ? 74  MET A HB3  2  
ATOM 2509  H HG2  . MET A 1 74  ? 8.776   5.392   1.473   1.00 0.00 ? 74  MET A HG2  2  
ATOM 2510  H HG3  . MET A 1 74  ? 7.219   5.408   0.647   1.00 0.00 ? 74  MET A HG3  2  
ATOM 2511  H HE1  . MET A 1 74  ? 5.284   8.220   2.517   1.00 0.00 ? 74  MET A HE1  2  
ATOM 2512  H HE2  . MET A 1 74  ? 5.282   7.113   1.143   1.00 0.00 ? 74  MET A HE2  2  
ATOM 2513  H HE3  . MET A 1 74  ? 5.220   6.478   2.788   1.00 0.00 ? 74  MET A HE3  2  
ATOM 2514  N N    . GLU A 1 75  ? 7.593   2.838   5.696   1.00 0.00 ? 75  GLU A N    2  
ATOM 2515  C CA   . GLU A 1 75  ? 6.840   2.325   6.834   1.00 0.00 ? 75  GLU A CA   2  
ATOM 2516  C C    . GLU A 1 75  ? 6.256   3.467   7.661   1.00 0.00 ? 75  GLU A C    2  
ATOM 2517  O O    . GLU A 1 75  ? 5.056   3.501   7.932   1.00 0.00 ? 75  GLU A O    2  
ATOM 2518  C CB   . GLU A 1 75  ? 7.736   1.450   7.714   1.00 0.00 ? 75  GLU A CB   2  
ATOM 2519  C CG   . GLU A 1 75  ? 8.897   2.205   8.340   1.00 0.00 ? 75  GLU A CG   2  
ATOM 2520  C CD   . GLU A 1 75  ? 9.954   1.280   8.912   1.00 0.00 ? 75  GLU A CD   2  
ATOM 2521  O OE1  . GLU A 1 75  ? 9.614   0.125   9.245   1.00 0.00 ? 75  GLU A OE1  2  
ATOM 2522  O OE2  . GLU A 1 75  ? 11.120  1.711   9.026   1.00 0.00 ? 75  GLU A OE2  2  
ATOM 2523  H H    . GLU A 1 75  ? 8.440   2.411   5.450   1.00 0.00 ? 75  GLU A H    2  
ATOM 2524  H HA   . GLU A 1 75  ? 6.030   1.723   6.452   1.00 0.00 ? 75  GLU A HA   2  
ATOM 2525  H HB2  . GLU A 1 75  ? 7.138   1.027   8.508   1.00 0.00 ? 75  GLU A HB2  2  
ATOM 2526  H HB3  . GLU A 1 75  ? 8.138   0.649   7.112   1.00 0.00 ? 75  GLU A HB3  2  
ATOM 2527  H HG2  . GLU A 1 75  ? 9.356   2.826   7.585   1.00 0.00 ? 75  GLU A HG2  2  
ATOM 2528  H HG3  . GLU A 1 75  ? 8.517   2.829   9.135   1.00 0.00 ? 75  GLU A HG3  2  
ATOM 2529  N N    . ASP A 1 76  ? 7.114   4.400   8.058   1.00 0.00 ? 76  ASP A N    2  
ATOM 2530  C CA   . ASP A 1 76  ? 6.685   5.545   8.853   1.00 0.00 ? 76  ASP A CA   2  
ATOM 2531  C C    . ASP A 1 76  ? 6.781   6.835   8.045   1.00 0.00 ? 76  ASP A C    2  
ATOM 2532  O O    . ASP A 1 76  ? 6.929   7.921   8.604   1.00 0.00 ? 76  ASP A O    2  
ATOM 2533  C CB   . ASP A 1 76  ? 7.532   5.659   10.121  1.00 0.00 ? 76  ASP A CB   2  
ATOM 2534  C CG   . ASP A 1 76  ? 8.998   5.898   9.818   1.00 0.00 ? 76  ASP A CG   2  
ATOM 2535  O OD1  . ASP A 1 76  ? 9.336   7.012   9.365   1.00 0.00 ? 76  ASP A OD1  2  
ATOM 2536  O OD2  . ASP A 1 76  ? 9.808   4.972   10.033  1.00 0.00 ? 76  ASP A OD2  2  
ATOM 2537  H H    . ASP A 1 76  ? 8.059   4.318   7.810   1.00 0.00 ? 76  ASP A H    2  
ATOM 2538  H HA   . ASP A 1 76  ? 5.654   5.386   9.133   1.00 0.00 ? 76  ASP A HA   2  
ATOM 2539  H HB2  . ASP A 1 76  ? 7.168   6.483   10.717  1.00 0.00 ? 76  ASP A HB2  2  
ATOM 2540  H HB3  . ASP A 1 76  ? 7.445   4.744   10.688  1.00 0.00 ? 76  ASP A HB3  2  
ATOM 2541  N N    . GLY A 1 77  ? 6.697   6.707   6.724   1.00 0.00 ? 77  GLY A N    2  
ATOM 2542  C CA   . GLY A 1 77  ? 6.778   7.870   5.859   1.00 0.00 ? 77  GLY A CA   2  
ATOM 2543  C C    . GLY A 1 77  ? 5.458   8.609   5.757   1.00 0.00 ? 77  GLY A C    2  
ATOM 2544  O O    . GLY A 1 77  ? 4.406   8.059   6.078   1.00 0.00 ? 77  GLY A O    2  
ATOM 2545  H H    . GLY A 1 77  ? 6.580   5.816   6.333   1.00 0.00 ? 77  GLY A H    2  
ATOM 2546  H HA2  . GLY A 1 77  ? 7.526   8.544   6.249   1.00 0.00 ? 77  GLY A HA2  2  
ATOM 2547  H HA3  . GLY A 1 77  ? 7.075   7.550   4.872   1.00 0.00 ? 77  GLY A HA3  2  
ATOM 2548  N N    . GLU A 1 78  ? 5.515   9.860   5.310   1.00 0.00 ? 78  GLU A N    2  
ATOM 2549  C CA   . GLU A 1 78  ? 4.315   10.675  5.169   1.00 0.00 ? 78  GLU A CA   2  
ATOM 2550  C C    . GLU A 1 78  ? 4.304   11.401  3.826   1.00 0.00 ? 78  GLU A C    2  
ATOM 2551  O O    . GLU A 1 78  ? 5.165   12.238  3.555   1.00 0.00 ? 78  GLU A O    2  
ATOM 2552  C CB   . GLU A 1 78  ? 4.224   11.691  6.310   1.00 0.00 ? 78  GLU A CB   2  
ATOM 2553  C CG   . GLU A 1 78  ? 5.505   12.479  6.526   1.00 0.00 ? 78  GLU A CG   2  
ATOM 2554  C CD   . GLU A 1 78  ? 5.277   13.759  7.307   1.00 0.00 ? 78  GLU A CD   2  
ATOM 2555  O OE1  . GLU A 1 78  ? 4.583   13.707  8.343   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 2556  O OE2  . GLU A 1 78  ? 5.793   14.814  6.880   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 2557  H H    . GLU A 1 78  ? 6.385   10.243  5.070   1.00 0.00 ? 78  GLU A H    2  
ATOM 2558  H HA   . GLU A 1 78  ? 3.460   10.018  5.216   1.00 0.00 ? 78  GLU A HA   2  
ATOM 2559  H HB2  . GLU A 1 78  ? 3.428   12.388  6.094   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 2560  H HB3  . GLU A 1 78  ? 3.991   11.166  7.225   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 2561  H HG2  . GLU A 1 78  ? 6.204   11.864  7.071   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 2562  H HG3  . GLU A 1 78  ? 5.923   12.732  5.563   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 2563  N N    . ILE A 1 79  ? 3.324   11.072  2.991   1.00 0.00 ? 79  ILE A N    2  
ATOM 2564  C CA   . ILE A 1 79  ? 3.201   11.691  1.677   1.00 0.00 ? 79  ILE A CA   2  
ATOM 2565  C C    . ILE A 1 79  ? 2.438   13.009  1.761   1.00 0.00 ? 79  ILE A C    2  
ATOM 2566  O O    . ILE A 1 79  ? 1.397   13.096  2.413   1.00 0.00 ? 79  ILE A O    2  
ATOM 2567  C CB   . ILE A 1 79  ? 2.487   10.760  0.680   1.00 0.00 ? 79  ILE A CB   2  
ATOM 2568  C CG1  . ILE A 1 79  ? 3.142   9.378   0.681   1.00 0.00 ? 79  ILE A CG1  2  
ATOM 2569  C CG2  . ILE A 1 79  ? 2.510   11.362  -0.717  1.00 0.00 ? 79  ILE A CG2  2  
ATOM 2570  C CD1  . ILE A 1 79  ? 2.585   8.444   -0.371  1.00 0.00 ? 79  ILE A CD1  2  
ATOM 2571  H H    . ILE A 1 79  ? 2.669   10.397  3.265   1.00 0.00 ? 79  ILE A H    2  
ATOM 2572  H HA   . ILE A 1 79  ? 4.197   11.887  1.307   1.00 0.00 ? 79  ILE A HA   2  
ATOM 2573  H HB   . ILE A 1 79  ? 1.457   10.662  0.988   1.00 0.00 ? 79  ILE A HB   2  
ATOM 2574  H HG12 . ILE A 1 79  ? 4.200   9.487   0.499   1.00 0.00 ? 79  ILE A HG12 2  
ATOM 2575  H HG13 . ILE A 1 79  ? 2.993   8.917   1.647   1.00 0.00 ? 79  ILE A HG13 2  
ATOM 2576  H HG21 . ILE A 1 79  ? 3.148   10.769  -1.354  1.00 0.00 ? 79  ILE A HG21 2  
ATOM 2577  H HG22 . ILE A 1 79  ? 1.508   11.372  -1.120  1.00 0.00 ? 79  ILE A HG22 2  
ATOM 2578  H HG23 . ILE A 1 79  ? 2.888   12.372  -0.667  1.00 0.00 ? 79  ILE A HG23 2  
ATOM 2579  H HD11 . ILE A 1 79  ? 3.348   8.231   -1.104  1.00 0.00 ? 79  ILE A HD11 2  
ATOM 2580  H HD12 . ILE A 1 79  ? 2.266   7.525   0.096   1.00 0.00 ? 79  ILE A HD12 2  
ATOM 2581  H HD13 . ILE A 1 79  ? 1.741   8.913   -0.857  1.00 0.00 ? 79  ILE A HD13 2  
ATOM 2582  N N    . ASP A 1 80  ? 2.962   14.033  1.095   1.00 0.00 ? 80  ASP A N    2  
ATOM 2583  C CA   . ASP A 1 80  ? 2.329   15.346  1.091   1.00 0.00 ? 80  ASP A CA   2  
ATOM 2584  C C    . ASP A 1 80  ? 2.127   15.856  2.514   1.00 0.00 ? 80  ASP A C    2  
ATOM 2585  O O    . ASP A 1 80  ? 1.107   16.471  2.825   1.00 0.00 ? 80  ASP A O    2  
ATOM 2586  C CB   . ASP A 1 80  ? 0.986   15.287  0.361   1.00 0.00 ? 80  ASP A CB   2  
ATOM 2587  C CG   . ASP A 1 80  ? 1.130   15.496  -1.133  1.00 0.00 ? 80  ASP A CG   2  
ATOM 2588  O OD1  . ASP A 1 80  ? 1.137   16.665  -1.571  1.00 0.00 ? 80  ASP A OD1  2  
ATOM 2589  O OD2  . ASP A 1 80  ? 1.234   14.490  -1.866  1.00 0.00 ? 80  ASP A OD2  2  
ATOM 2590  H H    . ASP A 1 80  ? 3.794   13.901  0.594   1.00 0.00 ? 80  ASP A H    2  
ATOM 2591  H HA   . ASP A 1 80  ? 2.983   16.028  0.568   1.00 0.00 ? 80  ASP A HA   2  
ATOM 2592  H HB2  . ASP A 1 80  ? 0.535   14.320  0.529   1.00 0.00 ? 80  ASP A HB2  2  
ATOM 2593  H HB3  . ASP A 1 80  ? 0.337   16.055  0.754   1.00 0.00 ? 80  ASP A HB3  2  
ATOM 2594  N N    . GLY A 1 81  ? 3.105   15.596  3.376   1.00 0.00 ? 81  GLY A N    2  
ATOM 2595  C CA   . GLY A 1 81  ? 3.014   16.035  4.757   1.00 0.00 ? 81  GLY A CA   2  
ATOM 2596  C C    . GLY A 1 81  ? 1.925   15.312  5.524   1.00 0.00 ? 81  GLY A C    2  
ATOM 2597  O O    . GLY A 1 81  ? 1.460   15.793  6.556   1.00 0.00 ? 81  GLY A O    2  
ATOM 2598  H H    . GLY A 1 81  ? 3.895   15.102  3.072   1.00 0.00 ? 81  GLY A H    2  
ATOM 2599  H HA2  . GLY A 1 81  ? 3.962   15.856  5.243   1.00 0.00 ? 81  GLY A HA2  2  
ATOM 2600  H HA3  . GLY A 1 81  ? 2.807   17.095  4.772   1.00 0.00 ? 81  GLY A HA3  2  
ATOM 2601  N N    . ASN A 1 82  ? 1.516   14.153  5.018   1.00 0.00 ? 82  ASN A N    2  
ATOM 2602  C CA   . ASN A 1 82  ? 0.473   13.363  5.662   1.00 0.00 ? 82  ASN A CA   2  
ATOM 2603  C C    . ASN A 1 82  ? 0.941   11.931  5.897   1.00 0.00 ? 82  ASN A C    2  
ATOM 2604  O O    . ASN A 1 82  ? 1.514   11.299  5.009   1.00 0.00 ? 82  ASN A O    2  
ATOM 2605  C CB   . ASN A 1 82  ? -0.796  13.363  4.807   1.00 0.00 ? 82  ASN A CB   2  
ATOM 2606  C CG   . ASN A 1 82  ? -1.648  14.597  5.035   1.00 0.00 ? 82  ASN A CG   2  
ATOM 2607  O OD1  . ASN A 1 82  ? -1.428  15.349  5.985   1.00 0.00 ? 82  ASN A OD1  2  
ATOM 2608  N ND2  . ASN A 1 82  ? -2.626  14.810  4.163   1.00 0.00 ? 82  ASN A ND2  2  
ATOM 2609  H H    . ASN A 1 82  ? 1.925   13.821  4.192   1.00 0.00 ? 82  ASN A H    2  
ATOM 2610  H HA   . ASN A 1 82  ? 0.253   13.819  6.615   1.00 0.00 ? 82  ASN A HA   2  
ATOM 2611  H HB2  . ASN A 1 82  ? -0.520  13.328  3.763   1.00 0.00 ? 82  ASN A HB2  2  
ATOM 2612  H HB3  . ASN A 1 82  ? -1.386  12.491  5.048   1.00 0.00 ? 82  ASN A HB3  2  
ATOM 2613  H HD21 . ASN A 1 82  ? -2.742  14.168  3.431   1.00 0.00 ? 82  ASN A HD21 2  
ATOM 2614  H HD22 . ASN A 1 82  ? -3.191  15.601  4.286   1.00 0.00 ? 82  ASN A HD22 2  
ATOM 2615  N N    . LYS A 1 83  ? 0.694   11.423  7.100   1.00 0.00 ? 83  LYS A N    2  
ATOM 2616  C CA   . LYS A 1 83  ? 1.088   10.064  7.453   1.00 0.00 ? 83  LYS A CA   2  
ATOM 2617  C C    . LYS A 1 83  ? 0.304   9.041   6.638   1.00 0.00 ? 83  LYS A C    2  
ATOM 2618  O O    . LYS A 1 83  ? -0.926  9.082   6.589   1.00 0.00 ? 83  LYS A O    2  
ATOM 2619  C CB   . LYS A 1 83  ? 0.867   9.820   8.947   1.00 0.00 ? 83  LYS A CB   2  
ATOM 2620  C CG   . LYS A 1 83  ? 1.642   10.772  9.841   1.00 0.00 ? 83  LYS A CG   2  
ATOM 2621  C CD   . LYS A 1 83  ? 1.489   10.409  11.309  1.00 0.00 ? 83  LYS A CD   2  
ATOM 2622  C CE   . LYS A 1 83  ? 2.688   10.869  12.124  1.00 0.00 ? 83  LYS A CE   2  
ATOM 2623  N NZ   . LYS A 1 83  ? 2.524   12.268  12.609  1.00 0.00 ? 83  LYS A NZ   2  
ATOM 2624  H H    . LYS A 1 83  ? 0.234   11.976  7.766   1.00 0.00 ? 83  LYS A H    2  
ATOM 2625  H HA   . LYS A 1 83  ? 2.139   9.955   7.231   1.00 0.00 ? 83  LYS A HA   2  
ATOM 2626  H HB2  . LYS A 1 83  ? -0.185  9.930   9.166   1.00 0.00 ? 83  LYS A HB2  2  
ATOM 2627  H HB3  . LYS A 1 83  ? 1.171   8.810   9.183   1.00 0.00 ? 83  LYS A HB3  2  
ATOM 2628  H HG2  . LYS A 1 83  ? 2.688   10.728  9.577   1.00 0.00 ? 83  LYS A HG2  2  
ATOM 2629  H HG3  . LYS A 1 83  ? 1.272   11.776  9.688   1.00 0.00 ? 83  LYS A HG3  2  
ATOM 2630  H HD2  . LYS A 1 83  ? 0.600   10.882  11.697  1.00 0.00 ? 83  LYS A HD2  2  
ATOM 2631  H HD3  . LYS A 1 83  ? 1.396   9.336   11.397  1.00 0.00 ? 83  LYS A HD3  2  
ATOM 2632  H HE2  . LYS A 1 83  ? 2.801   10.214  12.974  1.00 0.00 ? 83  LYS A HE2  2  
ATOM 2633  H HE3  . LYS A 1 83  ? 3.571   10.813  11.505  1.00 0.00 ? 83  LYS A HE3  2  
ATOM 2634  H HZ1  . LYS A 1 83  ? 3.232   12.885  12.163  1.00 0.00 ? 83  LYS A HZ1  2  
ATOM 2635  H HZ2  . LYS A 1 83  ? 2.648   12.305  13.641  1.00 0.00 ? 83  LYS A HZ2  2  
ATOM 2636  H HZ3  . LYS A 1 83  ? 1.574   12.620  12.372  1.00 0.00 ? 83  LYS A HZ3  2  
ATOM 2637  N N    . VAL A 1 84  ? 1.023   8.122   6.001   1.00 0.00 ? 84  VAL A N    2  
ATOM 2638  C CA   . VAL A 1 84  ? 0.394   7.087   5.190   1.00 0.00 ? 84  VAL A CA   2  
ATOM 2639  C C    . VAL A 1 84  ? 0.656   5.701   5.769   1.00 0.00 ? 84  VAL A C    2  
ATOM 2640  O O    . VAL A 1 84  ? 1.705   5.452   6.364   1.00 0.00 ? 84  VAL A O    2  
ATOM 2641  C CB   . VAL A 1 84  ? 0.900   7.127   3.736   1.00 0.00 ? 84  VAL A CB   2  
ATOM 2642  C CG1  . VAL A 1 84  ? 0.617   8.484   3.109   1.00 0.00 ? 84  VAL A CG1  2  
ATOM 2643  C CG2  . VAL A 1 84  ? 2.386   6.805   3.680   1.00 0.00 ? 84  VAL A CG2  2  
ATOM 2644  H H    . VAL A 1 84  ? 2.000   8.142   6.078   1.00 0.00 ? 84  VAL A H    2  
ATOM 2645  H HA   . VAL A 1 84  ? -0.671  7.268   5.183   1.00 0.00 ? 84  VAL A HA   2  
ATOM 2646  H HB   . VAL A 1 84  ? 0.369   6.376   3.170   1.00 0.00 ? 84  VAL A HB   2  
ATOM 2647  H HG11 . VAL A 1 84  ? -0.450  8.651   3.080   1.00 0.00 ? 84  VAL A HG11 2  
ATOM 2648  H HG12 . VAL A 1 84  ? 1.088   9.258   3.697   1.00 0.00 ? 84  VAL A HG12 2  
ATOM 2649  H HG13 . VAL A 1 84  ? 1.011   8.505   2.104   1.00 0.00 ? 84  VAL A HG13 2  
ATOM 2650  H HG21 . VAL A 1 84  ? 2.568   5.862   4.175   1.00 0.00 ? 84  VAL A HG21 2  
ATOM 2651  H HG22 . VAL A 1 84  ? 2.702   6.737   2.649   1.00 0.00 ? 84  VAL A HG22 2  
ATOM 2652  H HG23 . VAL A 1 84  ? 2.943   7.586   4.176   1.00 0.00 ? 84  VAL A HG23 2  
ATOM 2653  N N    . THR A 1 85  ? -0.305  4.799   5.590   1.00 0.00 ? 85  THR A N    2  
ATOM 2654  C CA   . THR A 1 85  ? -0.179  3.438   6.095   1.00 0.00 ? 85  THR A CA   2  
ATOM 2655  C C    . THR A 1 85  ? -0.099  2.433   4.952   1.00 0.00 ? 85  THR A C    2  
ATOM 2656  O O    . THR A 1 85  ? -1.044  2.281   4.178   1.00 0.00 ? 85  THR A O    2  
ATOM 2657  C CB   . THR A 1 85  ? -1.363  3.066   7.008   1.00 0.00 ? 85  THR A CB   2  
ATOM 2658  O OG1  . THR A 1 85  ? -1.391  3.930   8.150   1.00 0.00 ? 85  THR A OG1  2  
ATOM 2659  C CG2  . THR A 1 85  ? -1.260  1.618   7.464   1.00 0.00 ? 85  THR A CG2  2  
ATOM 2660  H H    . THR A 1 85  ? -1.117  5.058   5.107   1.00 0.00 ? 85  THR A H    2  
ATOM 2661  H HA   . THR A 1 85  ? 0.729   3.381   6.677   1.00 0.00 ? 85  THR A HA   2  
ATOM 2662  H HB   . THR A 1 85  ? -2.280  3.188   6.451   1.00 0.00 ? 85  THR A HB   2  
ATOM 2663  H HG1  . THR A 1 85  ? -0.502  4.238   8.341   1.00 0.00 ? 85  THR A HG1  2  
ATOM 2664  H HG21 . THR A 1 85  ? -1.534  0.964   6.650   1.00 0.00 ? 85  THR A HG21 2  
ATOM 2665  H HG22 . THR A 1 85  ? -1.927  1.456   8.298   1.00 0.00 ? 85  THR A HG22 2  
ATOM 2666  H HG23 . THR A 1 85  ? -0.246  1.408   7.769   1.00 0.00 ? 85  THR A HG23 2  
ATOM 2667  N N    . LEU A 1 86  ? 1.035   1.748   4.852   1.00 0.00 ? 86  LEU A N    2  
ATOM 2668  C CA   . LEU A 1 86  ? 1.239   0.755   3.803   1.00 0.00 ? 86  LEU A CA   2  
ATOM 2669  C C    . LEU A 1 86  ? 0.817   -0.632  4.276   1.00 0.00 ? 86  LEU A C    2  
ATOM 2670  O O    . LEU A 1 86  ? 1.285   -1.117  5.306   1.00 0.00 ? 86  LEU A O    2  
ATOM 2671  C CB   . LEU A 1 86  ? 2.707   0.734   3.371   1.00 0.00 ? 86  LEU A CB   2  
ATOM 2672  C CG   . LEU A 1 86  ? 3.461   2.059   3.494   1.00 0.00 ? 86  LEU A CG   2  
ATOM 2673  C CD1  . LEU A 1 86  ? 4.954   1.843   3.297   1.00 0.00 ? 86  LEU A CD1  2  
ATOM 2674  C CD2  . LEU A 1 86  ? 2.930   3.070   2.489   1.00 0.00 ? 86  LEU A CD2  2  
ATOM 2675  H H    . LEU A 1 86  ? 1.753   1.913   5.498   1.00 0.00 ? 86  LEU A H    2  
ATOM 2676  H HA   . LEU A 1 86  ? 0.628   1.036   2.958   1.00 0.00 ? 86  LEU A HA   2  
ATOM 2677  H HB2  . LEU A 1 86  ? 3.219   0.004   3.978   1.00 0.00 ? 86  LEU A HB2  2  
ATOM 2678  H HB3  . LEU A 1 86  ? 2.742   0.427   2.336   1.00 0.00 ? 86  LEU A HB3  2  
ATOM 2679  H HG   . LEU A 1 86  ? 3.311   2.461   4.486   1.00 0.00 ? 86  LEU A HG   2  
ATOM 2680  H HD11 . LEU A 1 86  ? 5.502   2.480   3.974   1.00 0.00 ? 86  LEU A HD11 2  
ATOM 2681  H HD12 . LEU A 1 86  ? 5.221   2.084   2.279   1.00 0.00 ? 86  LEU A HD12 2  
ATOM 2682  H HD13 . LEU A 1 86  ? 5.197   0.810   3.497   1.00 0.00 ? 86  LEU A HD13 2  
ATOM 2683  H HD21 . LEU A 1 86  ? 3.714   3.767   2.231   1.00 0.00 ? 86  LEU A HD21 2  
ATOM 2684  H HD22 . LEU A 1 86  ? 2.100   3.608   2.924   1.00 0.00 ? 86  LEU A HD22 2  
ATOM 2685  H HD23 . LEU A 1 86  ? 2.599   2.554   1.600   1.00 0.00 ? 86  LEU A HD23 2  
ATOM 2686  N N    . ASP A 1 87  ? -0.069  -1.266  3.516   1.00 0.00 ? 87  ASP A N    2  
ATOM 2687  C CA   . ASP A 1 87  ? -0.552  -2.600  3.856   1.00 0.00 ? 87  ASP A CA   2  
ATOM 2688  C C    . ASP A 1 87  ? -0.736  -3.447  2.600   1.00 0.00 ? 87  ASP A C    2  
ATOM 2689  O O    . ASP A 1 87  ? -1.174  -2.950  1.563   1.00 0.00 ? 87  ASP A O    2  
ATOM 2690  C CB   . ASP A 1 87  ? -1.873  -2.507  4.621   1.00 0.00 ? 87  ASP A CB   2  
ATOM 2691  C CG   . ASP A 1 87  ? -2.612  -3.830  4.664   1.00 0.00 ? 87  ASP A CG   2  
ATOM 2692  O OD1  . ASP A 1 87  ? -3.194  -4.217  3.629   1.00 0.00 ? 87  ASP A OD1  2  
ATOM 2693  O OD2  . ASP A 1 87  ? -2.609  -4.478  5.732   1.00 0.00 ? 87  ASP A OD2  2  
ATOM 2694  H H    . ASP A 1 87  ? -0.406  -0.828  2.706   1.00 0.00 ? 87  ASP A H    2  
ATOM 2695  H HA   . ASP A 1 87  ? 0.187   -3.070  4.487   1.00 0.00 ? 87  ASP A HA   2  
ATOM 2696  H HB2  . ASP A 1 87  ? -1.672  -2.196  5.636   1.00 0.00 ? 87  ASP A HB2  2  
ATOM 2697  H HB3  . ASP A 1 87  ? -2.508  -1.775  4.144   1.00 0.00 ? 87  ASP A HB3  2  
ATOM 2698  N N    . TRP A 1 88  ? -0.398  -4.727  2.703   1.00 0.00 ? 88  TRP A N    2  
ATOM 2699  C CA   . TRP A 1 88  ? -0.525  -5.643  1.575   1.00 0.00 ? 88  TRP A CA   2  
ATOM 2700  C C    . TRP A 1 88  ? -1.978  -5.759  1.129   1.00 0.00 ? 88  TRP A C    2  
ATOM 2701  O O    . TRP A 1 88  ? -2.797  -6.382  1.805   1.00 0.00 ? 88  TRP A O    2  
ATOM 2702  C CB   . TRP A 1 88  ? 0.018   -7.023  1.949   1.00 0.00 ? 88  TRP A CB   2  
ATOM 2703  C CG   . TRP A 1 88  ? 1.486   -7.021  2.255   1.00 0.00 ? 88  TRP A CG   2  
ATOM 2704  C CD1  . TRP A 1 88  ? 2.081   -7.429  3.415   1.00 0.00 ? 88  TRP A CD1  2  
ATOM 2705  C CD2  . TRP A 1 88  ? 2.541   -6.589  1.390   1.00 0.00 ? 88  TRP A CD2  2  
ATOM 2706  N NE1  . TRP A 1 88  ? 3.444   -7.276  3.322   1.00 0.00 ? 88  TRP A NE1  2  
ATOM 2707  C CE2  . TRP A 1 88  ? 3.751   -6.763  2.089   1.00 0.00 ? 88  TRP A CE2  2  
ATOM 2708  C CE3  . TRP A 1 88  ? 2.582   -6.074  0.091   1.00 0.00 ? 88  TRP A CE3  2  
ATOM 2709  C CZ2  . TRP A 1 88  ? 4.986   -6.439  1.533   1.00 0.00 ? 88  TRP A CZ2  2  
ATOM 2710  C CZ3  . TRP A 1 88  ? 3.808   -5.753  -0.459  1.00 0.00 ? 88  TRP A CZ3  2  
ATOM 2711  C CH2  . TRP A 1 88  ? 4.996   -5.937  0.260   1.00 0.00 ? 88  TRP A CH2  2  
ATOM 2712  H H    . TRP A 1 88  ? -0.055  -5.065  3.557   1.00 0.00 ? 88  TRP A H    2  
ATOM 2713  H HA   . TRP A 1 88  ? 0.060   -5.246  0.759   1.00 0.00 ? 88  TRP A HA   2  
ATOM 2714  H HB2  . TRP A 1 88  ? -0.504  -7.385  2.822   1.00 0.00 ? 88  TRP A HB2  2  
ATOM 2715  H HB3  . TRP A 1 88  ? -0.150  -7.703  1.126   1.00 0.00 ? 88  TRP A HB3  2  
ATOM 2716  H HD1  . TRP A 1 88  ? 1.547   -7.811  4.271   1.00 0.00 ? 88  TRP A HD1  2  
ATOM 2717  H HE1  . TRP A 1 88  ? 4.090   -7.499  4.024   1.00 0.00 ? 88  TRP A HE1  2  
ATOM 2718  H HE3  . TRP A 1 88  ? 1.677   -5.925  -0.479  1.00 0.00 ? 88  TRP A HE3  2  
ATOM 2719  H HZ2  . TRP A 1 88  ? 5.910   -6.576  2.074   1.00 0.00 ? 88  TRP A HZ2  2  
ATOM 2720  H HZ3  . TRP A 1 88  ? 3.859   -5.353  -1.462  1.00 0.00 ? 88  TRP A HZ3  2  
ATOM 2721  H HH2  . TRP A 1 88  ? 5.931   -5.672  -0.210  1.00 0.00 ? 88  TRP A HH2  2  
ATOM 2722  N N    . ALA A 1 89  ? -2.292  -5.157  -0.013  1.00 0.00 ? 89  ALA A N    2  
ATOM 2723  C CA   . ALA A 1 89  ? -3.646  -5.195  -0.550  1.00 0.00 ? 89  ALA A CA   2  
ATOM 2724  C C    . ALA A 1 89  ? -4.325  -6.524  -0.235  1.00 0.00 ? 89  ALA A C    2  
ATOM 2725  O O    . ALA A 1 89  ? -3.681  -7.573  -0.221  1.00 0.00 ? 89  ALA A O    2  
ATOM 2726  C CB   . ALA A 1 89  ? -3.626  -4.954  -2.053  1.00 0.00 ? 89  ALA A CB   2  
ATOM 2727  H H    . ALA A 1 89  ? -1.595  -4.676  -0.507  1.00 0.00 ? 89  ALA A H    2  
ATOM 2728  H HA   . ALA A 1 89  ? -4.211  -4.396  -0.090  1.00 0.00 ? 89  ALA A HA   2  
ATOM 2729  H HB1  . ALA A 1 89  ? -3.799  -5.887  -2.568  1.00 0.00 ? 89  ALA A HB1  2  
ATOM 2730  H HB2  . ALA A 1 89  ? -4.400  -4.248  -2.314  1.00 0.00 ? 89  ALA A HB2  2  
ATOM 2731  H HB3  . ALA A 1 89  ? -2.663  -4.557  -2.340  1.00 0.00 ? 89  ALA A HB3  2  
ATOM 2732  N N    . LYS A 1 90  ? -5.628  -6.472  0.018   1.00 0.00 ? 90  LYS A N    2  
ATOM 2733  C CA   . LYS A 1 90  ? -6.395  -7.672  0.333   1.00 0.00 ? 90  LYS A CA   2  
ATOM 2734  C C    . LYS A 1 90  ? -7.393  -7.986  -0.777  1.00 0.00 ? 90  LYS A C    2  
ATOM 2735  O O    . LYS A 1 90  ? -7.948  -7.093  -1.418  1.00 0.00 ? 90  LYS A O    2  
ATOM 2736  C CB   . LYS A 1 90  ? -7.133  -7.496  1.662   1.00 0.00 ? 90  LYS A CB   2  
ATOM 2737  C CG   . LYS A 1 90  ? -6.224  -7.575  2.876   1.00 0.00 ? 90  LYS A CG   2  
ATOM 2738  C CD   . LYS A 1 90  ? -5.580  -8.945  3.004   1.00 0.00 ? 90  LYS A CD   2  
ATOM 2739  C CE   . LYS A 1 90  ? -5.005  -9.164  4.395   1.00 0.00 ? 90  LYS A CE   2  
ATOM 2740  N NZ   . LYS A 1 90  ? -3.638  -8.588  4.527   1.00 0.00 ? 90  LYS A NZ   2  
ATOM 2741  H H    . LYS A 1 90  ? -6.086  -5.605  -0.009  1.00 0.00 ? 90  LYS A H    2  
ATOM 2742  H HA   . LYS A 1 90  ? -5.702  -8.495  0.421   1.00 0.00 ? 90  LYS A HA   2  
ATOM 2743  H HB2  . LYS A 1 90  ? -7.620  -6.532  1.665   1.00 0.00 ? 90  LYS A HB2  2  
ATOM 2744  H HB3  . LYS A 1 90  ? -7.882  -8.269  1.749   1.00 0.00 ? 90  LYS A HB3  2  
ATOM 2745  H HG2  . LYS A 1 90  ? -5.447  -6.831  2.782   1.00 0.00 ? 90  LYS A HG2  2  
ATOM 2746  H HG3  . LYS A 1 90  ? -6.808  -7.377  3.765   1.00 0.00 ? 90  LYS A HG3  2  
ATOM 2747  H HD2  . LYS A 1 90  ? -6.325  -9.703  2.811   1.00 0.00 ? 90  LYS A HD2  2  
ATOM 2748  H HD3  . LYS A 1 90  ? -4.784  -9.028  2.277   1.00 0.00 ? 90  LYS A HD3  2  
ATOM 2749  H HE2  . LYS A 1 90  ? -5.656  -8.694  5.117   1.00 0.00 ? 90  LYS A HE2  2  
ATOM 2750  H HE3  . LYS A 1 90  ? -4.960  -10.225 4.588   1.00 0.00 ? 90  LYS A HE3  2  
ATOM 2751  H HZ1  . LYS A 1 90  ? -3.362  -8.551  5.529   1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 2752  H HZ2  . LYS A 1 90  ? -3.618  -7.624  4.138   1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 2753  H HZ3  . LYS A 1 90  ? -2.952  -9.174  4.010   1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 2754  N N    . PRO A 1 91  ? -7.630  -9.285  -1.011  1.00 0.00 ? 91  PRO A N    2  
ATOM 2755  C CA   . PRO A 1 91  ? -8.564  -9.747  -2.042  1.00 0.00 ? 91  PRO A CA   2  
ATOM 2756  C C    . PRO A 1 91  ? -10.016 -9.446  -1.686  1.00 0.00 ? 91  PRO A C    2  
ATOM 2757  O O    . PRO A 1 91  ? -10.462 -9.717  -0.571  1.00 0.00 ? 91  PRO A O    2  
ATOM 2758  C CB   . PRO A 1 91  ? -8.327  -11.259 -2.084  1.00 0.00 ? 91  PRO A CB   2  
ATOM 2759  C CG   . PRO A 1 91  ? -7.802  -11.598 -0.732  1.00 0.00 ? 91  PRO A CG   2  
ATOM 2760  C CD   . PRO A 1 91  ? -7.005  -10.404 -0.286  1.00 0.00 ? 91  PRO A CD   2  
ATOM 2761  H HA   . PRO A 1 91  ? -8.334  -9.318  -3.006  1.00 0.00 ? 91  PRO A HA   2  
ATOM 2762  H HB2  . PRO A 1 91  ? -9.259  -11.766 -2.286  1.00 0.00 ? 91  PRO A HB2  2  
ATOM 2763  H HB3  . PRO A 1 91  ? -7.609  -11.492 -2.856  1.00 0.00 ? 91  PRO A HB3  2  
ATOM 2764  H HG2  . PRO A 1 91  ? -8.623  -11.776 -0.054  1.00 0.00 ? 91  PRO A HG2  2  
ATOM 2765  H HG3  . PRO A 1 91  ? -7.168  -12.470 -0.793  1.00 0.00 ? 91  PRO A HG3  2  
ATOM 2766  H HD2  . PRO A 1 91  ? -7.093  -10.269 0.782   1.00 0.00 ? 91  PRO A HD2  2  
ATOM 2767  H HD3  . PRO A 1 91  ? -5.968  -10.515 -0.569  1.00 0.00 ? 91  PRO A HD3  2  
ATOM 2768  N N    . LYS A 1 92  ? -10.750 -8.883  -2.640  1.00 0.00 ? 92  LYS A N    2  
ATOM 2769  C CA   . LYS A 1 92  ? -12.152 -8.546  -2.429  1.00 0.00 ? 92  LYS A CA   2  
ATOM 2770  C C    . LYS A 1 92  ? -13.004 -9.806  -2.314  1.00 0.00 ? 92  LYS A C    2  
ATOM 2771  O O    . LYS A 1 92  ? -13.241 -10.499 -3.303  1.00 0.00 ? 92  LYS A O    2  
ATOM 2772  C CB   . LYS A 1 92  ? -12.667 -7.673  -3.575  1.00 0.00 ? 92  LYS A CB   2  
ATOM 2773  C CG   . LYS A 1 92  ? -14.145 -7.341  -3.471  1.00 0.00 ? 92  LYS A CG   2  
ATOM 2774  C CD   . LYS A 1 92  ? -14.746 -7.038  -4.833  1.00 0.00 ? 92  LYS A CD   2  
ATOM 2775  C CE   . LYS A 1 92  ? -16.206 -6.626  -4.720  1.00 0.00 ? 92  LYS A CE   2  
ATOM 2776  N NZ   . LYS A 1 92  ? -17.116 -7.805  -4.713  1.00 0.00 ? 92  LYS A NZ   2  
ATOM 2777  H H    . LYS A 1 92  ? -10.337 -8.691  -3.509  1.00 0.00 ? 92  LYS A H    2  
ATOM 2778  H HA   . LYS A 1 92  ? -12.225 -7.992  -1.505  1.00 0.00 ? 92  LYS A HA   2  
ATOM 2779  H HB2  . LYS A 1 92  ? -12.111 -6.747  -3.584  1.00 0.00 ? 92  LYS A HB2  2  
ATOM 2780  H HB3  . LYS A 1 92  ? -12.501 -8.191  -4.509  1.00 0.00 ? 92  LYS A HB3  2  
ATOM 2781  H HG2  . LYS A 1 92  ? -14.665 -8.184  -3.040  1.00 0.00 ? 92  LYS A HG2  2  
ATOM 2782  H HG3  . LYS A 1 92  ? -14.267 -6.476  -2.834  1.00 0.00 ? 92  LYS A HG3  2  
ATOM 2783  H HD2  . LYS A 1 92  ? -14.192 -6.232  -5.291  1.00 0.00 ? 92  LYS A HD2  2  
ATOM 2784  H HD3  . LYS A 1 92  ? -14.677 -7.922  -5.452  1.00 0.00 ? 92  LYS A HD3  2  
ATOM 2785  H HE2  . LYS A 1 92  ? -16.340 -6.074  -3.802  1.00 0.00 ? 92  LYS A HE2  2  
ATOM 2786  H HE3  . LYS A 1 92  ? -16.455 -5.994  -5.560  1.00 0.00 ? 92  LYS A HE3  2  
ATOM 2787  H HZ1  . LYS A 1 92  ? -17.052 -8.301  -3.801  1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 2788  H HZ2  . LYS A 1 92  ? -16.851 -8.465  -5.473  1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 2789  H HZ3  . LYS A 1 92  ? -18.099 -7.499  -4.862  1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 2790  N N    . GLY A 1 93  ? -13.462 -10.098 -1.100  1.00 0.00 ? 93  GLY A N    2  
ATOM 2791  C CA   . GLY A 1 93  ? -14.283 -11.274 -0.880  1.00 0.00 ? 93  GLY A CA   2  
ATOM 2792  C C    . GLY A 1 93  ? -13.467 -12.551 -0.836  1.00 0.00 ? 93  GLY A C    2  
ATOM 2793  O O    . GLY A 1 93  ? -12.429 -12.654 -1.488  1.00 0.00 ? 93  GLY A O    2  
ATOM 2794  H H    . GLY A 1 93  ? -13.241 -9.509  -0.349  1.00 0.00 ? 93  GLY A H    2  
ATOM 2795  H HA2  . GLY A 1 93  ? -14.809 -11.162 0.056   1.00 0.00 ? 93  GLY A HA2  2  
ATOM 2796  H HA3  . GLY A 1 93  ? -15.005 -11.350 -1.680  1.00 0.00 ? 93  GLY A HA3  2  
ATOM 2797  N N    . GLU A 1 94  ? -13.937 -13.525 -0.063  1.00 0.00 ? 94  GLU A N    2  
ATOM 2798  C CA   . GLU A 1 94  ? -13.241 -14.800 0.066   1.00 0.00 ? 94  GLU A CA   2  
ATOM 2799  C C    . GLU A 1 94  ? -14.205 -15.906 0.487   1.00 0.00 ? 94  GLU A C    2  
ATOM 2800  O O    . GLU A 1 94  ? -15.384 -15.656 0.732   1.00 0.00 ? 94  GLU A O    2  
ATOM 2801  C CB   . GLU A 1 94  ? -12.104 -14.685 1.083   1.00 0.00 ? 94  GLU A CB   2  
ATOM 2802  C CG   . GLU A 1 94  ? -12.563 -14.241 2.462   1.00 0.00 ? 94  GLU A CG   2  
ATOM 2803  C CD   . GLU A 1 94  ? -11.439 -13.644 3.286   1.00 0.00 ? 94  GLU A CD   2  
ATOM 2804  O OE1  . GLU A 1 94  ? -10.553 -12.990 2.698   1.00 0.00 ? 94  GLU A OE1  2  
ATOM 2805  O OE2  . GLU A 1 94  ? -11.446 -13.831 4.521   1.00 0.00 ? 94  GLU A OE2  2  
ATOM 2806  H H    . GLU A 1 94  ? -14.770 -13.383 0.433   1.00 0.00 ? 94  GLU A H    2  
ATOM 2807  H HA   . GLU A 1 94  ? -12.825 -15.049 -0.898  1.00 0.00 ? 94  GLU A HA   2  
ATOM 2808  H HB2  . GLU A 1 94  ? -11.624 -15.648 1.179   1.00 0.00 ? 94  GLU A HB2  2  
ATOM 2809  H HB3  . GLU A 1 94  ? -11.382 -13.969 0.719   1.00 0.00 ? 94  GLU A HB3  2  
ATOM 2810  H HG2  . GLU A 1 94  ? -13.338 -13.498 2.347   1.00 0.00 ? 94  GLU A HG2  2  
ATOM 2811  H HG3  . GLU A 1 94  ? -12.960 -15.096 2.988   1.00 0.00 ? 94  GLU A HG3  2  
ATOM 2812  N N    . GLY A 1 95  ? -13.693 -17.130 0.567   1.00 0.00 ? 95  GLY A N    2  
ATOM 2813  C CA   . GLY A 1 95  ? -14.521 -18.256 0.957   1.00 0.00 ? 95  GLY A CA   2  
ATOM 2814  C C    . GLY A 1 95  ? -14.399 -19.425 -0.001  1.00 0.00 ? 95  GLY A C    2  
ATOM 2815  O O    . GLY A 1 95  ? -13.508 -19.452 -0.849  1.00 0.00 ? 95  GLY A O    2  
ATOM 2816  H H    . GLY A 1 95  ? -12.745 -17.270 0.359   1.00 0.00 ? 95  GLY A H    2  
ATOM 2817  H HA2  . GLY A 1 95  ? -14.226 -18.581 1.943   1.00 0.00 ? 95  GLY A HA2  2  
ATOM 2818  H HA3  . GLY A 1 95  ? -15.552 -17.937 0.987   1.00 0.00 ? 95  GLY A HA3  2  
ATOM 2819  N N    . GLY A 1 96  ? -15.298 -20.395 0.134   1.00 0.00 ? 96  GLY A N    2  
ATOM 2820  C CA   . GLY A 1 96  ? -15.269 -21.559 -0.732  1.00 0.00 ? 96  GLY A CA   2  
ATOM 2821  C C    . GLY A 1 96  ? -14.782 -22.803 -0.016  1.00 0.00 ? 96  GLY A C    2  
ATOM 2822  O O    . GLY A 1 96  ? -13.919 -23.521 -0.521  1.00 0.00 ? 96  GLY A O    2  
ATOM 2823  H H    . GLY A 1 96  ? -15.987 -20.320 0.828   1.00 0.00 ? 96  GLY A H    2  
ATOM 2824  H HA2  . GLY A 1 96  ? -16.265 -21.740 -1.108  1.00 0.00 ? 96  GLY A HA2  2  
ATOM 2825  H HA3  . GLY A 1 96  ? -14.612 -21.357 -1.565  1.00 0.00 ? 96  GLY A HA3  2  
ATOM 2826  N N    . SER A 1 97  ? -15.335 -23.058 1.166   1.00 0.00 ? 97  SER A N    2  
ATOM 2827  C CA   . SER A 1 97  ? -14.948 -24.221 1.956   1.00 0.00 ? 97  SER A CA   2  
ATOM 2828  C C    . SER A 1 97  ? -14.989 -25.491 1.111   1.00 0.00 ? 97  SER A C    2  
ATOM 2829  O O    . SER A 1 97  ? -16.048 -25.900 0.637   1.00 0.00 ? 97  SER A O    2  
ATOM 2830  C CB   . SER A 1 97  ? -15.870 -24.371 3.167   1.00 0.00 ? 97  SER A CB   2  
ATOM 2831  O OG   . SER A 1 97  ? -17.229 -24.431 2.770   1.00 0.00 ? 97  SER A OG   2  
ATOM 2832  H H    . SER A 1 97  ? -16.018 -22.449 1.515   1.00 0.00 ? 97  SER A H    2  
ATOM 2833  H HA   . SER A 1 97  ? -13.936 -24.065 2.301   1.00 0.00 ? 97  SER A HA   2  
ATOM 2834  H HB2  . SER A 1 97  ? -15.621 -25.279 3.695   1.00 0.00 ? 97  SER A HB2  2  
ATOM 2835  H HB3  . SER A 1 97  ? -15.736 -23.524 3.825   1.00 0.00 ? 97  SER A HB3  2  
ATOM 2836  H HG   . SER A 1 97  ? -17.634 -23.568 2.882   1.00 0.00 ? 97  SER A HG   2  
ATOM 2837  N N    . GLY A 1 98  ? -13.827 -26.109 0.926   1.00 0.00 ? 98  GLY A N    2  
ATOM 2838  C CA   . GLY A 1 98  ? -13.751 -27.326 0.138   1.00 0.00 ? 98  GLY A CA   2  
ATOM 2839  C C    . GLY A 1 98  ? -12.364 -27.566 -0.425  1.00 0.00 ? 98  GLY A C    2  
ATOM 2840  O O    . GLY A 1 98  ? -12.077 -27.251 -1.580  1.00 0.00 ? 98  GLY A O    2  
ATOM 2841  H H    . GLY A 1 98  ? -13.014 -25.737 1.328   1.00 0.00 ? 98  GLY A H    2  
ATOM 2842  H HA2  . GLY A 1 98  ? -14.025 -28.163 0.761   1.00 0.00 ? 98  GLY A HA2  2  
ATOM 2843  H HA3  . GLY A 1 98  ? -14.452 -27.255 -0.681  1.00 0.00 ? 98  GLY A HA3  2  
ATOM 2844  N N    . PRO A 1 99  ? -11.476 -28.136 0.402   1.00 0.00 ? 99  PRO A N    2  
ATOM 2845  C CA   . PRO A 1 99  ? -10.096 -28.430 0.002   1.00 0.00 ? 99  PRO A CA   2  
ATOM 2846  C C    . PRO A 1 99  ? -10.017 -29.559 -1.019  1.00 0.00 ? 99  PRO A C    2  
ATOM 2847  O O    . PRO A 1 99  ? -11.017 -30.215 -1.312  1.00 0.00 ? 99  PRO A O    2  
ATOM 2848  C CB   . PRO A 1 99  ? -9.428  -28.847 1.314   1.00 0.00 ? 99  PRO A CB   2  
ATOM 2849  C CG   . PRO A 1 99  ? -10.542 -29.354 2.163   1.00 0.00 ? 99  PRO A CG   2  
ATOM 2850  C CD   . PRO A 1 99  ? -11.749 -28.538 1.792   1.00 0.00 ? 99  PRO A CD   2  
ATOM 2851  H HA   . PRO A 1 99  ? -9.603  -27.554 -0.393  1.00 0.00 ? 99  PRO A HA   2  
ATOM 2852  H HB2  . PRO A 1 99  ? -8.696  -29.618 1.119   1.00 0.00 ? 99  PRO A HB2  2  
ATOM 2853  H HB3  . PRO A 1 99  ? -8.946  -27.992 1.765   1.00 0.00 ? 99  PRO A HB3  2  
ATOM 2854  H HG2  . PRO A 1 99  ? -10.717 -30.398 1.954   1.00 0.00 ? 99  PRO A HG2  2  
ATOM 2855  H HG3  . PRO A 1 99  ? -10.301 -29.214 3.206   1.00 0.00 ? 99  PRO A HG3  2  
ATOM 2856  H HD2  . PRO A 1 99  ? -12.644 -29.139 1.851   1.00 0.00 ? 99  PRO A HD2  2  
ATOM 2857  H HD3  . PRO A 1 99  ? -11.831 -27.673 2.434   1.00 0.00 ? 99  PRO A HD3  2  
ATOM 2858  N N    . SER A 1 100 ? -8.822  -29.782 -1.558  1.00 0.00 ? 100 SER A N    2  
ATOM 2859  C CA   . SER A 1 100 ? -8.614  -30.831 -2.549  1.00 0.00 ? 100 SER A CA   2  
ATOM 2860  C C    . SER A 1 100 ? -8.872  -32.208 -1.945  1.00 0.00 ? 100 SER A C    2  
ATOM 2861  O O    . SER A 1 100 ? -8.235  -32.597 -0.966  1.00 0.00 ? 100 SER A O    2  
ATOM 2862  C CB   . SER A 1 100 ? -7.189  -30.762 -3.102  1.00 0.00 ? 100 SER A CB   2  
ATOM 2863  O OG   . SER A 1 100 ? -6.233  -30.966 -2.077  1.00 0.00 ? 100 SER A OG   2  
ATOM 2864  H H    . SER A 1 100 ? -8.064  -29.225 -1.283  1.00 0.00 ? 100 SER A H    2  
ATOM 2865  H HA   . SER A 1 100 ? -9.313  -30.668 -3.356  1.00 0.00 ? 100 SER A HA   2  
ATOM 2866  H HB2  . SER A 1 100 ? -7.061  -31.526 -3.854  1.00 0.00 ? 100 SER A HB2  2  
ATOM 2867  H HB3  . SER A 1 100 ? -7.024  -29.790 -3.544  1.00 0.00 ? 100 SER A HB3  2  
ATOM 2868  H HG   . SER A 1 100 ? -5.958  -31.886 -2.073  1.00 0.00 ? 100 SER A HG   2  
ATOM 2869  N N    . SER A 1 101 ? -9.810  -32.940 -2.536  1.00 0.00 ? 101 SER A N    2  
ATOM 2870  C CA   . SER A 1 101 ? -10.156 -34.273 -2.055  1.00 0.00 ? 101 SER A CA   2  
ATOM 2871  C C    . SER A 1 101 ? -11.166 -34.940 -2.983  1.00 0.00 ? 101 SER A C    2  
ATOM 2872  O O    . SER A 1 101 ? -11.740 -34.295 -3.861  1.00 0.00 ? 101 SER A O    2  
ATOM 2873  C CB   . SER A 1 101 ? -10.723 -34.194 -0.637  1.00 0.00 ? 101 SER A CB   2  
ATOM 2874  O OG   . SER A 1 101 ? -11.982 -33.543 -0.626  1.00 0.00 ? 101 SER A OG   2  
ATOM 2875  H H    . SER A 1 101 ? -10.283 -32.574 -3.313  1.00 0.00 ? 101 SER A H    2  
ATOM 2876  H HA   . SER A 1 101 ? -9.253  -34.864 -2.041  1.00 0.00 ? 101 SER A HA   2  
ATOM 2877  H HB2  . SER A 1 101 ? -10.845 -35.193 -0.245  1.00 0.00 ? 101 SER A HB2  2  
ATOM 2878  H HB3  . SER A 1 101 ? -10.039 -33.642 -0.009  1.00 0.00 ? 101 SER A HB3  2  
ATOM 2879  H HG   . SER A 1 101 ? -11.854 -32.597 -0.727  1.00 0.00 ? 101 SER A HG   2  
ATOM 2880  N N    . GLY A 1 102 ? -11.379 -36.237 -2.783  1.00 0.00 ? 102 GLY A N    2  
ATOM 2881  C CA   . GLY A 1 102 ? -12.320 -36.971 -3.608  1.00 0.00 ? 102 GLY A CA   2  
ATOM 2882  C C    . GLY A 1 102 ? -12.154 -38.472 -3.481  1.00 0.00 ? 102 GLY A C    2  
ATOM 2883  O O    . GLY A 1 102 ? -11.242 -39.055 -4.066  1.00 0.00 ? 102 GLY A O    2  
ATOM 2884  H H    . GLY A 1 102 ? -10.893 -36.699 -2.068  1.00 0.00 ? 102 GLY A H    2  
ATOM 2885  H HA2  . GLY A 1 102 ? -13.324 -36.704 -3.315  1.00 0.00 ? 102 GLY A HA2  2  
ATOM 2886  H HA3  . GLY A 1 102 ? -12.170 -36.690 -4.641  1.00 0.00 ? 102 GLY A HA3  2  
ATOM 2887  N N    . GLY A 1 1   ? 17.503  -7.467  13.505  1.00 0.00 ? 1   GLY A N    3  
ATOM 2888  C CA   . GLY A 1 1   ? 18.401  -6.679  14.328  1.00 0.00 ? 1   GLY A CA   3  
ATOM 2889  C C    . GLY A 1 1   ? 19.832  -6.723  13.829  1.00 0.00 ? 1   GLY A C    3  
ATOM 2890  O O    . GLY A 1 1   ? 20.460  -5.682  13.633  1.00 0.00 ? 1   GLY A O    3  
ATOM 2891  H H1   . GLY A 1 1   ? 16.932  -8.148  13.919  1.00 0.00 ? 1   GLY A H1   3  
ATOM 2892  H HA2  . GLY A 1 1   ? 18.063  -5.653  14.331  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 2893  H HA3  . GLY A 1 1   ? 18.373  -7.060  15.338  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 2894  N N    . SER A 1 2   ? 20.350  -7.930  13.626  1.00 0.00 ? 2   SER A N    3  
ATOM 2895  C CA   . SER A 1 2   ? 21.718  -8.105  13.153  1.00 0.00 ? 2   SER A CA   3  
ATOM 2896  C C    . SER A 1 2   ? 21.796  -7.928  11.640  1.00 0.00 ? 2   SER A C    3  
ATOM 2897  O O    . SER A 1 2   ? 22.604  -7.148  11.136  1.00 0.00 ? 2   SER A O    3  
ATOM 2898  C CB   . SER A 1 2   ? 22.242  -9.489  13.544  1.00 0.00 ? 2   SER A CB   3  
ATOM 2899  O OG   . SER A 1 2   ? 23.658  -9.504  13.591  1.00 0.00 ? 2   SER A OG   3  
ATOM 2900  H H    . SER A 1 2   ? 19.799  -8.721  13.801  1.00 0.00 ? 2   SER A H    3  
ATOM 2901  H HA   . SER A 1 2   ? 22.331  -7.352  13.624  1.00 0.00 ? 2   SER A HA   3  
ATOM 2902  H HB2  . SER A 1 2   ? 21.859  -9.754  14.518  1.00 0.00 ? 2   SER A HB2  3  
ATOM 2903  H HB3  . SER A 1 2   ? 21.909  -10.215 12.816  1.00 0.00 ? 2   SER A HB3  3  
ATOM 2904  H HG   . SER A 1 2   ? 24.008  -9.521  12.697  1.00 0.00 ? 2   SER A HG   3  
ATOM 2905  N N    . SER A 1 3   ? 20.951  -8.659  10.920  1.00 0.00 ? 3   SER A N    3  
ATOM 2906  C CA   . SER A 1 3   ? 20.926  -8.587  9.464   1.00 0.00 ? 3   SER A CA   3  
ATOM 2907  C C    . SER A 1 3   ? 19.746  -7.749  8.982   1.00 0.00 ? 3   SER A C    3  
ATOM 2908  O O    . SER A 1 3   ? 19.916  -6.792  8.228   1.00 0.00 ? 3   SER A O    3  
ATOM 2909  C CB   . SER A 1 3   ? 20.848  -9.992  8.864   1.00 0.00 ? 3   SER A CB   3  
ATOM 2910  O OG   . SER A 1 3   ? 22.064  -10.695 9.052   1.00 0.00 ? 3   SER A OG   3  
ATOM 2911  H H    . SER A 1 3   ? 20.331  -9.264  11.380  1.00 0.00 ? 3   SER A H    3  
ATOM 2912  H HA   . SER A 1 3   ? 21.843  -8.116  9.140   1.00 0.00 ? 3   SER A HA   3  
ATOM 2913  H HB2  . SER A 1 3   ? 20.051  -10.541 9.341   1.00 0.00 ? 3   SER A HB2  3  
ATOM 2914  H HB3  . SER A 1 3   ? 20.649  -9.917  7.804   1.00 0.00 ? 3   SER A HB3  3  
ATOM 2915  H HG   . SER A 1 3   ? 22.343  -11.081 8.218   1.00 0.00 ? 3   SER A HG   3  
ATOM 2916  N N    . GLY A 1 4   ? 18.547  -8.117  9.424   1.00 0.00 ? 4   GLY A N    3  
ATOM 2917  C CA   . GLY A 1 4   ? 17.355  -7.390  9.027   1.00 0.00 ? 4   GLY A CA   3  
ATOM 2918  C C    . GLY A 1 4   ? 16.142  -8.291  8.901   1.00 0.00 ? 4   GLY A C    3  
ATOM 2919  O O    . GLY A 1 4   ? 15.809  -9.028  9.829   1.00 0.00 ? 4   GLY A O    3  
ATOM 2920  H H    . GLY A 1 4   ? 18.471  -8.889  10.023  1.00 0.00 ? 4   GLY A H    3  
ATOM 2921  H HA2  . GLY A 1 4   ? 17.150  -6.628  9.764   1.00 0.00 ? 4   GLY A HA2  3  
ATOM 2922  H HA3  . GLY A 1 4   ? 17.537  -6.916  8.074   1.00 0.00 ? 4   GLY A HA3  3  
ATOM 2923  N N    . SER A 1 5   ? 15.479  -8.230  7.751   1.00 0.00 ? 5   SER A N    3  
ATOM 2924  C CA   . SER A 1 5   ? 14.292  -9.042  7.509   1.00 0.00 ? 5   SER A CA   3  
ATOM 2925  C C    . SER A 1 5   ? 14.616  -10.218 6.592   1.00 0.00 ? 5   SER A C    3  
ATOM 2926  O O    . SER A 1 5   ? 15.612  -10.199 5.868   1.00 0.00 ? 5   SER A O    3  
ATOM 2927  C CB   . SER A 1 5   ? 13.182  -8.190  6.891   1.00 0.00 ? 5   SER A CB   3  
ATOM 2928  O OG   . SER A 1 5   ? 12.670  -7.261  7.831   1.00 0.00 ? 5   SER A OG   3  
ATOM 2929  H H    . SER A 1 5   ? 15.794  -7.622  7.049   1.00 0.00 ? 5   SER A H    3  
ATOM 2930  H HA   . SER A 1 5   ? 13.953  -9.425  8.460   1.00 0.00 ? 5   SER A HA   3  
ATOM 2931  H HB2  . SER A 1 5   ? 13.577  -7.648  6.045   1.00 0.00 ? 5   SER A HB2  3  
ATOM 2932  H HB3  . SER A 1 5   ? 12.378  -8.833  6.564   1.00 0.00 ? 5   SER A HB3  3  
ATOM 2933  H HG   . SER A 1 5   ? 11.934  -7.656  8.304   1.00 0.00 ? 5   SER A HG   3  
ATOM 2934  N N    . SER A 1 6   ? 13.768  -11.240 6.629   1.00 0.00 ? 6   SER A N    3  
ATOM 2935  C CA   . SER A 1 6   ? 13.965  -12.427 5.805   1.00 0.00 ? 6   SER A CA   3  
ATOM 2936  C C    . SER A 1 6   ? 13.129  -12.349 4.531   1.00 0.00 ? 6   SER A C    3  
ATOM 2937  O O    . SER A 1 6   ? 13.618  -12.624 3.436   1.00 0.00 ? 6   SER A O    3  
ATOM 2938  C CB   . SER A 1 6   ? 13.599  -13.687 6.592   1.00 0.00 ? 6   SER A CB   3  
ATOM 2939  O OG   . SER A 1 6   ? 12.300  -13.582 7.147   1.00 0.00 ? 6   SER A OG   3  
ATOM 2940  H H    . SER A 1 6   ? 12.992  -11.196 7.227   1.00 0.00 ? 6   SER A H    3  
ATOM 2941  H HA   . SER A 1 6   ? 15.009  -12.473 5.534   1.00 0.00 ? 6   SER A HA   3  
ATOM 2942  H HB2  . SER A 1 6   ? 13.628  -14.541 5.933   1.00 0.00 ? 6   SER A HB2  3  
ATOM 2943  H HB3  . SER A 1 6   ? 14.310  -13.826 7.394   1.00 0.00 ? 6   SER A HB3  3  
ATOM 2944  H HG   . SER A 1 6   ? 12.241  -14.131 7.933   1.00 0.00 ? 6   SER A HG   3  
ATOM 2945  N N    . GLY A 1 7   ? 11.863  -11.971 4.684   1.00 0.00 ? 7   GLY A N    3  
ATOM 2946  C CA   . GLY A 1 7   ? 10.978  -11.863 3.539   1.00 0.00 ? 7   GLY A CA   3  
ATOM 2947  C C    . GLY A 1 7   ? 9.587   -12.390 3.830   1.00 0.00 ? 7   GLY A C    3  
ATOM 2948  O O    . GLY A 1 7   ? 9.155   -12.463 4.981   1.00 0.00 ? 7   GLY A O    3  
ATOM 2949  H H    . GLY A 1 7   ? 11.527  -11.764 5.581   1.00 0.00 ? 7   GLY A H    3  
ATOM 2950  H HA2  . GLY A 1 7   ? 10.905  -10.825 3.250   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 2951  H HA3  . GLY A 1 7   ? 11.399  -12.426 2.719   1.00 0.00 ? 7   GLY A HA3  3  
ATOM 2952  N N    . PRO A 1 8   ? 8.859   -12.768 2.768   1.00 0.00 ? 8   PRO A N    3  
ATOM 2953  C CA   . PRO A 1 8   ? 7.497   -13.296 2.890   1.00 0.00 ? 8   PRO A CA   3  
ATOM 2954  C C    . PRO A 1 8   ? 7.467   -14.681 3.527   1.00 0.00 ? 8   PRO A C    3  
ATOM 2955  O O    . PRO A 1 8   ? 8.416   -15.453 3.400   1.00 0.00 ? 8   PRO A O    3  
ATOM 2956  C CB   . PRO A 1 8   ? 7.012   -13.364 1.440   1.00 0.00 ? 8   PRO A CB   3  
ATOM 2957  C CG   . PRO A 1 8   ? 8.256   -13.487 0.630   1.00 0.00 ? 8   PRO A CG   3  
ATOM 2958  C CD   . PRO A 1 8   ? 9.310   -12.709 1.368   1.00 0.00 ? 8   PRO A CD   3  
ATOM 2959  H HA   . PRO A 1 8   ? 6.861   -12.629 3.453   1.00 0.00 ? 8   PRO A HA   3  
ATOM 2960  H HB2  . PRO A 1 8   ? 6.369   -14.224 1.312   1.00 0.00 ? 8   PRO A HB2  3  
ATOM 2961  H HB3  . PRO A 1 8   ? 6.469   -12.463 1.195   1.00 0.00 ? 8   PRO A HB3  3  
ATOM 2962  H HG2  . PRO A 1 8   ? 8.542   -14.525 0.552   1.00 0.00 ? 8   PRO A HG2  3  
ATOM 2963  H HG3  . PRO A 1 8   ? 8.097   -13.065 -0.352  1.00 0.00 ? 8   PRO A HG3  3  
ATOM 2964  H HD2  . PRO A 1 8   ? 10.275  -13.179 1.253   1.00 0.00 ? 8   PRO A HD2  3  
ATOM 2965  H HD3  . PRO A 1 8   ? 9.340   -11.688 1.016   1.00 0.00 ? 8   PRO A HD3  3  
ATOM 2966  N N    . ASN A 1 9   ? 6.370   -14.990 4.212   1.00 0.00 ? 9   ASN A N    3  
ATOM 2967  C CA   . ASN A 1 9   ? 6.217   -16.283 4.868   1.00 0.00 ? 9   ASN A CA   3  
ATOM 2968  C C    . ASN A 1 9   ? 5.780   -17.351 3.871   1.00 0.00 ? 9   ASN A C    3  
ATOM 2969  O O    . ASN A 1 9   ? 5.333   -17.039 2.768   1.00 0.00 ? 9   ASN A O    3  
ATOM 2970  C CB   . ASN A 1 9   ? 5.199   -16.183 6.006   1.00 0.00 ? 9   ASN A CB   3  
ATOM 2971  C CG   . ASN A 1 9   ? 5.643   -15.229 7.098   1.00 0.00 ? 9   ASN A CG   3  
ATOM 2972  O OD1  . ASN A 1 9   ? 5.402   -14.024 7.021   1.00 0.00 ? 9   ASN A OD1  3  
ATOM 2973  N ND2  . ASN A 1 9   ? 6.297   -15.765 8.122   1.00 0.00 ? 9   ASN A ND2  3  
ATOM 2974  H H    . ASN A 1 9   ? 5.647   -14.332 4.277   1.00 0.00 ? 9   ASN A H    3  
ATOM 2975  H HA   . ASN A 1 9   ? 7.176   -16.561 5.279   1.00 0.00 ? 9   ASN A HA   3  
ATOM 2976  H HB2  . ASN A 1 9   ? 4.258   -15.831 5.608   1.00 0.00 ? 9   ASN A HB2  3  
ATOM 2977  H HB3  . ASN A 1 9   ? 5.058   -17.160 6.442   1.00 0.00 ? 9   ASN A HB3  3  
ATOM 2978  H HD21 . ASN A 1 9   ? 6.454   -16.733 8.116   1.00 0.00 ? 9   ASN A HD21 3  
ATOM 2979  H HD22 . ASN A 1 9   ? 6.595   -15.172 8.842   1.00 0.00 ? 9   ASN A HD22 3  
ATOM 2980  N N    . ALA A 1 10  ? 5.910   -18.612 4.268   1.00 0.00 ? 10  ALA A N    3  
ATOM 2981  C CA   . ALA A 1 10  ? 5.526   -19.727 3.411   1.00 0.00 ? 10  ALA A CA   3  
ATOM 2982  C C    . ALA A 1 10  ? 4.011   -19.894 3.374   1.00 0.00 ? 10  ALA A C    3  
ATOM 2983  O O    . ALA A 1 10  ? 3.420   -20.047 2.305   1.00 0.00 ? 10  ALA A O    3  
ATOM 2984  C CB   . ALA A 1 10  ? 6.189   -21.011 3.887   1.00 0.00 ? 10  ALA A CB   3  
ATOM 2985  H H    . ALA A 1 10  ? 6.272   -18.798 5.160   1.00 0.00 ? 10  ALA A H    3  
ATOM 2986  H HA   . ALA A 1 10  ? 5.880   -19.517 2.412   1.00 0.00 ? 10  ALA A HA   3  
ATOM 2987  H HB1  . ALA A 1 10  ? 6.648   -21.511 3.046   1.00 0.00 ? 10  ALA A HB1  3  
ATOM 2988  H HB2  . ALA A 1 10  ? 6.944   -20.776 4.622   1.00 0.00 ? 10  ALA A HB2  3  
ATOM 2989  H HB3  . ALA A 1 10  ? 5.445   -21.658 4.328   1.00 0.00 ? 10  ALA A HB3  3  
ATOM 2990  N N    . ARG A 1 11  ? 3.388   -19.863 4.547   1.00 0.00 ? 11  ARG A N    3  
ATOM 2991  C CA   . ARG A 1 11  ? 1.941   -20.013 4.648   1.00 0.00 ? 11  ARG A CA   3  
ATOM 2992  C C    . ARG A 1 11  ? 1.226   -18.808 4.045   1.00 0.00 ? 11  ARG A C    3  
ATOM 2993  O O    . ARG A 1 11  ? 0.282   -18.957 3.270   1.00 0.00 ? 11  ARG A O    3  
ATOM 2994  C CB   . ARG A 1 11  ? 1.526   -20.187 6.110   1.00 0.00 ? 11  ARG A CB   3  
ATOM 2995  C CG   . ARG A 1 11  ? 0.085   -20.641 6.284   1.00 0.00 ? 11  ARG A CG   3  
ATOM 2996  C CD   . ARG A 1 11  ? -0.377  -20.486 7.725   1.00 0.00 ? 11  ARG A CD   3  
ATOM 2997  N NE   . ARG A 1 11  ? -1.668  -21.128 7.957   1.00 0.00 ? 11  ARG A NE   3  
ATOM 2998  C CZ   . ARG A 1 11  ? -1.807  -22.418 8.241   1.00 0.00 ? 11  ARG A CZ   3  
ATOM 2999  N NH1  . ARG A 1 11  ? -0.740  -23.200 8.328   1.00 0.00 ? 11  ARG A NH1  3  
ATOM 3000  N NH2  . ARG A 1 11  ? -3.016  -22.929 8.439   1.00 0.00 ? 11  ARG A NH2  3  
ATOM 3001  H H    . ARG A 1 11  ? 3.913   -19.738 5.365   1.00 0.00 ? 11  ARG A H    3  
ATOM 3002  H HA   . ARG A 1 11  ? 1.660   -20.897 4.096   1.00 0.00 ? 11  ARG A HA   3  
ATOM 3003  H HB2  . ARG A 1 11  ? 2.169   -20.922 6.570   1.00 0.00 ? 11  ARG A HB2  3  
ATOM 3004  H HB3  . ARG A 1 11  ? 1.647   -19.244 6.621   1.00 0.00 ? 11  ARG A HB3  3  
ATOM 3005  H HG2  . ARG A 1 11  ? -0.550  -20.043 5.648   1.00 0.00 ? 11  ARG A HG2  3  
ATOM 3006  H HG3  . ARG A 1 11  ? 0.008   -21.679 6.000   1.00 0.00 ? 11  ARG A HG3  3  
ATOM 3007  H HD2  . ARG A 1 11  ? 0.359   -20.935 8.375   1.00 0.00 ? 11  ARG A HD2  3  
ATOM 3008  H HD3  . ARG A 1 11  ? -0.462  -19.434 7.950   1.00 0.00 ? 11  ARG A HD3  3  
ATOM 3009  H HE   . ARG A 1 11  ? -2.470  -20.569 7.898   1.00 0.00 ? 11  ARG A HE   3  
ATOM 3010  H HH11 . ARG A 1 11  ? 0.172   -22.818 8.180   1.00 0.00 ? 11  ARG A HH11 3  
ATOM 3011  H HH12 . ARG A 1 11  ? -0.847  -24.171 8.543   1.00 0.00 ? 11  ARG A HH12 3  
ATOM 3012  H HH21 . ARG A 1 11  ? -3.822  -22.342 8.375   1.00 0.00 ? 11  ARG A HH21 3  
ATOM 3013  H HH22 . ARG A 1 11  ? -3.119  -23.900 8.653   1.00 0.00 ? 11  ARG A HH22 3  
ATOM 3014  N N    . SER A 1 12  ? 1.683   -17.613 4.407   1.00 0.00 ? 12  SER A N    3  
ATOM 3015  C CA   . SER A 1 12  ? 1.085   -16.382 3.905   1.00 0.00 ? 12  SER A CA   3  
ATOM 3016  C C    . SER A 1 12  ? 1.938   -15.776 2.795   1.00 0.00 ? 12  SER A C    3  
ATOM 3017  O O    . SER A 1 12  ? 3.156   -15.658 2.929   1.00 0.00 ? 12  SER A O    3  
ATOM 3018  C CB   . SER A 1 12  ? 0.915   -15.372 5.042   1.00 0.00 ? 12  SER A CB   3  
ATOM 3019  O OG   . SER A 1 12  ? 0.587   -14.088 4.539   1.00 0.00 ? 12  SER A OG   3  
ATOM 3020  H H    . SER A 1 12  ? 2.439   -17.559 5.028   1.00 0.00 ? 12  SER A H    3  
ATOM 3021  H HA   . SER A 1 12  ? 0.113   -16.625 3.503   1.00 0.00 ? 12  SER A HA   3  
ATOM 3022  H HB2  . SER A 1 12  ? 0.124   -15.702 5.697   1.00 0.00 ? 12  SER A HB2  3  
ATOM 3023  H HB3  . SER A 1 12  ? 1.839   -15.303 5.598   1.00 0.00 ? 12  SER A HB3  3  
ATOM 3024  H HG   . SER A 1 12  ? -0.310  -14.097 4.199   1.00 0.00 ? 12  SER A HG   3  
ATOM 3025  N N    . GLN A 1 13  ? 1.290   -15.395 1.699   1.00 0.00 ? 13  GLN A N    3  
ATOM 3026  C CA   . GLN A 1 13  ? 1.989   -14.802 0.565   1.00 0.00 ? 13  GLN A CA   3  
ATOM 3027  C C    . GLN A 1 13  ? 1.766   -13.294 0.516   1.00 0.00 ? 13  GLN A C    3  
ATOM 3028  O O    . GLN A 1 13  ? 0.685   -12.791 0.823   1.00 0.00 ? 13  GLN A O    3  
ATOM 3029  C CB   . GLN A 1 13  ? 1.518   -15.442 -0.742  1.00 0.00 ? 13  GLN A CB   3  
ATOM 3030  C CG   . GLN A 1 13  ? 2.090   -16.830 -0.981  1.00 0.00 ? 13  GLN A CG   3  
ATOM 3031  C CD   . GLN A 1 13  ? 1.304   -17.915 -0.274  1.00 0.00 ? 13  GLN A CD   3  
ATOM 3032  O OE1  . GLN A 1 13  ? 1.640   -18.315 0.841   1.00 0.00 ? 13  GLN A OE1  3  
ATOM 3033  N NE2  . GLN A 1 13  ? 0.250   -18.399 -0.920  1.00 0.00 ? 13  GLN A NE2  3  
ATOM 3034  H H    . GLN A 1 13  ? 0.319   -15.516 1.652   1.00 0.00 ? 13  GLN A H    3  
ATOM 3035  H HA   . GLN A 1 13  ? 3.044   -14.994 0.689   1.00 0.00 ? 13  GLN A HA   3  
ATOM 3036  H HB2  . GLN A 1 13  ? 0.441   -15.518 -0.724  1.00 0.00 ? 13  GLN A HB2  3  
ATOM 3037  H HB3  . GLN A 1 13  ? 1.812   -14.808 -1.566  1.00 0.00 ? 13  GLN A HB3  3  
ATOM 3038  H HG2  . GLN A 1 13  ? 2.079   -17.032 -2.042  1.00 0.00 ? 13  GLN A HG2  3  
ATOM 3039  H HG3  . GLN A 1 13  ? 3.109   -16.851 -0.623  1.00 0.00 ? 13  GLN A HG3  3  
ATOM 3040  H HE21 . GLN A 1 13  ? 0.042   -18.034 -1.806  1.00 0.00 ? 13  GLN A HE21 3  
ATOM 3041  H HE22 . GLN A 1 13  ? -0.276  -19.102 -0.486  1.00 0.00 ? 13  GLN A HE22 3  
ATOM 3042  N N    . PRO A 1 14  ? 2.813   -12.554 0.122   1.00 0.00 ? 14  PRO A N    3  
ATOM 3043  C CA   . PRO A 1 14  ? 2.756   -11.092 0.024   1.00 0.00 ? 14  PRO A CA   3  
ATOM 3044  C C    . PRO A 1 14  ? 1.867   -10.622 -1.122  1.00 0.00 ? 14  PRO A C    3  
ATOM 3045  O O    . PRO A 1 14  ? 1.133   -11.413 -1.715  1.00 0.00 ? 14  PRO A O    3  
ATOM 3046  C CB   . PRO A 1 14  ? 4.213   -10.697 -0.233  1.00 0.00 ? 14  PRO A CB   3  
ATOM 3047  C CG   . PRO A 1 14  ? 4.825   -11.899 -0.866  1.00 0.00 ? 14  PRO A CG   3  
ATOM 3048  C CD   . PRO A 1 14  ? 4.132   -13.086 -0.258  1.00 0.00 ? 14  PRO A CD   3  
ATOM 3049  H HA   . PRO A 1 14  ? 2.418   -10.645 0.947   1.00 0.00 ? 14  PRO A HA   3  
ATOM 3050  H HB2  . PRO A 1 14  ? 4.246   -9.841  -0.892  1.00 0.00 ? 14  PRO A HB2  3  
ATOM 3051  H HB3  . PRO A 1 14  ? 4.694   -10.456 0.703   1.00 0.00 ? 14  PRO A HB3  3  
ATOM 3052  H HG2  . PRO A 1 14  ? 4.661   -11.875 -1.933  1.00 0.00 ? 14  PRO A HG2  3  
ATOM 3053  H HG3  . PRO A 1 14  ? 5.882   -11.930 -0.648  1.00 0.00 ? 14  PRO A HG3  3  
ATOM 3054  H HD2  . PRO A 1 14  ? 4.033   -13.879 -0.985  1.00 0.00 ? 14  PRO A HD2  3  
ATOM 3055  H HD3  . PRO A 1 14  ? 4.672   -13.434 0.611   1.00 0.00 ? 14  PRO A HD3  3  
ATOM 3056  N N    . SER A 1 15  ? 1.939   -9.331  -1.430  1.00 0.00 ? 15  SER A N    3  
ATOM 3057  C CA   . SER A 1 15  ? 1.138   -8.756  -2.504  1.00 0.00 ? 15  SER A CA   3  
ATOM 3058  C C    . SER A 1 15  ? 1.962   -7.771  -3.329  1.00 0.00 ? 15  SER A C    3  
ATOM 3059  O O    . SER A 1 15  ? 2.545   -6.829  -2.792  1.00 0.00 ? 15  SER A O    3  
ATOM 3060  C CB   . SER A 1 15  ? -0.093  -8.052  -1.929  1.00 0.00 ? 15  SER A CB   3  
ATOM 3061  O OG   . SER A 1 15  ? -1.182  -8.951  -1.804  1.00 0.00 ? 15  SER A OG   3  
ATOM 3062  H H    . SER A 1 15  ? 2.544   -8.752  -0.921  1.00 0.00 ? 15  SER A H    3  
ATOM 3063  H HA   . SER A 1 15  ? 0.815   -9.562  -3.145  1.00 0.00 ? 15  SER A HA   3  
ATOM 3064  H HB2  . SER A 1 15  ? 0.144   -7.655  -0.954  1.00 0.00 ? 15  SER A HB2  3  
ATOM 3065  H HB3  . SER A 1 15  ? -0.382  -7.245  -2.587  1.00 0.00 ? 15  SER A HB3  3  
ATOM 3066  H HG   . SER A 1 15  ? -1.395  -9.068  -0.875  1.00 0.00 ? 15  SER A HG   3  
ATOM 3067  N N    . LYS A 1 16  ? 2.005   -7.997  -4.637  1.00 0.00 ? 16  LYS A N    3  
ATOM 3068  C CA   . LYS A 1 16  ? 2.756   -7.131  -5.539  1.00 0.00 ? 16  LYS A CA   3  
ATOM 3069  C C    . LYS A 1 16  ? 2.299   -5.681  -5.406  1.00 0.00 ? 16  LYS A C    3  
ATOM 3070  O O    . LYS A 1 16  ? 3.096   -4.753  -5.550  1.00 0.00 ? 16  LYS A O    3  
ATOM 3071  C CB   . LYS A 1 16  ? 2.588   -7.599  -6.986  1.00 0.00 ? 16  LYS A CB   3  
ATOM 3072  C CG   . LYS A 1 16  ? 3.083   -9.014  -7.229  1.00 0.00 ? 16  LYS A CG   3  
ATOM 3073  C CD   . LYS A 1 16  ? 3.101   -9.352  -8.711  1.00 0.00 ? 16  LYS A CD   3  
ATOM 3074  C CE   . LYS A 1 16  ? 3.401   -10.824 -8.943  1.00 0.00 ? 16  LYS A CE   3  
ATOM 3075  N NZ   . LYS A 1 16  ? 2.255   -11.692 -8.554  1.00 0.00 ? 16  LYS A NZ   3  
ATOM 3076  H H    . LYS A 1 16  ? 1.519   -8.765  -5.006  1.00 0.00 ? 16  LYS A H    3  
ATOM 3077  H HA   . LYS A 1 16  ? 3.799   -7.194  -5.268  1.00 0.00 ? 16  LYS A HA   3  
ATOM 3078  H HB2  . LYS A 1 16  ? 1.540   -7.557  -7.246  1.00 0.00 ? 16  LYS A HB2  3  
ATOM 3079  H HB3  . LYS A 1 16  ? 3.138   -6.931  -7.634  1.00 0.00 ? 16  LYS A HB3  3  
ATOM 3080  H HG2  . LYS A 1 16  ? 4.085   -9.107  -6.838  1.00 0.00 ? 16  LYS A HG2  3  
ATOM 3081  H HG3  . LYS A 1 16  ? 2.429   -9.707  -6.719  1.00 0.00 ? 16  LYS A HG3  3  
ATOM 3082  H HD2  . LYS A 1 16  ? 2.135   -9.122  -9.135  1.00 0.00 ? 16  LYS A HD2  3  
ATOM 3083  H HD3  . LYS A 1 16  ? 3.861   -8.757  -9.197  1.00 0.00 ? 16  LYS A HD3  3  
ATOM 3084  H HE2  . LYS A 1 16  ? 3.616   -10.974 -9.990  1.00 0.00 ? 16  LYS A HE2  3  
ATOM 3085  H HE3  . LYS A 1 16  ? 4.265   -11.099 -8.355  1.00 0.00 ? 16  LYS A HE3  3  
ATOM 3086  H HZ1  . LYS A 1 16  ? 2.019   -12.341 -9.332  1.00 0.00 ? 16  LYS A HZ1  3  
ATOM 3087  H HZ2  . LYS A 1 16  ? 1.422   -11.108 -8.340  1.00 0.00 ? 16  LYS A HZ2  3  
ATOM 3088  H HZ3  . LYS A 1 16  ? 2.499   -12.252 -7.712  1.00 0.00 ? 16  LYS A HZ3  3  
ATOM 3089  N N    . THR A 1 17  ? 1.013   -5.493  -5.129  1.00 0.00 ? 17  THR A N    3  
ATOM 3090  C CA   . THR A 1 17  ? 0.451   -4.157  -4.976  1.00 0.00 ? 17  THR A CA   3  
ATOM 3091  C C    . THR A 1 17  ? 0.316   -3.782  -3.505  1.00 0.00 ? 17  THR A C    3  
ATOM 3092  O O    . THR A 1 17  ? -0.229  -4.545  -2.707  1.00 0.00 ? 17  THR A O    3  
ATOM 3093  C CB   . THR A 1 17  ? -0.930  -4.048  -5.651  1.00 0.00 ? 17  THR A CB   3  
ATOM 3094  O OG1  . THR A 1 17  ? -0.876  -4.604  -6.969  1.00 0.00 ? 17  THR A OG1  3  
ATOM 3095  C CG2  . THR A 1 17  ? -1.382  -2.597  -5.725  1.00 0.00 ? 17  THR A CG2  3  
ATOM 3096  H H    . THR A 1 17  ? 0.428   -6.273  -5.026  1.00 0.00 ? 17  THR A H    3  
ATOM 3097  H HA   . THR A 1 17  ? 1.119   -3.457  -5.457  1.00 0.00 ? 17  THR A HA   3  
ATOM 3098  H HB   . THR A 1 17  ? -1.646  -4.603  -5.062  1.00 0.00 ? 17  THR A HB   3  
ATOM 3099  H HG1  . THR A 1 17  ? -0.314  -5.383  -6.965  1.00 0.00 ? 17  THR A HG1  3  
ATOM 3100  H HG21 . THR A 1 17  ? -2.404  -2.521  -5.384  1.00 0.00 ? 17  THR A HG21 3  
ATOM 3101  H HG22 . THR A 1 17  ? -1.317  -2.252  -6.746  1.00 0.00 ? 17  THR A HG22 3  
ATOM 3102  H HG23 . THR A 1 17  ? -0.747  -1.990  -5.098  1.00 0.00 ? 17  THR A HG23 3  
ATOM 3103  N N    . LEU A 1 18  ? 0.815   -2.603  -3.152  1.00 0.00 ? 18  LEU A N    3  
ATOM 3104  C CA   . LEU A 1 18  ? 0.750   -2.125  -1.775  1.00 0.00 ? 18  LEU A CA   3  
ATOM 3105  C C    . LEU A 1 18  ? -0.380  -1.115  -1.602  1.00 0.00 ? 18  LEU A C    3  
ATOM 3106  O O    . LEU A 1 18  ? -0.545  -0.207  -2.417  1.00 0.00 ? 18  LEU A O    3  
ATOM 3107  C CB   . LEU A 1 18  ? 2.082   -1.492  -1.370  1.00 0.00 ? 18  LEU A CB   3  
ATOM 3108  C CG   . LEU A 1 18  ? 3.131   -2.445  -0.795  1.00 0.00 ? 18  LEU A CG   3  
ATOM 3109  C CD1  . LEU A 1 18  ? 4.504   -1.792  -0.798  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 3110  C CD2  . LEU A 1 18  ? 2.745   -2.875  0.613   1.00 0.00 ? 18  LEU A CD2  3  
ATOM 3111  H H    . LEU A 1 18  ? 1.238   -2.039  -3.833  1.00 0.00 ? 18  LEU A H    3  
ATOM 3112  H HA   . LEU A 1 18  ? 0.556   -2.976  -1.139  1.00 0.00 ? 18  LEU A HA   3  
ATOM 3113  H HB2  . LEU A 1 18  ? 2.506   -1.025  -2.246  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 3114  H HB3  . LEU A 1 18  ? 1.876   -0.737  -0.625  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 3115  H HG   . LEU A 1 18  ? 3.181   -3.331  -1.414  1.00 0.00 ? 18  LEU A HG   3  
ATOM 3116  H HD11 . LEU A 1 18  ? 5.014   -2.023  0.125   1.00 0.00 ? 18  LEU A HD11 3  
ATOM 3117  H HD12 . LEU A 1 18  ? 4.394   -0.722  -0.890  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 3118  H HD13 . LEU A 1 18  ? 5.079   -2.168  -1.632  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 3119  H HD21 . LEU A 1 18  ? 3.218   -2.221  1.331   1.00 0.00 ? 18  LEU A HD21 3  
ATOM 3120  H HD22 . LEU A 1 18  ? 3.073   -3.891  0.782   1.00 0.00 ? 18  LEU A HD22 3  
ATOM 3121  H HD23 . LEU A 1 18  ? 1.673   -2.819  0.726   1.00 0.00 ? 18  LEU A HD23 3  
ATOM 3122  N N    . PHE A 1 19  ? -1.154  -1.278  -0.534  1.00 0.00 ? 19  PHE A N    3  
ATOM 3123  C CA   . PHE A 1 19  ? -2.267  -0.379  -0.253  1.00 0.00 ? 19  PHE A CA   3  
ATOM 3124  C C    . PHE A 1 19  ? -1.796  0.841   0.533   1.00 0.00 ? 19  PHE A C    3  
ATOM 3125  O O    . PHE A 1 19  ? -1.269  0.717   1.638   1.00 0.00 ? 19  PHE A O    3  
ATOM 3126  C CB   . PHE A 1 19  ? -3.358  -1.114  0.530   1.00 0.00 ? 19  PHE A CB   3  
ATOM 3127  C CG   . PHE A 1 19  ? -4.592  -0.288  0.757   1.00 0.00 ? 19  PHE A CG   3  
ATOM 3128  C CD1  . PHE A 1 19  ? -5.142  0.457   -0.273  1.00 0.00 ? 19  PHE A CD1  3  
ATOM 3129  C CD2  . PHE A 1 19  ? -5.201  -0.257  2.001   1.00 0.00 ? 19  PHE A CD2  3  
ATOM 3130  C CE1  . PHE A 1 19  ? -6.277  1.219   -0.066  1.00 0.00 ? 19  PHE A CE1  3  
ATOM 3131  C CE2  . PHE A 1 19  ? -6.337  0.502   2.214   1.00 0.00 ? 19  PHE A CE2  3  
ATOM 3132  C CZ   . PHE A 1 19  ? -6.876  1.240   1.178   1.00 0.00 ? 19  PHE A CZ   3  
ATOM 3133  H H    . PHE A 1 19  ? -0.972  -2.021  0.079   1.00 0.00 ? 19  PHE A H    3  
ATOM 3134  H HA   . PHE A 1 19  ? -2.673  -0.050  -1.197  1.00 0.00 ? 19  PHE A HA   3  
ATOM 3135  H HB2  . PHE A 1 19  ? -3.648  -1.999  -0.015  1.00 0.00 ? 19  PHE A HB2  3  
ATOM 3136  H HB3  . PHE A 1 19  ? -2.967  -1.401  1.494   1.00 0.00 ? 19  PHE A HB3  3  
ATOM 3137  H HD1  . PHE A 1 19  ? -4.676  0.441   -1.247  1.00 0.00 ? 19  PHE A HD1  3  
ATOM 3138  H HD2  . PHE A 1 19  ? -4.780  -0.835  2.812   1.00 0.00 ? 19  PHE A HD2  3  
ATOM 3139  H HE1  . PHE A 1 19  ? -6.697  1.795   -0.877  1.00 0.00 ? 19  PHE A HE1  3  
ATOM 3140  H HE2  . PHE A 1 19  ? -6.802  0.516   3.188   1.00 0.00 ? 19  PHE A HE2  3  
ATOM 3141  H HZ   . PHE A 1 19  ? -7.762  1.834   1.343   1.00 0.00 ? 19  PHE A HZ   3  
ATOM 3142  N N    . VAL A 1 20  ? -1.989  2.022   -0.048  1.00 0.00 ? 20  VAL A N    3  
ATOM 3143  C CA   . VAL A 1 20  ? -1.585  3.266   0.597   1.00 0.00 ? 20  VAL A CA   3  
ATOM 3144  C C    . VAL A 1 20  ? -2.798  4.059   1.070   1.00 0.00 ? 20  VAL A C    3  
ATOM 3145  O O    . VAL A 1 20  ? -3.644  4.458   0.269   1.00 0.00 ? 20  VAL A O    3  
ATOM 3146  C CB   . VAL A 1 20  ? -0.750  4.144   -0.353  1.00 0.00 ? 20  VAL A CB   3  
ATOM 3147  C CG1  . VAL A 1 20  ? -0.339  5.436   0.337   1.00 0.00 ? 20  VAL A CG1  3  
ATOM 3148  C CG2  . VAL A 1 20  ? 0.471   3.382   -0.847  1.00 0.00 ? 20  VAL A CG2  3  
ATOM 3149  H H    . VAL A 1 20  ? -2.414  2.057   -0.930  1.00 0.00 ? 20  VAL A H    3  
ATOM 3150  H HA   . VAL A 1 20  ? -0.975  3.015   1.453   1.00 0.00 ? 20  VAL A HA   3  
ATOM 3151  H HB   . VAL A 1 20  ? -1.360  4.397   -1.207  1.00 0.00 ? 20  VAL A HB   3  
ATOM 3152  H HG11 . VAL A 1 20  ? -0.074  5.227   1.363   1.00 0.00 ? 20  VAL A HG11 3  
ATOM 3153  H HG12 . VAL A 1 20  ? 0.510   5.864   -0.175  1.00 0.00 ? 20  VAL A HG12 3  
ATOM 3154  H HG13 . VAL A 1 20  ? -1.163  6.134   0.314   1.00 0.00 ? 20  VAL A HG13 3  
ATOM 3155  H HG21 . VAL A 1 20  ? 0.805   2.702   -0.078  1.00 0.00 ? 20  VAL A HG21 3  
ATOM 3156  H HG22 . VAL A 1 20  ? 0.212   2.823   -1.734  1.00 0.00 ? 20  VAL A HG22 3  
ATOM 3157  H HG23 . VAL A 1 20  ? 1.261   4.080   -1.080  1.00 0.00 ? 20  VAL A HG23 3  
ATOM 3158  N N    . LYS A 1 21  ? -2.877  4.285   2.377   1.00 0.00 ? 21  LYS A N    3  
ATOM 3159  C CA   . LYS A 1 21  ? -3.986  5.033   2.959   1.00 0.00 ? 21  LYS A CA   3  
ATOM 3160  C C    . LYS A 1 21  ? -3.475  6.208   3.786   1.00 0.00 ? 21  LYS A C    3  
ATOM 3161  O O    . LYS A 1 21  ? -2.370  6.166   4.325   1.00 0.00 ? 21  LYS A O    3  
ATOM 3162  C CB   . LYS A 1 21  ? -4.844  4.115   3.832   1.00 0.00 ? 21  LYS A CB   3  
ATOM 3163  C CG   . LYS A 1 21  ? -4.044  3.326   4.854   1.00 0.00 ? 21  LYS A CG   3  
ATOM 3164  C CD   . LYS A 1 21  ? -4.795  2.088   5.316   1.00 0.00 ? 21  LYS A CD   3  
ATOM 3165  C CE   . LYS A 1 21  ? -4.419  1.707   6.740   1.00 0.00 ? 21  LYS A CE   3  
ATOM 3166  N NZ   . LYS A 1 21  ? -4.997  2.649   7.738   1.00 0.00 ? 21  LYS A NZ   3  
ATOM 3167  H H    . LYS A 1 21  ? -2.172  3.942   2.965   1.00 0.00 ? 21  LYS A H    3  
ATOM 3168  H HA   . LYS A 1 21  ? -4.590  5.413   2.149   1.00 0.00 ? 21  LYS A HA   3  
ATOM 3169  H HB2  . LYS A 1 21  ? -5.570  4.716   4.360   1.00 0.00 ? 21  LYS A HB2  3  
ATOM 3170  H HB3  . LYS A 1 21  ? -5.364  3.415   3.195   1.00 0.00 ? 21  LYS A HB3  3  
ATOM 3171  H HG2  . LYS A 1 21  ? -3.109  3.020   4.408   1.00 0.00 ? 21  LYS A HG2  3  
ATOM 3172  H HG3  . LYS A 1 21  ? -3.847  3.957   5.709   1.00 0.00 ? 21  LYS A HG3  3  
ATOM 3173  H HD2  . LYS A 1 21  ? -5.856  2.286   5.277   1.00 0.00 ? 21  LYS A HD2  3  
ATOM 3174  H HD3  . LYS A 1 21  ? -4.556  1.266   4.657   1.00 0.00 ? 21  LYS A HD3  3  
ATOM 3175  H HE2  . LYS A 1 21  ? -4.787  0.712   6.941   1.00 0.00 ? 21  LYS A HE2  3  
ATOM 3176  H HE3  . LYS A 1 21  ? -3.343  1.717   6.828   1.00 0.00 ? 21  LYS A HE3  3  
ATOM 3177  H HZ1  . LYS A 1 21  ? -4.281  3.346   8.026   1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 3178  H HZ2  . LYS A 1 21  ? -5.315  2.127   8.579   1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 3179  H HZ3  . LYS A 1 21  ? -5.809  3.152   7.326   1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 3180  N N    . GLY A 1 22  ? -4.288  7.255   3.883   1.00 0.00 ? 22  GLY A N    3  
ATOM 3181  C CA   . GLY A 1 22  ? -3.901  8.427   4.648   1.00 0.00 ? 22  GLY A CA   3  
ATOM 3182  C C    . GLY A 1 22  ? -3.309  9.517   3.777   1.00 0.00 ? 22  GLY A C    3  
ATOM 3183  O O    . GLY A 1 22  ? -2.449  10.279  4.222   1.00 0.00 ? 22  GLY A O    3  
ATOM 3184  H H    . GLY A 1 22  ? -5.158  7.233   3.432   1.00 0.00 ? 22  GLY A H    3  
ATOM 3185  H HA2  . GLY A 1 22  ? -4.771  8.817   5.153   1.00 0.00 ? 22  GLY A HA2  3  
ATOM 3186  H HA3  . GLY A 1 22  ? -3.169  8.134   5.386   1.00 0.00 ? 22  GLY A HA3  3  
ATOM 3187  N N    . LEU A 1 23  ? -3.767  9.593   2.533   1.00 0.00 ? 23  LEU A N    3  
ATOM 3188  C CA   . LEU A 1 23  ? -3.275  10.597  1.596   1.00 0.00 ? 23  LEU A CA   3  
ATOM 3189  C C    . LEU A 1 23  ? -4.115  11.869  1.671   1.00 0.00 ? 23  LEU A C    3  
ATOM 3190  O O    . LEU A 1 23  ? -5.098  11.932  2.409   1.00 0.00 ? 23  LEU A O    3  
ATOM 3191  C CB   . LEU A 1 23  ? -3.292  10.045  0.170   1.00 0.00 ? 23  LEU A CB   3  
ATOM 3192  C CG   . LEU A 1 23  ? -2.423  8.813   -0.083  1.00 0.00 ? 23  LEU A CG   3  
ATOM 3193  C CD1  . LEU A 1 23  ? -2.661  8.270   -1.484  1.00 0.00 ? 23  LEU A CD1  3  
ATOM 3194  C CD2  . LEU A 1 23  ? -0.952  9.146   0.120   1.00 0.00 ? 23  LEU A CD2  3  
ATOM 3195  H H    . LEU A 1 23  ? -4.451  8.958   2.235   1.00 0.00 ? 23  LEU A H    3  
ATOM 3196  H HA   . LEU A 1 23  ? -2.258  10.836  1.869   1.00 0.00 ? 23  LEU A HA   3  
ATOM 3197  H HB2  . LEU A 1 23  ? -4.311  9.786   -0.073  1.00 0.00 ? 23  LEU A HB2  3  
ATOM 3198  H HB3  . LEU A 1 23  ? -2.955  10.830  -0.492  1.00 0.00 ? 23  LEU A HB3  3  
ATOM 3199  H HG   . LEU A 1 23  ? -2.692  8.039   0.623   1.00 0.00 ? 23  LEU A HG   3  
ATOM 3200  H HD11 . LEU A 1 23  ? -3.212  8.996   -2.062  1.00 0.00 ? 23  LEU A HD11 3  
ATOM 3201  H HD12 . LEU A 1 23  ? -3.227  7.353   -1.424  1.00 0.00 ? 23  LEU A HD12 3  
ATOM 3202  H HD13 . LEU A 1 23  ? -1.711  8.076   -1.960  1.00 0.00 ? 23  LEU A HD13 3  
ATOM 3203  H HD21 . LEU A 1 23  ? -0.834  9.706   1.035   1.00 0.00 ? 23  LEU A HD21 3  
ATOM 3204  H HD22 . LEU A 1 23  ? -0.600  9.738   -0.713  1.00 0.00 ? 23  LEU A HD22 3  
ATOM 3205  H HD23 . LEU A 1 23  ? -0.381  8.232   0.180   1.00 0.00 ? 23  LEU A HD23 3  
ATOM 3206  N N    . SER A 1 24  ? -3.722  12.878  0.901   1.00 0.00 ? 24  SER A N    3  
ATOM 3207  C CA   . SER A 1 24  ? -4.437  14.148  0.882   1.00 0.00 ? 24  SER A CA   3  
ATOM 3208  C C    . SER A 1 24  ? -5.313  14.260  -0.363  1.00 0.00 ? 24  SER A C    3  
ATOM 3209  O O    . SER A 1 24  ? -4.917  13.846  -1.452  1.00 0.00 ? 24  SER A O    3  
ATOM 3210  C CB   . SER A 1 24  ? -3.449  15.315  0.930   1.00 0.00 ? 24  SER A CB   3  
ATOM 3211  O OG   . SER A 1 24  ? -4.129  16.557  0.997   1.00 0.00 ? 24  SER A OG   3  
ATOM 3212  H H    . SER A 1 24  ? -2.930  12.766  0.335   1.00 0.00 ? 24  SER A H    3  
ATOM 3213  H HA   . SER A 1 24  ? -5.069  14.187  1.757   1.00 0.00 ? 24  SER A HA   3  
ATOM 3214  H HB2  . SER A 1 24  ? -2.820  15.216  1.801   1.00 0.00 ? 24  SER A HB2  3  
ATOM 3215  H HB3  . SER A 1 24  ? -2.837  15.301  0.040   1.00 0.00 ? 24  SER A HB3  3  
ATOM 3216  H HG   . SER A 1 24  ? -3.746  17.167  0.361   1.00 0.00 ? 24  SER A HG   3  
ATOM 3217  N N    . GLU A 1 25  ? -6.505  14.822  -0.191  1.00 0.00 ? 25  GLU A N    3  
ATOM 3218  C CA   . GLU A 1 25  ? -7.438  14.987  -1.300  1.00 0.00 ? 25  GLU A CA   3  
ATOM 3219  C C    . GLU A 1 25  ? -6.712  15.461  -2.556  1.00 0.00 ? 25  GLU A C    3  
ATOM 3220  O O    . GLU A 1 25  ? -7.186  15.258  -3.674  1.00 0.00 ? 25  GLU A O    3  
ATOM 3221  C CB   . GLU A 1 25  ? -8.538  15.983  -0.927  1.00 0.00 ? 25  GLU A CB   3  
ATOM 3222  C CG   . GLU A 1 25  ? -9.361  15.558  0.277   1.00 0.00 ? 25  GLU A CG   3  
ATOM 3223  C CD   . GLU A 1 25  ? -10.554 14.703  -0.104  1.00 0.00 ? 25  GLU A CD   3  
ATOM 3224  O OE1  . GLU A 1 25  ? -11.635 15.273  -0.360  1.00 0.00 ? 25  GLU A OE1  3  
ATOM 3225  O OE2  . GLU A 1 25  ? -10.405 13.464  -0.147  1.00 0.00 ? 25  GLU A OE2  3  
ATOM 3226  H H    . GLU A 1 25  ? -6.764  15.132  0.702   1.00 0.00 ? 25  GLU A H    3  
ATOM 3227  H HA   . GLU A 1 25  ? -7.889  14.027  -1.500  1.00 0.00 ? 25  GLU A HA   3  
ATOM 3228  H HB2  . GLU A 1 25  ? -8.082  16.938  -0.707  1.00 0.00 ? 25  GLU A HB2  3  
ATOM 3229  H HB3  . GLU A 1 25  ? -9.203  16.098  -1.769  1.00 0.00 ? 25  GLU A HB3  3  
ATOM 3230  H HG2  . GLU A 1 25  ? -8.731  14.992  0.947   1.00 0.00 ? 25  GLU A HG2  3  
ATOM 3231  H HG3  . GLU A 1 25  ? -9.718  16.443  0.784   1.00 0.00 ? 25  GLU A HG3  3  
ATOM 3232  N N    . ASP A 1 26  ? -5.560  16.093  -2.362  1.00 0.00 ? 26  ASP A N    3  
ATOM 3233  C CA   . ASP A 1 26  ? -4.767  16.596  -3.478  1.00 0.00 ? 26  ASP A CA   3  
ATOM 3234  C C    . ASP A 1 26  ? -3.708  15.580  -3.894  1.00 0.00 ? 26  ASP A C    3  
ATOM 3235  O O    . ASP A 1 26  ? -3.334  15.500  -5.065  1.00 0.00 ? 26  ASP A O    3  
ATOM 3236  C CB   . ASP A 1 26  ? -4.101  17.921  -3.103  1.00 0.00 ? 26  ASP A CB   3  
ATOM 3237  C CG   . ASP A 1 26  ? -5.059  18.877  -2.419  1.00 0.00 ? 26  ASP A CG   3  
ATOM 3238  O OD1  . ASP A 1 26  ? -6.197  19.029  -2.909  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 3239  O OD2  . ASP A 1 26  ? -4.670  19.472  -1.393  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 3240  H H    . ASP A 1 26  ? -5.234  16.225  -1.447  1.00 0.00 ? 26  ASP A H    3  
ATOM 3241  H HA   . ASP A 1 26  ? -5.434  16.763  -4.311  1.00 0.00 ? 26  ASP A HA   3  
ATOM 3242  H HB2  . ASP A 1 26  ? -3.277  17.724  -2.432  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 3243  H HB3  . ASP A 1 26  ? -3.726  18.394  -3.998  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 3244  N N    . THR A 1 27  ? -3.227  14.805  -2.927  1.00 0.00 ? 27  THR A N    3  
ATOM 3245  C CA   . THR A 1 27  ? -2.210  13.795  -3.192  1.00 0.00 ? 27  THR A CA   3  
ATOM 3246  C C    . THR A 1 27  ? -2.474  13.081  -4.512  1.00 0.00 ? 27  THR A C    3  
ATOM 3247  O O    . THR A 1 27  ? -3.435  12.321  -4.638  1.00 0.00 ? 27  THR A O    3  
ATOM 3248  C CB   . THR A 1 27  ? -2.146  12.752  -2.060  1.00 0.00 ? 27  THR A CB   3  
ATOM 3249  O OG1  . THR A 1 27  ? -1.715  13.373  -0.844  1.00 0.00 ? 27  THR A OG1  3  
ATOM 3250  C CG2  . THR A 1 27  ? -1.196  11.620  -2.421  1.00 0.00 ? 27  THR A CG2  3  
ATOM 3251  H H    . THR A 1 27  ? -3.565  14.916  -2.014  1.00 0.00 ? 27  THR A H    3  
ATOM 3252  H HA   . THR A 1 27  ? -1.253  14.293  -3.248  1.00 0.00 ? 27  THR A HA   3  
ATOM 3253  H HB   . THR A 1 27  ? -3.135  12.340  -1.915  1.00 0.00 ? 27  THR A HB   3  
ATOM 3254  H HG1  . THR A 1 27  ? -0.784  13.598  -0.912  1.00 0.00 ? 27  THR A HG1  3  
ATOM 3255  H HG21 . THR A 1 27  ? -0.360  11.619  -1.738  1.00 0.00 ? 27  THR A HG21 3  
ATOM 3256  H HG22 . THR A 1 27  ? -0.837  11.759  -3.430  1.00 0.00 ? 27  THR A HG22 3  
ATOM 3257  H HG23 . THR A 1 27  ? -1.718  10.677  -2.351  1.00 0.00 ? 27  THR A HG23 3  
ATOM 3258  N N    . THR A 1 28  ? -1.615  13.329  -5.496  1.00 0.00 ? 28  THR A N    3  
ATOM 3259  C CA   . THR A 1 28  ? -1.756  12.709  -6.808  1.00 0.00 ? 28  THR A CA   3  
ATOM 3260  C C    . THR A 1 28  ? -0.957  11.414  -6.893  1.00 0.00 ? 28  THR A C    3  
ATOM 3261  O O    . THR A 1 28  ? -0.019  11.202  -6.126  1.00 0.00 ? 28  THR A O    3  
ATOM 3262  C CB   . THR A 1 28  ? -1.296  13.659  -7.930  1.00 0.00 ? 28  THR A CB   3  
ATOM 3263  O OG1  . THR A 1 28  ? 0.056   14.072  -7.698  1.00 0.00 ? 28  THR A OG1  3  
ATOM 3264  C CG2  . THR A 1 28  ? -2.198  14.881  -8.009  1.00 0.00 ? 28  THR A CG2  3  
ATOM 3265  H H    . THR A 1 28  ? -0.869  13.943  -5.335  1.00 0.00 ? 28  THR A H    3  
ATOM 3266  H HA   . THR A 1 28  ? -2.802  12.486  -6.960  1.00 0.00 ? 28  THR A HA   3  
ATOM 3267  H HB   . THR A 1 28  ? -1.346  13.130  -8.871  1.00 0.00 ? 28  THR A HB   3  
ATOM 3268  H HG1  . THR A 1 28  ? 0.630   13.302  -7.699  1.00 0.00 ? 28  THR A HG1  3  
ATOM 3269  H HG21 . THR A 1 28  ? -2.215  15.379  -7.051  1.00 0.00 ? 28  THR A HG21 3  
ATOM 3270  H HG22 . THR A 1 28  ? -3.199  14.573  -8.272  1.00 0.00 ? 28  THR A HG22 3  
ATOM 3271  H HG23 . THR A 1 28  ? -1.821  15.558  -8.760  1.00 0.00 ? 28  THR A HG23 3  
ATOM 3272  N N    . GLU A 1 29  ? -1.334  10.552  -7.832  1.00 0.00 ? 29  GLU A N    3  
ATOM 3273  C CA   . GLU A 1 29  ? -0.651  9.277   -8.017  1.00 0.00 ? 29  GLU A CA   3  
ATOM 3274  C C    . GLU A 1 29  ? 0.844   9.488   -8.239  1.00 0.00 ? 29  GLU A C    3  
ATOM 3275  O O    . GLU A 1 29  ? 1.657   8.622   -7.921  1.00 0.00 ? 29  GLU A O    3  
ATOM 3276  C CB   . GLU A 1 29  ? -1.252  8.518   -9.201  1.00 0.00 ? 29  GLU A CB   3  
ATOM 3277  C CG   . GLU A 1 29  ? -2.760  8.355   -9.118  1.00 0.00 ? 29  GLU A CG   3  
ATOM 3278  C CD   . GLU A 1 29  ? -3.400  8.146   -10.476 1.00 0.00 ? 29  GLU A CD   3  
ATOM 3279  O OE1  . GLU A 1 29  ? -2.741  7.560   -11.360 1.00 0.00 ? 29  GLU A OE1  3  
ATOM 3280  O OE2  . GLU A 1 29  ? -4.562  8.570   -10.655 1.00 0.00 ? 29  GLU A OE2  3  
ATOM 3281  H H    . GLU A 1 29  ? -2.090  10.778  -8.414  1.00 0.00 ? 29  GLU A H    3  
ATOM 3282  H HA   . GLU A 1 29  ? -0.790  8.694   -7.119  1.00 0.00 ? 29  GLU A HA   3  
ATOM 3283  H HB2  . GLU A 1 29  ? -1.017  9.050   -10.111 1.00 0.00 ? 29  GLU A HB2  3  
ATOM 3284  H HB3  . GLU A 1 29  ? -0.807  7.535   -9.246  1.00 0.00 ? 29  GLU A HB3  3  
ATOM 3285  H HG2  . GLU A 1 29  ? -2.983  7.500   -8.497  1.00 0.00 ? 29  GLU A HG2  3  
ATOM 3286  H HG3  . GLU A 1 29  ? -3.181  9.243   -8.670  1.00 0.00 ? 29  GLU A HG3  3  
ATOM 3287  N N    . GLU A 1 30  ? 1.197   10.646  -8.789  1.00 0.00 ? 30  GLU A N    3  
ATOM 3288  C CA   . GLU A 1 30  ? 2.593   10.971  -9.056  1.00 0.00 ? 30  GLU A CA   3  
ATOM 3289  C C    . GLU A 1 30  ? 3.407   10.976  -7.765  1.00 0.00 ? 30  GLU A C    3  
ATOM 3290  O O    . GLU A 1 30  ? 4.472   10.363  -7.685  1.00 0.00 ? 30  GLU A O    3  
ATOM 3291  C CB   . GLU A 1 30  ? 2.701   12.333  -9.745  1.00 0.00 ? 30  GLU A CB   3  
ATOM 3292  C CG   . GLU A 1 30  ? 2.661   12.252  -11.261 1.00 0.00 ? 30  GLU A CG   3  
ATOM 3293  C CD   . GLU A 1 30  ? 3.364   13.420  -11.926 1.00 0.00 ? 30  GLU A CD   3  
ATOM 3294  O OE1  . GLU A 1 30  ? 4.336   13.939  -11.340 1.00 0.00 ? 30  GLU A OE1  3  
ATOM 3295  O OE2  . GLU A 1 30  ? 2.942   13.813  -13.034 1.00 0.00 ? 30  GLU A OE2  3  
ATOM 3296  H H    . GLU A 1 30  ? 0.502   11.297  -9.021  1.00 0.00 ? 30  GLU A H    3  
ATOM 3297  H HA   . GLU A 1 30  ? 2.990   10.212  -9.714  1.00 0.00 ? 30  GLU A HA   3  
ATOM 3298  H HB2  . GLU A 1 30  ? 1.882   12.955  -9.416  1.00 0.00 ? 30  GLU A HB2  3  
ATOM 3299  H HB3  . GLU A 1 30  ? 3.632   12.796  -9.454  1.00 0.00 ? 30  GLU A HB3  3  
ATOM 3300  H HG2  . GLU A 1 30  ? 3.142   11.337  -11.574 1.00 0.00 ? 30  GLU A HG2  3  
ATOM 3301  H HG3  . GLU A 1 30  ? 1.629   12.242  -11.582 1.00 0.00 ? 30  GLU A HG3  3  
ATOM 3302  N N    . THR A 1 31  ? 2.897   11.673  -6.754  1.00 0.00 ? 31  THR A N    3  
ATOM 3303  C CA   . THR A 1 31  ? 3.576   11.760  -5.467  1.00 0.00 ? 31  THR A CA   3  
ATOM 3304  C C    . THR A 1 31  ? 3.480   10.443  -4.704  1.00 0.00 ? 31  THR A C    3  
ATOM 3305  O O    . THR A 1 31  ? 4.276   10.177  -3.803  1.00 0.00 ? 31  THR A O    3  
ATOM 3306  C CB   . THR A 1 31  ? 2.988   12.887  -4.597  1.00 0.00 ? 31  THR A CB   3  
ATOM 3307  O OG1  . THR A 1 31  ? 3.900   13.220  -3.545  1.00 0.00 ? 31  THR A OG1  3  
ATOM 3308  C CG2  . THR A 1 31  ? 1.650   12.471  -4.003  1.00 0.00 ? 31  THR A CG2  3  
ATOM 3309  H H    . THR A 1 31  ? 2.045   12.140  -6.878  1.00 0.00 ? 31  THR A H    3  
ATOM 3310  H HA   . THR A 1 31  ? 4.616   11.983  -5.653  1.00 0.00 ? 31  THR A HA   3  
ATOM 3311  H HB   . THR A 1 31  ? 2.833   13.758  -5.219  1.00 0.00 ? 31  THR A HB   3  
ATOM 3312  H HG1  . THR A 1 31  ? 4.497   12.484  -3.393  1.00 0.00 ? 31  THR A HG1  3  
ATOM 3313  H HG21 . THR A 1 31  ? 0.885   13.165  -4.318  1.00 0.00 ? 31  THR A HG21 3  
ATOM 3314  H HG22 . THR A 1 31  ? 1.718   12.475  -2.926  1.00 0.00 ? 31  THR A HG22 3  
ATOM 3315  H HG23 . THR A 1 31  ? 1.398   11.479  -4.345  1.00 0.00 ? 31  THR A HG23 3  
ATOM 3316  N N    . LEU A 1 32  ? 2.503   9.622   -5.072  1.00 0.00 ? 32  LEU A N    3  
ATOM 3317  C CA   . LEU A 1 32  ? 2.304   8.331   -4.422  1.00 0.00 ? 32  LEU A CA   3  
ATOM 3318  C C    . LEU A 1 32  ? 3.336   7.315   -4.903  1.00 0.00 ? 32  LEU A C    3  
ATOM 3319  O O    . LEU A 1 32  ? 3.849   6.517   -4.118  1.00 0.00 ? 32  LEU A O    3  
ATOM 3320  C CB   . LEU A 1 32  ? 0.892   7.811   -4.699  1.00 0.00 ? 32  LEU A CB   3  
ATOM 3321  C CG   . LEU A 1 32  ? 0.546   6.452   -4.090  1.00 0.00 ? 32  LEU A CG   3  
ATOM 3322  C CD1  . LEU A 1 32  ? 0.741   6.478   -2.582  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 3323  C CD2  . LEU A 1 32  ? -0.882  6.059   -4.438  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 3324  H H    . LEU A 1 32  ? 1.900   9.889   -5.796  1.00 0.00 ? 32  LEU A H    3  
ATOM 3325  H HA   . LEU A 1 32  ? 2.424   8.473   -3.359  1.00 0.00 ? 32  LEU A HA   3  
ATOM 3326  H HB2  . LEU A 1 32  ? 0.192   8.534   -4.313  1.00 0.00 ? 32  LEU A HB2  3  
ATOM 3327  H HB3  . LEU A 1 32  ? 0.774   7.734   -5.771  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 3328  H HG   . LEU A 1 32  ? 1.210   5.702   -4.498  1.00 0.00 ? 32  LEU A HG   3  
ATOM 3329  H HD11 . LEU A 1 32  ? 1.788   6.613   -2.356  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 3330  H HD12 . LEU A 1 32  ? 0.399   5.546   -2.158  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 3331  H HD13 . LEU A 1 32  ? 0.173   7.294   -2.160  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 3332  H HD21 . LEU A 1 32  ? -1.499  6.128   -3.555  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 3333  H HD22 . LEU A 1 32  ? -0.896  5.044   -4.808  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 3334  H HD23 . LEU A 1 32  ? -1.263  6.725   -5.198  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 3335  N N    . LYS A 1 33  ? 3.637   7.352   -6.196  1.00 0.00 ? 33  LYS A N    3  
ATOM 3336  C CA   . LYS A 1 33  ? 4.611   6.438   -6.782  1.00 0.00 ? 33  LYS A CA   3  
ATOM 3337  C C    . LYS A 1 33  ? 6.020   6.759   -6.294  1.00 0.00 ? 33  LYS A C    3  
ATOM 3338  O O    . LYS A 1 33  ? 6.700   5.903   -5.729  1.00 0.00 ? 33  LYS A O    3  
ATOM 3339  C CB   . LYS A 1 33  ? 4.558   6.515   -8.309  1.00 0.00 ? 33  LYS A CB   3  
ATOM 3340  C CG   . LYS A 1 33  ? 5.428   5.479   -9.001  1.00 0.00 ? 33  LYS A CG   3  
ATOM 3341  C CD   . LYS A 1 33  ? 5.900   5.966   -10.360 1.00 0.00 ? 33  LYS A CD   3  
ATOM 3342  C CE   . LYS A 1 33  ? 7.253   5.373   -10.726 1.00 0.00 ? 33  LYS A CE   3  
ATOM 3343  N NZ   . LYS A 1 33  ? 8.003   6.243   -11.673 1.00 0.00 ? 33  LYS A NZ   3  
ATOM 3344  H H    . LYS A 1 33  ? 3.195   8.012   -6.771  1.00 0.00 ? 33  LYS A H    3  
ATOM 3345  H HA   . LYS A 1 33  ? 4.354   5.437   -6.471  1.00 0.00 ? 33  LYS A HA   3  
ATOM 3346  H HB2  . LYS A 1 33  ? 3.537   6.369   -8.630  1.00 0.00 ? 33  LYS A HB2  3  
ATOM 3347  H HB3  . LYS A 1 33  ? 4.888   7.496   -8.620  1.00 0.00 ? 33  LYS A HB3  3  
ATOM 3348  H HG2  . LYS A 1 33  ? 6.291   5.277   -8.383  1.00 0.00 ? 33  LYS A HG2  3  
ATOM 3349  H HG3  . LYS A 1 33  ? 4.856   4.572   -9.132  1.00 0.00 ? 33  LYS A HG3  3  
ATOM 3350  H HD2  . LYS A 1 33  ? 5.178   5.674   -11.108 1.00 0.00 ? 33  LYS A HD2  3  
ATOM 3351  H HD3  . LYS A 1 33  ? 5.984   7.043   -10.338 1.00 0.00 ? 33  LYS A HD3  3  
ATOM 3352  H HE2  . LYS A 1 33  ? 7.833   5.252   -9.824  1.00 0.00 ? 33  LYS A HE2  3  
ATOM 3353  H HE3  . LYS A 1 33  ? 7.095   4.408   -11.185 1.00 0.00 ? 33  LYS A HE3  3  
ATOM 3354  H HZ1  . LYS A 1 33  ? 7.338   6.770   -12.276 1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 3355  H HZ2  . LYS A 1 33  ? 8.619   5.665   -12.278 1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 3356  H HZ3  . LYS A 1 33  ? 8.589   6.922   -11.147 1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 3357  N N    . GLU A 1 34  ? 6.451   7.996   -6.517  1.00 0.00 ? 34  GLU A N    3  
ATOM 3358  C CA   . GLU A 1 34  ? 7.780   8.428   -6.099  1.00 0.00 ? 34  GLU A CA   3  
ATOM 3359  C C    . GLU A 1 34  ? 8.035   8.067   -4.638  1.00 0.00 ? 34  GLU A C    3  
ATOM 3360  O O    . GLU A 1 34  ? 9.091   7.534   -4.295  1.00 0.00 ? 34  GLU A O    3  
ATOM 3361  C CB   . GLU A 1 34  ? 7.935   9.938   -6.296  1.00 0.00 ? 34  GLU A CB   3  
ATOM 3362  C CG   . GLU A 1 34  ? 7.848   10.373  -7.750  1.00 0.00 ? 34  GLU A CG   3  
ATOM 3363  C CD   . GLU A 1 34  ? 8.920   9.739   -8.614  1.00 0.00 ? 34  GLU A CD   3  
ATOM 3364  O OE1  . GLU A 1 34  ? 8.762   8.556   -8.981  1.00 0.00 ? 34  GLU A OE1  3  
ATOM 3365  O OE2  . GLU A 1 34  ? 9.917   10.425  -8.923  1.00 0.00 ? 34  GLU A OE2  3  
ATOM 3366  H H    . GLU A 1 34  ? 5.863   8.633   -6.973  1.00 0.00 ? 34  GLU A H    3  
ATOM 3367  H HA   . GLU A 1 34  ? 8.504   7.918   -6.715  1.00 0.00 ? 34  GLU A HA   3  
ATOM 3368  H HB2  . GLU A 1 34  ? 7.158   10.443  -5.743  1.00 0.00 ? 34  GLU A HB2  3  
ATOM 3369  H HB3  . GLU A 1 34  ? 8.896   10.242  -5.909  1.00 0.00 ? 34  GLU A HB3  3  
ATOM 3370  H HG2  . GLU A 1 34  ? 6.881   10.093  -8.139  1.00 0.00 ? 34  GLU A HG2  3  
ATOM 3371  H HG3  . GLU A 1 34  ? 7.956   11.447  -7.797  1.00 0.00 ? 34  GLU A HG3  3  
ATOM 3372  N N    . SER A 1 35  ? 7.061   8.361   -3.783  1.00 0.00 ? 35  SER A N    3  
ATOM 3373  C CA   . SER A 1 35  ? 7.181   8.071   -2.359  1.00 0.00 ? 35  SER A CA   3  
ATOM 3374  C C    . SER A 1 35  ? 7.954   6.775   -2.131  1.00 0.00 ? 35  SER A C    3  
ATOM 3375  O O    . SER A 1 35  ? 8.659   6.627   -1.133  1.00 0.00 ? 35  SER A O    3  
ATOM 3376  C CB   . SER A 1 35  ? 5.796   7.971   -1.719  1.00 0.00 ? 35  SER A CB   3  
ATOM 3377  O OG   . SER A 1 35  ? 5.217   9.253   -1.552  1.00 0.00 ? 35  SER A OG   3  
ATOM 3378  H H    . SER A 1 35  ? 6.243   8.785   -4.118  1.00 0.00 ? 35  SER A H    3  
ATOM 3379  H HA   . SER A 1 35  ? 7.723   8.885   -1.900  1.00 0.00 ? 35  SER A HA   3  
ATOM 3380  H HB2  . SER A 1 35  ? 5.152   7.378   -2.351  1.00 0.00 ? 35  SER A HB2  3  
ATOM 3381  H HB3  . SER A 1 35  ? 5.883   7.499   -0.751  1.00 0.00 ? 35  SER A HB3  3  
ATOM 3382  H HG   . SER A 1 35  ? 4.278   9.209   -1.748  1.00 0.00 ? 35  SER A HG   3  
ATOM 3383  N N    . PHE A 1 36  ? 7.817   5.840   -3.065  1.00 0.00 ? 36  PHE A N    3  
ATOM 3384  C CA   . PHE A 1 36  ? 8.501   4.556   -2.968  1.00 0.00 ? 36  PHE A CA   3  
ATOM 3385  C C    . PHE A 1 36  ? 9.655   4.477   -3.963  1.00 0.00 ? 36  PHE A C    3  
ATOM 3386  O O    . PHE A 1 36  ? 9.442   4.450   -5.175  1.00 0.00 ? 36  PHE A O    3  
ATOM 3387  C CB   . PHE A 1 36  ? 7.518   3.410   -3.218  1.00 0.00 ? 36  PHE A CB   3  
ATOM 3388  C CG   . PHE A 1 36  ? 6.268   3.502   -2.390  1.00 0.00 ? 36  PHE A CG   3  
ATOM 3389  C CD1  . PHE A 1 36  ? 5.262   4.393   -2.726  1.00 0.00 ? 36  PHE A CD1  3  
ATOM 3390  C CD2  . PHE A 1 36  ? 6.099   2.696   -1.276  1.00 0.00 ? 36  PHE A CD2  3  
ATOM 3391  C CE1  . PHE A 1 36  ? 4.111   4.480   -1.966  1.00 0.00 ? 36  PHE A CE1  3  
ATOM 3392  C CE2  . PHE A 1 36  ? 4.950   2.778   -0.512  1.00 0.00 ? 36  PHE A CE2  3  
ATOM 3393  C CZ   . PHE A 1 36  ? 3.954   3.670   -0.858  1.00 0.00 ? 36  PHE A CZ   3  
ATOM 3394  H H    . PHE A 1 36  ? 7.241   6.018   -3.839  1.00 0.00 ? 36  PHE A H    3  
ATOM 3395  H HA   . PHE A 1 36  ? 8.897   4.468   -1.968  1.00 0.00 ? 36  PHE A HA   3  
ATOM 3396  H HB2  . PHE A 1 36  ? 7.228   3.415   -4.257  1.00 0.00 ? 36  PHE A HB2  3  
ATOM 3397  H HB3  . PHE A 1 36  ? 8.002   2.474   -2.987  1.00 0.00 ? 36  PHE A HB3  3  
ATOM 3398  H HD1  . PHE A 1 36  ? 5.383   5.026   -3.593  1.00 0.00 ? 36  PHE A HD1  3  
ATOM 3399  H HD2  . PHE A 1 36  ? 6.877   1.997   -1.004  1.00 0.00 ? 36  PHE A HD2  3  
ATOM 3400  H HE1  . PHE A 1 36  ? 3.334   5.178   -2.239  1.00 0.00 ? 36  PHE A HE1  3  
ATOM 3401  H HE2  . PHE A 1 36  ? 4.831   2.143   0.354   1.00 0.00 ? 36  PHE A HE2  3  
ATOM 3402  H HZ   . PHE A 1 36  ? 3.056   3.736   -0.262  1.00 0.00 ? 36  PHE A HZ   3  
ATOM 3403  N N    . ASP A 1 37  ? 10.876  4.442   -3.442  1.00 0.00 ? 37  ASP A N    3  
ATOM 3404  C CA   . ASP A 1 37  ? 12.065  4.366   -4.283  1.00 0.00 ? 37  ASP A CA   3  
ATOM 3405  C C    . ASP A 1 37  ? 12.227  2.967   -4.869  1.00 0.00 ? 37  ASP A C    3  
ATOM 3406  O O    . ASP A 1 37  ? 12.812  2.084   -4.243  1.00 0.00 ? 37  ASP A O    3  
ATOM 3407  C CB   . ASP A 1 37  ? 13.310  4.743   -3.479  1.00 0.00 ? 37  ASP A CB   3  
ATOM 3408  C CG   . ASP A 1 37  ? 14.429  5.268   -4.357  1.00 0.00 ? 37  ASP A CG   3  
ATOM 3409  O OD1  . ASP A 1 37  ? 14.125  5.923   -5.376  1.00 0.00 ? 37  ASP A OD1  3  
ATOM 3410  O OD2  . ASP A 1 37  ? 15.608  5.024   -4.026  1.00 0.00 ? 37  ASP A OD2  3  
ATOM 3411  H H    . ASP A 1 37  ? 10.981  4.467   -2.467  1.00 0.00 ? 37  ASP A H    3  
ATOM 3412  H HA   . ASP A 1 37  ? 11.944  5.069   -5.093  1.00 0.00 ? 37  ASP A HA   3  
ATOM 3413  H HB2  . ASP A 1 37  ? 13.050  5.509   -2.763  1.00 0.00 ? 37  ASP A HB2  3  
ATOM 3414  H HB3  . ASP A 1 37  ? 13.669  3.871   -2.953  1.00 0.00 ? 37  ASP A HB3  3  
ATOM 3415  N N    . GLY A 1 38  ? 11.704  2.771   -6.076  1.00 0.00 ? 38  GLY A N    3  
ATOM 3416  C CA   . GLY A 1 38  ? 11.800  1.477   -6.726  1.00 0.00 ? 38  GLY A CA   3  
ATOM 3417  C C    . GLY A 1 38  ? 10.537  1.112   -7.480  1.00 0.00 ? 38  GLY A C    3  
ATOM 3418  O O    . GLY A 1 38  ? 10.600  0.530   -8.563  1.00 0.00 ? 38  GLY A O    3  
ATOM 3419  H H    . GLY A 1 38  ? 11.248  3.512   -6.528  1.00 0.00 ? 38  GLY A H    3  
ATOM 3420  H HA2  . GLY A 1 38  ? 12.628  1.495   -7.418  1.00 0.00 ? 38  GLY A HA2  3  
ATOM 3421  H HA3  . GLY A 1 38  ? 11.987  0.723   -5.975  1.00 0.00 ? 38  GLY A HA3  3  
ATOM 3422  N N    . SER A 1 39  ? 9.387   1.452   -6.907  1.00 0.00 ? 39  SER A N    3  
ATOM 3423  C CA   . SER A 1 39  ? 8.104   1.152   -7.530  1.00 0.00 ? 39  SER A CA   3  
ATOM 3424  C C    . SER A 1 39  ? 8.143   1.449   -9.026  1.00 0.00 ? 39  SER A C    3  
ATOM 3425  O O    . SER A 1 39  ? 9.041   2.138   -9.510  1.00 0.00 ? 39  SER A O    3  
ATOM 3426  C CB   . SER A 1 39  ? 6.989   1.962   -6.867  1.00 0.00 ? 39  SER A CB   3  
ATOM 3427  O OG   . SER A 1 39  ? 7.052   3.325   -7.250  1.00 0.00 ? 39  SER A OG   3  
ATOM 3428  H H    . SER A 1 39  ? 9.403   1.915   -6.042  1.00 0.00 ? 39  SER A H    3  
ATOM 3429  H HA   . SER A 1 39  ? 7.905   0.100   -7.389  1.00 0.00 ? 39  SER A HA   3  
ATOM 3430  H HB2  . SER A 1 39  ? 6.031   1.562   -7.163  1.00 0.00 ? 39  SER A HB2  3  
ATOM 3431  H HB3  . SER A 1 39  ? 7.090   1.897   -5.793  1.00 0.00 ? 39  SER A HB3  3  
ATOM 3432  H HG   . SER A 1 39  ? 7.569   3.815   -6.606  1.00 0.00 ? 39  SER A HG   3  
ATOM 3433  N N    . VAL A 1 40  ? 7.163   0.923   -9.753  1.00 0.00 ? 40  VAL A N    3  
ATOM 3434  C CA   . VAL A 1 40  ? 7.083   1.132   -11.194 1.00 0.00 ? 40  VAL A CA   3  
ATOM 3435  C C    . VAL A 1 40  ? 5.952   2.090   -11.549 1.00 0.00 ? 40  VAL A C    3  
ATOM 3436  O O    . VAL A 1 40  ? 6.078   2.904   -12.464 1.00 0.00 ? 40  VAL A O    3  
ATOM 3437  C CB   . VAL A 1 40  ? 6.870   -0.197  -11.943 1.00 0.00 ? 40  VAL A CB   3  
ATOM 3438  C CG1  . VAL A 1 40  ? 8.034   -1.144  -11.694 1.00 0.00 ? 40  VAL A CG1  3  
ATOM 3439  C CG2  . VAL A 1 40  ? 5.554   -0.837  -11.527 1.00 0.00 ? 40  VAL A CG2  3  
ATOM 3440  H H    . VAL A 1 40  ? 6.476   0.382   -9.310  1.00 0.00 ? 40  VAL A H    3  
ATOM 3441  H HA   . VAL A 1 40  ? 8.020   1.559   -11.522 1.00 0.00 ? 40  VAL A HA   3  
ATOM 3442  H HB   . VAL A 1 40  ? 6.825   0.013   -13.001 1.00 0.00 ? 40  VAL A HB   3  
ATOM 3443  H HG11 . VAL A 1 40  ? 7.654   -2.127  -11.458 1.00 0.00 ? 40  VAL A HG11 3  
ATOM 3444  H HG12 . VAL A 1 40  ? 8.651   -1.197  -12.579 1.00 0.00 ? 40  VAL A HG12 3  
ATOM 3445  H HG13 . VAL A 1 40  ? 8.623   -0.779  -10.865 1.00 0.00 ? 40  VAL A HG13 3  
ATOM 3446  H HG21 . VAL A 1 40  ? 5.282   -0.491  -10.541 1.00 0.00 ? 40  VAL A HG21 3  
ATOM 3447  H HG22 . VAL A 1 40  ? 4.781   -0.561  -12.230 1.00 0.00 ? 40  VAL A HG22 3  
ATOM 3448  H HG23 . VAL A 1 40  ? 5.663   -1.911  -11.515 1.00 0.00 ? 40  VAL A HG23 3  
ATOM 3449  N N    . ARG A 1 41  ? 4.846   1.988   -10.819 1.00 0.00 ? 41  ARG A N    3  
ATOM 3450  C CA   . ARG A 1 41  ? 3.691   2.845   -11.057 1.00 0.00 ? 41  ARG A CA   3  
ATOM 3451  C C    . ARG A 1 41  ? 2.847   2.984   -9.793  1.00 0.00 ? 41  ARG A C    3  
ATOM 3452  O O    . ARG A 1 41  ? 3.075   2.289   -8.803  1.00 0.00 ? 41  ARG A O    3  
ATOM 3453  C CB   . ARG A 1 41  ? 2.837   2.282   -12.194 1.00 0.00 ? 41  ARG A CB   3  
ATOM 3454  C CG   . ARG A 1 41  ? 3.603   2.092   -13.494 1.00 0.00 ? 41  ARG A CG   3  
ATOM 3455  C CD   . ARG A 1 41  ? 2.660   1.932   -14.676 1.00 0.00 ? 41  ARG A CD   3  
ATOM 3456  N NE   . ARG A 1 41  ? 3.273   1.177   -15.766 1.00 0.00 ? 41  ARG A NE   3  
ATOM 3457  C CZ   . ARG A 1 41  ? 2.734   1.061   -16.974 1.00 0.00 ? 41  ARG A CZ   3  
ATOM 3458  N NH1  . ARG A 1 41  ? 1.577   1.648   -17.246 1.00 0.00 ? 41  ARG A NH1  3  
ATOM 3459  N NH2  . ARG A 1 41  ? 3.352   0.356   -17.913 1.00 0.00 ? 41  ARG A NH2  3  
ATOM 3460  H H    . ARG A 1 41  ? 4.806   1.319   -10.103 1.00 0.00 ? 41  ARG A H    3  
ATOM 3461  H HA   . ARG A 1 41  ? 4.056   3.821   -11.341 1.00 0.00 ? 41  ARG A HA   3  
ATOM 3462  H HB2  . ARG A 1 41  ? 2.442   1.324   -11.892 1.00 0.00 ? 41  ARG A HB2  3  
ATOM 3463  H HB3  . ARG A 1 41  ? 2.017   2.958   -12.380 1.00 0.00 ? 41  ARG A HB3  3  
ATOM 3464  H HG2  . ARG A 1 41  ? 4.229   2.956   -13.661 1.00 0.00 ? 41  ARG A HG2  3  
ATOM 3465  H HG3  . ARG A 1 41  ? 4.218   1.209   -13.412 1.00 0.00 ? 41  ARG A HG3  3  
ATOM 3466  H HD2  . ARG A 1 41  ? 1.774   1.412   -14.346 1.00 0.00 ? 41  ARG A HD2  3  
ATOM 3467  H HD3  . ARG A 1 41  ? 2.389   2.912   -15.038 1.00 0.00 ? 41  ARG A HD3  3  
ATOM 3468  H HE   . ARG A 1 41  ? 4.129   0.734   -15.587 1.00 0.00 ? 41  ARG A HE   3  
ATOM 3469  H HH11 . ARG A 1 41  ? 1.109   2.180   -16.541 1.00 0.00 ? 41  ARG A HH11 3  
ATOM 3470  H HH12 . ARG A 1 41  ? 1.173   1.560   -18.157 1.00 0.00 ? 41  ARG A HH12 3  
ATOM 3471  H HH21 . ARG A 1 41  ? 4.225   -0.088  -17.712 1.00 0.00 ? 41  ARG A HH21 3  
ATOM 3472  H HH22 . ARG A 1 41  ? 2.946   0.269   -18.822 1.00 0.00 ? 41  ARG A HH22 3  
ATOM 3473  N N    . ALA A 1 42  ? 1.872   3.885   -9.835  1.00 0.00 ? 42  ALA A N    3  
ATOM 3474  C CA   . ALA A 1 42  ? 0.993   4.114   -8.694  1.00 0.00 ? 42  ALA A CA   3  
ATOM 3475  C C    . ALA A 1 42  ? -0.412  4.491   -9.151  1.00 0.00 ? 42  ALA A C    3  
ATOM 3476  O O    . ALA A 1 42  ? -0.605  4.962   -10.272 1.00 0.00 ? 42  ALA A O    3  
ATOM 3477  C CB   . ALA A 1 42  ? 1.567   5.199   -7.795  1.00 0.00 ? 42  ALA A CB   3  
ATOM 3478  H H    . ALA A 1 42  ? 1.740   4.409   -10.653 1.00 0.00 ? 42  ALA A H    3  
ATOM 3479  H HA   . ALA A 1 42  ? 0.942   3.198   -8.124  1.00 0.00 ? 42  ALA A HA   3  
ATOM 3480  H HB1  . ALA A 1 42  ? 2.579   4.940   -7.520  1.00 0.00 ? 42  ALA A HB1  3  
ATOM 3481  H HB2  . ALA A 1 42  ? 1.567   6.141   -8.323  1.00 0.00 ? 42  ALA A HB2  3  
ATOM 3482  H HB3  . ALA A 1 42  ? 0.963   5.285   -6.905  1.00 0.00 ? 42  ALA A HB3  3  
ATOM 3483  N N    . ARG A 1 43  ? -1.390  4.279   -8.277  1.00 0.00 ? 43  ARG A N    3  
ATOM 3484  C CA   . ARG A 1 43  ? -2.778  4.594   -8.591  1.00 0.00 ? 43  ARG A CA   3  
ATOM 3485  C C    . ARG A 1 43  ? -3.494  5.170   -7.373  1.00 0.00 ? 43  ARG A C    3  
ATOM 3486  O O    . ARG A 1 43  ? -3.177  4.825   -6.234  1.00 0.00 ? 43  ARG A O    3  
ATOM 3487  C CB   . ARG A 1 43  ? -3.509  3.344   -9.083  1.00 0.00 ? 43  ARG A CB   3  
ATOM 3488  C CG   . ARG A 1 43  ? -2.643  2.427   -9.932  1.00 0.00 ? 43  ARG A CG   3  
ATOM 3489  C CD   . ARG A 1 43  ? -3.488  1.552   -10.845 1.00 0.00 ? 43  ARG A CD   3  
ATOM 3490  N NE   . ARG A 1 43  ? -4.265  0.568   -10.096 1.00 0.00 ? 43  ARG A NE   3  
ATOM 3491  C CZ   . ARG A 1 43  ? -4.856  -0.482  -10.655 1.00 0.00 ? 43  ARG A CZ   3  
ATOM 3492  N NH1  . ARG A 1 43  ? -4.758  -0.684  -11.961 1.00 0.00 ? 43  ARG A NH1  3  
ATOM 3493  N NH2  . ARG A 1 43  ? -5.546  -1.333  -9.906  1.00 0.00 ? 43  ARG A NH2  3  
ATOM 3494  H H    . ARG A 1 43  ? -1.173  3.900   -7.399  1.00 0.00 ? 43  ARG A H    3  
ATOM 3495  H HA   . ARG A 1 43  ? -2.780  5.334   -9.378  1.00 0.00 ? 43  ARG A HA   3  
ATOM 3496  H HB2  . ARG A 1 43  ? -3.856  2.784   -8.227  1.00 0.00 ? 43  ARG A HB2  3  
ATOM 3497  H HB3  . ARG A 1 43  ? -4.360  3.648   -9.674  1.00 0.00 ? 43  ARG A HB3  3  
ATOM 3498  H HG2  . ARG A 1 43  ? -1.983  3.029   -10.538 1.00 0.00 ? 43  ARG A HG2  3  
ATOM 3499  H HG3  . ARG A 1 43  ? -2.059  1.794   -9.280  1.00 0.00 ? 43  ARG A HG3  3  
ATOM 3500  H HD2  . ARG A 1 43  ? -4.164  2.183   -11.401 1.00 0.00 ? 43  ARG A HD2  3  
ATOM 3501  H HD3  . ARG A 1 43  ? -2.834  1.034   -11.530 1.00 0.00 ? 43  ARG A HD3  3  
ATOM 3502  H HE   . ARG A 1 43  ? -4.351  0.699   -9.128  1.00 0.00 ? 43  ARG A HE   3  
ATOM 3503  H HH11 . ARG A 1 43  ? -4.238  -0.045  -12.528 1.00 0.00 ? 43  ARG A HH11 3  
ATOM 3504  H HH12 . ARG A 1 43  ? -5.203  -1.477  -12.379 1.00 0.00 ? 43  ARG A HH12 3  
ATOM 3505  H HH21 . ARG A 1 43  ? -5.622  -1.183  -8.920  1.00 0.00 ? 43  ARG A HH21 3  
ATOM 3506  H HH22 . ARG A 1 43  ? -5.991  -2.122  -10.327 1.00 0.00 ? 43  ARG A HH22 3  
ATOM 3507  N N    . ILE A 1 44  ? -4.461  6.047   -7.621  1.00 0.00 ? 44  ILE A N    3  
ATOM 3508  C CA   . ILE A 1 44  ? -5.223  6.668   -6.545  1.00 0.00 ? 44  ILE A CA   3  
ATOM 3509  C C    . ILE A 1 44  ? -6.722  6.573   -6.806  1.00 0.00 ? 44  ILE A C    3  
ATOM 3510  O O    . ILE A 1 44  ? -7.188  6.836   -7.915  1.00 0.00 ? 44  ILE A O    3  
ATOM 3511  C CB   . ILE A 1 44  ? -4.837  8.148   -6.365  1.00 0.00 ? 44  ILE A CB   3  
ATOM 3512  C CG1  . ILE A 1 44  ? -3.469  8.263   -5.690  1.00 0.00 ? 44  ILE A CG1  3  
ATOM 3513  C CG2  . ILE A 1 44  ? -5.897  8.877   -5.553  1.00 0.00 ? 44  ILE A CG2  3  
ATOM 3514  C CD1  . ILE A 1 44  ? -3.047  9.690   -5.416  1.00 0.00 ? 44  ILE A CD1  3  
ATOM 3515  H H    . ILE A 1 44  ? -4.668  6.280   -8.550  1.00 0.00 ? 44  ILE A H    3  
ATOM 3516  H HA   . ILE A 1 44  ? -4.994  6.143   -5.629  1.00 0.00 ? 44  ILE A HA   3  
ATOM 3517  H HB   . ILE A 1 44  ? -4.788  8.606   -7.341  1.00 0.00 ? 44  ILE A HB   3  
ATOM 3518  H HG12 . ILE A 1 44  ? -3.494  7.739   -4.747  1.00 0.00 ? 44  ILE A HG12 3  
ATOM 3519  H HG13 . ILE A 1 44  ? -2.722  7.812   -6.328  1.00 0.00 ? 44  ILE A HG13 3  
ATOM 3520  H HG21 . ILE A 1 44  ? -6.530  8.155   -5.058  1.00 0.00 ? 44  ILE A HG21 3  
ATOM 3521  H HG22 . ILE A 1 44  ? -5.418  9.501   -4.813  1.00 0.00 ? 44  ILE A HG22 3  
ATOM 3522  H HG23 . ILE A 1 44  ? -6.495  9.491   -6.209  1.00 0.00 ? 44  ILE A HG23 3  
ATOM 3523  H HD11 . ILE A 1 44  ? -3.383  9.983   -4.433  1.00 0.00 ? 44  ILE A HD11 3  
ATOM 3524  H HD12 . ILE A 1 44  ? -1.972  9.765   -5.468  1.00 0.00 ? 44  ILE A HD12 3  
ATOM 3525  H HD13 . ILE A 1 44  ? -3.489  10.343  -6.155  1.00 0.00 ? 44  ILE A HD13 3  
ATOM 3526  N N    . VAL A 1 45  ? -7.474  6.198   -5.776  1.00 0.00 ? 45  VAL A N    3  
ATOM 3527  C CA   . VAL A 1 45  ? -8.922  6.071   -5.893  1.00 0.00 ? 45  VAL A CA   3  
ATOM 3528  C C    . VAL A 1 45  ? -9.602  7.433   -5.802  1.00 0.00 ? 45  VAL A C    3  
ATOM 3529  O O    . VAL A 1 45  ? -9.051  8.379   -5.238  1.00 0.00 ? 45  VAL A O    3  
ATOM 3530  C CB   . VAL A 1 45  ? -9.494  5.150   -4.799  1.00 0.00 ? 45  VAL A CB   3  
ATOM 3531  C CG1  . VAL A 1 45  ? -8.551  3.987   -4.533  1.00 0.00 ? 45  VAL A CG1  3  
ATOM 3532  C CG2  . VAL A 1 45  ? -9.758  5.936   -3.524  1.00 0.00 ? 45  VAL A CG2  3  
ATOM 3533  H H    . VAL A 1 45  ? -7.045  6.003   -4.917  1.00 0.00 ? 45  VAL A H    3  
ATOM 3534  H HA   . VAL A 1 45  ? -9.142  5.633   -6.855  1.00 0.00 ? 45  VAL A HA   3  
ATOM 3535  H HB   . VAL A 1 45  ? -10.434 4.749   -5.151  1.00 0.00 ? 45  VAL A HB   3  
ATOM 3536  H HG11 . VAL A 1 45  ? -9.114  3.146   -4.155  1.00 0.00 ? 45  VAL A HG11 3  
ATOM 3537  H HG12 . VAL A 1 45  ? -8.056  3.707   -5.451  1.00 0.00 ? 45  VAL A HG12 3  
ATOM 3538  H HG13 . VAL A 1 45  ? -7.813  4.283   -3.801  1.00 0.00 ? 45  VAL A HG13 3  
ATOM 3539  H HG21 . VAL A 1 45  ? -10.109 5.266   -2.754  1.00 0.00 ? 45  VAL A HG21 3  
ATOM 3540  H HG22 . VAL A 1 45  ? -8.843  6.411   -3.198  1.00 0.00 ? 45  VAL A HG22 3  
ATOM 3541  H HG23 . VAL A 1 45  ? -10.506 6.691   -3.714  1.00 0.00 ? 45  VAL A HG23 3  
ATOM 3542  N N    . THR A 1 46  ? -10.804 7.526   -6.361  1.00 0.00 ? 46  THR A N    3  
ATOM 3543  C CA   . THR A 1 46  ? -11.560 8.772   -6.344  1.00 0.00 ? 46  THR A CA   3  
ATOM 3544  C C    . THR A 1 46  ? -13.043 8.512   -6.100  1.00 0.00 ? 46  THR A C    3  
ATOM 3545  O O    . THR A 1 46  ? -13.551 7.432   -6.400  1.00 0.00 ? 46  THR A O    3  
ATOM 3546  C CB   . THR A 1 46  ? -11.397 9.546   -7.666  1.00 0.00 ? 46  THR A CB   3  
ATOM 3547  O OG1  . THR A 1 46  ? -11.813 8.730   -8.766  1.00 0.00 ? 46  THR A OG1  3  
ATOM 3548  C CG2  . THR A 1 46  ? -9.952  9.977   -7.866  1.00 0.00 ? 46  THR A CG2  3  
ATOM 3549  H H    . THR A 1 46  ? -11.191 6.737   -6.796  1.00 0.00 ? 46  THR A H    3  
ATOM 3550  H HA   . THR A 1 46  ? -11.175 9.385   -5.542  1.00 0.00 ? 46  THR A HA   3  
ATOM 3551  H HB   . THR A 1 46  ? -12.019 10.429  -7.627  1.00 0.00 ? 46  THR A HB   3  
ATOM 3552  H HG1  . THR A 1 46  ? -12.754 8.851   -8.917  1.00 0.00 ? 46  THR A HG1  3  
ATOM 3553  H HG21 . THR A 1 46  ? -9.868  10.539  -8.784  1.00 0.00 ? 46  THR A HG21 3  
ATOM 3554  H HG22 . THR A 1 46  ? -9.320  9.103   -7.918  1.00 0.00 ? 46  THR A HG22 3  
ATOM 3555  H HG23 . THR A 1 46  ? -9.644  10.596  -7.036  1.00 0.00 ? 46  THR A HG23 3  
ATOM 3556  N N    . ASP A 1 47  ? -13.731 9.509   -5.555  1.00 0.00 ? 47  ASP A N    3  
ATOM 3557  C CA   . ASP A 1 47  ? -15.157 9.389   -5.273  1.00 0.00 ? 47  ASP A CA   3  
ATOM 3558  C C    . ASP A 1 47  ? -15.975 9.491   -6.555  1.00 0.00 ? 47  ASP A C    3  
ATOM 3559  O O    . ASP A 1 47  ? -15.474 9.931   -7.590  1.00 0.00 ? 47  ASP A O    3  
ATOM 3560  C CB   . ASP A 1 47  ? -15.595 10.471  -4.285  1.00 0.00 ? 47  ASP A CB   3  
ATOM 3561  C CG   . ASP A 1 47  ? -17.032 10.295  -3.833  1.00 0.00 ? 47  ASP A CG   3  
ATOM 3562  O OD1  . ASP A 1 47  ? -17.329 9.267   -3.190  1.00 0.00 ? 47  ASP A OD1  3  
ATOM 3563  O OD2  . ASP A 1 47  ? -17.859 11.184  -4.125  1.00 0.00 ? 47  ASP A OD2  3  
ATOM 3564  H H    . ASP A 1 47  ? -13.269 10.347  -5.339  1.00 0.00 ? 47  ASP A H    3  
ATOM 3565  H HA   . ASP A 1 47  ? -15.326 8.420   -4.829  1.00 0.00 ? 47  ASP A HA   3  
ATOM 3566  H HB2  . ASP A 1 47  ? -14.957 10.435  -3.414  1.00 0.00 ? 47  ASP A HB2  3  
ATOM 3567  H HB3  . ASP A 1 47  ? -15.501 11.439  -4.756  1.00 0.00 ? 47  ASP A HB3  3  
ATOM 3568  N N    . ARG A 1 48  ? -17.238 9.082   -6.480  1.00 0.00 ? 48  ARG A N    3  
ATOM 3569  C CA   . ARG A 1 48  ? -18.125 9.126   -7.636  1.00 0.00 ? 48  ARG A CA   3  
ATOM 3570  C C    . ARG A 1 48  ? -18.947 10.412  -7.642  1.00 0.00 ? 48  ARG A C    3  
ATOM 3571  O O    . ARG A 1 48  ? -19.299 10.929  -8.701  1.00 0.00 ? 48  ARG A O    3  
ATOM 3572  C CB   . ARG A 1 48  ? -19.057 7.913   -7.636  1.00 0.00 ? 48  ARG A CB   3  
ATOM 3573  C CG   . ARG A 1 48  ? -20.088 7.936   -6.520  1.00 0.00 ? 48  ARG A CG   3  
ATOM 3574  C CD   . ARG A 1 48  ? -21.363 8.641   -6.953  1.00 0.00 ? 48  ARG A CD   3  
ATOM 3575  N NE   . ARG A 1 48  ? -22.264 7.748   -7.676  1.00 0.00 ? 48  ARG A NE   3  
ATOM 3576  C CZ   . ARG A 1 48  ? -23.326 8.167   -8.355  1.00 0.00 ? 48  ARG A CZ   3  
ATOM 3577  N NH1  . ARG A 1 48  ? -23.617 9.460   -8.405  1.00 0.00 ? 48  ARG A NH1  3  
ATOM 3578  N NH2  . ARG A 1 48  ? -24.099 7.293   -8.987  1.00 0.00 ? 48  ARG A NH2  3  
ATOM 3579  H H    . ARG A 1 48  ? -17.580 8.742   -5.627  1.00 0.00 ? 48  ARG A H    3  
ATOM 3580  H HA   . ARG A 1 48  ? -17.514 9.100   -8.525  1.00 0.00 ? 48  ARG A HA   3  
ATOM 3581  H HB2  . ARG A 1 48  ? -19.581 7.876   -8.580  1.00 0.00 ? 48  ARG A HB2  3  
ATOM 3582  H HB3  . ARG A 1 48  ? -18.462 7.018   -7.529  1.00 0.00 ? 48  ARG A HB3  3  
ATOM 3583  H HG2  . ARG A 1 48  ? -20.328 6.920   -6.243  1.00 0.00 ? 48  ARG A HG2  3  
ATOM 3584  H HG3  . ARG A 1 48  ? -19.671 8.454   -5.669  1.00 0.00 ? 48  ARG A HG3  3  
ATOM 3585  H HD2  . ARG A 1 48  ? -21.869 9.014   -6.075  1.00 0.00 ? 48  ARG A HD2  3  
ATOM 3586  H HD3  . ARG A 1 48  ? -21.100 9.469   -7.595  1.00 0.00 ? 48  ARG A HD3  3  
ATOM 3587  H HE   . ARG A 1 48  ? -22.068 6.789   -7.652  1.00 0.00 ? 48  ARG A HE   3  
ATOM 3588  H HH11 . ARG A 1 48  ? -23.036 10.121  -7.931  1.00 0.00 ? 48  ARG A HH11 3  
ATOM 3589  H HH12 . ARG A 1 48  ? -24.416 9.773   -8.919  1.00 0.00 ? 48  ARG A HH12 3  
ATOM 3590  H HH21 . ARG A 1 48  ? -23.882 6.318   -8.952  1.00 0.00 ? 48  ARG A HH21 3  
ATOM 3591  H HH22 . ARG A 1 48  ? -24.897 7.609   -9.498  1.00 0.00 ? 48  ARG A HH22 3  
ATOM 3592  N N    . GLU A 1 49  ? -19.250 10.920  -6.451  1.00 0.00 ? 49  GLU A N    3  
ATOM 3593  C CA   . GLU A 1 49  ? -20.031 12.144  -6.320  1.00 0.00 ? 49  GLU A CA   3  
ATOM 3594  C C    . GLU A 1 49  ? -19.144 13.376  -6.475  1.00 0.00 ? 49  GLU A C    3  
ATOM 3595  O O    . GLU A 1 49  ? -19.368 14.212  -7.351  1.00 0.00 ? 49  GLU A O    3  
ATOM 3596  C CB   . GLU A 1 49  ? -20.741 12.180  -4.965  1.00 0.00 ? 49  GLU A CB   3  
ATOM 3597  C CG   . GLU A 1 49  ? -21.856 13.210  -4.889  1.00 0.00 ? 49  GLU A CG   3  
ATOM 3598  C CD   . GLU A 1 49  ? -21.352 14.587  -4.503  1.00 0.00 ? 49  GLU A CD   3  
ATOM 3599  O OE1  . GLU A 1 49  ? -20.970 15.356  -5.410  1.00 0.00 ? 49  GLU A OE1  3  
ATOM 3600  O OE2  . GLU A 1 49  ? -21.340 14.896  -3.293  1.00 0.00 ? 49  GLU A OE2  3  
ATOM 3601  H H    . GLU A 1 49  ? -18.940 10.462  -5.642  1.00 0.00 ? 49  GLU A H    3  
ATOM 3602  H HA   . GLU A 1 49  ? -20.773 12.149  -7.105  1.00 0.00 ? 49  GLU A HA   3  
ATOM 3603  H HB2  . GLU A 1 49  ? -21.164 11.206  -4.768  1.00 0.00 ? 49  GLU A HB2  3  
ATOM 3604  H HB3  . GLU A 1 49  ? -20.015 12.409  -4.199  1.00 0.00 ? 49  GLU A HB3  3  
ATOM 3605  H HG2  . GLU A 1 49  ? -22.334 13.276  -5.855  1.00 0.00 ? 49  GLU A HG2  3  
ATOM 3606  H HG3  . GLU A 1 49  ? -22.577 12.887  -4.153  1.00 0.00 ? 49  GLU A HG3  3  
ATOM 3607  N N    . THR A 1 50  ? -18.134 13.482  -5.616  1.00 0.00 ? 50  THR A N    3  
ATOM 3608  C CA   . THR A 1 50  ? -17.213 14.611  -5.655  1.00 0.00 ? 50  THR A CA   3  
ATOM 3609  C C    . THR A 1 50  ? -16.207 14.461  -6.790  1.00 0.00 ? 50  THR A C    3  
ATOM 3610  O O    . THR A 1 50  ? -15.765 15.449  -7.375  1.00 0.00 ? 50  THR A O    3  
ATOM 3611  C CB   . THR A 1 50  ? -16.451 14.760  -4.325  1.00 0.00 ? 50  THR A CB   3  
ATOM 3612  O OG1  . THR A 1 50  ? -15.739 13.553  -4.031  1.00 0.00 ? 50  THR A OG1  3  
ATOM 3613  C CG2  . THR A 1 50  ? -17.407 15.080  -3.186  1.00 0.00 ? 50  THR A CG2  3  
ATOM 3614  H H    . THR A 1 50  ? -18.007 12.783  -4.941  1.00 0.00 ? 50  THR A H    3  
ATOM 3615  H HA   . THR A 1 50  ? -17.793 15.508  -5.816  1.00 0.00 ? 50  THR A HA   3  
ATOM 3616  H HB   . THR A 1 50  ? -15.744 15.571  -4.421  1.00 0.00 ? 50  THR A HB   3  
ATOM 3617  H HG1  . THR A 1 50  ? -15.595 13.489  -3.083  1.00 0.00 ? 50  THR A HG1  3  
ATOM 3618  H HG21 . THR A 1 50  ? -17.837 16.059  -3.341  1.00 0.00 ? 50  THR A HG21 3  
ATOM 3619  H HG22 . THR A 1 50  ? -16.869 15.068  -2.250  1.00 0.00 ? 50  THR A HG22 3  
ATOM 3620  H HG23 . THR A 1 50  ? -18.194 14.342  -3.159  1.00 0.00 ? 50  THR A HG23 3  
ATOM 3621  N N    . GLY A 1 51  ? -15.849 13.218  -7.098  1.00 0.00 ? 51  GLY A N    3  
ATOM 3622  C CA   . GLY A 1 51  ? -14.897 12.962  -8.163  1.00 0.00 ? 51  GLY A CA   3  
ATOM 3623  C C    . GLY A 1 51  ? -13.506 13.464  -7.830  1.00 0.00 ? 51  GLY A C    3  
ATOM 3624  O O    . GLY A 1 51  ? -12.852 14.096  -8.660  1.00 0.00 ? 51  GLY A O    3  
ATOM 3625  H H    . GLY A 1 51  ? -16.234 12.469  -6.597  1.00 0.00 ? 51  GLY A H    3  
ATOM 3626  H HA2  . GLY A 1 51  ? -14.852 11.898  -8.342  1.00 0.00 ? 51  GLY A HA2  3  
ATOM 3627  H HA3  . GLY A 1 51  ? -15.239 13.454  -9.061  1.00 0.00 ? 51  GLY A HA3  3  
ATOM 3628  N N    . SER A 1 52  ? -13.053 13.183  -6.613  1.00 0.00 ? 52  SER A N    3  
ATOM 3629  C CA   . SER A 1 52  ? -11.732 13.615  -6.170  1.00 0.00 ? 52  SER A CA   3  
ATOM 3630  C C    . SER A 1 52  ? -11.032 12.508  -5.388  1.00 0.00 ? 52  SER A C    3  
ATOM 3631  O O    . SER A 1 52  ? -11.669 11.562  -4.924  1.00 0.00 ? 52  SER A O    3  
ATOM 3632  C CB   . SER A 1 52  ? -11.846 14.872  -5.306  1.00 0.00 ? 52  SER A CB   3  
ATOM 3633  O OG   . SER A 1 52  ? -10.636 15.609  -5.315  1.00 0.00 ? 52  SER A OG   3  
ATOM 3634  H H    . SER A 1 52  ? -13.621 12.675  -5.996  1.00 0.00 ? 52  SER A H    3  
ATOM 3635  H HA   . SER A 1 52  ? -11.147 13.844  -7.048  1.00 0.00 ? 52  SER A HA   3  
ATOM 3636  H HB2  . SER A 1 52  ? -12.638 15.498  -5.688  1.00 0.00 ? 52  SER A HB2  3  
ATOM 3637  H HB3  . SER A 1 52  ? -12.073 14.586  -4.288  1.00 0.00 ? 52  SER A HB3  3  
ATOM 3638  H HG   . SER A 1 52  ? -10.241 15.587  -4.440  1.00 0.00 ? 52  SER A HG   3  
ATOM 3639  N N    . SER A 1 53  ? -9.716  12.633  -5.246  1.00 0.00 ? 53  SER A N    3  
ATOM 3640  C CA   . SER A 1 53  ? -8.928  11.642  -4.524  1.00 0.00 ? 53  SER A CA   3  
ATOM 3641  C C    . SER A 1 53  ? -9.497  11.407  -3.128  1.00 0.00 ? 53  SER A C    3  
ATOM 3642  O O    . SER A 1 53  ? -9.382  12.258  -2.246  1.00 0.00 ? 53  SER A O    3  
ATOM 3643  C CB   . SER A 1 53  ? -7.470  12.094  -4.424  1.00 0.00 ? 53  SER A CB   3  
ATOM 3644  O OG   . SER A 1 53  ? -6.829  11.504  -3.306  1.00 0.00 ? 53  SER A OG   3  
ATOM 3645  H H    . SER A 1 53  ? -9.265  13.409  -5.640  1.00 0.00 ? 53  SER A H    3  
ATOM 3646  H HA   . SER A 1 53  ? -8.971  10.716  -5.078  1.00 0.00 ? 53  SER A HA   3  
ATOM 3647  H HB2  . SER A 1 53  ? -6.943  11.804  -5.320  1.00 0.00 ? 53  SER A HB2  3  
ATOM 3648  H HB3  . SER A 1 53  ? -7.436  13.168  -4.317  1.00 0.00 ? 53  SER A HB3  3  
ATOM 3649  H HG   . SER A 1 53  ? -5.952  11.205  -3.560  1.00 0.00 ? 53  SER A HG   3  
ATOM 3650  N N    . LYS A 1 54  ? -10.112 10.245  -2.935  1.00 0.00 ? 54  LYS A N    3  
ATOM 3651  C CA   . LYS A 1 54  ? -10.699 9.895   -1.647  1.00 0.00 ? 54  LYS A CA   3  
ATOM 3652  C C    . LYS A 1 54  ? -9.673  10.033  -0.526  1.00 0.00 ? 54  LYS A C    3  
ATOM 3653  O O    . LYS A 1 54  ? -9.992  10.503  0.566   1.00 0.00 ? 54  LYS A O    3  
ATOM 3654  C CB   . LYS A 1 54  ? -11.241 8.464   -1.682  1.00 0.00 ? 54  LYS A CB   3  
ATOM 3655  C CG   . LYS A 1 54  ? -12.474 8.303   -2.554  1.00 0.00 ? 54  LYS A CG   3  
ATOM 3656  C CD   . LYS A 1 54  ? -13.350 7.157   -2.075  1.00 0.00 ? 54  LYS A CD   3  
ATOM 3657  C CE   . LYS A 1 54  ? -12.965 5.845   -2.742  1.00 0.00 ? 54  LYS A CE   3  
ATOM 3658  N NZ   . LYS A 1 54  ? -14.015 4.804   -2.565  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 3659  H H    . LYS A 1 54  ? -10.171 9.607   -3.677  1.00 0.00 ? 54  LYS A H    3  
ATOM 3660  H HA   . LYS A 1 54  ? -11.515 10.576  -1.458  1.00 0.00 ? 54  LYS A HA   3  
ATOM 3661  H HB2  . LYS A 1 54  ? -10.470 7.809   -2.060  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 3662  H HB3  . LYS A 1 54  ? -11.495 8.163   -0.676  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 3663  H HG2  . LYS A 1 54  ? -13.048 9.217   -2.524  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 3664  H HG3  . LYS A 1 54  ? -12.162 8.105   -3.570  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 3665  H HD2  . LYS A 1 54  ? -13.236 7.051   -1.007  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 3666  H HD3  . LYS A 1 54  ? -14.381 7.381   -2.309  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 3667  H HE2  . LYS A 1 54  ? -12.820 6.022   -3.797  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 3668  H HE3  . LYS A 1 54  ? -12.043 5.491   -2.306  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 3669  H HZ1  . LYS A 1 54  ? -13.804 3.979   -3.163  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 3670  H HZ2  . LYS A 1 54  ? -14.945 5.185   -2.836  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 3671  H HZ3  . LYS A 1 54  ? -14.053 4.499   -1.572  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 3672  N N    . GLY A 1 55  ? -8.440  9.622   -0.804  1.00 0.00 ? 55  GLY A N    3  
ATOM 3673  C CA   . GLY A 1 55  ? -7.387  9.710   0.191   1.00 0.00 ? 55  GLY A CA   3  
ATOM 3674  C C    . GLY A 1 55  ? -6.624  8.409   0.345   1.00 0.00 ? 55  GLY A C    3  
ATOM 3675  O O    . GLY A 1 55  ? -6.086  8.119   1.413   1.00 0.00 ? 55  GLY A O    3  
ATOM 3676  H H    . GLY A 1 55  ? -8.243  9.256   -1.691  1.00 0.00 ? 55  GLY A H    3  
ATOM 3677  H HA2  . GLY A 1 55  ? -6.697  10.488  -0.099  1.00 0.00 ? 55  GLY A HA2  3  
ATOM 3678  H HA3  . GLY A 1 55  ? -7.827  9.970   1.143   1.00 0.00 ? 55  GLY A HA3  3  
ATOM 3679  N N    . PHE A 1 56  ? -6.578  7.622   -0.725  1.00 0.00 ? 56  PHE A N    3  
ATOM 3680  C CA   . PHE A 1 56  ? -5.878  6.343   -0.704  1.00 0.00 ? 56  PHE A CA   3  
ATOM 3681  C C    . PHE A 1 56  ? -5.847  5.717   -2.095  1.00 0.00 ? 56  PHE A C    3  
ATOM 3682  O O    . PHE A 1 56  ? -6.699  6.002   -2.935  1.00 0.00 ? 56  PHE A O    3  
ATOM 3683  C CB   . PHE A 1 56  ? -6.549  5.387   0.284   1.00 0.00 ? 56  PHE A CB   3  
ATOM 3684  C CG   . PHE A 1 56  ? -8.036  5.280   0.099   1.00 0.00 ? 56  PHE A CG   3  
ATOM 3685  C CD1  . PHE A 1 56  ? -8.879  6.269   0.580   1.00 0.00 ? 56  PHE A CD1  3  
ATOM 3686  C CD2  . PHE A 1 56  ? -8.590  4.193   -0.556  1.00 0.00 ? 56  PHE A CD2  3  
ATOM 3687  C CE1  . PHE A 1 56  ? -10.248 6.173   0.412   1.00 0.00 ? 56  PHE A CE1  3  
ATOM 3688  C CE2  . PHE A 1 56  ? -9.958  4.092   -0.727  1.00 0.00 ? 56  PHE A CE2  3  
ATOM 3689  C CZ   . PHE A 1 56  ? -10.788 5.084   -0.243  1.00 0.00 ? 56  PHE A CZ   3  
ATOM 3690  H H    . PHE A 1 56  ? -7.027  7.908   -1.549  1.00 0.00 ? 56  PHE A H    3  
ATOM 3691  H HA   . PHE A 1 56  ? -4.864  6.526   -0.382  1.00 0.00 ? 56  PHE A HA   3  
ATOM 3692  H HB2  . PHE A 1 56  ? -6.129  4.400   0.160   1.00 0.00 ? 56  PHE A HB2  3  
ATOM 3693  H HB3  . PHE A 1 56  ? -6.362  5.730   1.290   1.00 0.00 ? 56  PHE A HB3  3  
ATOM 3694  H HD1  . PHE A 1 56  ? -8.459  7.122   1.092   1.00 0.00 ? 56  PHE A HD1  3  
ATOM 3695  H HD2  . PHE A 1 56  ? -7.941  3.416   -0.936  1.00 0.00 ? 56  PHE A HD2  3  
ATOM 3696  H HE1  . PHE A 1 56  ? -10.895 6.950   0.792   1.00 0.00 ? 56  PHE A HE1  3  
ATOM 3697  H HE2  . PHE A 1 56  ? -10.376 3.239   -1.241  1.00 0.00 ? 56  PHE A HE2  3  
ATOM 3698  H HZ   . PHE A 1 56  ? -11.857 5.007   -0.376  1.00 0.00 ? 56  PHE A HZ   3  
ATOM 3699  N N    . GLY A 1 57  ? -4.856  4.862   -2.330  1.00 0.00 ? 57  GLY A N    3  
ATOM 3700  C CA   . GLY A 1 57  ? -4.731  4.209   -3.620  1.00 0.00 ? 57  GLY A CA   3  
ATOM 3701  C C    . GLY A 1 57  ? -3.967  2.902   -3.537  1.00 0.00 ? 57  GLY A C    3  
ATOM 3702  O O    . GLY A 1 57  ? -4.238  2.070   -2.671  1.00 0.00 ? 57  GLY A O    3  
ATOM 3703  H H    . GLY A 1 57  ? -4.205  4.673   -1.623  1.00 0.00 ? 57  GLY A H    3  
ATOM 3704  H HA2  . GLY A 1 57  ? -5.719  4.012   -4.009  1.00 0.00 ? 57  GLY A HA2  3  
ATOM 3705  H HA3  . GLY A 1 57  ? -4.214  4.872   -4.298  1.00 0.00 ? 57  GLY A HA3  3  
ATOM 3706  N N    . PHE A 1 58  ? -3.011  2.719   -4.441  1.00 0.00 ? 58  PHE A N    3  
ATOM 3707  C CA   . PHE A 1 58  ? -2.207  1.503   -4.468  1.00 0.00 ? 58  PHE A CA   3  
ATOM 3708  C C    . PHE A 1 58  ? -0.914  1.723   -5.249  1.00 0.00 ? 58  PHE A C    3  
ATOM 3709  O O    . PHE A 1 58  ? -0.902  2.411   -6.270  1.00 0.00 ? 58  PHE A O    3  
ATOM 3710  C CB   . PHE A 1 58  ? -3.003  0.354   -5.090  1.00 0.00 ? 58  PHE A CB   3  
ATOM 3711  C CG   . PHE A 1 58  ? -4.329  0.115   -4.427  1.00 0.00 ? 58  PHE A CG   3  
ATOM 3712  C CD1  . PHE A 1 58  ? -5.416  0.927   -4.709  1.00 0.00 ? 58  PHE A CD1  3  
ATOM 3713  C CD2  . PHE A 1 58  ? -4.489  -0.922  -3.522  1.00 0.00 ? 58  PHE A CD2  3  
ATOM 3714  C CE1  . PHE A 1 58  ? -6.637  0.710   -4.099  1.00 0.00 ? 58  PHE A CE1  3  
ATOM 3715  C CE2  . PHE A 1 58  ? -5.708  -1.144  -2.909  1.00 0.00 ? 58  PHE A CE2  3  
ATOM 3716  C CZ   . PHE A 1 58  ? -6.783  -0.327  -3.199  1.00 0.00 ? 58  PHE A CZ   3  
ATOM 3717  H H    . PHE A 1 58  ? -2.842  3.419   -5.107  1.00 0.00 ? 58  PHE A H    3  
ATOM 3718  H HA   . PHE A 1 58  ? -1.959  1.248   -3.450  1.00 0.00 ? 58  PHE A HA   3  
ATOM 3719  H HB2  . PHE A 1 58  ? -3.188  0.575   -6.131  1.00 0.00 ? 58  PHE A HB2  3  
ATOM 3720  H HB3  . PHE A 1 58  ? -2.425  -0.555  -5.017  1.00 0.00 ? 58  PHE A HB3  3  
ATOM 3721  H HD1  . PHE A 1 58  ? -5.303  1.738   -5.413  1.00 0.00 ? 58  PHE A HD1  3  
ATOM 3722  H HD2  . PHE A 1 58  ? -3.648  -1.561  -3.294  1.00 0.00 ? 58  PHE A HD2  3  
ATOM 3723  H HE1  . PHE A 1 58  ? -7.476  1.350   -4.328  1.00 0.00 ? 58  PHE A HE1  3  
ATOM 3724  H HE2  . PHE A 1 58  ? -5.819  -1.956  -2.206  1.00 0.00 ? 58  PHE A HE2  3  
ATOM 3725  H HZ   . PHE A 1 58  ? -7.736  -0.498  -2.721  1.00 0.00 ? 58  PHE A HZ   3  
ATOM 3726  N N    . VAL A 1 59  ? 0.172   1.132   -4.762  1.00 0.00 ? 59  VAL A N    3  
ATOM 3727  C CA   . VAL A 1 59  ? 1.470   1.262   -5.413  1.00 0.00 ? 59  VAL A CA   3  
ATOM 3728  C C    . VAL A 1 59  ? 1.888   -0.048  -6.072  1.00 0.00 ? 59  VAL A C    3  
ATOM 3729  O O    . VAL A 1 59  ? 2.177   -1.033  -5.391  1.00 0.00 ? 59  VAL A O    3  
ATOM 3730  C CB   . VAL A 1 59  ? 2.560   1.691   -4.413  1.00 0.00 ? 59  VAL A CB   3  
ATOM 3731  C CG1  . VAL A 1 59  ? 3.890   1.889   -5.124  1.00 0.00 ? 59  VAL A CG1  3  
ATOM 3732  C CG2  . VAL A 1 59  ? 2.143   2.959   -3.683  1.00 0.00 ? 59  VAL A CG2  3  
ATOM 3733  H H    . VAL A 1 59  ? 0.099   0.596   -3.945  1.00 0.00 ? 59  VAL A H    3  
ATOM 3734  H HA   . VAL A 1 59  ? 1.388   2.025   -6.173  1.00 0.00 ? 59  VAL A HA   3  
ATOM 3735  H HB   . VAL A 1 59  ? 2.680   0.904   -3.683  1.00 0.00 ? 59  VAL A HB   3  
ATOM 3736  H HG11 . VAL A 1 59  ? 3.861   1.394   -6.084  1.00 0.00 ? 59  VAL A HG11 3  
ATOM 3737  H HG12 . VAL A 1 59  ? 4.069   2.944   -5.266  1.00 0.00 ? 59  VAL A HG12 3  
ATOM 3738  H HG13 . VAL A 1 59  ? 4.684   1.466   -4.526  1.00 0.00 ? 59  VAL A HG13 3  
ATOM 3739  H HG21 . VAL A 1 59  ? 2.280   2.824   -2.621  1.00 0.00 ? 59  VAL A HG21 3  
ATOM 3740  H HG22 . VAL A 1 59  ? 2.749   3.787   -4.022  1.00 0.00 ? 59  VAL A HG22 3  
ATOM 3741  H HG23 . VAL A 1 59  ? 1.103   3.168   -3.888  1.00 0.00 ? 59  VAL A HG23 3  
ATOM 3742  N N    . ASP A 1 60  ? 1.919   -0.053  -7.400  1.00 0.00 ? 60  ASP A N    3  
ATOM 3743  C CA   . ASP A 1 60  ? 2.304   -1.242  -8.151  1.00 0.00 ? 60  ASP A CA   3  
ATOM 3744  C C    . ASP A 1 60  ? 3.820   -1.412  -8.161  1.00 0.00 ? 60  ASP A C    3  
ATOM 3745  O O    . ASP A 1 60  ? 4.560   -0.458  -8.401  1.00 0.00 ? 60  ASP A O    3  
ATOM 3746  C CB   . ASP A 1 60  ? 1.778   -1.157  -9.585  1.00 0.00 ? 60  ASP A CB   3  
ATOM 3747  C CG   . ASP A 1 60  ? 0.354   -1.662  -9.711  1.00 0.00 ? 60  ASP A CG   3  
ATOM 3748  O OD1  . ASP A 1 60  ? -0.567  -0.959  -9.248  1.00 0.00 ? 60  ASP A OD1  3  
ATOM 3749  O OD2  . ASP A 1 60  ? 0.162   -2.761  -10.272 1.00 0.00 ? 60  ASP A OD2  3  
ATOM 3750  H H    . ASP A 1 60  ? 1.678   0.764   -7.886  1.00 0.00 ? 60  ASP A H    3  
ATOM 3751  H HA   . ASP A 1 60  ? 1.861   -2.098  -7.666  1.00 0.00 ? 60  ASP A HA   3  
ATOM 3752  H HB2  . ASP A 1 60  ? 1.805   -0.127  -9.911  1.00 0.00 ? 60  ASP A HB2  3  
ATOM 3753  H HB3  . ASP A 1 60  ? 2.410   -1.750  -10.229 1.00 0.00 ? 60  ASP A HB3  3  
ATOM 3754  N N    . PHE A 1 61  ? 4.275   -2.632  -7.899  1.00 0.00 ? 61  PHE A N    3  
ATOM 3755  C CA   . PHE A 1 61  ? 5.703   -2.927  -7.875  1.00 0.00 ? 61  PHE A CA   3  
ATOM 3756  C C    . PHE A 1 61  ? 6.049   -4.018  -8.884  1.00 0.00 ? 61  PHE A C    3  
ATOM 3757  O O    . PHE A 1 61  ? 5.181   -4.772  -9.322  1.00 0.00 ? 61  PHE A O    3  
ATOM 3758  C CB   . PHE A 1 61  ? 6.133   -3.359  -6.472  1.00 0.00 ? 61  PHE A CB   3  
ATOM 3759  C CG   . PHE A 1 61  ? 6.357   -2.209  -5.533  1.00 0.00 ? 61  PHE A CG   3  
ATOM 3760  C CD1  . PHE A 1 61  ? 7.593   -1.588  -5.459  1.00 0.00 ? 61  PHE A CD1  3  
ATOM 3761  C CD2  . PHE A 1 61  ? 5.331   -1.748  -4.723  1.00 0.00 ? 61  PHE A CD2  3  
ATOM 3762  C CE1  . PHE A 1 61  ? 7.802   -0.528  -4.597  1.00 0.00 ? 61  PHE A CE1  3  
ATOM 3763  C CE2  . PHE A 1 61  ? 5.534   -0.689  -3.859  1.00 0.00 ? 61  PHE A CE2  3  
ATOM 3764  C CZ   . PHE A 1 61  ? 6.772   -0.079  -3.795  1.00 0.00 ? 61  PHE A CZ   3  
ATOM 3765  H H    . PHE A 1 61  ? 3.635   -3.352  -7.716  1.00 0.00 ? 61  PHE A H    3  
ATOM 3766  H HA   . PHE A 1 61  ? 6.231   -2.025  -8.143  1.00 0.00 ? 61  PHE A HA   3  
ATOM 3767  H HB2  . PHE A 1 61  ? 5.367   -3.990  -6.047  1.00 0.00 ? 61  PHE A HB2  3  
ATOM 3768  H HB3  . PHE A 1 61  ? 7.054   -3.917  -6.542  1.00 0.00 ? 61  PHE A HB3  3  
ATOM 3769  H HD1  . PHE A 1 61  ? 8.401   -1.939  -6.087  1.00 0.00 ? 61  PHE A HD1  3  
ATOM 3770  H HD2  . PHE A 1 61  ? 4.363   -2.225  -4.771  1.00 0.00 ? 61  PHE A HD2  3  
ATOM 3771  H HE1  . PHE A 1 61  ? 8.771   -0.054  -4.549  1.00 0.00 ? 61  PHE A HE1  3  
ATOM 3772  H HE2  . PHE A 1 61  ? 4.727   -0.340  -3.233  1.00 0.00 ? 61  PHE A HE2  3  
ATOM 3773  H HZ   . PHE A 1 61  ? 6.933   0.749   -3.120  1.00 0.00 ? 61  PHE A HZ   3  
ATOM 3774  N N    . ASN A 1 62  ? 7.325   -4.095  -9.249  1.00 0.00 ? 62  ASN A N    3  
ATOM 3775  C CA   . ASN A 1 62  ? 7.788   -5.093  -10.207 1.00 0.00 ? 62  ASN A CA   3  
ATOM 3776  C C    . ASN A 1 62  ? 7.697   -6.497  -9.616  1.00 0.00 ? 62  ASN A C    3  
ATOM 3777  O O    . ASN A 1 62  ? 7.597   -7.483  -10.346 1.00 0.00 ? 62  ASN A O    3  
ATOM 3778  C CB   . ASN A 1 62  ? 9.228   -4.796  -10.628 1.00 0.00 ? 62  ASN A CB   3  
ATOM 3779  C CG   . ASN A 1 62  ? 10.085  -4.327  -9.468  1.00 0.00 ? 62  ASN A CG   3  
ATOM 3780  O OD1  . ASN A 1 62  ? 10.766  -5.124  -8.822  1.00 0.00 ? 62  ASN A OD1  3  
ATOM 3781  N ND2  . ASN A 1 62  ? 10.054  -3.027  -9.198  1.00 0.00 ? 62  ASN A ND2  3  
ATOM 3782  H H    . ASN A 1 62  ? 7.971   -3.466  -8.864  1.00 0.00 ? 62  ASN A H    3  
ATOM 3783  H HA   . ASN A 1 62  ? 7.150   -5.038  -11.076 1.00 0.00 ? 62  ASN A HA   3  
ATOM 3784  H HB2  . ASN A 1 62  ? 9.670   -5.694  -11.035 1.00 0.00 ? 62  ASN A HB2  3  
ATOM 3785  H HB3  . ASN A 1 62  ? 9.225   -4.026  -11.384 1.00 0.00 ? 62  ASN A HB3  3  
ATOM 3786  H HD21 . ASN A 1 62  ? 9.488   -2.452  -9.754  1.00 0.00 ? 62  ASN A HD21 3  
ATOM 3787  H HD22 . ASN A 1 62  ? 10.599  -2.696  -8.453  1.00 0.00 ? 62  ASN A HD22 3  
ATOM 3788  N N    . SER A 1 63  ? 7.733   -6.579  -8.290  1.00 0.00 ? 63  SER A N    3  
ATOM 3789  C CA   . SER A 1 63  ? 7.658   -7.862  -7.601  1.00 0.00 ? 63  SER A CA   3  
ATOM 3790  C C    . SER A 1 63  ? 7.279   -7.670  -6.136  1.00 0.00 ? 63  SER A C    3  
ATOM 3791  O O    . SER A 1 63  ? 7.360   -6.564  -5.603  1.00 0.00 ? 63  SER A O    3  
ATOM 3792  C CB   . SER A 1 63  ? 8.996   -8.598  -7.702  1.00 0.00 ? 63  SER A CB   3  
ATOM 3793  O OG   . SER A 1 63  ? 9.134   -9.234  -8.961  1.00 0.00 ? 63  SER A OG   3  
ATOM 3794  H H    . SER A 1 63  ? 7.814   -5.757  -7.763  1.00 0.00 ? 63  SER A H    3  
ATOM 3795  H HA   . SER A 1 63  ? 6.894   -8.453  -8.084  1.00 0.00 ? 63  SER A HA   3  
ATOM 3796  H HB2  . SER A 1 63  ? 9.802   -7.891  -7.579  1.00 0.00 ? 63  SER A HB2  3  
ATOM 3797  H HB3  . SER A 1 63  ? 9.051   -9.346  -6.925  1.00 0.00 ? 63  SER A HB3  3  
ATOM 3798  H HG   . SER A 1 63  ? 9.313   -8.575  -9.635  1.00 0.00 ? 63  SER A HG   3  
ATOM 3799  N N    . GLU A 1 64  ? 6.867   -8.757  -5.491  1.00 0.00 ? 64  GLU A N    3  
ATOM 3800  C CA   . GLU A 1 64  ? 6.475   -8.709  -4.087  1.00 0.00 ? 64  GLU A CA   3  
ATOM 3801  C C    . GLU A 1 64  ? 7.665   -8.349  -3.202  1.00 0.00 ? 64  GLU A C    3  
ATOM 3802  O O    . GLU A 1 64  ? 7.540   -7.558  -2.268  1.00 0.00 ? 64  GLU A O    3  
ATOM 3803  C CB   . GLU A 1 64  ? 5.890   -10.054 -3.651  1.00 0.00 ? 64  GLU A CB   3  
ATOM 3804  C CG   . GLU A 1 64  ? 4.418   -10.217 -3.994  1.00 0.00 ? 64  GLU A CG   3  
ATOM 3805  C CD   . GLU A 1 64  ? 4.024   -11.667 -4.198  1.00 0.00 ? 64  GLU A CD   3  
ATOM 3806  O OE1  . GLU A 1 64  ? 4.917   -12.490 -4.488  1.00 0.00 ? 64  GLU A OE1  3  
ATOM 3807  O OE2  . GLU A 1 64  ? 2.821   -11.978 -4.069  1.00 0.00 ? 64  GLU A OE2  3  
ATOM 3808  H H    . GLU A 1 64  ? 6.825   -9.611  -5.970  1.00 0.00 ? 64  GLU A H    3  
ATOM 3809  H HA   . GLU A 1 64  ? 5.719   -7.946  -3.980  1.00 0.00 ? 64  GLU A HA   3  
ATOM 3810  H HB2  . GLU A 1 64  ? 6.441   -10.847 -4.135  1.00 0.00 ? 64  GLU A HB2  3  
ATOM 3811  H HB3  . GLU A 1 64  ? 6.001   -10.151 -2.582  1.00 0.00 ? 64  GLU A HB3  3  
ATOM 3812  H HG2  . GLU A 1 64  ? 3.827   -9.809  -3.188  1.00 0.00 ? 64  GLU A HG2  3  
ATOM 3813  H HG3  . GLU A 1 64  ? 4.211   -9.671  -4.902  1.00 0.00 ? 64  GLU A HG3  3  
ATOM 3814  N N    . GLU A 1 65  ? 8.818   -8.937  -3.503  1.00 0.00 ? 65  GLU A N    3  
ATOM 3815  C CA   . GLU A 1 65  ? 10.030  -8.680  -2.734  1.00 0.00 ? 65  GLU A CA   3  
ATOM 3816  C C    . GLU A 1 65  ? 10.359  -7.190  -2.720  1.00 0.00 ? 65  GLU A C    3  
ATOM 3817  O O    . GLU A 1 65  ? 10.546  -6.595  -1.658  1.00 0.00 ? 65  GLU A O    3  
ATOM 3818  C CB   . GLU A 1 65  ? 11.206  -9.468  -3.315  1.00 0.00 ? 65  GLU A CB   3  
ATOM 3819  C CG   . GLU A 1 65  ? 11.371  -10.852 -2.710  1.00 0.00 ? 65  GLU A CG   3  
ATOM 3820  C CD   . GLU A 1 65  ? 11.763  -10.805 -1.245  1.00 0.00 ? 65  GLU A CD   3  
ATOM 3821  O OE1  . GLU A 1 65  ? 12.432  -9.831  -0.842  1.00 0.00 ? 65  GLU A OE1  3  
ATOM 3822  O OE2  . GLU A 1 65  ? 11.401  -11.742 -0.504  1.00 0.00 ? 65  GLU A OE2  3  
ATOM 3823  H H    . GLU A 1 65  ? 8.855   -9.559  -4.260  1.00 0.00 ? 65  GLU A H    3  
ATOM 3824  H HA   . GLU A 1 65  ? 9.855   -9.007  -1.721  1.00 0.00 ? 65  GLU A HA   3  
ATOM 3825  H HB2  . GLU A 1 65  ? 11.060  -9.578  -4.379  1.00 0.00 ? 65  GLU A HB2  3  
ATOM 3826  H HB3  . GLU A 1 65  ? 12.116  -8.912  -3.142  1.00 0.00 ? 65  GLU A HB3  3  
ATOM 3827  H HG2  . GLU A 1 65  ? 10.435  -11.383 -2.799  1.00 0.00 ? 65  GLU A HG2  3  
ATOM 3828  H HG3  . GLU A 1 65  ? 12.137  -11.381 -3.256  1.00 0.00 ? 65  GLU A HG3  3  
ATOM 3829  N N    . ASP A 1 66  ? 10.428  -6.594  -3.905  1.00 0.00 ? 66  ASP A N    3  
ATOM 3830  C CA   . ASP A 1 66  ? 10.734  -5.174  -4.030  1.00 0.00 ? 66  ASP A CA   3  
ATOM 3831  C C    . ASP A 1 66  ? 9.685   -4.327  -3.317  1.00 0.00 ? 66  ASP A C    3  
ATOM 3832  O O    . ASP A 1 66  ? 10.006  -3.308  -2.705  1.00 0.00 ? 66  ASP A O    3  
ATOM 3833  C CB   . ASP A 1 66  ? 10.813  -4.775  -5.505  1.00 0.00 ? 66  ASP A CB   3  
ATOM 3834  C CG   . ASP A 1 66  ? 12.207  -4.942  -6.076  1.00 0.00 ? 66  ASP A CG   3  
ATOM 3835  O OD1  . ASP A 1 66  ? 12.696  -6.090  -6.121  1.00 0.00 ? 66  ASP A OD1  3  
ATOM 3836  O OD2  . ASP A 1 66  ? 12.810  -3.924  -6.478  1.00 0.00 ? 66  ASP A OD2  3  
ATOM 3837  H H    . ASP A 1 66  ? 10.269  -7.122  -4.716  1.00 0.00 ? 66  ASP A H    3  
ATOM 3838  H HA   . ASP A 1 66  ? 11.694  -4.999  -3.568  1.00 0.00 ? 66  ASP A HA   3  
ATOM 3839  H HB2  . ASP A 1 66  ? 10.134  -5.393  -6.075  1.00 0.00 ? 66  ASP A HB2  3  
ATOM 3840  H HB3  . ASP A 1 66  ? 10.522  -3.740  -5.607  1.00 0.00 ? 66  ASP A HB3  3  
ATOM 3841  N N    . ALA A 1 67  ? 8.430   -4.755  -3.400  1.00 0.00 ? 67  ALA A N    3  
ATOM 3842  C CA   . ALA A 1 67  ? 7.334   -4.038  -2.762  1.00 0.00 ? 67  ALA A CA   3  
ATOM 3843  C C    . ALA A 1 67  ? 7.515   -3.991  -1.248  1.00 0.00 ? 67  ALA A C    3  
ATOM 3844  O O    . ALA A 1 67  ? 7.175   -3.001  -0.601  1.00 0.00 ? 67  ALA A O    3  
ATOM 3845  C CB   . ALA A 1 67  ? 6.002   -4.684  -3.116  1.00 0.00 ? 67  ALA A CB   3  
ATOM 3846  H H    . ALA A 1 67  ? 8.237   -5.575  -3.902  1.00 0.00 ? 67  ALA A H    3  
ATOM 3847  H HA   . ALA A 1 67  ? 7.329   -3.027  -3.144  1.00 0.00 ? 67  ALA A HA   3  
ATOM 3848  H HB1  . ALA A 1 67  ? 5.878   -5.589  -2.540  1.00 0.00 ? 67  ALA A HB1  3  
ATOM 3849  H HB2  . ALA A 1 67  ? 5.199   -3.999  -2.889  1.00 0.00 ? 67  ALA A HB2  3  
ATOM 3850  H HB3  . ALA A 1 67  ? 5.987   -4.922  -4.169  1.00 0.00 ? 67  ALA A HB3  3  
ATOM 3851  N N    . LYS A 1 68  ? 8.052   -5.070  -0.688  1.00 0.00 ? 68  LYS A N    3  
ATOM 3852  C CA   . LYS A 1 68  ? 8.280   -5.153  0.749   1.00 0.00 ? 68  LYS A CA   3  
ATOM 3853  C C    . LYS A 1 68  ? 9.401   -4.212  1.178   1.00 0.00 ? 68  LYS A C    3  
ATOM 3854  O O    . LYS A 1 68  ? 9.215   -3.370  2.057   1.00 0.00 ? 68  LYS A O    3  
ATOM 3855  C CB   . LYS A 1 68  ? 8.625   -6.590  1.149   1.00 0.00 ? 68  LYS A CB   3  
ATOM 3856  C CG   . LYS A 1 68  ? 8.671   -6.808  2.652   1.00 0.00 ? 68  LYS A CG   3  
ATOM 3857  C CD   . LYS A 1 68  ? 9.453   -8.061  3.009   1.00 0.00 ? 68  LYS A CD   3  
ATOM 3858  C CE   . LYS A 1 68  ? 9.278   -8.428  4.475   1.00 0.00 ? 68  LYS A CE   3  
ATOM 3859  N NZ   . LYS A 1 68  ? 10.063  -7.532  5.368   1.00 0.00 ? 68  LYS A NZ   3  
ATOM 3860  H H    . LYS A 1 68  ? 8.303   -5.829  -1.257  1.00 0.00 ? 68  LYS A H    3  
ATOM 3861  H HA   . LYS A 1 68  ? 7.369   -4.859  1.247   1.00 0.00 ? 68  LYS A HA   3  
ATOM 3862  H HB2  . LYS A 1 68  ? 7.884   -7.255  0.732   1.00 0.00 ? 68  LYS A HB2  3  
ATOM 3863  H HB3  . LYS A 1 68  ? 9.593   -6.842  0.740   1.00 0.00 ? 68  LYS A HB3  3  
ATOM 3864  H HG2  . LYS A 1 68  ? 9.146   -5.957  3.116   1.00 0.00 ? 68  LYS A HG2  3  
ATOM 3865  H HG3  . LYS A 1 68  ? 7.661   -6.906  3.023   1.00 0.00 ? 68  LYS A HG3  3  
ATOM 3866  H HD2  . LYS A 1 68  ? 9.100   -8.881  2.401   1.00 0.00 ? 68  LYS A HD2  3  
ATOM 3867  H HD3  . LYS A 1 68  ? 10.502  -7.890  2.813   1.00 0.00 ? 68  LYS A HD3  3  
ATOM 3868  H HE2  . LYS A 1 68  ? 8.232   -8.350  4.730   1.00 0.00 ? 68  LYS A HE2  3  
ATOM 3869  H HE3  . LYS A 1 68  ? 9.609   -9.446  4.620   1.00 0.00 ? 68  LYS A HE3  3  
ATOM 3870  H HZ1  . LYS A 1 68  ? 9.428   -7.049  6.037   1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 3871  H HZ2  . LYS A 1 68  ? 10.563  -6.815  4.805   1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 3872  H HZ3  . LYS A 1 68  ? 10.760  -8.084  5.906   1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 3873  N N    . ALA A 1 69  ? 10.563  -4.358  0.551   1.00 0.00 ? 69  ALA A N    3  
ATOM 3874  C CA   . ALA A 1 69  ? 11.712  -3.519  0.866   1.00 0.00 ? 69  ALA A CA   3  
ATOM 3875  C C    . ALA A 1 69  ? 11.345  -2.040  0.804   1.00 0.00 ? 69  ALA A C    3  
ATOM 3876  O O    . ALA A 1 69  ? 11.947  -1.212  1.487   1.00 0.00 ? 69  ALA A O    3  
ATOM 3877  C CB   . ALA A 1 69  ? 12.862  -3.819  -0.085  1.00 0.00 ? 69  ALA A CB   3  
ATOM 3878  H H    . ALA A 1 69  ? 10.650  -5.047  -0.140  1.00 0.00 ? 69  ALA A H    3  
ATOM 3879  H HA   . ALA A 1 69  ? 12.035  -3.757  1.869   1.00 0.00 ? 69  ALA A HA   3  
ATOM 3880  H HB1  . ALA A 1 69  ? 12.466  -4.075  -1.057  1.00 0.00 ? 69  ALA A HB1  3  
ATOM 3881  H HB2  . ALA A 1 69  ? 13.495  -2.949  -0.170  1.00 0.00 ? 69  ALA A HB2  3  
ATOM 3882  H HB3  . ALA A 1 69  ? 13.438  -4.648  0.299   1.00 0.00 ? 69  ALA A HB3  3  
ATOM 3883  N N    . ALA A 1 70  ? 10.354  -1.715  -0.020  1.00 0.00 ? 70  ALA A N    3  
ATOM 3884  C CA   . ALA A 1 70  ? 9.906   -0.336  -0.170  1.00 0.00 ? 70  ALA A CA   3  
ATOM 3885  C C    . ALA A 1 70  ? 8.909   0.039   0.921   1.00 0.00 ? 70  ALA A C    3  
ATOM 3886  O O    . ALA A 1 70  ? 8.712   1.217   1.218   1.00 0.00 ? 70  ALA A O    3  
ATOM 3887  C CB   . ALA A 1 70  ? 9.290   -0.129  -1.546  1.00 0.00 ? 70  ALA A CB   3  
ATOM 3888  H H    . ALA A 1 70  ? 9.913   -2.420  -0.538  1.00 0.00 ? 70  ALA A H    3  
ATOM 3889  H HA   . ALA A 1 70  ? 10.771  0.306   -0.090  1.00 0.00 ? 70  ALA A HA   3  
ATOM 3890  H HB1  . ALA A 1 70  ? 9.847   0.629   -2.078  1.00 0.00 ? 70  ALA A HB1  3  
ATOM 3891  H HB2  . ALA A 1 70  ? 9.322   -1.055  -2.098  1.00 0.00 ? 70  ALA A HB2  3  
ATOM 3892  H HB3  . ALA A 1 70  ? 8.264   0.190   -1.436  1.00 0.00 ? 70  ALA A HB3  3  
ATOM 3893  N N    . LYS A 1 71  ? 8.281   -0.971  1.514   1.00 0.00 ? 71  LYS A N    3  
ATOM 3894  C CA   . LYS A 1 71  ? 7.303   -0.748  2.573   1.00 0.00 ? 71  LYS A CA   3  
ATOM 3895  C C    . LYS A 1 71  ? 7.992   -0.343  3.872   1.00 0.00 ? 71  LYS A C    3  
ATOM 3896  O O    . LYS A 1 71  ? 7.549   0.578   4.558   1.00 0.00 ? 71  LYS A O    3  
ATOM 3897  C CB   . LYS A 1 71  ? 6.468   -2.010  2.798   1.00 0.00 ? 71  LYS A CB   3  
ATOM 3898  C CG   . LYS A 1 71  ? 5.646   -1.976  4.075   1.00 0.00 ? 71  LYS A CG   3  
ATOM 3899  C CD   . LYS A 1 71  ? 4.486   -2.956  4.018   1.00 0.00 ? 71  LYS A CD   3  
ATOM 3900  C CE   . LYS A 1 71  ? 4.928   -4.364  4.387   1.00 0.00 ? 71  LYS A CE   3  
ATOM 3901  N NZ   . LYS A 1 71  ? 6.144   -4.780  3.634   1.00 0.00 ? 71  LYS A NZ   3  
ATOM 3902  H H    . LYS A 1 71  ? 8.480   -1.889  1.233   1.00 0.00 ? 71  LYS A H    3  
ATOM 3903  H HA   . LYS A 1 71  ? 6.652   0.053   2.259   1.00 0.00 ? 71  LYS A HA   3  
ATOM 3904  H HB2  . LYS A 1 71  ? 5.794   -2.135  1.963   1.00 0.00 ? 71  LYS A HB2  3  
ATOM 3905  H HB3  . LYS A 1 71  ? 7.131   -2.863  2.844   1.00 0.00 ? 71  LYS A HB3  3  
ATOM 3906  H HG2  . LYS A 1 71  ? 6.282   -2.236  4.908   1.00 0.00 ? 71  LYS A HG2  3  
ATOM 3907  H HG3  . LYS A 1 71  ? 5.256   -0.978  4.214   1.00 0.00 ? 71  LYS A HG3  3  
ATOM 3908  H HD2  . LYS A 1 71  ? 3.722   -2.637  4.711   1.00 0.00 ? 71  LYS A HD2  3  
ATOM 3909  H HD3  . LYS A 1 71  ? 4.084   -2.966  3.014   1.00 0.00 ? 71  LYS A HD3  3  
ATOM 3910  H HE2  . LYS A 1 71  ? 5.141   -4.395  5.444   1.00 0.00 ? 71  LYS A HE2  3  
ATOM 3911  H HE3  . LYS A 1 71  ? 4.124   -5.050  4.162   1.00 0.00 ? 71  LYS A HE3  3  
ATOM 3912  H HZ1  . LYS A 1 71  ? 6.251   -5.814  3.673   1.00 0.00 ? 71  LYS A HZ1  3  
ATOM 3913  H HZ2  . LYS A 1 71  ? 6.989   -4.339  4.050   1.00 0.00 ? 71  LYS A HZ2  3  
ATOM 3914  H HZ3  . LYS A 1 71  ? 6.066   -4.487  2.639   1.00 0.00 ? 71  LYS A HZ3  3  
ATOM 3915  N N    . GLU A 1 72  ? 9.077   -1.036  4.203   1.00 0.00 ? 72  GLU A N    3  
ATOM 3916  C CA   . GLU A 1 72  ? 9.826   -0.746  5.420   1.00 0.00 ? 72  GLU A CA   3  
ATOM 3917  C C    . GLU A 1 72  ? 10.367  0.680   5.399   1.00 0.00 ? 72  GLU A C    3  
ATOM 3918  O O    . GLU A 1 72  ? 10.507  1.317   6.443   1.00 0.00 ? 72  GLU A O    3  
ATOM 3919  C CB   . GLU A 1 72  ? 10.980  -1.738  5.583   1.00 0.00 ? 72  GLU A CB   3  
ATOM 3920  C CG   . GLU A 1 72  ? 10.540  -3.193  5.562   1.00 0.00 ? 72  GLU A CG   3  
ATOM 3921  C CD   . GLU A 1 72  ? 11.525  -4.110  6.260   1.00 0.00 ? 72  GLU A CD   3  
ATOM 3922  O OE1  . GLU A 1 72  ? 11.785  -3.898  7.462   1.00 0.00 ? 72  GLU A OE1  3  
ATOM 3923  O OE2  . GLU A 1 72  ? 12.035  -5.042  5.602   1.00 0.00 ? 72  GLU A OE2  3  
ATOM 3924  H H    . GLU A 1 72  ? 9.381   -1.759  3.615   1.00 0.00 ? 72  GLU A H    3  
ATOM 3925  H HA   . GLU A 1 72  ? 9.153   -0.851  6.257   1.00 0.00 ? 72  GLU A HA   3  
ATOM 3926  H HB2  . GLU A 1 72  ? 11.687  -1.586  4.781   1.00 0.00 ? 72  GLU A HB2  3  
ATOM 3927  H HB3  . GLU A 1 72  ? 11.472  -1.547  6.526   1.00 0.00 ? 72  GLU A HB3  3  
ATOM 3928  H HG2  . GLU A 1 72  ? 9.584   -3.273  6.057   1.00 0.00 ? 72  GLU A HG2  3  
ATOM 3929  H HG3  . GLU A 1 72  ? 10.439  -3.510  4.535   1.00 0.00 ? 72  GLU A HG3  3  
ATOM 3930  N N    . ALA A 1 73  ? 10.670  1.175   4.204   1.00 0.00 ? 73  ALA A N    3  
ATOM 3931  C CA   . ALA A 1 73  ? 11.194  2.526   4.046   1.00 0.00 ? 73  ALA A CA   3  
ATOM 3932  C C    . ALA A 1 73  ? 10.101  3.568   4.265   1.00 0.00 ? 73  ALA A C    3  
ATOM 3933  O O    . ALA A 1 73  ? 10.312  4.567   4.950   1.00 0.00 ? 73  ALA A O    3  
ATOM 3934  C CB   . ALA A 1 73  ? 11.817  2.694   2.668   1.00 0.00 ? 73  ALA A CB   3  
ATOM 3935  H H    . ALA A 1 73  ? 10.536  0.619   3.408   1.00 0.00 ? 73  ALA A H    3  
ATOM 3936  H HA   . ALA A 1 73  ? 11.969  2.672   4.785   1.00 0.00 ? 73  ALA A HA   3  
ATOM 3937  H HB1  . ALA A 1 73  ? 11.986  1.720   2.230   1.00 0.00 ? 73  ALA A HB1  3  
ATOM 3938  H HB2  . ALA A 1 73  ? 11.149  3.261   2.038   1.00 0.00 ? 73  ALA A HB2  3  
ATOM 3939  H HB3  . ALA A 1 73  ? 12.757  3.216   2.760   1.00 0.00 ? 73  ALA A HB3  3  
ATOM 3940  N N    . MET A 1 74  ? 8.934   3.326   3.677   1.00 0.00 ? 74  MET A N    3  
ATOM 3941  C CA   . MET A 1 74  ? 7.808   4.244   3.808   1.00 0.00 ? 74  MET A CA   3  
ATOM 3942  C C    . MET A 1 74  ? 6.867   3.794   4.922   1.00 0.00 ? 74  MET A C    3  
ATOM 3943  O O    . MET A 1 74  ? 5.720   4.234   4.992   1.00 0.00 ? 74  MET A O    3  
ATOM 3944  C CB   . MET A 1 74  ? 7.044   4.340   2.486   1.00 0.00 ? 74  MET A CB   3  
ATOM 3945  C CG   . MET A 1 74  ? 7.563   5.429   1.562   1.00 0.00 ? 74  MET A CG   3  
ATOM 3946  S SD   . MET A 1 74  ? 7.284   7.086   2.214   1.00 0.00 ? 74  MET A SD   3  
ATOM 3947  C CE   . MET A 1 74  ? 5.494   7.160   2.194   1.00 0.00 ? 74  MET A CE   3  
ATOM 3948  H H    . MET A 1 74  ? 8.826   2.512   3.142   1.00 0.00 ? 74  MET A H    3  
ATOM 3949  H HA   . MET A 1 74  ? 8.202   5.218   4.057   1.00 0.00 ? 74  MET A HA   3  
ATOM 3950  H HB2  . MET A 1 74  ? 7.119   3.394   1.971   1.00 0.00 ? 74  MET A HB2  3  
ATOM 3951  H HB3  . MET A 1 74  ? 6.005   4.544   2.699   1.00 0.00 ? 74  MET A HB3  3  
ATOM 3952  H HG2  . MET A 1 74  ? 8.624   5.288   1.421   1.00 0.00 ? 74  MET A HG2  3  
ATOM 3953  H HG3  . MET A 1 74  ? 7.061   5.342   0.609   1.00 0.00 ? 74  MET A HG3  3  
ATOM 3954  H HE1  . MET A 1 74  ? 5.169   8.116   2.578   1.00 0.00 ? 74  MET A HE1  3  
ATOM 3955  H HE2  . MET A 1 74  ? 5.141   7.041   1.181   1.00 0.00 ? 74  MET A HE2  3  
ATOM 3956  H HE3  . MET A 1 74  ? 5.094   6.369   2.811   1.00 0.00 ? 74  MET A HE3  3  
ATOM 3957  N N    . GLU A 1 75  ? 7.361   2.916   5.789   1.00 0.00 ? 75  GLU A N    3  
ATOM 3958  C CA   . GLU A 1 75  ? 6.562   2.407   6.898   1.00 0.00 ? 75  GLU A CA   3  
ATOM 3959  C C    . GLU A 1 75  ? 5.942   3.553   7.692   1.00 0.00 ? 75  GLU A C    3  
ATOM 3960  O O    . GLU A 1 75  ? 4.739   3.560   7.954   1.00 0.00 ? 75  GLU A O    3  
ATOM 3961  C CB   . GLU A 1 75  ? 7.423   1.540   7.819   1.00 0.00 ? 75  GLU A CB   3  
ATOM 3962  C CG   . GLU A 1 75  ? 8.619   2.273   8.402   1.00 0.00 ? 75  GLU A CG   3  
ATOM 3963  C CD   . GLU A 1 75  ? 9.523   1.363   9.212   1.00 0.00 ? 75  GLU A CD   3  
ATOM 3964  O OE1  . GLU A 1 75  ? 9.037   0.764   10.193  1.00 0.00 ? 75  GLU A OE1  3  
ATOM 3965  O OE2  . GLU A 1 75  ? 10.717  1.251   8.862   1.00 0.00 ? 75  GLU A OE2  3  
ATOM 3966  H H    . GLU A 1 75  ? 8.283   2.602   5.680   1.00 0.00 ? 75  GLU A H    3  
ATOM 3967  H HA   . GLU A 1 75  ? 5.770   1.801   6.485   1.00 0.00 ? 75  GLU A HA   3  
ATOM 3968  H HB2  . GLU A 1 75  ? 6.811   1.185   8.635   1.00 0.00 ? 75  GLU A HB2  3  
ATOM 3969  H HB3  . GLU A 1 75  ? 7.786   0.691   7.259   1.00 0.00 ? 75  GLU A HB3  3  
ATOM 3970  H HG2  . GLU A 1 75  ? 9.194   2.699   7.593   1.00 0.00 ? 75  GLU A HG2  3  
ATOM 3971  H HG3  . GLU A 1 75  ? 8.262   3.065   9.044   1.00 0.00 ? 75  GLU A HG3  3  
ATOM 3972  N N    . ASP A 1 76  ? 6.772   4.518   8.073   1.00 0.00 ? 76  ASP A N    3  
ATOM 3973  C CA   . ASP A 1 76  ? 6.306   5.669   8.837   1.00 0.00 ? 76  ASP A CA   3  
ATOM 3974  C C    . ASP A 1 76  ? 6.409   6.947   8.011   1.00 0.00 ? 76  ASP A C    3  
ATOM 3975  O O    . ASP A 1 76  ? 6.365   8.052   8.550   1.00 0.00 ? 76  ASP A O    3  
ATOM 3976  C CB   . ASP A 1 76  ? 7.115   5.814   10.127  1.00 0.00 ? 76  ASP A CB   3  
ATOM 3977  C CG   . ASP A 1 76  ? 8.559   6.193   9.864   1.00 0.00 ? 76  ASP A CG   3  
ATOM 3978  O OD1  . ASP A 1 76  ? 9.078   5.844   8.782   1.00 0.00 ? 76  ASP A OD1  3  
ATOM 3979  O OD2  . ASP A 1 76  ? 9.171   6.840   10.740  1.00 0.00 ? 76  ASP A OD2  3  
ATOM 3980  H H    . ASP A 1 76  ? 7.720   4.455   7.834   1.00 0.00 ? 76  ASP A H    3  
ATOM 3981  H HA   . ASP A 1 76  ? 5.270   5.502   9.090   1.00 0.00 ? 76  ASP A HA   3  
ATOM 3982  H HB2  . ASP A 1 76  ? 6.667   6.581   10.741  1.00 0.00 ? 76  ASP A HB2  3  
ATOM 3983  H HB3  . ASP A 1 76  ? 7.100   4.875   10.661  1.00 0.00 ? 76  ASP A HB3  3  
ATOM 3984  N N    . GLY A 1 77  ? 6.547   6.788   6.698   1.00 0.00 ? 77  GLY A N    3  
ATOM 3985  C CA   . GLY A 1 77  ? 6.656   7.938   5.819   1.00 0.00 ? 77  GLY A CA   3  
ATOM 3986  C C    . GLY A 1 77  ? 5.352   8.702   5.701   1.00 0.00 ? 77  GLY A C    3  
ATOM 3987  O O    . GLY A 1 77  ? 4.289   8.185   6.042   1.00 0.00 ? 77  GLY A O    3  
ATOM 3988  H H    . GLY A 1 77  ? 6.576   5.883   6.324   1.00 0.00 ? 77  GLY A H    3  
ATOM 3989  H HA2  . GLY A 1 77  ? 7.416   8.600   6.203   1.00 0.00 ? 77  GLY A HA2  3  
ATOM 3990  H HA3  . GLY A 1 77  ? 6.950   7.598   4.837   1.00 0.00 ? 77  GLY A HA3  3  
ATOM 3991  N N    . GLU A 1 78  ? 5.434   9.938   5.219   1.00 0.00 ? 78  GLU A N    3  
ATOM 3992  C CA   . GLU A 1 78  ? 4.251   10.776  5.060   1.00 0.00 ? 78  GLU A CA   3  
ATOM 3993  C C    . GLU A 1 78  ? 4.264   11.485  3.708   1.00 0.00 ? 78  GLU A C    3  
ATOM 3994  O O    . GLU A 1 78  ? 5.156   12.285  3.424   1.00 0.00 ? 78  GLU A O    3  
ATOM 3995  C CB   . GLU A 1 78  ? 4.174   11.807  6.188   1.00 0.00 ? 78  GLU A CB   3  
ATOM 3996  C CG   . GLU A 1 78  ? 5.470   12.568  6.408   1.00 0.00 ? 78  GLU A CG   3  
ATOM 3997  C CD   . GLU A 1 78  ? 5.346   13.637  7.476   1.00 0.00 ? 78  GLU A CD   3  
ATOM 3998  O OE1  . GLU A 1 78  ? 5.195   13.276  8.662   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 3999  O OE2  . GLU A 1 78  ? 5.399   14.834  7.125   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 4000  H H    . GLU A 1 78  ? 6.311   10.295  4.964   1.00 0.00 ? 78  GLU A H    3  
ATOM 4001  H HA   . GLU A 1 78  ? 3.383   10.136  5.109   1.00 0.00 ? 78  GLU A HA   3  
ATOM 4002  H HB2  . GLU A 1 78  ? 3.396   12.520  5.955   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 4003  H HB3  . GLU A 1 78  ? 3.919   11.298  7.106   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 4004  H HG2  . GLU A 1 78  ? 6.237   11.869  6.708   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 4005  H HG3  . GLU A 1 78  ? 5.758   13.039  5.479   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 4006  N N    . ILE A 1 79  ? 3.270   11.184  2.880   1.00 0.00 ? 79  ILE A N    3  
ATOM 4007  C CA   . ILE A 1 79  ? 3.167   11.792  1.559   1.00 0.00 ? 79  ILE A CA   3  
ATOM 4008  C C    . ILE A 1 79  ? 2.449   13.136  1.627   1.00 0.00 ? 79  ILE A C    3  
ATOM 4009  O O    . ILE A 1 79  ? 1.446   13.281  2.326   1.00 0.00 ? 79  ILE A O    3  
ATOM 4010  C CB   . ILE A 1 79  ? 2.420   10.874  0.573   1.00 0.00 ? 79  ILE A CB   3  
ATOM 4011  C CG1  . ILE A 1 79  ? 2.971   9.449   0.653   1.00 0.00 ? 79  ILE A CG1  3  
ATOM 4012  C CG2  . ILE A 1 79  ? 2.534   11.414  -0.844  1.00 0.00 ? 79  ILE A CG2  3  
ATOM 4013  C CD1  . ILE A 1 79  ? 2.395   8.519   -0.393  1.00 0.00 ? 79  ILE A CD1  3  
ATOM 4014  H H    . ILE A 1 79  ? 2.590   10.538  3.163   1.00 0.00 ? 79  ILE A H    3  
ATOM 4015  H HA   . ILE A 1 79  ? 4.168   11.949  1.185   1.00 0.00 ? 79  ILE A HA   3  
ATOM 4016  H HB   . ILE A 1 79  ? 1.376   10.864  0.846   1.00 0.00 ? 79  ILE A HB   3  
ATOM 4017  H HG12 . ILE A 1 79  ? 4.041   9.475   0.519   1.00 0.00 ? 79  ILE A HG12 3  
ATOM 4018  H HG13 . ILE A 1 79  ? 2.744   9.037   1.625   1.00 0.00 ? 79  ILE A HG13 3  
ATOM 4019  H HG21 . ILE A 1 79  ? 2.695   12.481  -0.811  1.00 0.00 ? 79  ILE A HG21 3  
ATOM 4020  H HG22 . ILE A 1 79  ? 3.367   10.941  -1.343  1.00 0.00 ? 79  ILE A HG22 3  
ATOM 4021  H HG23 . ILE A 1 79  ? 1.624   11.204  -1.385  1.00 0.00 ? 79  ILE A HG23 3  
ATOM 4022  H HD11 . ILE A 1 79  ? 3.170   7.858   -0.753  1.00 0.00 ? 79  ILE A HD11 3  
ATOM 4023  H HD12 . ILE A 1 79  ? 1.597   7.937   0.042   1.00 0.00 ? 79  ILE A HD12 3  
ATOM 4024  H HD13 . ILE A 1 79  ? 2.008   9.101   -1.217  1.00 0.00 ? 79  ILE A HD13 3  
ATOM 4025  N N    . ASP A 1 80  ? 2.970   14.116  0.897   1.00 0.00 ? 80  ASP A N    3  
ATOM 4026  C CA   . ASP A 1 80  ? 2.378   15.448  0.872   1.00 0.00 ? 80  ASP A CA   3  
ATOM 4027  C C    . ASP A 1 80  ? 2.104   15.948  2.287   1.00 0.00 ? 80  ASP A C    3  
ATOM 4028  O O    . ASP A 1 80  ? 1.005   16.411  2.590   1.00 0.00 ? 80  ASP A O    3  
ATOM 4029  C CB   . ASP A 1 80  ? 1.081   15.438  0.061   1.00 0.00 ? 80  ASP A CB   3  
ATOM 4030  C CG   . ASP A 1 80  ? 1.333   15.465  -1.434  1.00 0.00 ? 80  ASP A CG   3  
ATOM 4031  O OD1  . ASP A 1 80  ? 2.481   15.196  -1.848  1.00 0.00 ? 80  ASP A OD1  3  
ATOM 4032  O OD2  . ASP A 1 80  ? 0.383   15.755  -2.190  1.00 0.00 ? 80  ASP A OD2  3  
ATOM 4033  H H    . ASP A 1 80  ? 3.771   13.938  0.361   1.00 0.00 ? 80  ASP A H    3  
ATOM 4034  H HA   . ASP A 1 80  ? 3.083   16.115  0.398   1.00 0.00 ? 80  ASP A HA   3  
ATOM 4035  H HB2  . ASP A 1 80  ? 0.524   14.544  0.297   1.00 0.00 ? 80  ASP A HB2  3  
ATOM 4036  H HB3  . ASP A 1 80  ? 0.493   16.305  0.324   1.00 0.00 ? 80  ASP A HB3  3  
ATOM 4037  N N    . GLY A 1 81  ? 3.110   15.849  3.150   1.00 0.00 ? 81  GLY A N    3  
ATOM 4038  C CA   . GLY A 1 81  ? 2.957   16.293  4.523   1.00 0.00 ? 81  GLY A CA   3  
ATOM 4039  C C    . GLY A 1 81  ? 1.838   15.569  5.245   1.00 0.00 ? 81  GLY A C    3  
ATOM 4040  O O    . GLY A 1 81  ? 1.246   16.104  6.181   1.00 0.00 ? 81  GLY A O    3  
ATOM 4041  H H    . GLY A 1 81  ? 3.964   15.471  2.851   1.00 0.00 ? 81  GLY A H    3  
ATOM 4042  H HA2  . GLY A 1 81  ? 3.883   16.121  5.051   1.00 0.00 ? 81  GLY A HA2  3  
ATOM 4043  H HA3  . GLY A 1 81  ? 2.744   17.352  4.524   1.00 0.00 ? 81  GLY A HA3  3  
ATOM 4044  N N    . ASN A 1 82  ? 1.546   14.348  4.808   1.00 0.00 ? 82  ASN A N    3  
ATOM 4045  C CA   . ASN A 1 82  ? 0.489   13.551  5.418   1.00 0.00 ? 82  ASN A CA   3  
ATOM 4046  C C    . ASN A 1 82  ? 0.970   12.129  5.693   1.00 0.00 ? 82  ASN A C    3  
ATOM 4047  O O    . ASN A 1 82  ? 1.567   11.485  4.830   1.00 0.00 ? 82  ASN A O    3  
ATOM 4048  C CB   . ASN A 1 82  ? -0.742  13.517  4.509   1.00 0.00 ? 82  ASN A CB   3  
ATOM 4049  C CG   . ASN A 1 82  ? -1.706  14.651  4.800   1.00 0.00 ? 82  ASN A CG   3  
ATOM 4050  O OD1  . ASN A 1 82  ? -1.429  15.519  5.628   1.00 0.00 ? 82  ASN A OD1  3  
ATOM 4051  N ND2  . ASN A 1 82  ? -2.845  14.649  4.118   1.00 0.00 ? 82  ASN A ND2  3  
ATOM 4052  H H    . ASN A 1 82  ? 2.054   13.975  4.057   1.00 0.00 ? 82  ASN A H    3  
ATOM 4053  H HA   . ASN A 1 82  ? 0.221   14.016  6.354   1.00 0.00 ? 82  ASN A HA   3  
ATOM 4054  H HB2  . ASN A 1 82  ? -0.424  13.596  3.480   1.00 0.00 ? 82  ASN A HB2  3  
ATOM 4055  H HB3  . ASN A 1 82  ? -1.262  12.582  4.651   1.00 0.00 ? 82  ASN A HB3  3  
ATOM 4056  H HD21 . ASN A 1 82  ? -2.998  13.925  3.474   1.00 0.00 ? 82  ASN A HD21 3  
ATOM 4057  H HD22 . ASN A 1 82  ? -3.486  15.371  4.285   1.00 0.00 ? 82  ASN A HD22 3  
ATOM 4058  N N    . LYS A 1 83  ? 0.706   11.645  6.902   1.00 0.00 ? 83  LYS A N    3  
ATOM 4059  C CA   . LYS A 1 83  ? 1.110   10.300  7.293   1.00 0.00 ? 83  LYS A CA   3  
ATOM 4060  C C    . LYS A 1 83  ? 0.314   9.249   6.526   1.00 0.00 ? 83  LYS A C    3  
ATOM 4061  O O    . LYS A 1 83  ? -0.912  9.323   6.441   1.00 0.00 ? 83  LYS A O    3  
ATOM 4062  C CB   . LYS A 1 83  ? 0.915   10.104  8.798   1.00 0.00 ? 83  LYS A CB   3  
ATOM 4063  C CG   . LYS A 1 83  ? 1.960   10.812  9.644   1.00 0.00 ? 83  LYS A CG   3  
ATOM 4064  C CD   . LYS A 1 83  ? 1.811   10.469  11.117  1.00 0.00 ? 83  LYS A CD   3  
ATOM 4065  C CE   . LYS A 1 83  ? 3.147   10.528  11.841  1.00 0.00 ? 83  LYS A CE   3  
ATOM 4066  N NZ   . LYS A 1 83  ? 3.919   9.264   11.685  1.00 0.00 ? 83  LYS A NZ   3  
ATOM 4067  H H    . LYS A 1 83  ? 0.227   12.207  7.548   1.00 0.00 ? 83  LYS A H    3  
ATOM 4068  H HA   . LYS A 1 83  ? 2.157   10.185  7.056   1.00 0.00 ? 83  LYS A HA   3  
ATOM 4069  H HB2  . LYS A 1 83  ? -0.058  10.481  9.075   1.00 0.00 ? 83  LYS A HB2  3  
ATOM 4070  H HB3  . LYS A 1 83  ? 0.959   9.047   9.020   1.00 0.00 ? 83  LYS A HB3  3  
ATOM 4071  H HG2  . LYS A 1 83  ? 2.943   10.510  9.313   1.00 0.00 ? 83  LYS A HG2  3  
ATOM 4072  H HG3  . LYS A 1 83  ? 1.848   11.879  9.519   1.00 0.00 ? 83  LYS A HG3  3  
ATOM 4073  H HD2  . LYS A 1 83  ? 1.134   11.175  11.575  1.00 0.00 ? 83  LYS A HD2  3  
ATOM 4074  H HD3  . LYS A 1 83  ? 1.407   9.470   11.206  1.00 0.00 ? 83  LYS A HD3  3  
ATOM 4075  H HE2  . LYS A 1 83  ? 3.725   11.345  11.436  1.00 0.00 ? 83  LYS A HE2  3  
ATOM 4076  H HE3  . LYS A 1 83  ? 2.965   10.702  12.891  1.00 0.00 ? 83  LYS A HE3  3  
ATOM 4077  H HZ1  . LYS A 1 83  ? 3.379   8.585   11.111  1.00 0.00 ? 83  LYS A HZ1  3  
ATOM 4078  H HZ2  . LYS A 1 83  ? 4.104   8.842   12.617  1.00 0.00 ? 83  LYS A HZ2  3  
ATOM 4079  H HZ3  . LYS A 1 83  ? 4.827   9.455   11.216  1.00 0.00 ? 83  LYS A HZ3  3  
ATOM 4080  N N    . VAL A 1 84  ? 1.019   8.269   5.969   1.00 0.00 ? 84  VAL A N    3  
ATOM 4081  C CA   . VAL A 1 84  ? 0.378   7.201   5.211   1.00 0.00 ? 84  VAL A CA   3  
ATOM 4082  C C    . VAL A 1 84  ? 0.711   5.834   5.798   1.00 0.00 ? 84  VAL A C    3  
ATOM 4083  O O    . VAL A 1 84  ? 1.741   5.660   6.450   1.00 0.00 ? 84  VAL A O    3  
ATOM 4084  C CB   . VAL A 1 84  ? 0.804   7.230   3.731   1.00 0.00 ? 84  VAL A CB   3  
ATOM 4085  C CG1  . VAL A 1 84  ? 0.453   8.569   3.100   1.00 0.00 ? 84  VAL A CG1  3  
ATOM 4086  C CG2  . VAL A 1 84  ? 2.292   6.943   3.599   1.00 0.00 ? 84  VAL A CG2  3  
ATOM 4087  H H    . VAL A 1 84  ? 1.994   8.264   6.071   1.00 0.00 ? 84  VAL A H    3  
ATOM 4088  H HA   . VAL A 1 84  ? -0.691  7.352   5.259   1.00 0.00 ? 84  VAL A HA   3  
ATOM 4089  H HB   . VAL A 1 84  ? 0.261   6.457   3.206   1.00 0.00 ? 84  VAL A HB   3  
ATOM 4090  H HG11 . VAL A 1 84  ? 1.006   9.355   3.593   1.00 0.00 ? 84  VAL A HG11 3  
ATOM 4091  H HG12 . VAL A 1 84  ? 0.708   8.551   2.051   1.00 0.00 ? 84  VAL A HG12 3  
ATOM 4092  H HG13 . VAL A 1 84  ? -0.606  8.752   3.210   1.00 0.00 ? 84  VAL A HG13 3  
ATOM 4093  H HG21 . VAL A 1 84  ? 2.557   6.895   2.554   1.00 0.00 ? 84  VAL A HG21 3  
ATOM 4094  H HG22 . VAL A 1 84  ? 2.855   7.731   4.077   1.00 0.00 ? 84  VAL A HG22 3  
ATOM 4095  H HG23 . VAL A 1 84  ? 2.520   6.000   4.073   1.00 0.00 ? 84  VAL A HG23 3  
ATOM 4096  N N    . THR A 1 85  ? -0.167  4.865   5.561   1.00 0.00 ? 85  THR A N    3  
ATOM 4097  C CA   . THR A 1 85  ? 0.033   3.512   6.067   1.00 0.00 ? 85  THR A CA   3  
ATOM 4098  C C    . THR A 1 85  ? 0.023   2.494   4.932   1.00 0.00 ? 85  THR A C    3  
ATOM 4099  O O    . THR A 1 85  ? -0.980  2.337   4.234   1.00 0.00 ? 85  THR A O    3  
ATOM 4100  C CB   . THR A 1 85  ? -1.050  3.130   7.094   1.00 0.00 ? 85  THR A CB   3  
ATOM 4101  O OG1  . THR A 1 85  ? -0.989  4.012   8.220   1.00 0.00 ? 85  THR A OG1  3  
ATOM 4102  C CG2  . THR A 1 85  ? -0.872  1.693   7.558   1.00 0.00 ? 85  THR A CG2  3  
ATOM 4103  H H    . THR A 1 85  ? -0.969  5.065   5.035   1.00 0.00 ? 85  THR A H    3  
ATOM 4104  H HA   . THR A 1 85  ? 0.994   3.479   6.559   1.00 0.00 ? 85  THR A HA   3  
ATOM 4105  H HB   . THR A 1 85  ? -2.019  3.225   6.624   1.00 0.00 ? 85  THR A HB   3  
ATOM 4106  H HG1  . THR A 1 85  ? -1.772  4.567   8.235   1.00 0.00 ? 85  THR A HG1  3  
ATOM 4107  H HG21 . THR A 1 85  ? -1.772  1.361   8.054   1.00 0.00 ? 85  THR A HG21 3  
ATOM 4108  H HG22 . THR A 1 85  ? -0.041  1.636   8.245   1.00 0.00 ? 85  THR A HG22 3  
ATOM 4109  H HG23 . THR A 1 85  ? -0.678  1.061   6.705   1.00 0.00 ? 85  THR A HG23 3  
ATOM 4110  N N    . LEU A 1 86  ? 1.143   1.804   4.753   1.00 0.00 ? 86  LEU A N    3  
ATOM 4111  C CA   . LEU A 1 86  ? 1.263   0.799   3.702   1.00 0.00 ? 86  LEU A CA   3  
ATOM 4112  C C    . LEU A 1 86  ? 0.829   -0.573  4.209   1.00 0.00 ? 86  LEU A C    3  
ATOM 4113  O O    . LEU A 1 86  ? 1.319   -1.052  5.232   1.00 0.00 ? 86  LEU A O    3  
ATOM 4114  C CB   . LEU A 1 86  ? 2.704   0.734   3.194   1.00 0.00 ? 86  LEU A CB   3  
ATOM 4115  C CG   . LEU A 1 86  ? 3.500   2.038   3.263   1.00 0.00 ? 86  LEU A CG   3  
ATOM 4116  C CD1  . LEU A 1 86  ? 4.910   1.832   2.731   1.00 0.00 ? 86  LEU A CD1  3  
ATOM 4117  C CD2  . LEU A 1 86  ? 2.791   3.138   2.488   1.00 0.00 ? 86  LEU A CD2  3  
ATOM 4118  H H    . LEU A 1 86  ? 1.909   1.973   5.341   1.00 0.00 ? 86  LEU A H    3  
ATOM 4119  H HA   . LEU A 1 86  ? 0.616   1.091   2.889   1.00 0.00 ? 86  LEU A HA   3  
ATOM 4120  H HB2  . LEU A 1 86  ? 3.229   -0.005  3.779   1.00 0.00 ? 86  LEU A HB2  3  
ATOM 4121  H HB3  . LEU A 1 86  ? 2.675   0.418   2.160   1.00 0.00 ? 86  LEU A HB3  3  
ATOM 4122  H HG   . LEU A 1 86  ? 3.576   2.351   4.296   1.00 0.00 ? 86  LEU A HG   3  
ATOM 4123  H HD11 . LEU A 1 86  ? 5.571   1.588   3.549   1.00 0.00 ? 86  LEU A HD11 3  
ATOM 4124  H HD12 . LEU A 1 86  ? 5.249   2.738   2.251   1.00 0.00 ? 86  LEU A HD12 3  
ATOM 4125  H HD13 . LEU A 1 86  ? 4.909   1.024   2.014   1.00 0.00 ? 86  LEU A HD13 3  
ATOM 4126  H HD21 . LEU A 1 86  ? 2.387   2.730   1.573   1.00 0.00 ? 86  LEU A HD21 3  
ATOM 4127  H HD22 . LEU A 1 86  ? 3.494   3.923   2.252   1.00 0.00 ? 86  LEU A HD22 3  
ATOM 4128  H HD23 . LEU A 1 86  ? 1.988   3.541   3.087   1.00 0.00 ? 86  LEU A HD23 3  
ATOM 4129  N N    . ASP A 1 87  ? -0.092  -1.200  3.485   1.00 0.00 ? 87  ASP A N    3  
ATOM 4130  C CA   . ASP A 1 87  ? -0.591  -2.519  3.859   1.00 0.00 ? 87  ASP A CA   3  
ATOM 4131  C C    . ASP A 1 87  ? -0.820  -3.383  2.624   1.00 0.00 ? 87  ASP A C    3  
ATOM 4132  O O    . ASP A 1 87  ? -1.383  -2.925  1.630   1.00 0.00 ? 87  ASP A O    3  
ATOM 4133  C CB   . ASP A 1 87  ? -1.890  -2.389  4.655   1.00 0.00 ? 87  ASP A CB   3  
ATOM 4134  C CG   . ASP A 1 87  ? -2.112  -3.557  5.596   1.00 0.00 ? 87  ASP A CG   3  
ATOM 4135  O OD1  . ASP A 1 87  ? -2.104  -4.711  5.120   1.00 0.00 ? 87  ASP A OD1  3  
ATOM 4136  O OD2  . ASP A 1 87  ? -2.294  -3.316  6.808   1.00 0.00 ? 87  ASP A OD2  3  
ATOM 4137  H H    . ASP A 1 87  ? -0.445  -0.766  2.680   1.00 0.00 ? 87  ASP A H    3  
ATOM 4138  H HA   . ASP A 1 87  ? 0.155   -2.991  4.480   1.00 0.00 ? 87  ASP A HA   3  
ATOM 4139  H HB2  . ASP A 1 87  ? -1.858  -1.481  5.240   1.00 0.00 ? 87  ASP A HB2  3  
ATOM 4140  H HB3  . ASP A 1 87  ? -2.722  -2.340  3.968   1.00 0.00 ? 87  ASP A HB3  3  
ATOM 4141  N N    . TRP A 1 88  ? -0.380  -4.634  2.693   1.00 0.00 ? 88  TRP A N    3  
ATOM 4142  C CA   . TRP A 1 88  ? -0.537  -5.562  1.579   1.00 0.00 ? 88  TRP A CA   3  
ATOM 4143  C C    . TRP A 1 88  ? -2.005  -5.712  1.198   1.00 0.00 ? 88  TRP A C    3  
ATOM 4144  O O    . TRP A 1 88  ? -2.762  -6.412  1.870   1.00 0.00 ? 88  TRP A O    3  
ATOM 4145  C CB   . TRP A 1 88  ? 0.051   -6.928  1.940   1.00 0.00 ? 88  TRP A CB   3  
ATOM 4146  C CG   . TRP A 1 88  ? 1.526   -6.888  2.207   1.00 0.00 ? 88  TRP A CG   3  
ATOM 4147  C CD1  . TRP A 1 88  ? 2.157   -7.220  3.371   1.00 0.00 ? 88  TRP A CD1  3  
ATOM 4148  C CD2  . TRP A 1 88  ? 2.552   -6.491  1.291   1.00 0.00 ? 88  TRP A CD2  3  
ATOM 4149  N NE1  . TRP A 1 88  ? 3.514   -7.054  3.234   1.00 0.00 ? 88  TRP A NE1  3  
ATOM 4150  C CE2  . TRP A 1 88  ? 3.782   -6.609  1.967   1.00 0.00 ? 88  TRP A CE2  3  
ATOM 4151  C CE3  . TRP A 1 88  ? 2.552   -6.050  -0.035  1.00 0.00 ? 88  TRP A CE3  3  
ATOM 4152  C CZ2  . TRP A 1 88  ? 4.997   -6.299  1.361   1.00 0.00 ? 88  TRP A CZ2  3  
ATOM 4153  C CZ3  . TRP A 1 88  ? 3.758   -5.743  -0.635  1.00 0.00 ? 88  TRP A CZ3  3  
ATOM 4154  C CH2  . TRP A 1 88  ? 4.967   -5.870  0.062   1.00 0.00 ? 88  TRP A CH2  3  
ATOM 4155  H H    . TRP A 1 88  ? 0.061   -4.941  3.513   1.00 0.00 ? 88  TRP A H    3  
ATOM 4156  H HA   . TRP A 1 88  ? 0.003   -5.160  0.735   1.00 0.00 ? 88  TRP A HA   3  
ATOM 4157  H HB2  . TRP A 1 88  ? -0.438  -7.301  2.827   1.00 0.00 ? 88  TRP A HB2  3  
ATOM 4158  H HB3  . TRP A 1 88  ? -0.122  -7.613  1.123   1.00 0.00 ? 88  TRP A HB3  3  
ATOM 4159  H HD1  . TRP A 1 88  ? 1.651   -7.561  4.262   1.00 0.00 ? 88  TRP A HD1  3  
ATOM 4160  H HE1  . TRP A 1 88  ? 4.181   -7.229  3.931   1.00 0.00 ? 88  TRP A HE1  3  
ATOM 4161  H HE3  . TRP A 1 88  ? 1.631   -5.946  -0.589  1.00 0.00 ? 88  TRP A HE3  3  
ATOM 4162  H HZ2  . TRP A 1 88  ? 5.937   -6.392  1.885   1.00 0.00 ? 88  TRP A HZ2  3  
ATOM 4163  H HZ3  . TRP A 1 88  ? 3.778   -5.400  -1.659  1.00 0.00 ? 88  TRP A HZ3  3  
ATOM 4164  H HH2  . TRP A 1 88  ? 5.885   -5.619  -0.446  1.00 0.00 ? 88  TRP A HH2  3  
ATOM 4165  N N    . ALA A 1 89  ? -2.401  -5.051  0.116   1.00 0.00 ? 89  ALA A N    3  
ATOM 4166  C CA   . ALA A 1 89  ? -3.779  -5.113  -0.356  1.00 0.00 ? 89  ALA A CA   3  
ATOM 4167  C C    . ALA A 1 89  ? -4.389  -6.485  -0.090  1.00 0.00 ? 89  ALA A C    3  
ATOM 4168  O O    . ALA A 1 89  ? -4.075  -7.459  -0.774  1.00 0.00 ? 89  ALA A O    3  
ATOM 4169  C CB   . ALA A 1 89  ? -3.845  -4.782  -1.840  1.00 0.00 ? 89  ALA A CB   3  
ATOM 4170  H H    . ALA A 1 89  ? -1.751  -4.509  -0.378  1.00 0.00 ? 89  ALA A H    3  
ATOM 4171  H HA   . ALA A 1 89  ? -4.349  -4.367  0.179   1.00 0.00 ? 89  ALA A HA   3  
ATOM 4172  H HB1  . ALA A 1 89  ? -4.829  -4.407  -2.081  1.00 0.00 ? 89  ALA A HB1  3  
ATOM 4173  H HB2  . ALA A 1 89  ? -3.106  -4.031  -2.074  1.00 0.00 ? 89  ALA A HB2  3  
ATOM 4174  H HB3  . ALA A 1 89  ? -3.648  -5.674  -2.416  1.00 0.00 ? 89  ALA A HB3  3  
ATOM 4175  N N    . LYS A 1 90  ? -5.263  -6.555  0.909   1.00 0.00 ? 90  LYS A N    3  
ATOM 4176  C CA   . LYS A 1 90  ? -5.918  -7.808  1.266   1.00 0.00 ? 90  LYS A CA   3  
ATOM 4177  C C    . LYS A 1 90  ? -7.399  -7.770  0.903   1.00 0.00 ? 90  LYS A C    3  
ATOM 4178  O O    . LYS A 1 90  ? -8.083  -6.764  1.091   1.00 0.00 ? 90  LYS A O    3  
ATOM 4179  C CB   . LYS A 1 90  ? -5.756  -8.084  2.762   1.00 0.00 ? 90  LYS A CB   3  
ATOM 4180  C CG   . LYS A 1 90  ? -5.696  -9.562  3.106   1.00 0.00 ? 90  LYS A CG   3  
ATOM 4181  C CD   . LYS A 1 90  ? -4.995  -9.799  4.432   1.00 0.00 ? 90  LYS A CD   3  
ATOM 4182  C CE   . LYS A 1 90  ? -3.492  -9.948  4.249   1.00 0.00 ? 90  LYS A CE   3  
ATOM 4183  N NZ   . LYS A 1 90  ? -2.759  -9.798  5.536   1.00 0.00 ? 90  LYS A NZ   3  
ATOM 4184  H H    . LYS A 1 90  ? -5.473  -5.744  1.418   1.00 0.00 ? 90  LYS A H    3  
ATOM 4185  H HA   . LYS A 1 90  ? -5.443  -8.601  0.709   1.00 0.00 ? 90  LYS A HA   3  
ATOM 4186  H HB2  . LYS A 1 90  ? -4.843  -7.619  3.105   1.00 0.00 ? 90  LYS A HB2  3  
ATOM 4187  H HB3  . LYS A 1 90  ? -6.592  -7.647  3.290   1.00 0.00 ? 90  LYS A HB3  3  
ATOM 4188  H HG2  . LYS A 1 90  ? -6.703  -9.948  3.169   1.00 0.00 ? 90  LYS A HG2  3  
ATOM 4189  H HG3  . LYS A 1 90  ? -5.158  -10.082 2.326   1.00 0.00 ? 90  LYS A HG3  3  
ATOM 4190  H HD2  . LYS A 1 90  ? -5.184  -8.960  5.085   1.00 0.00 ? 90  LYS A HD2  3  
ATOM 4191  H HD3  . LYS A 1 90  ? -5.385  -10.702 4.880   1.00 0.00 ? 90  LYS A HD3  3  
ATOM 4192  H HE2  . LYS A 1 90  ? -3.288  -10.926 3.841   1.00 0.00 ? 90  LYS A HE2  3  
ATOM 4193  H HE3  . LYS A 1 90  ? -3.150  -9.191  3.559   1.00 0.00 ? 90  LYS A HE3  3  
ATOM 4194  H HZ1  . LYS A 1 90  ? -2.225  -10.666 5.747   1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 4195  H HZ2  . LYS A 1 90  ? -3.429  -9.620  6.311   1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 4196  H HZ3  . LYS A 1 90  ? -2.094  -9.000  5.478   1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 4197  N N    . PRO A 1 91  ? -7.908  -8.891  0.372   1.00 0.00 ? 91  PRO A N    3  
ATOM 4198  C CA   . PRO A 1 91  ? -9.314  -9.012  -0.026  1.00 0.00 ? 91  PRO A CA   3  
ATOM 4199  C C    . PRO A 1 91  ? -10.256 -9.035  1.173   1.00 0.00 ? 91  PRO A C    3  
ATOM 4200  O O    . PRO A 1 91  ? -10.157 -9.907  2.037   1.00 0.00 ? 91  PRO A O    3  
ATOM 4201  C CB   . PRO A 1 91  ? -9.359  -10.350 -0.768  1.00 0.00 ? 91  PRO A CB   3  
ATOM 4202  C CG   . PRO A 1 91  ? -8.221  -11.132 -0.208  1.00 0.00 ? 91  PRO A CG   3  
ATOM 4203  C CD   . PRO A 1 91  ? -7.150  -10.129 0.120   1.00 0.00 ? 91  PRO A CD   3  
ATOM 4204  H HA   . PRO A 1 91  ? -9.606  -8.216  -0.696  1.00 0.00 ? 91  PRO A HA   3  
ATOM 4205  H HB2  . PRO A 1 91  ? -10.305 -10.837 -0.580  1.00 0.00 ? 91  PRO A HB2  3  
ATOM 4206  H HB3  . PRO A 1 91  ? -9.239  -10.182 -1.828  1.00 0.00 ? 91  PRO A HB3  3  
ATOM 4207  H HG2  . PRO A 1 91  ? -8.536  -11.650 0.685   1.00 0.00 ? 91  PRO A HG2  3  
ATOM 4208  H HG3  . PRO A 1 91  ? -7.862  -11.836 -0.945  1.00 0.00 ? 91  PRO A HG3  3  
ATOM 4209  H HD2  . PRO A 1 91  ? -6.605  -10.433 1.001   1.00 0.00 ? 91  PRO A HD2  3  
ATOM 4210  H HD3  . PRO A 1 91  ? -6.480  -10.005 -0.718  1.00 0.00 ? 91  PRO A HD3  3  
ATOM 4211  N N    . LYS A 1 92  ? -11.170 -8.073  1.219   1.00 0.00 ? 92  LYS A N    3  
ATOM 4212  C CA   . LYS A 1 92  ? -12.133 -7.983  2.311   1.00 0.00 ? 92  LYS A CA   3  
ATOM 4213  C C    . LYS A 1 92  ? -13.521 -8.416  1.850   1.00 0.00 ? 92  LYS A C    3  
ATOM 4214  O O    . LYS A 1 92  ? -14.113 -7.796  0.968   1.00 0.00 ? 92  LYS A O    3  
ATOM 4215  C CB   . LYS A 1 92  ? -12.187 -6.553  2.855   1.00 0.00 ? 92  LYS A CB   3  
ATOM 4216  C CG   . LYS A 1 92  ? -12.658 -6.468  4.296   1.00 0.00 ? 92  LYS A CG   3  
ATOM 4217  C CD   . LYS A 1 92  ? -14.174 -6.427  4.386   1.00 0.00 ? 92  LYS A CD   3  
ATOM 4218  C CE   . LYS A 1 92  ? -14.710 -5.026  4.138   1.00 0.00 ? 92  LYS A CE   3  
ATOM 4219  N NZ   . LYS A 1 92  ? -14.548 -4.151  5.332   1.00 0.00 ? 92  LYS A NZ   3  
ATOM 4220  H H    . LYS A 1 92  ? -11.200 -7.406  0.501   1.00 0.00 ? 92  LYS A H    3  
ATOM 4221  H HA   . LYS A 1 92  ? -11.805 -8.646  3.098   1.00 0.00 ? 92  LYS A HA   3  
ATOM 4222  H HB2  . LYS A 1 92  ? -11.199 -6.120  2.794   1.00 0.00 ? 92  LYS A HB2  3  
ATOM 4223  H HB3  . LYS A 1 92  ? -12.863 -5.974  2.242   1.00 0.00 ? 92  LYS A HB3  3  
ATOM 4224  H HG2  . LYS A 1 92  ? -12.299 -7.333  4.834   1.00 0.00 ? 92  LYS A HG2  3  
ATOM 4225  H HG3  . LYS A 1 92  ? -12.255 -5.570  4.744   1.00 0.00 ? 92  LYS A HG3  3  
ATOM 4226  H HD2  . LYS A 1 92  ? -14.588 -7.095  3.645   1.00 0.00 ? 92  LYS A HD2  3  
ATOM 4227  H HD3  . LYS A 1 92  ? -14.476 -6.750  5.372   1.00 0.00 ? 92  LYS A HD3  3  
ATOM 4228  H HE2  . LYS A 1 92  ? -14.173 -4.591  3.308   1.00 0.00 ? 92  LYS A HE2  3  
ATOM 4229  H HE3  . LYS A 1 92  ? -15.759 -5.094  3.891   1.00 0.00 ? 92  LYS A HE3  3  
ATOM 4230  H HZ1  . LYS A 1 92  ? -13.830 -3.421  5.145   1.00 0.00 ? 92  LYS A HZ1  3  
ATOM 4231  H HZ2  . LYS A 1 92  ? -14.246 -4.716  6.151   1.00 0.00 ? 92  LYS A HZ2  3  
ATOM 4232  H HZ3  . LYS A 1 92  ? -15.449 -3.685  5.558   1.00 0.00 ? 92  LYS A HZ3  3  
ATOM 4233  N N    . GLY A 1 93  ? -14.034 -9.483  2.455   1.00 0.00 ? 93  GLY A N    3  
ATOM 4234  C CA   . GLY A 1 93  ? -15.349 -9.979  2.094   1.00 0.00 ? 93  GLY A CA   3  
ATOM 4235  C C    . GLY A 1 93  ? -15.298 -11.363 1.476   1.00 0.00 ? 93  GLY A C    3  
ATOM 4236  O O    . GLY A 1 93  ? -15.050 -11.506 0.280   1.00 0.00 ? 93  GLY A O    3  
ATOM 4237  H H    . GLY A 1 93  ? -13.516 -9.937  3.152   1.00 0.00 ? 93  GLY A H    3  
ATOM 4238  H HA2  . GLY A 1 93  ? -15.965 -10.014 2.980   1.00 0.00 ? 93  GLY A HA2  3  
ATOM 4239  H HA3  . GLY A 1 93  ? -15.796 -9.298  1.384   1.00 0.00 ? 93  GLY A HA3  3  
ATOM 4240  N N    . GLU A 1 94  ? -15.531 -12.383 2.295   1.00 0.00 ? 94  GLU A N    3  
ATOM 4241  C CA   . GLU A 1 94  ? -15.507 -13.762 1.822   1.00 0.00 ? 94  GLU A CA   3  
ATOM 4242  C C    . GLU A 1 94  ? -16.516 -14.617 2.584   1.00 0.00 ? 94  GLU A C    3  
ATOM 4243  O O    . GLU A 1 94  ? -16.663 -14.488 3.799   1.00 0.00 ? 94  GLU A O    3  
ATOM 4244  C CB   . GLU A 1 94  ? -14.104 -14.353 1.975   1.00 0.00 ? 94  GLU A CB   3  
ATOM 4245  C CG   . GLU A 1 94  ? -13.679 -14.547 3.421   1.00 0.00 ? 94  GLU A CG   3  
ATOM 4246  C CD   . GLU A 1 94  ? -13.300 -13.244 4.097   1.00 0.00 ? 94  GLU A CD   3  
ATOM 4247  O OE1  . GLU A 1 94  ? -14.210 -12.538 4.580   1.00 0.00 ? 94  GLU A OE1  3  
ATOM 4248  O OE2  . GLU A 1 94  ? -12.092 -12.930 4.144   1.00 0.00 ? 94  GLU A OE2  3  
ATOM 4249  H H    . GLU A 1 94  ? -15.723 -12.205 3.240   1.00 0.00 ? 94  GLU A H    3  
ATOM 4250  H HA   . GLU A 1 94  ? -15.773 -13.759 0.776   1.00 0.00 ? 94  GLU A HA   3  
ATOM 4251  H HB2  . GLU A 1 94  ? -14.074 -15.313 1.481   1.00 0.00 ? 94  GLU A HB2  3  
ATOM 4252  H HB3  . GLU A 1 94  ? -13.394 -13.692 1.500   1.00 0.00 ? 94  GLU A HB3  3  
ATOM 4253  H HG2  . GLU A 1 94  ? -14.498 -14.992 3.967   1.00 0.00 ? 94  GLU A HG2  3  
ATOM 4254  H HG3  . GLU A 1 94  ? -12.827 -15.210 3.447   1.00 0.00 ? 94  GLU A HG3  3  
ATOM 4255  N N    . GLY A 1 95  ? -17.211 -15.489 1.859   1.00 0.00 ? 95  GLY A N    3  
ATOM 4256  C CA   . GLY A 1 95  ? -18.198 -16.351 2.482   1.00 0.00 ? 95  GLY A CA   3  
ATOM 4257  C C    . GLY A 1 95  ? -17.567 -17.506 3.234   1.00 0.00 ? 95  GLY A C    3  
ATOM 4258  O O    . GLY A 1 95  ? -16.430 -17.410 3.694   1.00 0.00 ? 95  GLY A O    3  
ATOM 4259  H H    . GLY A 1 95  ? -17.052 -15.547 0.894   1.00 0.00 ? 95  GLY A H    3  
ATOM 4260  H HA2  . GLY A 1 95  ? -18.788 -15.765 3.172   1.00 0.00 ? 95  GLY A HA2  3  
ATOM 4261  H HA3  . GLY A 1 95  ? -18.848 -16.748 1.716   1.00 0.00 ? 95  GLY A HA3  3  
ATOM 4262  N N    . GLY A 1 96  ? -18.308 -18.603 3.361   1.00 0.00 ? 96  GLY A N    3  
ATOM 4263  C CA   . GLY A 1 96  ? -17.799 -19.765 4.065   1.00 0.00 ? 96  GLY A CA   3  
ATOM 4264  C C    . GLY A 1 96  ? -18.872 -20.475 4.866   1.00 0.00 ? 96  GLY A C    3  
ATOM 4265  O O    . GLY A 1 96  ? -19.237 -20.034 5.955   1.00 0.00 ? 96  GLY A O    3  
ATOM 4266  H H    . GLY A 1 96  ? -19.209 -18.623 2.974   1.00 0.00 ? 96  GLY A H    3  
ATOM 4267  H HA2  . GLY A 1 96  ? -17.385 -20.456 3.345   1.00 0.00 ? 96  GLY A HA2  3  
ATOM 4268  H HA3  . GLY A 1 96  ? -17.014 -19.449 4.738   1.00 0.00 ? 96  GLY A HA3  3  
ATOM 4269  N N    . SER A 1 97  ? -19.380 -21.577 4.325   1.00 0.00 ? 97  SER A N    3  
ATOM 4270  C CA   . SER A 1 97  ? -20.423 -22.347 4.994   1.00 0.00 ? 97  SER A CA   3  
ATOM 4271  C C    . SER A 1 97  ? -19.864 -23.071 6.215   1.00 0.00 ? 97  SER A C    3  
ATOM 4272  O O    . SER A 1 97  ? -19.502 -24.244 6.143   1.00 0.00 ? 97  SER A O    3  
ATOM 4273  C CB   . SER A 1 97  ? -21.041 -23.358 4.025   1.00 0.00 ? 97  SER A CB   3  
ATOM 4274  O OG   . SER A 1 97  ? -22.095 -24.076 4.643   1.00 0.00 ? 97  SER A OG   3  
ATOM 4275  H H    . SER A 1 97  ? -19.048 -21.879 3.453   1.00 0.00 ? 97  SER A H    3  
ATOM 4276  H HA   . SER A 1 97  ? -21.188 -21.657 5.317   1.00 0.00 ? 97  SER A HA   3  
ATOM 4277  H HB2  . SER A 1 97  ? -21.432 -22.836 3.166   1.00 0.00 ? 97  SER A HB2  3  
ATOM 4278  H HB3  . SER A 1 97  ? -20.282 -24.058 3.707   1.00 0.00 ? 97  SER A HB3  3  
ATOM 4279  H HG   . SER A 1 97  ? -22.786 -23.466 4.908   1.00 0.00 ? 97  SER A HG   3  
ATOM 4280  N N    . GLY A 1 98  ? -19.799 -22.361 7.337   1.00 0.00 ? 98  GLY A N    3  
ATOM 4281  C CA   . GLY A 1 98  ? -19.283 -22.951 8.559   1.00 0.00 ? 98  GLY A CA   3  
ATOM 4282  C C    . GLY A 1 98  ? -18.142 -23.914 8.301   1.00 0.00 ? 98  GLY A C    3  
ATOM 4283  O O    . GLY A 1 98  ? -18.227 -25.106 8.599   1.00 0.00 ? 98  GLY A O    3  
ATOM 4284  H H    . GLY A 1 98  ? -20.102 -21.429 7.336   1.00 0.00 ? 98  GLY A H    3  
ATOM 4285  H HA2  . GLY A 1 98  ? -18.935 -22.162 9.208   1.00 0.00 ? 98  GLY A HA2  3  
ATOM 4286  H HA3  . GLY A 1 98  ? -20.083 -23.484 9.053   1.00 0.00 ? 98  GLY A HA3  3  
ATOM 4287  N N    . PRO A 1 99  ? -17.043 -23.397 7.733   1.00 0.00 ? 99  PRO A N    3  
ATOM 4288  C CA   . PRO A 1 99  ? -15.858 -24.202 7.421   1.00 0.00 ? 99  PRO A CA   3  
ATOM 4289  C C    . PRO A 1 99  ? -15.117 -24.652 8.676   1.00 0.00 ? 99  PRO A C    3  
ATOM 4290  O O    . PRO A 1 99  ? -14.316 -23.905 9.237   1.00 0.00 ? 99  PRO A O    3  
ATOM 4291  C CB   . PRO A 1 99  ? -14.987 -23.249 6.599   1.00 0.00 ? 99  PRO A CB   3  
ATOM 4292  C CG   . PRO A 1 99  ? -15.405 -21.886 7.030   1.00 0.00 ? 99  PRO A CG   3  
ATOM 4293  C CD   . PRO A 1 99  ? -16.871 -21.985 7.351   1.00 0.00 ? 99  PRO A CD   3  
ATOM 4294  H HA   . PRO A 1 99  ? -16.112 -25.066 6.825   1.00 0.00 ? 99  PRO A HA   3  
ATOM 4295  H HB2  . PRO A 1 99  ? -13.945 -23.431 6.817   1.00 0.00 ? 99  PRO A HB2  3  
ATOM 4296  H HB3  . PRO A 1 99  ? -15.173 -23.404 5.546   1.00 0.00 ? 99  PRO A HB3  3  
ATOM 4297  H HG2  . PRO A 1 99  ? -14.849 -21.592 7.907   1.00 0.00 ? 99  PRO A HG2  3  
ATOM 4298  H HG3  . PRO A 1 99  ? -15.245 -21.182 6.227   1.00 0.00 ? 99  PRO A HG3  3  
ATOM 4299  H HD2  . PRO A 1 99  ? -17.122 -21.330 8.173   1.00 0.00 ? 99  PRO A HD2  3  
ATOM 4300  H HD3  . PRO A 1 99  ? -17.465 -21.746 6.481   1.00 0.00 ? 99  PRO A HD3  3  
ATOM 4301  N N    . SER A 1 100 ? -15.388 -25.879 9.110   1.00 0.00 ? 100 SER A N    3  
ATOM 4302  C CA   . SER A 1 100 ? -14.749 -26.428 10.300  1.00 0.00 ? 100 SER A CA   3  
ATOM 4303  C C    . SER A 1 100 ? -14.034 -27.736 9.978   1.00 0.00 ? 100 SER A C    3  
ATOM 4304  O O    . SER A 1 100 ? -14.612 -28.640 9.375   1.00 0.00 ? 100 SER A O    3  
ATOM 4305  C CB   . SER A 1 100 ? -15.786 -26.657 11.402  1.00 0.00 ? 100 SER A CB   3  
ATOM 4306  O OG   . SER A 1 100 ? -15.161 -26.823 12.663  1.00 0.00 ? 100 SER A OG   3  
ATOM 4307  H H    . SER A 1 100 ? -16.036 -26.427 8.619   1.00 0.00 ? 100 SER A H    3  
ATOM 4308  H HA   . SER A 1 100 ? -14.021 -25.709 10.646  1.00 0.00 ? 100 SER A HA   3  
ATOM 4309  H HB2  . SER A 1 100 ? -16.449 -25.807 11.451  1.00 0.00 ? 100 SER A HB2  3  
ATOM 4310  H HB3  . SER A 1 100 ? -16.356 -27.546 11.175  1.00 0.00 ? 100 SER A HB3  3  
ATOM 4311  H HG   . SER A 1 100 ? -14.685 -26.022 12.892  1.00 0.00 ? 100 SER A HG   3  
ATOM 4312  N N    . SER A 1 101 ? -12.773 -27.830 10.387  1.00 0.00 ? 101 SER A N    3  
ATOM 4313  C CA   . SER A 1 101 ? -11.976 -29.026 10.139  1.00 0.00 ? 101 SER A CA   3  
ATOM 4314  C C    . SER A 1 101 ? -11.906 -29.900 11.388  1.00 0.00 ? 101 SER A C    3  
ATOM 4315  O O    . SER A 1 101 ? -11.216 -29.570 12.352  1.00 0.00 ? 101 SER A O    3  
ATOM 4316  C CB   . SER A 1 101 ? -10.564 -28.641 9.693   1.00 0.00 ? 101 SER A CB   3  
ATOM 4317  O OG   . SER A 1 101 ? -10.590 -27.969 8.445   1.00 0.00 ? 101 SER A OG   3  
ATOM 4318  H H    . SER A 1 101 ? -12.367 -27.075 10.863  1.00 0.00 ? 101 SER A H    3  
ATOM 4319  H HA   . SER A 1 101 ? -12.454 -29.585 9.349   1.00 0.00 ? 101 SER A HA   3  
ATOM 4320  H HB2  . SER A 1 101 ? -10.122 -27.988 10.430  1.00 0.00 ? 101 SER A HB2  3  
ATOM 4321  H HB3  . SER A 1 101 ? -9.964  -29.534 9.596   1.00 0.00 ? 101 SER A HB3  3  
ATOM 4322  H HG   . SER A 1 101 ? -10.000 -27.212 8.476   1.00 0.00 ? 101 SER A HG   3  
ATOM 4323  N N    . GLY A 1 102 ? -12.626 -31.017 11.362  1.00 0.00 ? 102 GLY A N    3  
ATOM 4324  C CA   . GLY A 1 102 ? -12.633 -31.921 12.497  1.00 0.00 ? 102 GLY A CA   3  
ATOM 4325  C C    . GLY A 1 102 ? -13.623 -33.056 12.328  1.00 0.00 ? 102 GLY A C    3  
ATOM 4326  O O    . GLY A 1 102 ? -13.236 -34.192 12.056  1.00 0.00 ? 102 GLY A O    3  
ATOM 4327  H H    . GLY A 1 102 ? -13.158 -31.228 10.566  1.00 0.00 ? 102 GLY A H    3  
ATOM 4328  H HA2  . GLY A 1 102 ? -11.643 -32.336 12.619  1.00 0.00 ? 102 GLY A HA2  3  
ATOM 4329  H HA3  . GLY A 1 102 ? -12.890 -31.364 13.386  1.00 0.00 ? 102 GLY A HA3  3  
ATOM 4330  N N    . GLY A 1 1   ? 10.906  -19.392 23.499  1.00 0.00 ? 1   GLY A N    4  
ATOM 4331  C CA   . GLY A 1 1   ? 9.920   -18.425 23.053  1.00 0.00 ? 1   GLY A CA   4  
ATOM 4332  C C    . GLY A 1 1   ? 10.466  -17.012 23.022  1.00 0.00 ? 1   GLY A C    4  
ATOM 4333  O O    . GLY A 1 1   ? 11.650  -16.802 22.757  1.00 0.00 ? 1   GLY A O    4  
ATOM 4334  H H1   . GLY A 1 1   ? 11.859  -19.166 23.469  1.00 0.00 ? 1   GLY A H1   4  
ATOM 4335  H HA2  . GLY A 1 1   ? 9.590   -18.694 22.061  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4336  H HA3  . GLY A 1 1   ? 9.073   -18.456 23.723  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4337  N N    . SER A 1 2   ? 9.602   -16.038 23.293  1.00 0.00 ? 2   SER A N    4  
ATOM 4338  C CA   . SER A 1 2   ? 10.004  -14.637 23.289  1.00 0.00 ? 2   SER A CA   4  
ATOM 4339  C C    . SER A 1 2   ? 10.687  -14.270 21.975  1.00 0.00 ? 2   SER A C    4  
ATOM 4340  O O    . SER A 1 2   ? 11.697  -13.567 21.962  1.00 0.00 ? 2   SER A O    4  
ATOM 4341  C CB   . SER A 1 2   ? 10.944  -14.351 24.462  1.00 0.00 ? 2   SER A CB   4  
ATOM 4342  O OG   . SER A 1 2   ? 10.887  -12.986 24.840  1.00 0.00 ? 2   SER A OG   4  
ATOM 4343  H H    . SER A 1 2   ? 8.672   -16.269 23.497  1.00 0.00 ? 2   SER A H    4  
ATOM 4344  H HA   . SER A 1 2   ? 9.113   -14.036 23.398  1.00 0.00 ? 2   SER A HA   4  
ATOM 4345  H HB2  . SER A 1 2   ? 10.656  -14.958 25.307  1.00 0.00 ? 2   SER A HB2  4  
ATOM 4346  H HB3  . SER A 1 2   ? 11.957  -14.591 24.175  1.00 0.00 ? 2   SER A HB3  4  
ATOM 4347  H HG   . SER A 1 2   ? 10.006  -12.778 25.158  1.00 0.00 ? 2   SER A HG   4  
ATOM 4348  N N    . SER A 1 3   ? 10.128  -14.754 20.870  1.00 0.00 ? 3   SER A N    4  
ATOM 4349  C CA   . SER A 1 3   ? 10.684  -14.482 19.550  1.00 0.00 ? 3   SER A CA   4  
ATOM 4350  C C    . SER A 1 3   ? 9.595   -14.019 18.587  1.00 0.00 ? 3   SER A C    4  
ATOM 4351  O O    . SER A 1 3   ? 8.724   -14.795 18.197  1.00 0.00 ? 3   SER A O    4  
ATOM 4352  C CB   . SER A 1 3   ? 11.374  -15.730 18.996  1.00 0.00 ? 3   SER A CB   4  
ATOM 4353  O OG   . SER A 1 3   ? 12.295  -15.393 17.974  1.00 0.00 ? 3   SER A OG   4  
ATOM 4354  H H    . SER A 1 3   ? 9.324   -15.309 20.945  1.00 0.00 ? 3   SER A H    4  
ATOM 4355  H HA   . SER A 1 3   ? 11.415  -13.693 19.654  1.00 0.00 ? 3   SER A HA   4  
ATOM 4356  H HB2  . SER A 1 3   ? 11.905  -16.228 19.793  1.00 0.00 ? 3   SER A HB2  4  
ATOM 4357  H HB3  . SER A 1 3   ? 10.629  -16.397 18.587  1.00 0.00 ? 3   SER A HB3  4  
ATOM 4358  H HG   . SER A 1 3   ? 12.075  -14.529 17.617  1.00 0.00 ? 3   SER A HG   4  
ATOM 4359  N N    . GLY A 1 4   ? 9.652   -12.746 18.206  1.00 0.00 ? 4   GLY A N    4  
ATOM 4360  C CA   . GLY A 1 4   ? 8.666   -12.200 17.292  1.00 0.00 ? 4   GLY A CA   4  
ATOM 4361  C C    . GLY A 1 4   ? 9.276   -11.250 16.281  1.00 0.00 ? 4   GLY A C    4  
ATOM 4362  O O    . GLY A 1 4   ? 9.632   -10.120 16.617  1.00 0.00 ? 4   GLY A O    4  
ATOM 4363  H H    . GLY A 1 4   ? 10.370  -12.173 18.549  1.00 0.00 ? 4   GLY A H    4  
ATOM 4364  H HA2  . GLY A 1 4   ? 8.191   -13.014 16.764  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4365  H HA3  . GLY A 1 4   ? 7.918   -11.669 17.862  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4366  N N    . SER A 1 5   ? 9.398   -11.707 15.039  1.00 0.00 ? 5   SER A N    4  
ATOM 4367  C CA   . SER A 1 5   ? 9.974   -10.891 13.977  1.00 0.00 ? 5   SER A CA   4  
ATOM 4368  C C    . SER A 1 5   ? 8.906   -10.026 13.316  1.00 0.00 ? 5   SER A C    4  
ATOM 4369  O O    . SER A 1 5   ? 7.744   -10.419 13.221  1.00 0.00 ? 5   SER A O    4  
ATOM 4370  C CB   . SER A 1 5   ? 10.646  -11.781 12.929  1.00 0.00 ? 5   SER A CB   4  
ATOM 4371  O OG   . SER A 1 5   ? 9.706   -12.648 12.318  1.00 0.00 ? 5   SER A OG   4  
ATOM 4372  H H    . SER A 1 5   ? 9.095   -12.617 14.833  1.00 0.00 ? 5   SER A H    4  
ATOM 4373  H HA   . SER A 1 5   ? 10.719  -10.248 14.420  1.00 0.00 ? 5   SER A HA   4  
ATOM 4374  H HB2  . SER A 1 5   ? 11.093  -11.161 12.167  1.00 0.00 ? 5   SER A HB2  4  
ATOM 4375  H HB3  . SER A 1 5   ? 11.412  -12.377 13.404  1.00 0.00 ? 5   SER A HB3  4  
ATOM 4376  H HG   . SER A 1 5   ? 9.919   -12.747 11.387  1.00 0.00 ? 5   SER A HG   4  
ATOM 4377  N N    . SER A 1 6   ? 9.309   -8.843  12.862  1.00 0.00 ? 6   SER A N    4  
ATOM 4378  C CA   . SER A 1 6   ? 8.387   -7.919  12.213  1.00 0.00 ? 6   SER A CA   4  
ATOM 4379  C C    . SER A 1 6   ? 8.527   -7.986  10.696  1.00 0.00 ? 6   SER A C    4  
ATOM 4380  O O    . SER A 1 6   ? 9.135   -7.112  10.078  1.00 0.00 ? 6   SER A O    4  
ATOM 4381  C CB   . SER A 1 6   ? 8.639   -6.490  12.698  1.00 0.00 ? 6   SER A CB   4  
ATOM 4382  O OG   . SER A 1 6   ? 7.506   -5.668  12.477  1.00 0.00 ? 6   SER A OG   4  
ATOM 4383  H H    . SER A 1 6   ? 10.249  -8.586  12.967  1.00 0.00 ? 6   SER A H    4  
ATOM 4384  H HA   . SER A 1 6   ? 7.382   -8.209  12.483  1.00 0.00 ? 6   SER A HA   4  
ATOM 4385  H HB2  . SER A 1 6   ? 8.858   -6.504  13.755  1.00 0.00 ? 6   SER A HB2  4  
ATOM 4386  H HB3  . SER A 1 6   ? 9.480   -6.074  12.161  1.00 0.00 ? 6   SER A HB3  4  
ATOM 4387  H HG   . SER A 1 6   ? 6.863   -5.815  13.174  1.00 0.00 ? 6   SER A HG   4  
ATOM 4388  N N    . GLY A 1 7   ? 7.960   -9.031  10.100  1.00 0.00 ? 7   GLY A N    4  
ATOM 4389  C CA   . GLY A 1 7   ? 8.033   -9.194  8.660   1.00 0.00 ? 7   GLY A CA   4  
ATOM 4390  C C    . GLY A 1 7   ? 6.742   -8.808  7.967   1.00 0.00 ? 7   GLY A C    4  
ATOM 4391  O O    . GLY A 1 7   ? 5.940   -8.033  8.488   1.00 0.00 ? 7   GLY A O    4  
ATOM 4392  H H    . GLY A 1 7   ? 7.488   -9.696  10.644  1.00 0.00 ? 7   GLY A H    4  
ATOM 4393  H HA2  . GLY A 1 7   ? 8.833   -8.577  8.279   1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4394  H HA3  . GLY A 1 7   ? 8.253   -10.228 8.437   1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4395  N N    . PRO A 1 8   ? 6.527   -9.355  6.761   1.00 0.00 ? 8   PRO A N    4  
ATOM 4396  C CA   . PRO A 1 8   ? 5.325   -9.077  5.969   1.00 0.00 ? 8   PRO A CA   4  
ATOM 4397  C C    . PRO A 1 8   ? 4.072   -9.693  6.581   1.00 0.00 ? 8   PRO A C    4  
ATOM 4398  O O    . PRO A 1 8   ? 4.096   -10.826 7.059   1.00 0.00 ? 8   PRO A O    4  
ATOM 4399  C CB   . PRO A 1 8   ? 5.634   -9.724  4.617   1.00 0.00 ? 8   PRO A CB   4  
ATOM 4400  C CG   . PRO A 1 8   ? 6.619   -10.798 4.927   1.00 0.00 ? 8   PRO A CG   4  
ATOM 4401  C CD   . PRO A 1 8   ? 7.440   -10.287 6.079   1.00 0.00 ? 8   PRO A CD   4  
ATOM 4402  H HA   . PRO A 1 8   ? 5.174   -8.016  5.836   1.00 0.00 ? 8   PRO A HA   4  
ATOM 4403  H HB2  . PRO A 1 8   ? 4.726   -10.130 4.193   1.00 0.00 ? 8   PRO A HB2  4  
ATOM 4404  H HB3  . PRO A 1 8   ? 6.052   -8.987  3.948   1.00 0.00 ? 8   PRO A HB3  4  
ATOM 4405  H HG2  . PRO A 1 8   ? 6.100   -11.702 5.208   1.00 0.00 ? 8   PRO A HG2  4  
ATOM 4406  H HG3  . PRO A 1 8   ? 7.249   -10.978 4.069   1.00 0.00 ? 8   PRO A HG3  4  
ATOM 4407  H HD2  . PRO A 1 8   ? 7.720   -11.100 6.732   1.00 0.00 ? 8   PRO A HD2  4  
ATOM 4408  H HD3  . PRO A 1 8   ? 8.317   -9.771  5.717   1.00 0.00 ? 8   PRO A HD3  4  
ATOM 4409  N N    . ASN A 1 9   ? 2.977   -8.940  6.561   1.00 0.00 ? 9   ASN A N    4  
ATOM 4410  C CA   . ASN A 1 9   ? 1.713   -9.413  7.114   1.00 0.00 ? 9   ASN A CA   4  
ATOM 4411  C C    . ASN A 1 9   ? 0.926   -10.203 6.074   1.00 0.00 ? 9   ASN A C    4  
ATOM 4412  O O    . ASN A 1 9   ? 0.282   -9.627  5.198   1.00 0.00 ? 9   ASN A O    4  
ATOM 4413  C CB   . ASN A 1 9   ? 0.878   -8.233  7.614   1.00 0.00 ? 9   ASN A CB   4  
ATOM 4414  C CG   . ASN A 1 9   ? 1.501   -7.551  8.817   1.00 0.00 ? 9   ASN A CG   4  
ATOM 4415  O OD1  . ASN A 1 9   ? 2.611   -7.024  8.740   1.00 0.00 ? 9   ASN A OD1  4  
ATOM 4416  N ND2  . ASN A 1 9   ? 0.787   -7.559  9.937   1.00 0.00 ? 9   ASN A ND2  4  
ATOM 4417  H H    . ASN A 1 9   ? 3.020   -8.044  6.166   1.00 0.00 ? 9   ASN A H    4  
ATOM 4418  H HA   . ASN A 1 9   ? 1.939   -10.061 7.948   1.00 0.00 ? 9   ASN A HA   4  
ATOM 4419  H HB2  . ASN A 1 9   ? 0.784   -7.505  6.821   1.00 0.00 ? 9   ASN A HB2  4  
ATOM 4420  H HB3  . ASN A 1 9   ? -0.104  -8.586  7.892   1.00 0.00 ? 9   ASN A HB3  4  
ATOM 4421  H HD21 . ASN A 1 9   ? -0.089  -7.998  9.925   1.00 0.00 ? 9   ASN A HD21 4  
ATOM 4422  H HD22 . ASN A 1 9   ? 1.166   -7.125  10.730  1.00 0.00 ? 9   ASN A HD22 4  
ATOM 4423  N N    . ALA A 1 10  ? 0.983   -11.527 6.177   1.00 0.00 ? 10  ALA A N    4  
ATOM 4424  C CA   . ALA A 1 10  ? 0.273   -12.397 5.247   1.00 0.00 ? 10  ALA A CA   4  
ATOM 4425  C C    . ALA A 1 10  ? 0.143   -13.809 5.807   1.00 0.00 ? 10  ALA A C    4  
ATOM 4426  O O    . ALA A 1 10  ? 0.837   -14.178 6.755   1.00 0.00 ? 10  ALA A O    4  
ATOM 4427  C CB   . ALA A 1 10  ? 0.985   -12.424 3.903   1.00 0.00 ? 10  ALA A CB   4  
ATOM 4428  H H    . ALA A 1 10  ? 1.513   -11.928 6.897   1.00 0.00 ? 10  ALA A H    4  
ATOM 4429  H HA   . ALA A 1 10  ? -0.715  -11.988 5.096   1.00 0.00 ? 10  ALA A HA   4  
ATOM 4430  H HB1  . ALA A 1 10  ? 1.766   -11.679 3.895   1.00 0.00 ? 10  ALA A HB1  4  
ATOM 4431  H HB2  . ALA A 1 10  ? 1.417   -13.401 3.744   1.00 0.00 ? 10  ALA A HB2  4  
ATOM 4432  H HB3  . ALA A 1 10  ? 0.276   -12.211 3.116   1.00 0.00 ? 10  ALA A HB3  4  
ATOM 4433  N N    . ARG A 1 11  ? -0.752  -14.595 5.217   1.00 0.00 ? 11  ARG A N    4  
ATOM 4434  C CA   . ARG A 1 11  ? -0.975  -15.966 5.659   1.00 0.00 ? 11  ARG A CA   4  
ATOM 4435  C C    . ARG A 1 11  ? 0.109   -16.894 5.119   1.00 0.00 ? 11  ARG A C    4  
ATOM 4436  O O    . ARG A 1 11  ? 0.777   -17.593 5.881   1.00 0.00 ? 11  ARG A O    4  
ATOM 4437  C CB   . ARG A 1 11  ? -2.352  -16.454 5.204   1.00 0.00 ? 11  ARG A CB   4  
ATOM 4438  C CG   . ARG A 1 11  ? -3.462  -16.161 6.200   1.00 0.00 ? 11  ARG A CG   4  
ATOM 4439  C CD   . ARG A 1 11  ? -4.720  -16.953 5.881   1.00 0.00 ? 11  ARG A CD   4  
ATOM 4440  N NE   . ARG A 1 11  ? -5.481  -16.355 4.788   1.00 0.00 ? 11  ARG A NE   4  
ATOM 4441  C CZ   . ARG A 1 11  ? -6.570  -16.906 4.263   1.00 0.00 ? 11  ARG A CZ   4  
ATOM 4442  N NH1  . ARG A 1 11  ? -7.022  -18.062 4.729   1.00 0.00 ? 11  ARG A NH1  4  
ATOM 4443  N NH2  . ARG A 1 11  ? -7.208  -16.300 3.270   1.00 0.00 ? 11  ARG A NH2  4  
ATOM 4444  H H    . ARG A 1 11  ? -1.276  -14.243 4.467   1.00 0.00 ? 11  ARG A H    4  
ATOM 4445  H HA   . ARG A 1 11  ? -0.938  -15.977 6.738   1.00 0.00 ? 11  ARG A HA   4  
ATOM 4446  H HB2  . ARG A 1 11  ? -2.601  -15.972 4.270   1.00 0.00 ? 11  ARG A HB2  4  
ATOM 4447  H HB3  . ARG A 1 11  ? -2.309  -17.521 5.049   1.00 0.00 ? 11  ARG A HB3  4  
ATOM 4448  H HG2  . ARG A 1 11  ? -3.123  -16.427 7.191   1.00 0.00 ? 11  ARG A HG2  4  
ATOM 4449  H HG3  . ARG A 1 11  ? -3.692  -15.107 6.168   1.00 0.00 ? 11  ARG A HG3  4  
ATOM 4450  H HD2  . ARG A 1 11  ? -4.436  -17.957 5.602   1.00 0.00 ? 11  ARG A HD2  4  
ATOM 4451  H HD3  . ARG A 1 11  ? -5.341  -16.987 6.764   1.00 0.00 ? 11  ARG A HD3  4  
ATOM 4452  H HE   . ARG A 1 11  ? -5.164  -15.500 4.429   1.00 0.00 ? 11  ARG A HE   4  
ATOM 4453  H HH11 . ARG A 1 11  ? -6.544  -18.520 5.478   1.00 0.00 ? 11  ARG A HH11 4  
ATOM 4454  H HH12 . ARG A 1 11  ? -7.843  -18.474 4.332   1.00 0.00 ? 11  ARG A HH12 4  
ATOM 4455  H HH21 . ARG A 1 11  ? -6.870  -15.428 2.916   1.00 0.00 ? 11  ARG A HH21 4  
ATOM 4456  H HH22 . ARG A 1 11  ? -8.027  -16.716 2.875   1.00 0.00 ? 11  ARG A HH22 4  
ATOM 4457  N N    . SER A 1 12  ? 0.278   -16.895 3.801   1.00 0.00 ? 12  SER A N    4  
ATOM 4458  C CA   . SER A 1 12  ? 1.278   -17.740 3.159   1.00 0.00 ? 12  SER A CA   4  
ATOM 4459  C C    . SER A 1 12  ? 2.268   -16.898 2.359   1.00 0.00 ? 12  SER A C    4  
ATOM 4460  O O    . SER A 1 12  ? 3.475   -17.136 2.400   1.00 0.00 ? 12  SER A O    4  
ATOM 4461  C CB   . SER A 1 12  ? 0.601   -18.760 2.241   1.00 0.00 ? 12  SER A CB   4  
ATOM 4462  O OG   . SER A 1 12  ? -0.103  -19.733 2.992   1.00 0.00 ? 12  SER A OG   4  
ATOM 4463  H H    . SER A 1 12  ? -0.286  -16.315 3.247   1.00 0.00 ? 12  SER A H    4  
ATOM 4464  H HA   . SER A 1 12  ? 1.814   -18.266 3.934   1.00 0.00 ? 12  SER A HA   4  
ATOM 4465  H HB2  . SER A 1 12  ? -0.095  -18.251 1.592   1.00 0.00 ? 12  SER A HB2  4  
ATOM 4466  H HB3  . SER A 1 12  ? 1.352   -19.257 1.644   1.00 0.00 ? 12  SER A HB3  4  
ATOM 4467  H HG   . SER A 1 12  ? 0.514   -20.223 3.541   1.00 0.00 ? 12  SER A HG   4  
ATOM 4468  N N    . GLN A 1 13  ? 1.747   -15.914 1.633   1.00 0.00 ? 13  GLN A N    4  
ATOM 4469  C CA   . GLN A 1 13  ? 2.585   -15.037 0.823   1.00 0.00 ? 13  GLN A CA   4  
ATOM 4470  C C    . GLN A 1 13  ? 2.030   -13.617 0.806   1.00 0.00 ? 13  GLN A C    4  
ATOM 4471  O O    . GLN A 1 13  ? 0.820   -13.397 0.877   1.00 0.00 ? 13  GLN A O    4  
ATOM 4472  C CB   . GLN A 1 13  ? 2.690   -15.574 -0.605  1.00 0.00 ? 13  GLN A CB   4  
ATOM 4473  C CG   . GLN A 1 13  ? 3.399   -16.915 -0.701  1.00 0.00 ? 13  GLN A CG   4  
ATOM 4474  C CD   . GLN A 1 13  ? 3.593   -17.372 -2.133  1.00 0.00 ? 13  GLN A CD   4  
ATOM 4475  O OE1  . GLN A 1 13  ? 3.358   -16.615 -3.076  1.00 0.00 ? 13  GLN A OE1  4  
ATOM 4476  N NE2  . GLN A 1 13  ? 4.024   -18.616 -2.305  1.00 0.00 ? 13  GLN A NE2  4  
ATOM 4477  H H    . GLN A 1 13  ? 0.778   -15.775 1.642   1.00 0.00 ? 13  GLN A H    4  
ATOM 4478  H HA   . GLN A 1 13  ? 3.570   -15.020 1.265   1.00 0.00 ? 13  GLN A HA   4  
ATOM 4479  H HB2  . GLN A 1 13  ? 1.695   -15.687 -1.009  1.00 0.00 ? 13  GLN A HB2  4  
ATOM 4480  H HB3  . GLN A 1 13  ? 3.234   -14.860 -1.206  1.00 0.00 ? 13  GLN A HB3  4  
ATOM 4481  H HG2  . GLN A 1 13  ? 4.369   -16.830 -0.233  1.00 0.00 ? 13  GLN A HG2  4  
ATOM 4482  H HG3  . GLN A 1 13  ? 2.813   -17.656 -0.178  1.00 0.00 ? 13  GLN A HG3  4  
ATOM 4483  H HE21 . GLN A 1 13  ? 4.190   -19.162 -1.507  1.00 0.00 ? 13  GLN A HE21 4  
ATOM 4484  H HE22 . GLN A 1 13  ? 4.157   -18.938 -3.220  1.00 0.00 ? 13  GLN A HE22 4  
ATOM 4485  N N    . PRO A 1 14  ? 2.932   -12.629 0.710   1.00 0.00 ? 14  PRO A N    4  
ATOM 4486  C CA   . PRO A 1 14  ? 2.555   -11.213 0.681   1.00 0.00 ? 14  PRO A CA   4  
ATOM 4487  C C    . PRO A 1 14  ? 1.850   -10.827 -0.614  1.00 0.00 ? 14  PRO A C    4  
ATOM 4488  O O    . PRO A 1 14  ? 1.423   -11.691 -1.381  1.00 0.00 ? 14  PRO A O    4  
ATOM 4489  C CB   . PRO A 1 14  ? 3.897   -10.486 0.796   1.00 0.00 ? 14  PRO A CB   4  
ATOM 4490  C CG   . PRO A 1 14  ? 4.898   -11.451 0.259   1.00 0.00 ? 14  PRO A CG   4  
ATOM 4491  C CD   . PRO A 1 14  ? 4.390   -12.819 0.622   1.00 0.00 ? 14  PRO A CD   4  
ATOM 4492  H HA   . PRO A 1 14  ? 1.929   -10.952 1.522   1.00 0.00 ? 14  PRO A HA   4  
ATOM 4493  H HB2  . PRO A 1 14  ? 3.869   -9.578  0.211   1.00 0.00 ? 14  PRO A HB2  4  
ATOM 4494  H HB3  . PRO A 1 14  ? 4.095   -10.249 1.831   1.00 0.00 ? 14  PRO A HB3  4  
ATOM 4495  H HG2  . PRO A 1 14  ? 4.967   -11.349 -0.813  1.00 0.00 ? 14  PRO A HG2  4  
ATOM 4496  H HG3  . PRO A 1 14  ? 5.860   -11.276 0.717   1.00 0.00 ? 14  PRO A HG3  4  
ATOM 4497  H HD2  . PRO A 1 14  ? 4.639   -13.532 -0.151  1.00 0.00 ? 14  PRO A HD2  4  
ATOM 4498  H HD3  . PRO A 1 14  ? 4.795   -13.133 1.572   1.00 0.00 ? 14  PRO A HD3  4  
ATOM 4499  N N    . SER A 1 15  ? 1.731   -9.525  -0.853  1.00 0.00 ? 15  SER A N    4  
ATOM 4500  C CA   . SER A 1 15  ? 1.074   -9.025  -2.055  1.00 0.00 ? 15  SER A CA   4  
ATOM 4501  C C    . SER A 1 15  ? 2.022   -8.149  -2.868  1.00 0.00 ? 15  SER A C    4  
ATOM 4502  O O    . SER A 1 15  ? 2.867   -7.446  -2.313  1.00 0.00 ? 15  SER A O    4  
ATOM 4503  C CB   . SER A 1 15  ? -0.180  -8.231  -1.683  1.00 0.00 ? 15  SER A CB   4  
ATOM 4504  O OG   . SER A 1 15  ? -1.069  -8.137  -2.783  1.00 0.00 ? 15  SER A OG   4  
ATOM 4505  H H    . SER A 1 15  ? 2.092   -8.885  -0.203  1.00 0.00 ? 15  SER A H    4  
ATOM 4506  H HA   . SER A 1 15  ? 0.786   -9.876  -2.654  1.00 0.00 ? 15  SER A HA   4  
ATOM 4507  H HB2  . SER A 1 15  ? -0.687  -8.723  -0.867  1.00 0.00 ? 15  SER A HB2  4  
ATOM 4508  H HB3  . SER A 1 15  ? 0.106   -7.234  -1.380  1.00 0.00 ? 15  SER A HB3  4  
ATOM 4509  H HG   . SER A 1 15  ? -1.909  -7.779  -2.486  1.00 0.00 ? 15  SER A HG   4  
ATOM 4510  N N    . LYS A 1 16  ? 1.876   -8.197  -4.187  1.00 0.00 ? 16  LYS A N    4  
ATOM 4511  C CA   . LYS A 1 16  ? 2.718   -7.408  -5.080  1.00 0.00 ? 16  LYS A CA   4  
ATOM 4512  C C    . LYS A 1 16  ? 2.338   -5.932  -5.022  1.00 0.00 ? 16  LYS A C    4  
ATOM 4513  O O    . LYS A 1 16  ? 3.178   -5.055  -5.226  1.00 0.00 ? 16  LYS A O    4  
ATOM 4514  C CB   . LYS A 1 16  ? 2.594   -7.921  -6.516  1.00 0.00 ? 16  LYS A CB   4  
ATOM 4515  C CG   . LYS A 1 16  ? 3.135   -9.327  -6.708  1.00 0.00 ? 16  LYS A CG   4  
ATOM 4516  C CD   . LYS A 1 16  ? 3.220   -9.696  -8.180  1.00 0.00 ? 16  LYS A CD   4  
ATOM 4517  C CE   . LYS A 1 16  ? 4.125   -10.898 -8.402  1.00 0.00 ? 16  LYS A CE   4  
ATOM 4518  N NZ   . LYS A 1 16  ? 4.038   -11.407 -9.799  1.00 0.00 ? 16  LYS A NZ   4  
ATOM 4519  H H    . LYS A 1 16  ? 1.185   -8.777  -4.571  1.00 0.00 ? 16  LYS A H    4  
ATOM 4520  H HA   . LYS A 1 16  ? 3.741   -7.517  -4.754  1.00 0.00 ? 16  LYS A HA   4  
ATOM 4521  H HB2  . LYS A 1 16  ? 1.552   -7.917  -6.799  1.00 0.00 ? 16  LYS A HB2  4  
ATOM 4522  H HB3  . LYS A 1 16  ? 3.139   -7.256  -7.171  1.00 0.00 ? 16  LYS A HB3  4  
ATOM 4523  H HG2  . LYS A 1 16  ? 4.123   -9.386  -6.277  1.00 0.00 ? 16  LYS A HG2  4  
ATOM 4524  H HG3  . LYS A 1 16  ? 2.480   -10.026 -6.208  1.00 0.00 ? 16  LYS A HG3  4  
ATOM 4525  H HD2  . LYS A 1 16  ? 2.230   -9.934  -8.540  1.00 0.00 ? 16  LYS A HD2  4  
ATOM 4526  H HD3  . LYS A 1 16  ? 3.612   -8.853  -8.731  1.00 0.00 ? 16  LYS A HD3  4  
ATOM 4527  H HE2  . LYS A 1 16  ? 5.144   -10.607 -8.197  1.00 0.00 ? 16  LYS A HE2  4  
ATOM 4528  H HE3  . LYS A 1 16  ? 3.831   -11.684 -7.723  1.00 0.00 ? 16  LYS A HE3  4  
ATOM 4529  H HZ1  . LYS A 1 16  ? 3.411   -12.235 -9.839  1.00 0.00 ? 16  LYS A HZ1  4  
ATOM 4530  H HZ2  . LYS A 1 16  ? 4.982   -11.685 -10.138 1.00 0.00 ? 16  LYS A HZ2  4  
ATOM 4531  H HZ3  . LYS A 1 16  ? 3.661   -10.668 -10.426 1.00 0.00 ? 16  LYS A HZ3  4  
ATOM 4532  N N    . THR A 1 17  ? 1.067   -5.663  -4.740  1.00 0.00 ? 17  THR A N    4  
ATOM 4533  C CA   . THR A 1 17  ? 0.576   -4.293  -4.655  1.00 0.00 ? 17  THR A CA   4  
ATOM 4534  C C    . THR A 1 17  ? 0.390   -3.865  -3.204  1.00 0.00 ? 17  THR A C    4  
ATOM 4535  O O    . THR A 1 17  ? -0.243  -4.567  -2.415  1.00 0.00 ? 17  THR A O    4  
ATOM 4536  C CB   . THR A 1 17  ? -0.761  -4.128  -5.402  1.00 0.00 ? 17  THR A CB   4  
ATOM 4537  O OG1  . THR A 1 17  ? -0.732  -4.869  -6.627  1.00 0.00 ? 17  THR A OG1  4  
ATOM 4538  C CG2  . THR A 1 17  ? -1.038  -2.661  -5.697  1.00 0.00 ? 17  THR A CG2  4  
ATOM 4539  H H    . THR A 1 17  ? 0.445   -6.405  -4.588  1.00 0.00 ? 17  THR A H    4  
ATOM 4540  H HA   . THR A 1 17  ? 1.307   -3.647  -5.120  1.00 0.00 ? 17  THR A HA   4  
ATOM 4541  H HB   . THR A 1 17  ? -1.555  -4.510  -4.777  1.00 0.00 ? 17  THR A HB   4  
ATOM 4542  H HG1  . THR A 1 17  ? -0.945  -5.788  -6.450  1.00 0.00 ? 17  THR A HG1  4  
ATOM 4543  H HG21 . THR A 1 17  ? -0.772  -2.064  -4.837  1.00 0.00 ? 17  THR A HG21 4  
ATOM 4544  H HG22 . THR A 1 17  ? -2.087  -2.530  -5.917  1.00 0.00 ? 17  THR A HG22 4  
ATOM 4545  H HG23 . THR A 1 17  ? -0.450  -2.348  -6.547  1.00 0.00 ? 17  THR A HG23 4  
ATOM 4546  N N    . LEU A 1 18  ? 0.946   -2.709  -2.857  1.00 0.00 ? 18  LEU A N    4  
ATOM 4547  C CA   . LEU A 1 18  ? 0.841   -2.186  -1.499  1.00 0.00 ? 18  LEU A CA   4  
ATOM 4548  C C    . LEU A 1 18  ? -0.315  -1.197  -1.385  1.00 0.00 ? 18  LEU A C    4  
ATOM 4549  O O    . LEU A 1 18  ? -0.510  -0.351  -2.257  1.00 0.00 ? 18  LEU A O    4  
ATOM 4550  C CB   . LEU A 1 18  ? 2.150   -1.509  -1.090  1.00 0.00 ? 18  LEU A CB   4  
ATOM 4551  C CG   . LEU A 1 18  ? 3.248   -2.433  -0.562  1.00 0.00 ? 18  LEU A CG   4  
ATOM 4552  C CD1  . LEU A 1 18  ? 4.614   -1.784  -0.721  1.00 0.00 ? 18  LEU A CD1  4  
ATOM 4553  C CD2  . LEU A 1 18  ? 2.990   -2.790  0.895   1.00 0.00 ? 18  LEU A CD2  4  
ATOM 4554  H H    . LEU A 1 18  ? 1.438   -2.194  -3.530  1.00 0.00 ? 18  LEU A H    4  
ATOM 4555  H HA   . LEU A 1 18  ? 0.653   -3.019  -0.838  1.00 0.00 ? 18  LEU A HA   4  
ATOM 4556  H HB2  . LEU A 1 18  ? 2.539   -0.993  -1.954  1.00 0.00 ? 18  LEU A HB2  4  
ATOM 4557  H HB3  . LEU A 1 18  ? 1.921   -0.790  -0.316  1.00 0.00 ? 18  LEU A HB3  4  
ATOM 4558  H HG   . LEU A 1 18  ? 3.245   -3.349  -1.137  1.00 0.00 ? 18  LEU A HG   4  
ATOM 4559  H HD11 . LEU A 1 18  ? 5.057   -2.101  -1.653  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 4560  H HD12 . LEU A 1 18  ? 5.250   -2.080  0.100   1.00 0.00 ? 18  LEU A HD12 4  
ATOM 4561  H HD13 . LEU A 1 18  ? 4.504   -0.709  -0.720  1.00 0.00 ? 18  LEU A HD13 4  
ATOM 4562  H HD21 . LEU A 1 18  ? 3.677   -3.564  1.202   1.00 0.00 ? 18  LEU A HD21 4  
ATOM 4563  H HD22 . LEU A 1 18  ? 1.975   -3.144  1.005   1.00 0.00 ? 18  LEU A HD22 4  
ATOM 4564  H HD23 . LEU A 1 18  ? 3.135   -1.914  1.510   1.00 0.00 ? 18  LEU A HD23 4  
ATOM 4565  N N    . PHE A 1 19  ? -1.077  -1.309  -0.302  1.00 0.00 ? 19  PHE A N    4  
ATOM 4566  C CA   . PHE A 1 19  ? -2.213  -0.424  -0.071  1.00 0.00 ? 19  PHE A CA   4  
ATOM 4567  C C    . PHE A 1 19  ? -1.787  0.816   0.710   1.00 0.00 ? 19  PHE A C    4  
ATOM 4568  O O    . PHE A 1 19  ? -1.323  0.718   1.847   1.00 0.00 ? 19  PHE A O    4  
ATOM 4569  C CB   . PHE A 1 19  ? -3.318  -1.163  0.685   1.00 0.00 ? 19  PHE A CB   4  
ATOM 4570  C CG   . PHE A 1 19  ? -4.505  -0.301  1.006   1.00 0.00 ? 19  PHE A CG   4  
ATOM 4571  C CD1  . PHE A 1 19  ? -5.341  0.152   -0.002  1.00 0.00 ? 19  PHE A CD1  4  
ATOM 4572  C CD2  . PHE A 1 19  ? -4.786  0.055   2.315   1.00 0.00 ? 19  PHE A CD2  4  
ATOM 4573  C CE1  . PHE A 1 19  ? -6.434  0.946   0.290   1.00 0.00 ? 19  PHE A CE1  4  
ATOM 4574  C CE2  . PHE A 1 19  ? -5.878  0.849   2.613   1.00 0.00 ? 19  PHE A CE2  4  
ATOM 4575  C CZ   . PHE A 1 19  ? -6.703  1.294   1.599   1.00 0.00 ? 19  PHE A CZ   4  
ATOM 4576  H H    . PHE A 1 19  ? -0.871  -2.004  0.359   1.00 0.00 ? 19  PHE A H    4  
ATOM 4577  H HA   . PHE A 1 19  ? -2.591  -0.115  -1.034  1.00 0.00 ? 19  PHE A HA   4  
ATOM 4578  H HB2  . PHE A 1 19  ? -3.662  -1.992  0.086   1.00 0.00 ? 19  PHE A HB2  4  
ATOM 4579  H HB3  . PHE A 1 19  ? -2.918  -1.539  1.615   1.00 0.00 ? 19  PHE A HB3  4  
ATOM 4580  H HD1  . PHE A 1 19  ? -5.132  -0.120  -1.026  1.00 0.00 ? 19  PHE A HD1  4  
ATOM 4581  H HD2  . PHE A 1 19  ? -4.141  -0.293  3.109   1.00 0.00 ? 19  PHE A HD2  4  
ATOM 4582  H HE1  . PHE A 1 19  ? -7.078  1.293   -0.504  1.00 0.00 ? 19  PHE A HE1  4  
ATOM 4583  H HE2  . PHE A 1 19  ? -6.085  1.119   3.638   1.00 0.00 ? 19  PHE A HE2  4  
ATOM 4584  H HZ   . PHE A 1 19  ? -7.556  1.914   1.830   1.00 0.00 ? 19  PHE A HZ   4  
ATOM 4585  N N    . VAL A 1 20  ? -1.947  1.982   0.093   1.00 0.00 ? 20  VAL A N    4  
ATOM 4586  C CA   . VAL A 1 20  ? -1.580  3.241   0.730   1.00 0.00 ? 20  VAL A CA   4  
ATOM 4587  C C    . VAL A 1 20  ? -2.818  4.034   1.132   1.00 0.00 ? 20  VAL A C    4  
ATOM 4588  O O    . VAL A 1 20  ? -3.593  4.471   0.281   1.00 0.00 ? 20  VAL A O    4  
ATOM 4589  C CB   . VAL A 1 20  ? -0.709  4.107   -0.199  1.00 0.00 ? 20  VAL A CB   4  
ATOM 4590  C CG1  . VAL A 1 20  ? -0.291  5.390   0.503   1.00 0.00 ? 20  VAL A CG1  4  
ATOM 4591  C CG2  . VAL A 1 20  ? 0.509   3.325   -0.668  1.00 0.00 ? 20  VAL A CG2  4  
ATOM 4592  H H    . VAL A 1 20  ? -2.322  1.995   -0.813  1.00 0.00 ? 20  VAL A H    4  
ATOM 4593  H HA   . VAL A 1 20  ? -1.007  3.012   1.616   1.00 0.00 ? 20  VAL A HA   4  
ATOM 4594  H HB   . VAL A 1 20  ? -1.296  4.372   -1.066  1.00 0.00 ? 20  VAL A HB   4  
ATOM 4595  H HG11 . VAL A 1 20  ? 0.380   5.947   -0.135  1.00 0.00 ? 20  VAL A HG11 4  
ATOM 4596  H HG12 . VAL A 1 20  ? -1.166  5.986   0.715   1.00 0.00 ? 20  VAL A HG12 4  
ATOM 4597  H HG13 . VAL A 1 20  ? 0.212   5.147   1.427   1.00 0.00 ? 20  VAL A HG13 4  
ATOM 4598  H HG21 . VAL A 1 20  ? 0.200   2.564   -1.368  1.00 0.00 ? 20  VAL A HG21 4  
ATOM 4599  H HG22 . VAL A 1 20  ? 1.205   3.996   -1.151  1.00 0.00 ? 20  VAL A HG22 4  
ATOM 4600  H HG23 . VAL A 1 20  ? 0.988   2.861   0.181   1.00 0.00 ? 20  VAL A HG23 4  
ATOM 4601  N N    . LYS A 1 21  ? -2.998  4.217   2.436   1.00 0.00 ? 21  LYS A N    4  
ATOM 4602  C CA   . LYS A 1 21  ? -4.141  4.960   2.954   1.00 0.00 ? 21  LYS A CA   4  
ATOM 4603  C C    . LYS A 1 21  ? -3.684  6.125   3.826   1.00 0.00 ? 21  LYS A C    4  
ATOM 4604  O O    . LYS A 1 21  ? -2.703  6.015   4.560   1.00 0.00 ? 21  LYS A O    4  
ATOM 4605  C CB   . LYS A 1 21  ? -5.055  4.034   3.760   1.00 0.00 ? 21  LYS A CB   4  
ATOM 4606  C CG   . LYS A 1 21  ? -4.454  3.587   5.082   1.00 0.00 ? 21  LYS A CG   4  
ATOM 4607  C CD   . LYS A 1 21  ? -5.523  3.095   6.042   1.00 0.00 ? 21  LYS A CD   4  
ATOM 4608  C CE   . LYS A 1 21  ? -5.121  3.326   7.491   1.00 0.00 ? 21  LYS A CE   4  
ATOM 4609  N NZ   . LYS A 1 21  ? -6.121  2.764   8.440   1.00 0.00 ? 21  LYS A NZ   4  
ATOM 4610  H H    . LYS A 1 21  ? -2.346  3.845   3.066   1.00 0.00 ? 21  LYS A H    4  
ATOM 4611  H HA   . LYS A 1 21  ? -4.692  5.351   2.112   1.00 0.00 ? 21  LYS A HA   4  
ATOM 4612  H HB2  . LYS A 1 21  ? -5.980  4.551   3.965   1.00 0.00 ? 21  LYS A HB2  4  
ATOM 4613  H HB3  . LYS A 1 21  ? -5.267  3.154   3.170   1.00 0.00 ? 21  LYS A HB3  4  
ATOM 4614  H HG2  . LYS A 1 21  ? -3.755  2.785   4.897   1.00 0.00 ? 21  LYS A HG2  4  
ATOM 4615  H HG3  . LYS A 1 21  ? -3.936  4.422   5.532   1.00 0.00 ? 21  LYS A HG3  4  
ATOM 4616  H HD2  . LYS A 1 21  ? -6.443  3.626   5.847   1.00 0.00 ? 21  LYS A HD2  4  
ATOM 4617  H HD3  . LYS A 1 21  ? -5.676  2.036   5.885   1.00 0.00 ? 21  LYS A HD3  4  
ATOM 4618  H HE2  . LYS A 1 21  ? -4.166  2.854   7.665   1.00 0.00 ? 21  LYS A HE2  4  
ATOM 4619  H HE3  . LYS A 1 21  ? -5.034  4.389   7.661   1.00 0.00 ? 21  LYS A HE3  4  
ATOM 4620  H HZ1  . LYS A 1 21  ? -6.636  3.533   8.913   1.00 0.00 ? 21  LYS A HZ1  4  
ATOM 4621  H HZ2  . LYS A 1 21  ? -5.643  2.187   9.162   1.00 0.00 ? 21  LYS A HZ2  4  
ATOM 4622  H HZ3  . LYS A 1 21  ? -6.802  2.167   7.930   1.00 0.00 ? 21  LYS A HZ3  4  
ATOM 4623  N N    . GLY A 1 22  ? -4.402  7.241   3.740   1.00 0.00 ? 22  GLY A N    4  
ATOM 4624  C CA   . GLY A 1 22  ? -4.054  8.409   4.527   1.00 0.00 ? 22  GLY A CA   4  
ATOM 4625  C C    . GLY A 1 22  ? -3.373  9.482   3.702   1.00 0.00 ? 22  GLY A C    4  
ATOM 4626  O O    . GLY A 1 22  ? -2.445  10.142  4.173   1.00 0.00 ? 22  GLY A O    4  
ATOM 4627  H H    . GLY A 1 22  ? -5.174  7.271   3.137   1.00 0.00 ? 22  GLY A H    4  
ATOM 4628  H HA2  . GLY A 1 22  ? -4.955  8.819   4.960   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 4629  H HA3  . GLY A 1 22  ? -3.390  8.107   5.324   1.00 0.00 ? 22  GLY A HA3  4  
ATOM 4630  N N    . LEU A 1 23  ? -3.831  9.658   2.468   1.00 0.00 ? 23  LEU A N    4  
ATOM 4631  C CA   . LEU A 1 23  ? -3.258  10.658  1.574   1.00 0.00 ? 23  LEU A CA   4  
ATOM 4632  C C    . LEU A 1 23  ? -4.122  11.914  1.537   1.00 0.00 ? 23  LEU A C    4  
ATOM 4633  O O    . LEU A 1 23  ? -5.292  11.886  1.918   1.00 0.00 ? 23  LEU A O    4  
ATOM 4634  C CB   . LEU A 1 23  ? -3.110  10.085  0.163   1.00 0.00 ? 23  LEU A CB   4  
ATOM 4635  C CG   . LEU A 1 23  ? -2.200  8.864   0.026   1.00 0.00 ? 23  LEU A CG   4  
ATOM 4636  C CD1  . LEU A 1 23  ? -2.306  8.273   -1.371  1.00 0.00 ? 23  LEU A CD1  4  
ATOM 4637  C CD2  . LEU A 1 23  ? -0.758  9.236   0.342   1.00 0.00 ? 23  LEU A CD2  4  
ATOM 4638  H H    . LEU A 1 23  ? -4.572  9.102   2.149   1.00 0.00 ? 23  LEU A H    4  
ATOM 4639  H HA   . LEU A 1 23  ? -2.281  10.919  1.952   1.00 0.00 ? 23  LEU A HA   4  
ATOM 4640  H HB2  . LEU A 1 23  ? -4.093  9.805   -0.184  1.00 0.00 ? 23  LEU A HB2  4  
ATOM 4641  H HB3  . LEU A 1 23  ? -2.715  10.867  -0.471  1.00 0.00 ? 23  LEU A HB3  4  
ATOM 4642  H HG   . LEU A 1 23  ? -2.514  8.108   0.733   1.00 0.00 ? 23  LEU A HG   4  
ATOM 4643  H HD11 . LEU A 1 23  ? -3.107  8.759   -1.907  1.00 0.00 ? 23  LEU A HD11 4  
ATOM 4644  H HD12 . LEU A 1 23  ? -2.509  7.215   -1.300  1.00 0.00 ? 23  LEU A HD12 4  
ATOM 4645  H HD13 . LEU A 1 23  ? -1.375  8.426   -1.898  1.00 0.00 ? 23  LEU A HD13 4  
ATOM 4646  H HD21 . LEU A 1 23  ? -0.319  9.729   -0.512  1.00 0.00 ? 23  LEU A HD21 4  
ATOM 4647  H HD22 . LEU A 1 23  ? -0.197  8.341   0.570   1.00 0.00 ? 23  LEU A HD22 4  
ATOM 4648  H HD23 . LEU A 1 23  ? -0.737  9.901   1.193   1.00 0.00 ? 23  LEU A HD23 4  
ATOM 4649  N N    . SER A 1 24  ? -3.538  13.015  1.074   1.00 0.00 ? 24  SER A N    4  
ATOM 4650  C CA   . SER A 1 24  ? -4.255  14.282  0.988   1.00 0.00 ? 24  SER A CA   4  
ATOM 4651  C C    . SER A 1 24  ? -5.079  14.354  -0.293  1.00 0.00 ? 24  SER A C    4  
ATOM 4652  O O    . SER A 1 24  ? -4.638  13.912  -1.353  1.00 0.00 ? 24  SER A O    4  
ATOM 4653  C CB   . SER A 1 24  ? -3.271  15.453  1.042   1.00 0.00 ? 24  SER A CB   4  
ATOM 4654  O OG   . SER A 1 24  ? -3.939  16.667  1.336   1.00 0.00 ? 24  SER A OG   4  
ATOM 4655  H H    . SER A 1 24  ? -2.603  12.974  0.785   1.00 0.00 ? 24  SER A H    4  
ATOM 4656  H HA   . SER A 1 24  ? -4.921  14.344  1.835   1.00 0.00 ? 24  SER A HA   4  
ATOM 4657  H HB2  . SER A 1 24  ? -2.535  15.266  1.809   1.00 0.00 ? 24  SER A HB2  4  
ATOM 4658  H HB3  . SER A 1 24  ? -2.778  15.549  0.085   1.00 0.00 ? 24  SER A HB3  4  
ATOM 4659  H HG   . SER A 1 24  ? -3.545  17.070  2.113   1.00 0.00 ? 24  SER A HG   4  
ATOM 4660  N N    . GLU A 1 25  ? -6.280  14.916  -0.186  1.00 0.00 ? 25  GLU A N    4  
ATOM 4661  C CA   . GLU A 1 25  ? -7.167  15.046  -1.336  1.00 0.00 ? 25  GLU A CA   4  
ATOM 4662  C C    . GLU A 1 25  ? -6.390  15.477  -2.577  1.00 0.00 ? 25  GLU A C    4  
ATOM 4663  O O    . GLU A 1 25  ? -6.816  15.232  -3.706  1.00 0.00 ? 25  GLU A O    4  
ATOM 4664  C CB   . GLU A 1 25  ? -8.278  16.055  -1.040  1.00 0.00 ? 25  GLU A CB   4  
ATOM 4665  C CG   . GLU A 1 25  ? -7.769  17.465  -0.793  1.00 0.00 ? 25  GLU A CG   4  
ATOM 4666  C CD   . GLU A 1 25  ? -8.892  18.464  -0.592  1.00 0.00 ? 25  GLU A CD   4  
ATOM 4667  O OE1  . GLU A 1 25  ? -9.389  19.009  -1.600  1.00 0.00 ? 25  GLU A OE1  4  
ATOM 4668  O OE2  . GLU A 1 25  ? -9.274  18.700  0.573   1.00 0.00 ? 25  GLU A OE2  4  
ATOM 4669  H H    . GLU A 1 25  ? -6.576  15.250  0.686   1.00 0.00 ? 25  GLU A H    4  
ATOM 4670  H HA   . GLU A 1 25  ? -7.611  14.080  -1.523  1.00 0.00 ? 25  GLU A HA   4  
ATOM 4671  H HB2  . GLU A 1 25  ? -8.958  16.081  -1.879  1.00 0.00 ? 25  GLU A HB2  4  
ATOM 4672  H HB3  . GLU A 1 25  ? -8.817  15.731  -0.162  1.00 0.00 ? 25  GLU A HB3  4  
ATOM 4673  H HG2  . GLU A 1 25  ? -7.150  17.461  0.091   1.00 0.00 ? 25  GLU A HG2  4  
ATOM 4674  H HG3  . GLU A 1 25  ? -7.179  17.775  -1.643  1.00 0.00 ? 25  GLU A HG3  4  
ATOM 4675  N N    . ASP A 1 26  ? -5.249  16.122  -2.359  1.00 0.00 ? 26  ASP A N    4  
ATOM 4676  C CA   . ASP A 1 26  ? -4.412  16.588  -3.458  1.00 0.00 ? 26  ASP A CA   4  
ATOM 4677  C C    . ASP A 1 26  ? -3.473  15.483  -3.932  1.00 0.00 ? 26  ASP A C    4  
ATOM 4678  O O    . ASP A 1 26  ? -3.192  15.360  -5.125  1.00 0.00 ? 26  ASP A O    4  
ATOM 4679  C CB   . ASP A 1 26  ? -3.602  17.812  -3.027  1.00 0.00 ? 26  ASP A CB   4  
ATOM 4680  C CG   . ASP A 1 26  ? -4.383  19.103  -3.173  1.00 0.00 ? 26  ASP A CG   4  
ATOM 4681  O OD1  . ASP A 1 26  ? -5.260  19.169  -4.061  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 4682  O OD2  . ASP A 1 26  ? -4.119  20.047  -2.400  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 4683  H H    . ASP A 1 26  ? -4.963  16.287  -1.436  1.00 0.00 ? 26  ASP A H    4  
ATOM 4684  H HA   . ASP A 1 26  ? -5.061  16.866  -4.274  1.00 0.00 ? 26  ASP A HA   4  
ATOM 4685  H HB2  . ASP A 1 26  ? -3.318  17.701  -1.991  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 4686  H HB3  . ASP A 1 26  ? -2.713  17.879  -3.635  1.00 0.00 ? 26  ASP A HB3  4  
ATOM 4687  N N    . THR A 1 27  ? -2.989  14.679  -2.990  1.00 0.00 ? 27  THR A N    4  
ATOM 4688  C CA   . THR A 1 27  ? -2.080  13.586  -3.310  1.00 0.00 ? 27  THR A CA   4  
ATOM 4689  C C    . THR A 1 27  ? -2.433  12.953  -4.651  1.00 0.00 ? 27  THR A C    4  
ATOM 4690  O O    . THR A 1 27  ? -3.539  12.445  -4.838  1.00 0.00 ? 27  THR A O    4  
ATOM 4691  C CB   . THR A 1 27  ? -2.103  12.498  -2.220  1.00 0.00 ? 27  THR A CB   4  
ATOM 4692  O OG1  . THR A 1 27  ? -1.710  13.058  -0.961  1.00 0.00 ? 27  THR A OG1  4  
ATOM 4693  C CG2  . THR A 1 27  ? -1.174  11.349  -2.582  1.00 0.00 ? 27  THR A CG2  4  
ATOM 4694  H H    . THR A 1 27  ? -3.250  14.827  -2.057  1.00 0.00 ? 27  THR A H    4  
ATOM 4695  H HA   . THR A 1 27  ? -1.080  13.990  -3.366  1.00 0.00 ? 27  THR A HA   4  
ATOM 4696  H HB   . THR A 1 27  ? -3.110  12.115  -2.136  1.00 0.00 ? 27  THR A HB   4  
ATOM 4697  H HG1  . THR A 1 27  ? -1.991  13.975  -0.917  1.00 0.00 ? 27  THR A HG1  4  
ATOM 4698  H HG21 . THR A 1 27  ? -1.655  10.411  -2.350  1.00 0.00 ? 27  THR A HG21 4  
ATOM 4699  H HG22 . THR A 1 27  ? -0.259  11.435  -2.016  1.00 0.00 ? 27  THR A HG22 4  
ATOM 4700  H HG23 . THR A 1 27  ? -0.950  11.387  -3.637  1.00 0.00 ? 27  THR A HG23 4  
ATOM 4701  N N    . THR A 1 28  ? -1.486  12.986  -5.584  1.00 0.00 ? 28  THR A N    4  
ATOM 4702  C CA   . THR A 1 28  ? -1.697  12.415  -6.908  1.00 0.00 ? 28  THR A CA   4  
ATOM 4703  C C    . THR A 1 28  ? -0.887  11.137  -7.092  1.00 0.00 ? 28  THR A C    4  
ATOM 4704  O O    . THR A 1 28  ? 0.099   10.911  -6.390  1.00 0.00 ? 28  THR A O    4  
ATOM 4705  C CB   . THR A 1 28  ? -1.318  13.414  -8.017  1.00 0.00 ? 28  THR A CB   4  
ATOM 4706  O OG1  . THR A 1 28  ? 0.032   13.858  -7.836  1.00 0.00 ? 28  THR A OG1  4  
ATOM 4707  C CG2  . THR A 1 28  ? -2.256  14.612  -8.011  1.00 0.00 ? 28  THR A CG2  4  
ATOM 4708  H H    . THR A 1 28  ? -0.625  13.405  -5.374  1.00 0.00 ? 28  THR A H    4  
ATOM 4709  H HA   . THR A 1 28  ? -2.747  12.181  -7.007  1.00 0.00 ? 28  THR A HA   4  
ATOM 4710  H HB   . THR A 1 28  ? -1.400  12.917  -8.973  1.00 0.00 ? 28  THR A HB   4  
ATOM 4711  H HG1  . THR A 1 28  ? 0.273   14.450  -8.553  1.00 0.00 ? 28  THR A HG1  4  
ATOM 4712  H HG21 . THR A 1 28  ? -3.277  14.269  -7.930  1.00 0.00 ? 28  THR A HG21 4  
ATOM 4713  H HG22 . THR A 1 28  ? -2.134  15.169  -8.927  1.00 0.00 ? 28  THR A HG22 4  
ATOM 4714  H HG23 . THR A 1 28  ? -2.022  15.247  -7.169  1.00 0.00 ? 28  THR A HG23 4  
ATOM 4715  N N    . GLU A 1 29  ? -1.308  10.306  -8.040  1.00 0.00 ? 29  GLU A N    4  
ATOM 4716  C CA   . GLU A 1 29  ? -0.619  9.050   -8.315  1.00 0.00 ? 29  GLU A CA   4  
ATOM 4717  C C    . GLU A 1 29  ? 0.853   9.295   -8.631  1.00 0.00 ? 29  GLU A C    4  
ATOM 4718  O O    . GLU A 1 29  ? 1.688   8.405   -8.475  1.00 0.00 ? 29  GLU A O    4  
ATOM 4719  C CB   . GLU A 1 29  ? -1.288  8.321   -9.482  1.00 0.00 ? 29  GLU A CB   4  
ATOM 4720  C CG   . GLU A 1 29  ? -2.784  8.126   -9.300  1.00 0.00 ? 29  GLU A CG   4  
ATOM 4721  C CD   . GLU A 1 29  ? -3.518  7.984   -10.620 1.00 0.00 ? 29  GLU A CD   4  
ATOM 4722  O OE1  . GLU A 1 29  ? -3.034  8.537   -11.630 1.00 0.00 ? 29  GLU A OE1  4  
ATOM 4723  O OE2  . GLU A 1 29  ? -4.577  7.322   -10.642 1.00 0.00 ? 29  GLU A OE2  4  
ATOM 4724  H H    . GLU A 1 29  ? -2.100  10.542  -8.566  1.00 0.00 ? 29  GLU A H    4  
ATOM 4725  H HA   . GLU A 1 29  ? -0.688  8.434   -7.431  1.00 0.00 ? 29  GLU A HA   4  
ATOM 4726  H HB2  . GLU A 1 29  ? -1.127  8.890   -10.386 1.00 0.00 ? 29  GLU A HB2  4  
ATOM 4727  H HB3  . GLU A 1 29  ? -0.830  7.349   -9.593  1.00 0.00 ? 29  GLU A HB3  4  
ATOM 4728  H HG2  . GLU A 1 29  ? -2.949  7.232   -8.717  1.00 0.00 ? 29  GLU A HG2  4  
ATOM 4729  H HG3  . GLU A 1 29  ? -3.184  8.978   -8.772  1.00 0.00 ? 29  GLU A HG3  4  
ATOM 4730  N N    . GLU A 1 30  ? 1.163   10.509  -9.076  1.00 0.00 ? 30  GLU A N    4  
ATOM 4731  C CA   . GLU A 1 30  ? 2.535   10.870  -9.416  1.00 0.00 ? 30  GLU A CA   4  
ATOM 4732  C C    . GLU A 1 30  ? 3.418   10.881  -8.171  1.00 0.00 ? 30  GLU A C    4  
ATOM 4733  O O    . GLU A 1 30  ? 4.468   10.238  -8.135  1.00 0.00 ? 30  GLU A O    4  
ATOM 4734  C CB   . GLU A 1 30  ? 2.572   12.242  -10.093 1.00 0.00 ? 30  GLU A CB   4  
ATOM 4735  C CG   . GLU A 1 30  ? 2.444   12.177  -11.606 1.00 0.00 ? 30  GLU A CG   4  
ATOM 4736  C CD   . GLU A 1 30  ? 1.953   13.481  -12.206 1.00 0.00 ? 30  GLU A CD   4  
ATOM 4737  O OE1  . GLU A 1 30  ? 0.944   14.020  -11.705 1.00 0.00 ? 30  GLU A OE1  4  
ATOM 4738  O OE2  . GLU A 1 30  ? 2.577   13.960  -13.175 1.00 0.00 ? 30  GLU A OE2  4  
ATOM 4739  H H    . GLU A 1 30  ? 0.453   11.176  -9.180  1.00 0.00 ? 30  GLU A H    4  
ATOM 4740  H HA   . GLU A 1 30  ? 2.912   10.129  -10.104 1.00 0.00 ? 30  GLU A HA   4  
ATOM 4741  H HB2  . GLU A 1 30  ? 1.760   12.842  -9.709  1.00 0.00 ? 30  GLU A HB2  4  
ATOM 4742  H HB3  . GLU A 1 30  ? 3.508   12.723  -9.852  1.00 0.00 ? 30  GLU A HB3  4  
ATOM 4743  H HG2  . GLU A 1 30  ? 3.411   11.947  -12.026 1.00 0.00 ? 30  GLU A HG2  4  
ATOM 4744  H HG3  . GLU A 1 30  ? 1.746   11.394  -11.862 1.00 0.00 ? 30  GLU A HG3  4  
ATOM 4745  N N    . THR A 1 31  ? 2.986   11.617  -7.152  1.00 0.00 ? 31  THR A N    4  
ATOM 4746  C CA   . THR A 1 31  ? 3.737   11.715  -5.907  1.00 0.00 ? 31  THR A CA   4  
ATOM 4747  C C    . THR A 1 31  ? 3.690   10.402  -5.133  1.00 0.00 ? 31  THR A C    4  
ATOM 4748  O O    . THR A 1 31  ? 4.640   10.048  -4.433  1.00 0.00 ? 31  THR A O    4  
ATOM 4749  C CB   . THR A 1 31  ? 3.195   12.845  -5.011  1.00 0.00 ? 31  THR A CB   4  
ATOM 4750  O OG1  . THR A 1 31  ? 4.228   13.314  -4.137  1.00 0.00 ? 31  THR A OG1  4  
ATOM 4751  C CG2  . THR A 1 31  ? 2.009   12.363  -4.190  1.00 0.00 ? 31  THR A CG2  4  
ATOM 4752  H H    . THR A 1 31  ? 2.142   12.107  -7.242  1.00 0.00 ? 31  THR A H    4  
ATOM 4753  H HA   . THR A 1 31  ? 4.764   11.940  -6.154  1.00 0.00 ? 31  THR A HA   4  
ATOM 4754  H HB   . THR A 1 31  ? 2.871   13.660  -5.643  1.00 0.00 ? 31  THR A HB   4  
ATOM 4755  H HG1  . THR A 1 31  ? 3.835   13.646  -3.326  1.00 0.00 ? 31  THR A HG1  4  
ATOM 4756  H HG21 . THR A 1 31  ? 2.363   11.918  -3.272  1.00 0.00 ? 31  THR A HG21 4  
ATOM 4757  H HG22 . THR A 1 31  ? 1.454   11.630  -4.756  1.00 0.00 ? 31  THR A HG22 4  
ATOM 4758  H HG23 . THR A 1 31  ? 1.368   13.201  -3.959  1.00 0.00 ? 31  THR A HG23 4  
ATOM 4759  N N    . LEU A 1 32  ? 2.581   9.683   -5.264  1.00 0.00 ? 32  LEU A N    4  
ATOM 4760  C CA   . LEU A 1 32  ? 2.411   8.407   -4.577  1.00 0.00 ? 32  LEU A CA   4  
ATOM 4761  C C    . LEU A 1 32  ? 3.370   7.358   -5.131  1.00 0.00 ? 32  LEU A C    4  
ATOM 4762  O O    . LEU A 1 32  ? 3.910   6.540   -4.387  1.00 0.00 ? 32  LEU A O    4  
ATOM 4763  C CB   . LEU A 1 32  ? 0.968   7.920   -4.714  1.00 0.00 ? 32  LEU A CB   4  
ATOM 4764  C CG   . LEU A 1 32  ? 0.652   6.568   -4.072  1.00 0.00 ? 32  LEU A CG   4  
ATOM 4765  C CD1  . LEU A 1 32  ? 0.547   6.707   -2.561  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 4766  C CD2  . LEU A 1 32  ? -0.633  5.992   -4.648  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 4767  H H    . LEU A 1 32  ? 1.859   10.016  -5.835  1.00 0.00 ? 32  LEU A H    4  
ATOM 4768  H HA   . LEU A 1 32  ? 2.632   8.562   -3.531  1.00 0.00 ? 32  LEU A HA   4  
ATOM 4769  H HB2  . LEU A 1 32  ? 0.325   8.659   -4.262  1.00 0.00 ? 32  LEU A HB2  4  
ATOM 4770  H HB3  . LEU A 1 32  ? 0.744   7.846   -5.769  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 4771  H HG   . LEU A 1 32  ? 1.455   5.877   -4.288  1.00 0.00 ? 32  LEU A HG   4  
ATOM 4772  H HD11 . LEU A 1 32  ? -0.492  6.673   -2.268  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 4773  H HD12 . LEU A 1 32  ? 0.976   7.649   -2.255  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 4774  H HD13 . LEU A 1 32  ? 1.082   5.897   -2.087  1.00 0.00 ? 32  LEU A HD13 4  
ATOM 4775  H HD21 . LEU A 1 32  ? -1.314  5.757   -3.842  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 4776  H HD22 . LEU A 1 32  ? -0.408  5.093   -5.202  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 4777  H HD23 . LEU A 1 32  ? -1.090  6.716   -5.305  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 4778  N N    . LYS A 1 33  ? 3.578   7.389   -6.443  1.00 0.00 ? 33  LYS A N    4  
ATOM 4779  C CA   . LYS A 1 33  ? 4.474   6.444   -7.099  1.00 0.00 ? 33  LYS A CA   4  
ATOM 4780  C C    . LYS A 1 33  ? 5.922   6.695   -6.692  1.00 0.00 ? 33  LYS A C    4  
ATOM 4781  O O    . LYS A 1 33  ? 6.614   5.787   -6.235  1.00 0.00 ? 33  LYS A O    4  
ATOM 4782  C CB   . LYS A 1 33  ? 4.334   6.548   -8.619  1.00 0.00 ? 33  LYS A CB   4  
ATOM 4783  C CG   . LYS A 1 33  ? 4.988   5.401   -9.370  1.00 0.00 ? 33  LYS A CG   4  
ATOM 4784  C CD   . LYS A 1 33  ? 5.470   5.836   -10.744 1.00 0.00 ? 33  LYS A CD   4  
ATOM 4785  C CE   . LYS A 1 33  ? 6.650   4.999   -11.211 1.00 0.00 ? 33  LYS A CE   4  
ATOM 4786  N NZ   . LYS A 1 33  ? 7.481   5.722   -12.214 1.00 0.00 ? 33  LYS A NZ   4  
ATOM 4787  H H    . LYS A 1 33  ? 3.118   8.065   -6.984  1.00 0.00 ? 33  LYS A H    4  
ATOM 4788  H HA   . LYS A 1 33  ? 4.192   5.449   -6.787  1.00 0.00 ? 33  LYS A HA   4  
ATOM 4789  H HB2  . LYS A 1 33  ? 3.284   6.564   -8.872  1.00 0.00 ? 33  LYS A HB2  4  
ATOM 4790  H HB3  . LYS A 1 33  ? 4.789   7.471   -8.948  1.00 0.00 ? 33  LYS A HB3  4  
ATOM 4791  H HG2  . LYS A 1 33  ? 5.833   5.045   -8.800  1.00 0.00 ? 33  LYS A HG2  4  
ATOM 4792  H HG3  . LYS A 1 33  ? 4.268   4.603   -9.487  1.00 0.00 ? 33  LYS A HG3  4  
ATOM 4793  H HD2  . LYS A 1 33  ? 4.662   5.725   -11.451 1.00 0.00 ? 33  LYS A HD2  4  
ATOM 4794  H HD3  . LYS A 1 33  ? 5.771   6.873   -10.698 1.00 0.00 ? 33  LYS A HD3  4  
ATOM 4795  H HE2  . LYS A 1 33  ? 7.263   4.755   -10.357 1.00 0.00 ? 33  LYS A HE2  4  
ATOM 4796  H HE3  . LYS A 1 33  ? 6.275   4.089   -11.656 1.00 0.00 ? 33  LYS A HE3  4  
ATOM 4797  H HZ1  . LYS A 1 33  ? 6.930   6.491   -12.646 1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 4798  H HZ2  . LYS A 1 33  ? 7.787   5.068   -12.962 1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 4799  H HZ3  . LYS A 1 33  ? 8.322   6.127   -11.756 1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 4800  N N    . GLU A 1 34  ? 6.373   7.935   -6.862  1.00 0.00 ? 34  GLU A N    4  
ATOM 4801  C CA   . GLU A 1 34  ? 7.739   8.304   -6.511  1.00 0.00 ? 34  GLU A CA   4  
ATOM 4802  C C    . GLU A 1 34  ? 8.012   8.040   -5.033  1.00 0.00 ? 34  GLU A C    4  
ATOM 4803  O O    . GLU A 1 34  ? 9.093   7.582   -4.663  1.00 0.00 ? 34  GLU A O    4  
ATOM 4804  C CB   . GLU A 1 34  ? 7.990   9.779   -6.831  1.00 0.00 ? 34  GLU A CB   4  
ATOM 4805  C CG   . GLU A 1 34  ? 7.858   10.112  -8.308  1.00 0.00 ? 34  GLU A CG   4  
ATOM 4806  C CD   . GLU A 1 34  ? 8.578   11.393  -8.684  1.00 0.00 ? 34  GLU A CD   4  
ATOM 4807  O OE1  . GLU A 1 34  ? 9.823   11.423  -8.588  1.00 0.00 ? 34  GLU A OE1  4  
ATOM 4808  O OE2  . GLU A 1 34  ? 7.897   12.364  -9.074  1.00 0.00 ? 34  GLU A OE2  4  
ATOM 4809  H H    . GLU A 1 34  ? 5.773   8.616   -7.231  1.00 0.00 ? 34  GLU A H    4  
ATOM 4810  H HA   . GLU A 1 34  ? 8.409   7.698   -7.102  1.00 0.00 ? 34  GLU A HA   4  
ATOM 4811  H HB2  . GLU A 1 34  ? 7.281   10.380  -6.282  1.00 0.00 ? 34  GLU A HB2  4  
ATOM 4812  H HB3  . GLU A 1 34  ? 8.990   10.038  -6.514  1.00 0.00 ? 34  GLU A HB3  4  
ATOM 4813  H HG2  . GLU A 1 34  ? 8.273   9.301   -8.886  1.00 0.00 ? 34  GLU A HG2  4  
ATOM 4814  H HG3  . GLU A 1 34  ? 6.810   10.223  -8.546  1.00 0.00 ? 34  GLU A HG3  4  
ATOM 4815  N N    . SER A 1 35  ? 7.024   8.332   -4.193  1.00 0.00 ? 35  SER A N    4  
ATOM 4816  C CA   . SER A 1 35  ? 7.159   8.130   -2.755  1.00 0.00 ? 35  SER A CA   4  
ATOM 4817  C C    . SER A 1 35  ? 7.930   6.848   -2.456  1.00 0.00 ? 35  SER A C    4  
ATOM 4818  O O    . SER A 1 35  ? 8.686   6.777   -1.487  1.00 0.00 ? 35  SER A O    4  
ATOM 4819  C CB   . SER A 1 35  ? 5.779   8.074   -2.096  1.00 0.00 ? 35  SER A CB   4  
ATOM 4820  O OG   . SER A 1 35  ? 5.251   9.375   -1.907  1.00 0.00 ? 35  SER A OG   4  
ATOM 4821  H H    . SER A 1 35  ? 6.186   8.694   -4.550  1.00 0.00 ? 35  SER A H    4  
ATOM 4822  H HA   . SER A 1 35  ? 7.707   8.969   -2.353  1.00 0.00 ? 35  SER A HA   4  
ATOM 4823  H HB2  . SER A 1 35  ? 5.105   7.513   -2.724  1.00 0.00 ? 35  SER A HB2  4  
ATOM 4824  H HB3  . SER A 1 35  ? 5.863   7.589   -1.134  1.00 0.00 ? 35  SER A HB3  4  
ATOM 4825  H HG   . SER A 1 35  ? 4.410   9.449   -2.365  1.00 0.00 ? 35  SER A HG   4  
ATOM 4826  N N    . PHE A 1 36  ? 7.734   5.837   -3.296  1.00 0.00 ? 36  PHE A N    4  
ATOM 4827  C CA   . PHE A 1 36  ? 8.409   4.557   -3.122  1.00 0.00 ? 36  PHE A CA   4  
ATOM 4828  C C    . PHE A 1 36  ? 9.526   4.387   -4.149  1.00 0.00 ? 36  PHE A C    4  
ATOM 4829  O O    . PHE A 1 36  ? 9.272   4.075   -5.312  1.00 0.00 ? 36  PHE A O    4  
ATOM 4830  C CB   . PHE A 1 36  ? 7.408   3.406   -3.247  1.00 0.00 ? 36  PHE A CB   4  
ATOM 4831  C CG   . PHE A 1 36  ? 6.183   3.583   -2.396  1.00 0.00 ? 36  PHE A CG   4  
ATOM 4832  C CD1  . PHE A 1 36  ? 5.127   4.366   -2.833  1.00 0.00 ? 36  PHE A CD1  4  
ATOM 4833  C CD2  . PHE A 1 36  ? 6.087   2.966   -1.159  1.00 0.00 ? 36  PHE A CD2  4  
ATOM 4834  C CE1  . PHE A 1 36  ? 3.999   4.531   -2.051  1.00 0.00 ? 36  PHE A CE1  4  
ATOM 4835  C CE2  . PHE A 1 36  ? 4.962   3.127   -0.373  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 4836  C CZ   . PHE A 1 36  ? 3.916   3.910   -0.821  1.00 0.00 ? 36  PHE A CZ   4  
ATOM 4837  H H    . PHE A 1 36  ? 7.118   5.955   -4.050  1.00 0.00 ? 36  PHE A H    4  
ATOM 4838  H HA   . PHE A 1 36  ? 8.840   4.542   -2.133  1.00 0.00 ? 36  PHE A HA   4  
ATOM 4839  H HB2  . PHE A 1 36  ? 7.088   3.327   -4.275  1.00 0.00 ? 36  PHE A HB2  4  
ATOM 4840  H HB3  . PHE A 1 36  ? 7.889   2.486   -2.951  1.00 0.00 ? 36  PHE A HB3  4  
ATOM 4841  H HD1  . PHE A 1 36  ? 5.190   4.852   -3.796  1.00 0.00 ? 36  PHE A HD1  4  
ATOM 4842  H HD2  . PHE A 1 36  ? 6.906   2.353   -0.808  1.00 0.00 ? 36  PHE A HD2  4  
ATOM 4843  H HE1  . PHE A 1 36  ? 3.182   5.144   -2.404  1.00 0.00 ? 36  PHE A HE1  4  
ATOM 4844  H HE2  . PHE A 1 36  ? 4.900   2.640   0.588   1.00 0.00 ? 36  PHE A HE2  4  
ATOM 4845  H HZ   . PHE A 1 36  ? 3.036   4.037   -0.208  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 4846  N N    . ASP A 1 37  ? 10.762  4.596   -3.709  1.00 0.00 ? 37  ASP A N    4  
ATOM 4847  C CA   . ASP A 1 37  ? 11.918  4.466   -4.588  1.00 0.00 ? 37  ASP A CA   4  
ATOM 4848  C C    . ASP A 1 37  ? 12.090  3.023   -5.050  1.00 0.00 ? 37  ASP A C    4  
ATOM 4849  O O    . ASP A 1 37  ? 12.767  2.228   -4.398  1.00 0.00 ? 37  ASP A O    4  
ATOM 4850  C CB   . ASP A 1 37  ? 13.185  4.940   -3.873  1.00 0.00 ? 37  ASP A CB   4  
ATOM 4851  C CG   . ASP A 1 37  ? 14.245  5.432   -4.839  1.00 0.00 ? 37  ASP A CG   4  
ATOM 4852  O OD1  . ASP A 1 37  ? 14.090  6.553   -5.368  1.00 0.00 ? 37  ASP A OD1  4  
ATOM 4853  O OD2  . ASP A 1 37  ? 15.228  4.697   -5.066  1.00 0.00 ? 37  ASP A OD2  4  
ATOM 4854  H H    . ASP A 1 37  ? 10.900  4.842   -2.770  1.00 0.00 ? 37  ASP A H    4  
ATOM 4855  H HA   . ASP A 1 37  ? 11.749  5.090   -5.453  1.00 0.00 ? 37  ASP A HA   4  
ATOM 4856  H HB2  . ASP A 1 37  ? 12.931  5.750   -3.204  1.00 0.00 ? 37  ASP A HB2  4  
ATOM 4857  H HB3  . ASP A 1 37  ? 13.596  4.121   -3.302  1.00 0.00 ? 37  ASP A HB3  4  
ATOM 4858  N N    . GLY A 1 38  ? 11.472  2.690   -6.179  1.00 0.00 ? 38  GLY A N    4  
ATOM 4859  C CA   . GLY A 1 38  ? 11.568  1.342   -6.708  1.00 0.00 ? 38  GLY A CA   4  
ATOM 4860  C C    . GLY A 1 38  ? 10.305  0.910   -7.427  1.00 0.00 ? 38  GLY A C    4  
ATOM 4861  O O    . GLY A 1 38  ? 10.367  0.208   -8.436  1.00 0.00 ? 38  GLY A O    4  
ATOM 4862  H H    . GLY A 1 38  ? 10.946  3.366   -6.657  1.00 0.00 ? 38  GLY A H    4  
ATOM 4863  H HA2  . GLY A 1 38  ? 12.397  1.297   -7.399  1.00 0.00 ? 38  GLY A HA2  4  
ATOM 4864  H HA3  . GLY A 1 38  ? 11.755  0.660   -5.892  1.00 0.00 ? 38  GLY A HA3  4  
ATOM 4865  N N    . SER A 1 39  ? 9.157   1.329   -6.905  1.00 0.00 ? 39  SER A N    4  
ATOM 4866  C CA   . SER A 1 39  ? 7.873   0.976   -7.500  1.00 0.00 ? 39  SER A CA   4  
ATOM 4867  C C    . SER A 1 39  ? 7.901   1.178   -9.012  1.00 0.00 ? 39  SER A C    4  
ATOM 4868  O O    . SER A 1 39  ? 8.770   1.872   -9.541  1.00 0.00 ? 39  SER A O    4  
ATOM 4869  C CB   . SER A 1 39  ? 6.753   1.815   -6.883  1.00 0.00 ? 39  SER A CB   4  
ATOM 4870  O OG   . SER A 1 39  ? 6.819   3.159   -7.326  1.00 0.00 ? 39  SER A OG   4  
ATOM 4871  H H    . SER A 1 39  ? 9.173   1.886   -6.099  1.00 0.00 ? 39  SER A H    4  
ATOM 4872  H HA   . SER A 1 39  ? 7.687   -0.067  -7.292  1.00 0.00 ? 39  SER A HA   4  
ATOM 4873  H HB2  . SER A 1 39  ? 5.798   1.401   -7.168  1.00 0.00 ? 39  SER A HB2  4  
ATOM 4874  H HB3  . SER A 1 39  ? 6.845   1.798   -5.807  1.00 0.00 ? 39  SER A HB3  4  
ATOM 4875  H HG   . SER A 1 39  ? 7.222   3.702   -6.644  1.00 0.00 ? 39  SER A HG   4  
ATOM 4876  N N    . VAL A 1 40  ? 6.944   0.567   -9.703  1.00 0.00 ? 40  VAL A N    4  
ATOM 4877  C CA   . VAL A 1 40  ? 6.857   0.680   -11.154 1.00 0.00 ? 40  VAL A CA   4  
ATOM 4878  C C    . VAL A 1 40  ? 5.644   1.505   -11.569 1.00 0.00 ? 40  VAL A C    4  
ATOM 4879  O O    . VAL A 1 40  ? 5.664   2.185   -12.595 1.00 0.00 ? 40  VAL A O    4  
ATOM 4880  C CB   . VAL A 1 40  ? 6.775   -0.706  -11.821 1.00 0.00 ? 40  VAL A CB   4  
ATOM 4881  C CG1  . VAL A 1 40  ? 8.080   -1.465  -11.637 1.00 0.00 ? 40  VAL A CG1  4  
ATOM 4882  C CG2  . VAL A 1 40  ? 5.604   -1.498  -11.259 1.00 0.00 ? 40  VAL A CG2  4  
ATOM 4883  H H    . VAL A 1 40  ? 6.280   0.028   -9.225  1.00 0.00 ? 40  VAL A H    4  
ATOM 4884  H HA   . VAL A 1 40  ? 7.752   1.173   -11.505 1.00 0.00 ? 40  VAL A HA   4  
ATOM 4885  H HB   . VAL A 1 40  ? 6.612   -0.564  -12.879 1.00 0.00 ? 40  VAL A HB   4  
ATOM 4886  H HG11 . VAL A 1 40  ? 7.998   -2.439  -12.097 1.00 0.00 ? 40  VAL A HG11 4  
ATOM 4887  H HG12 . VAL A 1 40  ? 8.886   -0.914  -12.100 1.00 0.00 ? 40  VAL A HG12 4  
ATOM 4888  H HG13 . VAL A 1 40  ? 8.283   -1.582  -10.583 1.00 0.00 ? 40  VAL A HG13 4  
ATOM 4889  H HG21 . VAL A 1 40  ? 5.948   -2.472  -10.943 1.00 0.00 ? 40  VAL A HG21 4  
ATOM 4890  H HG22 . VAL A 1 40  ? 5.186   -0.973  -10.413 1.00 0.00 ? 40  VAL A HG22 4  
ATOM 4891  H HG23 . VAL A 1 40  ? 4.848   -1.613  -12.021 1.00 0.00 ? 40  VAL A HG23 4  
ATOM 4892  N N    . ARG A 1 41  ? 4.587   1.439   -10.765 1.00 0.00 ? 41  ARG A N    4  
ATOM 4893  C CA   . ARG A 1 41  ? 3.364   2.179   -11.050 1.00 0.00 ? 41  ARG A CA   4  
ATOM 4894  C C    . ARG A 1 41  ? 2.610   2.499   -9.762  1.00 0.00 ? 41  ARG A C    4  
ATOM 4895  O O    . ARG A 1 41  ? 2.931   1.973   -8.696  1.00 0.00 ? 41  ARG A O    4  
ATOM 4896  C CB   . ARG A 1 41  ? 2.465   1.377   -11.993 1.00 0.00 ? 41  ARG A CB   4  
ATOM 4897  C CG   . ARG A 1 41  ? 3.043   1.211   -13.389 1.00 0.00 ? 41  ARG A CG   4  
ATOM 4898  C CD   . ARG A 1 41  ? 3.126   2.542   -14.120 1.00 0.00 ? 41  ARG A CD   4  
ATOM 4899  N NE   . ARG A 1 41  ? 3.522   2.377   -15.516 1.00 0.00 ? 41  ARG A NE   4  
ATOM 4900  C CZ   . ARG A 1 41  ? 2.702   1.939   -16.465 1.00 0.00 ? 41  ARG A CZ   4  
ATOM 4901  N NH1  . ARG A 1 41  ? 1.448   1.626   -16.170 1.00 0.00 ? 41  ARG A NH1  4  
ATOM 4902  N NH2  . ARG A 1 41  ? 3.136   1.815   -17.713 1.00 0.00 ? 41  ARG A NH2  4  
ATOM 4903  H H    . ARG A 1 41  ? 4.631   0.879   -9.962  1.00 0.00 ? 41  ARG A H    4  
ATOM 4904  H HA   . ARG A 1 41  ? 3.640   3.105   -11.531 1.00 0.00 ? 41  ARG A HA   4  
ATOM 4905  H HB2  . ARG A 1 41  ? 2.308   0.394   -11.573 1.00 0.00 ? 41  ARG A HB2  4  
ATOM 4906  H HB3  . ARG A 1 41  ? 1.514   1.880   -12.078 1.00 0.00 ? 41  ARG A HB3  4  
ATOM 4907  H HG2  . ARG A 1 41  ? 4.036   0.794   -13.311 1.00 0.00 ? 41  ARG A HG2  4  
ATOM 4908  H HG3  . ARG A 1 41  ? 2.411   0.540   -13.952 1.00 0.00 ? 41  ARG A HG3  4  
ATOM 4909  H HD2  . ARG A 1 41  ? 2.157   3.018   -14.085 1.00 0.00 ? 41  ARG A HD2  4  
ATOM 4910  H HD3  . ARG A 1 41  ? 3.852   3.166   -13.621 1.00 0.00 ? 41  ARG A HD3  4  
ATOM 4911  H HE   . ARG A 1 41  ? 4.444   2.603   -15.756 1.00 0.00 ? 41  ARG A HE   4  
ATOM 4912  H HH11 . ARG A 1 41  ? 1.118   1.719   -15.231 1.00 0.00 ? 41  ARG A HH11 4  
ATOM 4913  H HH12 . ARG A 1 41  ? 0.833   1.298   -16.888 1.00 0.00 ? 41  ARG A HH12 4  
ATOM 4914  H HH21 . ARG A 1 41  ? 4.081   2.051   -17.939 1.00 0.00 ? 41  ARG A HH21 4  
ATOM 4915  H HH22 . ARG A 1 41  ? 2.519   1.486   -18.427 1.00 0.00 ? 41  ARG A HH22 4  
ATOM 4916  N N    . ALA A 1 42  ? 1.607   3.364   -9.869  1.00 0.00 ? 42  ALA A N    4  
ATOM 4917  C CA   . ALA A 1 42  ? 0.808   3.753   -8.714  1.00 0.00 ? 42  ALA A CA   4  
ATOM 4918  C C    . ALA A 1 42  ? -0.606  4.144   -9.131  1.00 0.00 ? 42  ALA A C    4  
ATOM 4919  O O    . ALA A 1 42  ? -0.833  4.568   -10.265 1.00 0.00 ? 42  ALA A O    4  
ATOM 4920  C CB   . ALA A 1 42  ? 1.477   4.900   -7.970  1.00 0.00 ? 42  ALA A CB   4  
ATOM 4921  H H    . ALA A 1 42  ? 1.400   3.749   -10.745 1.00 0.00 ? 42  ALA A H    4  
ATOM 4922  H HA   . ALA A 1 42  ? 0.753   2.906   -8.045  1.00 0.00 ? 42  ALA A HA   4  
ATOM 4923  H HB1  . ALA A 1 42  ? 1.440   5.792   -8.578  1.00 0.00 ? 42  ALA A HB1  4  
ATOM 4924  H HB2  . ALA A 1 42  ? 0.958   5.076   -7.040  1.00 0.00 ? 42  ALA A HB2  4  
ATOM 4925  H HB3  . ALA A 1 42  ? 2.506   4.644   -7.767  1.00 0.00 ? 42  ALA A HB3  4  
ATOM 4926  N N    . ARG A 1 43  ? -1.552  3.999   -8.209  1.00 0.00 ? 43  ARG A N    4  
ATOM 4927  C CA   . ARG A 1 43  ? -2.944  4.336   -8.483  1.00 0.00 ? 43  ARG A CA   4  
ATOM 4928  C C    . ARG A 1 43  ? -3.585  5.020   -7.279  1.00 0.00 ? 43  ARG A C    4  
ATOM 4929  O O    . ARG A 1 43  ? -3.134  4.852   -6.146  1.00 0.00 ? 43  ARG A O    4  
ATOM 4930  C CB   . ARG A 1 43  ? -3.733  3.077   -8.848  1.00 0.00 ? 43  ARG A CB   4  
ATOM 4931  C CG   . ARG A 1 43  ? -3.053  2.215   -9.899  1.00 0.00 ? 43  ARG A CG   4  
ATOM 4932  C CD   . ARG A 1 43  ? -3.417  2.661   -11.307 1.00 0.00 ? 43  ARG A CD   4  
ATOM 4933  N NE   . ARG A 1 43  ? -2.734  1.869   -12.326 1.00 0.00 ? 43  ARG A NE   4  
ATOM 4934  C CZ   . ARG A 1 43  ? -2.723  2.185   -13.616 1.00 0.00 ? 43  ARG A CZ   4  
ATOM 4935  N NH1  . ARG A 1 43  ? -3.353  3.270   -14.042 1.00 0.00 ? 43  ARG A NH1  4  
ATOM 4936  N NH2  . ARG A 1 43  ? -2.079  1.413   -14.483 1.00 0.00 ? 43  ARG A NH2  4  
ATOM 4937  H H    . ARG A 1 43  ? -1.309  3.657   -7.324  1.00 0.00 ? 43  ARG A H    4  
ATOM 4938  H HA   . ARG A 1 43  ? -2.962  5.017   -9.321  1.00 0.00 ? 43  ARG A HA   4  
ATOM 4939  H HB2  . ARG A 1 43  ? -3.868  2.480   -7.958  1.00 0.00 ? 43  ARG A HB2  4  
ATOM 4940  H HB3  . ARG A 1 43  ? -4.701  3.370   -9.226  1.00 0.00 ? 43  ARG A HB3  4  
ATOM 4941  H HG2  . ARG A 1 43  ? -1.982  2.290   -9.776  1.00 0.00 ? 43  ARG A HG2  4  
ATOM 4942  H HG3  . ARG A 1 43  ? -3.362  1.189   -9.765  1.00 0.00 ? 43  ARG A HG3  4  
ATOM 4943  H HD2  . ARG A 1 43  ? -4.483  2.557   -11.438 1.00 0.00 ? 43  ARG A HD2  4  
ATOM 4944  H HD3  . ARG A 1 43  ? -3.140  3.698   -11.424 1.00 0.00 ? 43  ARG A HD3  4  
ATOM 4945  H HE   . ARG A 1 43  ? -2.262  1.063   -12.033 1.00 0.00 ? 43  ARG A HE   4  
ATOM 4946  H HH11 . ARG A 1 43  ? -3.838  3.854   -13.391 1.00 0.00 ? 43  ARG A HH11 4  
ATOM 4947  H HH12 . ARG A 1 43  ? -3.342  3.506   -15.014 1.00 0.00 ? 43  ARG A HH12 4  
ATOM 4948  H HH21 . ARG A 1 43  ? -1.602  0.594   -14.166 1.00 0.00 ? 43  ARG A HH21 4  
ATOM 4949  H HH22 . ARG A 1 43  ? -2.071  1.651   -15.454 1.00 0.00 ? 43  ARG A HH22 4  
ATOM 4950  N N    . ILE A 1 44  ? -4.637  5.790   -7.534  1.00 0.00 ? 44  ILE A N    4  
ATOM 4951  C CA   . ILE A 1 44  ? -5.339  6.499   -6.471  1.00 0.00 ? 44  ILE A CA   4  
ATOM 4952  C C    . ILE A 1 44  ? -6.851  6.384   -6.640  1.00 0.00 ? 44  ILE A C    4  
ATOM 4953  O O    . ILE A 1 44  ? -7.387  6.640   -7.718  1.00 0.00 ? 44  ILE A O    4  
ATOM 4954  C CB   . ILE A 1 44  ? -4.950  7.988   -6.434  1.00 0.00 ? 44  ILE A CB   4  
ATOM 4955  C CG1  . ILE A 1 44  ? -3.546  8.156   -5.850  1.00 0.00 ? 44  ILE A CG1  4  
ATOM 4956  C CG2  . ILE A 1 44  ? -5.965  8.781   -5.626  1.00 0.00 ? 44  ILE A CG2  4  
ATOM 4957  C CD1  . ILE A 1 44  ? -3.145  9.601   -5.648  1.00 0.00 ? 44  ILE A CD1  4  
ATOM 4958  H H    . ILE A 1 44  ? -4.948  5.884   -8.458  1.00 0.00 ? 44  ILE A H    4  
ATOM 4959  H HA   . ILE A 1 44  ? -5.058  6.050   -5.529  1.00 0.00 ? 44  ILE A HA   4  
ATOM 4960  H HB   . ILE A 1 44  ? -4.958  8.364   -7.446  1.00 0.00 ? 44  ILE A HB   4  
ATOM 4961  H HG12 . ILE A 1 44  ? -3.501  7.663   -4.892  1.00 0.00 ? 44  ILE A HG12 4  
ATOM 4962  H HG13 . ILE A 1 44  ? -2.829  7.702   -6.518  1.00 0.00 ? 44  ILE A HG13 4  
ATOM 4963  H HG21 . ILE A 1 44  ? -5.448  9.480   -4.984  1.00 0.00 ? 44  ILE A HG21 4  
ATOM 4964  H HG22 . ILE A 1 44  ? -6.615  9.323   -6.296  1.00 0.00 ? 44  ILE A HG22 4  
ATOM 4965  H HG23 . ILE A 1 44  ? -6.552  8.105   -5.022  1.00 0.00 ? 44  ILE A HG23 4  
ATOM 4966  H HD11 . ILE A 1 44  ? -2.068  9.683   -5.677  1.00 0.00 ? 44  ILE A HD11 4  
ATOM 4967  H HD12 . ILE A 1 44  ? -3.575  10.207  -6.430  1.00 0.00 ? 44  ILE A HD12 4  
ATOM 4968  H HD13 . ILE A 1 44  ? -3.505  9.944   -4.688  1.00 0.00 ? 44  ILE A HD13 4  
ATOM 4969  N N    . VAL A 1 45  ? -7.533  5.998   -5.566  1.00 0.00 ? 45  VAL A N    4  
ATOM 4970  C CA   . VAL A 1 45  ? -8.983  5.852   -5.593  1.00 0.00 ? 45  VAL A CA   4  
ATOM 4971  C C    . VAL A 1 45  ? -9.672  7.212   -5.607  1.00 0.00 ? 45  VAL A C    4  
ATOM 4972  O O    . VAL A 1 45  ? -9.136  8.198   -5.101  1.00 0.00 ? 45  VAL A O    4  
ATOM 4973  C CB   . VAL A 1 45  ? -9.489  5.045   -4.383  1.00 0.00 ? 45  VAL A CB   4  
ATOM 4974  C CG1  . VAL A 1 45  ? -8.720  3.739   -4.253  1.00 0.00 ? 45  VAL A CG1  4  
ATOM 4975  C CG2  . VAL A 1 45  ? -9.377  5.869   -3.109  1.00 0.00 ? 45  VAL A CG2  4  
ATOM 4976  H H    . VAL A 1 45  ? -7.049  5.808   -4.735  1.00 0.00 ? 45  VAL A H    4  
ATOM 4977  H HA   . VAL A 1 45  ? -9.248  5.316   -6.493  1.00 0.00 ? 45  VAL A HA   4  
ATOM 4978  H HB   . VAL A 1 45  ? -10.531 4.809   -4.543  1.00 0.00 ? 45  VAL A HB   4  
ATOM 4979  H HG11 . VAL A 1 45  ? -7.774  3.926   -3.765  1.00 0.00 ? 45  VAL A HG11 4  
ATOM 4980  H HG12 . VAL A 1 45  ? -9.296  3.038   -3.666  1.00 0.00 ? 45  VAL A HG12 4  
ATOM 4981  H HG13 . VAL A 1 45  ? -8.542  3.327   -5.235  1.00 0.00 ? 45  VAL A HG13 4  
ATOM 4982  H HG21 . VAL A 1 45  ? -9.031  6.862   -3.353  1.00 0.00 ? 45  VAL A HG21 4  
ATOM 4983  H HG22 . VAL A 1 45  ? -10.345 5.932   -2.634  1.00 0.00 ? 45  VAL A HG22 4  
ATOM 4984  H HG23 . VAL A 1 45  ? -8.676  5.398   -2.436  1.00 0.00 ? 45  VAL A HG23 4  
ATOM 4985  N N    . THR A 1 46  ? -10.866 7.259   -6.190  1.00 0.00 ? 46  THR A N    4  
ATOM 4986  C CA   . THR A 1 46  ? -11.629 8.497   -6.271  1.00 0.00 ? 46  THR A CA   4  
ATOM 4987  C C    . THR A 1 46  ? -13.113 8.246   -6.030  1.00 0.00 ? 46  THR A C    4  
ATOM 4988  O O    . THR A 1 46  ? -13.606 7.136   -6.235  1.00 0.00 ? 46  THR A O    4  
ATOM 4989  C CB   . THR A 1 46  ? -11.452 9.178   -7.642  1.00 0.00 ? 46  THR A CB   4  
ATOM 4990  O OG1  . THR A 1 46  ? -11.862 8.290   -8.687  1.00 0.00 ? 46  THR A OG1  4  
ATOM 4991  C CG2  . THR A 1 46  ? -10.003 9.589   -7.858  1.00 0.00 ? 46  THR A CG2  4  
ATOM 4992  H H    . THR A 1 46  ? -11.241 6.439   -6.576  1.00 0.00 ? 46  THR A H    4  
ATOM 4993  H HA   . THR A 1 46  ? -11.259 9.168   -5.509  1.00 0.00 ? 46  THR A HA   4  
ATOM 4994  H HB   . THR A 1 46  ? -12.070 10.064  -7.669  1.00 0.00 ? 46  THR A HB   4  
ATOM 4995  H HG1  . THR A 1 46  ? -11.948 8.780   -9.508  1.00 0.00 ? 46  THR A HG1  4  
ATOM 4996  H HG21 . THR A 1 46  ? -9.440  8.745   -8.227  1.00 0.00 ? 46  THR A HG21 4  
ATOM 4997  H HG22 . THR A 1 46  ? -9.580  9.923   -6.922  1.00 0.00 ? 46  THR A HG22 4  
ATOM 4998  H HG23 . THR A 1 46  ? -9.961  10.392  -8.579  1.00 0.00 ? 46  THR A HG23 4  
ATOM 4999  N N    . ASP A 1 47  ? -13.821 9.282   -5.595  1.00 0.00 ? 47  ASP A N    4  
ATOM 5000  C CA   . ASP A 1 47  ? -15.251 9.173   -5.327  1.00 0.00 ? 47  ASP A CA   4  
ATOM 5001  C C    . ASP A 1 47  ? -16.050 9.207   -6.626  1.00 0.00 ? 47  ASP A C    4  
ATOM 5002  O O    . ASP A 1 47  ? -15.604 9.768   -7.627  1.00 0.00 ? 47  ASP A O    4  
ATOM 5003  C CB   . ASP A 1 47  ? -15.706 10.304  -4.404  1.00 0.00 ? 47  ASP A CB   4  
ATOM 5004  C CG   . ASP A 1 47  ? -17.161 10.171  -3.999  1.00 0.00 ? 47  ASP A CG   4  
ATOM 5005  O OD1  . ASP A 1 47  ? -17.622 9.025   -3.813  1.00 0.00 ? 47  ASP A OD1  4  
ATOM 5006  O OD2  . ASP A 1 47  ? -17.839 11.212  -3.869  1.00 0.00 ? 47  ASP A OD2  4  
ATOM 5007  H H    . ASP A 1 47  ? -13.372 10.141  -5.450  1.00 0.00 ? 47  ASP A H    4  
ATOM 5008  H HA   . ASP A 1 47  ? -15.425 8.228   -4.836  1.00 0.00 ? 47  ASP A HA   4  
ATOM 5009  H HB2  . ASP A 1 47  ? -15.100 10.296  -3.510  1.00 0.00 ? 47  ASP A HB2  4  
ATOM 5010  H HB3  . ASP A 1 47  ? -15.577 11.249  -4.912  1.00 0.00 ? 47  ASP A HB3  4  
ATOM 5011  N N    . ARG A 1 48  ? -17.234 8.602   -6.602  1.00 0.00 ? 48  ARG A N    4  
ATOM 5012  C CA   . ARG A 1 48  ? -18.094 8.561   -7.778  1.00 0.00 ? 48  ARG A CA   4  
ATOM 5013  C C    . ARG A 1 48  ? -19.017 9.776   -7.820  1.00 0.00 ? 48  ARG A C    4  
ATOM 5014  O O    . ARG A 1 48  ? -19.529 10.141  -8.877  1.00 0.00 ? 48  ARG A O    4  
ATOM 5015  C CB   . ARG A 1 48  ? -18.925 7.276   -7.784  1.00 0.00 ? 48  ARG A CB   4  
ATOM 5016  C CG   . ARG A 1 48  ? -19.806 7.125   -9.013  1.00 0.00 ? 48  ARG A CG   4  
ATOM 5017  C CD   . ARG A 1 48  ? -19.015 6.608   -10.205 1.00 0.00 ? 48  ARG A CD   4  
ATOM 5018  N NE   . ARG A 1 48  ? -19.809 6.609   -11.431 1.00 0.00 ? 48  ARG A NE   4  
ATOM 5019  C CZ   . ARG A 1 48  ? -20.725 5.689   -11.714 1.00 0.00 ? 48  ARG A CZ   4  
ATOM 5020  N NH1  . ARG A 1 48  ? -20.960 4.700   -10.864 1.00 0.00 ? 48  ARG A NH1  4  
ATOM 5021  N NH2  . ARG A 1 48  ? -21.407 5.758   -12.850 1.00 0.00 ? 48  ARG A NH2  4  
ATOM 5022  H H    . ARG A 1 48  ? -17.535 8.173   -5.774  1.00 0.00 ? 48  ARG A H    4  
ATOM 5023  H HA   . ARG A 1 48  ? -17.462 8.574   -8.653  1.00 0.00 ? 48  ARG A HA   4  
ATOM 5024  H HB2  . ARG A 1 48  ? -18.256 6.429   -7.741  1.00 0.00 ? 48  ARG A HB2  4  
ATOM 5025  H HB3  . ARG A 1 48  ? -19.559 7.268   -6.910  1.00 0.00 ? 48  ARG A HB3  4  
ATOM 5026  H HG2  . ARG A 1 48  ? -20.600 6.428   -8.792  1.00 0.00 ? 48  ARG A HG2  4  
ATOM 5027  H HG3  . ARG A 1 48  ? -20.228 8.088   -9.262  1.00 0.00 ? 48  ARG A HG3  4  
ATOM 5028  H HD2  . ARG A 1 48  ? -18.150 7.239   -10.347 1.00 0.00 ? 48  ARG A HD2  4  
ATOM 5029  H HD3  . ARG A 1 48  ? -18.694 5.599   -9.996  1.00 0.00 ? 48  ARG A HD3  4  
ATOM 5030  H HE   . ARG A 1 48  ? -19.652 7.332   -12.073 1.00 0.00 ? 48  ARG A HE   4  
ATOM 5031  H HH11 . ARG A 1 48  ? -20.448 4.646   -10.007 1.00 0.00 ? 48  ARG A HH11 4  
ATOM 5032  H HH12 . ARG A 1 48  ? -21.651 4.009   -11.079 1.00 0.00 ? 48  ARG A HH12 4  
ATOM 5033  H HH21 . ARG A 1 48  ? -21.232 6.503   -13.493 1.00 0.00 ? 48  ARG A HH21 4  
ATOM 5034  H HH22 . ARG A 1 48  ? -22.095 5.066   -13.063 1.00 0.00 ? 48  ARG A HH22 4  
ATOM 5035  N N    . GLU A 1 49  ? -19.224 10.395  -6.662  1.00 0.00 ? 49  GLU A N    4  
ATOM 5036  C CA   . GLU A 1 49  ? -20.086 11.567  -6.567  1.00 0.00 ? 49  GLU A CA   4  
ATOM 5037  C C    . GLU A 1 49  ? -19.287 12.849  -6.786  1.00 0.00 ? 49  GLU A C    4  
ATOM 5038  O O    . GLU A 1 49  ? -19.583 13.633  -7.688  1.00 0.00 ? 49  GLU A O    4  
ATOM 5039  C CB   . GLU A 1 49  ? -20.776 11.611  -5.202  1.00 0.00 ? 49  GLU A CB   4  
ATOM 5040  C CG   . GLU A 1 49  ? -21.912 12.617  -5.126  1.00 0.00 ? 49  GLU A CG   4  
ATOM 5041  C CD   . GLU A 1 49  ? -22.979 12.373  -6.175  1.00 0.00 ? 49  GLU A CD   4  
ATOM 5042  O OE1  . GLU A 1 49  ? -23.423 11.214  -6.312  1.00 0.00 ? 49  GLU A OE1  4  
ATOM 5043  O OE2  . GLU A 1 49  ? -23.370 13.342  -6.860  1.00 0.00 ? 49  GLU A OE2  4  
ATOM 5044  H H    . GLU A 1 49  ? -18.787 10.056  -5.853  1.00 0.00 ? 49  GLU A H    4  
ATOM 5045  H HA   . GLU A 1 49  ? -20.837 11.490  -7.337  1.00 0.00 ? 49  GLU A HA   4  
ATOM 5046  H HB2  . GLU A 1 49  ? -21.175 10.632  -4.982  1.00 0.00 ? 49  GLU A HB2  4  
ATOM 5047  H HB3  . GLU A 1 49  ? -20.044 11.868  -4.450  1.00 0.00 ? 49  GLU A HB3  4  
ATOM 5048  H HG2  . GLU A 1 49  ? -22.368 12.554  -4.149  1.00 0.00 ? 49  GLU A HG2  4  
ATOM 5049  H HG3  . GLU A 1 49  ? -21.507 13.609  -5.269  1.00 0.00 ? 49  GLU A HG3  4  
ATOM 5050  N N    . THR A 1 50  ? -18.271 13.057  -5.953  1.00 0.00 ? 50  THR A N    4  
ATOM 5051  C CA   . THR A 1 50  ? -17.431 14.243  -6.053  1.00 0.00 ? 50  THR A CA   4  
ATOM 5052  C C    . THR A 1 50  ? -16.431 14.113  -7.197  1.00 0.00 ? 50  THR A C    4  
ATOM 5053  O O    . THR A 1 50  ? -16.100 15.095  -7.859  1.00 0.00 ? 50  THR A O    4  
ATOM 5054  C CB   . THR A 1 50  ? -16.663 14.500  -4.743  1.00 0.00 ? 50  THR A CB   4  
ATOM 5055  O OG1  . THR A 1 50  ? -15.699 13.464  -4.528  1.00 0.00 ? 50  THR A OG1  4  
ATOM 5056  C CG2  . THR A 1 50  ? -17.619 14.564  -3.560  1.00 0.00 ? 50  THR A CG2  4  
ATOM 5057  H H    . THR A 1 50  ? -18.085 12.395  -5.254  1.00 0.00 ? 50  THR A H    4  
ATOM 5058  H HA   . THR A 1 50  ? -18.072 15.091  -6.243  1.00 0.00 ? 50  THR A HA   4  
ATOM 5059  H HB   . THR A 1 50  ? -16.151 15.448  -4.824  1.00 0.00 ? 50  THR A HB   4  
ATOM 5060  H HG1  . THR A 1 50  ? -14.991 13.548  -5.171  1.00 0.00 ? 50  THR A HG1  4  
ATOM 5061  H HG21 . THR A 1 50  ? -18.052 15.551  -3.500  1.00 0.00 ? 50  THR A HG21 4  
ATOM 5062  H HG22 . THR A 1 50  ? -17.079 14.351  -2.650  1.00 0.00 ? 50  THR A HG22 4  
ATOM 5063  H HG23 . THR A 1 50  ? -18.403 13.835  -3.693  1.00 0.00 ? 50  THR A HG23 4  
ATOM 5064  N N    . GLY A 1 51  ? -15.954 12.893  -7.424  1.00 0.00 ? 51  GLY A N    4  
ATOM 5065  C CA   . GLY A 1 51  ? -14.997 12.657  -8.489  1.00 0.00 ? 51  GLY A CA   4  
ATOM 5066  C C    . GLY A 1 51  ? -13.618 13.194  -8.159  1.00 0.00 ? 51  GLY A C    4  
ATOM 5067  O O    . GLY A 1 51  ? -12.944 13.762  -9.018  1.00 0.00 ? 51  GLY A O    4  
ATOM 5068  H H    . GLY A 1 51  ? -16.254 12.147  -6.864  1.00 0.00 ? 51  GLY A H    4  
ATOM 5069  H HA2  . GLY A 1 51  ? -14.925 11.594  -8.665  1.00 0.00 ? 51  GLY A HA2  4  
ATOM 5070  H HA3  . GLY A 1 51  ? -15.351 13.138  -9.389  1.00 0.00 ? 51  GLY A HA3  4  
ATOM 5071  N N    . SER A 1 52  ? -13.198 13.016  -6.911  1.00 0.00 ? 52  SER A N    4  
ATOM 5072  C CA   . SER A 1 52  ? -11.893 13.492  -6.468  1.00 0.00 ? 52  SER A CA   4  
ATOM 5073  C C    . SER A 1 52  ? -11.148 12.402  -5.703  1.00 0.00 ? 52  SER A C    4  
ATOM 5074  O O    . SER A 1 52  ? -11.690 11.326  -5.449  1.00 0.00 ? 52  SER A O    4  
ATOM 5075  C CB   . SER A 1 52  ? -12.051 14.733  -5.586  1.00 0.00 ? 52  SER A CB   4  
ATOM 5076  O OG   . SER A 1 52  ? -10.831 15.446  -5.486  1.00 0.00 ? 52  SER A OG   4  
ATOM 5077  H H    . SER A 1 52  ? -13.782 12.555  -6.272  1.00 0.00 ? 52  SER A H    4  
ATOM 5078  H HA   . SER A 1 52  ? -11.321 13.755  -7.345  1.00 0.00 ? 52  SER A HA   4  
ATOM 5079  H HB2  . SER A 1 52  ? -12.800 15.382  -6.014  1.00 0.00 ? 52  SER A HB2  4  
ATOM 5080  H HB3  . SER A 1 52  ? -12.360 14.430  -4.596  1.00 0.00 ? 52  SER A HB3  4  
ATOM 5081  H HG   . SER A 1 52  ? -10.298 15.279  -6.267  1.00 0.00 ? 52  SER A HG   4  
ATOM 5082  N N    . SER A 1 53  ? -9.903  12.690  -5.338  1.00 0.00 ? 53  SER A N    4  
ATOM 5083  C CA   . SER A 1 53  ? -9.081  11.734  -4.606  1.00 0.00 ? 53  SER A CA   4  
ATOM 5084  C C    . SER A 1 53  ? -9.602  11.546  -3.184  1.00 0.00 ? 53  SER A C    4  
ATOM 5085  O O    . SER A 1 53  ? -9.594  12.477  -2.379  1.00 0.00 ? 53  SER A O    4  
ATOM 5086  C CB   . SER A 1 53  ? -7.625  12.203  -4.569  1.00 0.00 ? 53  SER A CB   4  
ATOM 5087  O OG   . SER A 1 53  ? -6.969  11.740  -3.402  1.00 0.00 ? 53  SER A OG   4  
ATOM 5088  H H    . SER A 1 53  ? -9.527  13.565  -5.570  1.00 0.00 ? 53  SER A H    4  
ATOM 5089  H HA   . SER A 1 53  ? -9.132  10.788  -5.123  1.00 0.00 ? 53  SER A HA   4  
ATOM 5090  H HB2  . SER A 1 53  ? -7.105  11.823  -5.435  1.00 0.00 ? 53  SER A HB2  4  
ATOM 5091  H HB3  . SER A 1 53  ? -7.598  13.284  -4.578  1.00 0.00 ? 53  SER A HB3  4  
ATOM 5092  H HG   . SER A 1 53  ? -6.460  10.953  -3.612  1.00 0.00 ? 53  SER A HG   4  
ATOM 5093  N N    . LYS A 1 54  ? -10.056 10.334  -2.882  1.00 0.00 ? 54  LYS A N    4  
ATOM 5094  C CA   . LYS A 1 54  ? -10.581 10.021  -1.559  1.00 0.00 ? 54  LYS A CA   4  
ATOM 5095  C C    . LYS A 1 54  ? -9.507  10.202  -0.491  1.00 0.00 ? 54  LYS A C    4  
ATOM 5096  O O    . LYS A 1 54  ? -9.742  10.834  0.538   1.00 0.00 ? 54  LYS A O    4  
ATOM 5097  C CB   . LYS A 1 54  ? -11.113 8.587   -1.525  1.00 0.00 ? 54  LYS A CB   4  
ATOM 5098  C CG   . LYS A 1 54  ? -12.352 8.377   -2.378  1.00 0.00 ? 54  LYS A CG   4  
ATOM 5099  C CD   . LYS A 1 54  ? -13.013 7.041   -2.083  1.00 0.00 ? 54  LYS A CD   4  
ATOM 5100  C CE   . LYS A 1 54  ? -14.141 6.749   -3.061  1.00 0.00 ? 54  LYS A CE   4  
ATOM 5101  N NZ   . LYS A 1 54  ? -15.441 7.299   -2.588  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 5102  H H    . LYS A 1 54  ? -10.037 9.633   -3.567  1.00 0.00 ? 54  LYS A H    4  
ATOM 5103  H HA   . LYS A 1 54  ? -11.393 10.702  -1.354  1.00 0.00 ? 54  LYS A HA   4  
ATOM 5104  H HB2  . LYS A 1 54  ? -10.340 7.920   -1.879  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 5105  H HB3  . LYS A 1 54  ? -11.357 8.330   -0.504  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 5106  H HG2  . LYS A 1 54  ? -13.057 9.168   -2.174  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 5107  H HG3  . LYS A 1 54  ? -12.068 8.405   -3.421  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 5108  H HD2  . LYS A 1 54  ? -12.273 6.258   -2.160  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 5109  H HD3  . LYS A 1 54  ? -13.414 7.062   -1.079  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 5110  H HE2  . LYS A 1 54  ? -13.897 7.192   -4.014  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 5111  H HE3  . LYS A 1 54  ? -14.232 5.678   -3.174  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 5112  H HZ1  . LYS A 1 54  ? -15.543 7.144   -1.565  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 5113  H HZ2  . LYS A 1 54  ? -16.228 6.828   -3.079  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 5114  H HZ3  . LYS A 1 54  ? -15.488 8.320   -2.780  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 5115  N N    . GLY A 1 55  ? -8.327  9.643   -0.744  1.00 0.00 ? 55  GLY A N    4  
ATOM 5116  C CA   . GLY A 1 55  ? -7.235  9.756   0.205   1.00 0.00 ? 55  GLY A CA   4  
ATOM 5117  C C    . GLY A 1 55  ? -6.507  8.441   0.410   1.00 0.00 ? 55  GLY A C    4  
ATOM 5118  O O    . GLY A 1 55  ? -6.025  8.155   1.506   1.00 0.00 ? 55  GLY A O    4  
ATOM 5119  H H    . GLY A 1 55  ? -8.198  9.151   -1.582  1.00 0.00 ? 55  GLY A H    4  
ATOM 5120  H HA2  . GLY A 1 55  ? -6.532  10.491  -0.157  1.00 0.00 ? 55  GLY A HA2  4  
ATOM 5121  H HA3  . GLY A 1 55  ? -7.630  10.087  1.154   1.00 0.00 ? 55  GLY A HA3  4  
ATOM 5122  N N    . PHE A 1 56  ? -6.429  7.639   -0.647  1.00 0.00 ? 56  PHE A N    4  
ATOM 5123  C CA   . PHE A 1 56  ? -5.758  6.347   -0.577  1.00 0.00 ? 56  PHE A CA   4  
ATOM 5124  C C    . PHE A 1 56  ? -5.692  5.693   -1.954  1.00 0.00 ? 56  PHE A C    4  
ATOM 5125  O O    . PHE A 1 56  ? -6.551  5.924   -2.805  1.00 0.00 ? 56  PHE A O    4  
ATOM 5126  C CB   . PHE A 1 56  ? -6.484  5.423   0.404   1.00 0.00 ? 56  PHE A CB   4  
ATOM 5127  C CG   . PHE A 1 56  ? -7.902  5.125   0.009   1.00 0.00 ? 56  PHE A CG   4  
ATOM 5128  C CD1  . PHE A 1 56  ? -8.916  6.029   0.283   1.00 0.00 ? 56  PHE A CD1  4  
ATOM 5129  C CD2  . PHE A 1 56  ? -8.221  3.941   -0.636  1.00 0.00 ? 56  PHE A CD2  4  
ATOM 5130  C CE1  . PHE A 1 56  ? -10.222 5.757   -0.079  1.00 0.00 ? 56  PHE A CE1  4  
ATOM 5131  C CE2  . PHE A 1 56  ? -9.525  3.664   -1.001  1.00 0.00 ? 56  PHE A CE2  4  
ATOM 5132  C CZ   . PHE A 1 56  ? -10.527 4.573   -0.722  1.00 0.00 ? 56  PHE A CZ   4  
ATOM 5133  H H    . PHE A 1 56  ? -6.834  7.923   -1.494  1.00 0.00 ? 56  PHE A H    4  
ATOM 5134  H HA   . PHE A 1 56  ? -4.753  6.515   -0.223  1.00 0.00 ? 56  PHE A HA   4  
ATOM 5135  H HB2  . PHE A 1 56  ? -5.953  4.485   0.464   1.00 0.00 ? 56  PHE A HB2  4  
ATOM 5136  H HB3  . PHE A 1 56  ? -6.500  5.887   1.378   1.00 0.00 ? 56  PHE A HB3  4  
ATOM 5137  H HD1  . PHE A 1 56  ? -8.679  6.955   0.785   1.00 0.00 ? 56  PHE A HD1  4  
ATOM 5138  H HD2  . PHE A 1 56  ? -7.438  3.229   -0.855  1.00 0.00 ? 56  PHE A HD2  4  
ATOM 5139  H HE1  . PHE A 1 56  ? -11.003 6.469   0.140   1.00 0.00 ? 56  PHE A HE1  4  
ATOM 5140  H HE2  . PHE A 1 56  ? -9.760  2.737   -1.504  1.00 0.00 ? 56  PHE A HE2  4  
ATOM 5141  H HZ   . PHE A 1 56  ? -11.546 4.358   -1.006  1.00 0.00 ? 56  PHE A HZ   4  
ATOM 5142  N N    . GLY A 1 57  ? -4.665  4.875   -2.167  1.00 0.00 ? 57  GLY A N    4  
ATOM 5143  C CA   . GLY A 1 57  ? -4.505  4.201   -3.442  1.00 0.00 ? 57  GLY A CA   4  
ATOM 5144  C C    . GLY A 1 57  ? -3.706  2.919   -3.323  1.00 0.00 ? 57  GLY A C    4  
ATOM 5145  O O    . GLY A 1 57  ? -3.664  2.301   -2.259  1.00 0.00 ? 57  GLY A O    4  
ATOM 5146  H H    . GLY A 1 57  ? -4.011  4.729   -1.452  1.00 0.00 ? 57  GLY A H    4  
ATOM 5147  H HA2  . GLY A 1 57  ? -5.482  3.969   -3.839  1.00 0.00 ? 57  GLY A HA2  4  
ATOM 5148  H HA3  . GLY A 1 57  ? -3.998  4.866   -4.126  1.00 0.00 ? 57  GLY A HA3  4  
ATOM 5149  N N    . PHE A 1 58  ? -3.071  2.515   -4.419  1.00 0.00 ? 58  PHE A N    4  
ATOM 5150  C CA   . PHE A 1 58  ? -2.271  1.296   -4.434  1.00 0.00 ? 58  PHE A CA   4  
ATOM 5151  C C    . PHE A 1 58  ? -0.978  1.503   -5.217  1.00 0.00 ? 58  PHE A C    4  
ATOM 5152  O O    . PHE A 1 58  ? -0.960  2.196   -6.235  1.00 0.00 ? 58  PHE A O    4  
ATOM 5153  C CB   . PHE A 1 58  ? -3.072  0.144   -5.045  1.00 0.00 ? 58  PHE A CB   4  
ATOM 5154  C CG   . PHE A 1 58  ? -4.370  -0.125  -4.339  1.00 0.00 ? 58  PHE A CG   4  
ATOM 5155  C CD1  . PHE A 1 58  ? -5.453  0.723   -4.507  1.00 0.00 ? 58  PHE A CD1  4  
ATOM 5156  C CD2  . PHE A 1 58  ? -4.508  -1.225  -3.508  1.00 0.00 ? 58  PHE A CD2  4  
ATOM 5157  C CE1  . PHE A 1 58  ? -6.649  0.479   -3.858  1.00 0.00 ? 58  PHE A CE1  4  
ATOM 5158  C CE2  . PHE A 1 58  ? -5.701  -1.474  -2.857  1.00 0.00 ? 58  PHE A CE2  4  
ATOM 5159  C CZ   . PHE A 1 58  ? -6.773  -0.622  -3.033  1.00 0.00 ? 58  PHE A CZ   4  
ATOM 5160  H H    . PHE A 1 58  ? -3.143  3.050   -5.237  1.00 0.00 ? 58  PHE A H    4  
ATOM 5161  H HA   . PHE A 1 58  ? -2.024  1.050   -3.413  1.00 0.00 ? 58  PHE A HA   4  
ATOM 5162  H HB2  . PHE A 1 58  ? -3.296  0.377   -6.074  1.00 0.00 ? 58  PHE A HB2  4  
ATOM 5163  H HB3  . PHE A 1 58  ? -2.478  -0.757  -5.005  1.00 0.00 ? 58  PHE A HB3  4  
ATOM 5164  H HD1  . PHE A 1 58  ? -5.358  1.583   -5.153  1.00 0.00 ? 58  PHE A HD1  4  
ATOM 5165  H HD2  . PHE A 1 58  ? -3.669  -1.893  -3.370  1.00 0.00 ? 58  PHE A HD2  4  
ATOM 5166  H HE1  . PHE A 1 58  ? -7.486  1.146   -3.998  1.00 0.00 ? 58  PHE A HE1  4  
ATOM 5167  H HE2  . PHE A 1 58  ? -5.795  -2.336  -2.212  1.00 0.00 ? 58  PHE A HE2  4  
ATOM 5168  H HZ   . PHE A 1 58  ? -7.706  -0.815  -2.525  1.00 0.00 ? 58  PHE A HZ   4  
ATOM 5169  N N    . VAL A 1 59  ? 0.102   0.898   -4.734  1.00 0.00 ? 59  VAL A N    4  
ATOM 5170  C CA   . VAL A 1 59  ? 1.400   1.015   -5.388  1.00 0.00 ? 59  VAL A CA   4  
ATOM 5171  C C    . VAL A 1 59  ? 1.843   -0.321  -5.974  1.00 0.00 ? 59  VAL A C    4  
ATOM 5172  O O    . VAL A 1 59  ? 2.143   -1.263  -5.241  1.00 0.00 ? 59  VAL A O    4  
ATOM 5173  C CB   . VAL A 1 59  ? 2.479   1.516   -4.409  1.00 0.00 ? 59  VAL A CB   4  
ATOM 5174  C CG1  . VAL A 1 59  ? 3.811   1.685   -5.123  1.00 0.00 ? 59  VAL A CG1  4  
ATOM 5175  C CG2  . VAL A 1 59  ? 2.043   2.821   -3.760  1.00 0.00 ? 59  VAL A CG2  4  
ATOM 5176  H H    . VAL A 1 59  ? 0.025   0.360   -3.919  1.00 0.00 ? 59  VAL A H    4  
ATOM 5177  H HA   . VAL A 1 59  ? 1.307   1.736   -6.188  1.00 0.00 ? 59  VAL A HA   4  
ATOM 5178  H HB   . VAL A 1 59  ? 2.603   0.776   -3.633  1.00 0.00 ? 59  VAL A HB   4  
ATOM 5179  H HG11 . VAL A 1 59  ? 4.012   0.809   -5.721  1.00 0.00 ? 59  VAL A HG11 4  
ATOM 5180  H HG12 . VAL A 1 59  ? 3.771   2.556   -5.761  1.00 0.00 ? 59  VAL A HG12 4  
ATOM 5181  H HG13 . VAL A 1 59  ? 4.597   1.809   -4.393  1.00 0.00 ? 59  VAL A HG13 4  
ATOM 5182  H HG21 . VAL A 1 59  ? 0.965   2.872   -3.744  1.00 0.00 ? 59  VAL A HG21 4  
ATOM 5183  H HG22 . VAL A 1 59  ? 2.420   2.864   -2.748  1.00 0.00 ? 59  VAL A HG22 4  
ATOM 5184  H HG23 . VAL A 1 59  ? 2.435   3.654   -4.325  1.00 0.00 ? 59  VAL A HG23 4  
ATOM 5185  N N    . ASP A 1 60  ? 1.881   -0.395  -7.300  1.00 0.00 ? 60  ASP A N    4  
ATOM 5186  C CA   . ASP A 1 60  ? 2.289   -1.615  -7.986  1.00 0.00 ? 60  ASP A CA   4  
ATOM 5187  C C    . ASP A 1 60  ? 3.804   -1.785  -7.939  1.00 0.00 ? 60  ASP A C    4  
ATOM 5188  O O    . ASP A 1 60  ? 4.552   -0.817  -8.078  1.00 0.00 ? 60  ASP A O    4  
ATOM 5189  C CB   . ASP A 1 60  ? 1.811   -1.594  -9.439  1.00 0.00 ? 60  ASP A CB   4  
ATOM 5190  C CG   . ASP A 1 60  ? 0.426   -0.995  -9.583  1.00 0.00 ? 60  ASP A CG   4  
ATOM 5191  O OD1  . ASP A 1 60  ? -0.351  -1.052  -8.607  1.00 0.00 ? 60  ASP A OD1  4  
ATOM 5192  O OD2  . ASP A 1 60  ? 0.118   -0.467  -10.672 1.00 0.00 ? 60  ASP A OD2  4  
ATOM 5193  H H    . ASP A 1 60  ? 1.630   0.391   -7.830  1.00 0.00 ? 60  ASP A H    4  
ATOM 5194  H HA   . ASP A 1 60  ? 1.830   -2.450  -7.478  1.00 0.00 ? 60  ASP A HA   4  
ATOM 5195  H HB2  . ASP A 1 60  ? 2.500   -1.007  -10.029 1.00 0.00 ? 60  ASP A HB2  4  
ATOM 5196  H HB3  . ASP A 1 60  ? 1.788   -2.604  -9.818  1.00 0.00 ? 60  ASP A HB3  4  
ATOM 5197  N N    . PHE A 1 61  ? 4.251   -3.021  -7.741  1.00 0.00 ? 61  PHE A N    4  
ATOM 5198  C CA   . PHE A 1 61  ? 5.677   -3.317  -7.673  1.00 0.00 ? 61  PHE A CA   4  
ATOM 5199  C C    . PHE A 1 61  ? 6.021   -4.533  -8.529  1.00 0.00 ? 61  PHE A C    4  
ATOM 5200  O O    . PHE A 1 61  ? 5.234   -5.473  -8.636  1.00 0.00 ? 61  PHE A O    4  
ATOM 5201  C CB   . PHE A 1 61  ? 6.100   -3.564  -6.224  1.00 0.00 ? 61  PHE A CB   4  
ATOM 5202  C CG   . PHE A 1 61  ? 6.212   -2.306  -5.410  1.00 0.00 ? 61  PHE A CG   4  
ATOM 5203  C CD1  . PHE A 1 61  ? 7.407   -1.607  -5.351  1.00 0.00 ? 61  PHE A CD1  4  
ATOM 5204  C CD2  . PHE A 1 61  ? 5.122   -1.823  -4.704  1.00 0.00 ? 61  PHE A CD2  4  
ATOM 5205  C CE1  . PHE A 1 61  ? 7.513   -0.450  -4.604  1.00 0.00 ? 61  PHE A CE1  4  
ATOM 5206  C CE2  . PHE A 1 61  ? 5.223   -0.666  -3.955  1.00 0.00 ? 61  PHE A CE2  4  
ATOM 5207  C CZ   . PHE A 1 61  ? 6.420   0.021   -3.904  1.00 0.00 ? 61  PHE A CZ   4  
ATOM 5208  H H    . PHE A 1 61  ? 3.605   -3.751  -7.637  1.00 0.00 ? 61  PHE A H    4  
ATOM 5209  H HA   . PHE A 1 61  ? 6.211   -2.461  -8.055  1.00 0.00 ? 61  PHE A HA   4  
ATOM 5210  H HB2  . PHE A 1 61  ? 5.372   -4.203  -5.747  1.00 0.00 ? 61  PHE A HB2  4  
ATOM 5211  H HB3  . PHE A 1 61  ? 7.062   -4.053  -6.215  1.00 0.00 ? 61  PHE A HB3  4  
ATOM 5212  H HD1  . PHE A 1 61  ? 8.264   -1.975  -5.898  1.00 0.00 ? 61  PHE A HD1  4  
ATOM 5213  H HD2  . PHE A 1 61  ? 4.186   -2.359  -4.741  1.00 0.00 ? 61  PHE A HD2  4  
ATOM 5214  H HE1  . PHE A 1 61  ? 8.451   0.085   -4.566  1.00 0.00 ? 61  PHE A HE1  4  
ATOM 5215  H HE2  . PHE A 1 61  ? 4.366   -0.300  -3.408  1.00 0.00 ? 61  PHE A HE2  4  
ATOM 5216  H HZ   . PHE A 1 61  ? 6.501   0.926   -3.320  1.00 0.00 ? 61  PHE A HZ   4  
ATOM 5217  N N    . ASN A 1 62  ? 7.202   -4.506  -9.137  1.00 0.00 ? 62  ASN A N    4  
ATOM 5218  C CA   . ASN A 1 62  ? 7.651   -5.605  -9.984  1.00 0.00 ? 62  ASN A CA   4  
ATOM 5219  C C    . ASN A 1 62  ? 7.390   -6.950  -9.314  1.00 0.00 ? 62  ASN A C    4  
ATOM 5220  O O    . ASN A 1 62  ? 7.139   -7.951  -9.986  1.00 0.00 ? 62  ASN A O    4  
ATOM 5221  C CB   . ASN A 1 62  ? 9.142   -5.459  -10.297 1.00 0.00 ? 62  ASN A CB   4  
ATOM 5222  C CG   . ASN A 1 62  ? 9.394   -4.609  -11.527 1.00 0.00 ? 62  ASN A CG   4  
ATOM 5223  O OD1  . ASN A 1 62  ? 8.819   -4.848  -12.589 1.00 0.00 ? 62  ASN A OD1  4  
ATOM 5224  N ND2  . ASN A 1 62  ? 10.258  -3.610  -11.388 1.00 0.00 ? 62  ASN A ND2  4  
ATOM 5225  H H    . ASN A 1 62  ? 7.786   -3.729  -9.013  1.00 0.00 ? 62  ASN A H    4  
ATOM 5226  H HA   . ASN A 1 62  ? 7.093   -5.561  -10.907 1.00 0.00 ? 62  ASN A HA   4  
ATOM 5227  H HB2  . ASN A 1 62  ? 9.636   -4.996  -9.455  1.00 0.00 ? 62  ASN A HB2  4  
ATOM 5228  H HB3  . ASN A 1 62  ? 9.566   -6.438  -10.464 1.00 0.00 ? 62  ASN A HB3  4  
ATOM 5229  H HD21 . ASN A 1 62  ? 10.679  -3.479  -10.513 1.00 0.00 ? 62  ASN A HD21 4  
ATOM 5230  H HD22 . ASN A 1 62  ? 10.440  -3.044  -12.167 1.00 0.00 ? 62  ASN A HD22 4  
ATOM 5231  N N    . SER A 1 63  ? 7.450   -6.966  -7.987  1.00 0.00 ? 63  SER A N    4  
ATOM 5232  C CA   . SER A 1 63  ? 7.223   -8.189  -7.225  1.00 0.00 ? 63  SER A CA   4  
ATOM 5233  C C    . SER A 1 63  ? 7.005   -7.876  -5.748  1.00 0.00 ? 63  SER A C    4  
ATOM 5234  O O    . SER A 1 63  ? 7.345   -6.792  -5.276  1.00 0.00 ? 63  SER A O    4  
ATOM 5235  C CB   . SER A 1 63  ? 8.408   -9.143  -7.388  1.00 0.00 ? 63  SER A CB   4  
ATOM 5236  O OG   . SER A 1 63  ? 8.410   -9.739  -8.673  1.00 0.00 ? 63  SER A OG   4  
ATOM 5237  H H    . SER A 1 63  ? 7.655   -6.135  -7.508  1.00 0.00 ? 63  SER A H    4  
ATOM 5238  H HA   . SER A 1 63  ? 6.334   -8.662  -7.616  1.00 0.00 ? 63  SER A HA   4  
ATOM 5239  H HB2  . SER A 1 63  ? 9.328   -8.595  -7.257  1.00 0.00 ? 63  SER A HB2  4  
ATOM 5240  H HB3  . SER A 1 63  ? 8.343   -9.922  -6.642  1.00 0.00 ? 63  SER A HB3  4  
ATOM 5241  H HG   . SER A 1 63  ? 7.627   -10.286 -8.774  1.00 0.00 ? 63  SER A HG   4  
ATOM 5242  N N    . GLU A 1 64  ? 6.436   -8.835  -5.024  1.00 0.00 ? 64  GLU A N    4  
ATOM 5243  C CA   . GLU A 1 64  ? 6.172   -8.662  -3.601  1.00 0.00 ? 64  GLU A CA   4  
ATOM 5244  C C    . GLU A 1 64  ? 7.415   -8.158  -2.874  1.00 0.00 ? 64  GLU A C    4  
ATOM 5245  O O    . GLU A 1 64  ? 7.331   -7.286  -2.011  1.00 0.00 ? 64  GLU A O    4  
ATOM 5246  C CB   . GLU A 1 64  ? 5.706   -9.982  -2.982  1.00 0.00 ? 64  GLU A CB   4  
ATOM 5247  C CG   . GLU A 1 64  ? 4.242   -10.294 -3.244  1.00 0.00 ? 64  GLU A CG   4  
ATOM 5248  C CD   . GLU A 1 64  ? 3.965   -11.783 -3.306  1.00 0.00 ? 64  GLU A CD   4  
ATOM 5249  O OE1  . GLU A 1 64  ? 4.691   -12.550 -2.640  1.00 0.00 ? 64  GLU A OE1  4  
ATOM 5250  O OE2  . GLU A 1 64  ? 3.020   -12.181 -4.019  1.00 0.00 ? 64  GLU A OE2  4  
ATOM 5251  H H    . GLU A 1 64  ? 6.187   -9.678  -5.458  1.00 0.00 ? 64  GLU A H    4  
ATOM 5252  H HA   . GLU A 1 64  ? 5.387   -7.929  -3.496  1.00 0.00 ? 64  GLU A HA   4  
ATOM 5253  H HB2  . GLU A 1 64  ? 6.302   -10.786 -3.387  1.00 0.00 ? 64  GLU A HB2  4  
ATOM 5254  H HB3  . GLU A 1 64  ? 5.857   -9.937  -1.913  1.00 0.00 ? 64  GLU A HB3  4  
ATOM 5255  H HG2  . GLU A 1 64  ? 3.648   -9.865  -2.451  1.00 0.00 ? 64  GLU A HG2  4  
ATOM 5256  H HG3  . GLU A 1 64  ? 3.956   -9.850  -4.186  1.00 0.00 ? 64  GLU A HG3  4  
ATOM 5257  N N    . GLU A 1 65  ? 8.569   -8.715  -3.231  1.00 0.00 ? 65  GLU A N    4  
ATOM 5258  C CA   . GLU A 1 65  ? 9.829   -8.323  -2.611  1.00 0.00 ? 65  GLU A CA   4  
ATOM 5259  C C    . GLU A 1 65  ? 10.037  -6.815  -2.709  1.00 0.00 ? 65  GLU A C    4  
ATOM 5260  O O    . GLU A 1 65  ? 10.117  -6.121  -1.695  1.00 0.00 ? 65  GLU A O    4  
ATOM 5261  C CB   . GLU A 1 65  ? 10.998  -9.054  -3.275  1.00 0.00 ? 65  GLU A CB   4  
ATOM 5262  C CG   . GLU A 1 65  ? 11.149  -10.497 -2.823  1.00 0.00 ? 65  GLU A CG   4  
ATOM 5263  C CD   . GLU A 1 65  ? 12.561  -11.020 -3.003  1.00 0.00 ? 65  GLU A CD   4  
ATOM 5264  O OE1  . GLU A 1 65  ? 13.488  -10.449 -2.391  1.00 0.00 ? 65  GLU A OE1  4  
ATOM 5265  O OE2  . GLU A 1 65  ? 12.739  -12.001 -3.755  1.00 0.00 ? 65  GLU A OE2  4  
ATOM 5266  H H    . GLU A 1 65  ? 8.572   -9.406  -3.926  1.00 0.00 ? 65  GLU A H    4  
ATOM 5267  H HA   . GLU A 1 65  ? 9.788   -8.602  -1.569  1.00 0.00 ? 65  GLU A HA   4  
ATOM 5268  H HB2  . GLU A 1 65  ? 10.851  -9.047  -4.345  1.00 0.00 ? 65  GLU A HB2  4  
ATOM 5269  H HB3  . GLU A 1 65  ? 11.913  -8.529  -3.044  1.00 0.00 ? 65  GLU A HB3  4  
ATOM 5270  H HG2  . GLU A 1 65  ? 10.888  -10.563 -1.778  1.00 0.00 ? 65  GLU A HG2  4  
ATOM 5271  H HG3  . GLU A 1 65  ? 10.476  -11.114 -3.401  1.00 0.00 ? 65  GLU A HG3  4  
ATOM 5272  N N    . ASP A 1 66  ? 10.125  -6.314  -3.936  1.00 0.00 ? 66  ASP A N    4  
ATOM 5273  C CA   . ASP A 1 66  ? 10.323  -4.888  -4.168  1.00 0.00 ? 66  ASP A CA   4  
ATOM 5274  C C    . ASP A 1 66  ? 9.376   -4.060  -3.305  1.00 0.00 ? 66  ASP A C    4  
ATOM 5275  O O    . ASP A 1 66  ? 9.776   -3.059  -2.711  1.00 0.00 ? 66  ASP A O    4  
ATOM 5276  C CB   . ASP A 1 66  ? 10.109  -4.554  -5.645  1.00 0.00 ? 66  ASP A CB   4  
ATOM 5277  C CG   . ASP A 1 66  ? 11.335  -4.847  -6.488  1.00 0.00 ? 66  ASP A CG   4  
ATOM 5278  O OD1  . ASP A 1 66  ? 11.498  -6.010  -6.913  1.00 0.00 ? 66  ASP A OD1  4  
ATOM 5279  O OD2  . ASP A 1 66  ? 12.132  -3.914  -6.721  1.00 0.00 ? 66  ASP A OD2  4  
ATOM 5280  H H    . ASP A 1 66  ? 10.053  -6.918  -4.705  1.00 0.00 ? 66  ASP A H    4  
ATOM 5281  H HA   . ASP A 1 66  ? 11.340  -4.646  -3.897  1.00 0.00 ? 66  ASP A HA   4  
ATOM 5282  H HB2  . ASP A 1 66  ? 9.286   -5.142  -6.025  1.00 0.00 ? 66  ASP A HB2  4  
ATOM 5283  H HB3  . ASP A 1 66  ? 9.871   -3.505  -5.740  1.00 0.00 ? 66  ASP A HB3  4  
ATOM 5284  N N    . ALA A 1 67  ? 8.118   -4.485  -3.241  1.00 0.00 ? 67  ALA A N    4  
ATOM 5285  C CA   . ALA A 1 67  ? 7.114   -3.784  -2.450  1.00 0.00 ? 67  ALA A CA   4  
ATOM 5286  C C    . ALA A 1 67  ? 7.526   -3.707  -0.984  1.00 0.00 ? 67  ALA A C    4  
ATOM 5287  O O    . ALA A 1 67  ? 7.474   -2.642  -0.368  1.00 0.00 ? 67  ALA A O    4  
ATOM 5288  C CB   . ALA A 1 67  ? 5.763   -4.470  -2.585  1.00 0.00 ? 67  ALA A CB   4  
ATOM 5289  H H    . ALA A 1 67  ? 7.860   -5.290  -3.736  1.00 0.00 ? 67  ALA A H    4  
ATOM 5290  H HA   . ALA A 1 67  ? 7.022   -2.781  -2.841  1.00 0.00 ? 67  ALA A HA   4  
ATOM 5291  H HB1  . ALA A 1 67  ? 5.355   -4.270  -3.566  1.00 0.00 ? 67  ALA A HB1  4  
ATOM 5292  H HB2  . ALA A 1 67  ? 5.885   -5.535  -2.456  1.00 0.00 ? 67  ALA A HB2  4  
ATOM 5293  H HB3  . ALA A 1 67  ? 5.090   -4.090  -1.831  1.00 0.00 ? 67  ALA A HB3  4  
ATOM 5294  N N    . LYS A 1 68  ? 7.935   -4.843  -0.428  1.00 0.00 ? 68  LYS A N    4  
ATOM 5295  C CA   . LYS A 1 68  ? 8.356   -4.905  0.966   1.00 0.00 ? 68  LYS A CA   4  
ATOM 5296  C C    . LYS A 1 68  ? 9.489   -3.919  1.236   1.00 0.00 ? 68  LYS A C    4  
ATOM 5297  O O    . LYS A 1 68  ? 9.417   -3.117  2.167   1.00 0.00 ? 68  LYS A O    4  
ATOM 5298  C CB   . LYS A 1 68  ? 8.806   -6.324  1.322   1.00 0.00 ? 68  LYS A CB   4  
ATOM 5299  C CG   . LYS A 1 68  ? 8.952   -6.559  2.815   1.00 0.00 ? 68  LYS A CG   4  
ATOM 5300  C CD   . LYS A 1 68  ? 9.830   -7.764  3.106   1.00 0.00 ? 68  LYS A CD   4  
ATOM 5301  C CE   . LYS A 1 68  ? 10.506  -7.647  4.464   1.00 0.00 ? 68  LYS A CE   4  
ATOM 5302  N NZ   . LYS A 1 68  ? 11.799  -8.385  4.506   1.00 0.00 ? 68  LYS A NZ   4  
ATOM 5303  H H    . LYS A 1 68  ? 7.955   -5.660  -0.970  1.00 0.00 ? 68  LYS A H    4  
ATOM 5304  H HA   . LYS A 1 68  ? 7.510   -4.640  1.581   1.00 0.00 ? 68  LYS A HA   4  
ATOM 5305  H HB2  . LYS A 1 68  ? 8.080   -7.025  0.938   1.00 0.00 ? 68  LYS A HB2  4  
ATOM 5306  H HB3  . LYS A 1 68  ? 9.761   -6.514  0.853   1.00 0.00 ? 68  LYS A HB3  4  
ATOM 5307  H HG2  . LYS A 1 68  ? 9.398   -5.685  3.266   1.00 0.00 ? 68  LYS A HG2  4  
ATOM 5308  H HG3  . LYS A 1 68  ? 7.973   -6.727  3.242   1.00 0.00 ? 68  LYS A HG3  4  
ATOM 5309  H HD2  . LYS A 1 68  ? 9.220   -8.655  3.097   1.00 0.00 ? 68  LYS A HD2  4  
ATOM 5310  H HD3  . LYS A 1 68  ? 10.590  -7.839  2.341   1.00 0.00 ? 68  LYS A HD3  4  
ATOM 5311  H HE2  . LYS A 1 68  ? 10.690  -6.604  4.671   1.00 0.00 ? 68  LYS A HE2  4  
ATOM 5312  H HE3  . LYS A 1 68  ? 9.846   -8.052  5.216   1.00 0.00 ? 68  LYS A HE3  4  
ATOM 5313  H HZ1  . LYS A 1 68  ? 12.521  -7.814  4.990   1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 5314  H HZ2  . LYS A 1 68  ? 12.125  -8.589  3.540   1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 5315  H HZ3  . LYS A 1 68  ? 11.682  -9.282  5.018   1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 5316  N N    . ALA A 1 69  ? 10.532  -3.984  0.416   1.00 0.00 ? 69  ALA A N    4  
ATOM 5317  C CA   . ALA A 1 69  ? 11.678  -3.095  0.565   1.00 0.00 ? 69  ALA A CA   4  
ATOM 5318  C C    . ALA A 1 69  ? 11.231  -1.643  0.702   1.00 0.00 ? 69  ALA A C    4  
ATOM 5319  O O    . ALA A 1 69  ? 11.913  -0.830  1.326   1.00 0.00 ? 69  ALA A O    4  
ATOM 5320  C CB   . ALA A 1 69  ? 12.623  -3.250  -0.616  1.00 0.00 ? 69  ALA A CB   4  
ATOM 5321  H H    . ALA A 1 69  ? 10.531  -4.645  -0.307  1.00 0.00 ? 69  ALA A H    4  
ATOM 5322  H HA   . ALA A 1 69  ? 12.210  -3.383  1.461   1.00 0.00 ? 69  ALA A HA   4  
ATOM 5323  H HB1  . ALA A 1 69  ? 12.314  -2.588  -1.413  1.00 0.00 ? 69  ALA A HB1  4  
ATOM 5324  H HB2  . ALA A 1 69  ? 13.627  -2.998  -0.309  1.00 0.00 ? 69  ALA A HB2  4  
ATOM 5325  H HB3  . ALA A 1 69  ? 12.598  -4.271  -0.966  1.00 0.00 ? 69  ALA A HB3  4  
ATOM 5326  N N    . ALA A 1 70  ? 10.083  -1.324  0.113   1.00 0.00 ? 70  ALA A N    4  
ATOM 5327  C CA   . ALA A 1 70  ? 9.546   0.030   0.171   1.00 0.00 ? 70  ALA A CA   4  
ATOM 5328  C C    . ALA A 1 70  ? 8.696   0.230   1.421   1.00 0.00 ? 70  ALA A C    4  
ATOM 5329  O O    . ALA A 1 70  ? 8.595   1.340   1.944   1.00 0.00 ? 70  ALA A O    4  
ATOM 5330  C CB   . ALA A 1 70  ? 8.729   0.327   -1.078  1.00 0.00 ? 70  ALA A CB   4  
ATOM 5331  H H    . ALA A 1 70  ? 9.585   -2.016  -0.370  1.00 0.00 ? 70  ALA A H    4  
ATOM 5332  H HA   . ALA A 1 70  ? 10.378  0.718   0.199   1.00 0.00 ? 70  ALA A HA   4  
ATOM 5333  H HB1  . ALA A 1 70  ? 7.703   0.519   -0.800  1.00 0.00 ? 70  ALA A HB1  4  
ATOM 5334  H HB2  . ALA A 1 70  ? 9.136   1.194   -1.576  1.00 0.00 ? 70  ALA A HB2  4  
ATOM 5335  H HB3  . ALA A 1 70  ? 8.769   -0.522  -1.744  1.00 0.00 ? 70  ALA A HB3  4  
ATOM 5336  N N    . LYS A 1 71  ? 8.084   -0.850  1.895   1.00 0.00 ? 71  LYS A N    4  
ATOM 5337  C CA   . LYS A 1 71  ? 7.243   -0.794  3.084   1.00 0.00 ? 71  LYS A CA   4  
ATOM 5338  C C    . LYS A 1 71  ? 8.076   -0.502  4.327   1.00 0.00 ? 71  LYS A C    4  
ATOM 5339  O O    . LYS A 1 71  ? 7.708   0.336   5.149   1.00 0.00 ? 71  LYS A O    4  
ATOM 5340  C CB   . LYS A 1 71  ? 6.487   -2.113  3.261   1.00 0.00 ? 71  LYS A CB   4  
ATOM 5341  C CG   . LYS A 1 71  ? 5.634   -2.160  4.517   1.00 0.00 ? 71  LYS A CG   4  
ATOM 5342  C CD   . LYS A 1 71  ? 4.458   -3.110  4.357   1.00 0.00 ? 71  LYS A CD   4  
ATOM 5343  C CE   . LYS A 1 71  ? 4.870   -4.553  4.607   1.00 0.00 ? 71  LYS A CE   4  
ATOM 5344  N NZ   . LYS A 1 71  ? 5.145   -4.810  6.048   1.00 0.00 ? 71  LYS A NZ   4  
ATOM 5345  H H    . LYS A 1 71  ? 8.203   -1.707  1.433   1.00 0.00 ? 71  LYS A H    4  
ATOM 5346  H HA   . LYS A 1 71  ? 6.529   0.005   2.948   1.00 0.00 ? 71  LYS A HA   4  
ATOM 5347  H HB2  . LYS A 1 71  ? 5.842   -2.262  2.408   1.00 0.00 ? 71  LYS A HB2  4  
ATOM 5348  H HB3  . LYS A 1 71  ? 7.202   -2.921  3.307   1.00 0.00 ? 71  LYS A HB3  4  
ATOM 5349  H HG2  . LYS A 1 71  ? 6.243   -2.495  5.343   1.00 0.00 ? 71  LYS A HG2  4  
ATOM 5350  H HG3  . LYS A 1 71  ? 5.258   -1.168  4.724   1.00 0.00 ? 71  LYS A HG3  4  
ATOM 5351  H HD2  . LYS A 1 71  ? 3.689   -2.839  5.065   1.00 0.00 ? 71  LYS A HD2  4  
ATOM 5352  H HD3  . LYS A 1 71  ? 4.071   -3.024  3.352   1.00 0.00 ? 71  LYS A HD3  4  
ATOM 5353  H HE2  . LYS A 1 71  ? 4.072   -5.202  4.281   1.00 0.00 ? 71  LYS A HE2  4  
ATOM 5354  H HE3  . LYS A 1 71  ? 5.761   -4.763  4.035   1.00 0.00 ? 71  LYS A HE3  4  
ATOM 5355  H HZ1  . LYS A 1 71  ? 4.511   -5.552  6.406   1.00 0.00 ? 71  LYS A HZ1  4  
ATOM 5356  H HZ2  . LYS A 1 71  ? 4.992   -3.943  6.601   1.00 0.00 ? 71  LYS A HZ2  4  
ATOM 5357  H HZ3  . LYS A 1 71  ? 6.130   -5.119  6.174   1.00 0.00 ? 71  LYS A HZ3  4  
ATOM 5358  N N    . GLU A 1 72  ? 9.201   -1.198  4.457   1.00 0.00 ? 72  GLU A N    4  
ATOM 5359  C CA   . GLU A 1 72  ? 10.087  -1.012  5.600   1.00 0.00 ? 72  GLU A CA   4  
ATOM 5360  C C    . GLU A 1 72  ? 10.586  0.428   5.673   1.00 0.00 ? 72  GLU A C    4  
ATOM 5361  O O    . GLU A 1 72  ? 10.788  0.972   6.759   1.00 0.00 ? 72  GLU A O    4  
ATOM 5362  C CB   . GLU A 1 72  ? 11.276  -1.972  5.514   1.00 0.00 ? 72  GLU A CB   4  
ATOM 5363  C CG   . GLU A 1 72  ? 10.877  -3.411  5.235   1.00 0.00 ? 72  GLU A CG   4  
ATOM 5364  C CD   . GLU A 1 72  ? 10.686  -4.220  6.504   1.00 0.00 ? 72  GLU A CD   4  
ATOM 5365  O OE1  . GLU A 1 72  ? 9.620   -4.086  7.139   1.00 0.00 ? 72  GLU A OE1  4  
ATOM 5366  O OE2  . GLU A 1 72  ? 11.605  -4.988  6.861   1.00 0.00 ? 72  GLU A OE2  4  
ATOM 5367  H H    . GLU A 1 72  ? 9.441   -1.853  3.767   1.00 0.00 ? 72  GLU A H    4  
ATOM 5368  H HA   . GLU A 1 72  ? 9.524   -1.231  6.495   1.00 0.00 ? 72  GLU A HA   4  
ATOM 5369  H HB2  . GLU A 1 72  ? 11.933  -1.642  4.723   1.00 0.00 ? 72  GLU A HB2  4  
ATOM 5370  H HB3  . GLU A 1 72  ? 11.813  -1.944  6.451   1.00 0.00 ? 72  GLU A HB3  4  
ATOM 5371  H HG2  . GLU A 1 72  ? 9.950   -3.414  4.682   1.00 0.00 ? 72  GLU A HG2  4  
ATOM 5372  H HG3  . GLU A 1 72  ? 11.650  -3.877  4.642   1.00 0.00 ? 72  GLU A HG3  4  
ATOM 5373  N N    . ALA A 1 73  ? 10.783  1.039   4.510   1.00 0.00 ? 73  ALA A N    4  
ATOM 5374  C CA   . ALA A 1 73  ? 11.257  2.416   4.441   1.00 0.00 ? 73  ALA A CA   4  
ATOM 5375  C C    . ALA A 1 73  ? 10.118  3.401   4.680   1.00 0.00 ? 73  ALA A C    4  
ATOM 5376  O O    . ALA A 1 73  ? 10.175  4.219   5.597   1.00 0.00 ? 73  ALA A O    4  
ATOM 5377  C CB   . ALA A 1 73  ? 11.913  2.682   3.094   1.00 0.00 ? 73  ALA A CB   4  
ATOM 5378  H H    . ALA A 1 73  ? 10.605  0.553   3.678   1.00 0.00 ? 73  ALA A H    4  
ATOM 5379  H HA   . ALA A 1 73  ? 12.004  2.551   5.210   1.00 0.00 ? 73  ALA A HA   4  
ATOM 5380  H HB1  . ALA A 1 73  ? 12.203  1.743   2.644   1.00 0.00 ? 73  ALA A HB1  4  
ATOM 5381  H HB2  . ALA A 1 73  ? 11.215  3.191   2.448   1.00 0.00 ? 73  ALA A HB2  4  
ATOM 5382  H HB3  . ALA A 1 73  ? 12.789  3.298   3.236   1.00 0.00 ? 73  ALA A HB3  4  
ATOM 5383  N N    . MET A 1 74  ? 9.085   3.317   3.848   1.00 0.00 ? 74  MET A N    4  
ATOM 5384  C CA   . MET A 1 74  ? 7.932   4.201   3.970   1.00 0.00 ? 74  MET A CA   4  
ATOM 5385  C C    . MET A 1 74  ? 7.027   3.760   5.116   1.00 0.00 ? 74  MET A C    4  
ATOM 5386  O O    . MET A 1 74  ? 5.943   4.309   5.309   1.00 0.00 ? 74  MET A O    4  
ATOM 5387  C CB   . MET A 1 74  ? 7.141   4.227   2.661   1.00 0.00 ? 74  MET A CB   4  
ATOM 5388  C CG   . MET A 1 74  ? 7.674   5.227   1.648   1.00 0.00 ? 74  MET A CG   4  
ATOM 5389  S SD   . MET A 1 74  ? 7.470   6.936   2.185   1.00 0.00 ? 74  MET A SD   4  
ATOM 5390  C CE   . MET A 1 74  ? 5.698   7.133   2.020   1.00 0.00 ? 74  MET A CE   4  
ATOM 5391  H H    . MET A 1 74  ? 9.097   2.644   3.136   1.00 0.00 ? 74  MET A H    4  
ATOM 5392  H HA   . MET A 1 74  ? 8.298   5.196   4.179   1.00 0.00 ? 74  MET A HA   4  
ATOM 5393  H HB2  . MET A 1 74  ? 7.172   3.244   2.216   1.00 0.00 ? 74  MET A HB2  4  
ATOM 5394  H HB3  . MET A 1 74  ? 6.114   4.482   2.879   1.00 0.00 ? 74  MET A HB3  4  
ATOM 5395  H HG2  . MET A 1 74  ? 8.726   5.036   1.493   1.00 0.00 ? 74  MET A HG2  4  
ATOM 5396  H HG3  . MET A 1 74  ? 7.145   5.090   0.716   1.00 0.00 ? 74  MET A HG3  4  
ATOM 5397  H HE1  . MET A 1 74  ? 5.388   8.037   2.524   1.00 0.00 ? 74  MET A HE1  4  
ATOM 5398  H HE2  . MET A 1 74  ? 5.439   7.199   0.973   1.00 0.00 ? 74  MET A HE2  4  
ATOM 5399  H HE3  . MET A 1 74  ? 5.198   6.284   2.462   1.00 0.00 ? 74  MET A HE3  4  
ATOM 5400  N N    . GLU A 1 75  ? 7.481   2.766   5.874   1.00 0.00 ? 75  GLU A N    4  
ATOM 5401  C CA   . GLU A 1 75  ? 6.710   2.252   7.000   1.00 0.00 ? 75  GLU A CA   4  
ATOM 5402  C C    . GLU A 1 75  ? 6.106   3.394   7.813   1.00 0.00 ? 75  GLU A C    4  
ATOM 5403  O O    . GLU A 1 75  ? 4.937   3.346   8.196   1.00 0.00 ? 75  GLU A O    4  
ATOM 5404  C CB   . GLU A 1 75  ? 7.594   1.384   7.898   1.00 0.00 ? 75  GLU A CB   4  
ATOM 5405  C CG   . GLU A 1 75  ? 8.791   2.124   8.471   1.00 0.00 ? 75  GLU A CG   4  
ATOM 5406  C CD   . GLU A 1 75  ? 9.609   1.266   9.417   1.00 0.00 ? 75  GLU A CD   4  
ATOM 5407  O OE1  . GLU A 1 75  ? 9.012   0.634   10.313  1.00 0.00 ? 75  GLU A OE1  4  
ATOM 5408  O OE2  . GLU A 1 75  ? 10.848  1.225   9.259   1.00 0.00 ? 75  GLU A OE2  4  
ATOM 5409  H H    . GLU A 1 75  ? 8.353   2.370   5.670   1.00 0.00 ? 75  GLU A H    4  
ATOM 5410  H HA   . GLU A 1 75  ? 5.910   1.645   6.604   1.00 0.00 ? 75  GLU A HA   4  
ATOM 5411  H HB2  . GLU A 1 75  ? 6.999   1.013   8.719   1.00 0.00 ? 75  GLU A HB2  4  
ATOM 5412  H HB3  . GLU A 1 75  ? 7.958   0.546   7.321   1.00 0.00 ? 75  GLU A HB3  4  
ATOM 5413  H HG2  . GLU A 1 75  ? 9.426   2.441   7.658   1.00 0.00 ? 75  GLU A HG2  4  
ATOM 5414  H HG3  . GLU A 1 75  ? 8.438   2.991   9.010   1.00 0.00 ? 75  GLU A HG3  4  
ATOM 5415  N N    . ASP A 1 76  ? 6.912   4.418   8.072   1.00 0.00 ? 76  ASP A N    4  
ATOM 5416  C CA   . ASP A 1 76  ? 6.458   5.572   8.839   1.00 0.00 ? 76  ASP A CA   4  
ATOM 5417  C C    . ASP A 1 76  ? 6.556   6.848   8.009   1.00 0.00 ? 76  ASP A C    4  
ATOM 5418  O O    . ASP A 1 76  ? 6.594   7.952   8.551   1.00 0.00 ? 76  ASP A O    4  
ATOM 5419  C CB   . ASP A 1 76  ? 7.283   5.717   10.119  1.00 0.00 ? 76  ASP A CB   4  
ATOM 5420  C CG   . ASP A 1 76  ? 6.967   4.638   11.136  1.00 0.00 ? 76  ASP A CG   4  
ATOM 5421  O OD1  . ASP A 1 76  ? 5.769   4.370   11.365  1.00 0.00 ? 76  ASP A OD1  4  
ATOM 5422  O OD2  . ASP A 1 76  ? 7.919   4.061   11.703  1.00 0.00 ? 76  ASP A OD2  4  
ATOM 5423  H H    . ASP A 1 76  ? 7.834   4.397   7.739   1.00 0.00 ? 76  ASP A H    4  
ATOM 5424  H HA   . ASP A 1 76  ? 5.425   5.409   9.104   1.00 0.00 ? 76  ASP A HA   4  
ATOM 5425  H HB2  . ASP A 1 76  ? 8.333   5.657   9.872   1.00 0.00 ? 76  ASP A HB2  4  
ATOM 5426  H HB3  . ASP A 1 76  ? 7.077   6.679   10.565  1.00 0.00 ? 76  ASP A HB3  4  
ATOM 5427  N N    . GLY A 1 77  ? 6.597   6.688   6.689   1.00 0.00 ? 77  GLY A N    4  
ATOM 5428  C CA   . GLY A 1 77  ? 6.691   7.836   5.806   1.00 0.00 ? 77  GLY A CA   4  
ATOM 5429  C C    . GLY A 1 77  ? 5.380   8.587   5.690   1.00 0.00 ? 77  GLY A C    4  
ATOM 5430  O O    . GLY A 1 77  ? 4.323   8.060   6.033   1.00 0.00 ? 77  GLY A O    4  
ATOM 5431  H H    . GLY A 1 77  ? 6.562   5.784   6.313   1.00 0.00 ? 77  GLY A H    4  
ATOM 5432  H HA2  . GLY A 1 77  ? 7.447   8.507   6.185   1.00 0.00 ? 77  GLY A HA2  4  
ATOM 5433  H HA3  . GLY A 1 77  ? 6.986   7.496   4.824   1.00 0.00 ? 77  GLY A HA3  4  
ATOM 5434  N N    . GLU A 1 78  ? 5.449   9.824   5.205   1.00 0.00 ? 78  GLU A N    4  
ATOM 5435  C CA   . GLU A 1 78  ? 4.257   10.649  5.048   1.00 0.00 ? 78  GLU A CA   4  
ATOM 5436  C C    . GLU A 1 78  ? 4.286   11.398  3.718   1.00 0.00 ? 78  GLU A C    4  
ATOM 5437  O O    . GLU A 1 78  ? 5.173   12.216  3.473   1.00 0.00 ? 78  GLU A O    4  
ATOM 5438  C CB   . GLU A 1 78  ? 4.143   11.645  6.204   1.00 0.00 ? 78  GLU A CB   4  
ATOM 5439  C CG   . GLU A 1 78  ? 5.438   12.381  6.503   1.00 0.00 ? 78  GLU A CG   4  
ATOM 5440  C CD   . GLU A 1 78  ? 5.276   13.431  7.585   1.00 0.00 ? 78  GLU A CD   4  
ATOM 5441  O OE1  . GLU A 1 78  ? 4.415   13.244  8.470   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 5442  O OE2  . GLU A 1 78  ? 6.011   14.441  7.546   1.00 0.00 ? 78  GLU A OE2  4  
ATOM 5443  H H    . GLU A 1 78  ? 6.321   10.189  4.948   1.00 0.00 ? 78  GLU A H    4  
ATOM 5444  H HA   . GLU A 1 78  ? 3.397   9.997   5.061   1.00 0.00 ? 78  GLU A HA   4  
ATOM 5445  H HB2  . GLU A 1 78  ? 3.385   12.375  5.961   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 5446  H HB3  . GLU A 1 78  ? 3.844   11.112  7.094   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 5447  H HG2  . GLU A 1 78  ? 6.178   11.665  6.827   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 5448  H HG3  . GLU A 1 78  ? 5.779   12.866  5.600   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 5449  N N    . ILE A 1 79  ? 3.309   11.111  2.864   1.00 0.00 ? 79  ILE A N    4  
ATOM 5450  C CA   . ILE A 1 79  ? 3.222   11.757  1.560   1.00 0.00 ? 79  ILE A CA   4  
ATOM 5451  C C    . ILE A 1 79  ? 2.426   13.055  1.642   1.00 0.00 ? 79  ILE A C    4  
ATOM 5452  O O    . ILE A 1 79  ? 1.415   13.132  2.339   1.00 0.00 ? 79  ILE A O    4  
ATOM 5453  C CB   . ILE A 1 79  ? 2.569   10.832  0.516   1.00 0.00 ? 79  ILE A CB   4  
ATOM 5454  C CG1  . ILE A 1 79  ? 3.201   9.440   0.570   1.00 0.00 ? 79  ILE A CG1  4  
ATOM 5455  C CG2  . ILE A 1 79  ? 2.703   11.428  -0.877  1.00 0.00 ? 79  ILE A CG2  4  
ATOM 5456  C CD1  . ILE A 1 79  ? 2.656   8.488   -0.472  1.00 0.00 ? 79  ILE A CD1  4  
ATOM 5457  H H    . ILE A 1 79  ? 2.631   10.451  3.116   1.00 0.00 ? 79  ILE A H    4  
ATOM 5458  H HA   . ILE A 1 79  ? 4.227   11.983  1.232   1.00 0.00 ? 79  ILE A HA   4  
ATOM 5459  H HB   . ILE A 1 79  ? 1.518   10.752  0.747   1.00 0.00 ? 79  ILE A HB   4  
ATOM 5460  H HG12 . ILE A 1 79  ? 4.264   9.528   0.414   1.00 0.00 ? 79  ILE A HG12 4  
ATOM 5461  H HG13 . ILE A 1 79  ? 3.018   9.007   1.543   1.00 0.00 ? 79  ILE A HG13 4  
ATOM 5462  H HG21 . ILE A 1 79  ? 3.530   10.959  -1.390  1.00 0.00 ? 79  ILE A HG21 4  
ATOM 5463  H HG22 . ILE A 1 79  ? 1.793   11.255  -1.432  1.00 0.00 ? 79  ILE A HG22 4  
ATOM 5464  H HG23 . ILE A 1 79  ? 2.882   12.489  -0.800  1.00 0.00 ? 79  ILE A HG23 4  
ATOM 5465  H HD11 . ILE A 1 79  ? 3.468   7.918   -0.899  1.00 0.00 ? 79  ILE A HD11 4  
ATOM 5466  H HD12 . ILE A 1 79  ? 1.946   7.818   -0.012  1.00 0.00 ? 79  ILE A HD12 4  
ATOM 5467  H HD13 . ILE A 1 79  ? 2.165   9.052   -1.252  1.00 0.00 ? 79  ILE A HD13 4  
ATOM 5468  N N    . ASP A 1 80  ? 2.888   14.072  0.923   1.00 0.00 ? 80  ASP A N    4  
ATOM 5469  C CA   . ASP A 1 80  ? 2.218   15.367  0.911   1.00 0.00 ? 80  ASP A CA   4  
ATOM 5470  C C    . ASP A 1 80  ? 2.002   15.880  2.331   1.00 0.00 ? 80  ASP A C    4  
ATOM 5471  O O    . ASP A 1 80  ? 0.949   16.429  2.651   1.00 0.00 ? 80  ASP A O    4  
ATOM 5472  C CB   . ASP A 1 80  ? 0.876   15.264  0.183   1.00 0.00 ? 80  ASP A CB   4  
ATOM 5473  C CG   . ASP A 1 80  ? 0.319   16.622  -0.197  1.00 0.00 ? 80  ASP A CG   4  
ATOM 5474  O OD1  . ASP A 1 80  ? 1.104   17.591  -0.257  1.00 0.00 ? 80  ASP A OD1  4  
ATOM 5475  O OD2  . ASP A 1 80  ? -0.903  16.715  -0.436  1.00 0.00 ? 80  ASP A OD2  4  
ATOM 5476  H H    . ASP A 1 80  ? 3.699   13.949  0.386   1.00 0.00 ? 80  ASP A H    4  
ATOM 5477  H HA   . ASP A 1 80  ? 2.851   16.063  0.382   1.00 0.00 ? 80  ASP A HA   4  
ATOM 5478  H HB2  . ASP A 1 80  ? 1.007   14.684  -0.719  1.00 0.00 ? 80  ASP A HB2  4  
ATOM 5479  H HB3  . ASP A 1 80  ? 0.163   14.769  0.826   1.00 0.00 ? 80  ASP A HB3  4  
ATOM 5480  N N    . GLY A 1 81  ? 3.009   15.697  3.181   1.00 0.00 ? 81  GLY A N    4  
ATOM 5481  C CA   . GLY A 1 81  ? 2.909   16.146  4.557   1.00 0.00 ? 81  GLY A CA   4  
ATOM 5482  C C    . GLY A 1 81  ? 1.830   15.412  5.329   1.00 0.00 ? 81  GLY A C    4  
ATOM 5483  O O    . GLY A 1 81  ? 1.320   15.918  6.328   1.00 0.00 ? 81  GLY A O    4  
ATOM 5484  H H    . GLY A 1 81  ? 3.826   15.253  2.870   1.00 0.00 ? 81  GLY A H    4  
ATOM 5485  H HA2  . GLY A 1 81  ? 3.859   15.986  5.046   1.00 0.00 ? 81  GLY A HA2  4  
ATOM 5486  H HA3  . GLY A 1 81  ? 2.685   17.202  4.564   1.00 0.00 ? 81  GLY A HA3  4  
ATOM 5487  N N    . ASN A 1 82  ? 1.481   14.217  4.865   1.00 0.00 ? 82  ASN A N    4  
ATOM 5488  C CA   . ASN A 1 82  ? 0.454   13.413  5.518   1.00 0.00 ? 82  ASN A CA   4  
ATOM 5489  C C    . ASN A 1 82  ? 0.940   11.984  5.739   1.00 0.00 ? 82  ASN A C    4  
ATOM 5490  O O    . ASN A 1 82  ? 1.523   11.369  4.846   1.00 0.00 ? 82  ASN A O    4  
ATOM 5491  C CB   . ASN A 1 82  ? -0.826  13.405  4.680   1.00 0.00 ? 82  ASN A CB   4  
ATOM 5492  C CG   . ASN A 1 82  ? -1.713  14.601  4.967   1.00 0.00 ? 82  ASN A CG   4  
ATOM 5493  O OD1  . ASN A 1 82  ? -1.506  15.321  5.943   1.00 0.00 ? 82  ASN A OD1  4  
ATOM 5494  N ND2  . ASN A 1 82  ? -2.708  14.817  4.114   1.00 0.00 ? 82  ASN A ND2  4  
ATOM 5495  H H    . ASN A 1 82  ? 1.925   13.866  4.064   1.00 0.00 ? 82  ASN A H    4  
ATOM 5496  H HA   . ASN A 1 82  ? 0.243   13.862  6.477   1.00 0.00 ? 82  ASN A HA   4  
ATOM 5497  H HB2  . ASN A 1 82  ? -0.563  13.420  3.632   1.00 0.00 ? 82  ASN A HB2  4  
ATOM 5498  H HB3  . ASN A 1 82  ? -1.384  12.506  4.894   1.00 0.00 ? 82  ASN A HB3  4  
ATOM 5499  H HD21 . ASN A 1 82  ? -2.813  14.202  3.358   1.00 0.00 ? 82  ASN A HD21 4  
ATOM 5500  H HD22 . ASN A 1 82  ? -3.296  15.584  4.275   1.00 0.00 ? 82  ASN A HD22 4  
ATOM 5501  N N    . LYS A 1 83  ? 0.696   11.460  6.935   1.00 0.00 ? 83  LYS A N    4  
ATOM 5502  C CA   . LYS A 1 83  ? 1.106   10.103  7.275   1.00 0.00 ? 83  LYS A CA   4  
ATOM 5503  C C    . LYS A 1 83  ? 0.344   9.079   6.439   1.00 0.00 ? 83  LYS A C    4  
ATOM 5504  O O    . LYS A 1 83  ? -0.868  9.189   6.258   1.00 0.00 ? 83  LYS A O    4  
ATOM 5505  C CB   . LYS A 1 83  ? 0.873   9.835   8.764   1.00 0.00 ? 83  LYS A CB   4  
ATOM 5506  C CG   . LYS A 1 83  ? 2.008   10.315  9.652   1.00 0.00 ? 83  LYS A CG   4  
ATOM 5507  C CD   . LYS A 1 83  ? 3.160   9.325   9.669   1.00 0.00 ? 83  LYS A CD   4  
ATOM 5508  C CE   . LYS A 1 83  ? 3.942   9.401   10.972  1.00 0.00 ? 83  LYS A CE   4  
ATOM 5509  N NZ   . LYS A 1 83  ? 5.323   8.864   10.822  1.00 0.00 ? 83  LYS A NZ   4  
ATOM 5510  H H    . LYS A 1 83  ? 0.227   12.000  7.606   1.00 0.00 ? 83  LYS A H    4  
ATOM 5511  H HA   . LYS A 1 83  ? 2.160   10.011  7.062   1.00 0.00 ? 83  LYS A HA   4  
ATOM 5512  H HB2  . LYS A 1 83  ? -0.033  10.337  9.070   1.00 0.00 ? 83  LYS A HB2  4  
ATOM 5513  H HB3  . LYS A 1 83  ? 0.754   8.772   8.912   1.00 0.00 ? 83  LYS A HB3  4  
ATOM 5514  H HG2  . LYS A 1 83  ? 2.368   11.263  9.281   1.00 0.00 ? 83  LYS A HG2  4  
ATOM 5515  H HG3  . LYS A 1 83  ? 1.636   10.439  10.660  1.00 0.00 ? 83  LYS A HG3  4  
ATOM 5516  H HD2  . LYS A 1 83  ? 2.766   8.326   9.557   1.00 0.00 ? 83  LYS A HD2  4  
ATOM 5517  H HD3  . LYS A 1 83  ? 3.825   9.546   8.846   1.00 0.00 ? 83  LYS A HD3  4  
ATOM 5518  H HE2  . LYS A 1 83  ? 3.998   10.433  11.282  1.00 0.00 ? 83  LYS A HE2  4  
ATOM 5519  H HE3  . LYS A 1 83  ? 3.421   8.827   11.723  1.00 0.00 ? 83  LYS A HE3  4  
ATOM 5520  H HZ1  . LYS A 1 83  ? 5.371   7.894   11.195  1.00 0.00 ? 83  LYS A HZ1  4  
ATOM 5521  H HZ2  . LYS A 1 83  ? 5.996   9.459   11.347  1.00 0.00 ? 83  LYS A HZ2  4  
ATOM 5522  H HZ3  . LYS A 1 83  ? 5.595   8.853   9.819   1.00 0.00 ? 83  LYS A HZ3  4  
ATOM 5523  N N    . VAL A 1 84  ? 1.064   8.082   5.932   1.00 0.00 ? 84  VAL A N    4  
ATOM 5524  C CA   . VAL A 1 84  ? 0.455   7.038   5.118   1.00 0.00 ? 84  VAL A CA   4  
ATOM 5525  C C    . VAL A 1 84  ? 0.726   5.656   5.704   1.00 0.00 ? 84  VAL A C    4  
ATOM 5526  O O    . VAL A 1 84  ? 1.781   5.415   6.292   1.00 0.00 ? 84  VAL A O    4  
ATOM 5527  C CB   . VAL A 1 84  ? 0.977   7.080   3.669   1.00 0.00 ? 84  VAL A CB   4  
ATOM 5528  C CG1  . VAL A 1 84  ? 0.718   8.444   3.048   1.00 0.00 ? 84  VAL A CG1  4  
ATOM 5529  C CG2  . VAL A 1 84  ? 2.459   6.738   3.627   1.00 0.00 ? 84  VAL A CG2  4  
ATOM 5530  H H    . VAL A 1 84  ? 2.027   8.049   6.112   1.00 0.00 ? 84  VAL A H    4  
ATOM 5531  H HA   . VAL A 1 84  ? -0.611  7.207   5.099   1.00 0.00 ? 84  VAL A HA   4  
ATOM 5532  H HB   . VAL A 1 84  ? 0.442   6.340   3.093   1.00 0.00 ? 84  VAL A HB   4  
ATOM 5533  H HG11 . VAL A 1 84  ? -0.347  8.616   2.989   1.00 0.00 ? 84  VAL A HG11 4  
ATOM 5534  H HG12 . VAL A 1 84  ? 1.174   9.210   3.658   1.00 0.00 ? 84  VAL A HG12 4  
ATOM 5535  H HG13 . VAL A 1 84  ? 1.142   8.474   2.055   1.00 0.00 ? 84  VAL A HG13 4  
ATOM 5536  H HG21 . VAL A 1 84  ? 2.773   6.628   2.599   1.00 0.00 ? 84  VAL A HG21 4  
ATOM 5537  H HG22 . VAL A 1 84  ? 3.025   7.531   4.093   1.00 0.00 ? 84  VAL A HG22 4  
ATOM 5538  H HG23 . VAL A 1 84  ? 2.631   5.814   4.157   1.00 0.00 ? 84  VAL A HG23 4  
ATOM 5539  N N    . THR A 1 85  ? -0.233  4.751   5.539   1.00 0.00 ? 85  THR A N    4  
ATOM 5540  C CA   . THR A 1 85  ? -0.099  3.393   6.052   1.00 0.00 ? 85  THR A CA   4  
ATOM 5541  C C    . THR A 1 85  ? -0.059  2.378   4.915   1.00 0.00 ? 85  THR A C    4  
ATOM 5542  O O    . THR A 1 85  ? -1.020  2.242   4.156   1.00 0.00 ? 85  THR A O    4  
ATOM 5543  C CB   . THR A 1 85  ? -1.256  3.036   7.004   1.00 0.00 ? 85  THR A CB   4  
ATOM 5544  O OG1  . THR A 1 85  ? -1.241  3.905   8.141   1.00 0.00 ? 85  THR A OG1  4  
ATOM 5545  C CG2  . THR A 1 85  ? -1.152  1.589   7.463   1.00 0.00 ? 85  THR A CG2  4  
ATOM 5546  H H    . THR A 1 85  ? -1.051  5.004   5.061   1.00 0.00 ? 85  THR A H    4  
ATOM 5547  H HA   . THR A 1 85  ? 0.826   3.336   6.606   1.00 0.00 ? 85  THR A HA   4  
ATOM 5548  H HB   . THR A 1 85  ? -2.190  3.164   6.475   1.00 0.00 ? 85  THR A HB   4  
ATOM 5549  H HG1  . THR A 1 85  ? -1.380  4.811   7.854   1.00 0.00 ? 85  THR A HG1  4  
ATOM 5550  H HG21 . THR A 1 85  ? -0.899  1.562   8.513   1.00 0.00 ? 85  THR A HG21 4  
ATOM 5551  H HG22 . THR A 1 85  ? -0.384  1.086   6.895   1.00 0.00 ? 85  THR A HG22 4  
ATOM 5552  H HG23 . THR A 1 85  ? -2.098  1.094   7.308   1.00 0.00 ? 85  THR A HG23 4  
ATOM 5553  N N    . LEU A 1 86  ? 1.057   1.667   4.803   1.00 0.00 ? 86  LEU A N    4  
ATOM 5554  C CA   . LEU A 1 86  ? 1.222   0.662   3.759   1.00 0.00 ? 86  LEU A CA   4  
ATOM 5555  C C    . LEU A 1 86  ? 0.815   -0.719  4.263   1.00 0.00 ? 86  LEU A C    4  
ATOM 5556  O O    . LEU A 1 86  ? 1.374   -1.225  5.236   1.00 0.00 ? 86  LEU A O    4  
ATOM 5557  C CB   . LEU A 1 86  ? 2.674   0.633   3.276   1.00 0.00 ? 86  LEU A CB   4  
ATOM 5558  C CG   . LEU A 1 86  ? 3.438   1.955   3.369   1.00 0.00 ? 86  LEU A CG   4  
ATOM 5559  C CD1  . LEU A 1 86  ? 4.894   1.758   2.976   1.00 0.00 ? 86  LEU A CD1  4  
ATOM 5560  C CD2  . LEU A 1 86  ? 2.784   3.012   2.492   1.00 0.00 ? 86  LEU A CD2  4  
ATOM 5561  H H    . LEU A 1 86  ? 1.788   1.820   5.437   1.00 0.00 ? 86  LEU A H    4  
ATOM 5562  H HA   . LEU A 1 86  ? 0.582   0.934   2.933   1.00 0.00 ? 86  LEU A HA   4  
ATOM 5563  H HB2  . LEU A 1 86  ? 3.204   -0.098  3.866   1.00 0.00 ? 86  LEU A HB2  4  
ATOM 5564  H HB3  . LEU A 1 86  ? 2.670   0.324   2.240   1.00 0.00 ? 86  LEU A HB3  4  
ATOM 5565  H HG   . LEU A 1 86  ? 3.414   2.305   4.392   1.00 0.00 ? 86  LEU A HG   4  
ATOM 5566  H HD11 . LEU A 1 86  ? 4.961   0.995   2.215   1.00 0.00 ? 86  LEU A HD11 4  
ATOM 5567  H HD12 . LEU A 1 86  ? 5.463   1.454   3.842   1.00 0.00 ? 86  LEU A HD12 4  
ATOM 5568  H HD13 . LEU A 1 86  ? 5.291   2.686   2.592   1.00 0.00 ? 86  LEU A HD13 4  
ATOM 5569  H HD21 . LEU A 1 86  ? 2.040   3.545   3.065   1.00 0.00 ? 86  LEU A HD21 4  
ATOM 5570  H HD22 . LEU A 1 86  ? 2.313   2.535   1.644   1.00 0.00 ? 86  LEU A HD22 4  
ATOM 5571  H HD23 . LEU A 1 86  ? 3.535   3.706   2.144   1.00 0.00 ? 86  LEU A HD23 4  
ATOM 5572  N N    . ASP A 1 87  ? -0.160  -1.324  3.593   1.00 0.00 ? 87  ASP A N    4  
ATOM 5573  C CA   . ASP A 1 87  ? -0.640  -2.648  3.970   1.00 0.00 ? 87  ASP A CA   4  
ATOM 5574  C C    . ASP A 1 87  ? -0.834  -3.527  2.738   1.00 0.00 ? 87  ASP A C    4  
ATOM 5575  O O    . ASP A 1 87  ? -1.353  -3.075  1.718   1.00 0.00 ? 87  ASP A O    4  
ATOM 5576  C CB   . ASP A 1 87  ? -1.953  -2.536  4.745   1.00 0.00 ? 87  ASP A CB   4  
ATOM 5577  C CG   . ASP A 1 87  ? -2.779  -3.805  4.671   1.00 0.00 ? 87  ASP A CG   4  
ATOM 5578  O OD1  . ASP A 1 87  ? -2.509  -4.737  5.458   1.00 0.00 ? 87  ASP A OD1  4  
ATOM 5579  O OD2  . ASP A 1 87  ? -3.697  -3.867  3.826   1.00 0.00 ? 87  ASP A OD2  4  
ATOM 5580  H H    . ASP A 1 87  ? -0.566  -0.869  2.825   1.00 0.00 ? 87  ASP A H    4  
ATOM 5581  H HA   . ASP A 1 87  ? 0.105   -3.102  4.606   1.00 0.00 ? 87  ASP A HA   4  
ATOM 5582  H HB2  . ASP A 1 87  ? -1.735  -2.331  5.783   1.00 0.00 ? 87  ASP A HB2  4  
ATOM 5583  H HB3  . ASP A 1 87  ? -2.536  -1.724  4.337   1.00 0.00 ? 87  ASP A HB3  4  
ATOM 5584  N N    . TRP A 1 88  ? -0.415  -4.783  2.842   1.00 0.00 ? 88  TRP A N    4  
ATOM 5585  C CA   . TRP A 1 88  ? -0.542  -5.725  1.736   1.00 0.00 ? 88  TRP A CA   4  
ATOM 5586  C C    . TRP A 1 88  ? -1.998  -5.863  1.304   1.00 0.00 ? 88  TRP A C    4  
ATOM 5587  O O    . TRP A 1 88  ? -2.847  -6.295  2.083   1.00 0.00 ? 88  TRP A O    4  
ATOM 5588  C CB   . TRP A 1 88  ? 0.017   -7.091  2.135   1.00 0.00 ? 88  TRP A CB   4  
ATOM 5589  C CG   . TRP A 1 88  ? 1.479   -7.062  2.461   1.00 0.00 ? 88  TRP A CG   4  
ATOM 5590  C CD1  . TRP A 1 88  ? 2.060   -7.390  3.653   1.00 0.00 ? 88  TRP A CD1  4  
ATOM 5591  C CD2  . TRP A 1 88  ? 2.546   -6.684  1.584   1.00 0.00 ? 88  TRP A CD2  4  
ATOM 5592  N NE1  . TRP A 1 88  ? 3.423   -7.237  3.570   1.00 0.00 ? 88  TRP A NE1  4  
ATOM 5593  C CE2  . TRP A 1 88  ? 3.746   -6.806  2.311   1.00 0.00 ? 88  TRP A CE2  4  
ATOM 5594  C CE3  . TRP A 1 88  ? 2.603   -6.255  0.255   1.00 0.00 ? 88  TRP A CE3  4  
ATOM 5595  C CZ2  . TRP A 1 88  ? 4.987   -6.514  1.751   1.00 0.00 ? 88  TRP A CZ2  4  
ATOM 5596  C CZ3  . TRP A 1 88  ? 3.836   -5.966  -0.298  1.00 0.00 ? 88  TRP A CZ3  4  
ATOM 5597  C CH2  . TRP A 1 88  ? 5.014   -6.097  0.448   1.00 0.00 ? 88  TRP A CH2  4  
ATOM 5598  H H    . TRP A 1 88  ? -0.009  -5.084  3.682   1.00 0.00 ? 88  TRP A H    4  
ATOM 5599  H HA   . TRP A 1 88  ? 0.032   -5.340  0.906   1.00 0.00 ? 88  TRP A HA   4  
ATOM 5600  H HB2  . TRP A 1 88  ? -0.512  -7.449  3.006   1.00 0.00 ? 88  TRP A HB2  4  
ATOM 5601  H HB3  . TRP A 1 88  ? -0.130  -7.784  1.319   1.00 0.00 ? 88  TRP A HB3  4  
ATOM 5602  H HD1  . TRP A 1 88  ? 1.515   -7.716  4.525   1.00 0.00 ? 88  TRP A HD1  4  
ATOM 5603  H HE1  . TRP A 1 88  ? 4.060   -7.411  4.295   1.00 0.00 ? 88  TRP A HE1  4  
ATOM 5604  H HE3  . TRP A 1 88  ? 1.706   -6.148  -0.337  1.00 0.00 ? 88  TRP A HE3  4  
ATOM 5605  H HZ2  . TRP A 1 88  ? 5.905   -6.610  2.314   1.00 0.00 ? 88  TRP A HZ2  4  
ATOM 5606  H HZ3  . TRP A 1 88  ? 3.900   -5.633  -1.324  1.00 0.00 ? 88  TRP A HZ3  4  
ATOM 5607  H HH2  . TRP A 1 88  ? 5.955   -5.859  -0.024  1.00 0.00 ? 88  TRP A HH2  4  
ATOM 5608  N N    . ALA A 1 89  ? -2.279  -5.496  0.058   1.00 0.00 ? 89  ALA A N    4  
ATOM 5609  C CA   . ALA A 1 89  ? -3.632  -5.582  -0.477  1.00 0.00 ? 89  ALA A CA   4  
ATOM 5610  C C    . ALA A 1 89  ? -4.189  -6.995  -0.337  1.00 0.00 ? 89  ALA A C    4  
ATOM 5611  O O    . ALA A 1 89  ? -3.907  -7.868  -1.158  1.00 0.00 ? 89  ALA A O    4  
ATOM 5612  C CB   . ALA A 1 89  ? -3.652  -5.146  -1.934  1.00 0.00 ? 89  ALA A CB   4  
ATOM 5613  H H    . ALA A 1 89  ? -1.559  -5.160  -0.515  1.00 0.00 ? 89  ALA A H    4  
ATOM 5614  H HA   . ALA A 1 89  ? -4.257  -4.902  0.085   1.00 0.00 ? 89  ALA A HA   4  
ATOM 5615  H HB1  . ALA A 1 89  ? -2.772  -4.556  -2.145  1.00 0.00 ? 89  ALA A HB1  4  
ATOM 5616  H HB2  . ALA A 1 89  ? -3.661  -6.019  -2.570  1.00 0.00 ? 89  ALA A HB2  4  
ATOM 5617  H HB3  . ALA A 1 89  ? -4.536  -4.555  -2.121  1.00 0.00 ? 89  ALA A HB3  4  
ATOM 5618  N N    . LYS A 1 90  ? -4.980  -7.213  0.708   1.00 0.00 ? 90  LYS A N    4  
ATOM 5619  C CA   . LYS A 1 90  ? -5.577  -8.520  0.956   1.00 0.00 ? 90  LYS A CA   4  
ATOM 5620  C C    . LYS A 1 90  ? -6.861  -8.693  0.150   1.00 0.00 ? 90  LYS A C    4  
ATOM 5621  O O    . LYS A 1 90  ? -7.551  -7.728  -0.179  1.00 0.00 ? 90  LYS A O    4  
ATOM 5622  C CB   . LYS A 1 90  ? -5.872  -8.694  2.447   1.00 0.00 ? 90  LYS A CB   4  
ATOM 5623  C CG   . LYS A 1 90  ? -4.630  -8.932  3.289   1.00 0.00 ? 90  LYS A CG   4  
ATOM 5624  C CD   . LYS A 1 90  ? -4.132  -10.362 3.156   1.00 0.00 ? 90  LYS A CD   4  
ATOM 5625  C CE   . LYS A 1 90  ? -4.824  -11.287 4.145   1.00 0.00 ? 90  LYS A CE   4  
ATOM 5626  N NZ   . LYS A 1 90  ? -4.455  -10.970 5.552   1.00 0.00 ? 90  LYS A NZ   4  
ATOM 5627  H H    . LYS A 1 90  ? -5.168  -6.477  1.327   1.00 0.00 ? 90  LYS A H    4  
ATOM 5628  H HA   . LYS A 1 90  ? -4.868  -9.273  0.647   1.00 0.00 ? 90  LYS A HA   4  
ATOM 5629  H HB2  . LYS A 1 90  ? -6.363  -7.804  2.811   1.00 0.00 ? 90  LYS A HB2  4  
ATOM 5630  H HB3  . LYS A 1 90  ? -6.535  -9.538  2.575   1.00 0.00 ? 90  LYS A HB3  4  
ATOM 5631  H HG2  . LYS A 1 90  ? -3.851  -8.259  2.963   1.00 0.00 ? 90  LYS A HG2  4  
ATOM 5632  H HG3  . LYS A 1 90  ? -4.866  -8.738  4.325   1.00 0.00 ? 90  LYS A HG3  4  
ATOM 5633  H HD2  . LYS A 1 90  ? -4.330  -10.711 2.154   1.00 0.00 ? 90  LYS A HD2  4  
ATOM 5634  H HD3  . LYS A 1 90  ? -3.067  -10.381 3.342   1.00 0.00 ? 90  LYS A HD3  4  
ATOM 5635  H HE2  . LYS A 1 90  ? -5.892  -11.182 4.029   1.00 0.00 ? 90  LYS A HE2  4  
ATOM 5636  H HE3  . LYS A 1 90  ? -4.537  -12.305 3.927   1.00 0.00 ? 90  LYS A HE3  4  
ATOM 5637  H HZ1  . LYS A 1 90  ? -4.696  -11.769 6.173   1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 5638  H HZ2  . LYS A 1 90  ? -4.971  -10.127 5.876   1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 5639  H HZ3  . LYS A 1 90  ? -3.434  -10.787 5.622   1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 5640  N N    . PRO A 1 91  ? -7.190  -9.952  -0.176  1.00 0.00 ? 91  PRO A N    4  
ATOM 5641  C CA   . PRO A 1 91  ? -8.394  -10.281 -0.946  1.00 0.00 ? 91  PRO A CA   4  
ATOM 5642  C C    . PRO A 1 91  ? -9.673  -10.048 -0.149  1.00 0.00 ? 91  PRO A C    4  
ATOM 5643  O O    . PRO A 1 91  ? -9.765  -10.422 1.020   1.00 0.00 ? 91  PRO A O    4  
ATOM 5644  C CB   . PRO A 1 91  ? -8.220  -11.770 -1.256  1.00 0.00 ? 91  PRO A CB   4  
ATOM 5645  C CG   . PRO A 1 91  ? -7.339  -12.283 -0.170  1.00 0.00 ? 91  PRO A CG   4  
ATOM 5646  C CD   . PRO A 1 91  ? -6.414  -11.151 0.182   1.00 0.00 ? 91  PRO A CD   4  
ATOM 5647  H HA   . PRO A 1 91  ? -8.439  -9.722  -1.869  1.00 0.00 ? 91  PRO A HA   4  
ATOM 5648  H HB2  . PRO A 1 91  ? -9.185  -12.257 -1.246  1.00 0.00 ? 91  PRO A HB2  4  
ATOM 5649  H HB3  . PRO A 1 91  ? -7.761  -11.888 -2.226  1.00 0.00 ? 91  PRO A HB3  4  
ATOM 5650  H HG2  . PRO A 1 91  ? -7.935  -12.561 0.686   1.00 0.00 ? 91  PRO A HG2  4  
ATOM 5651  H HG3  . PRO A 1 91  ? -6.774  -13.131 -0.527  1.00 0.00 ? 91  PRO A HG3  4  
ATOM 5652  H HD2  . PRO A 1 91  ? -6.188  -11.163 1.238   1.00 0.00 ? 91  PRO A HD2  4  
ATOM 5653  H HD3  . PRO A 1 91  ? -5.507  -11.210 -0.401  1.00 0.00 ? 91  PRO A HD3  4  
ATOM 5654  N N    . LYS A 1 92  ? -10.659 -9.429  -0.790  1.00 0.00 ? 92  LYS A N    4  
ATOM 5655  C CA   . LYS A 1 92  ? -11.935 -9.147  -0.142  1.00 0.00 ? 92  LYS A CA   4  
ATOM 5656  C C    . LYS A 1 92  ? -12.424 -10.358 0.645   1.00 0.00 ? 92  LYS A C    4  
ATOM 5657  O O    . LYS A 1 92  ? -12.903 -11.334 0.068   1.00 0.00 ? 92  LYS A O    4  
ATOM 5658  C CB   . LYS A 1 92  ? -12.981 -8.746  -1.184  1.00 0.00 ? 92  LYS A CB   4  
ATOM 5659  C CG   . LYS A 1 92  ? -12.592 -7.524  -1.997  1.00 0.00 ? 92  LYS A CG   4  
ATOM 5660  C CD   . LYS A 1 92  ? -13.506 -7.339  -3.197  1.00 0.00 ? 92  LYS A CD   4  
ATOM 5661  C CE   . LYS A 1 92  ? -13.591 -5.878  -3.613  1.00 0.00 ? 92  LYS A CE   4  
ATOM 5662  N NZ   . LYS A 1 92  ? -12.315 -5.396  -4.210  1.00 0.00 ? 92  LYS A NZ   4  
ATOM 5663  H H    . LYS A 1 92  ? -10.525 -9.155  -1.722  1.00 0.00 ? 92  LYS A H    4  
ATOM 5664  H HA   . LYS A 1 92  ? -11.785 -8.325  0.541   1.00 0.00 ? 92  LYS A HA   4  
ATOM 5665  H HB2  . LYS A 1 92  ? -13.131 -9.572  -1.863  1.00 0.00 ? 92  LYS A HB2  4  
ATOM 5666  H HB3  . LYS A 1 92  ? -13.912 -8.534  -0.678  1.00 0.00 ? 92  LYS A HB3  4  
ATOM 5667  H HG2  . LYS A 1 92  ? -12.659 -6.648  -1.369  1.00 0.00 ? 92  LYS A HG2  4  
ATOM 5668  H HG3  . LYS A 1 92  ? -11.576 -7.643  -2.346  1.00 0.00 ? 92  LYS A HG3  4  
ATOM 5669  H HD2  . LYS A 1 92  ? -13.121 -7.915  -4.025  1.00 0.00 ? 92  LYS A HD2  4  
ATOM 5670  H HD3  . LYS A 1 92  ? -14.496 -7.689  -2.942  1.00 0.00 ? 92  LYS A HD3  4  
ATOM 5671  H HE2  . LYS A 1 92  ? -14.382 -5.769  -4.339  1.00 0.00 ? 92  LYS A HE2  4  
ATOM 5672  H HE3  . LYS A 1 92  ? -13.818 -5.282  -2.741  1.00 0.00 ? 92  LYS A HE3  4  
ATOM 5673  H HZ1  . LYS A 1 92  ? -11.824 -4.766  -3.544  1.00 0.00 ? 92  LYS A HZ1  4  
ATOM 5674  H HZ2  . LYS A 1 92  ? -12.506 -4.872  -5.088  1.00 0.00 ? 92  LYS A HZ2  4  
ATOM 5675  H HZ3  . LYS A 1 92  ? -11.695 -6.202  -4.428  1.00 0.00 ? 92  LYS A HZ3  4  
ATOM 5676  N N    . GLY A 1 93  ? -12.302 -10.288 1.967   1.00 0.00 ? 93  GLY A N    4  
ATOM 5677  C CA   . GLY A 1 93  ? -12.737 -11.385 2.812   1.00 0.00 ? 93  GLY A CA   4  
ATOM 5678  C C    . GLY A 1 93  ? -14.122 -11.160 3.387   1.00 0.00 ? 93  GLY A C    4  
ATOM 5679  O O    . GLY A 1 93  ? -14.386 -10.124 3.996   1.00 0.00 ? 93  GLY A O    4  
ATOM 5680  H H    . GLY A 1 93  ? -11.912 -9.485  2.373   1.00 0.00 ? 93  GLY A H    4  
ATOM 5681  H HA2  . GLY A 1 93  ? -12.744 -12.293 2.229   1.00 0.00 ? 93  GLY A HA2  4  
ATOM 5682  H HA3  . GLY A 1 93  ? -12.036 -11.497 3.626   1.00 0.00 ? 93  GLY A HA3  4  
ATOM 5683  N N    . GLU A 1 94  ? -15.008 -12.131 3.191   1.00 0.00 ? 94  GLU A N    4  
ATOM 5684  C CA   . GLU A 1 94  ? -16.373 -12.032 3.693   1.00 0.00 ? 94  GLU A CA   4  
ATOM 5685  C C    . GLU A 1 94  ? -16.595 -12.990 4.859   1.00 0.00 ? 94  GLU A C    4  
ATOM 5686  O O    . GLU A 1 94  ? -17.647 -13.618 4.969   1.00 0.00 ? 94  GLU A O    4  
ATOM 5687  C CB   . GLU A 1 94  ? -17.374 -12.332 2.575   1.00 0.00 ? 94  GLU A CB   4  
ATOM 5688  C CG   . GLU A 1 94  ? -17.217 -13.718 1.973   1.00 0.00 ? 94  GLU A CG   4  
ATOM 5689  C CD   . GLU A 1 94  ? -18.044 -14.764 2.694   1.00 0.00 ? 94  GLU A CD   4  
ATOM 5690  O OE1  . GLU A 1 94  ? -19.288 -14.688 2.627   1.00 0.00 ? 94  GLU A OE1  4  
ATOM 5691  O OE2  . GLU A 1 94  ? -17.445 -15.660 3.326   1.00 0.00 ? 94  GLU A OE2  4  
ATOM 5692  H H    . GLU A 1 94  ? -14.737 -12.933 2.697   1.00 0.00 ? 94  GLU A H    4  
ATOM 5693  H HA   . GLU A 1 94  ? -16.526 -11.021 4.039   1.00 0.00 ? 94  GLU A HA   4  
ATOM 5694  H HB2  . GLU A 1 94  ? -18.375 -12.245 2.971   1.00 0.00 ? 94  GLU A HB2  4  
ATOM 5695  H HB3  . GLU A 1 94  ? -17.244 -11.604 1.787   1.00 0.00 ? 94  GLU A HB3  4  
ATOM 5696  H HG2  . GLU A 1 94  ? -17.528 -13.685 0.939   1.00 0.00 ? 94  GLU A HG2  4  
ATOM 5697  H HG3  . GLU A 1 94  ? -16.176 -14.003 2.025   1.00 0.00 ? 94  GLU A HG3  4  
ATOM 5698  N N    . GLY A 1 95  ? -15.595 -13.097 5.729   1.00 0.00 ? 95  GLY A N    4  
ATOM 5699  C CA   . GLY A 1 95  ? -15.699 -13.980 6.875   1.00 0.00 ? 95  GLY A CA   4  
ATOM 5700  C C    . GLY A 1 95  ? -14.765 -13.583 8.001   1.00 0.00 ? 95  GLY A C    4  
ATOM 5701  O O    . GLY A 1 95  ? -15.192 -12.995 8.993   1.00 0.00 ? 95  GLY A O    4  
ATOM 5702  H H    . GLY A 1 95  ? -14.779 -12.571 5.590   1.00 0.00 ? 95  GLY A H    4  
ATOM 5703  H HA2  . GLY A 1 95  ? -16.715 -13.959 7.240   1.00 0.00 ? 95  GLY A HA2  4  
ATOM 5704  H HA3  . GLY A 1 95  ? -15.460 -14.986 6.563   1.00 0.00 ? 95  GLY A HA3  4  
ATOM 5705  N N    . GLY A 1 96  ? -13.484 -13.906 7.846   1.00 0.00 ? 96  GLY A N    4  
ATOM 5706  C CA   . GLY A 1 96  ? -12.507 -13.573 8.866   1.00 0.00 ? 96  GLY A CA   4  
ATOM 5707  C C    . GLY A 1 96  ? -12.991 -13.906 10.264  1.00 0.00 ? 96  GLY A C    4  
ATOM 5708  O O    . GLY A 1 96  ? -13.891 -14.728 10.437  1.00 0.00 ? 96  GLY A O    4  
ATOM 5709  H H    . GLY A 1 96  ? -13.201 -14.375 7.034   1.00 0.00 ? 96  GLY A H    4  
ATOM 5710  H HA2  . GLY A 1 96  ? -11.598 -14.122 8.671   1.00 0.00 ? 96  GLY A HA2  4  
ATOM 5711  H HA3  . GLY A 1 96  ? -12.296 -12.515 8.814   1.00 0.00 ? 96  GLY A HA3  4  
ATOM 5712  N N    . SER A 1 97  ? -12.391 -13.269 11.264  1.00 0.00 ? 97  SER A N    4  
ATOM 5713  C CA   . SER A 1 97  ? -12.763 -13.506 12.654  1.00 0.00 ? 97  SER A CA   4  
ATOM 5714  C C    . SER A 1 97  ? -12.939 -12.188 13.402  1.00 0.00 ? 97  SER A C    4  
ATOM 5715  O O    . SER A 1 97  ? -12.368 -11.166 13.024  1.00 0.00 ? 97  SER A O    4  
ATOM 5716  C CB   . SER A 1 97  ? -11.701 -14.361 13.348  1.00 0.00 ? 97  SER A CB   4  
ATOM 5717  O OG   . SER A 1 97  ? -12.249 -15.051 14.459  1.00 0.00 ? 97  SER A OG   4  
ATOM 5718  H H    . SER A 1 97  ? -11.680 -12.625 11.062  1.00 0.00 ? 97  SER A H    4  
ATOM 5719  H HA   . SER A 1 97  ? -13.702 -14.038 12.660  1.00 0.00 ? 97  SER A HA   4  
ATOM 5720  H HB2  . SER A 1 97  ? -11.311 -15.084 12.649  1.00 0.00 ? 97  SER A HB2  4  
ATOM 5721  H HB3  . SER A 1 97  ? -10.900 -13.725 13.694  1.00 0.00 ? 97  SER A HB3  4  
ATOM 5722  H HG   . SER A 1 97  ? -12.579 -14.416 15.099  1.00 0.00 ? 97  SER A HG   4  
ATOM 5723  N N    . GLY A 1 98  ? -13.736 -12.220 14.466  1.00 0.00 ? 98  GLY A N    4  
ATOM 5724  C CA   . GLY A 1 98  ? -13.974 -11.023 15.250  1.00 0.00 ? 98  GLY A CA   4  
ATOM 5725  C C    . GLY A 1 98  ? -15.433 -10.858 15.628  1.00 0.00 ? 98  GLY A C    4  
ATOM 5726  O O    . GLY A 1 98  ? -16.257 -11.748 15.412  1.00 0.00 ? 98  GLY A O    4  
ATOM 5727  H H    . GLY A 1 98  ? -14.165 -13.064 14.720  1.00 0.00 ? 98  GLY A H    4  
ATOM 5728  H HA2  . GLY A 1 98  ? -13.383 -11.073 16.153  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 5729  H HA3  . GLY A 1 98  ? -13.664 -10.162 14.676  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 5730  N N    . PRO A 1 99  ? -15.771 -9.696  16.206  1.00 0.00 ? 99  PRO A N    4  
ATOM 5731  C CA   . PRO A 1 99  ? -17.142 -9.391  16.627  1.00 0.00 ? 99  PRO A CA   4  
ATOM 5732  C C    . PRO A 1 99  ? -18.080 -9.187  15.443  1.00 0.00 ? 99  PRO A C    4  
ATOM 5733  O O    . PRO A 1 99  ? -19.301 -9.194  15.598  1.00 0.00 ? 99  PRO A O    4  
ATOM 5734  C CB   . PRO A 1 99  ? -16.988 -8.089  17.418  1.00 0.00 ? 99  PRO A CB   4  
ATOM 5735  C CG   . PRO A 1 99  ? -15.754 -7.457  16.871  1.00 0.00 ? 99  PRO A CG   4  
ATOM 5736  C CD   . PRO A 1 99  ? -14.842 -8.591  16.493  1.00 0.00 ? 99  PRO A CD   4  
ATOM 5737  H HA   . PRO A 1 99  ? -17.539 -10.161 17.272  1.00 0.00 ? 99  PRO A HA   4  
ATOM 5738  H HB2  . PRO A 1 99  ? -17.856 -7.464  17.260  1.00 0.00 ? 99  PRO A HB2  4  
ATOM 5739  H HB3  . PRO A 1 99  ? -16.884 -8.312  18.469  1.00 0.00 ? 99  PRO A HB3  4  
ATOM 5740  H HG2  . PRO A 1 99  ? -15.999 -6.866  16.002  1.00 0.00 ? 99  PRO A HG2  4  
ATOM 5741  H HG3  . PRO A 1 99  ? -15.292 -6.841  17.628  1.00 0.00 ? 99  PRO A HG3  4  
ATOM 5742  H HD2  . PRO A 1 99  ? -14.265 -8.334  15.616  1.00 0.00 ? 99  PRO A HD2  4  
ATOM 5743  H HD3  . PRO A 1 99  ? -14.189 -8.841  17.316  1.00 0.00 ? 99  PRO A HD3  4  
ATOM 5744  N N    . SER A 1 100 ? -17.502 -9.005  14.260  1.00 0.00 ? 100 SER A N    4  
ATOM 5745  C CA   . SER A 1 100 ? -18.288 -8.796  13.049  1.00 0.00 ? 100 SER A CA   4  
ATOM 5746  C C    . SER A 1 100 ? -19.433 -9.801  12.965  1.00 0.00 ? 100 SER A C    4  
ATOM 5747  O O    . SER A 1 100 ? -19.382 -10.870 13.573  1.00 0.00 ? 100 SER A O    4  
ATOM 5748  C CB   . SER A 1 100 ? -17.397 -8.916  11.811  1.00 0.00 ? 100 SER A CB   4  
ATOM 5749  O OG   . SER A 1 100 ? -16.678 -7.717  11.583  1.00 0.00 ? 100 SER A OG   4  
ATOM 5750  H H    . SER A 1 100 ? -16.524 -9.010  14.201  1.00 0.00 ? 100 SER A H    4  
ATOM 5751  H HA   . SER A 1 100 ? -18.701 -7.800  13.090  1.00 0.00 ? 100 SER A HA   4  
ATOM 5752  H HB2  . SER A 1 100 ? -16.694 -9.722  11.953  1.00 0.00 ? 100 SER A HB2  4  
ATOM 5753  H HB3  . SER A 1 100 ? -18.013 -9.122  10.947  1.00 0.00 ? 100 SER A HB3  4  
ATOM 5754  H HG   . SER A 1 100 ? -15.816 -7.925  11.216  1.00 0.00 ? 100 SER A HG   4  
ATOM 5755  N N    . SER A 1 101 ? -20.466 -9.448  12.206  1.00 0.00 ? 101 SER A N    4  
ATOM 5756  C CA   . SER A 1 101 ? -21.627 -10.316 12.044  1.00 0.00 ? 101 SER A CA   4  
ATOM 5757  C C    . SER A 1 101 ? -22.391 -10.451 13.357  1.00 0.00 ? 101 SER A C    4  
ATOM 5758  O O    . SER A 1 101 ? -22.828 -11.541 13.725  1.00 0.00 ? 101 SER A O    4  
ATOM 5759  C CB   . SER A 1 101 ? -21.193 -11.696 11.548  1.00 0.00 ? 101 SER A CB   4  
ATOM 5760  O OG   . SER A 1 101 ? -22.302 -12.441 11.076  1.00 0.00 ? 101 SER A OG   4  
ATOM 5761  H H    . SER A 1 101 ? -20.448 -8.582  11.747  1.00 0.00 ? 101 SER A H    4  
ATOM 5762  H HA   . SER A 1 101 ? -22.277 -9.866  11.308  1.00 0.00 ? 101 SER A HA   4  
ATOM 5763  H HB2  . SER A 1 101 ? -20.484 -11.580 10.743  1.00 0.00 ? 101 SER A HB2  4  
ATOM 5764  H HB3  . SER A 1 101 ? -20.730 -12.238 12.361  1.00 0.00 ? 101 SER A HB3  4  
ATOM 5765  H HG   . SER A 1 101 ? -22.902 -11.858 10.604  1.00 0.00 ? 101 SER A HG   4  
ATOM 5766  N N    . GLY A 1 102 ? -22.549 -9.335  14.062  1.00 0.00 ? 102 GLY A N    4  
ATOM 5767  C CA   . GLY A 1 102 ? -23.260 -9.349  15.327  1.00 0.00 ? 102 GLY A CA   4  
ATOM 5768  C C    . GLY A 1 102 ? -24.764 -9.394  15.145  1.00 0.00 ? 102 GLY A C    4  
ATOM 5769  O O    . GLY A 1 102 ? -25.340 -10.464 14.945  1.00 0.00 ? 102 GLY A O    4  
ATOM 5770  H H    . GLY A 1 102 ? -22.179 -8.494  13.719  1.00 0.00 ? 102 GLY A H    4  
ATOM 5771  H HA2  . GLY A 1 102 ? -22.950 -10.215 15.892  1.00 0.00 ? 102 GLY A HA2  4  
ATOM 5772  H HA3  . GLY A 1 102 ? -23.003 -8.459  15.881  1.00 0.00 ? 102 GLY A HA3  4  
ATOM 5773  N N    . GLY A 1 1   ? -9.207  -9.521  21.648  1.00 0.00 ? 1   GLY A N    5  
ATOM 5774  C CA   . GLY A 1 1   ? -9.430  -9.282  20.234  1.00 0.00 ? 1   GLY A CA   5  
ATOM 5775  C C    . GLY A 1 1   ? -8.135  -9.152  19.457  1.00 0.00 ? 1   GLY A C    5  
ATOM 5776  O O    . GLY A 1 1   ? -7.048  -9.218  20.033  1.00 0.00 ? 1   GLY A O    5  
ATOM 5777  H H1   . GLY A 1 1   ? -8.576  -8.960  22.145  1.00 0.00 ? 1   GLY A H1   5  
ATOM 5778  H HA2  . GLY A 1 1   ? -10.001 -10.102 19.827  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 5779  H HA3  . GLY A 1 1   ? -9.997  -8.369  20.120  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 5780  N N    . SER A 1 2   ? -8.249  -8.968  18.146  1.00 0.00 ? 2   SER A N    5  
ATOM 5781  C CA   . SER A 1 2   ? -7.077  -8.834  17.288  1.00 0.00 ? 2   SER A CA   5  
ATOM 5782  C C    . SER A 1 2   ? -6.757  -7.365  17.031  1.00 0.00 ? 2   SER A C    5  
ATOM 5783  O O    . SER A 1 2   ? -7.653  -6.522  16.985  1.00 0.00 ? 2   SER A O    5  
ATOM 5784  C CB   . SER A 1 2   ? -7.307  -9.558  15.959  1.00 0.00 ? 2   SER A CB   5  
ATOM 5785  O OG   . SER A 1 2   ? -8.332  -8.932  15.208  1.00 0.00 ? 2   SER A OG   5  
ATOM 5786  H H    . SER A 1 2   ? -9.143  -8.924  17.746  1.00 0.00 ? 2   SER A H    5  
ATOM 5787  H HA   . SER A 1 2   ? -6.241  -9.289  17.796  1.00 0.00 ? 2   SER A HA   5  
ATOM 5788  H HB2  . SER A 1 2   ? -6.395  -9.543  15.382  1.00 0.00 ? 2   SER A HB2  5  
ATOM 5789  H HB3  . SER A 1 2   ? -7.593  -10.581 16.155  1.00 0.00 ? 2   SER A HB3  5  
ATOM 5790  H HG   . SER A 1 2   ? -9.189  -9.228  15.526  1.00 0.00 ? 2   SER A HG   5  
ATOM 5791  N N    . SER A 1 3   ? -5.473  -7.066  16.865  1.00 0.00 ? 3   SER A N    5  
ATOM 5792  C CA   . SER A 1 3   ? -5.032  -5.698  16.616  1.00 0.00 ? 3   SER A CA   5  
ATOM 5793  C C    . SER A 1 3   ? -4.874  -5.442  15.120  1.00 0.00 ? 3   SER A C    5  
ATOM 5794  O O    . SER A 1 3   ? -5.248  -4.383  14.618  1.00 0.00 ? 3   SER A O    5  
ATOM 5795  C CB   . SER A 1 3   ? -3.709  -5.428  17.334  1.00 0.00 ? 3   SER A CB   5  
ATOM 5796  O OG   . SER A 1 3   ? -2.622  -6.012  16.638  1.00 0.00 ? 3   SER A OG   5  
ATOM 5797  H H    . SER A 1 3   ? -4.805  -7.782  16.913  1.00 0.00 ? 3   SER A H    5  
ATOM 5798  H HA   . SER A 1 3   ? -5.786  -5.031  17.006  1.00 0.00 ? 3   SER A HA   5  
ATOM 5799  H HB2  . SER A 1 3   ? -3.548  -4.362  17.399  1.00 0.00 ? 3   SER A HB2  5  
ATOM 5800  H HB3  . SER A 1 3   ? -3.750  -5.847  18.329  1.00 0.00 ? 3   SER A HB3  5  
ATOM 5801  H HG   . SER A 1 3   ? -2.719  -6.967  16.634  1.00 0.00 ? 3   SER A HG   5  
ATOM 5802  N N    . GLY A 1 4   ? -4.315  -6.420  14.414  1.00 0.00 ? 4   GLY A N    5  
ATOM 5803  C CA   . GLY A 1 4   ? -4.116  -6.282  12.983  1.00 0.00 ? 4   GLY A CA   5  
ATOM 5804  C C    . GLY A 1 4   ? -3.930  -7.619  12.292  1.00 0.00 ? 4   GLY A C    5  
ATOM 5805  O O    . GLY A 1 4   ? -4.731  -8.536  12.473  1.00 0.00 ? 4   GLY A O    5  
ATOM 5806  H H    . GLY A 1 4   ? -4.036  -7.243  14.869  1.00 0.00 ? 4   GLY A H    5  
ATOM 5807  H HA2  . GLY A 1 4   ? -4.975  -5.786  12.558  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 5808  H HA3  . GLY A 1 4   ? -3.240  -5.676  12.810  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 5809  N N    . SER A 1 5   ? -2.870  -7.729  11.497  1.00 0.00 ? 5   SER A N    5  
ATOM 5810  C CA   . SER A 1 5   ? -2.584  -8.961  10.772  1.00 0.00 ? 5   SER A CA   5  
ATOM 5811  C C    . SER A 1 5   ? -1.159  -9.434  11.046  1.00 0.00 ? 5   SER A C    5  
ATOM 5812  O O    . SER A 1 5   ? -0.237  -8.627  11.161  1.00 0.00 ? 5   SER A O    5  
ATOM 5813  C CB   . SER A 1 5   ? -2.784  -8.752  9.270   1.00 0.00 ? 5   SER A CB   5  
ATOM 5814  O OG   . SER A 1 5   ? -2.139  -7.570  8.829   1.00 0.00 ? 5   SER A OG   5  
ATOM 5815  H H    . SER A 1 5   ? -2.268  -6.962  11.394  1.00 0.00 ? 5   SER A H    5  
ATOM 5816  H HA   . SER A 1 5   ? -3.274  -9.717  11.117  1.00 0.00 ? 5   SER A HA   5  
ATOM 5817  H HB2  . SER A 1 5   ? -2.373  -9.594  8.734   1.00 0.00 ? 5   SER A HB2  5  
ATOM 5818  H HB3  . SER A 1 5   ? -3.841  -8.672  9.058   1.00 0.00 ? 5   SER A HB3  5  
ATOM 5819  H HG   . SER A 1 5   ? -1.402  -7.371  9.411   1.00 0.00 ? 5   SER A HG   5  
ATOM 5820  N N    . SER A 1 6   ? -0.989  -10.748 11.150  1.00 0.00 ? 6   SER A N    5  
ATOM 5821  C CA   . SER A 1 6   ? 0.322   -11.330 11.414  1.00 0.00 ? 6   SER A CA   5  
ATOM 5822  C C    . SER A 1 6   ? 1.336   -10.885 10.364  1.00 0.00 ? 6   SER A C    5  
ATOM 5823  O O    . SER A 1 6   ? 2.313   -10.206 10.678  1.00 0.00 ? 6   SER A O    5  
ATOM 5824  C CB   . SER A 1 6   ? 0.231   -12.857 11.435  1.00 0.00 ? 6   SER A CB   5  
ATOM 5825  O OG   . SER A 1 6   ? -0.377  -13.315 12.630  1.00 0.00 ? 6   SER A OG   5  
ATOM 5826  H H    . SER A 1 6   ? -1.763  -11.340 11.049  1.00 0.00 ? 6   SER A H    5  
ATOM 5827  H HA   . SER A 1 6   ? 0.649   -10.984 12.383  1.00 0.00 ? 6   SER A HA   5  
ATOM 5828  H HB2  . SER A 1 6   ? -0.358  -13.192 10.594  1.00 0.00 ? 6   SER A HB2  5  
ATOM 5829  H HB3  . SER A 1 6   ? 1.225   -13.275 11.367  1.00 0.00 ? 6   SER A HB3  5  
ATOM 5830  H HG   . SER A 1 6   ? 0.026   -12.877 13.383  1.00 0.00 ? 6   SER A HG   5  
ATOM 5831  N N    . GLY A 1 7   ? 1.095   -11.272 9.116   1.00 0.00 ? 7   GLY A N    5  
ATOM 5832  C CA   . GLY A 1 7   ? 1.995   -10.904 8.038   1.00 0.00 ? 7   GLY A CA   5  
ATOM 5833  C C    . GLY A 1 7   ? 2.350   -12.082 7.152   1.00 0.00 ? 7   GLY A C    5  
ATOM 5834  O O    . GLY A 1 7   ? 1.843   -13.190 7.323   1.00 0.00 ? 7   GLY A O    5  
ATOM 5835  H H    . GLY A 1 7   ? 0.300   -11.812 8.924   1.00 0.00 ? 7   GLY A H    5  
ATOM 5836  H HA2  . GLY A 1 7   ? 1.524   -10.142 7.435   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 5837  H HA3  . GLY A 1 7   ? 2.902   -10.502 8.464   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 5838  N N    . PRO A 1 8   ? 3.242   -11.846 6.178   1.00 0.00 ? 8   PRO A N    5  
ATOM 5839  C CA   . PRO A 1 8   ? 3.684   -12.884 5.242   1.00 0.00 ? 8   PRO A CA   5  
ATOM 5840  C C    . PRO A 1 8   ? 4.553   -13.940 5.915   1.00 0.00 ? 8   PRO A C    5  
ATOM 5841  O O    . PRO A 1 8   ? 5.051   -14.856 5.262   1.00 0.00 ? 8   PRO A O    5  
ATOM 5842  C CB   . PRO A 1 8   ? 4.497   -12.104 4.206   1.00 0.00 ? 8   PRO A CB   5  
ATOM 5843  C CG   . PRO A 1 8   ? 4.970   -10.891 4.931   1.00 0.00 ? 8   PRO A CG   5  
ATOM 5844  C CD   . PRO A 1 8   ? 3.887   -10.549 5.916   1.00 0.00 ? 8   PRO A CD   5  
ATOM 5845  H HA   . PRO A 1 8   ? 2.846   -13.364 4.757   1.00 0.00 ? 8   PRO A HA   5  
ATOM 5846  H HB2  . PRO A 1 8   ? 5.325   -12.709 3.864   1.00 0.00 ? 8   PRO A HB2  5  
ATOM 5847  H HB3  . PRO A 1 8   ? 3.866   -11.843 3.370   1.00 0.00 ? 8   PRO A HB3  5  
ATOM 5848  H HG2  . PRO A 1 8   ? 5.892   -11.109 5.448   1.00 0.00 ? 8   PRO A HG2  5  
ATOM 5849  H HG3  . PRO A 1 8   ? 5.112   -10.079 4.233   1.00 0.00 ? 8   PRO A HG3  5  
ATOM 5850  H HD2  . PRO A 1 8   ? 4.314   -10.141 6.820   1.00 0.00 ? 8   PRO A HD2  5  
ATOM 5851  H HD3  . PRO A 1 8   ? 3.187   -9.852  5.479   1.00 0.00 ? 8   PRO A HD3  5  
ATOM 5852  N N    . ASN A 1 9   ? 4.730   -13.807 7.226   1.00 0.00 ? 9   ASN A N    5  
ATOM 5853  C CA   . ASN A 1 9   ? 5.539   -14.751 7.988   1.00 0.00 ? 9   ASN A CA   5  
ATOM 5854  C C    . ASN A 1 9   ? 4.715   -15.969 8.395   1.00 0.00 ? 9   ASN A C    5  
ATOM 5855  O O    . ASN A 1 9   ? 5.212   -17.094 8.398   1.00 0.00 ? 9   ASN A O    5  
ATOM 5856  C CB   . ASN A 1 9   ? 6.115   -14.072 9.232   1.00 0.00 ? 9   ASN A CB   5  
ATOM 5857  C CG   . ASN A 1 9   ? 5.061   -13.815 10.292  1.00 0.00 ? 9   ASN A CG   5  
ATOM 5858  O OD1  . ASN A 1 9   ? 4.827   -14.651 11.165  1.00 0.00 ? 9   ASN A OD1  5  
ATOM 5859  N ND2  . ASN A 1 9   ? 4.420   -12.655 10.219  1.00 0.00 ? 9   ASN A ND2  5  
ATOM 5860  H H    . ASN A 1 9   ? 4.307   -13.055 7.692   1.00 0.00 ? 9   ASN A H    5  
ATOM 5861  H HA   . ASN A 1 9   ? 6.352   -15.075 7.357   1.00 0.00 ? 9   ASN A HA   5  
ATOM 5862  H HB2  . ASN A 1 9   ? 6.880   -14.705 9.659   1.00 0.00 ? 9   ASN A HB2  5  
ATOM 5863  H HB3  . ASN A 1 9   ? 6.553   -13.126 8.949   1.00 0.00 ? 9   ASN A HB3  5  
ATOM 5864  H HD21 . ASN A 1 9   ? 4.659   -12.038 9.496   1.00 0.00 ? 9   ASN A HD21 5  
ATOM 5865  H HD22 . ASN A 1 9   ? 3.734   -12.463 10.892  1.00 0.00 ? 9   ASN A HD22 5  
ATOM 5866  N N    . ALA A 1 10  ? 3.453   -15.734 8.738   1.00 0.00 ? 10  ALA A N    5  
ATOM 5867  C CA   . ALA A 1 10  ? 2.559   -16.812 9.144   1.00 0.00 ? 10  ALA A CA   5  
ATOM 5868  C C    . ALA A 1 10  ? 2.167   -17.678 7.952   1.00 0.00 ? 10  ALA A C    5  
ATOM 5869  O O    . ALA A 1 10  ? 1.031   -17.623 7.480   1.00 0.00 ? 10  ALA A O    5  
ATOM 5870  C CB   . ALA A 1 10  ? 1.318   -16.243 9.817   1.00 0.00 ? 10  ALA A CB   5  
ATOM 5871  H H    . ALA A 1 10  ? 3.114   -14.815 8.716   1.00 0.00 ? 10  ALA A H    5  
ATOM 5872  H HA   . ALA A 1 10  ? 3.081   -17.424 9.866   1.00 0.00 ? 10  ALA A HA   5  
ATOM 5873  H HB1  . ALA A 1 10  ? 0.685   -15.784 9.072   1.00 0.00 ? 10  ALA A HB1  5  
ATOM 5874  H HB2  . ALA A 1 10  ? 0.779   -17.039 10.308  1.00 0.00 ? 10  ALA A HB2  5  
ATOM 5875  H HB3  . ALA A 1 10  ? 1.612   -15.503 10.546  1.00 0.00 ? 10  ALA A HB3  5  
ATOM 5876  N N    . ARG A 1 11  ? 3.113   -18.477 7.470   1.00 0.00 ? 11  ARG A N    5  
ATOM 5877  C CA   . ARG A 1 11  ? 2.866   -19.354 6.332   1.00 0.00 ? 11  ARG A CA   5  
ATOM 5878  C C    . ARG A 1 11  ? 1.918   -18.695 5.334   1.00 0.00 ? 11  ARG A C    5  
ATOM 5879  O O    . ARG A 1 11  ? 0.924   -19.291 4.921   1.00 0.00 ? 11  ARG A O    5  
ATOM 5880  C CB   . ARG A 1 11  ? 2.282   -20.686 6.804   1.00 0.00 ? 11  ARG A CB   5  
ATOM 5881  C CG   . ARG A 1 11  ? 3.314   -21.624 7.409   1.00 0.00 ? 11  ARG A CG   5  
ATOM 5882  C CD   . ARG A 1 11  ? 2.654   -22.743 8.199   1.00 0.00 ? 11  ARG A CD   5  
ATOM 5883  N NE   . ARG A 1 11  ? 2.119   -23.786 7.328   1.00 0.00 ? 11  ARG A NE   5  
ATOM 5884  C CZ   . ARG A 1 11  ? 1.136   -24.607 7.683   1.00 0.00 ? 11  ARG A CZ   5  
ATOM 5885  N NH1  . ARG A 1 11  ? 0.584   -24.505 8.884   1.00 0.00 ? 11  ARG A NH1  5  
ATOM 5886  N NH2  . ARG A 1 11  ? 0.703   -25.531 6.835   1.00 0.00 ? 11  ARG A NH2  5  
ATOM 5887  H H    . ARG A 1 11  ? 3.999   -18.476 7.889   1.00 0.00 ? 11  ARG A H    5  
ATOM 5888  H HA   . ARG A 1 11  ? 3.812   -19.538 5.844   1.00 0.00 ? 11  ARG A HA   5  
ATOM 5889  H HB2  . ARG A 1 11  ? 1.526   -20.490 7.551   1.00 0.00 ? 11  ARG A HB2  5  
ATOM 5890  H HB3  . ARG A 1 11  ? 1.824   -21.183 5.962   1.00 0.00 ? 11  ARG A HB3  5  
ATOM 5891  H HG2  . ARG A 1 11  ? 3.901   -22.058 6.613   1.00 0.00 ? 11  ARG A HG2  5  
ATOM 5892  H HG3  . ARG A 1 11  ? 3.957   -21.060 8.068   1.00 0.00 ? 11  ARG A HG3  5  
ATOM 5893  H HD2  . ARG A 1 11  ? 3.388   -23.181 8.859   1.00 0.00 ? 11  ARG A HD2  5  
ATOM 5894  H HD3  . ARG A 1 11  ? 1.848   -22.326 8.784   1.00 0.00 ? 11  ARG A HD3  5  
ATOM 5895  H HE   . ARG A 1 11  ? 2.512   -23.879 6.436   1.00 0.00 ? 11  ARG A HE   5  
ATOM 5896  H HH11 . ARG A 1 11  ? 0.908   -23.809 9.525   1.00 0.00 ? 11  ARG A HH11 5  
ATOM 5897  H HH12 . ARG A 1 11  ? -0.156  -25.124 9.148   1.00 0.00 ? 11  ARG A HH12 5  
ATOM 5898  H HH21 . ARG A 1 11  ? 1.117   -25.610 5.928   1.00 0.00 ? 11  ARG A HH21 5  
ATOM 5899  H HH22 . ARG A 1 11  ? -0.036  -26.148 7.103   1.00 0.00 ? 11  ARG A HH22 5  
ATOM 5900  N N    . SER A 1 12  ? 2.233   -17.462 4.952   1.00 0.00 ? 12  SER A N    5  
ATOM 5901  C CA   . SER A 1 12  ? 1.407   -16.720 4.006   1.00 0.00 ? 12  SER A CA   5  
ATOM 5902  C C    . SER A 1 12  ? 2.275   -15.931 3.029   1.00 0.00 ? 12  SER A C    5  
ATOM 5903  O O    . SER A 1 12  ? 3.281   -15.339 3.417   1.00 0.00 ? 12  SER A O    5  
ATOM 5904  C CB   . SER A 1 12  ? 0.467   -15.772 4.752   1.00 0.00 ? 12  SER A CB   5  
ATOM 5905  O OG   . SER A 1 12  ? 1.117   -15.178 5.862   1.00 0.00 ? 12  SER A OG   5  
ATOM 5906  H H    . SER A 1 12  ? 3.039   -17.040 5.316   1.00 0.00 ? 12  SER A H    5  
ATOM 5907  H HA   . SER A 1 12  ? 0.818   -17.434 3.450   1.00 0.00 ? 12  SER A HA   5  
ATOM 5908  H HB2  . SER A 1 12  ? 0.141   -14.991 4.081   1.00 0.00 ? 12  SER A HB2  5  
ATOM 5909  H HB3  . SER A 1 12  ? -0.391  -16.325 5.106   1.00 0.00 ? 12  SER A HB3  5  
ATOM 5910  H HG   . SER A 1 12  ? 1.364   -15.859 6.491   1.00 0.00 ? 12  SER A HG   5  
ATOM 5911  N N    . GLN A 1 13  ? 1.875   -15.929 1.762   1.00 0.00 ? 13  GLN A N    5  
ATOM 5912  C CA   . GLN A 1 13  ? 2.616   -15.214 0.729   1.00 0.00 ? 13  GLN A CA   5  
ATOM 5913  C C    . GLN A 1 13  ? 2.245   -13.735 0.718   1.00 0.00 ? 13  GLN A C    5  
ATOM 5914  O O    . GLN A 1 13  ? 1.087   -13.359 0.905   1.00 0.00 ? 13  GLN A O    5  
ATOM 5915  C CB   . GLN A 1 13  ? 2.343   -15.831 -0.644  1.00 0.00 ? 13  GLN A CB   5  
ATOM 5916  C CG   . GLN A 1 13  ? 2.968   -15.057 -1.793  1.00 0.00 ? 13  GLN A CG   5  
ATOM 5917  C CD   . GLN A 1 13  ? 2.325   -15.376 -3.129  1.00 0.00 ? 13  GLN A CD   5  
ATOM 5918  O OE1  . GLN A 1 13  ? 1.668   -14.527 -3.733  1.00 0.00 ? 13  GLN A OE1  5  
ATOM 5919  N NE2  . GLN A 1 13  ? 2.512   -16.604 -3.598  1.00 0.00 ? 13  GLN A NE2  5  
ATOM 5920  H H    . GLN A 1 13  ? 1.065   -16.421 1.515   1.00 0.00 ? 13  GLN A H    5  
ATOM 5921  H HA   . GLN A 1 13  ? 3.668   -15.306 0.952   1.00 0.00 ? 13  GLN A HA   5  
ATOM 5922  H HB2  . GLN A 1 13  ? 2.738   -16.836 -0.658  1.00 0.00 ? 13  GLN A HB2  5  
ATOM 5923  H HB3  . GLN A 1 13  ? 1.276   -15.869 -0.802  1.00 0.00 ? 13  GLN A HB3  5  
ATOM 5924  H HG2  . GLN A 1 13  ? 2.857   -14.000 -1.601  1.00 0.00 ? 13  GLN A HG2  5  
ATOM 5925  H HG3  . GLN A 1 13  ? 4.018   -15.303 -1.847  1.00 0.00 ? 13  GLN A HG3  5  
ATOM 5926  H HE21 . GLN A 1 13  ? 3.047   -17.227 -3.062  1.00 0.00 ? 13  GLN A HE21 5  
ATOM 5927  H HE22 . GLN A 1 13  ? 2.108   -16.837 -4.458  1.00 0.00 ? 13  GLN A HE22 5  
ATOM 5928  N N    . PRO A 1 14  ? 3.248   -12.874 0.495   1.00 0.00 ? 14  PRO A N    5  
ATOM 5929  C CA   . PRO A 1 14  ? 3.051   -11.422 0.455   1.00 0.00 ? 14  PRO A CA   5  
ATOM 5930  C C    . PRO A 1 14  ? 2.266   -10.978 -0.775  1.00 0.00 ? 14  PRO A C    5  
ATOM 5931  O O    . PRO A 1 14  ? 2.004   -11.774 -1.677  1.00 0.00 ? 14  PRO A O    5  
ATOM 5932  C CB   . PRO A 1 14  ? 4.479   -10.871 0.405   1.00 0.00 ? 14  PRO A CB   5  
ATOM 5933  C CG   . PRO A 1 14  ? 5.287   -11.968 -0.196  1.00 0.00 ? 14  PRO A CG   5  
ATOM 5934  C CD   . PRO A 1 14  ? 4.653   -13.251 0.265   1.00 0.00 ? 14  PRO A CD   5  
ATOM 5935  H HA   . PRO A 1 14  ? 2.556   -11.064 1.345   1.00 0.00 ? 14  PRO A HA   5  
ATOM 5936  H HB2  . PRO A 1 14  ? 4.503   -9.980  -0.206  1.00 0.00 ? 14  PRO A HB2  5  
ATOM 5937  H HB3  . PRO A 1 14  ? 4.813   -10.638 1.405   1.00 0.00 ? 14  PRO A HB3  5  
ATOM 5938  H HG2  . PRO A 1 14  ? 5.255   -11.900 -1.273  1.00 0.00 ? 14  PRO A HG2  5  
ATOM 5939  H HG3  . PRO A 1 14  ? 6.307   -11.907 0.155   1.00 0.00 ? 14  PRO A HG3  5  
ATOM 5940  H HD2  . PRO A 1 14  ? 4.728   -14.007 -0.503  1.00 0.00 ? 14  PRO A HD2  5  
ATOM 5941  H HD3  . PRO A 1 14  ? 5.115   -13.593 1.180   1.00 0.00 ? 14  PRO A HD3  5  
ATOM 5942  N N    . SER A 1 15  ? 1.895   -9.702  -0.805  1.00 0.00 ? 15  SER A N    5  
ATOM 5943  C CA   . SER A 1 15  ? 1.137   -9.153  -1.923  1.00 0.00 ? 15  SER A CA   5  
ATOM 5944  C C    . SER A 1 15  ? 2.019   -8.264  -2.794  1.00 0.00 ? 15  SER A C    5  
ATOM 5945  O O    . SER A 1 15  ? 2.992   -7.677  -2.318  1.00 0.00 ? 15  SER A O    5  
ATOM 5946  C CB   . SER A 1 15  ? -0.063  -8.353  -1.410  1.00 0.00 ? 15  SER A CB   5  
ATOM 5947  O OG   . SER A 1 15  ? -1.132  -8.384  -2.340  1.00 0.00 ? 15  SER A OG   5  
ATOM 5948  H H    . SER A 1 15  ? 2.134   -9.117  -0.056  1.00 0.00 ? 15  SER A H    5  
ATOM 5949  H HA   . SER A 1 15  ? 0.779   -9.979  -2.519  1.00 0.00 ? 15  SER A HA   5  
ATOM 5950  H HB2  . SER A 1 15  ? -0.402  -8.777  -0.477  1.00 0.00 ? 15  SER A HB2  5  
ATOM 5951  H HB3  . SER A 1 15  ? 0.233   -7.326  -1.253  1.00 0.00 ? 15  SER A HB3  5  
ATOM 5952  H HG   . SER A 1 15  ? -1.156  -9.241  -2.772  1.00 0.00 ? 15  SER A HG   5  
ATOM 5953  N N    . LYS A 1 16  ? 1.674   -8.169  -4.073  1.00 0.00 ? 16  LYS A N    5  
ATOM 5954  C CA   . LYS A 1 16  ? 2.432   -7.351  -5.012  1.00 0.00 ? 16  LYS A CA   5  
ATOM 5955  C C    . LYS A 1 16  ? 1.989   -5.893  -4.946  1.00 0.00 ? 16  LYS A C    5  
ATOM 5956  O O    . LYS A 1 16  ? 2.794   -4.979  -5.126  1.00 0.00 ? 16  LYS A O    5  
ATOM 5957  C CB   . LYS A 1 16  ? 2.261   -7.883  -6.437  1.00 0.00 ? 16  LYS A CB   5  
ATOM 5958  C CG   . LYS A 1 16  ? 2.939   -9.222  -6.672  1.00 0.00 ? 16  LYS A CG   5  
ATOM 5959  C CD   . LYS A 1 16  ? 2.719   -9.717  -8.092  1.00 0.00 ? 16  LYS A CD   5  
ATOM 5960  C CE   . LYS A 1 16  ? 3.187   -11.154 -8.260  1.00 0.00 ? 16  LYS A CE   5  
ATOM 5961  N NZ   . LYS A 1 16  ? 2.811   -11.709 -9.589  1.00 0.00 ? 16  LYS A NZ   5  
ATOM 5962  H H    . LYS A 1 16  ? 0.888   -8.661  -4.393  1.00 0.00 ? 16  LYS A H    5  
ATOM 5963  H HA   . LYS A 1 16  ? 3.475   -7.411  -4.738  1.00 0.00 ? 16  LYS A HA   5  
ATOM 5964  H HB2  . LYS A 1 16  ? 1.207   -7.996  -6.642  1.00 0.00 ? 16  LYS A HB2  5  
ATOM 5965  H HB3  . LYS A 1 16  ? 2.679   -7.166  -7.129  1.00 0.00 ? 16  LYS A HB3  5  
ATOM 5966  H HG2  . LYS A 1 16  ? 4.000   -9.113  -6.501  1.00 0.00 ? 16  LYS A HG2  5  
ATOM 5967  H HG3  . LYS A 1 16  ? 2.533   -9.947  -5.980  1.00 0.00 ? 16  LYS A HG3  5  
ATOM 5968  H HD2  . LYS A 1 16  ? 1.665   -9.665  -8.322  1.00 0.00 ? 16  LYS A HD2  5  
ATOM 5969  H HD3  . LYS A 1 16  ? 3.270   -9.085  -8.774  1.00 0.00 ? 16  LYS A HD3  5  
ATOM 5970  H HE2  . LYS A 1 16  ? 4.262   -11.183 -8.159  1.00 0.00 ? 16  LYS A HE2  5  
ATOM 5971  H HE3  . LYS A 1 16  ? 2.737   -11.759 -7.486  1.00 0.00 ? 16  LYS A HE3  5  
ATOM 5972  H HZ1  . LYS A 1 16  ? 1.992   -12.343 -9.493  1.00 0.00 ? 16  LYS A HZ1  5  
ATOM 5973  H HZ2  . LYS A 1 16  ? 3.605   -12.246 -9.990  1.00 0.00 ? 16  LYS A HZ2  5  
ATOM 5974  H HZ3  . LYS A 1 16  ? 2.563   -10.937 -10.241 1.00 0.00 ? 16  LYS A HZ3  5  
ATOM 5975  N N    . THR A 1 17  ? 0.702   -5.682  -4.685  1.00 0.00 ? 17  THR A N    5  
ATOM 5976  C CA   . THR A 1 17  ? 0.152   -4.335  -4.594  1.00 0.00 ? 17  THR A CA   5  
ATOM 5977  C C    . THR A 1 17  ? 0.039   -3.884  -3.143  1.00 0.00 ? 17  THR A C    5  
ATOM 5978  O O    . THR A 1 17  ? -0.592  -4.552  -2.322  1.00 0.00 ? 17  THR A O    5  
ATOM 5979  C CB   . THR A 1 17  ? -1.236  -4.250  -5.257  1.00 0.00 ? 17  THR A CB   5  
ATOM 5980  O OG1  . THR A 1 17  ? -1.200  -4.861  -6.551  1.00 0.00 ? 17  THR A OG1  5  
ATOM 5981  C CG2  . THR A 1 17  ? -1.686  -2.803  -5.385  1.00 0.00 ? 17  THR A CG2  5  
ATOM 5982  H H    . THR A 1 17  ? 0.110   -6.451  -4.551  1.00 0.00 ? 17  THR A H    5  
ATOM 5983  H HA   . THR A 1 17  ? 0.819   -3.666  -5.118  1.00 0.00 ? 17  THR A HA   5  
ATOM 5984  H HB   . THR A 1 17  ? -1.947  -4.779  -4.637  1.00 0.00 ? 17  THR A HB   5  
ATOM 5985  H HG1  . THR A 1 17  ? -1.051  -5.805  -6.456  1.00 0.00 ? 17  THR A HG1  5  
ATOM 5986  H HG21 . THR A 1 17  ? -2.755  -2.744  -5.240  1.00 0.00 ? 17  THR A HG21 5  
ATOM 5987  H HG22 . THR A 1 17  ? -1.435  -2.434  -6.368  1.00 0.00 ? 17  THR A HG22 5  
ATOM 5988  H HG23 . THR A 1 17  ? -1.189  -2.204  -4.638  1.00 0.00 ? 17  THR A HG23 5  
ATOM 5989  N N    . LEU A 1 18  ? 0.652   -2.748  -2.832  1.00 0.00 ? 18  LEU A N    5  
ATOM 5990  C CA   . LEU A 1 18  ? 0.619   -2.206  -1.477  1.00 0.00 ? 18  LEU A CA   5  
ATOM 5991  C C    . LEU A 1 18  ? -0.541  -1.231  -1.309  1.00 0.00 ? 18  LEU A C    5  
ATOM 5992  O O    . LEU A 1 18  ? -0.881  -0.489  -2.231  1.00 0.00 ? 18  LEU A O    5  
ATOM 5993  C CB   . LEU A 1 18  ? 1.940   -1.506  -1.155  1.00 0.00 ? 18  LEU A CB   5  
ATOM 5994  C CG   . LEU A 1 18  ? 3.069   -2.404  -0.647  1.00 0.00 ? 18  LEU A CG   5  
ATOM 5995  C CD1  . LEU A 1 18  ? 4.375   -1.628  -0.572  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 5996  C CD2  . LEU A 1 18  ? 2.715   -2.989  0.712   1.00 0.00 ? 18  LEU A CD2  5  
ATOM 5997  H H    . LEU A 1 18  ? 1.139   -2.260  -3.528  1.00 0.00 ? 18  LEU A H    5  
ATOM 5998  H HA   . LEU A 1 18  ? 0.482   -3.031  -0.794  1.00 0.00 ? 18  LEU A HA   5  
ATOM 5999  H HB2  . LEU A 1 18  ? 2.284   -1.019  -2.054  1.00 0.00 ? 18  LEU A HB2  5  
ATOM 6000  H HB3  . LEU A 1 18  ? 1.742   -0.761  -0.397  1.00 0.00 ? 18  LEU A HB3  5  
ATOM 6001  H HG   . LEU A 1 18  ? 3.208   -3.223  -1.339  1.00 0.00 ? 18  LEU A HG   5  
ATOM 6002  H HD11 . LEU A 1 18  ? 5.082   -2.043  -1.274  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 6003  H HD12 . LEU A 1 18  ? 4.778   -1.697  0.428   1.00 0.00 ? 18  LEU A HD12 5  
ATOM 6004  H HD13 . LEU A 1 18  ? 4.192   -0.591  -0.815  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 6005  H HD21 . LEU A 1 18  ? 2.577   -2.188  1.423   1.00 0.00 ? 18  LEU A HD21 5  
ATOM 6006  H HD22 . LEU A 1 18  ? 3.516   -3.633  1.046   1.00 0.00 ? 18  LEU A HD22 5  
ATOM 6007  H HD23 . LEU A 1 18  ? 1.802   -3.560  0.631   1.00 0.00 ? 18  LEU A HD23 5  
ATOM 6008  N N    . PHE A 1 19  ? -1.145  -1.235  -0.125  1.00 0.00 ? 19  PHE A N    5  
ATOM 6009  C CA   . PHE A 1 19  ? -2.266  -0.350  0.165   1.00 0.00 ? 19  PHE A CA   5  
ATOM 6010  C C    . PHE A 1 19  ? -1.796  0.900   0.903   1.00 0.00 ? 19  PHE A C    5  
ATOM 6011  O O    . PHE A 1 19  ? -1.327  0.824   2.039   1.00 0.00 ? 19  PHE A O    5  
ATOM 6012  C CB   . PHE A 1 19  ? -3.320  -1.082  0.999   1.00 0.00 ? 19  PHE A CB   5  
ATOM 6013  C CG   . PHE A 1 19  ? -4.499  -0.225  1.362   1.00 0.00 ? 19  PHE A CG   5  
ATOM 6014  C CD1  . PHE A 1 19  ? -5.122  0.560   0.406   1.00 0.00 ? 19  PHE A CD1  5  
ATOM 6015  C CD2  . PHE A 1 19  ? -4.984  -0.206  2.660   1.00 0.00 ? 19  PHE A CD2  5  
ATOM 6016  C CE1  . PHE A 1 19  ? -6.206  1.350   0.738   1.00 0.00 ? 19  PHE A CE1  5  
ATOM 6017  C CE2  . PHE A 1 19  ? -6.068  0.582   2.998   1.00 0.00 ? 19  PHE A CE2  5  
ATOM 6018  C CZ   . PHE A 1 19  ? -6.681  1.360   2.035   1.00 0.00 ? 19  PHE A CZ   5  
ATOM 6019  H H    . PHE A 1 19  ? -0.828  -1.850  0.570   1.00 0.00 ? 19  PHE A H    5  
ATOM 6020  H HA   . PHE A 1 19  ? -2.706  -0.054  -0.775  1.00 0.00 ? 19  PHE A HA   5  
ATOM 6021  H HB2  . PHE A 1 19  ? -3.686  -1.929  0.439   1.00 0.00 ? 19  PHE A HB2  5  
ATOM 6022  H HB3  . PHE A 1 19  ? -2.865  -1.430  1.914   1.00 0.00 ? 19  PHE A HB3  5  
ATOM 6023  H HD1  . PHE A 1 19  ? -4.753  0.553   -0.609  1.00 0.00 ? 19  PHE A HD1  5  
ATOM 6024  H HD2  . PHE A 1 19  ? -4.505  -0.815  3.414   1.00 0.00 ? 19  PHE A HD2  5  
ATOM 6025  H HE1  . PHE A 1 19  ? -6.684  1.957   -0.017  1.00 0.00 ? 19  PHE A HE1  5  
ATOM 6026  H HE2  . PHE A 1 19  ? -6.436  0.587   4.013   1.00 0.00 ? 19  PHE A HE2  5  
ATOM 6027  H HZ   . PHE A 1 19  ? -7.528  1.976   2.297   1.00 0.00 ? 19  PHE A HZ   5  
ATOM 6028  N N    . VAL A 1 20  ? -1.924  2.050   0.249   1.00 0.00 ? 20  VAL A N    5  
ATOM 6029  C CA   . VAL A 1 20  ? -1.513  3.317   0.842   1.00 0.00 ? 20  VAL A CA   5  
ATOM 6030  C C    . VAL A 1 20  ? -2.721  4.130   1.294   1.00 0.00 ? 20  VAL A C    5  
ATOM 6031  O O    . VAL A 1 20  ? -3.523  4.578   0.476   1.00 0.00 ? 20  VAL A O    5  
ATOM 6032  C CB   . VAL A 1 20  ? -0.684  4.157   -0.148  1.00 0.00 ? 20  VAL A CB   5  
ATOM 6033  C CG1  . VAL A 1 20  ? -0.132  5.398   0.537   1.00 0.00 ? 20  VAL A CG1  5  
ATOM 6034  C CG2  . VAL A 1 20  ? 0.440   3.323   -0.744  1.00 0.00 ? 20  VAL A CG2  5  
ATOM 6035  H H    . VAL A 1 20  ? -2.304  2.046   -0.654  1.00 0.00 ? 20  VAL A H    5  
ATOM 6036  H HA   . VAL A 1 20  ? -0.895  3.099   1.701   1.00 0.00 ? 20  VAL A HA   5  
ATOM 6037  H HB   . VAL A 1 20  ? -1.333  4.475   -0.951  1.00 0.00 ? 20  VAL A HB   5  
ATOM 6038  H HG11 . VAL A 1 20  ? 0.777   5.708   0.042   1.00 0.00 ? 20  VAL A HG11 5  
ATOM 6039  H HG12 . VAL A 1 20  ? -0.861  6.194   0.484   1.00 0.00 ? 20  VAL A HG12 5  
ATOM 6040  H HG13 . VAL A 1 20  ? 0.082   5.173   1.571   1.00 0.00 ? 20  VAL A HG13 5  
ATOM 6041  H HG21 . VAL A 1 20  ? 1.068   2.947   0.049   1.00 0.00 ? 20  VAL A HG21 5  
ATOM 6042  H HG22 . VAL A 1 20  ? 0.020   2.493   -1.294  1.00 0.00 ? 20  VAL A HG22 5  
ATOM 6043  H HG23 . VAL A 1 20  ? 1.028   3.935   -1.411  1.00 0.00 ? 20  VAL A HG23 5  
ATOM 6044  N N    . LYS A 1 21  ? -2.844  4.316   2.604   1.00 0.00 ? 21  LYS A N    5  
ATOM 6045  C CA   . LYS A 1 21  ? -3.953  5.076   3.168   1.00 0.00 ? 21  LYS A CA   5  
ATOM 6046  C C    . LYS A 1 21  ? -3.442  6.245   4.005   1.00 0.00 ? 21  LYS A C    5  
ATOM 6047  O O    . LYS A 1 21  ? -2.468  6.112   4.745   1.00 0.00 ? 21  LYS A O    5  
ATOM 6048  C CB   . LYS A 1 21  ? -4.837  4.168   4.026   1.00 0.00 ? 21  LYS A CB   5  
ATOM 6049  C CG   . LYS A 1 21  ? -4.247  3.860   5.392   1.00 0.00 ? 21  LYS A CG   5  
ATOM 6050  C CD   . LYS A 1 21  ? -5.286  3.267   6.328   1.00 0.00 ? 21  LYS A CD   5  
ATOM 6051  C CE   . LYS A 1 21  ? -4.652  2.327   7.341   1.00 0.00 ? 21  LYS A CE   5  
ATOM 6052  N NZ   . LYS A 1 21  ? -4.112  1.098   6.697   1.00 0.00 ? 21  LYS A NZ   5  
ATOM 6053  H H    . LYS A 1 21  ? -2.172  3.933   3.207   1.00 0.00 ? 21  LYS A H    5  
ATOM 6054  H HA   . LYS A 1 21  ? -4.539  5.465   2.349   1.00 0.00 ? 21  LYS A HA   5  
ATOM 6055  H HB2  . LYS A 1 21  ? -5.793  4.649   4.171   1.00 0.00 ? 21  LYS A HB2  5  
ATOM 6056  H HB3  . LYS A 1 21  ? -4.988  3.235   3.504   1.00 0.00 ? 21  LYS A HB3  5  
ATOM 6057  H HG2  . LYS A 1 21  ? -3.439  3.152   5.274   1.00 0.00 ? 21  LYS A HG2  5  
ATOM 6058  H HG3  . LYS A 1 21  ? -3.866  4.774   5.824   1.00 0.00 ? 21  LYS A HG3  5  
ATOM 6059  H HD2  . LYS A 1 21  ? -5.781  4.068   6.857   1.00 0.00 ? 21  LYS A HD2  5  
ATOM 6060  H HD3  . LYS A 1 21  ? -6.011  2.717   5.744   1.00 0.00 ? 21  LYS A HD3  5  
ATOM 6061  H HE2  . LYS A 1 21  ? -3.847  2.845   7.839   1.00 0.00 ? 21  LYS A HE2  5  
ATOM 6062  H HE3  . LYS A 1 21  ? -5.401  2.043   8.067   1.00 0.00 ? 21  LYS A HE3  5  
ATOM 6063  H HZ1  . LYS A 1 21  ? -4.422  1.050   5.705   1.00 0.00 ? 21  LYS A HZ1  5  
ATOM 6064  H HZ2  . LYS A 1 21  ? -4.454  0.253   7.196   1.00 0.00 ? 21  LYS A HZ2  5  
ATOM 6065  H HZ3  . LYS A 1 21  ? -3.073  1.108   6.724   1.00 0.00 ? 21  LYS A HZ3  5  
ATOM 6066  N N    . GLY A 1 22  ? -4.107  7.390   3.883   1.00 0.00 ? 22  GLY A N    5  
ATOM 6067  C CA   . GLY A 1 22  ? -3.706  8.564   4.635   1.00 0.00 ? 22  GLY A CA   5  
ATOM 6068  C C    . GLY A 1 22  ? -3.072  9.626   3.758   1.00 0.00 ? 22  GLY A C    5  
ATOM 6069  O O    . GLY A 1 22  ? -2.158  10.332  4.187   1.00 0.00 ? 22  GLY A O    5  
ATOM 6070  H H    . GLY A 1 22  ? -4.876  7.437   3.278   1.00 0.00 ? 22  GLY A H    5  
ATOM 6071  H HA2  . GLY A 1 22  ? -4.576  8.983   5.119   1.00 0.00 ? 22  GLY A HA2  5  
ATOM 6072  H HA3  . GLY A 1 22  ? -2.994  8.267   5.392   1.00 0.00 ? 22  GLY A HA3  5  
ATOM 6073  N N    . LEU A 1 23  ? -3.556  9.739   2.527   1.00 0.00 ? 23  LEU A N    5  
ATOM 6074  C CA   . LEU A 1 23  ? -3.030  10.721  1.585   1.00 0.00 ? 23  LEU A CA   5  
ATOM 6075  C C    . LEU A 1 23  ? -3.894  11.978  1.570   1.00 0.00 ? 23  LEU A C    5  
ATOM 6076  O O    . LEU A 1 23  ? -4.980  12.004  2.149   1.00 0.00 ? 23  LEU A O    5  
ATOM 6077  C CB   . LEU A 1 23  ? -2.957  10.122  0.180   1.00 0.00 ? 23  LEU A CB   5  
ATOM 6078  C CG   . LEU A 1 23  ? -2.065  8.890   0.020   1.00 0.00 ? 23  LEU A CG   5  
ATOM 6079  C CD1  . LEU A 1 23  ? -2.281  8.247   -1.341  1.00 0.00 ? 23  LEU A CD1  5  
ATOM 6080  C CD2  . LEU A 1 23  ? -0.602  9.263   0.210   1.00 0.00 ? 23  LEU A CD2  5  
ATOM 6081  H H    . LEU A 1 23  ? -4.284  9.149   2.242   1.00 0.00 ? 23  LEU A H    5  
ATOM 6082  H HA   . LEU A 1 23  ? -2.034  10.988  1.906   1.00 0.00 ? 23  LEU A HA   5  
ATOM 6083  H HB2  . LEU A 1 23  ? -3.958  9.846   -0.114  1.00 0.00 ? 23  LEU A HB2  5  
ATOM 6084  H HB3  . LEU A 1 23  ? -2.587  10.889  -0.487  1.00 0.00 ? 23  LEU A HB3  5  
ATOM 6085  H HG   . LEU A 1 23  ? -2.327  8.164   0.778   1.00 0.00 ? 23  LEU A HG   5  
ATOM 6086  H HD11 . LEU A 1 23  ? -1.325  8.056   -1.804  1.00 0.00 ? 23  LEU A HD11 5  
ATOM 6087  H HD12 . LEU A 1 23  ? -2.858  8.913   -1.966  1.00 0.00 ? 23  LEU A HD12 5  
ATOM 6088  H HD13 . LEU A 1 23  ? -2.815  7.316   -1.218  1.00 0.00 ? 23  LEU A HD13 5  
ATOM 6089  H HD21 . LEU A 1 23  ? -0.478  9.759   1.162   1.00 0.00 ? 23  LEU A HD21 5  
ATOM 6090  H HD22 . LEU A 1 23  ? -0.294  9.928   -0.584  1.00 0.00 ? 23  LEU A HD22 5  
ATOM 6091  H HD23 . LEU A 1 23  ? 0.003   8.369   0.188   1.00 0.00 ? 23  LEU A HD23 5  
ATOM 6092  N N    . SER A 1 24  ? -3.405  13.019  0.903   1.00 0.00 ? 24  SER A N    5  
ATOM 6093  C CA   . SER A 1 24  ? -4.132  14.280  0.814   1.00 0.00 ? 24  SER A CA   5  
ATOM 6094  C C    . SER A 1 24  ? -5.056  14.289  -0.400  1.00 0.00 ? 24  SER A C    5  
ATOM 6095  O O    . SER A 1 24  ? -4.698  13.797  -1.469  1.00 0.00 ? 24  SER A O    5  
ATOM 6096  C CB   . SER A 1 24  ? -3.152  15.452  0.733   1.00 0.00 ? 24  SER A CB   5  
ATOM 6097  O OG   . SER A 1 24  ? -3.832  16.692  0.835   1.00 0.00 ? 24  SER A OG   5  
ATOM 6098  H H    . SER A 1 24  ? -2.533  12.936  0.462   1.00 0.00 ? 24  SER A H    5  
ATOM 6099  H HA   . SER A 1 24  ? -4.729  14.382  1.707   1.00 0.00 ? 24  SER A HA   5  
ATOM 6100  H HB2  . SER A 1 24  ? -2.439  15.379  1.540   1.00 0.00 ? 24  SER A HB2  5  
ATOM 6101  H HB3  . SER A 1 24  ? -2.631  15.418  -0.213  1.00 0.00 ? 24  SER A HB3  5  
ATOM 6102  H HG   . SER A 1 24  ? -3.728  17.183  0.017   1.00 0.00 ? 24  SER A HG   5  
ATOM 6103  N N    . GLU A 1 25  ? -6.246  14.854  -0.225  1.00 0.00 ? 25  GLU A N    5  
ATOM 6104  C CA   . GLU A 1 25  ? -7.223  14.928  -1.306  1.00 0.00 ? 25  GLU A CA   5  
ATOM 6105  C C    . GLU A 1 25  ? -6.557  15.353  -2.612  1.00 0.00 ? 25  GLU A C    5  
ATOM 6106  O O    . GLU A 1 25  ? -7.074  15.090  -3.698  1.00 0.00 ? 25  GLU A O    5  
ATOM 6107  C CB   . GLU A 1 25  ? -8.341  15.908  -0.947  1.00 0.00 ? 25  GLU A CB   5  
ATOM 6108  C CG   . GLU A 1 25  ? -7.868  17.345  -0.805  1.00 0.00 ? 25  GLU A CG   5  
ATOM 6109  C CD   . GLU A 1 25  ? -8.971  18.352  -1.067  1.00 0.00 ? 25  GLU A CD   5  
ATOM 6110  O OE1  . GLU A 1 25  ? -9.703  18.690  -0.113  1.00 0.00 ? 25  GLU A OE1  5  
ATOM 6111  O OE2  . GLU A 1 25  ? -9.103  18.800  -2.225  1.00 0.00 ? 25  GLU A OE2  5  
ATOM 6112  H H    . GLU A 1 25  ? -6.474  15.230  0.651   1.00 0.00 ? 25  GLU A H    5  
ATOM 6113  H HA   . GLU A 1 25  ? -7.647  13.944  -1.436  1.00 0.00 ? 25  GLU A HA   5  
ATOM 6114  H HB2  . GLU A 1 25  ? -9.095  15.874  -1.720  1.00 0.00 ? 25  GLU A HB2  5  
ATOM 6115  H HB3  . GLU A 1 25  ? -8.784  15.603  -0.011  1.00 0.00 ? 25  GLU A HB3  5  
ATOM 6116  H HG2  . GLU A 1 25  ? -7.499  17.492  0.199   1.00 0.00 ? 25  GLU A HG2  5  
ATOM 6117  H HG3  . GLU A 1 25  ? -7.067  17.519  -1.509  1.00 0.00 ? 25  GLU A HG3  5  
ATOM 6118  N N    . ASP A 1 26  ? -5.409  16.011  -2.497  1.00 0.00 ? 26  ASP A N    5  
ATOM 6119  C CA   . ASP A 1 26  ? -4.672  16.473  -3.668  1.00 0.00 ? 26  ASP A CA   5  
ATOM 6120  C C    . ASP A 1 26  ? -3.647  15.433  -4.109  1.00 0.00 ? 26  ASP A C    5  
ATOM 6121  O O    . ASP A 1 26  ? -3.333  15.319  -5.295  1.00 0.00 ? 26  ASP A O    5  
ATOM 6122  C CB   . ASP A 1 26  ? -3.974  17.800  -3.366  1.00 0.00 ? 26  ASP A CB   5  
ATOM 6123  C CG   . ASP A 1 26  ? -3.125  18.284  -4.526  1.00 0.00 ? 26  ASP A CG   5  
ATOM 6124  O OD1  . ASP A 1 26  ? -3.696  18.574  -5.598  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 6125  O OD2  . ASP A 1 26  ? -1.890  18.372  -4.361  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 6126  H H    . ASP A 1 26  ? -5.049  16.190  -1.603  1.00 0.00 ? 26  ASP A H    5  
ATOM 6127  H HA   . ASP A 1 26  ? -5.381  16.623  -4.468  1.00 0.00 ? 26  ASP A HA   5  
ATOM 6128  H HB2  . ASP A 1 26  ? -4.720  18.552  -3.153  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 6129  H HB3  . ASP A 1 26  ? -3.337  17.676  -2.504  1.00 0.00 ? 26  ASP A HB3  5  
ATOM 6130  N N    . THR A 1 27  ? -3.127  14.677  -3.148  1.00 0.00 ? 27  THR A N    5  
ATOM 6131  C CA   . THR A 1 27  ? -2.135  13.649  -3.436  1.00 0.00 ? 27  THR A CA   5  
ATOM 6132  C C    . THR A 1 27  ? -2.459  12.923  -4.737  1.00 0.00 ? 27  THR A C    5  
ATOM 6133  O O    . THR A 1 27  ? -3.488  12.256  -4.849  1.00 0.00 ? 27  THR A O    5  
ATOM 6134  C CB   . THR A 1 27  ? -2.046  12.618  -2.295  1.00 0.00 ? 27  THR A CB   5  
ATOM 6135  O OG1  . THR A 1 27  ? -1.660  13.267  -1.078  1.00 0.00 ? 27  THR A OG1  5  
ATOM 6136  C CG2  . THR A 1 27  ? -1.046  11.523  -2.632  1.00 0.00 ? 27  THR A CG2  5  
ATOM 6137  H H    . THR A 1 27  ? -3.417  14.816  -2.222  1.00 0.00 ? 27  THR A H    5  
ATOM 6138  H HA   . THR A 1 27  ? -1.173  14.131  -3.534  1.00 0.00 ? 27  THR A HA   5  
ATOM 6139  H HB   . THR A 1 27  ? -3.019  12.168  -2.161  1.00 0.00 ? 27  THR A HB   5  
ATOM 6140  H HG1  . THR A 1 27  ? -1.084  14.008  -1.280  1.00 0.00 ? 27  THR A HG1  5  
ATOM 6141  H HG21 . THR A 1 27  ? -0.938  11.451  -3.704  1.00 0.00 ? 27  THR A HG21 5  
ATOM 6142  H HG22 . THR A 1 27  ? -1.399  10.580  -2.241  1.00 0.00 ? 27  THR A HG22 5  
ATOM 6143  H HG23 . THR A 1 27  ? -0.090  11.760  -2.190  1.00 0.00 ? 27  THR A HG23 5  
ATOM 6144  N N    . THR A 1 28  ? -1.573  13.056  -5.720  1.00 0.00 ? 28  THR A N    5  
ATOM 6145  C CA   . THR A 1 28  ? -1.765  12.413  -7.014  1.00 0.00 ? 28  THR A CA   5  
ATOM 6146  C C    . THR A 1 28  ? -0.973  11.113  -7.104  1.00 0.00 ? 28  THR A C    5  
ATOM 6147  O O    . THR A 1 28  ? -0.056  10.878  -6.318  1.00 0.00 ? 28  THR A O    5  
ATOM 6148  C CB   . THR A 1 28  ? -1.343  13.339  -8.169  1.00 0.00 ? 28  THR A CB   5  
ATOM 6149  O OG1  . THR A 1 28  ? 0.016   13.755  -7.993  1.00 0.00 ? 28  THR A OG1  5  
ATOM 6150  C CG2  . THR A 1 28  ? -2.247  14.561  -8.241  1.00 0.00 ? 28  THR A CG2  5  
ATOM 6151  H H    . THR A 1 28  ? -0.772  13.600  -5.569  1.00 0.00 ? 28  THR A H    5  
ATOM 6152  H HA   . THR A 1 28  ? -2.816  12.191  -7.123  1.00 0.00 ? 28  THR A HA   5  
ATOM 6153  H HB   . THR A 1 28  ? -1.427  12.793  -9.098  1.00 0.00 ? 28  THR A HB   5  
ATOM 6154  H HG1  . THR A 1 28  ? 0.101   14.228  -7.162  1.00 0.00 ? 28  THR A HG1  5  
ATOM 6155  H HG21 . THR A 1 28  ? -1.988  15.150  -9.108  1.00 0.00 ? 28  THR A HG21 5  
ATOM 6156  H HG22 . THR A 1 28  ? -2.119  15.156  -7.349  1.00 0.00 ? 28  THR A HG22 5  
ATOM 6157  H HG23 . THR A 1 28  ? -3.276  14.242  -8.317  1.00 0.00 ? 28  THR A HG23 5  
ATOM 6158  N N    . GLU A 1 29  ? -1.332  10.273  -8.070  1.00 0.00 ? 29  GLU A N    5  
ATOM 6159  C CA   . GLU A 1 29  ? -0.654  8.996   -8.262  1.00 0.00 ? 29  GLU A CA   5  
ATOM 6160  C C    . GLU A 1 29  ? 0.827   9.207   -8.566  1.00 0.00 ? 29  GLU A C    5  
ATOM 6161  O O    . GLU A 1 29  ? 1.647   8.314   -8.357  1.00 0.00 ? 29  GLU A O    5  
ATOM 6162  C CB   . GLU A 1 29  ? -1.312  8.210   -9.398  1.00 0.00 ? 29  GLU A CB   5  
ATOM 6163  C CG   . GLU A 1 29  ? -2.815  8.054   -9.239  1.00 0.00 ? 29  GLU A CG   5  
ATOM 6164  C CD   . GLU A 1 29  ? -3.516  7.786   -10.557 1.00 0.00 ? 29  GLU A CD   5  
ATOM 6165  O OE1  . GLU A 1 29  ? -2.865  7.246   -11.476 1.00 0.00 ? 29  GLU A OE1  5  
ATOM 6166  O OE2  . GLU A 1 29  ? -4.715  8.115   -10.668 1.00 0.00 ? 29  GLU A OE2  5  
ATOM 6167  H H    . GLU A 1 29  ? -2.071  10.516  -8.666  1.00 0.00 ? 29  GLU A H    5  
ATOM 6168  H HA   . GLU A 1 29  ? -0.744  8.431   -7.347  1.00 0.00 ? 29  GLU A HA   5  
ATOM 6169  H HB2  . GLU A 1 29  ? -1.119  8.719   -10.331 1.00 0.00 ? 29  GLU A HB2  5  
ATOM 6170  H HB3  . GLU A 1 29  ? -0.872  7.224   -9.439  1.00 0.00 ? 29  GLU A HB3  5  
ATOM 6171  H HG2  . GLU A 1 29  ? -3.010  7.229   -8.571  1.00 0.00 ? 29  GLU A HG2  5  
ATOM 6172  H HG3  . GLU A 1 29  ? -3.215  8.963   -8.814  1.00 0.00 ? 29  GLU A HG3  5  
ATOM 6173  N N    . GLU A 1 30  ? 1.160   10.395  -9.061  1.00 0.00 ? 30  GLU A N    5  
ATOM 6174  C CA   . GLU A 1 30  ? 2.541   10.723  -9.395  1.00 0.00 ? 30  GLU A CA   5  
ATOM 6175  C C    . GLU A 1 30  ? 3.403   10.792  -8.138  1.00 0.00 ? 30  GLU A C    5  
ATOM 6176  O O    . GLU A 1 30  ? 4.483   10.203  -8.078  1.00 0.00 ? 30  GLU A O    5  
ATOM 6177  C CB   . GLU A 1 30  ? 2.605   12.056  -10.144 1.00 0.00 ? 30  GLU A CB   5  
ATOM 6178  C CG   . GLU A 1 30  ? 2.503   11.911  -11.653 1.00 0.00 ? 30  GLU A CG   5  
ATOM 6179  C CD   . GLU A 1 30  ? 2.043   13.187  -12.332 1.00 0.00 ? 30  GLU A CD   5  
ATOM 6180  O OE1  . GLU A 1 30  ? 2.854   14.131  -12.434 1.00 0.00 ? 30  GLU A OE1  5  
ATOM 6181  O OE2  . GLU A 1 30  ? 0.872   13.241  -12.761 1.00 0.00 ? 30  GLU A OE2  5  
ATOM 6182  H H    . GLU A 1 30  ? 0.460   11.066  -9.206  1.00 0.00 ? 30  GLU A H    5  
ATOM 6183  H HA   . GLU A 1 30  ? 2.921   9.942   -10.036 1.00 0.00 ? 30  GLU A HA   5  
ATOM 6184  H HB2  . GLU A 1 30  ? 1.794   12.684  -9.807  1.00 0.00 ? 30  GLU A HB2  5  
ATOM 6185  H HB3  . GLU A 1 30  ? 3.543   12.539  -9.913  1.00 0.00 ? 30  GLU A HB3  5  
ATOM 6186  H HG2  . GLU A 1 30  ? 3.474   11.645  -12.043 1.00 0.00 ? 30  GLU A HG2  5  
ATOM 6187  H HG3  . GLU A 1 30  ? 1.797   11.126  -11.880 1.00 0.00 ? 30  GLU A HG3  5  
ATOM 6188  N N    . THR A 1 31  ? 2.918   11.516  -7.134  1.00 0.00 ? 31  THR A N    5  
ATOM 6189  C CA   . THR A 1 31  ? 3.644   11.663  -5.878  1.00 0.00 ? 31  THR A CA   5  
ATOM 6190  C C    . THR A 1 31  ? 3.547   10.397  -5.035  1.00 0.00 ? 31  THR A C    5  
ATOM 6191  O O    . THR A 1 31  ? 4.370   10.165  -4.148  1.00 0.00 ? 31  THR A O    5  
ATOM 6192  C CB   . THR A 1 31  ? 3.112   12.854  -5.059  1.00 0.00 ? 31  THR A CB   5  
ATOM 6193  O OG1  . THR A 1 31  ? 4.107   13.291  -4.127  1.00 0.00 ? 31  THR A OG1  5  
ATOM 6194  C CG2  . THR A 1 31  ? 1.843   12.473  -4.312  1.00 0.00 ? 31  THR A CG2  5  
ATOM 6195  H H    . THR A 1 31  ? 2.052   11.961  -7.242  1.00 0.00 ? 31  THR A H    5  
ATOM 6196  H HA   . THR A 1 31  ? 4.682   11.850  -6.113  1.00 0.00 ? 31  THR A HA   5  
ATOM 6197  H HB   . THR A 1 31  ? 2.884   13.665  -5.736  1.00 0.00 ? 31  THR A HB   5  
ATOM 6198  H HG1  . THR A 1 31  ? 4.535   12.526  -3.734  1.00 0.00 ? 31  THR A HG1  5  
ATOM 6199  H HG21 . THR A 1 31  ? 1.428   11.574  -4.742  1.00 0.00 ? 31  THR A HG21 5  
ATOM 6200  H HG22 . THR A 1 31  ? 1.124   13.275  -4.391  1.00 0.00 ? 31  THR A HG22 5  
ATOM 6201  H HG23 . THR A 1 31  ? 2.076   12.300  -3.272  1.00 0.00 ? 31  THR A HG23 5  
ATOM 6202  N N    . LEU A 1 32  ? 2.539   9.580   -5.317  1.00 0.00 ? 32  LEU A N    5  
ATOM 6203  C CA   . LEU A 1 32  ? 2.335   8.335   -4.584  1.00 0.00 ? 32  LEU A CA   5  
ATOM 6204  C C    . LEU A 1 32  ? 3.295   7.254   -5.070  1.00 0.00 ? 32  LEU A C    5  
ATOM 6205  O O    . LEU A 1 32  ? 3.782   6.441   -4.283  1.00 0.00 ? 32  LEU A O    5  
ATOM 6206  C CB   . LEU A 1 32  ? 0.890   7.858   -4.742  1.00 0.00 ? 32  LEU A CB   5  
ATOM 6207  C CG   . LEU A 1 32  ? 0.525   6.569   -4.005  1.00 0.00 ? 32  LEU A CG   5  
ATOM 6208  C CD1  . LEU A 1 32  ? 0.594   6.776   -2.500  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 6209  C CD2  . LEU A 1 32  ? -0.861  6.094   -4.417  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 6210  H H    . LEU A 1 32  ? 1.916   9.818   -6.034  1.00 0.00 ? 32  LEU A H    5  
ATOM 6211  H HA   . LEU A 1 32  ? 2.529   8.530   -3.540  1.00 0.00 ? 32  LEU A HA   5  
ATOM 6212  H HB2  . LEU A 1 32  ? 0.242   8.641   -4.378  1.00 0.00 ? 32  LEU A HB2  5  
ATOM 6213  H HB3  . LEU A 1 32  ? 0.707   7.702   -5.795  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 6214  H HG   . LEU A 1 32  ? 1.235   5.798   -4.269  1.00 0.00 ? 32  LEU A HG   5  
ATOM 6215  H HD11 . LEU A 1 32  ? 1.494   6.321   -2.116  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 6216  H HD12 . LEU A 1 32  ? -0.267  6.320   -2.034  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 6217  H HD13 . LEU A 1 32  ? 0.603   7.834   -2.282  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 6218  H HD21 . LEU A 1 32  ? -1.186  6.645   -5.287  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 6219  H HD22 . LEU A 1 32  ? -1.555  6.262   -3.605  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 6220  H HD23 . LEU A 1 32  ? -0.827  5.040   -4.649  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 6221  N N    . LYS A 1 33  ? 3.565   7.251   -6.371  1.00 0.00 ? 33  LYS A N    5  
ATOM 6222  C CA   . LYS A 1 33  ? 4.470   6.273   -6.962  1.00 0.00 ? 33  LYS A CA   5  
ATOM 6223  C C    . LYS A 1 33  ? 5.914   6.554   -6.561  1.00 0.00 ? 33  LYS A C    5  
ATOM 6224  O O    . LYS A 1 33  ? 6.599   5.685   -6.024  1.00 0.00 ? 33  LYS A O    5  
ATOM 6225  C CB   . LYS A 1 33  ? 4.342   6.285   -8.487  1.00 0.00 ? 33  LYS A CB   5  
ATOM 6226  C CG   . LYS A 1 33  ? 5.092   5.155   -9.170  1.00 0.00 ? 33  LYS A CG   5  
ATOM 6227  C CD   . LYS A 1 33  ? 5.519   5.540   -10.577 1.00 0.00 ? 33  LYS A CD   5  
ATOM 6228  C CE   . LYS A 1 33  ? 6.801   4.829   -10.984 1.00 0.00 ? 33  LYS A CE   5  
ATOM 6229  N NZ   . LYS A 1 33  ? 7.974   5.312   -10.205 1.00 0.00 ? 33  LYS A NZ   5  
ATOM 6230  H H    . LYS A 1 33  ? 3.146   7.924   -6.947  1.00 0.00 ? 33  LYS A H    5  
ATOM 6231  H HA   . LYS A 1 33  ? 4.191   5.297   -6.594  1.00 0.00 ? 33  LYS A HA   5  
ATOM 6232  H HB2  . LYS A 1 33  ? 3.297   6.206   -8.749  1.00 0.00 ? 33  LYS A HB2  5  
ATOM 6233  H HB3  . LYS A 1 33  ? 4.727   7.223   -8.861  1.00 0.00 ? 33  LYS A HB3  5  
ATOM 6234  H HG2  . LYS A 1 33  ? 5.972   4.917   -8.591  1.00 0.00 ? 33  LYS A HG2  5  
ATOM 6235  H HG3  . LYS A 1 33  ? 4.448   4.288   -9.224  1.00 0.00 ? 33  LYS A HG3  5  
ATOM 6236  H HD2  . LYS A 1 33  ? 4.736   5.268   -11.269 1.00 0.00 ? 33  LYS A HD2  5  
ATOM 6237  H HD3  . LYS A 1 33  ? 5.682   6.607   -10.615 1.00 0.00 ? 33  LYS A HD3  5  
ATOM 6238  H HE2  . LYS A 1 33  ? 6.679   3.770   -10.816 1.00 0.00 ? 33  LYS A HE2  5  
ATOM 6239  H HE3  . LYS A 1 33  ? 6.978   5.009   -12.034 1.00 0.00 ? 33  LYS A HE3  5  
ATOM 6240  H HZ1  . LYS A 1 33  ? 8.274   6.245   -10.552 1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 6241  H HZ2  . LYS A 1 33  ? 8.767   4.647   -10.304 1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 6242  H HZ3  . LYS A 1 33  ? 7.726   5.391   -9.198  1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 6243  N N    . GLU A 1 34  ? 6.369   7.776   -6.823  1.00 0.00 ? 34  GLU A N    5  
ATOM 6244  C CA   . GLU A 1 34  ? 7.732   8.171   -6.488  1.00 0.00 ? 34  GLU A CA   5  
ATOM 6245  C C    . GLU A 1 34  ? 8.055   7.833   -5.035  1.00 0.00 ? 34  GLU A C    5  
ATOM 6246  O O    . GLU A 1 34  ? 9.128   7.313   -4.731  1.00 0.00 ? 34  GLU A O    5  
ATOM 6247  C CB   . GLU A 1 34  ? 7.926   9.669   -6.730  1.00 0.00 ? 34  GLU A CB   5  
ATOM 6248  C CG   . GLU A 1 34  ? 7.965   10.048  -8.201  1.00 0.00 ? 34  GLU A CG   5  
ATOM 6249  C CD   . GLU A 1 34  ? 9.354   9.929   -8.798  1.00 0.00 ? 34  GLU A CD   5  
ATOM 6250  O OE1  . GLU A 1 34  ? 10.168  10.854  -8.596  1.00 0.00 ? 34  GLU A OE1  5  
ATOM 6251  O OE2  . GLU A 1 34  ? 9.626   8.911   -9.467  1.00 0.00 ? 34  GLU A OE2  5  
ATOM 6252  H H    . GLU A 1 34  ? 5.775   8.426   -7.253  1.00 0.00 ? 34  GLU A H    5  
ATOM 6253  H HA   . GLU A 1 34  ? 8.404   7.622   -7.130  1.00 0.00 ? 34  GLU A HA   5  
ATOM 6254  H HB2  . GLU A 1 34  ? 7.114   10.206  -6.262  1.00 0.00 ? 34  GLU A HB2  5  
ATOM 6255  H HB3  . GLU A 1 34  ? 8.857   9.977   -6.277  1.00 0.00 ? 34  GLU A HB3  5  
ATOM 6256  H HG2  . GLU A 1 34  ? 7.299   9.396   -8.745  1.00 0.00 ? 34  GLU A HG2  5  
ATOM 6257  H HG3  . GLU A 1 34  ? 7.630   11.070  -8.305  1.00 0.00 ? 34  GLU A HG3  5  
ATOM 6258  N N    . SER A 1 35  ? 7.118   8.134   -4.142  1.00 0.00 ? 35  SER A N    5  
ATOM 6259  C CA   . SER A 1 35  ? 7.303   7.866   -2.720  1.00 0.00 ? 35  SER A CA   5  
ATOM 6260  C C    . SER A 1 35  ? 8.043   6.550   -2.507  1.00 0.00 ? 35  SER A C    5  
ATOM 6261  O O    . SER A 1 35  ? 8.851   6.420   -1.587  1.00 0.00 ? 35  SER A O    5  
ATOM 6262  C CB   . SER A 1 35  ? 5.950   7.825   -2.007  1.00 0.00 ? 35  SER A CB   5  
ATOM 6263  O OG   . SER A 1 35  ? 5.260   9.055   -2.151  1.00 0.00 ? 35  SER A OG   5  
ATOM 6264  H H    . SER A 1 35  ? 6.283   8.547   -4.446  1.00 0.00 ? 35  SER A H    5  
ATOM 6265  H HA   . SER A 1 35  ? 7.894   8.670   -2.306  1.00 0.00 ? 35  SER A HA   5  
ATOM 6266  H HB2  . SER A 1 35  ? 5.347   7.036   -2.430  1.00 0.00 ? 35  SER A HB2  5  
ATOM 6267  H HB3  . SER A 1 35  ? 6.107   7.634   -0.955  1.00 0.00 ? 35  SER A HB3  5  
ATOM 6268  H HG   . SER A 1 35  ? 4.458   8.914   -2.660  1.00 0.00 ? 35  SER A HG   5  
ATOM 6269  N N    . PHE A 1 36  ? 7.762   5.574   -3.365  1.00 0.00 ? 36  PHE A N    5  
ATOM 6270  C CA   . PHE A 1 36  ? 8.400   4.266   -3.271  1.00 0.00 ? 36  PHE A CA   5  
ATOM 6271  C C    . PHE A 1 36  ? 9.494   4.118   -4.324  1.00 0.00 ? 36  PHE A C    5  
ATOM 6272  O O    . PHE A 1 36  ? 9.213   3.888   -5.500  1.00 0.00 ? 36  PHE A O    5  
ATOM 6273  C CB   . PHE A 1 36  ? 7.361   3.156   -3.439  1.00 0.00 ? 36  PHE A CB   5  
ATOM 6274  C CG   . PHE A 1 36  ? 6.174   3.303   -2.532  1.00 0.00 ? 36  PHE A CG   5  
ATOM 6275  C CD1  . PHE A 1 36  ? 5.198   4.252   -2.793  1.00 0.00 ? 36  PHE A CD1  5  
ATOM 6276  C CD2  . PHE A 1 36  ? 6.032   2.492   -1.417  1.00 0.00 ? 36  PHE A CD2  5  
ATOM 6277  C CE1  . PHE A 1 36  ? 4.105   4.390   -1.958  1.00 0.00 ? 36  PHE A CE1  5  
ATOM 6278  C CE2  . PHE A 1 36  ? 4.941   2.625   -0.579  1.00 0.00 ? 36  PHE A CE2  5  
ATOM 6279  C CZ   . PHE A 1 36  ? 3.976   3.574   -0.851  1.00 0.00 ? 36  PHE A CZ   5  
ATOM 6280  H H    . PHE A 1 36  ? 7.109   5.738   -4.078  1.00 0.00 ? 36  PHE A H    5  
ATOM 6281  H HA   . PHE A 1 36  ? 8.845   4.185   -2.292  1.00 0.00 ? 36  PHE A HA   5  
ATOM 6282  H HB2  . PHE A 1 36  ? 7.002   3.160   -4.458  1.00 0.00 ? 36  PHE A HB2  5  
ATOM 6283  H HB3  . PHE A 1 36  ? 7.825   2.204   -3.229  1.00 0.00 ? 36  PHE A HB3  5  
ATOM 6284  H HD1  . PHE A 1 36  ? 5.298   4.890   -3.659  1.00 0.00 ? 36  PHE A HD1  5  
ATOM 6285  H HD2  . PHE A 1 36  ? 6.787   1.748   -1.204  1.00 0.00 ? 36  PHE A HD2  5  
ATOM 6286  H HE1  . PHE A 1 36  ? 3.352   5.133   -2.173  1.00 0.00 ? 36  PHE A HE1  5  
ATOM 6287  H HE2  . PHE A 1 36  ? 4.843   1.985   0.285   1.00 0.00 ? 36  PHE A HE2  5  
ATOM 6288  H HZ   . PHE A 1 36  ? 3.123   3.680   -0.198  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 6289  N N    . ASP A 1 37  ? 10.744  4.253   -3.892  1.00 0.00 ? 37  ASP A N    5  
ATOM 6290  C CA   . ASP A 1 37  ? 11.882  4.134   -4.796  1.00 0.00 ? 37  ASP A CA   5  
ATOM 6291  C C    . ASP A 1 37  ? 12.018  2.705   -5.313  1.00 0.00 ? 37  ASP A C    5  
ATOM 6292  O O    . ASP A 1 37  ? 12.555  1.836   -4.628  1.00 0.00 ? 37  ASP A O    5  
ATOM 6293  C CB   . ASP A 1 37  ? 13.169  4.559   -4.088  1.00 0.00 ? 37  ASP A CB   5  
ATOM 6294  C CG   . ASP A 1 37  ? 13.296  6.065   -3.973  1.00 0.00 ? 37  ASP A CG   5  
ATOM 6295  O OD1  . ASP A 1 37  ? 13.529  6.723   -5.009  1.00 0.00 ? 37  ASP A OD1  5  
ATOM 6296  O OD2  . ASP A 1 37  ? 13.161  6.587   -2.846  1.00 0.00 ? 37  ASP A OD2  5  
ATOM 6297  H H    . ASP A 1 37  ? 10.904  4.436   -2.943  1.00 0.00 ? 37  ASP A H    5  
ATOM 6298  H HA   . ASP A 1 37  ? 11.709  4.792   -5.635  1.00 0.00 ? 37  ASP A HA   5  
ATOM 6299  H HB2  . ASP A 1 37  ? 13.181  4.138   -3.093  1.00 0.00 ? 37  ASP A HB2  5  
ATOM 6300  H HB3  . ASP A 1 37  ? 14.017  4.186   -4.643  1.00 0.00 ? 37  ASP A HB3  5  
ATOM 6301  N N    . GLY A 1 38  ? 11.528  2.470   -6.526  1.00 0.00 ? 38  GLY A N    5  
ATOM 6302  C CA   . GLY A 1 38  ? 11.604  1.145   -7.113  1.00 0.00 ? 38  GLY A CA   5  
ATOM 6303  C C    . GLY A 1 38  ? 10.306  0.730   -7.778  1.00 0.00 ? 38  GLY A C    5  
ATOM 6304  O O    . GLY A 1 38  ? 10.317  0.060   -8.810  1.00 0.00 ? 38  GLY A O    5  
ATOM 6305  H H    . GLY A 1 38  ? 11.111  3.202   -7.026  1.00 0.00 ? 38  GLY A H    5  
ATOM 6306  H HA2  . GLY A 1 38  ? 12.393  1.135   -7.850  1.00 0.00 ? 38  GLY A HA2  5  
ATOM 6307  H HA3  . GLY A 1 38  ? 11.841  0.433   -6.336  1.00 0.00 ? 38  GLY A HA3  5  
ATOM 6308  N N    . SER A 1 39  ? 9.186   1.128   -7.184  1.00 0.00 ? 39  SER A N    5  
ATOM 6309  C CA   . SER A 1 39  ? 7.874   0.788   -7.722  1.00 0.00 ? 39  SER A CA   5  
ATOM 6310  C C    . SER A 1 39  ? 7.840   0.984   -9.235  1.00 0.00 ? 39  SER A C    5  
ATOM 6311  O O    . SER A 1 39  ? 8.737   1.596   -9.814  1.00 0.00 ? 39  SER A O    5  
ATOM 6312  C CB   . SER A 1 39  ? 6.791   1.644   -7.062  1.00 0.00 ? 39  SER A CB   5  
ATOM 6313  O OG   . SER A 1 39  ? 6.801   2.965   -7.575  1.00 0.00 ? 39  SER A OG   5  
ATOM 6314  H H    . SER A 1 39  ? 9.243   1.660   -6.363  1.00 0.00 ? 39  SER A H    5  
ATOM 6315  H HA   . SER A 1 39  ? 7.684   -0.252  -7.501  1.00 0.00 ? 39  SER A HA   5  
ATOM 6316  H HB2  . SER A 1 39  ? 5.823   1.204   -7.251  1.00 0.00 ? 39  SER A HB2  5  
ATOM 6317  H HB3  . SER A 1 39  ? 6.967   1.682   -5.996  1.00 0.00 ? 39  SER A HB3  5  
ATOM 6318  H HG   . SER A 1 39  ? 7.563   3.436   -7.231  1.00 0.00 ? 39  SER A HG   5  
ATOM 6319  N N    . VAL A 1 40  ? 6.797   0.459   -9.870  1.00 0.00 ? 40  VAL A N    5  
ATOM 6320  C CA   . VAL A 1 40  ? 6.643   0.576   -11.315 1.00 0.00 ? 40  VAL A CA   5  
ATOM 6321  C C    . VAL A 1 40  ? 5.496   1.514   -11.672 1.00 0.00 ? 40  VAL A C    5  
ATOM 6322  O O    . VAL A 1 40  ? 5.594   2.300   -12.615 1.00 0.00 ? 40  VAL A O    5  
ATOM 6323  C CB   . VAL A 1 40  ? 6.390   -0.797  -11.966 1.00 0.00 ? 40  VAL A CB   5  
ATOM 6324  C CG1  . VAL A 1 40  ? 7.575   -1.723  -11.737 1.00 0.00 ? 40  VAL A CG1  5  
ATOM 6325  C CG2  . VAL A 1 40  ? 5.109   -1.414  -11.426 1.00 0.00 ? 40  VAL A CG2  5  
ATOM 6326  H H    . VAL A 1 40  ? 6.113   -0.018  -9.354  1.00 0.00 ? 40  VAL A H    5  
ATOM 6327  H HA   . VAL A 1 40  ? 7.562   0.977   -11.717 1.00 0.00 ? 40  VAL A HA   5  
ATOM 6328  H HB   . VAL A 1 40  ? 6.275   -0.653  -13.030 1.00 0.00 ? 40  VAL A HB   5  
ATOM 6329  H HG11 . VAL A 1 40  ? 7.698   -1.895  -10.678 1.00 0.00 ? 40  VAL A HG11 5  
ATOM 6330  H HG12 . VAL A 1 40  ? 7.399   -2.664  -12.237 1.00 0.00 ? 40  VAL A HG12 5  
ATOM 6331  H HG13 . VAL A 1 40  ? 8.470   -1.267  -12.133 1.00 0.00 ? 40  VAL A HG13 5  
ATOM 6332  H HG21 . VAL A 1 40  ? 4.933   -1.056  -10.422 1.00 0.00 ? 40  VAL A HG21 5  
ATOM 6333  H HG22 . VAL A 1 40  ? 4.279   -1.133  -12.058 1.00 0.00 ? 40  VAL A HG22 5  
ATOM 6334  H HG23 . VAL A 1 40  ? 5.203   -2.489  -11.414 1.00 0.00 ? 40  VAL A HG23 5  
ATOM 6335  N N    . ARG A 1 41  ? 4.409   1.427   -10.912 1.00 0.00 ? 41  ARG A N    5  
ATOM 6336  C CA   . ARG A 1 41  ? 3.242   2.268   -11.149 1.00 0.00 ? 41  ARG A CA   5  
ATOM 6337  C C    . ARG A 1 41  ? 2.438   2.455   -9.865  1.00 0.00 ? 41  ARG A C    5  
ATOM 6338  O O    . ARG A 1 41  ? 2.700   1.801   -8.856  1.00 0.00 ? 41  ARG A O    5  
ATOM 6339  C CB   . ARG A 1 41  ? 2.356   1.654   -12.234 1.00 0.00 ? 41  ARG A CB   5  
ATOM 6340  C CG   . ARG A 1 41  ? 3.013   1.610   -13.604 1.00 0.00 ? 41  ARG A CG   5  
ATOM 6341  C CD   . ARG A 1 41  ? 3.235   3.008   -14.160 1.00 0.00 ? 41  ARG A CD   5  
ATOM 6342  N NE   . ARG A 1 41  ? 3.866   2.979   -15.477 1.00 0.00 ? 41  ARG A NE   5  
ATOM 6343  C CZ   . ARG A 1 41  ? 4.547   3.999   -15.988 1.00 0.00 ? 41  ARG A CZ   5  
ATOM 6344  N NH1  . ARG A 1 41  ? 4.685   5.122   -15.296 1.00 0.00 ? 41  ARG A NH1  5  
ATOM 6345  N NH2  . ARG A 1 41  ? 5.092   3.897   -17.193 1.00 0.00 ? 41  ARG A NH2  5  
ATOM 6346  H H    . ARG A 1 41  ? 4.392   0.781   -10.175 1.00 0.00 ? 41  ARG A H    5  
ATOM 6347  H HA   . ARG A 1 41  ? 3.591   3.233   -11.485 1.00 0.00 ? 41  ARG A HA   5  
ATOM 6348  H HB2  . ARG A 1 41  ? 2.104   0.644   -11.947 1.00 0.00 ? 41  ARG A HB2  5  
ATOM 6349  H HB3  . ARG A 1 41  ? 1.449   2.234   -12.312 1.00 0.00 ? 41  ARG A HB3  5  
ATOM 6350  H HG2  . ARG A 1 41  ? 3.967   1.112   -13.520 1.00 0.00 ? 41  ARG A HG2  5  
ATOM 6351  H HG3  . ARG A 1 41  ? 2.376   1.060   -14.280 1.00 0.00 ? 41  ARG A HG3  5  
ATOM 6352  H HD2  . ARG A 1 41  ? 2.281   3.506   -14.240 1.00 0.00 ? 41  ARG A HD2  5  
ATOM 6353  H HD3  . ARG A 1 41  ? 3.870   3.555   -13.478 1.00 0.00 ? 41  ARG A HD3  5  
ATOM 6354  H HE   . ARG A 1 41  ? 3.777   2.159   -16.005 1.00 0.00 ? 41  ARG A HE   5  
ATOM 6355  H HH11 . ARG A 1 41  ? 4.276   5.201   -14.387 1.00 0.00 ? 41  ARG A HH11 5  
ATOM 6356  H HH12 . ARG A 1 41  ? 5.199   5.888   -15.683 1.00 0.00 ? 41  ARG A HH12 5  
ATOM 6357  H HH21 . ARG A 1 41  ? 4.991   3.052   -17.717 1.00 0.00 ? 41  ARG A HH21 5  
ATOM 6358  H HH22 . ARG A 1 41  ? 5.604   4.664   -17.577 1.00 0.00 ? 41  ARG A HH22 5  
ATOM 6359  N N    . ALA A 1 42  ? 1.459   3.353   -9.912  1.00 0.00 ? 42  ALA A N    5  
ATOM 6360  C CA   . ALA A 1 42  ? 0.616   3.625   -8.755  1.00 0.00 ? 42  ALA A CA   5  
ATOM 6361  C C    . ALA A 1 42  ? -0.809  3.962   -9.181  1.00 0.00 ? 42  ALA A C    5  
ATOM 6362  O O    . ALA A 1 42  ? -1.053  4.325   -10.331 1.00 0.00 ? 42  ALA A O    5  
ATOM 6363  C CB   . ALA A 1 42  ? 1.204   4.758   -7.928  1.00 0.00 ? 42  ALA A CB   5  
ATOM 6364  H H    . ALA A 1 42  ? 1.299   3.842   -10.746 1.00 0.00 ? 42  ALA A H    5  
ATOM 6365  H HA   . ALA A 1 42  ? 0.596   2.736   -8.140  1.00 0.00 ? 42  ALA A HA   5  
ATOM 6366  H HB1  . ALA A 1 42  ? 2.282   4.687   -7.937  1.00 0.00 ? 42  ALA A HB1  5  
ATOM 6367  H HB2  . ALA A 1 42  ? 0.902   5.705   -8.349  1.00 0.00 ? 42  ALA A HB2  5  
ATOM 6368  H HB3  . ALA A 1 42  ? 0.847   4.685   -6.912  1.00 0.00 ? 42  ALA A HB3  5  
ATOM 6369  N N    . ARG A 1 43  ? -1.746  3.840   -8.246  1.00 0.00 ? 43  ARG A N    5  
ATOM 6370  C CA   . ARG A 1 43  ? -3.147  4.131   -8.526  1.00 0.00 ? 43  ARG A CA   5  
ATOM 6371  C C    . ARG A 1 43  ? -3.833  4.730   -7.301  1.00 0.00 ? 43  ARG A C    5  
ATOM 6372  O O    . ARG A 1 43  ? -3.641  4.261   -6.179  1.00 0.00 ? 43  ARG A O    5  
ATOM 6373  C CB   . ARG A 1 43  ? -3.876  2.859   -8.961  1.00 0.00 ? 43  ARG A CB   5  
ATOM 6374  C CG   . ARG A 1 43  ? -3.072  1.992   -9.916  1.00 0.00 ? 43  ARG A CG   5  
ATOM 6375  C CD   . ARG A 1 43  ? -3.978  1.184   -10.832 1.00 0.00 ? 43  ARG A CD   5  
ATOM 6376  N NE   . ARG A 1 43  ? -3.350  0.912   -12.122 1.00 0.00 ? 43  ARG A NE   5  
ATOM 6377  C CZ   . ARG A 1 43  ? -4.024  0.536   -13.203 1.00 0.00 ? 43  ARG A CZ   5  
ATOM 6378  N NH1  . ARG A 1 43  ? -5.340  0.390   -13.150 1.00 0.00 ? 43  ARG A NH1  5  
ATOM 6379  N NH2  . ARG A 1 43  ? -3.381  0.307   -14.341 1.00 0.00 ? 43  ARG A NH2  5  
ATOM 6380  H H    . ARG A 1 43  ? -1.489  3.546   -7.347  1.00 0.00 ? 43  ARG A H    5  
ATOM 6381  H HA   . ARG A 1 43  ? -3.182  4.849   -9.331  1.00 0.00 ? 43  ARG A HA   5  
ATOM 6382  H HB2  . ARG A 1 43  ? -4.107  2.271   -8.084  1.00 0.00 ? 43  ARG A HB2  5  
ATOM 6383  H HB3  . ARG A 1 43  ? -4.798  3.136   -9.450  1.00 0.00 ? 43  ARG A HB3  5  
ATOM 6384  H HG2  . ARG A 1 43  ? -2.442  2.627   -10.521 1.00 0.00 ? 43  ARG A HG2  5  
ATOM 6385  H HG3  . ARG A 1 43  ? -2.458  1.314   -9.342  1.00 0.00 ? 43  ARG A HG3  5  
ATOM 6386  H HD2  . ARG A 1 43  ? -4.210  0.246   -10.351 1.00 0.00 ? 43  ARG A HD2  5  
ATOM 6387  H HD3  . ARG A 1 43  ? -4.889  1.739   -10.996 1.00 0.00 ? 43  ARG A HD3  5  
ATOM 6388  H HE   . ARG A 1 43  ? -2.377  1.014   -12.184 1.00 0.00 ? 43  ARG A HE   5  
ATOM 6389  H HH11 . ARG A 1 43  ? -5.828  0.563   -12.294 1.00 0.00 ? 43  ARG A HH11 5  
ATOM 6390  H HH12 . ARG A 1 43  ? -5.846  0.108   -13.966 1.00 0.00 ? 43  ARG A HH12 5  
ATOM 6391  H HH21 . ARG A 1 43  ? -2.388  0.417   -14.385 1.00 0.00 ? 43  ARG A HH21 5  
ATOM 6392  H HH22 . ARG A 1 43  ? -3.889  0.024   -15.154 1.00 0.00 ? 43  ARG A HH22 5  
ATOM 6393  N N    . ILE A 1 44  ? -4.631  5.768   -7.526  1.00 0.00 ? 44  ILE A N    5  
ATOM 6394  C CA   . ILE A 1 44  ? -5.345  6.430   -6.441  1.00 0.00 ? 44  ILE A CA   5  
ATOM 6395  C C    . ILE A 1 44  ? -6.855  6.324   -6.632  1.00 0.00 ? 44  ILE A C    5  
ATOM 6396  O O    . ILE A 1 44  ? -7.365  6.492   -7.739  1.00 0.00 ? 44  ILE A O    5  
ATOM 6397  C CB   . ILE A 1 44  ? -4.956  7.916   -6.335  1.00 0.00 ? 44  ILE A CB   5  
ATOM 6398  C CG1  . ILE A 1 44  ? -3.533  8.055   -5.791  1.00 0.00 ? 44  ILE A CG1  5  
ATOM 6399  C CG2  . ILE A 1 44  ? -5.943  8.660   -5.449  1.00 0.00 ? 44  ILE A CG2  5  
ATOM 6400  C CD1  . ILE A 1 44  ? -3.010  9.474   -5.820  1.00 0.00 ? 44  ILE A CD1  5  
ATOM 6401  H H    . ILE A 1 44  ? -4.743  6.095   -8.442  1.00 0.00 ? 44  ILE A H    5  
ATOM 6402  H HA   . ILE A 1 44  ? -5.075  5.940   -5.516  1.00 0.00 ? 44  ILE A HA   5  
ATOM 6403  H HB   . ILE A 1 44  ? -4.999  8.348   -7.323  1.00 0.00 ? 44  ILE A HB   5  
ATOM 6404  H HG12 . ILE A 1 44  ? -3.510  7.715   -4.767  1.00 0.00 ? 44  ILE A HG12 5  
ATOM 6405  H HG13 . ILE A 1 44  ? -2.867  7.443   -6.383  1.00 0.00 ? 44  ILE A HG13 5  
ATOM 6406  H HG21 . ILE A 1 44  ? -6.546  7.948   -4.905  1.00 0.00 ? 44  ILE A HG21 5  
ATOM 6407  H HG22 . ILE A 1 44  ? -5.402  9.280   -4.749  1.00 0.00 ? 44  ILE A HG22 5  
ATOM 6408  H HG23 . ILE A 1 44  ? -6.581  9.280   -6.061  1.00 0.00 ? 44  ILE A HG23 5  
ATOM 6409  H HD11 . ILE A 1 44  ? -3.280  9.938   -6.757  1.00 0.00 ? 44  ILE A HD11 5  
ATOM 6410  H HD12 . ILE A 1 44  ? -3.440  10.034  -5.003  1.00 0.00 ? 44  ILE A HD12 5  
ATOM 6411  H HD13 . ILE A 1 44  ? -1.934  9.464   -5.721  1.00 0.00 ? 44  ILE A HD13 5  
ATOM 6412  N N    . VAL A 1 45  ? -7.565  6.046   -5.543  1.00 0.00 ? 45  VAL A N    5  
ATOM 6413  C CA   . VAL A 1 45  ? -9.017  5.921   -5.589  1.00 0.00 ? 45  VAL A CA   5  
ATOM 6414  C C    . VAL A 1 45  ? -9.691  7.280   -5.439  1.00 0.00 ? 45  VAL A C    5  
ATOM 6415  O O    . VAL A 1 45  ? -9.124  8.206   -4.858  1.00 0.00 ? 45  VAL A O    5  
ATOM 6416  C CB   . VAL A 1 45  ? -9.534  4.979   -4.485  1.00 0.00 ? 45  VAL A CB   5  
ATOM 6417  C CG1  . VAL A 1 45  ? -8.829  3.633   -4.558  1.00 0.00 ? 45  VAL A CG1  5  
ATOM 6418  C CG2  . VAL A 1 45  ? -9.350  5.613   -3.115  1.00 0.00 ? 45  VAL A CG2  5  
ATOM 6419  H H    . VAL A 1 45  ? -7.102  5.923   -4.688  1.00 0.00 ? 45  VAL A H    5  
ATOM 6420  H HA   . VAL A 1 45  ? -9.286  5.500   -6.547  1.00 0.00 ? 45  VAL A HA   5  
ATOM 6421  H HB   . VAL A 1 45  ? -10.590 4.816   -4.645  1.00 0.00 ? 45  VAL A HB   5  
ATOM 6422  H HG11 . VAL A 1 45  ? -8.725  3.337   -5.592  1.00 0.00 ? 45  VAL A HG11 5  
ATOM 6423  H HG12 . VAL A 1 45  ? -7.852  3.712   -4.105  1.00 0.00 ? 45  VAL A HG12 5  
ATOM 6424  H HG13 . VAL A 1 45  ? -9.413  2.892   -4.031  1.00 0.00 ? 45  VAL A HG13 5  
ATOM 6425  H HG21 . VAL A 1 45  ? -9.171  6.671   -3.230  1.00 0.00 ? 45  VAL A HG21 5  
ATOM 6426  H HG22 . VAL A 1 45  ? -10.242 5.460   -2.524  1.00 0.00 ? 45  VAL A HG22 5  
ATOM 6427  H HG23 . VAL A 1 45  ? -8.507  5.157   -2.617  1.00 0.00 ? 45  VAL A HG23 5  
ATOM 6428  N N    . THR A 1 46  ? -10.906 7.394   -5.966  1.00 0.00 ? 46  THR A N    5  
ATOM 6429  C CA   . THR A 1 46  ? -11.658 8.640   -5.892  1.00 0.00 ? 46  THR A CA   5  
ATOM 6430  C C    . THR A 1 46  ? -13.113 8.382   -5.516  1.00 0.00 ? 46  THR A C    5  
ATOM 6431  O O    . THR A 1 46  ? -13.570 7.239   -5.512  1.00 0.00 ? 46  THR A O    5  
ATOM 6432  C CB   . THR A 1 46  ? -11.613 9.404   -7.228  1.00 0.00 ? 46  THR A CB   5  
ATOM 6433  O OG1  . THR A 1 46  ? -12.317 8.671   -8.236  1.00 0.00 ? 46  THR A OG1  5  
ATOM 6434  C CG2  . THR A 1 46  ? -10.176 9.633   -7.672  1.00 0.00 ? 46  THR A CG2  5  
ATOM 6435  H H    . THR A 1 46  ? -11.304 6.620   -6.417  1.00 0.00 ? 46  THR A H    5  
ATOM 6436  H HA   . THR A 1 46  ? -11.204 9.259   -5.132  1.00 0.00 ? 46  THR A HA   5  
ATOM 6437  H HB   . THR A 1 46  ? -12.089 10.364  -7.093  1.00 0.00 ? 46  THR A HB   5  
ATOM 6438  H HG1  . THR A 1 46  ? -12.279 7.732   -8.035  1.00 0.00 ? 46  THR A HG1  5  
ATOM 6439  H HG21 . THR A 1 46  ? -9.651  8.689   -7.693  1.00 0.00 ? 46  THR A HG21 5  
ATOM 6440  H HG22 . THR A 1 46  ? -9.687  10.302  -6.980  1.00 0.00 ? 46  THR A HG22 5  
ATOM 6441  H HG23 . THR A 1 46  ? -10.170 10.069  -8.660  1.00 0.00 ? 46  THR A HG23 5  
ATOM 6442  N N    . ASP A 1 47  ? -13.835 9.452   -5.200  1.00 0.00 ? 47  ASP A N    5  
ATOM 6443  C CA   . ASP A 1 47  ? -15.240 9.341   -4.825  1.00 0.00 ? 47  ASP A CA   5  
ATOM 6444  C C    . ASP A 1 47  ? -16.129 9.264   -6.062  1.00 0.00 ? 47  ASP A C    5  
ATOM 6445  O O    . ASP A 1 47  ? -15.750 9.722   -7.140  1.00 0.00 ? 47  ASP A O    5  
ATOM 6446  C CB   . ASP A 1 47  ? -15.653 10.532  -3.958  1.00 0.00 ? 47  ASP A CB   5  
ATOM 6447  C CG   . ASP A 1 47  ? -16.752 10.179  -2.975  1.00 0.00 ? 47  ASP A CG   5  
ATOM 6448  O OD1  . ASP A 1 47  ? -17.391 9.121   -3.154  1.00 0.00 ? 47  ASP A OD1  5  
ATOM 6449  O OD2  . ASP A 1 47  ? -16.973 10.961  -2.026  1.00 0.00 ? 47  ASP A OD2  5  
ATOM 6450  H H    . ASP A 1 47  ? -13.414 10.337  -5.222  1.00 0.00 ? 47  ASP A H    5  
ATOM 6451  H HA   . ASP A 1 47  ? -15.360 8.433   -4.253  1.00 0.00 ? 47  ASP A HA   5  
ATOM 6452  H HB2  . ASP A 1 47  ? -14.795 10.878  -3.400  1.00 0.00 ? 47  ASP A HB2  5  
ATOM 6453  H HB3  . ASP A 1 47  ? -16.007 11.328  -4.596  1.00 0.00 ? 47  ASP A HB3  5  
ATOM 6454  N N    . ARG A 1 48  ? -17.312 8.682   -5.898  1.00 0.00 ? 48  ARG A N    5  
ATOM 6455  C CA   . ARG A 1 48  ? -18.254 8.542   -7.002  1.00 0.00 ? 48  ARG A CA   5  
ATOM 6456  C C    . ARG A 1 48  ? -19.254 9.695   -7.013  1.00 0.00 ? 48  ARG A C    5  
ATOM 6457  O O    . ARG A 1 48  ? -19.963 9.905   -7.996  1.00 0.00 ? 48  ARG A O    5  
ATOM 6458  C CB   . ARG A 1 48  ? -18.998 7.209   -6.901  1.00 0.00 ? 48  ARG A CB   5  
ATOM 6459  C CG   . ARG A 1 48  ? -20.161 7.234   -5.923  1.00 0.00 ? 48  ARG A CG   5  
ATOM 6460  C CD   . ARG A 1 48  ? -21.454 7.653   -6.605  1.00 0.00 ? 48  ARG A CD   5  
ATOM 6461  N NE   . ARG A 1 48  ? -22.628 7.331   -5.798  1.00 0.00 ? 48  ARG A NE   5  
ATOM 6462  C CZ   . ARG A 1 48  ? -23.876 7.553   -6.196  1.00 0.00 ? 48  ARG A CZ   5  
ATOM 6463  N NH1  . ARG A 1 48  ? -24.111 8.093   -7.384  1.00 0.00 ? 48  ARG A NH1  5  
ATOM 6464  N NH2  . ARG A 1 48  ? -24.892 7.233   -5.405  1.00 0.00 ? 48  ARG A NH2  5  
ATOM 6465  H H    . ARG A 1 48  ? -17.558 8.336   -5.014  1.00 0.00 ? 48  ARG A H    5  
ATOM 6466  H HA   . ARG A 1 48  ? -17.691 8.561   -7.923  1.00 0.00 ? 48  ARG A HA   5  
ATOM 6467  H HB2  . ARG A 1 48  ? -19.382 6.950   -7.877  1.00 0.00 ? 48  ARG A HB2  5  
ATOM 6468  H HB3  . ARG A 1 48  ? -18.304 6.447   -6.582  1.00 0.00 ? 48  ARG A HB3  5  
ATOM 6469  H HG2  . ARG A 1 48  ? -20.291 6.245   -5.507  1.00 0.00 ? 48  ARG A HG2  5  
ATOM 6470  H HG3  . ARG A 1 48  ? -19.939 7.933   -5.131  1.00 0.00 ? 48  ARG A HG3  5  
ATOM 6471  H HD2  . ARG A 1 48  ? -21.427 8.719   -6.775  1.00 0.00 ? 48  ARG A HD2  5  
ATOM 6472  H HD3  . ARG A 1 48  ? -21.528 7.140   -7.553  1.00 0.00 ? 48  ARG A HD3  5  
ATOM 6473  H HE   . ARG A 1 48  ? -22.477 6.931   -4.917  1.00 0.00 ? 48  ARG A HE   5  
ATOM 6474  H HH11 . ARG A 1 48  ? -23.347 8.335   -7.982  1.00 0.00 ? 48  ARG A HH11 5  
ATOM 6475  H HH12 . ARG A 1 48  ? -25.052 8.258   -7.681  1.00 0.00 ? 48  ARG A HH12 5  
ATOM 6476  H HH21 . ARG A 1 48  ? -24.719 6.825   -4.509  1.00 0.00 ? 48  ARG A HH21 5  
ATOM 6477  H HH22 . ARG A 1 48  ? -25.831 7.400   -5.705  1.00 0.00 ? 48  ARG A HH22 5  
ATOM 6478  N N    . GLU A 1 49  ? -19.304 10.438  -5.911  1.00 0.00 ? 49  GLU A N    5  
ATOM 6479  C CA   . GLU A 1 49  ? -20.218 11.569  -5.794  1.00 0.00 ? 49  GLU A CA   5  
ATOM 6480  C C    . GLU A 1 49  ? -19.495 12.884  -6.072  1.00 0.00 ? 49  GLU A C    5  
ATOM 6481  O O    . GLU A 1 49  ? -20.028 13.771  -6.739  1.00 0.00 ? 49  GLU A O    5  
ATOM 6482  C CB   . GLU A 1 49  ? -20.845 11.603  -4.399  1.00 0.00 ? 49  GLU A CB   5  
ATOM 6483  C CG   . GLU A 1 49  ? -19.916 11.112  -3.302  1.00 0.00 ? 49  GLU A CG   5  
ATOM 6484  C CD   . GLU A 1 49  ? -20.468 11.369  -1.912  1.00 0.00 ? 49  GLU A CD   5  
ATOM 6485  O OE1  . GLU A 1 49  ? -21.185 12.376  -1.736  1.00 0.00 ? 49  GLU A OE1  5  
ATOM 6486  O OE2  . GLU A 1 49  ? -20.182 10.564  -1.002  1.00 0.00 ? 49  GLU A OE2  5  
ATOM 6487  H H    . GLU A 1 49  ? -18.714 10.221  -5.160  1.00 0.00 ? 49  GLU A H    5  
ATOM 6488  H HA   . GLU A 1 49  ? -21.000 11.440  -6.527  1.00 0.00 ? 49  GLU A HA   5  
ATOM 6489  H HB2  . GLU A 1 49  ? -21.133 12.619  -4.172  1.00 0.00 ? 49  GLU A HB2  5  
ATOM 6490  H HB3  . GLU A 1 49  ? -21.728 10.981  -4.399  1.00 0.00 ? 49  GLU A HB3  5  
ATOM 6491  H HG2  . GLU A 1 49  ? -19.767 10.050  -3.422  1.00 0.00 ? 49  GLU A HG2  5  
ATOM 6492  H HG3  . GLU A 1 49  ? -18.968 11.621  -3.396  1.00 0.00 ? 49  GLU A HG3  5  
ATOM 6493  N N    . THR A 1 50  ? -18.276 13.003  -5.554  1.00 0.00 ? 50  THR A N    5  
ATOM 6494  C CA   . THR A 1 50  ? -17.480 14.209  -5.743  1.00 0.00 ? 50  THR A CA   5  
ATOM 6495  C C    . THR A 1 50  ? -16.474 14.031  -6.874  1.00 0.00 ? 50  THR A C    5  
ATOM 6496  O O    . THR A 1 50  ? -15.984 15.007  -7.441  1.00 0.00 ? 50  THR A O    5  
ATOM 6497  C CB   . THR A 1 50  ? -16.726 14.592  -4.456  1.00 0.00 ? 50  THR A CB   5  
ATOM 6498  O OG1  . THR A 1 50  ? -15.899 13.504  -4.030  1.00 0.00 ? 50  THR A OG1  5  
ATOM 6499  C CG2  . THR A 1 50  ? -17.701 14.960  -3.347  1.00 0.00 ? 50  THR A CG2  5  
ATOM 6500  H H    . THR A 1 50  ? -17.906 12.261  -5.031  1.00 0.00 ? 50  THR A H    5  
ATOM 6501  H HA   . THR A 1 50  ? -18.152 15.016  -5.996  1.00 0.00 ? 50  THR A HA   5  
ATOM 6502  H HB   . THR A 1 50  ? -16.102 15.449  -4.664  1.00 0.00 ? 50  THR A HB   5  
ATOM 6503  H HG1  . THR A 1 50  ? -15.064 13.531  -4.503  1.00 0.00 ? 50  THR A HG1  5  
ATOM 6504  H HG21 . THR A 1 50  ? -17.276 14.694  -2.391  1.00 0.00 ? 50  THR A HG21 5  
ATOM 6505  H HG22 . THR A 1 50  ? -18.628 14.424  -3.490  1.00 0.00 ? 50  THR A HG22 5  
ATOM 6506  H HG23 . THR A 1 50  ? -17.891 16.022  -3.373  1.00 0.00 ? 50  THR A HG23 5  
ATOM 6507  N N    . GLY A 1 51  ? -16.169 12.778  -7.198  1.00 0.00 ? 51  GLY A N    5  
ATOM 6508  C CA   . GLY A 1 51  ? -15.222 12.495  -8.261  1.00 0.00 ? 51  GLY A CA   5  
ATOM 6509  C C    . GLY A 1 51  ? -13.833 13.017  -7.953  1.00 0.00 ? 51  GLY A C    5  
ATOM 6510  O O    . GLY A 1 51  ? -13.076 13.359  -8.861  1.00 0.00 ? 51  GLY A O    5  
ATOM 6511  H H    . GLY A 1 51  ? -16.591 12.039  -6.711  1.00 0.00 ? 51  GLY A H    5  
ATOM 6512  H HA2  . GLY A 1 51  ? -15.170 11.427  -8.407  1.00 0.00 ? 51  GLY A HA2  5  
ATOM 6513  H HA3  . GLY A 1 51  ? -15.574 12.957  -9.172  1.00 0.00 ? 51  GLY A HA3  5  
ATOM 6514  N N    . SER A 1 52  ? -13.497 13.080  -6.669  1.00 0.00 ? 52  SER A N    5  
ATOM 6515  C CA   . SER A 1 52  ? -12.191 13.570  -6.243  1.00 0.00 ? 52  SER A CA   5  
ATOM 6516  C C    . SER A 1 52  ? -11.438 12.498  -5.461  1.00 0.00 ? 52  SER A C    5  
ATOM 6517  O O    . SER A 1 52  ? -12.031 11.532  -4.982  1.00 0.00 ? 52  SER A O    5  
ATOM 6518  C CB   . SER A 1 52  ? -12.348 14.827  -5.386  1.00 0.00 ? 52  SER A CB   5  
ATOM 6519  O OG   . SER A 1 52  ? -11.087 15.319  -4.965  1.00 0.00 ? 52  SER A OG   5  
ATOM 6520  H H    . SER A 1 52  ? -14.144 12.793  -5.991  1.00 0.00 ? 52  SER A H    5  
ATOM 6521  H HA   . SER A 1 52  ? -11.625 13.817  -7.129  1.00 0.00 ? 52  SER A HA   5  
ATOM 6522  H HB2  . SER A 1 52  ? -12.846 15.592  -5.962  1.00 0.00 ? 52  SER A HB2  5  
ATOM 6523  H HB3  . SER A 1 52  ? -12.939 14.592  -4.513  1.00 0.00 ? 52  SER A HB3  5  
ATOM 6524  H HG   . SER A 1 52  ? -10.710 15.867  -5.657  1.00 0.00 ? 52  SER A HG   5  
ATOM 6525  N N    . SER A 1 53  ? -10.126 12.677  -5.336  1.00 0.00 ? 53  SER A N    5  
ATOM 6526  C CA   . SER A 1 53  ? -9.290  11.724  -4.616  1.00 0.00 ? 53  SER A CA   5  
ATOM 6527  C C    . SER A 1 53  ? -9.665  11.682  -3.137  1.00 0.00 ? 53  SER A C    5  
ATOM 6528  O O    . SER A 1 53  ? -9.541  12.678  -2.424  1.00 0.00 ? 53  SER A O    5  
ATOM 6529  C CB   . SER A 1 53  ? -7.813  12.092  -4.769  1.00 0.00 ? 53  SER A CB   5  
ATOM 6530  O OG   . SER A 1 53  ? -7.376  11.904  -6.104  1.00 0.00 ? 53  SER A OG   5  
ATOM 6531  H H    . SER A 1 53  ? -9.712  13.468  -5.741  1.00 0.00 ? 53  SER A H    5  
ATOM 6532  H HA   . SER A 1 53  ? -9.455  10.747  -5.045  1.00 0.00 ? 53  SER A HA   5  
ATOM 6533  H HB2  . SER A 1 53  ? -7.673  13.128  -4.500  1.00 0.00 ? 53  SER A HB2  5  
ATOM 6534  H HB3  . SER A 1 53  ? -7.220  11.468  -4.117  1.00 0.00 ? 53  SER A HB3  5  
ATOM 6535  H HG   . SER A 1 53  ? -6.425  12.026  -6.150  1.00 0.00 ? 53  SER A HG   5  
ATOM 6536  N N    . LYS A 1 54  ? -10.123 10.521  -2.683  1.00 0.00 ? 54  LYS A N    5  
ATOM 6537  C CA   . LYS A 1 54  ? -10.515 10.345  -1.289  1.00 0.00 ? 54  LYS A CA   5  
ATOM 6538  C C    . LYS A 1 54  ? -9.329  10.569  -0.358  1.00 0.00 ? 54  LYS A C    5  
ATOM 6539  O O    . LYS A 1 54  ? -9.411  11.344  0.594   1.00 0.00 ? 54  LYS A O    5  
ATOM 6540  C CB   . LYS A 1 54  ? -11.091 8.944   -1.073  1.00 0.00 ? 54  LYS A CB   5  
ATOM 6541  C CG   . LYS A 1 54  ? -12.379 8.691   -1.836  1.00 0.00 ? 54  LYS A CG   5  
ATOM 6542  C CD   . LYS A 1 54  ? -12.690 7.206   -1.928  1.00 0.00 ? 54  LYS A CD   5  
ATOM 6543  C CE   . LYS A 1 54  ? -13.414 6.710   -0.685  1.00 0.00 ? 54  LYS A CE   5  
ATOM 6544  N NZ   . LYS A 1 54  ? -13.813 5.281   -0.809  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 6545  H H    . LYS A 1 54  ? -10.199 9.763   -3.300  1.00 0.00 ? 54  LYS A H    5  
ATOM 6546  H HA   . LYS A 1 54  ? -11.277 11.076  -1.064  1.00 0.00 ? 54  LYS A HA   5  
ATOM 6547  H HB2  . LYS A 1 54  ? -10.360 8.215   -1.390  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 6548  H HB3  . LYS A 1 54  ? -11.288 8.808   -0.019  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 6549  H HG2  . LYS A 1 54  ? -13.192 9.187   -1.327  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 6550  H HG3  . LYS A 1 54  ? -12.280 9.091   -2.835  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 6551  H HD2  . LYS A 1 54  ? -13.317 7.031   -2.789  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 6552  H HD3  . LYS A 1 54  ? -11.764 6.659   -2.037  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 6553  H HE2  . LYS A 1 54  ? -12.759 6.820   0.165   1.00 0.00 ? 54  LYS A HE2  5  
ATOM 6554  H HE3  . LYS A 1 54  ? -14.300 7.311   -0.537  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 6555  H HZ1  . LYS A 1 54  ? -14.772 5.211   -1.205  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 6556  H HZ2  . LYS A 1 54  ? -13.802 4.825   0.126   1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 6557  H HZ3  . LYS A 1 54  ? -13.153 4.778   -1.436  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 6558  N N    . GLY A 1 55  ? -8.224  9.884   -0.639  1.00 0.00 ? 55  GLY A N    5  
ATOM 6559  C CA   . GLY A 1 55  ? -7.036  10.023  0.183   1.00 0.00 ? 55  GLY A CA   5  
ATOM 6560  C C    . GLY A 1 55  ? -6.313  8.706   0.385   1.00 0.00 ? 55  GLY A C    5  
ATOM 6561  O O    . GLY A 1 55  ? -5.781  8.440   1.463   1.00 0.00 ? 55  GLY A O    5  
ATOM 6562  H H    . GLY A 1 55  ? -8.216  9.280   -1.410  1.00 0.00 ? 55  GLY A H    5  
ATOM 6563  H HA2  . GLY A 1 55  ? -6.363  10.722  -0.292  1.00 0.00 ? 55  GLY A HA2  5  
ATOM 6564  H HA3  . GLY A 1 55  ? -7.323  10.414  1.148   1.00 0.00 ? 55  GLY A HA3  5  
ATOM 6565  N N    . PHE A 1 56  ? -6.294  7.878   -0.654  1.00 0.00 ? 56  PHE A N    5  
ATOM 6566  C CA   . PHE A 1 56  ? -5.634  6.580   -0.585  1.00 0.00 ? 56  PHE A CA   5  
ATOM 6567  C C    . PHE A 1 56  ? -5.653  5.887   -1.945  1.00 0.00 ? 56  PHE A C    5  
ATOM 6568  O O    . PHE A 1 56  ? -6.477  6.201   -2.802  1.00 0.00 ? 56  PHE A O    5  
ATOM 6569  C CB   . PHE A 1 56  ? -6.312  5.693   0.461   1.00 0.00 ? 56  PHE A CB   5  
ATOM 6570  C CG   . PHE A 1 56  ? -7.784  5.507   0.225   1.00 0.00 ? 56  PHE A CG   5  
ATOM 6571  C CD1  . PHE A 1 56  ? -8.693  6.464   0.645   1.00 0.00 ? 56  PHE A CD1  5  
ATOM 6572  C CD2  . PHE A 1 56  ? -8.257  4.374   -0.417  1.00 0.00 ? 56  PHE A CD2  5  
ATOM 6573  C CE1  . PHE A 1 56  ? -10.048 6.294   0.430   1.00 0.00 ? 56  PHE A CE1  5  
ATOM 6574  C CE2  . PHE A 1 56  ? -9.611  4.199   -0.635  1.00 0.00 ? 56  PHE A CE2  5  
ATOM 6575  C CZ   . PHE A 1 56  ? -10.507 5.161   -0.212  1.00 0.00 ? 56  PHE A CZ   5  
ATOM 6576  H H    . PHE A 1 56  ? -6.736  8.146   -1.488  1.00 0.00 ? 56  PHE A H    5  
ATOM 6577  H HA   . PHE A 1 56  ? -4.608  6.746   -0.294  1.00 0.00 ? 56  PHE A HA   5  
ATOM 6578  H HB2  . PHE A 1 56  ? -5.849  4.718   0.452   1.00 0.00 ? 56  PHE A HB2  5  
ATOM 6579  H HB3  . PHE A 1 56  ? -6.185  6.139   1.436   1.00 0.00 ? 56  PHE A HB3  5  
ATOM 6580  H HD1  . PHE A 1 56  ? -8.336  7.351   1.147   1.00 0.00 ? 56  PHE A HD1  5  
ATOM 6581  H HD2  . PHE A 1 56  ? -7.557  3.621   -0.749  1.00 0.00 ? 56  PHE A HD2  5  
ATOM 6582  H HE1  . PHE A 1 56  ? -10.746 7.047   0.762   1.00 0.00 ? 56  PHE A HE1  5  
ATOM 6583  H HE2  . PHE A 1 56  ? -9.967  3.311   -1.138  1.00 0.00 ? 56  PHE A HE2  5  
ATOM 6584  H HZ   . PHE A 1 56  ? -11.565 5.025   -0.381  1.00 0.00 ? 56  PHE A HZ   5  
ATOM 6585  N N    . GLY A 1 57  ? -4.737  4.941   -2.134  1.00 0.00 ? 57  GLY A N    5  
ATOM 6586  C CA   . GLY A 1 57  ? -4.665  4.219   -3.390  1.00 0.00 ? 57  GLY A CA   5  
ATOM 6587  C C    . GLY A 1 57  ? -3.942  2.893   -3.256  1.00 0.00 ? 57  GLY A C    5  
ATOM 6588  O O    . GLY A 1 57  ? -4.209  2.123   -2.333  1.00 0.00 ? 57  GLY A O    5  
ATOM 6589  H H    . GLY A 1 57  ? -4.105  4.733   -1.414  1.00 0.00 ? 57  GLY A H    5  
ATOM 6590  H HA2  . GLY A 1 57  ? -5.668  4.036   -3.746  1.00 0.00 ? 57  GLY A HA2  5  
ATOM 6591  H HA3  . GLY A 1 57  ? -4.143  4.828   -4.113  1.00 0.00 ? 57  GLY A HA3  5  
ATOM 6592  N N    . PHE A 1 58  ? -3.026  2.625   -4.180  1.00 0.00 ? 58  PHE A N    5  
ATOM 6593  C CA   . PHE A 1 58  ? -2.264  1.381   -4.163  1.00 0.00 ? 58  PHE A CA   5  
ATOM 6594  C C    . PHE A 1 58  ? -0.997  1.508   -5.003  1.00 0.00 ? 58  PHE A C    5  
ATOM 6595  O O    . PHE A 1 58  ? -0.995  2.155   -6.050  1.00 0.00 ? 58  PHE A O    5  
ATOM 6596  C CB   . PHE A 1 58  ? -3.121  0.226   -4.684  1.00 0.00 ? 58  PHE A CB   5  
ATOM 6597  C CG   . PHE A 1 58  ? -4.431  0.079   -3.963  1.00 0.00 ? 58  PHE A CG   5  
ATOM 6598  C CD1  . PHE A 1 58  ? -5.499  0.910   -4.263  1.00 0.00 ? 58  PHE A CD1  5  
ATOM 6599  C CD2  . PHE A 1 58  ? -4.595  -0.891  -2.987  1.00 0.00 ? 58  PHE A CD2  5  
ATOM 6600  C CE1  . PHE A 1 58  ? -6.704  0.777   -3.601  1.00 0.00 ? 58  PHE A CE1  5  
ATOM 6601  C CE2  . PHE A 1 58  ? -5.798  -1.028  -2.322  1.00 0.00 ? 58  PHE A CE2  5  
ATOM 6602  C CZ   . PHE A 1 58  ? -6.855  -0.194  -2.630  1.00 0.00 ? 58  PHE A CZ   5  
ATOM 6603  H H    . PHE A 1 58  ? -2.858  3.278   -4.891  1.00 0.00 ? 58  PHE A H    5  
ATOM 6604  H HA   . PHE A 1 58  ? -1.985  1.179   -3.140  1.00 0.00 ? 58  PHE A HA   5  
ATOM 6605  H HB2  . PHE A 1 58  ? -3.335  0.389   -5.729  1.00 0.00 ? 58  PHE A HB2  5  
ATOM 6606  H HB3  . PHE A 1 58  ? -2.574  -0.698  -4.572  1.00 0.00 ? 58  PHE A HB3  5  
ATOM 6607  H HD1  . PHE A 1 58  ? -5.383  1.669   -5.022  1.00 0.00 ? 58  PHE A HD1  5  
ATOM 6608  H HD2  . PHE A 1 58  ? -3.768  -1.544  -2.745  1.00 0.00 ? 58  PHE A HD2  5  
ATOM 6609  H HE1  . PHE A 1 58  ? -7.529  1.430   -3.843  1.00 0.00 ? 58  PHE A HE1  5  
ATOM 6610  H HE2  . PHE A 1 58  ? -5.912  -1.789  -1.563  1.00 0.00 ? 58  PHE A HE2  5  
ATOM 6611  H HZ   . PHE A 1 58  ? -7.796  -0.300  -2.111  1.00 0.00 ? 58  PHE A HZ   5  
ATOM 6612  N N    . VAL A 1 59  ? 0.081   0.887   -4.535  1.00 0.00 ? 59  VAL A N    5  
ATOM 6613  C CA   . VAL A 1 59  ? 1.356   0.929   -5.242  1.00 0.00 ? 59  VAL A CA   5  
ATOM 6614  C C    . VAL A 1 59  ? 1.695   -0.430  -5.843  1.00 0.00 ? 59  VAL A C    5  
ATOM 6615  O O    . VAL A 1 59  ? 1.972   -1.389  -5.122  1.00 0.00 ? 59  VAL A O    5  
ATOM 6616  C CB   . VAL A 1 59  ? 2.501   1.366   -4.309  1.00 0.00 ? 59  VAL A CB   5  
ATOM 6617  C CG1  . VAL A 1 59  ? 3.822   1.394   -5.062  1.00 0.00 ? 59  VAL A CG1  5  
ATOM 6618  C CG2  . VAL A 1 59  ? 2.198   2.725   -3.695  1.00 0.00 ? 59  VAL A CG2  5  
ATOM 6619  H H    . VAL A 1 59  ? 0.017   0.387   -3.694  1.00 0.00 ? 59  VAL A H    5  
ATOM 6620  H HA   . VAL A 1 59  ? 1.272   1.654   -6.038  1.00 0.00 ? 59  VAL A HA   5  
ATOM 6621  H HB   . VAL A 1 59  ? 2.583   0.644   -3.510  1.00 0.00 ? 59  VAL A HB   5  
ATOM 6622  H HG11 . VAL A 1 59  ? 3.718   0.851   -5.990  1.00 0.00 ? 59  VAL A HG11 5  
ATOM 6623  H HG12 . VAL A 1 59  ? 4.096   2.418   -5.272  1.00 0.00 ? 59  VAL A HG12 5  
ATOM 6624  H HG13 . VAL A 1 59  ? 4.590   0.932   -4.459  1.00 0.00 ? 59  VAL A HG13 5  
ATOM 6625  H HG21 . VAL A 1 59  ? 3.024   3.395   -3.883  1.00 0.00 ? 59  VAL A HG21 5  
ATOM 6626  H HG22 . VAL A 1 59  ? 1.299   3.128   -4.138  1.00 0.00 ? 59  VAL A HG22 5  
ATOM 6627  H HG23 . VAL A 1 59  ? 2.057   2.616   -2.630  1.00 0.00 ? 59  VAL A HG23 5  
ATOM 6628  N N    . ASP A 1 60  ? 1.673   -0.506  -7.169  1.00 0.00 ? 60  ASP A N    5  
ATOM 6629  C CA   . ASP A 1 60  ? 1.981   -1.748  -7.870  1.00 0.00 ? 60  ASP A CA   5  
ATOM 6630  C C    . ASP A 1 60  ? 3.489   -1.943  -7.993  1.00 0.00 ? 60  ASP A C    5  
ATOM 6631  O O    . ASP A 1 60  ? 4.237   -0.982  -8.172  1.00 0.00 ? 60  ASP A O    5  
ATOM 6632  C CB   . ASP A 1 60  ? 1.339   -1.748  -9.258  1.00 0.00 ? 60  ASP A CB   5  
ATOM 6633  C CG   . ASP A 1 60  ? -0.044  -1.127  -9.256  1.00 0.00 ? 60  ASP A CG   5  
ATOM 6634  O OD1  . ASP A 1 60  ? -0.943  -1.680  -8.589  1.00 0.00 ? 60  ASP A OD1  5  
ATOM 6635  O OD2  . ASP A 1 60  ? -0.228  -0.086  -9.921  1.00 0.00 ? 60  ASP A OD2  5  
ATOM 6636  H H    . ASP A 1 60  ? 1.446   0.293   -7.690  1.00 0.00 ? 60  ASP A H    5  
ATOM 6637  H HA   . ASP A 1 60  ? 1.571   -2.563  -7.293  1.00 0.00 ? 60  ASP A HA   5  
ATOM 6638  H HB2  . ASP A 1 60  ? 1.964   -1.187  -9.937  1.00 0.00 ? 60  ASP A HB2  5  
ATOM 6639  H HB3  . ASP A 1 60  ? 1.256   -2.766  -9.609  1.00 0.00 ? 60  ASP A HB3  5  
ATOM 6640  N N    . PHE A 1 61  ? 3.928   -3.193  -7.896  1.00 0.00 ? 61  PHE A N    5  
ATOM 6641  C CA   . PHE A 1 61  ? 5.347   -3.514  -7.994  1.00 0.00 ? 61  PHE A CA   5  
ATOM 6642  C C    . PHE A 1 61  ? 5.577   -4.671  -8.962  1.00 0.00 ? 61  PHE A C    5  
ATOM 6643  O O    . PHE A 1 61  ? 4.629   -5.297  -9.434  1.00 0.00 ? 61  PHE A O    5  
ATOM 6644  C CB   . PHE A 1 61  ? 5.909   -3.869  -6.616  1.00 0.00 ? 61  PHE A CB   5  
ATOM 6645  C CG   . PHE A 1 61  ? 6.128   -2.674  -5.732  1.00 0.00 ? 61  PHE A CG   5  
ATOM 6646  C CD1  . PHE A 1 61  ? 7.274   -1.906  -5.856  1.00 0.00 ? 61  PHE A CD1  5  
ATOM 6647  C CD2  . PHE A 1 61  ? 5.188   -2.320  -4.778  1.00 0.00 ? 61  PHE A CD2  5  
ATOM 6648  C CE1  . PHE A 1 61  ? 7.478   -0.805  -5.045  1.00 0.00 ? 61  PHE A CE1  5  
ATOM 6649  C CE2  . PHE A 1 61  ? 5.386   -1.221  -3.964  1.00 0.00 ? 61  PHE A CE2  5  
ATOM 6650  C CZ   . PHE A 1 61  ? 6.533   -0.463  -4.097  1.00 0.00 ? 61  PHE A CZ   5  
ATOM 6651  H H    . PHE A 1 61  ? 3.283   -3.917  -7.753  1.00 0.00 ? 61  PHE A H    5  
ATOM 6652  H HA   . PHE A 1 61  ? 5.859   -2.641  -8.368  1.00 0.00 ? 61  PHE A HA   5  
ATOM 6653  H HB2  . PHE A 1 61  ? 5.219   -4.531  -6.113  1.00 0.00 ? 61  PHE A HB2  5  
ATOM 6654  H HB3  . PHE A 1 61  ? 6.857   -4.370  -6.740  1.00 0.00 ? 61  PHE A HB3  5  
ATOM 6655  H HD1  . PHE A 1 61  ? 8.014   -2.173  -6.597  1.00 0.00 ? 61  PHE A HD1  5  
ATOM 6656  H HD2  . PHE A 1 61  ? 4.290   -2.912  -4.672  1.00 0.00 ? 61  PHE A HD2  5  
ATOM 6657  H HE1  . PHE A 1 61  ? 8.376   -0.215  -5.151  1.00 0.00 ? 61  PHE A HE1  5  
ATOM 6658  H HE2  . PHE A 1 61  ? 4.646   -0.956  -3.224  1.00 0.00 ? 61  PHE A HE2  5  
ATOM 6659  H HZ   . PHE A 1 61  ? 6.691   0.396   -3.463  1.00 0.00 ? 61  PHE A HZ   5  
ATOM 6660  N N    . ASN A 1 62  ? 6.844   -4.948  -9.254  1.00 0.00 ? 62  ASN A N    5  
ATOM 6661  C CA   . ASN A 1 62  ? 7.199   -6.029  -10.167 1.00 0.00 ? 62  ASN A CA   5  
ATOM 6662  C C    . ASN A 1 62  ? 7.256   -7.365  -9.432  1.00 0.00 ? 62  ASN A C    5  
ATOM 6663  O O    . ASN A 1 62  ? 7.107   -8.426  -10.039 1.00 0.00 ? 62  ASN A O    5  
ATOM 6664  C CB   . ASN A 1 62  ? 8.547   -5.742  -10.830 1.00 0.00 ? 62  ASN A CB   5  
ATOM 6665  C CG   . ASN A 1 62  ? 9.594   -5.277  -9.836  1.00 0.00 ? 62  ASN A CG   5  
ATOM 6666  O OD1  . ASN A 1 62  ? 10.407  -6.069  -9.358  1.00 0.00 ? 62  ASN A OD1  5  
ATOM 6667  N ND2  . ASN A 1 62  ? 9.578   -3.988  -9.518  1.00 0.00 ? 62  ASN A ND2  5  
ATOM 6668  H H    . ASN A 1 62  ? 7.556   -4.414  -8.847  1.00 0.00 ? 62  ASN A H    5  
ATOM 6669  H HA   . ASN A 1 62  ? 6.437   -6.083  -10.930 1.00 0.00 ? 62  ASN A HA   5  
ATOM 6670  H HB2  . ASN A 1 62  ? 8.906   -6.642  -11.307 1.00 0.00 ? 62  ASN A HB2  5  
ATOM 6671  H HB3  . ASN A 1 62  ? 8.419   -4.971  -11.576 1.00 0.00 ? 62  ASN A HB3  5  
ATOM 6672  H HD21 . ASN A 1 62  ? 8.901   -3.416  -9.938  1.00 0.00 ? 62  ASN A HD21 5  
ATOM 6673  H HD22 . ASN A 1 62  ? 10.243  -3.661  -8.878  1.00 0.00 ? 62  ASN A HD22 5  
ATOM 6674  N N    . SER A 1 63  ? 7.471   -7.305  -8.122  1.00 0.00 ? 63  SER A N    5  
ATOM 6675  C CA   . SER A 1 63  ? 7.550   -8.510  -7.305  1.00 0.00 ? 63  SER A CA   5  
ATOM 6676  C C    . SER A 1 63  ? 7.423   -8.170  -5.823  1.00 0.00 ? 63  SER A C    5  
ATOM 6677  O O    . SER A 1 63  ? 8.044   -7.225  -5.337  1.00 0.00 ? 63  SER A O    5  
ATOM 6678  C CB   . SER A 1 63  ? 8.870   -9.240  -7.561  1.00 0.00 ? 63  SER A CB   5  
ATOM 6679  O OG   . SER A 1 63  ? 8.917   -9.762  -8.877  1.00 0.00 ? 63  SER A OG   5  
ATOM 6680  H H    . SER A 1 63  ? 7.581   -6.429  -7.696  1.00 0.00 ? 63  SER A H    5  
ATOM 6681  H HA   . SER A 1 63  ? 6.732   -9.156  -7.585  1.00 0.00 ? 63  SER A HA   5  
ATOM 6682  H HB2  . SER A 1 63  ? 9.691   -8.550  -7.431  1.00 0.00 ? 63  SER A HB2  5  
ATOM 6683  H HB3  . SER A 1 63  ? 8.970   -10.055 -6.859  1.00 0.00 ? 63  SER A HB3  5  
ATOM 6684  H HG   . SER A 1 63  ? 9.675   -9.397  -9.340  1.00 0.00 ? 63  SER A HG   5  
ATOM 6685  N N    . GLU A 1 64  ? 6.614   -8.949  -5.111  1.00 0.00 ? 64  GLU A N    5  
ATOM 6686  C CA   . GLU A 1 64  ? 6.405   -8.730  -3.685  1.00 0.00 ? 64  GLU A CA   5  
ATOM 6687  C C    . GLU A 1 64  ? 7.700   -8.297  -3.004  1.00 0.00 ? 64  GLU A C    5  
ATOM 6688  O O    . GLU A 1 64  ? 7.702   -7.391  -2.171  1.00 0.00 ? 64  GLU A O    5  
ATOM 6689  C CB   . GLU A 1 64  ? 5.870   -10.002 -3.024  1.00 0.00 ? 64  GLU A CB   5  
ATOM 6690  C CG   . GLU A 1 64  ? 4.640   -10.573 -3.709  1.00 0.00 ? 64  GLU A CG   5  
ATOM 6691  C CD   . GLU A 1 64  ? 4.989   -11.570 -4.798  1.00 0.00 ? 64  GLU A CD   5  
ATOM 6692  O OE1  . GLU A 1 64  ? 6.169   -11.615 -5.204  1.00 0.00 ? 64  GLU A OE1  5  
ATOM 6693  O OE2  . GLU A 1 64  ? 4.082   -12.305 -5.243  1.00 0.00 ? 64  GLU A OE2  5  
ATOM 6694  H H    . GLU A 1 64  ? 6.147   -9.687  -5.555  1.00 0.00 ? 64  GLU A H    5  
ATOM 6695  H HA   . GLU A 1 64  ? 5.673   -7.944  -3.573  1.00 0.00 ? 64  GLU A HA   5  
ATOM 6696  H HB2  . GLU A 1 64  ? 6.646   -10.754 -3.037  1.00 0.00 ? 64  GLU A HB2  5  
ATOM 6697  H HB3  . GLU A 1 64  ? 5.614   -9.780  -1.998  1.00 0.00 ? 64  GLU A HB3  5  
ATOM 6698  H HG2  . GLU A 1 64  ? 4.029   -11.070 -2.970  1.00 0.00 ? 64  GLU A HG2  5  
ATOM 6699  H HG3  . GLU A 1 64  ? 4.080   -9.762  -4.151  1.00 0.00 ? 64  GLU A HG3  5  
ATOM 6700  N N    . GLU A 1 65  ? 8.799   -8.951  -3.366  1.00 0.00 ? 65  GLU A N    5  
ATOM 6701  C CA   . GLU A 1 65  ? 10.101  -8.634  -2.790  1.00 0.00 ? 65  GLU A CA   5  
ATOM 6702  C C    . GLU A 1 65  ? 10.337  -7.127  -2.775  1.00 0.00 ? 65  GLU A C    5  
ATOM 6703  O O    . GLU A 1 65  ? 10.705  -6.555  -1.749  1.00 0.00 ? 65  GLU A O    5  
ATOM 6704  C CB   . GLU A 1 65  ? 11.214  -9.328  -3.577  1.00 0.00 ? 65  GLU A CB   5  
ATOM 6705  C CG   . GLU A 1 65  ? 11.651  -8.564  -4.816  1.00 0.00 ? 65  GLU A CG   5  
ATOM 6706  C CD   . GLU A 1 65  ? 12.749  -9.275  -5.583  1.00 0.00 ? 65  GLU A CD   5  
ATOM 6707  O OE1  . GLU A 1 65  ? 13.904  -9.269  -5.109  1.00 0.00 ? 65  GLU A OE1  5  
ATOM 6708  O OE2  . GLU A 1 65  ? 12.453  -9.838  -6.658  1.00 0.00 ? 65  GLU A OE2  5  
ATOM 6709  H H    . GLU A 1 65  ? 8.733   -9.663  -4.036  1.00 0.00 ? 65  GLU A H    5  
ATOM 6710  H HA   . GLU A 1 65  ? 10.111  -8.998  -1.774  1.00 0.00 ? 65  GLU A HA   5  
ATOM 6711  H HB2  . GLU A 1 65  ? 12.072  -9.450  -2.933  1.00 0.00 ? 65  GLU A HB2  5  
ATOM 6712  H HB3  . GLU A 1 65  ? 10.866  -10.303 -3.886  1.00 0.00 ? 65  GLU A HB3  5  
ATOM 6713  H HG2  . GLU A 1 65  ? 10.799  -8.442  -5.467  1.00 0.00 ? 65  GLU A HG2  5  
ATOM 6714  H HG3  . GLU A 1 65  ? 12.015  -7.592  -4.514  1.00 0.00 ? 65  GLU A HG3  5  
ATOM 6715  N N    . ASP A 1 66  ? 10.122  -6.489  -3.921  1.00 0.00 ? 66  ASP A N    5  
ATOM 6716  C CA   . ASP A 1 66  ? 10.311  -5.048  -4.041  1.00 0.00 ? 66  ASP A CA   5  
ATOM 6717  C C    . ASP A 1 66  ? 9.252   -4.293  -3.243  1.00 0.00 ? 66  ASP A C    5  
ATOM 6718  O O    . ASP A 1 66  ? 9.538   -3.266  -2.629  1.00 0.00 ? 66  ASP A O    5  
ATOM 6719  C CB   . ASP A 1 66  ? 10.257  -4.625  -5.510  1.00 0.00 ? 66  ASP A CB   5  
ATOM 6720  C CG   . ASP A 1 66  ? 11.605  -4.740  -6.194  1.00 0.00 ? 66  ASP A CG   5  
ATOM 6721  O OD1  . ASP A 1 66  ? 12.622  -4.380  -5.566  1.00 0.00 ? 66  ASP A OD1  5  
ATOM 6722  O OD2  . ASP A 1 66  ? 11.642  -5.192  -7.358  1.00 0.00 ? 66  ASP A OD2  5  
ATOM 6723  H H    . ASP A 1 66  ? 9.829   -7.000  -4.704  1.00 0.00 ? 66  ASP A H    5  
ATOM 6724  H HA   . ASP A 1 66  ? 11.284  -4.806  -3.642  1.00 0.00 ? 66  ASP A HA   5  
ATOM 6725  H HB2  . ASP A 1 66  ? 9.553   -5.256  -6.034  1.00 0.00 ? 66  ASP A HB2  5  
ATOM 6726  H HB3  . ASP A 1 66  ? 9.929   -3.598  -5.570  1.00 0.00 ? 66  ASP A HB3  5  
ATOM 6727  N N    . ALA A 1 67  ? 8.027   -4.810  -3.257  1.00 0.00 ? 67  ALA A N    5  
ATOM 6728  C CA   . ALA A 1 67  ? 6.926   -4.185  -2.534  1.00 0.00 ? 67  ALA A CA   5  
ATOM 6729  C C    . ALA A 1 67  ? 7.200   -4.159  -1.034  1.00 0.00 ? 67  ALA A C    5  
ATOM 6730  O O    . ALA A 1 67  ? 6.815   -3.218  -0.339  1.00 0.00 ? 67  ALA A O    5  
ATOM 6731  C CB   . ALA A 1 67  ? 5.624   -4.917  -2.822  1.00 0.00 ? 67  ALA A CB   5  
ATOM 6732  H H    . ALA A 1 67  ? 7.861   -5.631  -3.764  1.00 0.00 ? 67  ALA A H    5  
ATOM 6733  H HA   . ALA A 1 67  ? 6.827   -3.170  -2.890  1.00 0.00 ? 67  ALA A HA   5  
ATOM 6734  H HB1  . ALA A 1 67  ? 5.637   -5.286  -3.837  1.00 0.00 ? 67  ALA A HB1  5  
ATOM 6735  H HB2  . ALA A 1 67  ? 5.518   -5.745  -2.138  1.00 0.00 ? 67  ALA A HB2  5  
ATOM 6736  H HB3  . ALA A 1 67  ? 4.794   -4.237  -2.697  1.00 0.00 ? 67  ALA A HB3  5  
ATOM 6737  N N    . LYS A 1 68  ? 7.866   -5.196  -0.540  1.00 0.00 ? 68  LYS A N    5  
ATOM 6738  C CA   . LYS A 1 68  ? 8.192   -5.293  0.878   1.00 0.00 ? 68  LYS A CA   5  
ATOM 6739  C C    . LYS A 1 68  ? 9.347   -4.363  1.235   1.00 0.00 ? 68  LYS A C    5  
ATOM 6740  O O    . LYS A 1 68  ? 9.228   -3.525  2.128   1.00 0.00 ? 68  LYS A O    5  
ATOM 6741  C CB   . LYS A 1 68  ? 8.552   -6.734  1.243   1.00 0.00 ? 68  LYS A CB   5  
ATOM 6742  C CG   . LYS A 1 68  ? 8.655   -6.976  2.739   1.00 0.00 ? 68  LYS A CG   5  
ATOM 6743  C CD   . LYS A 1 68  ? 9.658   -8.072  3.059   1.00 0.00 ? 68  LYS A CD   5  
ATOM 6744  C CE   . LYS A 1 68  ? 11.056  -7.508  3.257   1.00 0.00 ? 68  LYS A CE   5  
ATOM 6745  N NZ   . LYS A 1 68  ? 12.060  -8.583  3.490   1.00 0.00 ? 68  LYS A NZ   5  
ATOM 6746  H H    . LYS A 1 68  ? 8.147   -5.916  -1.145  1.00 0.00 ? 68  LYS A H    5  
ATOM 6747  H HA   . LYS A 1 68  ? 7.320   -4.995  1.440   1.00 0.00 ? 68  LYS A HA   5  
ATOM 6748  H HB2  . LYS A 1 68  ? 7.795   -7.394  0.844   1.00 0.00 ? 68  LYS A HB2  5  
ATOM 6749  H HB3  . LYS A 1 68  ? 9.504   -6.980  0.793   1.00 0.00 ? 68  LYS A HB3  5  
ATOM 6750  H HG2  . LYS A 1 68  ? 8.971   -6.062  3.221   1.00 0.00 ? 68  LYS A HG2  5  
ATOM 6751  H HG3  . LYS A 1 68  ? 7.685   -7.266  3.115   1.00 0.00 ? 68  LYS A HG3  5  
ATOM 6752  H HD2  . LYS A 1 68  ? 9.353   -8.573  3.965   1.00 0.00 ? 68  LYS A HD2  5  
ATOM 6753  H HD3  . LYS A 1 68  ? 9.677   -8.780  2.243   1.00 0.00 ? 68  LYS A HD3  5  
ATOM 6754  H HE2  . LYS A 1 68  ? 11.335  -6.952  2.375   1.00 0.00 ? 68  LYS A HE2  5  
ATOM 6755  H HE3  . LYS A 1 68  ? 11.046  -6.846  4.111   1.00 0.00 ? 68  LYS A HE3  5  
ATOM 6756  H HZ1  . LYS A 1 68  ? 12.141  -8.782  4.508   1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 6757  H HZ2  . LYS A 1 68  ? 12.990  -8.287  3.131   1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 6758  H HZ3  . LYS A 1 68  ? 11.772  -9.453  2.999   1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 6759  N N    . ALA A 1 69  ? 10.464  -4.516  0.530   1.00 0.00 ? 69  ALA A N    5  
ATOM 6760  C CA   . ALA A 1 69  ? 11.639  -3.688  0.771   1.00 0.00 ? 69  ALA A CA   5  
ATOM 6761  C C    . ALA A 1 69  ? 11.283  -2.205  0.729   1.00 0.00 ? 69  ALA A C    5  
ATOM 6762  O O    . ALA A 1 69  ? 11.843  -1.402  1.474   1.00 0.00 ? 69  ALA A O    5  
ATOM 6763  C CB   . ALA A 1 69  ? 12.723  -4.001  -0.249  1.00 0.00 ? 69  ALA A CB   5  
ATOM 6764  H H    . ALA A 1 69  ? 10.497  -5.201  -0.169  1.00 0.00 ? 69  ALA A H    5  
ATOM 6765  H HA   . ALA A 1 69  ? 12.021  -3.928  1.753   1.00 0.00 ? 69  ALA A HA   5  
ATOM 6766  H HB1  . ALA A 1 69  ? 12.877  -3.142  -0.885  1.00 0.00 ? 69  ALA A HB1  5  
ATOM 6767  H HB2  . ALA A 1 69  ? 13.643  -4.238  0.266   1.00 0.00 ? 69  ALA A HB2  5  
ATOM 6768  H HB3  . ALA A 1 69  ? 12.419  -4.845  -0.850  1.00 0.00 ? 69  ALA A HB3  5  
ATOM 6769  N N    . ALA A 1 70  ? 10.350  -1.850  -0.148  1.00 0.00 ? 70  ALA A N    5  
ATOM 6770  C CA   . ALA A 1 70  ? 9.919   -0.464  -0.286  1.00 0.00 ? 70  ALA A CA   5  
ATOM 6771  C C    . ALA A 1 70  ? 8.976   -0.067  0.844   1.00 0.00 ? 70  ALA A C    5  
ATOM 6772  O O    . ALA A 1 70  ? 8.825   1.115   1.155   1.00 0.00 ? 70  ALA A O    5  
ATOM 6773  C CB   . ALA A 1 70  ? 9.248   -0.252  -1.635  1.00 0.00 ? 70  ALA A CB   5  
ATOM 6774  H H    . ALA A 1 70  ? 9.940   -2.537  -0.715  1.00 0.00 ? 70  ALA A H    5  
ATOM 6775  H HA   . ALA A 1 70  ? 10.798  0.164   -0.246  1.00 0.00 ? 70  ALA A HA   5  
ATOM 6776  H HB1  . ALA A 1 70  ? 8.181   -0.156  -1.494  1.00 0.00 ? 70  ALA A HB1  5  
ATOM 6777  H HB2  . ALA A 1 70  ? 9.633   0.647   -2.091  1.00 0.00 ? 70  ALA A HB2  5  
ATOM 6778  H HB3  . ALA A 1 70  ? 9.452   -1.098  -2.275  1.00 0.00 ? 70  ALA A HB3  5  
ATOM 6779  N N    . LYS A 1 71  ? 8.343   -1.062  1.457   1.00 0.00 ? 71  LYS A N    5  
ATOM 6780  C CA   . LYS A 1 71  ? 7.414   -0.817  2.554   1.00 0.00 ? 71  LYS A CA   5  
ATOM 6781  C C    . LYS A 1 71  ? 8.163   -0.426  3.824   1.00 0.00 ? 71  LYS A C    5  
ATOM 6782  O O    . LYS A 1 71  ? 7.842   0.578   4.460   1.00 0.00 ? 71  LYS A O    5  
ATOM 6783  C CB   . LYS A 1 71  ? 6.562   -2.061  2.815   1.00 0.00 ? 71  LYS A CB   5  
ATOM 6784  C CG   . LYS A 1 71  ? 5.645   -1.929  4.019   1.00 0.00 ? 71  LYS A CG   5  
ATOM 6785  C CD   . LYS A 1 71  ? 4.415   -2.810  3.883   1.00 0.00 ? 71  LYS A CD   5  
ATOM 6786  C CE   . LYS A 1 71  ? 4.749   -4.274  4.119   1.00 0.00 ? 71  LYS A CE   5  
ATOM 6787  N NZ   . LYS A 1 71  ? 5.146   -4.532  5.530   1.00 0.00 ? 71  LYS A NZ   5  
ATOM 6788  H H    . LYS A 1 71  ? 8.504   -1.983  1.164   1.00 0.00 ? 71  LYS A H    5  
ATOM 6789  H HA   . LYS A 1 71  ? 6.768   -0.002  2.266   1.00 0.00 ? 71  LYS A HA   5  
ATOM 6790  H HB2  . LYS A 1 71  ? 5.952   -2.254  1.944   1.00 0.00 ? 71  LYS A HB2  5  
ATOM 6791  H HB3  . LYS A 1 71  ? 7.217   -2.904  2.979   1.00 0.00 ? 71  LYS A HB3  5  
ATOM 6792  H HG2  . LYS A 1 71  ? 6.187   -2.221  4.906   1.00 0.00 ? 71  LYS A HG2  5  
ATOM 6793  H HG3  . LYS A 1 71  ? 5.331   -0.898  4.110   1.00 0.00 ? 71  LYS A HG3  5  
ATOM 6794  H HD2  . LYS A 1 71  ? 3.678   -2.499  4.608   1.00 0.00 ? 71  LYS A HD2  5  
ATOM 6795  H HD3  . LYS A 1 71  ? 4.011   -2.697  2.886   1.00 0.00 ? 71  LYS A HD3  5  
ATOM 6796  H HE2  . LYS A 1 71  ? 3.880   -4.871  3.883   1.00 0.00 ? 71  LYS A HE2  5  
ATOM 6797  H HE3  . LYS A 1 71  ? 5.564   -4.553  3.467   1.00 0.00 ? 71  LYS A HE3  5  
ATOM 6798  H HZ1  . LYS A 1 71  ? 5.861   -5.287  5.568   1.00 0.00 ? 71  LYS A HZ1  5  
ATOM 6799  H HZ2  . LYS A 1 71  ? 4.318   -4.827  6.086   1.00 0.00 ? 71  LYS A HZ2  5  
ATOM 6800  H HZ3  . LYS A 1 71  ? 5.544   -3.670  5.953   1.00 0.00 ? 71  LYS A HZ3  5  
ATOM 6801  N N    . GLU A 1 72  ? 9.163   -1.224  4.186   1.00 0.00 ? 72  GLU A N    5  
ATOM 6802  C CA   . GLU A 1 72  ? 9.957   -0.959  5.379   1.00 0.00 ? 72  GLU A CA   5  
ATOM 6803  C C    . GLU A 1 72  ? 10.545  0.448   5.340   1.00 0.00 ? 72  GLU A C    5  
ATOM 6804  O O    . GLU A 1 72  ? 10.790  1.059   6.380   1.00 0.00 ? 72  GLU A O    5  
ATOM 6805  C CB   . GLU A 1 72  ? 11.081  -1.990  5.510   1.00 0.00 ? 72  GLU A CB   5  
ATOM 6806  C CG   . GLU A 1 72  ? 10.591  -3.429  5.503   1.00 0.00 ? 72  GLU A CG   5  
ATOM 6807  C CD   . GLU A 1 72  ? 11.565  -4.380  6.170   1.00 0.00 ? 72  GLU A CD   5  
ATOM 6808  O OE1  . GLU A 1 72  ? 11.490  -4.535  7.407   1.00 0.00 ? 72  GLU A OE1  5  
ATOM 6809  O OE2  . GLU A 1 72  ? 12.401  -4.970  5.455   1.00 0.00 ? 72  GLU A OE2  5  
ATOM 6810  H H    . GLU A 1 72  ? 9.370   -2.009  3.637   1.00 0.00 ? 72  GLU A H    5  
ATOM 6811  H HA   . GLU A 1 72  ? 9.305   -1.041  6.236   1.00 0.00 ? 72  GLU A HA   5  
ATOM 6812  H HB2  . GLU A 1 72  ? 11.769  -1.861  4.688   1.00 0.00 ? 72  GLU A HB2  5  
ATOM 6813  H HB3  . GLU A 1 72  ? 11.606  -1.816  6.438   1.00 0.00 ? 72  GLU A HB3  5  
ATOM 6814  H HG2  . GLU A 1 72  ? 9.648   -3.477  6.026   1.00 0.00 ? 72  GLU A HG2  5  
ATOM 6815  H HG3  . GLU A 1 72  ? 10.449  -3.742  4.479   1.00 0.00 ? 72  GLU A HG3  5  
ATOM 6816  N N    . ALA A 1 73  ? 10.771  0.956   4.133   1.00 0.00 ? 73  ALA A N    5  
ATOM 6817  C CA   . ALA A 1 73  ? 11.329  2.291   3.958   1.00 0.00 ? 73  ALA A CA   5  
ATOM 6818  C C    . ALA A 1 73  ? 10.268  3.363   4.181   1.00 0.00 ? 73  ALA A C    5  
ATOM 6819  O O    . ALA A 1 73  ? 10.510  4.355   4.867   1.00 0.00 ? 73  ALA A O    5  
ATOM 6820  C CB   . ALA A 1 73  ? 11.939  2.430   2.571   1.00 0.00 ? 73  ALA A CB   5  
ATOM 6821  H H    . ALA A 1 73  ? 10.555  0.420   3.342   1.00 0.00 ? 73  ALA A H    5  
ATOM 6822  H HA   . ALA A 1 73  ? 12.117  2.421   4.685   1.00 0.00 ? 73  ALA A HA   5  
ATOM 6823  H HB1  . ALA A 1 73  ? 12.061  1.450   2.133   1.00 0.00 ? 73  ALA A HB1  5  
ATOM 6824  H HB2  . ALA A 1 73  ? 11.286  3.023   1.949   1.00 0.00 ? 73  ALA A HB2  5  
ATOM 6825  H HB3  . ALA A 1 73  ? 12.901  2.913   2.648   1.00 0.00 ? 73  ALA A HB3  5  
ATOM 6826  N N    . MET A 1 74  ? 9.092   3.156   3.596   1.00 0.00 ? 74  MET A N    5  
ATOM 6827  C CA   . MET A 1 74  ? 7.994   4.106   3.733   1.00 0.00 ? 74  MET A CA   5  
ATOM 6828  C C    . MET A 1 74  ? 7.083   3.721   4.894   1.00 0.00 ? 74  MET A C    5  
ATOM 6829  O O    . MET A 1 74  ? 5.984   4.255   5.035   1.00 0.00 ? 74  MET A O    5  
ATOM 6830  C CB   . MET A 1 74  ? 7.185   4.173   2.435   1.00 0.00 ? 74  MET A CB   5  
ATOM 6831  C CG   . MET A 1 74  ? 7.711   5.198   1.444   1.00 0.00 ? 74  MET A CG   5  
ATOM 6832  S SD   . MET A 1 74  ? 7.525   6.892   2.032   1.00 0.00 ? 74  MET A SD   5  
ATOM 6833  C CE   . MET A 1 74  ? 5.741   7.056   2.032   1.00 0.00 ? 74  MET A CE   5  
ATOM 6834  H H    . MET A 1 74  ? 8.959   2.346   3.061   1.00 0.00 ? 74  MET A H    5  
ATOM 6835  H HA   . MET A 1 74  ? 8.420   5.078   3.931   1.00 0.00 ? 74  MET A HA   5  
ATOM 6836  H HB2  . MET A 1 74  ? 7.206   3.202   1.962   1.00 0.00 ? 74  MET A HB2  5  
ATOM 6837  H HB3  . MET A 1 74  ? 6.163   4.427   2.674   1.00 0.00 ? 74  MET A HB3  5  
ATOM 6838  H HG2  . MET A 1 74  ? 8.759   5.006   1.269   1.00 0.00 ? 74  MET A HG2  5  
ATOM 6839  H HG3  . MET A 1 74  ? 7.169   5.091   0.516   1.00 0.00 ? 74  MET A HG3  5  
ATOM 6840  H HE1  . MET A 1 74  ? 5.379   7.046   1.015   1.00 0.00 ? 74  MET A HE1  5  
ATOM 6841  H HE2  . MET A 1 74  ? 5.304   6.234   2.579   1.00 0.00 ? 74  MET A HE2  5  
ATOM 6842  H HE3  . MET A 1 74  ? 5.466   7.989   2.503   1.00 0.00 ? 74  MET A HE3  5  
ATOM 6843  N N    . GLU A 1 75  ? 7.548   2.790   5.722   1.00 0.00 ? 75  GLU A N    5  
ATOM 6844  C CA   . GLU A 1 75  ? 6.773   2.334   6.870   1.00 0.00 ? 75  GLU A CA   5  
ATOM 6845  C C    . GLU A 1 75  ? 6.287   3.516   7.703   1.00 0.00 ? 75  GLU A C    5  
ATOM 6846  O O    . GLU A 1 75  ? 5.135   3.553   8.134   1.00 0.00 ? 75  GLU A O    5  
ATOM 6847  C CB   . GLU A 1 75  ? 7.612   1.394   7.738   1.00 0.00 ? 75  GLU A CB   5  
ATOM 6848  C CG   . GLU A 1 75  ? 8.712   2.101   8.512   1.00 0.00 ? 75  GLU A CG   5  
ATOM 6849  C CD   . GLU A 1 75  ? 9.618   1.135   9.252   1.00 0.00 ? 75  GLU A CD   5  
ATOM 6850  O OE1  . GLU A 1 75  ? 9.201   0.622   10.310  1.00 0.00 ? 75  GLU A OE1  5  
ATOM 6851  O OE2  . GLU A 1 75  ? 10.745  0.893   8.770   1.00 0.00 ? 75  GLU A OE2  5  
ATOM 6852  H H    . GLU A 1 75  ? 8.432   2.401   5.556   1.00 0.00 ? 75  GLU A H    5  
ATOM 6853  H HA   . GLU A 1 75  ? 5.915   1.795   6.497   1.00 0.00 ? 75  GLU A HA   5  
ATOM 6854  H HB2  . GLU A 1 75  ? 6.962   0.900   8.445   1.00 0.00 ? 75  GLU A HB2  5  
ATOM 6855  H HB3  . GLU A 1 75  ? 8.069   0.649   7.103   1.00 0.00 ? 75  GLU A HB3  5  
ATOM 6856  H HG2  . GLU A 1 75  ? 9.311   2.674   7.821   1.00 0.00 ? 75  GLU A HG2  5  
ATOM 6857  H HG3  . GLU A 1 75  ? 8.258   2.767   9.231   1.00 0.00 ? 75  GLU A HG3  5  
ATOM 6858  N N    . ASP A 1 76  ? 7.174   4.480   7.925   1.00 0.00 ? 76  ASP A N    5  
ATOM 6859  C CA   . ASP A 1 76  ? 6.837   5.664   8.706   1.00 0.00 ? 76  ASP A CA   5  
ATOM 6860  C C    . ASP A 1 76  ? 6.959   6.927   7.858   1.00 0.00 ? 76  ASP A C    5  
ATOM 6861  O O    . ASP A 1 76  ? 7.132   8.025   8.384   1.00 0.00 ? 76  ASP A O    5  
ATOM 6862  C CB   . ASP A 1 76  ? 7.746   5.769   9.932   1.00 0.00 ? 76  ASP A CB   5  
ATOM 6863  C CG   . ASP A 1 76  ? 7.745   4.500   10.763  1.00 0.00 ? 76  ASP A CG   5  
ATOM 6864  O OD1  . ASP A 1 76  ? 6.695   3.826   10.816  1.00 0.00 ? 76  ASP A OD1  5  
ATOM 6865  O OD2  . ASP A 1 76  ? 8.795   4.182   11.359  1.00 0.00 ? 76  ASP A OD2  5  
ATOM 6866  H H    . ASP A 1 76  ? 8.078   4.393   7.555   1.00 0.00 ? 76  ASP A H    5  
ATOM 6867  H HA   . ASP A 1 76  ? 5.814   5.564   9.035   1.00 0.00 ? 76  ASP A HA   5  
ATOM 6868  H HB2  . ASP A 1 76  ? 8.757   5.963   9.607   1.00 0.00 ? 76  ASP A HB2  5  
ATOM 6869  H HB3  . ASP A 1 76  ? 7.408   6.585   10.553  1.00 0.00 ? 76  ASP A HB3  5  
ATOM 6870  N N    . GLY A 1 77  ? 6.868   6.761   6.542   1.00 0.00 ? 77  GLY A N    5  
ATOM 6871  C CA   . GLY A 1 77  ? 6.971   7.895   5.643   1.00 0.00 ? 77  GLY A CA   5  
ATOM 6872  C C    . GLY A 1 77  ? 5.666   8.657   5.518   1.00 0.00 ? 77  GLY A C    5  
ATOM 6873  O O    . GLY A 1 77  ? 4.598   8.122   5.815   1.00 0.00 ? 77  GLY A O    5  
ATOM 6874  H H    . GLY A 1 77  ? 6.730   5.861   6.179   1.00 0.00 ? 77  GLY A H    5  
ATOM 6875  H HA2  . GLY A 1 77  ? 7.733   8.565   6.012   1.00 0.00 ? 77  GLY A HA2  5  
ATOM 6876  H HA3  . GLY A 1 77  ? 7.262   7.539   4.665   1.00 0.00 ? 77  GLY A HA3  5  
ATOM 6877  N N    . GLU A 1 78  ? 5.753   9.908   5.079   1.00 0.00 ? 78  GLU A N    5  
ATOM 6878  C CA   . GLU A 1 78  ? 4.570   10.745  4.919   1.00 0.00 ? 78  GLU A CA   5  
ATOM 6879  C C    . GLU A 1 78  ? 4.564   11.424  3.552   1.00 0.00 ? 78  GLU A C    5  
ATOM 6880  O O    . GLU A 1 78  ? 5.470   12.192  3.226   1.00 0.00 ? 78  GLU A O    5  
ATOM 6881  C CB   . GLU A 1 78  ? 4.510   11.800  6.025   1.00 0.00 ? 78  GLU A CB   5  
ATOM 6882  C CG   . GLU A 1 78  ? 5.771   12.640  6.134   1.00 0.00 ? 78  GLU A CG   5  
ATOM 6883  C CD   . GLU A 1 78  ? 5.869   13.377  7.456   1.00 0.00 ? 78  GLU A CD   5  
ATOM 6884  O OE1  . GLU A 1 78  ? 5.737   12.723  8.511   1.00 0.00 ? 78  GLU A OE1  5  
ATOM 6885  O OE2  . GLU A 1 78  ? 6.078   14.608  7.434   1.00 0.00 ? 78  GLU A OE2  5  
ATOM 6886  H H    . GLU A 1 78  ? 6.634   10.278  4.859   1.00 0.00 ? 78  GLU A H    5  
ATOM 6887  H HA   . GLU A 1 78  ? 3.701   10.108  4.994   1.00 0.00 ? 78  GLU A HA   5  
ATOM 6888  H HB2  . GLU A 1 78  ? 3.677   12.460  5.832   1.00 0.00 ? 78  GLU A HB2  5  
ATOM 6889  H HB3  . GLU A 1 78  ? 4.350   11.303  6.971   1.00 0.00 ? 78  GLU A HB3  5  
ATOM 6890  H HG2  . GLU A 1 78  ? 6.629   11.992  6.037   1.00 0.00 ? 78  GLU A HG2  5  
ATOM 6891  H HG3  . GLU A 1 78  ? 5.776   13.365  5.333   1.00 0.00 ? 78  GLU A HG3  5  
ATOM 6892  N N    . ILE A 1 79  ? 3.539   11.135  2.758   1.00 0.00 ? 79  ILE A N    5  
ATOM 6893  C CA   . ILE A 1 79  ? 3.416   11.717  1.428   1.00 0.00 ? 79  ILE A CA   5  
ATOM 6894  C C    . ILE A 1 79  ? 2.690   13.058  1.480   1.00 0.00 ? 79  ILE A C    5  
ATOM 6895  O O    . ILE A 1 79  ? 1.654   13.189  2.132   1.00 0.00 ? 79  ILE A O    5  
ATOM 6896  C CB   . ILE A 1 79  ? 2.664   10.776  0.468   1.00 0.00 ? 79  ILE A CB   5  
ATOM 6897  C CG1  . ILE A 1 79  ? 3.231   9.358   0.561   1.00 0.00 ? 79  ILE A CG1  5  
ATOM 6898  C CG2  . ILE A 1 79  ? 2.751   11.295  -0.959  1.00 0.00 ? 79  ILE A CG2  5  
ATOM 6899  C CD1  . ILE A 1 79  ? 2.684   8.418   -0.490  1.00 0.00 ? 79  ILE A CD1  5  
ATOM 6900  H H    . ILE A 1 79  ? 2.849   10.516  3.075   1.00 0.00 ? 79  ILE A H    5  
ATOM 6901  H HA   . ILE A 1 79  ? 4.412   11.874  1.039   1.00 0.00 ? 79  ILE A HA   5  
ATOM 6902  H HB   . ILE A 1 79  ? 1.624   10.760  0.757   1.00 0.00 ? 79  ILE A HB   5  
ATOM 6903  H HG12 . ILE A 1 79  ? 4.303   9.398   0.444   1.00 0.00 ? 79  ILE A HG12 5  
ATOM 6904  H HG13 . ILE A 1 79  ? 2.994   8.947   1.532   1.00 0.00 ? 79  ILE A HG13 5  
ATOM 6905  H HG21 . ILE A 1 79  ? 1.825   11.086  -1.475  1.00 0.00 ? 79  ILE A HG21 5  
ATOM 6906  H HG22 . ILE A 1 79  ? 2.921   12.361  -0.944  1.00 0.00 ? 79  ILE A HG22 5  
ATOM 6907  H HG23 . ILE A 1 79  ? 3.566   10.807  -1.471  1.00 0.00 ? 79  ILE A HG23 5  
ATOM 6908  H HD11 . ILE A 1 79  ? 3.501   7.990   -1.051  1.00 0.00 ? 79  ILE A HD11 5  
ATOM 6909  H HD12 . ILE A 1 79  ? 2.122   7.630   -0.012  1.00 0.00 ? 79  ILE A HD12 5  
ATOM 6910  H HD13 . ILE A 1 79  ? 2.036   8.966   -1.160  1.00 0.00 ? 79  ILE A HD13 5  
ATOM 6911  N N    . ASP A 1 80  ? 3.240   14.049  0.787   1.00 0.00 ? 80  ASP A N    5  
ATOM 6912  C CA   . ASP A 1 80  ? 2.644   15.379  0.751   1.00 0.00 ? 80  ASP A CA   5  
ATOM 6913  C C    . ASP A 1 80  ? 2.459   15.930  2.162   1.00 0.00 ? 80  ASP A C    5  
ATOM 6914  O O    . ASP A 1 80  ? 1.432   16.531  2.475   1.00 0.00 ? 80  ASP A O    5  
ATOM 6915  C CB   . ASP A 1 80  ? 1.298   15.339  0.026   1.00 0.00 ? 80  ASP A CB   5  
ATOM 6916  C CG   . ASP A 1 80  ? 1.454   15.175  -1.473  1.00 0.00 ? 80  ASP A CG   5  
ATOM 6917  O OD1  . ASP A 1 80  ? 1.770   16.176  -2.150  1.00 0.00 ? 80  ASP A OD1  5  
ATOM 6918  O OD2  . ASP A 1 80  ? 1.257   14.046  -1.971  1.00 0.00 ? 80  ASP A OD2  5  
ATOM 6919  H H    . ASP A 1 80  ? 4.066   13.882  0.287   1.00 0.00 ? 80  ASP A H    5  
ATOM 6920  H HA   . ASP A 1 80  ? 3.315   16.029  0.210   1.00 0.00 ? 80  ASP A HA   5  
ATOM 6921  H HB2  . ASP A 1 80  ? 0.718   14.509  0.401   1.00 0.00 ? 80  ASP A HB2  5  
ATOM 6922  H HB3  . ASP A 1 80  ? 0.766   16.260  0.216   1.00 0.00 ? 80  ASP A HB3  5  
ATOM 6923  N N    . GLY A 1 81  ? 3.460   15.719  3.011   1.00 0.00 ? 81  GLY A N    5  
ATOM 6924  C CA   . GLY A 1 81  ? 3.388   16.199  4.378   1.00 0.00 ? 81  GLY A CA   5  
ATOM 6925  C C    . GLY A 1 81  ? 2.306   15.503  5.180   1.00 0.00 ? 81  GLY A C    5  
ATOM 6926  O O    . GLY A 1 81  ? 1.877   16.002  6.220   1.00 0.00 ? 81  GLY A O    5  
ATOM 6927  H H    . GLY A 1 81  ? 4.255   15.233  2.706   1.00 0.00 ? 81  GLY A H    5  
ATOM 6928  H HA2  . GLY A 1 81  ? 4.341   16.032  4.858   1.00 0.00 ? 81  GLY A HA2  5  
ATOM 6929  H HA3  . GLY A 1 81  ? 3.184   17.259  4.365   1.00 0.00 ? 81  GLY A HA3  5  
ATOM 6930  N N    . ASN A 1 82  ? 1.862   14.348  4.695   1.00 0.00 ? 82  ASN A N    5  
ATOM 6931  C CA   . ASN A 1 82  ? 0.821   13.584  5.373   1.00 0.00 ? 82  ASN A CA   5  
ATOM 6932  C C    . ASN A 1 82  ? 1.279   12.153  5.634   1.00 0.00 ? 82  ASN A C    5  
ATOM 6933  O O    . ASN A 1 82  ? 1.786   11.478  4.737   1.00 0.00 ? 82  ASN A O    5  
ATOM 6934  C CB   . ASN A 1 82  ? -0.461  13.577  4.538   1.00 0.00 ? 82  ASN A CB   5  
ATOM 6935  C CG   . ASN A 1 82  ? -1.288  14.833  4.738   1.00 0.00 ? 82  ASN A CG   5  
ATOM 6936  O OD1  . ASN A 1 82  ? -1.041  15.612  5.658   1.00 0.00 ? 82  ASN A OD1  5  
ATOM 6937  N ND2  . ASN A 1 82  ? -2.277  15.033  3.874   1.00 0.00 ? 82  ASN A ND2  5  
ATOM 6938  H H    . ASN A 1 82  ? 2.243   14.002  3.861   1.00 0.00 ? 82  ASN A H    5  
ATOM 6939  H HA   . ASN A 1 82  ? 0.621   14.064  6.319   1.00 0.00 ? 82  ASN A HA   5  
ATOM 6940  H HB2  . ASN A 1 82  ? -0.202  13.503  3.492   1.00 0.00 ? 82  ASN A HB2  5  
ATOM 6941  H HB3  . ASN A 1 82  ? -1.062  12.724  4.817   1.00 0.00 ? 82  ASN A HB3  5  
ATOM 6942  H HD21 . ASN A 1 82  ? -2.416  14.369  3.166   1.00 0.00 ? 82  ASN A HD21 5  
ATOM 6943  H HD22 . ASN A 1 82  ? -2.827  15.837  3.979   1.00 0.00 ? 82  ASN A HD22 5  
ATOM 6944  N N    . LYS A 1 83  ? 1.096   11.694  6.867   1.00 0.00 ? 83  LYS A N    5  
ATOM 6945  C CA   . LYS A 1 83  ? 1.489   10.342  7.247   1.00 0.00 ? 83  LYS A CA   5  
ATOM 6946  C C    . LYS A 1 83  ? 0.655   9.304   6.503   1.00 0.00 ? 83  LYS A C    5  
ATOM 6947  O O    . LYS A 1 83  ? -0.570  9.407   6.438   1.00 0.00 ? 83  LYS A O    5  
ATOM 6948  C CB   . LYS A 1 83  ? 1.333   10.149  8.757   1.00 0.00 ? 83  LYS A CB   5  
ATOM 6949  C CG   . LYS A 1 83  ? -0.102  10.271  9.241   1.00 0.00 ? 83  LYS A CG   5  
ATOM 6950  C CD   . LYS A 1 83  ? -0.243  9.822   10.686  1.00 0.00 ? 83  LYS A CD   5  
ATOM 6951  C CE   . LYS A 1 83  ? 0.384   10.821  11.645  1.00 0.00 ? 83  LYS A CE   5  
ATOM 6952  N NZ   . LYS A 1 83  ? -0.592  11.856  12.085  1.00 0.00 ? 83  LYS A NZ   5  
ATOM 6953  H H    . LYS A 1 83  ? 0.687   12.279  7.539   1.00 0.00 ? 83  LYS A H    5  
ATOM 6954  H HA   . LYS A 1 83  ? 2.527   10.211  6.981   1.00 0.00 ? 83  LYS A HA   5  
ATOM 6955  H HB2  . LYS A 1 83  ? 1.698   9.168   9.023   1.00 0.00 ? 83  LYS A HB2  5  
ATOM 6956  H HB3  . LYS A 1 83  ? 1.927   10.895  9.267   1.00 0.00 ? 83  LYS A HB3  5  
ATOM 6957  H HG2  . LYS A 1 83  ? -0.411  11.303  9.165   1.00 0.00 ? 83  LYS A HG2  5  
ATOM 6958  H HG3  . LYS A 1 83  ? -0.736  9.656   8.618   1.00 0.00 ? 83  LYS A HG3  5  
ATOM 6959  H HD2  . LYS A 1 83  ? -1.292  9.723   10.922  1.00 0.00 ? 83  LYS A HD2  5  
ATOM 6960  H HD3  . LYS A 1 83  ? 0.246   8.865   10.805  1.00 0.00 ? 83  LYS A HD3  5  
ATOM 6961  H HE2  . LYS A 1 83  ? 0.747   10.290  12.511  1.00 0.00 ? 83  LYS A HE2  5  
ATOM 6962  H HE3  . LYS A 1 83  ? 1.211   11.307  11.148  1.00 0.00 ? 83  LYS A HE3  5  
ATOM 6963  H HZ1  . LYS A 1 83  ? -0.694  12.585  11.350  1.00 0.00 ? 83  LYS A HZ1  5  
ATOM 6964  H HZ2  . LYS A 1 83  ? -0.263  12.307  12.962  1.00 0.00 ? 83  LYS A HZ2  5  
ATOM 6965  H HZ3  . LYS A 1 83  ? -1.520  11.421  12.258  1.00 0.00 ? 83  LYS A HZ3  5  
ATOM 6966  N N    . VAL A 1 84  ? 1.327   8.303   5.943   1.00 0.00 ? 84  VAL A N    5  
ATOM 6967  C CA   . VAL A 1 84  ? 0.648   7.244   5.206   1.00 0.00 ? 84  VAL A CA   5  
ATOM 6968  C C    . VAL A 1 84  ? 0.940   5.877   5.813   1.00 0.00 ? 84  VAL A C    5  
ATOM 6969  O O    . VAL A 1 84  ? 2.025   5.640   6.346   1.00 0.00 ? 84  VAL A O    5  
ATOM 6970  C CB   . VAL A 1 84  ? 1.066   7.236   3.723   1.00 0.00 ? 84  VAL A CB   5  
ATOM 6971  C CG1  . VAL A 1 84  ? 0.790   8.588   3.083   1.00 0.00 ? 84  VAL A CG1  5  
ATOM 6972  C CG2  . VAL A 1 84  ? 2.534   6.861   3.586   1.00 0.00 ? 84  VAL A CG2  5  
ATOM 6973  H H    . VAL A 1 84  ? 2.303   8.275   6.029   1.00 0.00 ? 84  VAL A H    5  
ATOM 6974  H HA   . VAL A 1 84  ? -0.415  7.431   5.257   1.00 0.00 ? 84  VAL A HA   5  
ATOM 6975  H HB   . VAL A 1 84  ? 0.476   6.492   3.208   1.00 0.00 ? 84  VAL A HB   5  
ATOM 6976  H HG11 . VAL A 1 84  ? -0.247  8.851   3.231   1.00 0.00 ? 84  VAL A HG11 5  
ATOM 6977  H HG12 . VAL A 1 84  ? 1.422   9.337   3.537   1.00 0.00 ? 84  VAL A HG12 5  
ATOM 6978  H HG13 . VAL A 1 84  ? 0.998   8.534   2.024   1.00 0.00 ? 84  VAL A HG13 5  
ATOM 6979  H HG21 . VAL A 1 84  ? 2.777   6.737   2.541   1.00 0.00 ? 84  VAL A HG21 5  
ATOM 6980  H HG22 . VAL A 1 84  ? 3.147   7.645   4.007   1.00 0.00 ? 84  VAL A HG22 5  
ATOM 6981  H HG23 . VAL A 1 84  ? 2.721   5.937   4.112   1.00 0.00 ? 84  VAL A HG23 5  
ATOM 6982  N N    . THR A 1 85  ? -0.035  4.977   5.728   1.00 0.00 ? 85  THR A N    5  
ATOM 6983  C CA   . THR A 1 85  ? 0.117   3.632   6.269   1.00 0.00 ? 85  THR A CA   5  
ATOM 6984  C C    . THR A 1 85  ? 0.070   2.586   5.162   1.00 0.00 ? 85  THR A C    5  
ATOM 6985  O O    . THR A 1 85  ? -0.968  2.378   4.533   1.00 0.00 ? 85  THR A O    5  
ATOM 6986  C CB   . THR A 1 85  ? -0.979  3.317   7.305   1.00 0.00 ? 85  THR A CB   5  
ATOM 6987  O OG1  . THR A 1 85  ? -0.963  4.296   8.349   1.00 0.00 ? 85  THR A OG1  5  
ATOM 6988  C CG2  . THR A 1 85  ? -0.778  1.931   7.900   1.00 0.00 ? 85  THR A CG2  5  
ATOM 6989  H H    . THR A 1 85  ? -0.876  5.225   5.291   1.00 0.00 ? 85  THR A H    5  
ATOM 6990  H HA   . THR A 1 85  ? 1.076   3.578   6.763   1.00 0.00 ? 85  THR A HA   5  
ATOM 6991  H HB   . THR A 1 85  ? -1.939  3.344   6.810   1.00 0.00 ? 85  THR A HB   5  
ATOM 6992  H HG1  . THR A 1 85  ? -1.815  4.307   8.791   1.00 0.00 ? 85  THR A HG1  5  
ATOM 6993  H HG21 . THR A 1 85  ? -0.002  1.970   8.649   1.00 0.00 ? 85  THR A HG21 5  
ATOM 6994  H HG22 . THR A 1 85  ? -0.491  1.242   7.119   1.00 0.00 ? 85  THR A HG22 5  
ATOM 6995  H HG23 . THR A 1 85  ? -1.699  1.598   8.353   1.00 0.00 ? 85  THR A HG23 5  
ATOM 6996  N N    . LEU A 1 86  ? 1.201   1.928   4.928   1.00 0.00 ? 86  LEU A N    5  
ATOM 6997  C CA   . LEU A 1 86  ? 1.289   0.901   3.896   1.00 0.00 ? 86  LEU A CA   5  
ATOM 6998  C C    . LEU A 1 86  ? 0.897   -0.464  4.452   1.00 0.00 ? 86  LEU A C    5  
ATOM 6999  O O    . LEU A 1 86  ? 1.447   -0.918  5.456   1.00 0.00 ? 86  LEU A O    5  
ATOM 7000  C CB   . LEU A 1 86  ? 2.707   0.844   3.325   1.00 0.00 ? 86  LEU A CB   5  
ATOM 7001  C CG   . LEU A 1 86  ? 3.486   2.159   3.332   1.00 0.00 ? 86  LEU A CG   5  
ATOM 7002  C CD1  . LEU A 1 86  ? 4.942   1.919   2.963   1.00 0.00 ? 86  LEU A CD1  5  
ATOM 7003  C CD2  . LEU A 1 86  ? 2.851   3.161   2.378   1.00 0.00 ? 86  LEU A CD2  5  
ATOM 7004  H H    . LEU A 1 86  ? 1.995   2.138   5.461   1.00 0.00 ? 86  LEU A H    5  
ATOM 7005  H HA   . LEU A 1 86  ? 0.602   1.165   3.106   1.00 0.00 ? 86  LEU A HA   5  
ATOM 7006  H HB2  . LEU A 1 86  ? 3.267   0.125   3.903   1.00 0.00 ? 86  LEU A HB2  5  
ATOM 7007  H HB3  . LEU A 1 86  ? 2.637   0.504   2.301   1.00 0.00 ? 86  LEU A HB3  5  
ATOM 7008  H HG   . LEU A 1 86  ? 3.460   2.581   4.327   1.00 0.00 ? 86  LEU A HG   5  
ATOM 7009  H HD11 . LEU A 1 86  ? 5.040   0.950   2.498   1.00 0.00 ? 86  LEU A HD11 5  
ATOM 7010  H HD12 . LEU A 1 86  ? 5.550   1.954   3.854   1.00 0.00 ? 86  LEU A HD12 5  
ATOM 7011  H HD13 . LEU A 1 86  ? 5.270   2.684   2.274   1.00 0.00 ? 86  LEU A HD13 5  
ATOM 7012  H HD21 . LEU A 1 86  ? 2.342   2.630   1.587   1.00 0.00 ? 86  LEU A HD21 5  
ATOM 7013  H HD22 . LEU A 1 86  ? 3.619   3.791   1.954   1.00 0.00 ? 86  LEU A HD22 5  
ATOM 7014  H HD23 . LEU A 1 86  ? 2.141   3.770   2.917   1.00 0.00 ? 86  LEU A HD23 5  
ATOM 7015  N N    . ASP A 1 87  ? -0.055  -1.115  3.792   1.00 0.00 ? 87  ASP A N    5  
ATOM 7016  C CA   . ASP A 1 87  ? -0.518  -2.430  4.218   1.00 0.00 ? 87  ASP A CA   5  
ATOM 7017  C C    . ASP A 1 87  ? -0.747  -3.342  3.016   1.00 0.00 ? 87  ASP A C    5  
ATOM 7018  O O    . ASP A 1 87  ? -1.232  -2.901  1.974   1.00 0.00 ? 87  ASP A O    5  
ATOM 7019  C CB   . ASP A 1 87  ? -1.809  -2.302  5.029   1.00 0.00 ? 87  ASP A CB   5  
ATOM 7020  C CG   . ASP A 1 87  ? -1.995  -3.447  6.005   1.00 0.00 ? 87  ASP A CG   5  
ATOM 7021  O OD1  . ASP A 1 87  ? -1.017  -3.805  6.694   1.00 0.00 ? 87  ASP A OD1  5  
ATOM 7022  O OD2  . ASP A 1 87  ? -3.120  -3.984  6.082   1.00 0.00 ? 87  ASP A OD2  5  
ATOM 7023  H H    . ASP A 1 87  ? -0.455  -0.701  2.999   1.00 0.00 ? 87  ASP A H    5  
ATOM 7024  H HA   . ASP A 1 87  ? 0.247   -2.865  4.843   1.00 0.00 ? 87  ASP A HA   5  
ATOM 7025  H HB2  . ASP A 1 87  ? -1.785  -1.378  5.587   1.00 0.00 ? 87  ASP A HB2  5  
ATOM 7026  H HB3  . ASP A 1 87  ? -2.651  -2.288  4.353   1.00 0.00 ? 87  ASP A HB3  5  
ATOM 7027  N N    . TRP A 1 88  ? -0.393  -4.612  3.168   1.00 0.00 ? 88  TRP A N    5  
ATOM 7028  C CA   . TRP A 1 88  ? -0.558  -5.586  2.094   1.00 0.00 ? 88  TRP A CA   5  
ATOM 7029  C C    . TRP A 1 88  ? -2.025  -5.716  1.699   1.00 0.00 ? 88  TRP A C    5  
ATOM 7030  O O    . TRP A 1 88  ? -2.840  -6.229  2.466   1.00 0.00 ? 88  TRP A O    5  
ATOM 7031  C CB   . TRP A 1 88  ? -0.009  -6.947  2.523   1.00 0.00 ? 88  TRP A CB   5  
ATOM 7032  C CG   . TRP A 1 88  ? 1.474   -6.950  2.737   1.00 0.00 ? 88  TRP A CG   5  
ATOM 7033  C CD1  . TRP A 1 88  ? 2.136   -7.257  3.891   1.00 0.00 ? 88  TRP A CD1  5  
ATOM 7034  C CD2  . TRP A 1 88  ? 2.480   -6.627  1.770   1.00 0.00 ? 88  TRP A CD2  5  
ATOM 7035  N NE1  . TRP A 1 88  ? 3.492   -7.145  3.700   1.00 0.00 ? 88  TRP A NE1  5  
ATOM 7036  C CE2  . TRP A 1 88  ? 3.729   -6.761  2.407   1.00 0.00 ? 88  TRP A CE2  5  
ATOM 7037  C CE3  . TRP A 1 88  ? 2.446   -6.240  0.427   1.00 0.00 ? 88  TRP A CE3  5  
ATOM 7038  C CZ2  . TRP A 1 88  ? 4.930   -6.520  1.746   1.00 0.00 ? 88  TRP A CZ2  5  
ATOM 7039  C CZ3  . TRP A 1 88  ? 3.640   -6.000  -0.227  1.00 0.00 ? 88  TRP A CZ3  5  
ATOM 7040  C CH2  . TRP A 1 88  ? 4.868   -6.142  0.433   1.00 0.00 ? 88  TRP A CH2  5  
ATOM 7041  H H    . TRP A 1 88  ? -0.011  -4.904  4.023   1.00 0.00 ? 88  TRP A H    5  
ATOM 7042  H HA   . TRP A 1 88  ? 0.003   -5.234  1.241   1.00 0.00 ? 88  TRP A HA   5  
ATOM 7043  H HB2  . TRP A 1 88  ? -0.480  -7.243  3.449   1.00 0.00 ? 88  TRP A HB2  5  
ATOM 7044  H HB3  . TRP A 1 88  ? -0.238  -7.676  1.759   1.00 0.00 ? 88  TRP A HB3  5  
ATOM 7045  H HD1  . TRP A 1 88  ? 1.651   -7.543  4.812   1.00 0.00 ? 88  TRP A HD1  5  
ATOM 7046  H HE1  . TRP A 1 88  ? 4.178   -7.315  4.380   1.00 0.00 ? 88  TRP A HE1  5  
ATOM 7047  H HE3  . TRP A 1 88  ? 1.510   -6.125  -0.098  1.00 0.00 ? 88  TRP A HE3  5  
ATOM 7048  H HZ2  . TRP A 1 88  ? 5.885   -6.625  2.240   1.00 0.00 ? 88  TRP A HZ2  5  
ATOM 7049  H HZ3  . TRP A 1 88  ? 3.634   -5.700  -1.264  1.00 0.00 ? 88  TRP A HZ3  5  
ATOM 7050  H HH2  . TRP A 1 88  ? 5.776   -5.945  -0.117  1.00 0.00 ? 88  TRP A HH2  5  
ATOM 7051  N N    . ALA A 1 89  ? -2.354  -5.250  0.499   1.00 0.00 ? 89  ALA A N    5  
ATOM 7052  C CA   . ALA A 1 89  ? -3.723  -5.317  0.002   1.00 0.00 ? 89  ALA A CA   5  
ATOM 7053  C C    . ALA A 1 89  ? -4.368  -6.653  0.352   1.00 0.00 ? 89  ALA A C    5  
ATOM 7054  O O    . ALA A 1 89  ? -3.681  -7.620  0.682   1.00 0.00 ? 89  ALA A O    5  
ATOM 7055  C CB   . ALA A 1 89  ? -3.749  -5.094  -1.502  1.00 0.00 ? 89  ALA A CB   5  
ATOM 7056  H H    . ALA A 1 89  ? -1.659  -4.852  -0.066  1.00 0.00 ? 89  ALA A H    5  
ATOM 7057  H HA   . ALA A 1 89  ? -4.287  -4.523  0.470   1.00 0.00 ? 89  ALA A HA   5  
ATOM 7058  H HB1  . ALA A 1 89  ? -3.396  -5.983  -2.004  1.00 0.00 ? 89  ALA A HB1  5  
ATOM 7059  H HB2  . ALA A 1 89  ? -4.760  -4.880  -1.817  1.00 0.00 ? 89  ALA A HB2  5  
ATOM 7060  H HB3  . ALA A 1 89  ? -3.110  -4.261  -1.754  1.00 0.00 ? 89  ALA A HB3  5  
ATOM 7061  N N    . LYS A 1 90  ? -5.694  -6.701  0.280   1.00 0.00 ? 90  LYS A N    5  
ATOM 7062  C CA   . LYS A 1 90  ? -6.434  -7.919  0.588   1.00 0.00 ? 90  LYS A CA   5  
ATOM 7063  C C    . LYS A 1 90  ? -6.305  -8.936  -0.542  1.00 0.00 ? 90  LYS A C    5  
ATOM 7064  O O    . LYS A 1 90  ? -6.265  -8.587  -1.722  1.00 0.00 ? 90  LYS A O    5  
ATOM 7065  C CB   . LYS A 1 90  ? -7.910  -7.596  0.830   1.00 0.00 ? 90  LYS A CB   5  
ATOM 7066  C CG   . LYS A 1 90  ? -8.235  -7.283  2.281   1.00 0.00 ? 90  LYS A CG   5  
ATOM 7067  C CD   . LYS A 1 90  ? -7.836  -5.864  2.648   1.00 0.00 ? 90  LYS A CD   5  
ATOM 7068  C CE   . LYS A 1 90  ? -8.375  -5.469  4.014   1.00 0.00 ? 90  LYS A CE   5  
ATOM 7069  N NZ   . LYS A 1 90  ? -7.667  -6.178  5.116   1.00 0.00 ? 90  LYS A NZ   5  
ATOM 7070  H H    . LYS A 1 90  ? -6.187  -5.897  0.011   1.00 0.00 ? 90  LYS A H    5  
ATOM 7071  H HA   . LYS A 1 90  ? -6.015  -8.343  1.488   1.00 0.00 ? 90  LYS A HA   5  
ATOM 7072  H HB2  . LYS A 1 90  ? -8.183  -6.740  0.230   1.00 0.00 ? 90  LYS A HB2  5  
ATOM 7073  H HB3  . LYS A 1 90  ? -8.507  -8.444  0.525   1.00 0.00 ? 90  LYS A HB3  5  
ATOM 7074  H HG2  . LYS A 1 90  ? -9.297  -7.399  2.436   1.00 0.00 ? 90  LYS A HG2  5  
ATOM 7075  H HG3  . LYS A 1 90  ? -7.699  -7.974  2.917   1.00 0.00 ? 90  LYS A HG3  5  
ATOM 7076  H HD2  . LYS A 1 90  ? -6.758  -5.795  2.665   1.00 0.00 ? 90  LYS A HD2  5  
ATOM 7077  H HD3  . LYS A 1 90  ? -8.230  -5.185  1.905   1.00 0.00 ? 90  LYS A HD3  5  
ATOM 7078  H HE2  . LYS A 1 90  ? -8.249  -4.405  4.143   1.00 0.00 ? 90  LYS A HE2  5  
ATOM 7079  H HE3  . LYS A 1 90  ? -9.426  -5.714  4.056   1.00 0.00 ? 90  LYS A HE3  5  
ATOM 7080  H HZ1  . LYS A 1 90  ? -7.037  -6.907  4.724   1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 7081  H HZ2  . LYS A 1 90  ? -8.356  -6.634  5.747   1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 7082  H HZ3  . LYS A 1 90  ? -7.100  -5.504  5.668   1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 7083  N N    . PRO A 1 91  ? -6.238  -10.224 -0.175  1.00 0.00 ? 91  PRO A N    5  
ATOM 7084  C CA   . PRO A 1 91  ? -6.114  -11.317 -1.144  1.00 0.00 ? 91  PRO A CA   5  
ATOM 7085  C C    . PRO A 1 91  ? -7.385  -11.515 -1.962  1.00 0.00 ? 91  PRO A C    5  
ATOM 7086  O O    . PRO A 1 91  ? -8.342  -12.138 -1.501  1.00 0.00 ? 91  PRO A O    5  
ATOM 7087  C CB   . PRO A 1 91  ? -5.848  -12.542 -0.264  1.00 0.00 ? 91  PRO A CB   5  
ATOM 7088  C CG   . PRO A 1 91  ? -6.450  -12.198 1.055   1.00 0.00 ? 91  PRO A CG   5  
ATOM 7089  C CD   . PRO A 1 91  ? -6.279  -10.713 1.213   1.00 0.00 ? 91  PRO A CD   5  
ATOM 7090  H HA   . PRO A 1 91  ? -5.278  -11.164 -1.811  1.00 0.00 ? 91  PRO A HA   5  
ATOM 7091  H HB2  . PRO A 1 91  ? -6.321  -13.411 -0.701  1.00 0.00 ? 91  PRO A HB2  5  
ATOM 7092  H HB3  . PRO A 1 91  ? -4.785  -12.707 -0.182  1.00 0.00 ? 91  PRO A HB3  5  
ATOM 7093  H HG2  . PRO A 1 91  ? -7.497  -12.458 1.060   1.00 0.00 ? 91  PRO A HG2  5  
ATOM 7094  H HG3  . PRO A 1 91  ? -5.928  -12.721 1.843   1.00 0.00 ? 91  PRO A HG3  5  
ATOM 7095  H HD2  . PRO A 1 91  ? -7.119  -10.291 1.746   1.00 0.00 ? 91  PRO A HD2  5  
ATOM 7096  H HD3  . PRO A 1 91  ? -5.355  -10.492 1.727   1.00 0.00 ? 91  PRO A HD3  5  
ATOM 7097  N N    . LYS A 1 92  ? -7.390  -10.979 -3.178  1.00 0.00 ? 92  LYS A N    5  
ATOM 7098  C CA   . LYS A 1 92  ? -8.544  -11.097 -4.062  1.00 0.00 ? 92  LYS A CA   5  
ATOM 7099  C C    . LYS A 1 92  ? -8.974  -12.554 -4.203  1.00 0.00 ? 92  LYS A C    5  
ATOM 7100  O O    . LYS A 1 92  ? -8.170  -13.418 -4.552  1.00 0.00 ? 92  LYS A O    5  
ATOM 7101  C CB   . LYS A 1 92  ? -8.218  -10.514 -5.439  1.00 0.00 ? 92  LYS A CB   5  
ATOM 7102  C CG   . LYS A 1 92  ? -9.437  -10.338 -6.328  1.00 0.00 ? 92  LYS A CG   5  
ATOM 7103  C CD   . LYS A 1 92  ? -9.070  -9.697  -7.656  1.00 0.00 ? 92  LYS A CD   5  
ATOM 7104  C CE   . LYS A 1 92  ? -8.351  -10.678 -8.569  1.00 0.00 ? 92  LYS A CE   5  
ATOM 7105  N NZ   . LYS A 1 92  ? -8.503  -10.314 -10.005 1.00 0.00 ? 92  LYS A NZ   5  
ATOM 7106  H H    . LYS A 1 92  ? -6.597  -10.493 -3.489  1.00 0.00 ? 92  LYS A H    5  
ATOM 7107  H HA   . LYS A 1 92  ? -9.355  -10.535 -3.625  1.00 0.00 ? 92  LYS A HA   5  
ATOM 7108  H HB2  . LYS A 1 92  ? -7.752  -9.549  -5.307  1.00 0.00 ? 92  LYS A HB2  5  
ATOM 7109  H HB3  . LYS A 1 92  ? -7.525  -11.174 -5.941  1.00 0.00 ? 92  LYS A HB3  5  
ATOM 7110  H HG2  . LYS A 1 92  ? -9.876  -11.306 -6.517  1.00 0.00 ? 92  LYS A HG2  5  
ATOM 7111  H HG3  . LYS A 1 92  ? -10.154 -9.709  -5.820  1.00 0.00 ? 92  LYS A HG3  5  
ATOM 7112  H HD2  . LYS A 1 92  ? -9.973  -9.363  -8.146  1.00 0.00 ? 92  LYS A HD2  5  
ATOM 7113  H HD3  . LYS A 1 92  ? -8.424  -8.851  -7.471  1.00 0.00 ? 92  LYS A HD3  5  
ATOM 7114  H HE2  . LYS A 1 92  ? -7.302  -10.682 -8.316  1.00 0.00 ? 92  LYS A HE2  5  
ATOM 7115  H HE3  . LYS A 1 92  ? -8.762  -11.664 -8.411  1.00 0.00 ? 92  LYS A HE3  5  
ATOM 7116  H HZ1  . LYS A 1 92  ? -9.505  -10.146 -10.226 1.00 0.00 ? 92  LYS A HZ1  5  
ATOM 7117  H HZ2  . LYS A 1 92  ? -8.150  -11.083 -10.608 1.00 0.00 ? 92  LYS A HZ2  5  
ATOM 7118  H HZ3  . LYS A 1 92  ? -7.963  -9.449  -10.213 1.00 0.00 ? 92  LYS A HZ3  5  
ATOM 7119  N N    . GLY A 1 93  ? -10.248 -12.819 -3.931  1.00 0.00 ? 93  GLY A N    5  
ATOM 7120  C CA   . GLY A 1 93  ? -10.763 -14.172 -4.036  1.00 0.00 ? 93  GLY A CA   5  
ATOM 7121  C C    . GLY A 1 93  ? -12.102 -14.338 -3.346  1.00 0.00 ? 93  GLY A C    5  
ATOM 7122  O O    . GLY A 1 93  ? -12.161 -14.561 -2.137  1.00 0.00 ? 93  GLY A O    5  
ATOM 7123  H H    . GLY A 1 93  ? -10.843 -12.090 -3.658  1.00 0.00 ? 93  GLY A H    5  
ATOM 7124  H HA2  . GLY A 1 93  ? -10.873 -14.424 -5.080  1.00 0.00 ? 93  GLY A HA2  5  
ATOM 7125  H HA3  . GLY A 1 93  ? -10.053 -14.851 -3.586  1.00 0.00 ? 93  GLY A HA3  5  
ATOM 7126  N N    . GLU A 1 94  ? -13.180 -14.226 -4.115  1.00 0.00 ? 94  GLU A N    5  
ATOM 7127  C CA   . GLU A 1 94  ? -14.525 -14.363 -3.569  1.00 0.00 ? 94  GLU A CA   5  
ATOM 7128  C C    . GLU A 1 94  ? -15.558 -14.477 -4.687  1.00 0.00 ? 94  GLU A C    5  
ATOM 7129  O O    . GLU A 1 94  ? -15.345 -13.989 -5.796  1.00 0.00 ? 94  GLU A O    5  
ATOM 7130  C CB   . GLU A 1 94  ? -14.859 -13.169 -2.672  1.00 0.00 ? 94  GLU A CB   5  
ATOM 7131  C CG   . GLU A 1 94  ? -14.303 -11.850 -3.182  1.00 0.00 ? 94  GLU A CG   5  
ATOM 7132  C CD   . GLU A 1 94  ? -14.979 -10.649 -2.550  1.00 0.00 ? 94  GLU A CD   5  
ATOM 7133  O OE1  . GLU A 1 94  ? -15.945 -10.848 -1.784  1.00 0.00 ? 94  GLU A OE1  5  
ATOM 7134  O OE2  . GLU A 1 94  ? -14.544 -9.511  -2.823  1.00 0.00 ? 94  GLU A OE2  5  
ATOM 7135  H H    . GLU A 1 94  ? -13.069 -14.048 -5.073  1.00 0.00 ? 94  GLU A H    5  
ATOM 7136  H HA   . GLU A 1 94  ? -14.553 -15.265 -2.977  1.00 0.00 ? 94  GLU A HA   5  
ATOM 7137  H HB2  . GLU A 1 94  ? -15.933 -13.080 -2.597  1.00 0.00 ? 94  GLU A HB2  5  
ATOM 7138  H HB3  . GLU A 1 94  ? -14.453 -13.350 -1.688  1.00 0.00 ? 94  GLU A HB3  5  
ATOM 7139  H HG2  . GLU A 1 94  ? -13.248 -11.809 -2.959  1.00 0.00 ? 94  GLU A HG2  5  
ATOM 7140  H HG3  . GLU A 1 94  ? -14.446 -11.804 -4.252  1.00 0.00 ? 94  GLU A HG3  5  
ATOM 7141  N N    . GLY A 1 95  ? -16.678 -15.127 -4.386  1.00 0.00 ? 95  GLY A N    5  
ATOM 7142  C CA   . GLY A 1 95  ? -17.727 -15.295 -5.375  1.00 0.00 ? 95  GLY A CA   5  
ATOM 7143  C C    . GLY A 1 95  ? -17.421 -16.404 -6.362  1.00 0.00 ? 95  GLY A C    5  
ATOM 7144  O O    . GLY A 1 95  ? -16.272 -16.823 -6.500  1.00 0.00 ? 95  GLY A O    5  
ATOM 7145  H H    . GLY A 1 95  ? -16.794 -15.496 -3.485  1.00 0.00 ? 95  GLY A H    5  
ATOM 7146  H HA2  . GLY A 1 95  ? -18.652 -15.524 -4.868  1.00 0.00 ? 95  GLY A HA2  5  
ATOM 7147  H HA3  . GLY A 1 95  ? -17.845 -14.369 -5.918  1.00 0.00 ? 95  GLY A HA3  5  
ATOM 7148  N N    . GLY A 1 96  ? -18.452 -16.882 -7.051  1.00 0.00 ? 96  GLY A N    5  
ATOM 7149  C CA   . GLY A 1 96  ? -18.268 -17.947 -8.021  1.00 0.00 ? 96  GLY A CA   5  
ATOM 7150  C C    . GLY A 1 96  ? -19.572 -18.622 -8.396  1.00 0.00 ? 96  GLY A C    5  
ATOM 7151  O O    . GLY A 1 96  ? -20.644 -18.033 -8.262  1.00 0.00 ? 96  GLY A O    5  
ATOM 7152  H H    . GLY A 1 96  ? -19.346 -16.510 -6.900  1.00 0.00 ? 96  GLY A H    5  
ATOM 7153  H HA2  . GLY A 1 96  ? -17.819 -17.533 -8.911  1.00 0.00 ? 96  GLY A HA2  5  
ATOM 7154  H HA3  . GLY A 1 96  ? -17.600 -18.686 -7.603  1.00 0.00 ? 96  GLY A HA3  5  
ATOM 7155  N N    . SER A 1 97  ? -19.480 -19.861 -8.869  1.00 0.00 ? 97  SER A N    5  
ATOM 7156  C CA   . SER A 1 97  ? -20.662 -20.615 -9.270  1.00 0.00 ? 97  SER A CA   5  
ATOM 7157  C C    . SER A 1 97  ? -21.121 -21.542 -8.149  1.00 0.00 ? 97  SER A C    5  
ATOM 7158  O O    . SER A 1 97  ? -20.631 -22.663 -8.015  1.00 0.00 ? 97  SER A O    5  
ATOM 7159  C CB   . SER A 1 97  ? -20.369 -21.429 -10.532 1.00 0.00 ? 97  SER A CB   5  
ATOM 7160  O OG   . SER A 1 97  ? -20.152 -20.581 -11.647 1.00 0.00 ? 97  SER A OG   5  
ATOM 7161  H H    . SER A 1 97  ? -18.596 -20.276 -8.952  1.00 0.00 ? 97  SER A H    5  
ATOM 7162  H HA   . SER A 1 97  ? -21.450 -19.908 -9.483  1.00 0.00 ? 97  SER A HA   5  
ATOM 7163  H HB2  . SER A 1 97  ? -19.485 -22.028 -10.374 1.00 0.00 ? 97  SER A HB2  5  
ATOM 7164  H HB3  . SER A 1 97  ? -21.209 -22.075 -10.744 1.00 0.00 ? 97  SER A HB3  5  
ATOM 7165  H HG   . SER A 1 97  ? -20.038 -21.114 -12.437 1.00 0.00 ? 97  SER A HG   5  
ATOM 7166  N N    . GLY A 1 98  ? -22.067 -21.065 -7.345  1.00 0.00 ? 98  GLY A N    5  
ATOM 7167  C CA   . GLY A 1 98  ? -22.577 -21.863 -6.245  1.00 0.00 ? 98  GLY A CA   5  
ATOM 7168  C C    . GLY A 1 98  ? -24.058 -22.156 -6.380  1.00 0.00 ? 98  GLY A C    5  
ATOM 7169  O O    . GLY A 1 98  ? -24.906 -21.443 -5.843  1.00 0.00 ? 98  GLY A O    5  
ATOM 7170  H H    . GLY A 1 98  ? -22.420 -20.164 -7.500  1.00 0.00 ? 98  GLY A H    5  
ATOM 7171  H HA2  . GLY A 1 98  ? -22.037 -22.797 -6.211  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 7172  H HA3  . GLY A 1 98  ? -22.411 -21.329 -5.321  1.00 0.00 ? 98  GLY A HA3  5  
ATOM 7173  N N    . PRO A 1 99  ? -24.388 -23.229 -7.115  1.00 0.00 ? 99  PRO A N    5  
ATOM 7174  C CA   . PRO A 1 99  ? -25.778 -23.639 -7.338  1.00 0.00 ? 99  PRO A CA   5  
ATOM 7175  C C    . PRO A 1 99  ? -26.432 -24.183 -6.072  1.00 0.00 ? 99  PRO A C    5  
ATOM 7176  O O    . PRO A 1 99  ? -25.809 -24.229 -5.011  1.00 0.00 ? 99  PRO A O    5  
ATOM 7177  C CB   . PRO A 1 99  ? -25.658 -24.741 -8.393  1.00 0.00 ? 99  PRO A CB   5  
ATOM 7178  C CG   . PRO A 1 99  ? -24.282 -25.285 -8.218  1.00 0.00 ? 99  PRO A CG   5  
ATOM 7179  C CD   . PRO A 1 99  ? -23.430 -24.124 -7.784  1.00 0.00 ? 99  PRO A CD   5  
ATOM 7180  H HA   . PRO A 1 99  ? -26.373 -22.827 -7.729  1.00 0.00 ? 99  PRO A HA   5  
ATOM 7181  H HB2  . PRO A 1 99  ? -26.409 -25.498 -8.214  1.00 0.00 ? 99  PRO A HB2  5  
ATOM 7182  H HB3  . PRO A 1 99  ? -25.792 -24.318 -9.377  1.00 0.00 ? 99  PRO A HB3  5  
ATOM 7183  H HG2  . PRO A 1 99  ? -24.284 -26.052 -7.459  1.00 0.00 ? 99  PRO A HG2  5  
ATOM 7184  H HG3  . PRO A 1 99  ? -23.923 -25.683 -9.156  1.00 0.00 ? 99  PRO A HG3  5  
ATOM 7185  H HD2  . PRO A 1 99  ? -22.665 -24.454 -7.097  1.00 0.00 ? 99  PRO A HD2  5  
ATOM 7186  H HD3  . PRO A 1 99  ? -22.986 -23.641 -8.642  1.00 0.00 ? 99  PRO A HD3  5  
ATOM 7187  N N    . SER A 1 100 ? -27.690 -24.593 -6.191  1.00 0.00 ? 100 SER A N    5  
ATOM 7188  C CA   . SER A 1 100 ? -28.429 -25.131 -5.055  1.00 0.00 ? 100 SER A CA   5  
ATOM 7189  C C    . SER A 1 100 ? -29.425 -26.194 -5.509  1.00 0.00 ? 100 SER A C    5  
ATOM 7190  O O    . SER A 1 100 ? -29.934 -26.146 -6.628  1.00 0.00 ? 100 SER A O    5  
ATOM 7191  C CB   . SER A 1 100 ? -29.165 -24.008 -4.320  1.00 0.00 ? 100 SER A CB   5  
ATOM 7192  O OG   . SER A 1 100 ? -29.875 -24.510 -3.202  1.00 0.00 ? 100 SER A OG   5  
ATOM 7193  H H    . SER A 1 100 ? -28.133 -24.530 -7.063  1.00 0.00 ? 100 SER A H    5  
ATOM 7194  H HA   . SER A 1 100 ? -27.718 -25.585 -4.381  1.00 0.00 ? 100 SER A HA   5  
ATOM 7195  H HB2  . SER A 1 100 ? -28.449 -23.276 -3.978  1.00 0.00 ? 100 SER A HB2  5  
ATOM 7196  H HB3  . SER A 1 100 ? -29.865 -23.539 -4.996  1.00 0.00 ? 100 SER A HB3  5  
ATOM 7197  H HG   . SER A 1 100 ? -29.865 -23.859 -2.497  1.00 0.00 ? 100 SER A HG   5  
ATOM 7198  N N    . SER A 1 101 ? -29.697 -27.154 -4.630  1.00 0.00 ? 101 SER A N    5  
ATOM 7199  C CA   . SER A 1 101 ? -30.628 -28.232 -4.941  1.00 0.00 ? 101 SER A CA   5  
ATOM 7200  C C    . SER A 1 101 ? -31.295 -28.756 -3.672  1.00 0.00 ? 101 SER A C    5  
ATOM 7201  O O    . SER A 1 101 ? -30.700 -28.748 -2.596  1.00 0.00 ? 101 SER A O    5  
ATOM 7202  C CB   . SER A 1 101 ? -29.901 -29.372 -5.656  1.00 0.00 ? 101 SER A CB   5  
ATOM 7203  O OG   . SER A 1 101 ? -29.777 -29.107 -7.043  1.00 0.00 ? 101 SER A OG   5  
ATOM 7204  H H    . SER A 1 101 ? -29.259 -27.138 -3.753  1.00 0.00 ? 101 SER A H    5  
ATOM 7205  H HA   . SER A 1 101 ? -31.389 -27.835 -5.595  1.00 0.00 ? 101 SER A HA   5  
ATOM 7206  H HB2  . SER A 1 101 ? -28.915 -29.488 -5.235  1.00 0.00 ? 101 SER A HB2  5  
ATOM 7207  H HB3  . SER A 1 101 ? -30.458 -30.289 -5.526  1.00 0.00 ? 101 SER A HB3  5  
ATOM 7208  H HG   . SER A 1 101 ? -29.459 -28.210 -7.170  1.00 0.00 ? 101 SER A HG   5  
ATOM 7209  N N    . GLY A 1 102 ? -32.537 -29.212 -3.809  1.00 0.00 ? 102 GLY A N    5  
ATOM 7210  C CA   . GLY A 1 102 ? -33.265 -29.734 -2.667  1.00 0.00 ? 102 GLY A CA   5  
ATOM 7211  C C    . GLY A 1 102 ? -34.758 -29.494 -2.773  1.00 0.00 ? 102 GLY A C    5  
ATOM 7212  O O    . GLY A 1 102 ? -35.514 -29.831 -1.862  1.00 0.00 ? 102 GLY A O    5  
ATOM 7213  H H    . GLY A 1 102 ? -32.961 -29.194 -4.692  1.00 0.00 ? 102 GLY A H    5  
ATOM 7214  H HA2  . GLY A 1 102 ? -33.086 -30.796 -2.594  1.00 0.00 ? 102 GLY A HA2  5  
ATOM 7215  H HA3  . GLY A 1 102 ? -32.898 -29.255 -1.771  1.00 0.00 ? 102 GLY A HA3  5  
ATOM 7216  N N    . GLY A 1 1   ? -6.532  1.113   24.017  1.00 0.00 ? 1   GLY A N    6  
ATOM 7217  C CA   . GLY A 1 1   ? -6.528  0.290   22.822  1.00 0.00 ? 1   GLY A CA   6  
ATOM 7218  C C    . GLY A 1 1   ? -5.202  -0.409  22.604  1.00 0.00 ? 1   GLY A C    6  
ATOM 7219  O O    . GLY A 1 1   ? -4.142  0.209   22.705  1.00 0.00 ? 1   GLY A O    6  
ATOM 7220  H H1   . GLY A 1 1   ? -5.956  0.877   24.774  1.00 0.00 ? 1   GLY A H1   6  
ATOM 7221  H HA2  . GLY A 1 1   ? -7.306  -0.453  22.908  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7222  H HA3  . GLY A 1 1   ? -6.736  0.917   21.967  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7223  N N    . SER A 1 2   ? -5.259  -1.703  22.304  1.00 0.00 ? 2   SER A N    6  
ATOM 7224  C CA   . SER A 1 2   ? -4.052  -2.489  22.076  1.00 0.00 ? 2   SER A CA   6  
ATOM 7225  C C    . SER A 1 2   ? -3.667  -2.478  20.600  1.00 0.00 ? 2   SER A C    6  
ATOM 7226  O O    . SER A 1 2   ? -4.509  -2.681  19.726  1.00 0.00 ? 2   SER A O    6  
ATOM 7227  C CB   . SER A 1 2   ? -4.259  -3.929  22.550  1.00 0.00 ? 2   SER A CB   6  
ATOM 7228  O OG   . SER A 1 2   ? -3.904  -4.073  23.914  1.00 0.00 ? 2   SER A OG   6  
ATOM 7229  H H    . SER A 1 2   ? -6.134  -2.140  22.237  1.00 0.00 ? 2   SER A H    6  
ATOM 7230  H HA   . SER A 1 2   ? -3.253  -2.042  22.649  1.00 0.00 ? 2   SER A HA   6  
ATOM 7231  H HB2  . SER A 1 2   ? -5.297  -4.199  22.430  1.00 0.00 ? 2   SER A HB2  6  
ATOM 7232  H HB3  . SER A 1 2   ? -3.644  -4.592  21.958  1.00 0.00 ? 2   SER A HB3  6  
ATOM 7233  H HG   . SER A 1 2   ? -4.426  -4.776  24.308  1.00 0.00 ? 2   SER A HG   6  
ATOM 7234  N N    . SER A 1 3   ? -2.387  -2.238  20.331  1.00 0.00 ? 3   SER A N    6  
ATOM 7235  C CA   . SER A 1 3   ? -1.889  -2.195  18.961  1.00 0.00 ? 3   SER A CA   6  
ATOM 7236  C C    . SER A 1 3   ? -1.071  -3.443  18.642  1.00 0.00 ? 3   SER A C    6  
ATOM 7237  O O    . SER A 1 3   ? -0.650  -4.170  19.541  1.00 0.00 ? 3   SER A O    6  
ATOM 7238  C CB   . SER A 1 3   ? -1.037  -0.944  18.745  1.00 0.00 ? 3   SER A CB   6  
ATOM 7239  O OG   . SER A 1 3   ? 0.235   -1.081  19.353  1.00 0.00 ? 3   SER A OG   6  
ATOM 7240  H H    . SER A 1 3   ? -1.764  -2.083  21.072  1.00 0.00 ? 3   SER A H    6  
ATOM 7241  H HA   . SER A 1 3   ? -2.742  -2.159  18.300  1.00 0.00 ? 3   SER A HA   6  
ATOM 7242  H HB2  . SER A 1 3   ? -0.900  -0.783  17.686  1.00 0.00 ? 3   SER A HB2  6  
ATOM 7243  H HB3  . SER A 1 3   ? -1.540  -0.090  19.176  1.00 0.00 ? 3   SER A HB3  6  
ATOM 7244  H HG   . SER A 1 3   ? 0.693   -0.237  19.333  1.00 0.00 ? 3   SER A HG   6  
ATOM 7245  N N    . GLY A 1 4   ? -0.850  -3.684  17.353  1.00 0.00 ? 4   GLY A N    6  
ATOM 7246  C CA   . GLY A 1 4   ? -0.083  -4.844  16.936  1.00 0.00 ? 4   GLY A CA   6  
ATOM 7247  C C    . GLY A 1 4   ? 0.982   -4.498  15.915  1.00 0.00 ? 4   GLY A C    6  
ATOM 7248  O O    . GLY A 1 4   ? 1.339   -3.332  15.751  1.00 0.00 ? 4   GLY A O    6  
ATOM 7249  H H    . GLY A 1 4   ? -1.210  -3.069  16.680  1.00 0.00 ? 4   GLY A H    6  
ATOM 7250  H HA2  . GLY A 1 4   ? 0.391   -5.279  17.803  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7251  H HA3  . GLY A 1 4   ? -0.757  -5.570  16.505  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7252  N N    . SER A 1 5   ? 1.493   -5.515  15.228  1.00 0.00 ? 5   SER A N    6  
ATOM 7253  C CA   . SER A 1 5   ? 2.528   -5.313  14.221  1.00 0.00 ? 5   SER A CA   6  
ATOM 7254  C C    . SER A 1 5   ? 2.190   -6.065  12.936  1.00 0.00 ? 5   SER A C    6  
ATOM 7255  O O    . SER A 1 5   ? 1.495   -7.080  12.963  1.00 0.00 ? 5   SER A O    6  
ATOM 7256  C CB   . SER A 1 5   ? 3.885   -5.777  14.754  1.00 0.00 ? 5   SER A CB   6  
ATOM 7257  O OG   . SER A 1 5   ? 3.902   -7.180  14.954  1.00 0.00 ? 5   SER A OG   6  
ATOM 7258  H H    . SER A 1 5   ? 1.167   -6.422  15.404  1.00 0.00 ? 5   SER A H    6  
ATOM 7259  H HA   . SER A 1 5   ? 2.578   -4.257  14.003  1.00 0.00 ? 5   SER A HA   6  
ATOM 7260  H HB2  . SER A 1 5   ? 4.656   -5.517  14.045  1.00 0.00 ? 5   SER A HB2  6  
ATOM 7261  H HB3  . SER A 1 5   ? 4.084   -5.288  15.697  1.00 0.00 ? 5   SER A HB3  6  
ATOM 7262  H HG   . SER A 1 5   ? 3.993   -7.623  14.108  1.00 0.00 ? 5   SER A HG   6  
ATOM 7263  N N    . SER A 1 6   ? 2.688   -5.557  11.813  1.00 0.00 ? 6   SER A N    6  
ATOM 7264  C CA   . SER A 1 6   ? 2.437   -6.177  10.517  1.00 0.00 ? 6   SER A CA   6  
ATOM 7265  C C    . SER A 1 6   ? 3.735   -6.684  9.897   1.00 0.00 ? 6   SER A C    6  
ATOM 7266  O O    . SER A 1 6   ? 4.827   -6.301  10.314  1.00 0.00 ? 6   SER A O    6  
ATOM 7267  C CB   . SER A 1 6   ? 1.762   -5.179  9.574   1.00 0.00 ? 6   SER A CB   6  
ATOM 7268  O OG   . SER A 1 6   ? 2.707   -4.277  9.025   1.00 0.00 ? 6   SER A OG   6  
ATOM 7269  H H    . SER A 1 6   ? 3.235   -4.745  11.857  1.00 0.00 ? 6   SER A H    6  
ATOM 7270  H HA   . SER A 1 6   ? 1.775   -7.015  10.674  1.00 0.00 ? 6   SER A HA   6  
ATOM 7271  H HB2  . SER A 1 6   ? 1.285   -5.716  8.768   1.00 0.00 ? 6   SER A HB2  6  
ATOM 7272  H HB3  . SER A 1 6   ? 1.020   -4.616  10.120  1.00 0.00 ? 6   SER A HB3  6  
ATOM 7273  H HG   . SER A 1 6   ? 2.463   -3.378  9.254   1.00 0.00 ? 6   SER A HG   6  
ATOM 7274  N N    . GLY A 1 7   ? 3.606   -7.549  8.895   1.00 0.00 ? 7   GLY A N    6  
ATOM 7275  C CA   . GLY A 1 7   ? 4.776   -8.096  8.233   1.00 0.00 ? 7   GLY A CA   6  
ATOM 7276  C C    . GLY A 1 7   ? 4.491   -9.418  7.550   1.00 0.00 ? 7   GLY A C    6  
ATOM 7277  O O    . GLY A 1 7   ? 3.691   -10.226 8.023   1.00 0.00 ? 7   GLY A O    6  
ATOM 7278  H H    . GLY A 1 7   ? 2.710   -7.819  8.605   1.00 0.00 ? 7   GLY A H    6  
ATOM 7279  H HA2  . GLY A 1 7   ? 5.121   -7.388  7.494   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7280  H HA3  . GLY A 1 7   ? 5.555   -8.244  8.966   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7281  N N    . PRO A 1 8   ? 5.154   -9.655  6.408   1.00 0.00 ? 8   PRO A N    6  
ATOM 7282  C CA   . PRO A 1 8   ? 4.982   -10.887 5.633   1.00 0.00 ? 8   PRO A CA   6  
ATOM 7283  C C    . PRO A 1 8   ? 5.571   -12.103 6.341   1.00 0.00 ? 8   PRO A C    6  
ATOM 7284  O O    . PRO A 1 8   ? 5.157   -13.236 6.098   1.00 0.00 ? 8   PRO A O    6  
ATOM 7285  C CB   . PRO A 1 8   ? 5.746   -10.602 4.338   1.00 0.00 ? 8   PRO A CB   6  
ATOM 7286  C CG   . PRO A 1 8   ? 6.760   -9.577  4.714   1.00 0.00 ? 8   PRO A CG   6  
ATOM 7287  C CD   . PRO A 1 8   ? 6.122   -8.736  5.785   1.00 0.00 ? 8   PRO A CD   6  
ATOM 7288  H HA   . PRO A 1 8   ? 3.942   -11.073 5.407   1.00 0.00 ? 8   PRO A HA   6  
ATOM 7289  H HB2  . PRO A 1 8   ? 6.213   -11.510 3.984   1.00 0.00 ? 8   PRO A HB2  6  
ATOM 7290  H HB3  . PRO A 1 8   ? 5.064   -10.226 3.590   1.00 0.00 ? 8   PRO A HB3  6  
ATOM 7291  H HG2  . PRO A 1 8   ? 7.646   -10.061 5.095   1.00 0.00 ? 8   PRO A HG2  6  
ATOM 7292  H HG3  . PRO A 1 8   ? 7.002   -8.969  3.855   1.00 0.00 ? 8   PRO A HG3  6  
ATOM 7293  H HD2  . PRO A 1 8   ? 6.862   -8.413  6.502   1.00 0.00 ? 8   PRO A HD2  6  
ATOM 7294  H HD3  . PRO A 1 8   ? 5.620   -7.886  5.348   1.00 0.00 ? 8   PRO A HD3  6  
ATOM 7295  N N    . ASN A 1 9   ? 6.539   -11.860 7.219   1.00 0.00 ? 9   ASN A N    6  
ATOM 7296  C CA   . ASN A 1 9   ? 7.185   -12.936 7.962   1.00 0.00 ? 9   ASN A CA   6  
ATOM 7297  C C    . ASN A 1 9   ? 6.149   -13.892 8.546   1.00 0.00 ? 9   ASN A C    6  
ATOM 7298  O O    . ASN A 1 9   ? 6.051   -15.046 8.131   1.00 0.00 ? 9   ASN A O    6  
ATOM 7299  C CB   . ASN A 1 9   ? 8.052   -12.360 9.083   1.00 0.00 ? 9   ASN A CB   6  
ATOM 7300  C CG   . ASN A 1 9   ? 9.421   -11.931 8.592   1.00 0.00 ? 9   ASN A CG   6  
ATOM 7301  O OD1  . ASN A 1 9   ? 10.220  -12.756 8.147   1.00 0.00 ? 9   ASN A OD1  6  
ATOM 7302  N ND2  . ASN A 1 9   ? 9.699   -10.635 8.672   1.00 0.00 ? 9   ASN A ND2  6  
ATOM 7303  H H    . ASN A 1 9   ? 6.827   -10.935 7.370   1.00 0.00 ? 9   ASN A H    6  
ATOM 7304  H HA   . ASN A 1 9   ? 7.814   -13.481 7.276   1.00 0.00 ? 9   ASN A HA   6  
ATOM 7305  H HB2  . ASN A 1 9   ? 7.557   -11.498 9.507   1.00 0.00 ? 9   ASN A HB2  6  
ATOM 7306  H HB3  . ASN A 1 9   ? 8.183   -13.108 9.850   1.00 0.00 ? 9   ASN A HB3  6  
ATOM 7307  H HD21 . ASN A 1 9   ? 9.015   -10.036 9.038   1.00 0.00 ? 9   ASN A HD21 6  
ATOM 7308  H HD22 . ASN A 1 9   ? 10.577  -10.330 8.361   1.00 0.00 ? 9   ASN A HD22 6  
ATOM 7309  N N    . ALA A 1 10  ? 5.376   -13.402 9.510   1.00 0.00 ? 10  ALA A N    6  
ATOM 7310  C CA   . ALA A 1 10  ? 4.346   -14.211 10.149  1.00 0.00 ? 10  ALA A CA   6  
ATOM 7311  C C    . ALA A 1 10  ? 3.016   -14.088 9.413   1.00 0.00 ? 10  ALA A C    6  
ATOM 7312  O O    . ALA A 1 10  ? 1.955   -14.031 10.034  1.00 0.00 ? 10  ALA A O    6  
ATOM 7313  C CB   . ALA A 1 10  ? 4.184   -13.805 11.606  1.00 0.00 ? 10  ALA A CB   6  
ATOM 7314  H H    . ALA A 1 10  ? 5.502   -12.474 9.798   1.00 0.00 ? 10  ALA A H    6  
ATOM 7315  H HA   . ALA A 1 10  ? 4.667   -15.242 10.122  1.00 0.00 ? 10  ALA A HA   6  
ATOM 7316  H HB1  . ALA A 1 10  ? 4.730   -14.494 12.234  1.00 0.00 ? 10  ALA A HB1  6  
ATOM 7317  H HB2  . ALA A 1 10  ? 4.570   -12.806 11.747  1.00 0.00 ? 10  ALA A HB2  6  
ATOM 7318  H HB3  . ALA A 1 10  ? 3.138   -13.827 11.872  1.00 0.00 ? 10  ALA A HB3  6  
ATOM 7319  N N    . ARG A 1 11  ? 3.082   -14.047 8.086   1.00 0.00 ? 11  ARG A N    6  
ATOM 7320  C CA   . ARG A 1 11  ? 1.883   -13.929 7.265   1.00 0.00 ? 11  ARG A CA   6  
ATOM 7321  C C    . ARG A 1 11  ? 2.113   -14.520 5.877   1.00 0.00 ? 11  ARG A C    6  
ATOM 7322  O O    . ARG A 1 11  ? 3.208   -14.421 5.324   1.00 0.00 ? 11  ARG A O    6  
ATOM 7323  C CB   . ARG A 1 11  ? 1.465   -12.462 7.144   1.00 0.00 ? 11  ARG A CB   6  
ATOM 7324  C CG   . ARG A 1 11  ? -0.018  -12.272 6.866   1.00 0.00 ? 11  ARG A CG   6  
ATOM 7325  C CD   . ARG A 1 11  ? -0.856  -12.550 8.104   1.00 0.00 ? 11  ARG A CD   6  
ATOM 7326  N NE   . ARG A 1 11  ? -1.044  -11.352 8.918   1.00 0.00 ? 11  ARG A NE   6  
ATOM 7327  C CZ   . ARG A 1 11  ? -1.753  -10.299 8.524   1.00 0.00 ? 11  ARG A CZ   6  
ATOM 7328  N NH1  . ARG A 1 11  ? -2.338  -10.298 7.334   1.00 0.00 ? 11  ARG A NH1  6  
ATOM 7329  N NH2  . ARG A 1 11  ? -1.878  -9.246  9.321   1.00 0.00 ? 11  ARG A NH2  6  
ATOM 7330  H H    . ARG A 1 11  ? 3.957   -14.096 7.648   1.00 0.00 ? 11  ARG A H    6  
ATOM 7331  H HA   . ARG A 1 11  ? 1.092   -14.480 7.752   1.00 0.00 ? 11  ARG A HA   6  
ATOM 7332  H HB2  . ARG A 1 11  ? 1.704   -11.954 8.066   1.00 0.00 ? 11  ARG A HB2  6  
ATOM 7333  H HB3  . ARG A 1 11  ? 2.021   -12.008 6.337   1.00 0.00 ? 11  ARG A HB3  6  
ATOM 7334  H HG2  . ARG A 1 11  ? -0.188  -11.253 6.551   1.00 0.00 ? 11  ARG A HG2  6  
ATOM 7335  H HG3  . ARG A 1 11  ? -0.317  -12.949 6.080   1.00 0.00 ? 11  ARG A HG3  6  
ATOM 7336  H HD2  . ARG A 1 11  ? -1.823  -12.917 7.793   1.00 0.00 ? 11  ARG A HD2  6  
ATOM 7337  H HD3  . ARG A 1 11  ? -0.359  -13.303 8.697   1.00 0.00 ? 11  ARG A HD3  6  
ATOM 7338  H HE   . ARG A 1 11  ? -0.620  -11.332 9.801   1.00 0.00 ? 11  ARG A HE   6  
ATOM 7339  H HH11 . ARG A 1 11  ? -2.246  -11.090 6.732   1.00 0.00 ? 11  ARG A HH11 6  
ATOM 7340  H HH12 . ARG A 1 11  ? -2.872  -9.505  7.040   1.00 0.00 ? 11  ARG A HH12 6  
ATOM 7341  H HH21 . ARG A 1 11  ? -1.439  -9.244  10.219  1.00 0.00 ? 11  ARG A HH21 6  
ATOM 7342  H HH22 . ARG A 1 11  ? -2.411  -8.455  9.024   1.00 0.00 ? 11  ARG A HH22 6  
ATOM 7343  N N    . SER A 1 12  ? 1.074   -15.135 5.322   1.00 0.00 ? 12  SER A N    6  
ATOM 7344  C CA   . SER A 1 12  ? 1.164   -15.746 4.001   1.00 0.00 ? 12  SER A CA   6  
ATOM 7345  C C    . SER A 1 12  ? 1.902   -14.831 3.028   1.00 0.00 ? 12  SER A C    6  
ATOM 7346  O O    . SER A 1 12  ? 2.104   -13.649 3.305   1.00 0.00 ? 12  SER A O    6  
ATOM 7347  C CB   . SER A 1 12  ? -0.234  -16.058 3.464   1.00 0.00 ? 12  SER A CB   6  
ATOM 7348  O OG   . SER A 1 12  ? -0.206  -17.171 2.586   1.00 0.00 ? 12  SER A OG   6  
ATOM 7349  H H    . SER A 1 12  ? 0.227   -15.181 5.814   1.00 0.00 ? 12  SER A H    6  
ATOM 7350  H HA   . SER A 1 12  ? 1.717   -16.668 4.099   1.00 0.00 ? 12  SER A HA   6  
ATOM 7351  H HB2  . SER A 1 12  ? -0.892  -16.283 4.289   1.00 0.00 ? 12  SER A HB2  6  
ATOM 7352  H HB3  . SER A 1 12  ? -0.610  -15.200 2.926   1.00 0.00 ? 12  SER A HB3  6  
ATOM 7353  H HG   . SER A 1 12  ? 0.093   -16.887 1.719   1.00 0.00 ? 12  SER A HG   6  
ATOM 7354  N N    . GLN A 1 13  ? 2.302   -15.388 1.889   1.00 0.00 ? 13  GLN A N    6  
ATOM 7355  C CA   . GLN A 1 13  ? 3.018   -14.622 0.876   1.00 0.00 ? 13  GLN A CA   6  
ATOM 7356  C C    . GLN A 1 13  ? 2.477   -13.199 0.785   1.00 0.00 ? 13  GLN A C    6  
ATOM 7357  O O    . GLN A 1 13  ? 1.276   -12.957 0.902   1.00 0.00 ? 13  GLN A O    6  
ATOM 7358  C CB   . GLN A 1 13  ? 2.908   -15.311 -0.486  1.00 0.00 ? 13  GLN A CB   6  
ATOM 7359  C CG   . GLN A 1 13  ? 3.499   -14.500 -1.627  1.00 0.00 ? 13  GLN A CG   6  
ATOM 7360  C CD   . GLN A 1 13  ? 2.843   -14.803 -2.960  1.00 0.00 ? 13  GLN A CD   6  
ATOM 7361  O OE1  . GLN A 1 13  ? 1.720   -15.304 -3.012  1.00 0.00 ? 13  GLN A OE1  6  
ATOM 7362  N NE2  . GLN A 1 13  ? 3.543   -14.500 -4.047  1.00 0.00 ? 13  GLN A NE2  6  
ATOM 7363  H H    . GLN A 1 13  ? 2.111   -16.334 1.727   1.00 0.00 ? 13  GLN A H    6  
ATOM 7364  H HA   . GLN A 1 13  ? 4.057   -14.581 1.165   1.00 0.00 ? 13  GLN A HA   6  
ATOM 7365  H HB2  . GLN A 1 13  ? 3.424   -16.258 -0.440  1.00 0.00 ? 13  GLN A HB2  6  
ATOM 7366  H HB3  . GLN A 1 13  ? 1.865   -15.488 -0.702  1.00 0.00 ? 13  GLN A HB3  6  
ATOM 7367  H HG2  . GLN A 1 13  ? 3.370   -13.450 -1.411  1.00 0.00 ? 13  GLN A HG2  6  
ATOM 7368  H HG3  . GLN A 1 13  ? 4.553   -14.724 -1.702  1.00 0.00 ? 13  GLN A HG3  6  
ATOM 7369  H HE21 . GLN A 1 13  ? 4.432   -14.104 -3.929  1.00 0.00 ? 13  GLN A HE21 6  
ATOM 7370  H HE22 . GLN A 1 13  ? 3.143   -14.686 -4.921  1.00 0.00 ? 13  GLN A HE22 6  
ATOM 7371  N N    . PRO A 1 14  ? 3.383   -12.234 0.571   1.00 0.00 ? 14  PRO A N    6  
ATOM 7372  C CA   . PRO A 1 14  ? 3.020   -10.818 0.460   1.00 0.00 ? 14  PRO A CA   6  
ATOM 7373  C C    . PRO A 1 14  ? 2.252   -10.516 -0.822  1.00 0.00 ? 14  PRO A C    6  
ATOM 7374  O O    . PRO A 1 14  ? 1.778   -11.426 -1.502  1.00 0.00 ? 14  PRO A O    6  
ATOM 7375  C CB   . PRO A 1 14  ? 4.374   -10.104 0.453   1.00 0.00 ? 14  PRO A CB   6  
ATOM 7376  C CG   . PRO A 1 14  ? 5.335   -11.119 -0.064  1.00 0.00 ? 14  PRO A CG   6  
ATOM 7377  C CD   . PRO A 1 14  ? 4.832   -12.450 0.422   1.00 0.00 ? 14  PRO A CD   6  
ATOM 7378  H HA   . PRO A 1 14  ? 2.442   -10.488 1.311   1.00 0.00 ? 14  PRO A HA   6  
ATOM 7379  H HB2  . PRO A 1 14  ? 4.325   -9.240  -0.195  1.00 0.00 ? 14  PRO A HB2  6  
ATOM 7380  H HB3  . PRO A 1 14  ? 4.628   -9.795  1.456   1.00 0.00 ? 14  PRO A HB3  6  
ATOM 7381  H HG2  . PRO A 1 14  ? 5.349   -11.095 -1.143  1.00 0.00 ? 14  PRO A HG2  6  
ATOM 7382  H HG3  . PRO A 1 14  ? 6.321   -10.924 0.330   1.00 0.00 ? 14  PRO A HG3  6  
ATOM 7383  H HD2  . PRO A 1 14  ? 5.034   -13.219 -0.309  1.00 0.00 ? 14  PRO A HD2  6  
ATOM 7384  H HD3  . PRO A 1 14  ? 5.284   -12.700 1.371   1.00 0.00 ? 14  PRO A HD3  6  
ATOM 7385  N N    . SER A 1 15  ? 2.133   -9.232  -1.147  1.00 0.00 ? 15  SER A N    6  
ATOM 7386  C CA   . SER A 1 15  ? 1.419   -8.810  -2.346  1.00 0.00 ? 15  SER A CA   6  
ATOM 7387  C C    . SER A 1 15  ? 2.265   -7.845  -3.171  1.00 0.00 ? 15  SER A C    6  
ATOM 7388  O O    . SER A 1 15  ? 3.033   -7.052  -2.626  1.00 0.00 ? 15  SER A O    6  
ATOM 7389  C CB   . SER A 1 15  ? 0.092   -8.149  -1.969  1.00 0.00 ? 15  SER A CB   6  
ATOM 7390  O OG   . SER A 1 15  ? -0.936  -9.114  -1.823  1.00 0.00 ? 15  SER A OG   6  
ATOM 7391  H H    . SER A 1 15  ? 2.533   -8.553  -0.564  1.00 0.00 ? 15  SER A H    6  
ATOM 7392  H HA   . SER A 1 15  ? 1.217   -9.690  -2.939  1.00 0.00 ? 15  SER A HA   6  
ATOM 7393  H HB2  . SER A 1 15  ? 0.209   -7.621  -1.035  1.00 0.00 ? 15  SER A HB2  6  
ATOM 7394  H HB3  . SER A 1 15  ? -0.192  -7.452  -2.744  1.00 0.00 ? 15  SER A HB3  6  
ATOM 7395  H HG   . SER A 1 15  ? -0.725  -9.888  -2.350  1.00 0.00 ? 15  SER A HG   6  
ATOM 7396  N N    . LYS A 1 16  ? 2.119   -7.918  -4.490  1.00 0.00 ? 16  LYS A N    6  
ATOM 7397  C CA   . LYS A 1 16  ? 2.868   -7.052  -5.392  1.00 0.00 ? 16  LYS A CA   6  
ATOM 7398  C C    . LYS A 1 16  ? 2.387   -5.608  -5.283  1.00 0.00 ? 16  LYS A C    6  
ATOM 7399  O O    . LYS A 1 16  ? 3.163   -4.669  -5.464  1.00 0.00 ? 16  LYS A O    6  
ATOM 7400  C CB   . LYS A 1 16  ? 2.725   -7.540  -6.836  1.00 0.00 ? 16  LYS A CB   6  
ATOM 7401  C CG   . LYS A 1 16  ? 3.402   -8.875  -7.095  1.00 0.00 ? 16  LYS A CG   6  
ATOM 7402  C CD   . LYS A 1 16  ? 3.216   -9.324  -8.535  1.00 0.00 ? 16  LYS A CD   6  
ATOM 7403  C CE   . LYS A 1 16  ? 3.640   -10.772 -8.727  1.00 0.00 ? 16  LYS A CE   6  
ATOM 7404  N NZ   . LYS A 1 16  ? 5.103   -10.953 -8.524  1.00 0.00 ? 16  LYS A NZ   6  
ATOM 7405  H H    . LYS A 1 16  ? 1.491   -8.571  -4.865  1.00 0.00 ? 16  LYS A H    6  
ATOM 7406  H HA   . LYS A 1 16  ? 3.908   -7.095  -5.107  1.00 0.00 ? 16  LYS A HA   6  
ATOM 7407  H HB2  . LYS A 1 16  ? 1.675   -7.641  -7.067  1.00 0.00 ? 16  LYS A HB2  6  
ATOM 7408  H HB3  . LYS A 1 16  ? 3.162   -6.805  -7.496  1.00 0.00 ? 16  LYS A HB3  6  
ATOM 7409  H HG2  . LYS A 1 16  ? 4.458   -8.779  -6.893  1.00 0.00 ? 16  LYS A HG2  6  
ATOM 7410  H HG3  . LYS A 1 16  ? 2.973   -9.619  -6.438  1.00 0.00 ? 16  LYS A HG3  6  
ATOM 7411  H HD2  . LYS A 1 16  ? 2.174   -9.227  -8.802  1.00 0.00 ? 16  LYS A HD2  6  
ATOM 7412  H HD3  . LYS A 1 16  ? 3.814   -8.694  -9.179  1.00 0.00 ? 16  LYS A HD3  6  
ATOM 7413  H HE2  . LYS A 1 16  ? 3.107   -11.386 -8.018  1.00 0.00 ? 16  LYS A HE2  6  
ATOM 7414  H HE3  . LYS A 1 16  ? 3.384   -11.078 -9.731  1.00 0.00 ? 16  LYS A HE3  6  
ATOM 7415  H HZ1  . LYS A 1 16  ? 5.338   -11.966 -8.499  1.00 0.00 ? 16  LYS A HZ1  6  
ATOM 7416  H HZ2  . LYS A 1 16  ? 5.395   -10.520 -7.624  1.00 0.00 ? 16  LYS A HZ2  6  
ATOM 7417  H HZ3  . LYS A 1 16  ? 5.631   -10.504 -9.299  1.00 0.00 ? 16  LYS A HZ3  6  
ATOM 7418  N N    . THR A 1 17  ? 1.103   -5.437  -4.985  1.00 0.00 ? 17  THR A N    6  
ATOM 7419  C CA   . THR A 1 17  ? 0.520   -4.108  -4.851  1.00 0.00 ? 17  THR A CA   6  
ATOM 7420  C C    . THR A 1 17  ? 0.359   -3.723  -3.385  1.00 0.00 ? 17  THR A C    6  
ATOM 7421  O O    . THR A 1 17  ? -0.317  -4.414  -2.622  1.00 0.00 ? 17  THR A O    6  
ATOM 7422  C CB   . THR A 1 17  ? -0.852  -4.024  -5.546  1.00 0.00 ? 17  THR A CB   6  
ATOM 7423  O OG1  . THR A 1 17  ? -0.806  -4.703  -6.806  1.00 0.00 ? 17  THR A OG1  6  
ATOM 7424  C CG2  . THR A 1 17  ? -1.263  -2.575  -5.759  1.00 0.00 ? 17  THR A CG2  6  
ATOM 7425  H H    . THR A 1 17  ? 0.536   -6.225  -4.852  1.00 0.00 ? 17  THR A H    6  
ATOM 7426  H HA   . THR A 1 17  ? 1.185   -3.403  -5.328  1.00 0.00 ? 17  THR A HA   6  
ATOM 7427  H HB   . THR A 1 17  ? -1.588  -4.503  -4.915  1.00 0.00 ? 17  THR A HB   6  
ATOM 7428  H HG1  . THR A 1 17  ? -1.645  -4.594  -7.259  1.00 0.00 ? 17  THR A HG1  6  
ATOM 7429  H HG21 . THR A 1 17  ? -0.905  -1.975  -4.936  1.00 0.00 ? 17  THR A HG21 6  
ATOM 7430  H HG22 . THR A 1 17  ? -2.340  -2.511  -5.810  1.00 0.00 ? 17  THR A HG22 6  
ATOM 7431  H HG23 . THR A 1 17  ? -0.836  -2.213  -6.682  1.00 0.00 ? 17  THR A HG23 6  
ATOM 7432  N N    . LEU A 1 18  ? 0.984   -2.617  -2.997  1.00 0.00 ? 18  LEU A N    6  
ATOM 7433  C CA   . LEU A 1 18  ? 0.909   -2.139  -1.620  1.00 0.00 ? 18  LEU A CA   6  
ATOM 7434  C C    . LEU A 1 18  ? -0.219  -1.125  -1.456  1.00 0.00 ? 18  LEU A C    6  
ATOM 7435  O O    . LEU A 1 18  ? -0.351  -0.194  -2.251  1.00 0.00 ? 18  LEU A O    6  
ATOM 7436  C CB   . LEU A 1 18  ? 2.240   -1.510  -1.205  1.00 0.00 ? 18  LEU A CB   6  
ATOM 7437  C CG   . LEU A 1 18  ? 3.337   -2.483  -0.773  1.00 0.00 ? 18  LEU A CG   6  
ATOM 7438  C CD1  . LEU A 1 18  ? 4.697   -1.803  -0.801  1.00 0.00 ? 18  LEU A CD1  6  
ATOM 7439  C CD2  . LEU A 1 18  ? 3.044   -3.035  0.615   1.00 0.00 ? 18  LEU A CD2  6  
ATOM 7440  H H    . LEU A 1 18  ? 1.508   -2.109  -3.650  1.00 0.00 ? 18  LEU A H    6  
ATOM 7441  H HA   . LEU A 1 18  ? 0.709   -2.989  -0.985  1.00 0.00 ? 18  LEU A HA   6  
ATOM 7442  H HB2  . LEU A 1 18  ? 2.614   -0.943  -2.044  1.00 0.00 ? 18  LEU A HB2  6  
ATOM 7443  H HB3  . LEU A 1 18  ? 2.045   -0.841  -0.379  1.00 0.00 ? 18  LEU A HB3  6  
ATOM 7444  H HG   . LEU A 1 18  ? 3.366   -3.314  -1.465  1.00 0.00 ? 18  LEU A HG   6  
ATOM 7445  H HD11 . LEU A 1 18  ? 5.473   -2.546  -0.705  1.00 0.00 ? 18  LEU A HD11 6  
ATOM 7446  H HD12 . LEU A 1 18  ? 4.765   -1.102  0.018   1.00 0.00 ? 18  LEU A HD12 6  
ATOM 7447  H HD13 . LEU A 1 18  ? 4.816   -1.276  -1.736  1.00 0.00 ? 18  LEU A HD13 6  
ATOM 7448  H HD21 . LEU A 1 18  ? 3.803   -3.755  0.884   1.00 0.00 ? 18  LEU A HD21 6  
ATOM 7449  H HD22 . LEU A 1 18  ? 2.076   -3.516  0.614   1.00 0.00 ? 18  LEU A HD22 6  
ATOM 7450  H HD23 . LEU A 1 18  ? 3.044   -2.227  1.331   1.00 0.00 ? 18  LEU A HD23 6  
ATOM 7451  N N    . PHE A 1 19  ? -1.029  -1.312  -0.420  1.00 0.00 ? 19  PHE A N    6  
ATOM 7452  C CA   . PHE A 1 19  ? -2.145  -0.413  -0.150  1.00 0.00 ? 19  PHE A CA   6  
ATOM 7453  C C    . PHE A 1 19  ? -1.683  0.804   0.646   1.00 0.00 ? 19  PHE A C    6  
ATOM 7454  O O    . PHE A 1 19  ? -1.146  0.674   1.746   1.00 0.00 ? 19  PHE A O    6  
ATOM 7455  C CB   . PHE A 1 19  ? -3.247  -1.149  0.615   1.00 0.00 ? 19  PHE A CB   6  
ATOM 7456  C CG   . PHE A 1 19  ? -4.446  -0.294  0.909   1.00 0.00 ? 19  PHE A CG   6  
ATOM 7457  C CD1  . PHE A 1 19  ? -5.025  0.476   -0.087  1.00 0.00 ? 19  PHE A CD1  6  
ATOM 7458  C CD2  . PHE A 1 19  ? -4.995  -0.261  2.181   1.00 0.00 ? 19  PHE A CD2  6  
ATOM 7459  C CE1  . PHE A 1 19  ? -6.128  1.264   0.181   1.00 0.00 ? 19  PHE A CE1  6  
ATOM 7460  C CE2  . PHE A 1 19  ? -6.098  0.525   2.455   1.00 0.00 ? 19  PHE A CE2  6  
ATOM 7461  C CZ   . PHE A 1 19  ? -6.666  1.288   1.453   1.00 0.00 ? 19  PHE A CZ   6  
ATOM 7462  H H    . PHE A 1 19  ? -0.872  -2.073  0.178   1.00 0.00 ? 19  PHE A H    6  
ATOM 7463  H HA   . PHE A 1 19  ? -2.538  -0.080  -1.098  1.00 0.00 ? 19  PHE A HA   6  
ATOM 7464  H HB2  . PHE A 1 19  ? -3.578  -1.994  0.032   1.00 0.00 ? 19  PHE A HB2  6  
ATOM 7465  H HB3  . PHE A 1 19  ? -2.849  -1.499  1.556   1.00 0.00 ? 19  PHE A HB3  6  
ATOM 7466  H HD1  . PHE A 1 19  ? -4.606  0.458   -1.082  1.00 0.00 ? 19  PHE A HD1  6  
ATOM 7467  H HD2  . PHE A 1 19  ? -4.551  -0.857  2.966   1.00 0.00 ? 19  PHE A HD2  6  
ATOM 7468  H HE1  . PHE A 1 19  ? -6.571  1.859   -0.603  1.00 0.00 ? 19  PHE A HE1  6  
ATOM 7469  H HE2  . PHE A 1 19  ? -6.516  0.541   3.451   1.00 0.00 ? 19  PHE A HE2  6  
ATOM 7470  H HZ   . PHE A 1 19  ? -7.528  1.903   1.665   1.00 0.00 ? 19  PHE A HZ   6  
ATOM 7471  N N    . VAL A 1 20  ? -1.896  1.989   0.081   1.00 0.00 ? 20  VAL A N    6  
ATOM 7472  C CA   . VAL A 1 20  ? -1.502  3.230   0.737   1.00 0.00 ? 20  VAL A CA   6  
ATOM 7473  C C    . VAL A 1 20  ? -2.723  4.022   1.192   1.00 0.00 ? 20  VAL A C    6  
ATOM 7474  O O    . VAL A 1 20  ? -3.509  4.499   0.373   1.00 0.00 ? 20  VAL A O    6  
ATOM 7475  C CB   . VAL A 1 20  ? -0.651  4.112   -0.196  1.00 0.00 ? 20  VAL A CB   6  
ATOM 7476  C CG1  . VAL A 1 20  ? -0.204  5.375   0.525   1.00 0.00 ? 20  VAL A CG1  6  
ATOM 7477  C CG2  . VAL A 1 20  ? 0.547   3.333   -0.718  1.00 0.00 ? 20  VAL A CG2  6  
ATOM 7478  H H    . VAL A 1 20  ? -2.328  2.028   -0.798  1.00 0.00 ? 20  VAL A H    6  
ATOM 7479  H HA   . VAL A 1 20  ? -0.906  2.977   1.601   1.00 0.00 ? 20  VAL A HA   6  
ATOM 7480  H HB   . VAL A 1 20  ? -1.260  4.402   -1.039  1.00 0.00 ? 20  VAL A HB   6  
ATOM 7481  H HG11 . VAL A 1 20  ? 0.854   5.525   0.364   1.00 0.00 ? 20  VAL A HG11 6  
ATOM 7482  H HG12 . VAL A 1 20  ? -0.751  6.222   0.140   1.00 0.00 ? 20  VAL A HG12 6  
ATOM 7483  H HG13 . VAL A 1 20  ? -0.395  5.272   1.583   1.00 0.00 ? 20  VAL A HG13 6  
ATOM 7484  H HG21 . VAL A 1 20  ? 1.132   3.967   -1.368  1.00 0.00 ? 20  VAL A HG21 6  
ATOM 7485  H HG22 . VAL A 1 20  ? 1.157   3.010   0.113   1.00 0.00 ? 20  VAL A HG22 6  
ATOM 7486  H HG23 . VAL A 1 20  ? 0.204   2.470   -1.268  1.00 0.00 ? 20  VAL A HG23 6  
ATOM 7487  N N    . LYS A 1 21  ? -2.877  4.158   2.505   1.00 0.00 ? 21  LYS A N    6  
ATOM 7488  C CA   . LYS A 1 21  ? -4.001  4.894   3.071   1.00 0.00 ? 21  LYS A CA   6  
ATOM 7489  C C    . LYS A 1 21  ? -3.513  6.039   3.953   1.00 0.00 ? 21  LYS A C    6  
ATOM 7490  O O    . LYS A 1 21  ? -2.517  5.907   4.663   1.00 0.00 ? 21  LYS A O    6  
ATOM 7491  C CB   . LYS A 1 21  ? -4.893  3.954   3.885   1.00 0.00 ? 21  LYS A CB   6  
ATOM 7492  C CG   . LYS A 1 21  ? -4.207  3.370   5.108   1.00 0.00 ? 21  LYS A CG   6  
ATOM 7493  C CD   . LYS A 1 21  ? -5.155  2.501   5.918   1.00 0.00 ? 21  LYS A CD   6  
ATOM 7494  C CE   . LYS A 1 21  ? -4.590  2.197   7.297   1.00 0.00 ? 21  LYS A CE   6  
ATOM 7495  N NZ   . LYS A 1 21  ? -4.533  3.414   8.154   1.00 0.00 ? 21  LYS A NZ   6  
ATOM 7496  H H    . LYS A 1 21  ? -2.217  3.755   3.107   1.00 0.00 ? 21  LYS A H    6  
ATOM 7497  H HA   . LYS A 1 21  ? -4.575  5.304   2.254   1.00 0.00 ? 21  LYS A HA   6  
ATOM 7498  H HB2  . LYS A 1 21  ? -5.765  4.500   4.214   1.00 0.00 ? 21  LYS A HB2  6  
ATOM 7499  H HB3  . LYS A 1 21  ? -5.209  3.138   3.251   1.00 0.00 ? 21  LYS A HB3  6  
ATOM 7500  H HG2  . LYS A 1 21  ? -3.370  2.769   4.787   1.00 0.00 ? 21  LYS A HG2  6  
ATOM 7501  H HG3  . LYS A 1 21  ? -3.853  4.179   5.731   1.00 0.00 ? 21  LYS A HG3  6  
ATOM 7502  H HD2  . LYS A 1 21  ? -6.095  3.019   6.032   1.00 0.00 ? 21  LYS A HD2  6  
ATOM 7503  H HD3  . LYS A 1 21  ? -5.315  1.571   5.391   1.00 0.00 ? 21  LYS A HD3  6  
ATOM 7504  H HE2  . LYS A 1 21  ? -5.219  1.461   7.774   1.00 0.00 ? 21  LYS A HE2  6  
ATOM 7505  H HE3  . LYS A 1 21  ? -3.593  1.799   7.184   1.00 0.00 ? 21  LYS A HE3  6  
ATOM 7506  H HZ1  . LYS A 1 21  ? -4.621  3.150   9.156   1.00 0.00 ? 21  LYS A HZ1  6  
ATOM 7507  H HZ2  . LYS A 1 21  ? -5.309  4.061   7.908   1.00 0.00 ? 21  LYS A HZ2  6  
ATOM 7508  H HZ3  . LYS A 1 21  ? -3.628  3.907   8.014   1.00 0.00 ? 21  LYS A HZ3  6  
ATOM 7509  N N    . GLY A 1 22  ? -4.223  7.162   3.904   1.00 0.00 ? 22  GLY A N    6  
ATOM 7510  C CA   . GLY A 1 22  ? -3.847  8.313   4.704   1.00 0.00 ? 22  GLY A CA   6  
ATOM 7511  C C    . GLY A 1 22  ? -3.228  9.420   3.873   1.00 0.00 ? 22  GLY A C    6  
ATOM 7512  O O    . GLY A 1 22  ? -2.382  10.172  4.358   1.00 0.00 ? 22  GLY A O    6  
ATOM 7513  H H    . GLY A 1 22  ? -5.008  7.210   3.319   1.00 0.00 ? 22  GLY A H    6  
ATOM 7514  H HA2  . GLY A 1 22  ? -4.726  8.697   5.198   1.00 0.00 ? 22  GLY A HA2  6  
ATOM 7515  H HA3  . GLY A 1 22  ? -3.133  7.999   5.452   1.00 0.00 ? 22  GLY A HA3  6  
ATOM 7516  N N    . LEU A 1 23  ? -3.649  9.520   2.617   1.00 0.00 ? 23  LEU A N    6  
ATOM 7517  C CA   . LEU A 1 23  ? -3.130  10.542  1.715   1.00 0.00 ? 23  LEU A CA   6  
ATOM 7518  C C    . LEU A 1 23  ? -3.979  11.808  1.780   1.00 0.00 ? 23  LEU A C    6  
ATOM 7519  O O    . LEU A 1 23  ? -5.012  11.841  2.449   1.00 0.00 ? 23  LEU A O    6  
ATOM 7520  C CB   . LEU A 1 23  ? -3.092  10.013  0.280   1.00 0.00 ? 23  LEU A CB   6  
ATOM 7521  C CG   . LEU A 1 23  ? -2.202  8.793   0.038   1.00 0.00 ? 23  LEU A CG   6  
ATOM 7522  C CD1  . LEU A 1 23  ? -2.409  8.252   -1.368  1.00 0.00 ? 23  LEU A CD1  6  
ATOM 7523  C CD2  . LEU A 1 23  ? -0.739  9.147   0.265   1.00 0.00 ? 23  LEU A CD2  6  
ATOM 7524  H H    . LEU A 1 23  ? -4.325  8.892   2.287   1.00 0.00 ? 23  LEU A H    6  
ATOM 7525  H HA   . LEU A 1 23  ? -2.125  10.781  2.029   1.00 0.00 ? 23  LEU A HA   6  
ATOM 7526  H HB2  . LEU A 1 23  ? -4.099  9.748   -0.001  1.00 0.00 ? 23  LEU A HB2  6  
ATOM 7527  H HB3  . LEU A 1 23  ? -2.740  10.812  -0.357  1.00 0.00 ? 23  LEU A HB3  6  
ATOM 7528  H HG   . LEU A 1 23  ? -2.471  8.014   0.738   1.00 0.00 ? 23  LEU A HG   6  
ATOM 7529  H HD11 . LEU A 1 23  ? -2.897  7.291   -1.315  1.00 0.00 ? 23  LEU A HD11 6  
ATOM 7530  H HD12 . LEU A 1 23  ? -1.452  8.144   -1.857  1.00 0.00 ? 23  LEU A HD12 6  
ATOM 7531  H HD13 . LEU A 1 23  ? -3.025  8.939   -1.931  1.00 0.00 ? 23  LEU A HD13 6  
ATOM 7532  H HD21 . LEU A 1 23  ? -0.368  9.702   -0.584  1.00 0.00 ? 23  LEU A HD21 6  
ATOM 7533  H HD22 . LEU A 1 23  ? -0.163  8.240   0.382   1.00 0.00 ? 23  LEU A HD22 6  
ATOM 7534  H HD23 . LEU A 1 23  ? -0.649  9.749   1.157   1.00 0.00 ? 23  LEU A HD23 6  
ATOM 7535  N N    . SER A 1 24  ? -3.537  12.847  1.079   1.00 0.00 ? 24  SER A N    6  
ATOM 7536  C CA   . SER A 1 24  ? -4.255  14.116  1.058   1.00 0.00 ? 24  SER A CA   6  
ATOM 7537  C C    . SER A 1 24  ? -5.131  14.224  -0.186  1.00 0.00 ? 24  SER A C    6  
ATOM 7538  O O    . SER A 1 24  ? -4.734  13.811  -1.275  1.00 0.00 ? 24  SER A O    6  
ATOM 7539  C CB   . SER A 1 24  ? -3.270  15.285  1.105   1.00 0.00 ? 24  SER A CB   6  
ATOM 7540  O OG   . SER A 1 24  ? -3.935  16.502  1.397   1.00 0.00 ? 24  SER A OG   6  
ATOM 7541  H H    . SER A 1 24  ? -2.707  12.759  0.566   1.00 0.00 ? 24  SER A H    6  
ATOM 7542  H HA   . SER A 1 24  ? -4.887  14.154  1.933   1.00 0.00 ? 24  SER A HA   6  
ATOM 7543  H HB2  . SER A 1 24  ? -2.531  15.100  1.870   1.00 0.00 ? 24  SER A HB2  6  
ATOM 7544  H HB3  . SER A 1 24  ? -2.779  15.377  0.146   1.00 0.00 ? 24  SER A HB3  6  
ATOM 7545  H HG   . SER A 1 24  ? -3.829  16.710  2.328   1.00 0.00 ? 24  SER A HG   6  
ATOM 7546  N N    . GLU A 1 25  ? -6.326  14.782  -0.015  1.00 0.00 ? 25  GLU A N    6  
ATOM 7547  C CA   . GLU A 1 25  ? -7.259  14.944  -1.124  1.00 0.00 ? 25  GLU A CA   6  
ATOM 7548  C C    . GLU A 1 25  ? -6.538  15.441  -2.374  1.00 0.00 ? 25  GLU A C    6  
ATOM 7549  O O    . GLU A 1 25  ? -7.011  15.250  -3.494  1.00 0.00 ? 25  GLU A O    6  
ATOM 7550  C CB   . GLU A 1 25  ? -8.374  15.919  -0.743  1.00 0.00 ? 25  GLU A CB   6  
ATOM 7551  C CG   . GLU A 1 25  ? -7.889  17.343  -0.525  1.00 0.00 ? 25  GLU A CG   6  
ATOM 7552  C CD   . GLU A 1 25  ? -9.023  18.307  -0.234  1.00 0.00 ? 25  GLU A CD   6  
ATOM 7553  O OE1  . GLU A 1 25  ? -9.661  18.782  -1.197  1.00 0.00 ? 25  GLU A OE1  6  
ATOM 7554  O OE2  . GLU A 1 25  ? -9.273  18.586  0.957   1.00 0.00 ? 25  GLU A OE2  6  
ATOM 7555  H H    . GLU A 1 25  ? -6.585  15.092  0.878   1.00 0.00 ? 25  GLU A H    6  
ATOM 7556  H HA   . GLU A 1 25  ? -7.694  13.978  -1.335  1.00 0.00 ? 25  GLU A HA   6  
ATOM 7557  H HB2  . GLU A 1 25  ? -9.113  15.929  -1.531  1.00 0.00 ? 25  GLU A HB2  6  
ATOM 7558  H HB3  . GLU A 1 25  ? -8.839  15.576  0.169   1.00 0.00 ? 25  GLU A HB3  6  
ATOM 7559  H HG2  . GLU A 1 25  ? -7.206  17.353  0.311   1.00 0.00 ? 25  GLU A HG2  6  
ATOM 7560  H HG3  . GLU A 1 25  ? -7.374  17.674  -1.414  1.00 0.00 ? 25  GLU A HG3  6  
ATOM 7561  N N    . ASP A 1 26  ? -5.391  16.080  -2.172  1.00 0.00 ? 26  ASP A N    6  
ATOM 7562  C CA   . ASP A 1 26  ? -4.603  16.605  -3.282  1.00 0.00 ? 26  ASP A CA   6  
ATOM 7563  C C    . ASP A 1 26  ? -3.555  15.592  -3.732  1.00 0.00 ? 26  ASP A C    6  
ATOM 7564  O O    . ASP A 1 26  ? -3.188  15.542  -4.906  1.00 0.00 ? 26  ASP A O    6  
ATOM 7565  C CB   . ASP A 1 26  ? -3.924  17.915  -2.878  1.00 0.00 ? 26  ASP A CB   6  
ATOM 7566  C CG   . ASP A 1 26  ? -4.912  18.948  -2.373  1.00 0.00 ? 26  ASP A CG   6  
ATOM 7567  O OD1  . ASP A 1 26  ? -5.319  18.853  -1.196  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 7568  O OD2  . ASP A 1 26  ? -5.278  19.851  -3.154  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 7569  H H    . ASP A 1 26  ? -5.065  16.201  -1.255  1.00 0.00 ? 26  ASP A H    6  
ATOM 7570  H HA   . ASP A 1 26  ? -5.276  16.798  -4.104  1.00 0.00 ? 26  ASP A HA   6  
ATOM 7571  H HB2  . ASP A 1 26  ? -3.208  17.715  -2.094  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 7572  H HB3  . ASP A 1 26  ? -3.408  18.324  -3.734  1.00 0.00 ? 26  ASP A HB3  6  
ATOM 7573  N N    . THR A 1 27  ? -3.076  14.785  -2.790  1.00 0.00 ? 27  THR A N    6  
ATOM 7574  C CA   . THR A 1 27  ? -2.069  13.775  -3.088  1.00 0.00 ? 27  THR A CA   6  
ATOM 7575  C C    . THR A 1 27  ? -2.367  13.076  -4.410  1.00 0.00 ? 27  THR A C    6  
ATOM 7576  O O    . THR A 1 27  ? -3.346  12.338  -4.527  1.00 0.00 ? 27  THR A O    6  
ATOM 7577  C CB   . THR A 1 27  ? -1.984  12.719  -1.970  1.00 0.00 ? 27  THR A CB   6  
ATOM 7578  O OG1  . THR A 1 27  ? -1.541  13.330  -0.753  1.00 0.00 ? 27  THR A OG1  6  
ATOM 7579  C CG2  . THR A 1 27  ? -1.032  11.598  -2.356  1.00 0.00 ? 27  THR A CG2  6  
ATOM 7580  H H    . THR A 1 27  ? -3.409  14.874  -1.872  1.00 0.00 ? 27  THR A H    6  
ATOM 7581  H HA   . THR A 1 27  ? -1.112  14.270  -3.162  1.00 0.00 ? 27  THR A HA   6  
ATOM 7582  H HB   . THR A 1 27  ? -2.968  12.300  -1.816  1.00 0.00 ? 27  THR A HB   6  
ATOM 7583  H HG1  . THR A 1 27  ? -0.808  13.922  -0.940  1.00 0.00 ? 27  THR A HG1  6  
ATOM 7584  H HG21 . THR A 1 27  ? -0.315  11.444  -1.562  1.00 0.00 ? 27  THR A HG21 6  
ATOM 7585  H HG22 . THR A 1 27  ? -0.512  11.864  -3.264  1.00 0.00 ? 27  THR A HG22 6  
ATOM 7586  H HG23 . THR A 1 27  ? -1.592  10.689  -2.515  1.00 0.00 ? 27  THR A HG23 6  
ATOM 7587  N N    . THR A 1 28  ? -1.516  13.311  -5.404  1.00 0.00 ? 28  THR A N    6  
ATOM 7588  C CA   . THR A 1 28  ? -1.689  12.704  -6.717  1.00 0.00 ? 28  THR A CA   6  
ATOM 7589  C C    . THR A 1 28  ? -0.885  11.414  -6.837  1.00 0.00 ? 28  THR A C    6  
ATOM 7590  O O    . THR A 1 28  ? 0.001   11.148  -6.026  1.00 0.00 ? 28  THR A O    6  
ATOM 7591  C CB   . THR A 1 28  ? -1.262  13.667  -7.842  1.00 0.00 ? 28  THR A CB   6  
ATOM 7592  O OG1  . THR A 1 28  ? 0.090   14.093  -7.635  1.00 0.00 ? 28  THR A OG1  6  
ATOM 7593  C CG2  . THR A 1 28  ? -2.179  14.880  -7.893  1.00 0.00 ? 28  THR A CG2  6  
ATOM 7594  H H    . THR A 1 28  ? -0.755  13.909  -5.248  1.00 0.00 ? 28  THR A H    6  
ATOM 7595  H HA   . THR A 1 28  ? -2.737  12.477  -6.845  1.00 0.00 ? 28  THR A HA   6  
ATOM 7596  H HB   . THR A 1 28  ? -1.327  13.145  -8.786  1.00 0.00 ? 28  THR A HB   6  
ATOM 7597  H HG1  . THR A 1 28  ? 0.229   14.938  -8.069  1.00 0.00 ? 28  THR A HG1  6  
ATOM 7598  H HG21 . THR A 1 28  ? -2.090  15.437  -6.972  1.00 0.00 ? 28  THR A HG21 6  
ATOM 7599  H HG22 . THR A 1 28  ? -3.200  14.553  -8.019  1.00 0.00 ? 28  THR A HG22 6  
ATOM 7600  H HG23 . THR A 1 28  ? -1.896  15.509  -8.723  1.00 0.00 ? 28  THR A HG23 6  
ATOM 7601  N N    . GLU A 1 29  ? -1.202  10.617  -7.853  1.00 0.00 ? 29  GLU A N    6  
ATOM 7602  C CA   . GLU A 1 29  ? -0.508  9.354   -8.077  1.00 0.00 ? 29  GLU A CA   6  
ATOM 7603  C C    . GLU A 1 29  ? 0.972   9.590   -8.367  1.00 0.00 ? 29  GLU A C    6  
ATOM 7604  O O    . GLU A 1 29  ? 1.798   8.694   -8.199  1.00 0.00 ? 29  GLU A O    6  
ATOM 7605  C CB   . GLU A 1 29  ? -1.151  8.592   -9.237  1.00 0.00 ? 29  GLU A CB   6  
ATOM 7606  C CG   . GLU A 1 29  ? -2.657  8.435   -9.102  1.00 0.00 ? 29  GLU A CG   6  
ATOM 7607  C CD   . GLU A 1 29  ? -3.349  8.278   -10.441 1.00 0.00 ? 29  GLU A CD   6  
ATOM 7608  O OE1  . GLU A 1 29  ? -3.183  7.215   -11.075 1.00 0.00 ? 29  GLU A OE1  6  
ATOM 7609  O OE2  . GLU A 1 29  ? -4.058  9.219   -10.856 1.00 0.00 ? 29  GLU A OE2  6  
ATOM 7610  H H    . GLU A 1 29  ? -1.918  10.885  -8.465  1.00 0.00 ? 29  GLU A H    6  
ATOM 7611  H HA   . GLU A 1 29  ? -0.596  8.764   -7.177  1.00 0.00 ? 29  GLU A HA   6  
ATOM 7612  H HB2  . GLU A 1 29  ? -0.946  9.120   -10.157 1.00 0.00 ? 29  GLU A HB2  6  
ATOM 7613  H HB3  . GLU A 1 29  ? -0.712  7.607   -9.292  1.00 0.00 ? 29  GLU A HB3  6  
ATOM 7614  H HG2  . GLU A 1 29  ? -2.862  7.561   -8.503  1.00 0.00 ? 29  GLU A HG2  6  
ATOM 7615  H HG3  . GLU A 1 29  ? -3.054  9.310   -8.608  1.00 0.00 ? 29  GLU A HG3  6  
ATOM 7616  N N    . GLU A 1 30  ? 1.297   10.803  -8.804  1.00 0.00 ? 30  GLU A N    6  
ATOM 7617  C CA   . GLU A 1 30  ? 2.676   11.156  -9.119  1.00 0.00 ? 30  GLU A CA   6  
ATOM 7618  C C    . GLU A 1 30  ? 3.526   11.212  -7.852  1.00 0.00 ? 30  GLU A C    6  
ATOM 7619  O O    . GLU A 1 30  ? 4.607   10.625  -7.789  1.00 0.00 ? 30  GLU A O    6  
ATOM 7620  C CB   . GLU A 1 30  ? 2.729   12.504  -9.842  1.00 0.00 ? 30  GLU A CB   6  
ATOM 7621  C CG   . GLU A 1 30  ? 2.646   12.386  -11.354 1.00 0.00 ? 30  GLU A CG   6  
ATOM 7622  C CD   . GLU A 1 30  ? 2.502   13.732  -12.037 1.00 0.00 ? 30  GLU A CD   6  
ATOM 7623  O OE1  . GLU A 1 30  ? 3.447   14.544  -11.955 1.00 0.00 ? 30  GLU A OE1  6  
ATOM 7624  O OE2  . GLU A 1 30  ? 1.443   13.974  -12.653 1.00 0.00 ? 30  GLU A OE2  6  
ATOM 7625  H H    . GLU A 1 30  ? 0.593   11.475  -8.917  1.00 0.00 ? 30  GLU A H    6  
ATOM 7626  H HA   . GLU A 1 30  ? 3.073   10.393  -9.770  1.00 0.00 ? 30  GLU A HA   6  
ATOM 7627  H HB2  . GLU A 1 30  ? 1.904   13.113  -9.503  1.00 0.00 ? 30  GLU A HB2  6  
ATOM 7628  H HB3  . GLU A 1 30  ? 3.656   12.997  -9.590  1.00 0.00 ? 30  GLU A HB3  6  
ATOM 7629  H HG2  . GLU A 1 30  ? 3.546   11.912  -11.715 1.00 0.00 ? 30  GLU A HG2  6  
ATOM 7630  H HG3  . GLU A 1 30  ? 1.792   11.776  -11.609 1.00 0.00 ? 30  GLU A HG3  6  
ATOM 7631  N N    . THR A 1 31  ? 3.031   11.925  -6.845  1.00 0.00 ? 31  THR A N    6  
ATOM 7632  C CA   . THR A 1 31  ? 3.744   12.060  -5.581  1.00 0.00 ? 31  THR A CA   6  
ATOM 7633  C C    . THR A 1 31  ? 3.626   10.791  -4.745  1.00 0.00 ? 31  THR A C    6  
ATOM 7634  O O    . THR A 1 31  ? 4.393   10.583  -3.804  1.00 0.00 ? 31  THR A O    6  
ATOM 7635  C CB   . THR A 1 31  ? 3.213   13.252  -4.762  1.00 0.00 ? 31  THR A CB   6  
ATOM 7636  O OG1  . THR A 1 31  ? 4.227   13.720  -3.865  1.00 0.00 ? 31  THR A OG1  6  
ATOM 7637  C CG2  . THR A 1 31  ? 1.974   12.858  -3.973  1.00 0.00 ? 31  THR A CG2  6  
ATOM 7638  H H    . THR A 1 31  ? 2.165   12.370  -6.957  1.00 0.00 ? 31  THR A H    6  
ATOM 7639  H HA   . THR A 1 31  ? 4.786   12.239  -5.804  1.00 0.00 ? 31  THR A HA   6  
ATOM 7640  H HB   . THR A 1 31  ? 2.950   14.049  -5.443  1.00 0.00 ? 31  THR A HB   6  
ATOM 7641  H HG1  . THR A 1 31  ? 4.704   12.970  -3.502  1.00 0.00 ? 31  THR A HG1  6  
ATOM 7642  H HG21 . THR A 1 31  ? 1.251   13.659  -4.013  1.00 0.00 ? 31  THR A HG21 6  
ATOM 7643  H HG22 . THR A 1 31  ? 2.246   12.669  -2.945  1.00 0.00 ? 31  THR A HG22 6  
ATOM 7644  H HG23 . THR A 1 31  ? 1.544   11.965  -4.402  1.00 0.00 ? 31  THR A HG23 6  
ATOM 7645  N N    . LEU A 1 32  ? 2.664   9.945   -5.094  1.00 0.00 ? 32  LEU A N    6  
ATOM 7646  C CA   . LEU A 1 32  ? 2.447   8.694   -4.376  1.00 0.00 ? 32  LEU A CA   6  
ATOM 7647  C C    . LEU A 1 32  ? 3.398   7.610   -4.870  1.00 0.00 ? 32  LEU A C    6  
ATOM 7648  O O    . LEU A 1 32  ? 3.865   6.776   -4.094  1.00 0.00 ? 32  LEU A O    6  
ATOM 7649  C CB   . LEU A 1 32  ? 0.998   8.232   -4.542  1.00 0.00 ? 32  LEU A CB   6  
ATOM 7650  C CG   . LEU A 1 32  ? 0.639   6.899   -3.886  1.00 0.00 ? 32  LEU A CG   6  
ATOM 7651  C CD1  . LEU A 1 32  ? 0.747   7.002   -2.372  1.00 0.00 ? 32  LEU A CD1  6  
ATOM 7652  C CD2  . LEU A 1 32  ? -0.760  6.463   -4.294  1.00 0.00 ? 32  LEU A CD2  6  
ATOM 7653  H H    . LEU A 1 32  ? 2.085   10.166  -5.853  1.00 0.00 ? 32  LEU A H    6  
ATOM 7654  H HA   . LEU A 1 32  ? 2.640   8.876   -3.329  1.00 0.00 ? 32  LEU A HA   6  
ATOM 7655  H HB2  . LEU A 1 32  ? 0.358   8.991   -4.119  1.00 0.00 ? 32  LEU A HB2  6  
ATOM 7656  H HB3  . LEU A 1 32  ? 0.799   8.146   -5.601  1.00 0.00 ? 32  LEU A HB3  6  
ATOM 7657  H HG   . LEU A 1 32  ? 1.336   6.142   -4.218  1.00 0.00 ? 32  LEU A HG   6  
ATOM 7658  H HD11 . LEU A 1 32  ? 0.036   6.331   -1.914  1.00 0.00 ? 32  LEU A HD11 6  
ATOM 7659  H HD12 . LEU A 1 32  ? 0.535   8.016   -2.065  1.00 0.00 ? 32  LEU A HD12 6  
ATOM 7660  H HD13 . LEU A 1 32  ? 1.746   6.734   -2.063  1.00 0.00 ? 32  LEU A HD13 6  
ATOM 7661  H HD21 . LEU A 1 32  ? -1.119  7.102   -5.088  1.00 0.00 ? 32  LEU A HD21 6  
ATOM 7662  H HD22 . LEU A 1 32  ? -1.423  6.538   -3.444  1.00 0.00 ? 32  LEU A HD22 6  
ATOM 7663  H HD23 . LEU A 1 32  ? -0.732  5.440   -4.641  1.00 0.00 ? 32  LEU A HD23 6  
ATOM 7664  N N    . LYS A 1 33  ? 3.683   7.627   -6.168  1.00 0.00 ? 33  LYS A N    6  
ATOM 7665  C CA   . LYS A 1 33  ? 4.582   6.648   -6.768  1.00 0.00 ? 33  LYS A CA   6  
ATOM 7666  C C    . LYS A 1 33  ? 6.021   6.886   -6.321  1.00 0.00 ? 33  LYS A C    6  
ATOM 7667  O O    . LYS A 1 33  ? 6.660   5.998   -5.758  1.00 0.00 ? 33  LYS A O    6  
ATOM 7668  C CB   . LYS A 1 33  ? 4.493   6.712   -8.294  1.00 0.00 ? 33  LYS A CB   6  
ATOM 7669  C CG   . LYS A 1 33  ? 5.070   5.490   -8.988  1.00 0.00 ? 33  LYS A CG   6  
ATOM 7670  C CD   . LYS A 1 33  ? 5.547   5.820   -10.393 1.00 0.00 ? 33  LYS A CD   6  
ATOM 7671  C CE   . LYS A 1 33  ? 6.537   4.784   -10.903 1.00 0.00 ? 33  LYS A CE   6  
ATOM 7672  N NZ   . LYS A 1 33  ? 7.930   5.092   -10.478 1.00 0.00 ? 33  LYS A NZ   6  
ATOM 7673  H H    . LYS A 1 33  ? 3.280   8.317   -6.737  1.00 0.00 ? 33  LYS A H    6  
ATOM 7674  H HA   . LYS A 1 33  ? 4.273   5.668   -6.438  1.00 0.00 ? 33  LYS A HA   6  
ATOM 7675  H HB2  . LYS A 1 33  ? 3.456   6.805   -8.579  1.00 0.00 ? 33  LYS A HB2  6  
ATOM 7676  H HB3  . LYS A 1 33  ? 5.032   7.583   -8.638  1.00 0.00 ? 33  LYS A HB3  6  
ATOM 7677  H HG2  . LYS A 1 33  ? 5.907   5.122   -8.413  1.00 0.00 ? 33  LYS A HG2  6  
ATOM 7678  H HG3  . LYS A 1 33  ? 4.307   4.727   -9.047  1.00 0.00 ? 33  LYS A HG3  6  
ATOM 7679  H HD2  . LYS A 1 33  ? 4.695   5.845   -11.056 1.00 0.00 ? 33  LYS A HD2  6  
ATOM 7680  H HD3  . LYS A 1 33  ? 6.026   6.789   -10.383 1.00 0.00 ? 33  LYS A HD3  6  
ATOM 7681  H HE2  . LYS A 1 33  ? 6.257   3.816   -10.516 1.00 0.00 ? 33  LYS A HE2  6  
ATOM 7682  H HE3  . LYS A 1 33  ? 6.494   4.766   -11.982 1.00 0.00 ? 33  LYS A HE3  6  
ATOM 7683  H HZ1  . LYS A 1 33  ? 8.043   4.903   -9.461  1.00 0.00 ? 33  LYS A HZ1  6  
ATOM 7684  H HZ2  . LYS A 1 33  ? 8.147   6.093   -10.659 1.00 0.00 ? 33  LYS A HZ2  6  
ATOM 7685  H HZ3  . LYS A 1 33  ? 8.604   4.501   -11.006 1.00 0.00 ? 33  LYS A HZ3  6  
ATOM 7686  N N    . GLU A 1 34  ? 6.524   8.090   -6.576  1.00 0.00 ? 34  GLU A N    6  
ATOM 7687  C CA   . GLU A 1 34  ? 7.888   8.443   -6.199  1.00 0.00 ? 34  GLU A CA   6  
ATOM 7688  C C    . GLU A 1 34  ? 8.174   8.043   -4.754  1.00 0.00 ? 34  GLU A C    6  
ATOM 7689  O O    . GLU A 1 34  ? 9.233   7.497   -4.448  1.00 0.00 ? 34  GLU A O    6  
ATOM 7690  C CB   . GLU A 1 34  ? 8.118   9.945   -6.379  1.00 0.00 ? 34  GLU A CB   6  
ATOM 7691  C CG   . GLU A 1 34  ? 8.127   10.389  -7.832  1.00 0.00 ? 34  GLU A CG   6  
ATOM 7692  C CD   . GLU A 1 34  ? 9.318   9.850   -8.600  1.00 0.00 ? 34  GLU A CD   6  
ATOM 7693  O OE1  . GLU A 1 34  ? 10.382  10.502  -8.580  1.00 0.00 ? 34  GLU A OE1  6  
ATOM 7694  O OE2  . GLU A 1 34  ? 9.185   8.774   -9.221  1.00 0.00 ? 34  GLU A OE2  6  
ATOM 7695  H H    . GLU A 1 34  ? 5.965   8.756   -7.028  1.00 0.00 ? 34  GLU A H    6  
ATOM 7696  H HA   . GLU A 1 34  ? 8.561   7.905   -6.848  1.00 0.00 ? 34  GLU A HA   6  
ATOM 7697  H HB2  . GLU A 1 34  ? 7.334   10.481  -5.864  1.00 0.00 ? 34  GLU A HB2  6  
ATOM 7698  H HB3  . GLU A 1 34  ? 9.069   10.206  -5.939  1.00 0.00 ? 34  GLU A HB3  6  
ATOM 7699  H HG2  . GLU A 1 34  ? 7.223   10.039  -8.308  1.00 0.00 ? 34  GLU A HG2  6  
ATOM 7700  H HG3  . GLU A 1 34  ? 8.154   11.468  -7.865  1.00 0.00 ? 34  GLU A HG3  6  
ATOM 7701  N N    . SER A 1 35  ? 7.220   8.320   -3.870  1.00 0.00 ? 35  SER A N    6  
ATOM 7702  C CA   . SER A 1 35  ? 7.371   7.994   -2.457  1.00 0.00 ? 35  SER A CA   6  
ATOM 7703  C C    . SER A 1 35  ? 8.030   6.630   -2.281  1.00 0.00 ? 35  SER A C    6  
ATOM 7704  O O    . SER A 1 35  ? 8.774   6.405   -1.325  1.00 0.00 ? 35  SER A O    6  
ATOM 7705  C CB   . SER A 1 35  ? 6.008   8.008   -1.761  1.00 0.00 ? 35  SER A CB   6  
ATOM 7706  O OG   . SER A 1 35  ? 5.497   9.326   -1.667  1.00 0.00 ? 35  SER A OG   6  
ATOM 7707  H H    . SER A 1 35  ? 6.398   8.757   -4.176  1.00 0.00 ? 35  SER A H    6  
ATOM 7708  H HA   . SER A 1 35  ? 8.002   8.747   -2.008  1.00 0.00 ? 35  SER A HA   6  
ATOM 7709  H HB2  . SER A 1 35  ? 5.313   7.405   -2.324  1.00 0.00 ? 35  SER A HB2  6  
ATOM 7710  H HB3  . SER A 1 35  ? 6.112   7.602   -0.765  1.00 0.00 ? 35  SER A HB3  6  
ATOM 7711  H HG   . SER A 1 35  ? 4.997   9.533   -2.459  1.00 0.00 ? 35  SER A HG   6  
ATOM 7712  N N    . PHE A 1 36  ? 7.753   5.722   -3.210  1.00 0.00 ? 36  PHE A N    6  
ATOM 7713  C CA   . PHE A 1 36  ? 8.318   4.378   -3.159  1.00 0.00 ? 36  PHE A CA   6  
ATOM 7714  C C    . PHE A 1 36  ? 9.405   4.205   -4.216  1.00 0.00 ? 36  PHE A C    6  
ATOM 7715  O O    . PHE A 1 36  ? 9.113   4.039   -5.401  1.00 0.00 ? 36  PHE A O    6  
ATOM 7716  C CB   . PHE A 1 36  ? 7.221   3.332   -3.363  1.00 0.00 ? 36  PHE A CB   6  
ATOM 7717  C CG   . PHE A 1 36  ? 6.024   3.538   -2.479  1.00 0.00 ? 36  PHE A CG   6  
ATOM 7718  C CD1  . PHE A 1 36  ? 5.039   4.450   -2.825  1.00 0.00 ? 36  PHE A CD1  6  
ATOM 7719  C CD2  . PHE A 1 36  ? 5.884   2.820   -1.302  1.00 0.00 ? 36  PHE A CD2  6  
ATOM 7720  C CE1  . PHE A 1 36  ? 3.938   4.642   -2.012  1.00 0.00 ? 36  PHE A CE1  6  
ATOM 7721  C CE2  . PHE A 1 36  ? 4.785   3.008   -0.486  1.00 0.00 ? 36  PHE A CE2  6  
ATOM 7722  C CZ   . PHE A 1 36  ? 3.810   3.919   -0.842  1.00 0.00 ? 36  PHE A CZ   6  
ATOM 7723  H H    . PHE A 1 36  ? 7.154   5.961   -3.948  1.00 0.00 ? 36  PHE A H    6  
ATOM 7724  H HA   . PHE A 1 36  ? 8.757   4.241   -2.183  1.00 0.00 ? 36  PHE A HA   6  
ATOM 7725  H HB2  . PHE A 1 36  ? 6.885   3.369   -4.389  1.00 0.00 ? 36  PHE A HB2  6  
ATOM 7726  H HB3  . PHE A 1 36  ? 7.624   2.353   -3.156  1.00 0.00 ? 36  PHE A HB3  6  
ATOM 7727  H HD1  . PHE A 1 36  ? 5.137   5.015   -3.740  1.00 0.00 ? 36  PHE A HD1  6  
ATOM 7728  H HD2  . PHE A 1 36  ? 6.647   2.107   -1.023  1.00 0.00 ? 36  PHE A HD2  6  
ATOM 7729  H HE1  . PHE A 1 36  ? 3.177   5.355   -2.293  1.00 0.00 ? 36  PHE A HE1  6  
ATOM 7730  H HE2  . PHE A 1 36  ? 4.688   2.441   0.428   1.00 0.00 ? 36  PHE A HE2  6  
ATOM 7731  H HZ   . PHE A 1 36  ? 2.950   4.068   -0.205  1.00 0.00 ? 36  PHE A HZ   6  
ATOM 7732  N N    . ASP A 1 37  ? 10.659  4.244   -3.779  1.00 0.00 ? 37  ASP A N    6  
ATOM 7733  C CA   . ASP A 1 37  ? 11.790  4.091   -4.686  1.00 0.00 ? 37  ASP A CA   6  
ATOM 7734  C C    . ASP A 1 37  ? 11.879  2.660   -5.207  1.00 0.00 ? 37  ASP A C    6  
ATOM 7735  O O    . ASP A 1 37  ? 12.217  1.738   -4.466  1.00 0.00 ? 37  ASP A O    6  
ATOM 7736  C CB   . ASP A 1 37  ? 13.092  4.472   -3.981  1.00 0.00 ? 37  ASP A CB   6  
ATOM 7737  C CG   . ASP A 1 37  ? 14.129  5.026   -4.938  1.00 0.00 ? 37  ASP A CG   6  
ATOM 7738  O OD1  . ASP A 1 37  ? 14.058  6.232   -5.255  1.00 0.00 ? 37  ASP A OD1  6  
ATOM 7739  O OD2  . ASP A 1 37  ? 15.010  4.255   -5.371  1.00 0.00 ? 37  ASP A OD2  6  
ATOM 7740  H H    . ASP A 1 37  ? 10.827  4.379   -2.823  1.00 0.00 ? 37  ASP A H    6  
ATOM 7741  H HA   . ASP A 1 37  ? 11.637  4.756   -5.523  1.00 0.00 ? 37  ASP A HA   6  
ATOM 7742  H HB2  . ASP A 1 37  ? 12.883  5.222   -3.233  1.00 0.00 ? 37  ASP A HB2  6  
ATOM 7743  H HB3  . ASP A 1 37  ? 13.504  3.596   -3.501  1.00 0.00 ? 37  ASP A HB3  6  
ATOM 7744  N N    . GLY A 1 38  ? 11.571  2.482   -6.489  1.00 0.00 ? 38  GLY A N    6  
ATOM 7745  C CA   . GLY A 1 38  ? 11.621  1.160   -7.086  1.00 0.00 ? 38  GLY A CA   6  
ATOM 7746  C C    . GLY A 1 38  ? 10.343  0.807   -7.820  1.00 0.00 ? 38  GLY A C    6  
ATOM 7747  O O    . GLY A 1 38  ? 10.382  0.248   -8.916  1.00 0.00 ? 38  GLY A O    6  
ATOM 7748  H H    . GLY A 1 38  ? 11.308  3.254   -7.032  1.00 0.00 ? 38  GLY A H    6  
ATOM 7749  H HA2  . GLY A 1 38  ? 12.446  1.123   -7.783  1.00 0.00 ? 38  GLY A HA2  6  
ATOM 7750  H HA3  . GLY A 1 38  ? 11.788  0.431   -6.307  1.00 0.00 ? 38  GLY A HA3  6  
ATOM 7751  N N    . SER A 1 39  ? 9.205   1.132   -7.214  1.00 0.00 ? 39  SER A N    6  
ATOM 7752  C CA   . SER A 1 39  ? 7.909   0.840   -7.814  1.00 0.00 ? 39  SER A CA   6  
ATOM 7753  C C    . SER A 1 39  ? 7.924   1.138   -9.310  1.00 0.00 ? 39  SER A C    6  
ATOM 7754  O O    . SER A 1 39  ? 8.765   1.895   -9.796  1.00 0.00 ? 39  SER A O    6  
ATOM 7755  C CB   . SER A 1 39  ? 6.811   1.658   -7.131  1.00 0.00 ? 39  SER A CB   6  
ATOM 7756  O OG   . SER A 1 39  ? 6.978   3.043   -7.379  1.00 0.00 ? 39  SER A OG   6  
ATOM 7757  H H    . SER A 1 39  ? 9.239   1.576   -6.341  1.00 0.00 ? 39  SER A H    6  
ATOM 7758  H HA   . SER A 1 39  ? 7.706   -0.211  -7.670  1.00 0.00 ? 39  SER A HA   6  
ATOM 7759  H HB2  . SER A 1 39  ? 5.848   1.350   -7.509  1.00 0.00 ? 39  SER A HB2  6  
ATOM 7760  H HB3  . SER A 1 39  ? 6.851   1.488   -6.064  1.00 0.00 ? 39  SER A HB3  6  
ATOM 7761  H HG   . SER A 1 39  ? 7.390   3.458   -6.618  1.00 0.00 ? 39  SER A HG   6  
ATOM 7762  N N    . VAL A 1 40  ? 6.987   0.537   -10.037 1.00 0.00 ? 40  VAL A N    6  
ATOM 7763  C CA   . VAL A 1 40  ? 6.890   0.737   -11.477 1.00 0.00 ? 40  VAL A CA   6  
ATOM 7764  C C    . VAL A 1 40  ? 5.773   1.717   -11.822 1.00 0.00 ? 40  VAL A C    6  
ATOM 7765  O O    . VAL A 1 40  ? 5.880   2.484   -12.779 1.00 0.00 ? 40  VAL A O    6  
ATOM 7766  C CB   . VAL A 1 40  ? 6.637   -0.592  -12.213 1.00 0.00 ? 40  VAL A CB   6  
ATOM 7767  C CG1  . VAL A 1 40  ? 7.904   -1.432  -12.248 1.00 0.00 ? 40  VAL A CG1  6  
ATOM 7768  C CG2  . VAL A 1 40  ? 5.498   -1.357  -11.556 1.00 0.00 ? 40  VAL A CG2  6  
ATOM 7769  H H    . VAL A 1 40  ? 6.344   -0.055  -9.592  1.00 0.00 ? 40  VAL A H    6  
ATOM 7770  H HA   . VAL A 1 40  ? 7.830   1.142   -11.822 1.00 0.00 ? 40  VAL A HA   6  
ATOM 7771  H HB   . VAL A 1 40  ? 6.352   -0.368  -13.231 1.00 0.00 ? 40  VAL A HB   6  
ATOM 7772  H HG11 . VAL A 1 40  ? 8.539   -1.161  -11.417 1.00 0.00 ? 40  VAL A HG11 6  
ATOM 7773  H HG12 . VAL A 1 40  ? 7.645   -2.479  -12.179 1.00 0.00 ? 40  VAL A HG12 6  
ATOM 7774  H HG13 . VAL A 1 40  ? 8.430   -1.252  -13.175 1.00 0.00 ? 40  VAL A HG13 6  
ATOM 7775  H HG21 . VAL A 1 40  ? 5.044   -0.740  -10.794 1.00 0.00 ? 40  VAL A HG21 6  
ATOM 7776  H HG22 . VAL A 1 40  ? 4.758   -1.612  -12.300 1.00 0.00 ? 40  VAL A HG22 6  
ATOM 7777  H HG23 . VAL A 1 40  ? 5.883   -2.260  -11.106 1.00 0.00 ? 40  VAL A HG23 6  
ATOM 7778  N N    . ARG A 1 41  ? 4.703   1.686   -11.036 1.00 0.00 ? 41  ARG A N    6  
ATOM 7779  C CA   . ARG A 1 41  ? 3.565   2.570   -11.258 1.00 0.00 ? 41  ARG A CA   6  
ATOM 7780  C C    . ARG A 1 41  ? 2.764   2.759   -9.973  1.00 0.00 ? 41  ARG A C    6  
ATOM 7781  O O    . ARG A 1 41  ? 2.953   2.030   -9.000  1.00 0.00 ? 41  ARG A O    6  
ATOM 7782  C CB   . ARG A 1 41  ? 2.662   2.008   -12.358 1.00 0.00 ? 41  ARG A CB   6  
ATOM 7783  C CG   . ARG A 1 41  ? 2.357   0.528   -12.198 1.00 0.00 ? 41  ARG A CG   6  
ATOM 7784  C CD   . ARG A 1 41  ? 1.972   -0.108  -13.524 1.00 0.00 ? 41  ARG A CD   6  
ATOM 7785  N NE   . ARG A 1 41  ? 2.126   -1.560  -13.500 1.00 0.00 ? 41  ARG A NE   6  
ATOM 7786  C CZ   . ARG A 1 41  ? 1.679   -2.362  -14.460 1.00 0.00 ? 41  ARG A CZ   6  
ATOM 7787  N NH1  . ARG A 1 41  ? 1.055   -1.856  -15.514 1.00 0.00 ? 41  ARG A NH1  6  
ATOM 7788  N NH2  . ARG A 1 41  ? 1.858   -3.674  -14.367 1.00 0.00 ? 41  ARG A NH2  6  
ATOM 7789  H H    . ARG A 1 41  ? 4.676   1.052   -10.288 1.00 0.00 ? 41  ARG A H    6  
ATOM 7790  H HA   . ARG A 1 41  ? 3.948   3.529   -11.574 1.00 0.00 ? 41  ARG A HA   6  
ATOM 7791  H HB2  . ARG A 1 41  ? 1.727   2.549   -12.350 1.00 0.00 ? 41  ARG A HB2  6  
ATOM 7792  H HB3  . ARG A 1 41  ? 3.145   2.153   -13.312 1.00 0.00 ? 41  ARG A HB3  6  
ATOM 7793  H HG2  . ARG A 1 41  ? 3.234   0.029   -11.813 1.00 0.00 ? 41  ARG A HG2  6  
ATOM 7794  H HG3  . ARG A 1 41  ? 1.540   0.412   -11.502 1.00 0.00 ? 41  ARG A HG3  6  
ATOM 7795  H HD2  . ARG A 1 41  ? 0.941   0.131   -13.738 1.00 0.00 ? 41  ARG A HD2  6  
ATOM 7796  H HD3  . ARG A 1 41  ? 2.604   0.299   -14.300 1.00 0.00 ? 41  ARG A HD3  6  
ATOM 7797  H HE   . ARG A 1 41  ? 2.585   -1.955  -12.730 1.00 0.00 ? 41  ARG A HE   6  
ATOM 7798  H HH11 . ARG A 1 41  ? 0.920   -0.868  -15.588 1.00 0.00 ? 41  ARG A HH11 6  
ATOM 7799  H HH12 . ARG A 1 41  ? 0.720   -2.463  -16.236 1.00 0.00 ? 41  ARG A HH12 6  
ATOM 7800  H HH21 . ARG A 1 41  ? 2.329   -4.059  -13.574 1.00 0.00 ? 41  ARG A HH21 6  
ATOM 7801  H HH22 . ARG A 1 41  ? 1.521   -4.277  -15.089 1.00 0.00 ? 41  ARG A HH22 6  
ATOM 7802  N N    . ALA A 1 42  ? 1.869   3.742   -9.979  1.00 0.00 ? 42  ALA A N    6  
ATOM 7803  C CA   . ALA A 1 42  ? 1.038   4.025   -8.815  1.00 0.00 ? 42  ALA A CA   6  
ATOM 7804  C C    . ALA A 1 42  ? -0.369  4.439   -9.233  1.00 0.00 ? 42  ALA A C    6  
ATOM 7805  O O    . ALA A 1 42  ? -0.571  4.970   -10.325 1.00 0.00 ? 42  ALA A O    6  
ATOM 7806  C CB   . ALA A 1 42  ? 1.678   5.110   -7.962  1.00 0.00 ? 42  ALA A CB   6  
ATOM 7807  H H    . ALA A 1 42  ? 1.765   4.288   -10.785 1.00 0.00 ? 42  ALA A H    6  
ATOM 7808  H HA   . ALA A 1 42  ? 0.977   3.124   -8.222  1.00 0.00 ? 42  ALA A HA   6  
ATOM 7809  H HB1  . ALA A 1 42  ? 1.588   6.062   -8.464  1.00 0.00 ? 42  ALA A HB1  6  
ATOM 7810  H HB2  . ALA A 1 42  ? 1.177   5.158   -7.006  1.00 0.00 ? 42  ALA A HB2  6  
ATOM 7811  H HB3  . ALA A 1 42  ? 2.722   4.880   -7.810  1.00 0.00 ? 42  ALA A HB3  6  
ATOM 7812  N N    . ARG A 1 43  ? -1.338  4.191   -8.358  1.00 0.00 ? 43  ARG A N    6  
ATOM 7813  C CA   . ARG A 1 43  ? -2.726  4.536   -8.638  1.00 0.00 ? 43  ARG A CA   6  
ATOM 7814  C C    . ARG A 1 43  ? -3.392  5.150   -7.409  1.00 0.00 ? 43  ARG A C    6  
ATOM 7815  O O    . ARG A 1 43  ? -3.011  4.860   -6.275  1.00 0.00 ? 43  ARG A O    6  
ATOM 7816  C CB   . ARG A 1 43  ? -3.502  3.296   -9.085  1.00 0.00 ? 43  ARG A CB   6  
ATOM 7817  C CG   . ARG A 1 43  ? -2.670  2.316   -9.896  1.00 0.00 ? 43  ARG A CG   6  
ATOM 7818  C CD   . ARG A 1 43  ? -3.533  1.515   -10.858 1.00 0.00 ? 43  ARG A CD   6  
ATOM 7819  N NE   . ARG A 1 43  ? -4.072  2.345   -11.932 1.00 0.00 ? 43  ARG A NE   6  
ATOM 7820  C CZ   . ARG A 1 43  ? -5.143  2.019   -12.647 1.00 0.00 ? 43  ARG A CZ   6  
ATOM 7821  N NH1  . ARG A 1 43  ? -5.786  0.885   -12.403 1.00 0.00 ? 43  ARG A NH1  6  
ATOM 7822  N NH2  . ARG A 1 43  ? -5.572  2.827   -13.608 1.00 0.00 ? 43  ARG A NH2  6  
ATOM 7823  H H    . ARG A 1 43  ? -1.114  3.765   -7.504  1.00 0.00 ? 43  ARG A H    6  
ATOM 7824  H HA   . ARG A 1 43  ? -2.733  5.262   -9.437  1.00 0.00 ? 43  ARG A HA   6  
ATOM 7825  H HB2  . ARG A 1 43  ? -3.872  2.781   -8.210  1.00 0.00 ? 43  ARG A HB2  6  
ATOM 7826  H HB3  . ARG A 1 43  ? -4.340  3.609   -9.689  1.00 0.00 ? 43  ARG A HB3  6  
ATOM 7827  H HG2  . ARG A 1 43  ? -1.934  2.867   -10.464 1.00 0.00 ? 43  ARG A HG2  6  
ATOM 7828  H HG3  . ARG A 1 43  ? -2.172  1.637   -9.221  1.00 0.00 ? 43  ARG A HG3  6  
ATOM 7829  H HD2  . ARG A 1 43  ? -2.932  0.729   -11.291 1.00 0.00 ? 43  ARG A HD2  6  
ATOM 7830  H HD3  . ARG A 1 43  ? -4.353  1.079   -10.307 1.00 0.00 ? 43  ARG A HD3  6  
ATOM 7831  H HE   . ARG A 1 43  ? -3.612  3.187   -12.129 1.00 0.00 ? 43  ARG A HE   6  
ATOM 7832  H HH11 . ARG A 1 43  ? -5.465  0.275   -11.679 1.00 0.00 ? 43  ARG A HH11 6  
ATOM 7833  H HH12 . ARG A 1 43  ? -6.593  0.642   -12.942 1.00 0.00 ? 43  ARG A HH12 6  
ATOM 7834  H HH21 . ARG A 1 43  ? -5.090  3.682   -13.794 1.00 0.00 ? 43  ARG A HH21 6  
ATOM 7835  H HH22 . ARG A 1 43  ? -6.378  2.580   -14.145 1.00 0.00 ? 43  ARG A HH22 6  
ATOM 7836  N N    . ILE A 1 44  ? -4.386  5.999   -7.644  1.00 0.00 ? 44  ILE A N    6  
ATOM 7837  C CA   . ILE A 1 44  ? -5.104  6.653   -6.557  1.00 0.00 ? 44  ILE A CA   6  
ATOM 7838  C C    . ILE A 1 44  ? -6.610  6.614   -6.791  1.00 0.00 ? 44  ILE A C    6  
ATOM 7839  O O    . ILE A 1 44  ? -7.086  6.887   -7.894  1.00 0.00 ? 44  ILE A O    6  
ATOM 7840  C CB   . ILE A 1 44  ? -4.660  8.119   -6.391  1.00 0.00 ? 44  ILE A CB   6  
ATOM 7841  C CG1  . ILE A 1 44  ? -3.253  8.184   -5.794  1.00 0.00 ? 44  ILE A CG1  6  
ATOM 7842  C CG2  . ILE A 1 44  ? -5.648  8.875   -5.515  1.00 0.00 ? 44  ILE A CG2  6  
ATOM 7843  C CD1  . ILE A 1 44  ? -2.802  9.588   -5.460  1.00 0.00 ? 44  ILE A CD1  6  
ATOM 7844  H H    . ILE A 1 44  ? -4.643  6.190   -8.570  1.00 0.00 ? 44  ILE A H    6  
ATOM 7845  H HA   . ILE A 1 44  ? -4.878  6.124   -5.643  1.00 0.00 ? 44  ILE A HA   6  
ATOM 7846  H HB   . ILE A 1 44  ? -4.652  8.582   -7.365  1.00 0.00 ? 44  ILE A HB   6  
ATOM 7847  H HG12 . ILE A 1 44  ? -3.227  7.603   -4.885  1.00 0.00 ? 44  ILE A HG12 6  
ATOM 7848  H HG13 . ILE A 1 44  ? -2.550  7.768   -6.502  1.00 0.00 ? 44  ILE A HG13 6  
ATOM 7849  H HG21 . ILE A 1 44  ? -5.226  9.831   -5.240  1.00 0.00 ? 44  ILE A HG21 6  
ATOM 7850  H HG22 . ILE A 1 44  ? -6.566  9.033   -6.062  1.00 0.00 ? 44  ILE A HG22 6  
ATOM 7851  H HG23 . ILE A 1 44  ? -5.853  8.301   -4.624  1.00 0.00 ? 44  ILE A HG23 6  
ATOM 7852  H HD11 . ILE A 1 44  ? -3.113  9.837   -4.456  1.00 0.00 ? 44  ILE A HD11 6  
ATOM 7853  H HD12 . ILE A 1 44  ? -1.727  9.649   -5.530  1.00 0.00 ? 44  ILE A HD12 6  
ATOM 7854  H HD13 . ILE A 1 44  ? -3.248  10.284  -6.156  1.00 0.00 ? 44  ILE A HD13 6  
ATOM 7855  N N    . VAL A 1 45  ? -7.357  6.274   -5.746  1.00 0.00 ? 45  VAL A N    6  
ATOM 7856  C CA   . VAL A 1 45  ? -8.811  6.201   -5.836  1.00 0.00 ? 45  VAL A CA   6  
ATOM 7857  C C    . VAL A 1 45  ? -9.432  7.593   -5.822  1.00 0.00 ? 45  VAL A C    6  
ATOM 7858  O O    . VAL A 1 45  ? -8.836  8.547   -5.322  1.00 0.00 ? 45  VAL A O    6  
ATOM 7859  C CB   . VAL A 1 45  ? -9.404  5.374   -4.680  1.00 0.00 ? 45  VAL A CB   6  
ATOM 7860  C CG1  . VAL A 1 45  ? -8.531  4.164   -4.385  1.00 0.00 ? 45  VAL A CG1  6  
ATOM 7861  C CG2  . VAL A 1 45  ? -9.570  6.237   -3.438  1.00 0.00 ? 45  VAL A CG2  6  
ATOM 7862  H H    . VAL A 1 45  ? -6.921  6.067   -4.893  1.00 0.00 ? 45  VAL A H    6  
ATOM 7863  H HA   . VAL A 1 45  ? -9.064  5.713   -6.766  1.00 0.00 ? 45  VAL A HA   6  
ATOM 7864  H HB   . VAL A 1 45  ? -10.380 5.022   -4.980  1.00 0.00 ? 45  VAL A HB   6  
ATOM 7865  H HG11 . VAL A 1 45  ? -8.187  3.734   -5.315  1.00 0.00 ? 45  VAL A HG11 6  
ATOM 7866  H HG12 . VAL A 1 45  ? -7.681  4.468   -3.792  1.00 0.00 ? 45  VAL A HG12 6  
ATOM 7867  H HG13 . VAL A 1 45  ? -9.106  3.429   -3.841  1.00 0.00 ? 45  VAL A HG13 6  
ATOM 7868  H HG21 . VAL A 1 45  ? -8.603  6.598   -3.120  1.00 0.00 ? 45  VAL A HG21 6  
ATOM 7869  H HG22 . VAL A 1 45  ? -10.209 7.078   -3.666  1.00 0.00 ? 45  VAL A HG22 6  
ATOM 7870  H HG23 . VAL A 1 45  ? -10.014 5.651   -2.648  1.00 0.00 ? 45  VAL A HG23 6  
ATOM 7871  N N    . THR A 1 46  ? -10.636 7.703   -6.375  1.00 0.00 ? 46  THR A N    6  
ATOM 7872  C CA   . THR A 1 46  ? -11.340 8.978   -6.428  1.00 0.00 ? 46  THR A CA   6  
ATOM 7873  C C    . THR A 1 46  ? -12.827 8.798   -6.149  1.00 0.00 ? 46  THR A C    6  
ATOM 7874  O O    . THR A 1 46  ? -13.394 7.738   -6.415  1.00 0.00 ? 46  THR A O    6  
ATOM 7875  C CB   . THR A 1 46  ? -11.165 9.660   -7.798  1.00 0.00 ? 46  THR A CB   6  
ATOM 7876  O OG1  . THR A 1 46  ? -11.574 8.771   -8.843  1.00 0.00 ? 46  THR A OG1  6  
ATOM 7877  C CG2  . THR A 1 46  ? -9.718  10.075  -8.015  1.00 0.00 ? 46  THR A CG2  6  
ATOM 7878  H H    . THR A 1 46  ? -11.060 6.906   -6.758  1.00 0.00 ? 46  THR A H    6  
ATOM 7879  H HA   . THR A 1 46  ? -10.917 9.624   -5.671  1.00 0.00 ? 46  THR A HA   6  
ATOM 7880  H HB   . THR A 1 46  ? -11.786 10.545  -7.824  1.00 0.00 ? 46  THR A HB   6  
ATOM 7881  H HG1  . THR A 1 46  ? -11.458 7.863   -8.554  1.00 0.00 ? 46  THR A HG1  6  
ATOM 7882  H HG21 . THR A 1 46  ? -9.150  9.229   -8.373  1.00 0.00 ? 46  THR A HG21 6  
ATOM 7883  H HG22 . THR A 1 46  ? -9.299  10.422  -7.082  1.00 0.00 ? 46  THR A HG22 6  
ATOM 7884  H HG23 . THR A 1 46  ? -9.677  10.870  -8.745  1.00 0.00 ? 46  THR A HG23 6  
ATOM 7885  N N    . ASP A 1 47  ? -13.455 9.838   -5.612  1.00 0.00 ? 47  ASP A N    6  
ATOM 7886  C CA   . ASP A 1 47  ? -14.878 9.795   -5.298  1.00 0.00 ? 47  ASP A CA   6  
ATOM 7887  C C    . ASP A 1 47  ? -15.718 9.901   -6.568  1.00 0.00 ? 47  ASP A C    6  
ATOM 7888  O O    . ASP A 1 47  ? -15.284 10.481  -7.564  1.00 0.00 ? 47  ASP A O    6  
ATOM 7889  C CB   . ASP A 1 47  ? -15.244 10.924  -4.334  1.00 0.00 ? 47  ASP A CB   6  
ATOM 7890  C CG   . ASP A 1 47  ? -16.596 10.712  -3.681  1.00 0.00 ? 47  ASP A CG   6  
ATOM 7891  O OD1  . ASP A 1 47  ? -16.833 9.605   -3.154  1.00 0.00 ? 47  ASP A OD1  6  
ATOM 7892  O OD2  . ASP A 1 47  ? -17.418 11.652  -3.699  1.00 0.00 ? 47  ASP A OD2  6  
ATOM 7893  H H    . ASP A 1 47  ? -12.948 10.656  -5.422  1.00 0.00 ? 47  ASP A H    6  
ATOM 7894  H HA   . ASP A 1 47  ? -15.085 8.847   -4.824  1.00 0.00 ? 47  ASP A HA   6  
ATOM 7895  H HB2  . ASP A 1 47  ? -14.496 10.982  -3.557  1.00 0.00 ? 47  ASP A HB2  6  
ATOM 7896  H HB3  . ASP A 1 47  ? -15.268 11.858  -4.875  1.00 0.00 ? 47  ASP A HB3  6  
ATOM 7897  N N    . ARG A 1 48  ? -16.920 9.337   -6.525  1.00 0.00 ? 48  ARG A N    6  
ATOM 7898  C CA   . ARG A 1 48  ? -17.819 9.367   -7.672  1.00 0.00 ? 48  ARG A CA   6  
ATOM 7899  C C    . ARG A 1 48  ? -18.758 10.567  -7.596  1.00 0.00 ? 48  ARG A C    6  
ATOM 7900  O O    . ARG A 1 48  ? -19.475 10.867  -8.550  1.00 0.00 ? 48  ARG A O    6  
ATOM 7901  C CB   . ARG A 1 48  ? -18.633 8.073   -7.743  1.00 0.00 ? 48  ARG A CB   6  
ATOM 7902  C CG   . ARG A 1 48  ? -19.668 8.065   -8.856  1.00 0.00 ? 48  ARG A CG   6  
ATOM 7903  C CD   . ARG A 1 48  ? -20.302 6.692   -9.016  1.00 0.00 ? 48  ARG A CD   6  
ATOM 7904  N NE   . ARG A 1 48  ? -19.326 5.681   -9.413  1.00 0.00 ? 48  ARG A NE   6  
ATOM 7905  C CZ   . ARG A 1 48  ? -19.658 4.478   -9.868  1.00 0.00 ? 48  ARG A CZ   6  
ATOM 7906  N NH1  . ARG A 1 48  ? -20.934 4.138   -9.985  1.00 0.00 ? 48  ARG A NH1  6  
ATOM 7907  N NH2  . ARG A 1 48  ? -18.712 3.612   -10.208 1.00 0.00 ? 48  ARG A NH2  6  
ATOM 7908  H H    . ARG A 1 48  ? -17.210 8.890   -5.702  1.00 0.00 ? 48  ARG A H    6  
ATOM 7909  H HA   . ARG A 1 48  ? -17.217 9.452   -8.564  1.00 0.00 ? 48  ARG A HA   6  
ATOM 7910  H HB2  . ARG A 1 48  ? -17.958 7.245   -7.903  1.00 0.00 ? 48  ARG A HB2  6  
ATOM 7911  H HB3  . ARG A 1 48  ? -19.145 7.933   -6.803  1.00 0.00 ? 48  ARG A HB3  6  
ATOM 7912  H HG2  . ARG A 1 48  ? -20.441 8.781   -8.621  1.00 0.00 ? 48  ARG A HG2  6  
ATOM 7913  H HG3  . ARG A 1 48  ? -19.188 8.341   -9.783  1.00 0.00 ? 48  ARG A HG3  6  
ATOM 7914  H HD2  . ARG A 1 48  ? -20.744 6.403   -8.075  1.00 0.00 ? 48  ARG A HD2  6  
ATOM 7915  H HD3  . ARG A 1 48  ? -21.071 6.752   -9.772  1.00 0.00 ? 48  ARG A HD3  6  
ATOM 7916  H HE   . ARG A 1 48  ? -18.377 5.911   -9.334  1.00 0.00 ? 48  ARG A HE   6  
ATOM 7917  H HH11 . ARG A 1 48  ? -21.649 4.789   -9.730  1.00 0.00 ? 48  ARG A HH11 6  
ATOM 7918  H HH12 . ARG A 1 48  ? -21.181 3.232   -10.329 1.00 0.00 ? 48  ARG A HH12 6  
ATOM 7919  H HH21 . ARG A 1 48  ? -17.748 3.865   -10.122 1.00 0.00 ? 48  ARG A HH21 6  
ATOM 7920  H HH22 . ARG A 1 48  ? -18.962 2.707   -10.551 1.00 0.00 ? 48  ARG A HH22 6  
ATOM 7921  N N    . GLU A 1 49  ? -18.748 11.249  -6.454  1.00 0.00 ? 49  GLU A N    6  
ATOM 7922  C CA   . GLU A 1 49  ? -19.601 12.415  -6.254  1.00 0.00 ? 49  GLU A CA   6  
ATOM 7923  C C    . GLU A 1 49  ? -18.800 13.706  -6.402  1.00 0.00 ? 49  GLU A C    6  
ATOM 7924  O O    . GLU A 1 49  ? -19.166 14.593  -7.173  1.00 0.00 ? 49  GLU A O    6  
ATOM 7925  C CB   . GLU A 1 49  ? -20.257 12.364  -4.873  1.00 0.00 ? 49  GLU A CB   6  
ATOM 7926  C CG   . GLU A 1 49  ? -21.186 13.534  -4.597  1.00 0.00 ? 49  GLU A CG   6  
ATOM 7927  C CD   . GLU A 1 49  ? -22.545 13.366  -5.248  1.00 0.00 ? 49  GLU A CD   6  
ATOM 7928  O OE1  . GLU A 1 49  ? -23.153 12.287  -5.084  1.00 0.00 ? 49  GLU A OE1  6  
ATOM 7929  O OE2  . GLU A 1 49  ? -23.001 14.313  -5.922  1.00 0.00 ? 49  GLU A OE2  6  
ATOM 7930  H H    . GLU A 1 49  ? -18.155 10.960  -5.730  1.00 0.00 ? 49  GLU A H    6  
ATOM 7931  H HA   . GLU A 1 49  ? -20.371 12.396  -7.010  1.00 0.00 ? 49  GLU A HA   6  
ATOM 7932  H HB2  . GLU A 1 49  ? -20.827 11.450  -4.792  1.00 0.00 ? 49  GLU A HB2  6  
ATOM 7933  H HB3  . GLU A 1 49  ? -19.482 12.361  -4.120  1.00 0.00 ? 49  GLU A HB3  6  
ATOM 7934  H HG2  . GLU A 1 49  ? -21.324 13.623  -3.530  1.00 0.00 ? 49  GLU A HG2  6  
ATOM 7935  H HG3  . GLU A 1 49  ? -20.730 14.436  -4.977  1.00 0.00 ? 49  GLU A HG3  6  
ATOM 7936  N N    . THR A 1 50  ? -17.704 13.803  -5.656  1.00 0.00 ? 50  THR A N    6  
ATOM 7937  C CA   . THR A 1 50  ? -16.851 14.985  -5.701  1.00 0.00 ? 50  THR A CA   6  
ATOM 7938  C C    . THR A 1 50  ? -15.795 14.859  -6.793  1.00 0.00 ? 50  THR A C    6  
ATOM 7939  O O    . THR A 1 50  ? -15.287 15.860  -7.297  1.00 0.00 ? 50  THR A O    6  
ATOM 7940  C CB   . THR A 1 50  ? -16.151 15.224  -4.350  1.00 0.00 ? 50  THR A CB   6  
ATOM 7941  O OG1  . THR A 1 50  ? -15.561 14.006  -3.882  1.00 0.00 ? 50  THR A OG1  6  
ATOM 7942  C CG2  . THR A 1 50  ? -17.136 15.747  -3.315  1.00 0.00 ? 50  THR A CG2  6  
ATOM 7943  H H    . THR A 1 50  ? -17.464 13.063  -5.060  1.00 0.00 ? 50  THR A H    6  
ATOM 7944  H HA   . THR A 1 50  ? -17.477 15.839  -5.915  1.00 0.00 ? 50  THR A HA   6  
ATOM 7945  H HB   . THR A 1 50  ? -15.373 15.961  -4.490  1.00 0.00 ? 50  THR A HB   6  
ATOM 7946  H HG1  . THR A 1 50  ? -16.209 13.509  -3.377  1.00 0.00 ? 50  THR A HG1  6  
ATOM 7947  H HG21 . THR A 1 50  ? -17.598 16.651  -3.682  1.00 0.00 ? 50  THR A HG21 6  
ATOM 7948  H HG22 . THR A 1 50  ? -16.612 15.958  -2.394  1.00 0.00 ? 50  THR A HG22 6  
ATOM 7949  H HG23 . THR A 1 50  ? -17.896 15.002  -3.134  1.00 0.00 ? 50  THR A HG23 6  
ATOM 7950  N N    . GLY A 1 51  ? -15.469 13.622  -7.155  1.00 0.00 ? 51  GLY A N    6  
ATOM 7951  C CA   . GLY A 1 51  ? -14.474 13.389  -8.186  1.00 0.00 ? 51  GLY A CA   6  
ATOM 7952  C C    . GLY A 1 51  ? -13.081 13.796  -7.750  1.00 0.00 ? 51  GLY A C    6  
ATOM 7953  O O    . GLY A 1 51  ? -12.280 14.259  -8.563  1.00 0.00 ? 51  GLY A O    6  
ATOM 7954  H H    . GLY A 1 51  ? -15.907 12.862  -6.718  1.00 0.00 ? 51  GLY A H    6  
ATOM 7955  H HA2  . GLY A 1 51  ? -14.470 12.339  -8.435  1.00 0.00 ? 51  GLY A HA2  6  
ATOM 7956  H HA3  . GLY A 1 51  ? -14.744 13.956  -9.065  1.00 0.00 ? 51  GLY A HA3  6  
ATOM 7957  N N    . SER A 1 52  ? -12.791 13.627  -6.464  1.00 0.00 ? 52  SER A N    6  
ATOM 7958  C CA   . SER A 1 52  ? -11.486 13.985  -5.921  1.00 0.00 ? 52  SER A CA   6  
ATOM 7959  C C    . SER A 1 52  ? -10.838 12.789  -5.231  1.00 0.00 ? 52  SER A C    6  
ATOM 7960  O O    . SER A 1 52  ? -11.523 11.865  -4.793  1.00 0.00 ? 52  SER A O    6  
ATOM 7961  C CB   . SER A 1 52  ? -11.623 15.146  -4.933  1.00 0.00 ? 52  SER A CB   6  
ATOM 7962  O OG   . SER A 1 52  ? -10.432 15.911  -4.878  1.00 0.00 ? 52  SER A OG   6  
ATOM 7963  H H    . SER A 1 52  ? -13.472 13.253  -5.866  1.00 0.00 ? 52  SER A H    6  
ATOM 7964  H HA   . SER A 1 52  ? -10.859 14.295  -6.743  1.00 0.00 ? 52  SER A HA   6  
ATOM 7965  H HB2  . SER A 1 52  ? -12.434 15.786  -5.245  1.00 0.00 ? 52  SER A HB2  6  
ATOM 7966  H HB3  . SER A 1 52  ? -11.832 14.754  -3.948  1.00 0.00 ? 52  SER A HB3  6  
ATOM 7967  H HG   . SER A 1 52  ? -10.295 16.353  -5.719  1.00 0.00 ? 52  SER A HG   6  
ATOM 7968  N N    . SER A 1 53  ? -9.512  12.815  -5.137  1.00 0.00 ? 53  SER A N    6  
ATOM 7969  C CA   . SER A 1 53  ? -8.770  11.731  -4.504  1.00 0.00 ? 53  SER A CA   6  
ATOM 7970  C C    . SER A 1 53  ? -9.258  11.499  -3.077  1.00 0.00 ? 53  SER A C    6  
ATOM 7971  O O    . SER A 1 53  ? -8.994  12.300  -2.180  1.00 0.00 ? 53  SER A O    6  
ATOM 7972  C CB   . SER A 1 53  ? -7.273  12.047  -4.498  1.00 0.00 ? 53  SER A CB   6  
ATOM 7973  O OG   . SER A 1 53  ? -6.817  12.386  -5.796  1.00 0.00 ? 53  SER A OG   6  
ATOM 7974  H H    . SER A 1 53  ? -9.022  13.579  -5.506  1.00 0.00 ? 53  SER A H    6  
ATOM 7975  H HA   . SER A 1 53  ? -8.937  10.833  -5.080  1.00 0.00 ? 53  SER A HA   6  
ATOM 7976  H HB2  . SER A 1 53  ? -7.085  12.878  -3.835  1.00 0.00 ? 53  SER A HB2  6  
ATOM 7977  H HB3  . SER A 1 53  ? -6.727  11.181  -4.152  1.00 0.00 ? 53  SER A HB3  6  
ATOM 7978  H HG   . SER A 1 53  ? -6.045  11.859  -6.012  1.00 0.00 ? 53  SER A HG   6  
ATOM 7979  N N    . LYS A 1 54  ? -9.972  10.397  -2.876  1.00 0.00 ? 54  LYS A N    6  
ATOM 7980  C CA   . LYS A 1 54  ? -10.498 10.056  -1.559  1.00 0.00 ? 54  LYS A CA   6  
ATOM 7981  C C    . LYS A 1 54  ? -9.427  10.222  -0.486  1.00 0.00 ? 54  LYS A C    6  
ATOM 7982  O O    . LYS A 1 54  ? -9.683  10.784  0.578   1.00 0.00 ? 54  LYS A O    6  
ATOM 7983  C CB   . LYS A 1 54  ? -11.022 8.618   -1.553  1.00 0.00 ? 54  LYS A CB   6  
ATOM 7984  C CG   . LYS A 1 54  ? -12.213 8.401   -2.471  1.00 0.00 ? 54  LYS A CG   6  
ATOM 7985  C CD   . LYS A 1 54  ? -12.788 7.003   -2.317  1.00 0.00 ? 54  LYS A CD   6  
ATOM 7986  C CE   . LYS A 1 54  ? -13.607 6.873   -1.042  1.00 0.00 ? 54  LYS A CE   6  
ATOM 7987  N NZ   . LYS A 1 54  ? -14.097 5.482   -0.836  1.00 0.00 ? 54  LYS A NZ   6  
ATOM 7988  H H    . LYS A 1 54  ? -10.149 9.797   -3.631  1.00 0.00 ? 54  LYS A H    6  
ATOM 7989  H HA   . LYS A 1 54  ? -11.314 10.728  -1.343  1.00 0.00 ? 54  LYS A HA   6  
ATOM 7990  H HB2  . LYS A 1 54  ? -10.228 7.957   -1.867  1.00 0.00 ? 54  LYS A HB2  6  
ATOM 7991  H HB3  . LYS A 1 54  ? -11.318 8.359   -0.547  1.00 0.00 ? 54  LYS A HB3  6  
ATOM 7992  H HG2  . LYS A 1 54  ? -12.979 9.122   -2.227  1.00 0.00 ? 54  LYS A HG2  6  
ATOM 7993  H HG3  . LYS A 1 54  ? -11.897 8.541   -3.495  1.00 0.00 ? 54  LYS A HG3  6  
ATOM 7994  H HD2  . LYS A 1 54  ? -13.424 6.790   -3.163  1.00 0.00 ? 54  LYS A HD2  6  
ATOM 7995  H HD3  . LYS A 1 54  ? -11.975 6.291   -2.287  1.00 0.00 ? 54  LYS A HD3  6  
ATOM 7996  H HE2  . LYS A 1 54  ? -12.990 7.156   -0.203  1.00 0.00 ? 54  LYS A HE2  6  
ATOM 7997  H HE3  . LYS A 1 54  ? -14.455 7.539   -1.106  1.00 0.00 ? 54  LYS A HE3  6  
ATOM 7998  H HZ1  . LYS A 1 54  ? -13.494 4.811   -1.354  1.00 0.00 ? 54  LYS A HZ1  6  
ATOM 7999  H HZ2  . LYS A 1 54  ? -15.073 5.392   -1.183  1.00 0.00 ? 54  LYS A HZ2  6  
ATOM 8000  H HZ3  . LYS A 1 54  ? -14.076 5.242   0.175   1.00 0.00 ? 54  LYS A HZ3  6  
ATOM 8001  N N    . GLY A 1 55  ? -8.226  9.729   -0.773  1.00 0.00 ? 55  GLY A N    6  
ATOM 8002  C CA   . GLY A 1 55  ? -7.134  9.835   0.177   1.00 0.00 ? 55  GLY A CA   6  
ATOM 8003  C C    . GLY A 1 55  ? -6.374  8.533   0.334   1.00 0.00 ? 55  GLY A C    6  
ATOM 8004  O O    . GLY A 1 55  ? -5.806  8.260   1.391   1.00 0.00 ? 55  GLY A O    6  
ATOM 8005  H H    . GLY A 1 55  ? -8.080  9.291   -1.638  1.00 0.00 ? 55  GLY A H    6  
ATOM 8006  H HA2  . GLY A 1 55  ? -6.451  10.600  -0.159  1.00 0.00 ? 55  GLY A HA2  6  
ATOM 8007  H HA3  . GLY A 1 55  ? -7.535  10.121  1.138   1.00 0.00 ? 55  GLY A HA3  6  
ATOM 8008  N N    . PHE A 1 56  ? -6.363  7.725   -0.722  1.00 0.00 ? 56  PHE A N    6  
ATOM 8009  C CA   . PHE A 1 56  ? -5.669  6.443   -0.696  1.00 0.00 ? 56  PHE A CA   6  
ATOM 8010  C C    . PHE A 1 56  ? -5.624  5.821   -2.089  1.00 0.00 ? 56  PHE A C    6  
ATOM 8011  O O    . PHE A 1 56  ? -6.470  6.106   -2.936  1.00 0.00 ? 56  PHE A O    6  
ATOM 8012  C CB   . PHE A 1 56  ? -6.357  5.486   0.280   1.00 0.00 ? 56  PHE A CB   6  
ATOM 8013  C CG   . PHE A 1 56  ? -7.828  5.324   0.024   1.00 0.00 ? 56  PHE A CG   6  
ATOM 8014  C CD1  . PHE A 1 56  ? -8.735  6.256   0.502   1.00 0.00 ? 56  PHE A CD1  6  
ATOM 8015  C CD2  . PHE A 1 56  ? -8.305  4.239   -0.695  1.00 0.00 ? 56  PHE A CD2  6  
ATOM 8016  C CE1  . PHE A 1 56  ? -10.089 6.109   0.268   1.00 0.00 ? 56  PHE A CE1  6  
ATOM 8017  C CE2  . PHE A 1 56  ? -9.658  4.087   -0.932  1.00 0.00 ? 56  PHE A CE2  6  
ATOM 8018  C CZ   . PHE A 1 56  ? -10.551 5.024   -0.451  1.00 0.00 ? 56  PHE A CZ   6  
ATOM 8019  H H    . PHE A 1 56  ? -6.834  7.998   -1.537  1.00 0.00 ? 56  PHE A H    6  
ATOM 8020  H HA   . PHE A 1 56  ? -4.659  6.620   -0.361  1.00 0.00 ? 56  PHE A HA   6  
ATOM 8021  H HB2  . PHE A 1 56  ? -5.898  4.512   0.202   1.00 0.00 ? 56  PHE A HB2  6  
ATOM 8022  H HB3  . PHE A 1 56  ? -6.233  5.858   1.285   1.00 0.00 ? 56  PHE A HB3  6  
ATOM 8023  H HD1  . PHE A 1 56  ? -8.376  7.106   1.063   1.00 0.00 ? 56  PHE A HD1  6  
ATOM 8024  H HD2  . PHE A 1 56  ? -7.606  3.506   -1.073  1.00 0.00 ? 56  PHE A HD2  6  
ATOM 8025  H HE1  . PHE A 1 56  ? -10.786 6.843   0.646   1.00 0.00 ? 56  PHE A HE1  6  
ATOM 8026  H HE2  . PHE A 1 56  ? -10.015 3.237   -1.495  1.00 0.00 ? 56  PHE A HE2  6  
ATOM 8027  H HZ   . PHE A 1 56  ? -11.609 4.906   -0.634  1.00 0.00 ? 56  PHE A HZ   6  
ATOM 8028  N N    . GLY A 1 57  ? -4.629  4.969   -2.318  1.00 0.00 ? 57  GLY A N    6  
ATOM 8029  C CA   . GLY A 1 57  ? -4.491  4.320   -3.609  1.00 0.00 ? 57  GLY A CA   6  
ATOM 8030  C C    . GLY A 1 57  ? -3.731  3.012   -3.522  1.00 0.00 ? 57  GLY A C    6  
ATOM 8031  O O    . GLY A 1 57  ? -3.847  2.282   -2.537  1.00 0.00 ? 57  GLY A O    6  
ATOM 8032  H H    . GLY A 1 57  ? -3.984  4.779   -1.605  1.00 0.00 ? 57  GLY A H    6  
ATOM 8033  H HA2  . GLY A 1 57  ? -5.475  4.127   -4.010  1.00 0.00 ? 57  GLY A HA2  6  
ATOM 8034  H HA3  . GLY A 1 57  ? -3.964  4.985   -4.278  1.00 0.00 ? 57  GLY A HA3  6  
ATOM 8035  N N    . PHE A 1 58  ? -2.951  2.712   -4.555  1.00 0.00 ? 58  PHE A N    6  
ATOM 8036  C CA   . PHE A 1 58  ? -2.171  1.481   -4.593  1.00 0.00 ? 58  PHE A CA   6  
ATOM 8037  C C    . PHE A 1 58  ? -0.892  1.672   -5.404  1.00 0.00 ? 58  PHE A C    6  
ATOM 8038  O O    . PHE A 1 58  ? -0.897  2.325   -6.447  1.00 0.00 ? 58  PHE A O    6  
ATOM 8039  C CB   . PHE A 1 58  ? -3.002  0.343   -5.190  1.00 0.00 ? 58  PHE A CB   6  
ATOM 8040  C CG   . PHE A 1 58  ? -4.311  0.124   -4.487  1.00 0.00 ? 58  PHE A CG   6  
ATOM 8041  C CD1  . PHE A 1 58  ? -5.353  1.024   -4.640  1.00 0.00 ? 58  PHE A CD1  6  
ATOM 8042  C CD2  . PHE A 1 58  ? -4.499  -0.982  -3.675  1.00 0.00 ? 58  PHE A CD2  6  
ATOM 8043  C CE1  . PHE A 1 58  ? -6.558  0.825   -3.994  1.00 0.00 ? 58  PHE A CE1  6  
ATOM 8044  C CE2  . PHE A 1 58  ? -5.703  -1.187  -3.026  1.00 0.00 ? 58  PHE A CE2  6  
ATOM 8045  C CZ   . PHE A 1 58  ? -6.734  -0.282  -3.187  1.00 0.00 ? 58  PHE A CZ   6  
ATOM 8046  H H    . PHE A 1 58  ? -2.900  3.334   -5.312  1.00 0.00 ? 58  PHE A H    6  
ATOM 8047  H HA   . PHE A 1 58  ? -1.905  1.227   -3.578  1.00 0.00 ? 58  PHE A HA   6  
ATOM 8048  H HB2  . PHE A 1 58  ? -3.214  0.567   -6.225  1.00 0.00 ? 58  PHE A HB2  6  
ATOM 8049  H HB3  . PHE A 1 58  ? -2.435  -0.574  -5.134  1.00 0.00 ? 58  PHE A HB3  6  
ATOM 8050  H HD1  . PHE A 1 58  ? -5.218  1.890   -5.271  1.00 0.00 ? 58  PHE A HD1  6  
ATOM 8051  H HD2  . PHE A 1 58  ? -3.693  -1.691  -3.549  1.00 0.00 ? 58  PHE A HD2  6  
ATOM 8052  H HE1  . PHE A 1 58  ? -7.363  1.534   -4.121  1.00 0.00 ? 58  PHE A HE1  6  
ATOM 8053  H HE2  . PHE A 1 58  ? -5.836  -2.054  -2.397  1.00 0.00 ? 58  PHE A HE2  6  
ATOM 8054  H HZ   . PHE A 1 58  ? -7.675  -0.439  -2.681  1.00 0.00 ? 58  PHE A HZ   6  
ATOM 8055  N N    . VAL A 1 59  ? 0.202   1.097   -4.915  1.00 0.00 ? 59  VAL A N    6  
ATOM 8056  C CA   . VAL A 1 59  ? 1.489   1.203   -5.593  1.00 0.00 ? 59  VAL A CA   6  
ATOM 8057  C C    . VAL A 1 59  ? 1.933   -0.148  -6.143  1.00 0.00 ? 59  VAL A C    6  
ATOM 8058  O O    . VAL A 1 59  ? 2.157   -1.094  -5.387  1.00 0.00 ? 59  VAL A O    6  
ATOM 8059  C CB   . VAL A 1 59  ? 2.578   1.744   -4.649  1.00 0.00 ? 59  VAL A CB   6  
ATOM 8060  C CG1  . VAL A 1 59  ? 3.916   1.828   -5.369  1.00 0.00 ? 59  VAL A CG1  6  
ATOM 8061  C CG2  . VAL A 1 59  ? 2.176   3.102   -4.094  1.00 0.00 ? 59  VAL A CG2  6  
ATOM 8062  H H    . VAL A 1 59  ? 0.143   0.589   -4.080  1.00 0.00 ? 59  VAL A H    6  
ATOM 8063  H HA   . VAL A 1 59  ? 1.377   1.895   -6.415  1.00 0.00 ? 59  VAL A HA   6  
ATOM 8064  H HB   . VAL A 1 59  ? 2.683   1.057   -3.822  1.00 0.00 ? 59  VAL A HB   6  
ATOM 8065  H HG11 . VAL A 1 59  ? 3.990   1.022   -6.084  1.00 0.00 ? 59  VAL A HG11 6  
ATOM 8066  H HG12 . VAL A 1 59  ? 3.990   2.775   -5.882  1.00 0.00 ? 59  VAL A HG12 6  
ATOM 8067  H HG13 . VAL A 1 59  ? 4.717   1.744   -4.649  1.00 0.00 ? 59  VAL A HG13 6  
ATOM 8068  H HG21 . VAL A 1 59  ? 3.054   3.721   -3.987  1.00 0.00 ? 59  VAL A HG21 6  
ATOM 8069  H HG22 . VAL A 1 59  ? 1.482   3.577   -4.773  1.00 0.00 ? 59  VAL A HG22 6  
ATOM 8070  H HG23 . VAL A 1 59  ? 1.706   2.973   -3.131  1.00 0.00 ? 59  VAL A HG23 6  
ATOM 8071  N N    . ASP A 1 60  ? 2.059   -0.231  -7.463  1.00 0.00 ? 60  ASP A N    6  
ATOM 8072  C CA   . ASP A 1 60  ? 2.479   -1.467  -8.114  1.00 0.00 ? 60  ASP A CA   6  
ATOM 8073  C C    . ASP A 1 60  ? 3.995   -1.626  -8.053  1.00 0.00 ? 60  ASP A C    6  
ATOM 8074  O O    . ASP A 1 60  ? 4.732   -0.640  -8.028  1.00 0.00 ? 60  ASP A O    6  
ATOM 8075  C CB   . ASP A 1 60  ? 2.010   -1.485  -9.570  1.00 0.00 ? 60  ASP A CB   6  
ATOM 8076  C CG   . ASP A 1 60  ? 0.505   -1.350  -9.695  1.00 0.00 ? 60  ASP A CG   6  
ATOM 8077  O OD1  . ASP A 1 60  ? -0.197  -1.570  -8.686  1.00 0.00 ? 60  ASP A OD1  6  
ATOM 8078  O OD2  . ASP A 1 60  ? 0.029   -1.024  -10.803 1.00 0.00 ? 60  ASP A OD2  6  
ATOM 8079  H H    . ASP A 1 60  ? 1.866   0.557   -8.012  1.00 0.00 ? 60  ASP A H    6  
ATOM 8080  H HA   . ASP A 1 60  ? 2.021   -2.291  -7.588  1.00 0.00 ? 60  ASP A HA   6  
ATOM 8081  H HB2  . ASP A 1 60  ? 2.471   -0.665  -10.101 1.00 0.00 ? 60  ASP A HB2  6  
ATOM 8082  H HB3  . ASP A 1 60  ? 2.309   -2.417  -10.026 1.00 0.00 ? 60  ASP A HB3  6  
ATOM 8083  N N    . PHE A 1 61  ? 4.453   -2.873  -8.029  1.00 0.00 ? 61  PHE A N    6  
ATOM 8084  C CA   . PHE A 1 61  ? 5.881   -3.161  -7.969  1.00 0.00 ? 61  PHE A CA   6  
ATOM 8085  C C    . PHE A 1 61  ? 6.241   -4.323  -8.891  1.00 0.00 ? 61  PHE A C    6  
ATOM 8086  O O    . PHE A 1 61  ? 5.456   -5.254  -9.068  1.00 0.00 ? 61  PHE A O    6  
ATOM 8087  C CB   . PHE A 1 61  ? 6.297   -3.487  -6.533  1.00 0.00 ? 61  PHE A CB   6  
ATOM 8088  C CG   . PHE A 1 61  ? 6.321   -2.287  -5.629  1.00 0.00 ? 61  PHE A CG   6  
ATOM 8089  C CD1  . PHE A 1 61  ? 5.158   -1.834  -5.027  1.00 0.00 ? 61  PHE A CD1  6  
ATOM 8090  C CD2  . PHE A 1 61  ? 7.506   -1.613  -5.382  1.00 0.00 ? 61  PHE A CD2  6  
ATOM 8091  C CE1  . PHE A 1 61  ? 5.177   -0.730  -4.196  1.00 0.00 ? 61  PHE A CE1  6  
ATOM 8092  C CE2  . PHE A 1 61  ? 7.531   -0.509  -4.551  1.00 0.00 ? 61  PHE A CE2  6  
ATOM 8093  C CZ   . PHE A 1 61  ? 6.365   -0.068  -3.956  1.00 0.00 ? 61  PHE A CZ   6  
ATOM 8094  H H    . PHE A 1 61  ? 3.815   -3.617  -8.052  1.00 0.00 ? 61  PHE A H    6  
ATOM 8095  H HA   . PHE A 1 61  ? 6.411   -2.280  -8.297  1.00 0.00 ? 61  PHE A HA   6  
ATOM 8096  H HB2  . PHE A 1 61  ? 5.602   -4.201  -6.118  1.00 0.00 ? 61  PHE A HB2  6  
ATOM 8097  H HB3  . PHE A 1 61  ? 7.287   -3.917  -6.542  1.00 0.00 ? 61  PHE A HB3  6  
ATOM 8098  H HD1  . PHE A 1 61  ? 4.229   -2.352  -5.212  1.00 0.00 ? 61  PHE A HD1  6  
ATOM 8099  H HD2  . PHE A 1 61  ? 8.419   -1.958  -5.846  1.00 0.00 ? 61  PHE A HD2  6  
ATOM 8100  H HE1  . PHE A 1 61  ? 4.264   -0.388  -3.732  1.00 0.00 ? 61  PHE A HE1  6  
ATOM 8101  H HE2  . PHE A 1 61  ? 8.462   0.007   -4.366  1.00 0.00 ? 61  PHE A HE2  6  
ATOM 8102  H HZ   . PHE A 1 61  ? 6.382   0.795   -3.307  1.00 0.00 ? 61  PHE A HZ   6  
ATOM 8103  N N    . ASN A 1 62  ? 7.433   -4.260  -9.475  1.00 0.00 ? 62  ASN A N    6  
ATOM 8104  C CA   . ASN A 1 62  ? 7.897   -5.306  -10.379 1.00 0.00 ? 62  ASN A CA   6  
ATOM 8105  C C    . ASN A 1 62  ? 7.763   -6.682  -9.734  1.00 0.00 ? 62  ASN A C    6  
ATOM 8106  O O    . ASN A 1 62  ? 7.573   -7.685  -10.422 1.00 0.00 ? 62  ASN A O    6  
ATOM 8107  C CB   . ASN A 1 62  ? 9.354   -5.056  -10.776 1.00 0.00 ? 62  ASN A CB   6  
ATOM 8108  C CG   . ASN A 1 62  ? 9.475   -4.212  -12.030 1.00 0.00 ? 62  ASN A CG   6  
ATOM 8109  O OD1  . ASN A 1 62  ? 10.138  -3.175  -12.032 1.00 0.00 ? 62  ASN A OD1  6  
ATOM 8110  N ND2  . ASN A 1 62  ? 8.832   -4.655  -13.105 1.00 0.00 ? 62  ASN A ND2  6  
ATOM 8111  H H    . ASN A 1 62  ? 8.014   -3.492  -9.294  1.00 0.00 ? 62  ASN A H    6  
ATOM 8112  H HA   . ASN A 1 62  ? 7.281   -5.275  -11.265 1.00 0.00 ? 62  ASN A HA   6  
ATOM 8113  H HB2  . ASN A 1 62  ? 9.857   -4.543  -9.970  1.00 0.00 ? 62  ASN A HB2  6  
ATOM 8114  H HB3  . ASN A 1 62  ? 9.840   -6.004  -10.953 1.00 0.00 ? 62  ASN A HB3  6  
ATOM 8115  H HD21 . ASN A 1 62  ? 8.323   -5.489  -13.030 1.00 0.00 ? 62  ASN A HD21 6  
ATOM 8116  H HD22 . ASN A 1 62  ? 8.894   -4.129  -13.929 1.00 0.00 ? 62  ASN A HD22 6  
ATOM 8117  N N    . SER A 1 63  ? 7.862   -6.721  -8.409  1.00 0.00 ? 63  SER A N    6  
ATOM 8118  C CA   . SER A 1 63  ? 7.754   -7.974  -7.671  1.00 0.00 ? 63  SER A CA   6  
ATOM 8119  C C    . SER A 1 63  ? 7.500   -7.711  -6.190  1.00 0.00 ? 63  SER A C    6  
ATOM 8120  O O    . SER A 1 63  ? 7.909   -6.683  -5.652  1.00 0.00 ? 63  SER A O    6  
ATOM 8121  C CB   . SER A 1 63  ? 9.029   -8.802  -7.843  1.00 0.00 ? 63  SER A CB   6  
ATOM 8122  O OG   . SER A 1 63  ? 9.113   -9.343  -9.150  1.00 0.00 ? 63  SER A OG   6  
ATOM 8123  H H    . SER A 1 63  ? 8.013   -5.887  -7.917  1.00 0.00 ? 63  SER A H    6  
ATOM 8124  H HA   . SER A 1 63  ? 6.919   -8.526  -8.075  1.00 0.00 ? 63  SER A HA   6  
ATOM 8125  H HB2  . SER A 1 63  ? 9.889   -8.174  -7.670  1.00 0.00 ? 63  SER A HB2  6  
ATOM 8126  H HB3  . SER A 1 63  ? 9.026   -9.614  -7.129  1.00 0.00 ? 63  SER A HB3  6  
ATOM 8127  H HG   . SER A 1 63  ? 8.239   -9.611  -9.443  1.00 0.00 ? 63  SER A HG   6  
ATOM 8128  N N    . GLU A 1 64  ? 6.822   -8.650  -5.537  1.00 0.00 ? 64  GLU A N    6  
ATOM 8129  C CA   . GLU A 1 64  ? 6.513   -8.520  -4.117  1.00 0.00 ? 64  GLU A CA   6  
ATOM 8130  C C    . GLU A 1 64  ? 7.723   -8.007  -3.342  1.00 0.00 ? 64  GLU A C    6  
ATOM 8131  O O    . GLU A 1 64  ? 7.604   -7.105  -2.514  1.00 0.00 ? 64  GLU A O    6  
ATOM 8132  C CB   . GLU A 1 64  ? 6.060   -9.865  -3.546  1.00 0.00 ? 64  GLU A CB   6  
ATOM 8133  C CG   . GLU A 1 64  ? 4.623   -10.220 -3.891  1.00 0.00 ? 64  GLU A CG   6  
ATOM 8134  C CD   . GLU A 1 64  ? 4.392   -11.717 -3.960  1.00 0.00 ? 64  GLU A CD   6  
ATOM 8135  O OE1  . GLU A 1 64  ? 4.975   -12.447 -3.131  1.00 0.00 ? 64  GLU A OE1  6  
ATOM 8136  O OE2  . GLU A 1 64  ? 3.628   -12.159 -4.844  1.00 0.00 ? 64  GLU A OE2  6  
ATOM 8137  H H    . GLU A 1 64  ? 6.523   -9.448  -6.020  1.00 0.00 ? 64  GLU A H    6  
ATOM 8138  H HA   . GLU A 1 64  ? 5.708   -7.808  -4.018  1.00 0.00 ? 64  GLU A HA   6  
ATOM 8139  H HB2  . GLU A 1 64  ? 6.703   -10.642 -3.932  1.00 0.00 ? 64  GLU A HB2  6  
ATOM 8140  H HB3  . GLU A 1 64  ? 6.152   -9.835  -2.471  1.00 0.00 ? 64  GLU A HB3  6  
ATOM 8141  H HG2  . GLU A 1 64  ? 3.972   -9.806  -3.136  1.00 0.00 ? 64  GLU A HG2  6  
ATOM 8142  H HG3  . GLU A 1 64  ? 4.379   -9.788  -4.851  1.00 0.00 ? 64  GLU A HG3  6  
ATOM 8143  N N    . GLU A 1 65  ? 8.885   -8.591  -3.616  1.00 0.00 ? 65  GLU A N    6  
ATOM 8144  C CA   . GLU A 1 65  ? 10.116  -8.194  -2.943  1.00 0.00 ? 65  GLU A CA   6  
ATOM 8145  C C    . GLU A 1 65  ? 10.318  -6.683  -3.024  1.00 0.00 ? 65  GLU A C    6  
ATOM 8146  O O    . GLU A 1 65  ? 10.388  -6.000  -2.002  1.00 0.00 ? 65  GLU A O    6  
ATOM 8147  C CB   . GLU A 1 65  ? 11.317  -8.913  -3.561  1.00 0.00 ? 65  GLU A CB   6  
ATOM 8148  C CG   . GLU A 1 65  ? 11.542  -10.309 -3.004  1.00 0.00 ? 65  GLU A CG   6  
ATOM 8149  C CD   . GLU A 1 65  ? 12.884  -10.889 -3.409  1.00 0.00 ? 65  GLU A CD   6  
ATOM 8150  O OE1  . GLU A 1 65  ? 13.260  -10.741 -4.591  1.00 0.00 ? 65  GLU A OE1  6  
ATOM 8151  O OE2  . GLU A 1 65  ? 13.556  -11.489 -2.546  1.00 0.00 ? 65  GLU A OE2  6  
ATOM 8152  H H    . GLU A 1 65  ? 8.915   -9.305  -4.286  1.00 0.00 ? 65  GLU A H    6  
ATOM 8153  H HA   . GLU A 1 65  ? 10.033  -8.478  -1.905  1.00 0.00 ? 65  GLU A HA   6  
ATOM 8154  H HB2  . GLU A 1 65  ? 11.163  -8.993  -4.627  1.00 0.00 ? 65  GLU A HB2  6  
ATOM 8155  H HB3  . GLU A 1 65  ? 12.205  -8.328  -3.377  1.00 0.00 ? 65  GLU A HB3  6  
ATOM 8156  H HG2  . GLU A 1 65  ? 11.498  -10.265 -1.927  1.00 0.00 ? 65  GLU A HG2  6  
ATOM 8157  H HG3  . GLU A 1 65  ? 10.761  -10.959 -3.369  1.00 0.00 ? 65  GLU A HG3  6  
ATOM 8158  N N    . ASP A 1 66  ? 10.411  -6.169  -4.245  1.00 0.00 ? 66  ASP A N    6  
ATOM 8159  C CA   . ASP A 1 66  ? 10.604  -4.740  -4.461  1.00 0.00 ? 66  ASP A CA   6  
ATOM 8160  C C    . ASP A 1 66  ? 9.643   -3.926  -3.599  1.00 0.00 ? 66  ASP A C    6  
ATOM 8161  O O    . ASP A 1 66  ? 10.036  -2.939  -2.978  1.00 0.00 ? 66  ASP A O    6  
ATOM 8162  C CB   . ASP A 1 66  ? 10.403  -4.394  -5.937  1.00 0.00 ? 66  ASP A CB   6  
ATOM 8163  C CG   . ASP A 1 66  ? 11.644  -4.656  -6.767  1.00 0.00 ? 66  ASP A CG   6  
ATOM 8164  O OD1  . ASP A 1 66  ? 12.105  -5.816  -6.795  1.00 0.00 ? 66  ASP A OD1  6  
ATOM 8165  O OD2  . ASP A 1 66  ? 12.155  -3.701  -7.389  1.00 0.00 ? 66  ASP A OD2  6  
ATOM 8166  H H    . ASP A 1 66  ? 10.347  -6.766  -5.021  1.00 0.00 ? 66  ASP A H    6  
ATOM 8167  H HA   . ASP A 1 66  ? 11.616  -4.496  -4.178  1.00 0.00 ? 66  ASP A HA   6  
ATOM 8168  H HB2  . ASP A 1 66  ? 9.595   -4.991  -6.334  1.00 0.00 ? 66  ASP A HB2  6  
ATOM 8169  H HB3  . ASP A 1 66  ? 10.148  -3.348  -6.023  1.00 0.00 ? 66  ASP A HB3  6  
ATOM 8170  N N    . ALA A 1 67  ? 8.383   -4.346  -3.569  1.00 0.00 ? 67  ALA A N    6  
ATOM 8171  C CA   . ALA A 1 67  ? 7.367   -3.656  -2.784  1.00 0.00 ? 67  ALA A CA   6  
ATOM 8172  C C    . ALA A 1 67  ? 7.741   -3.628  -1.306  1.00 0.00 ? 67  ALA A C    6  
ATOM 8173  O O    . ALA A 1 67  ? 7.678   -2.583  -0.658  1.00 0.00 ? 67  ALA A O    6  
ATOM 8174  C CB   . ALA A 1 67  ? 6.011   -4.321  -2.974  1.00 0.00 ? 67  ALA A CB   6  
ATOM 8175  H H    . ALA A 1 67  ? 8.131   -5.139  -4.086  1.00 0.00 ? 67  ALA A H    6  
ATOM 8176  H HA   . ALA A 1 67  ? 7.297   -2.641  -3.146  1.00 0.00 ? 67  ALA A HA   6  
ATOM 8177  H HB1  . ALA A 1 67  ? 6.020   -5.294  -2.506  1.00 0.00 ? 67  ALA A HB1  6  
ATOM 8178  H HB2  . ALA A 1 67  ? 5.244   -3.710  -2.522  1.00 0.00 ? 67  ALA A HB2  6  
ATOM 8179  H HB3  . ALA A 1 67  ? 5.810   -4.430  -4.029  1.00 0.00 ? 67  ALA A HB3  6  
ATOM 8180  N N    . LYS A 1 68  ? 8.130   -4.783  -0.777  1.00 0.00 ? 68  LYS A N    6  
ATOM 8181  C CA   . LYS A 1 68  ? 8.516   -4.892  0.625   1.00 0.00 ? 68  LYS A CA   6  
ATOM 8182  C C    . LYS A 1 68  ? 9.645   -3.921  0.956   1.00 0.00 ? 68  LYS A C    6  
ATOM 8183  O O    . LYS A 1 68  ? 9.570   -3.178  1.935   1.00 0.00 ? 68  LYS A O    6  
ATOM 8184  C CB   . LYS A 1 68  ? 8.950   -6.324  0.947   1.00 0.00 ? 68  LYS A CB   6  
ATOM 8185  C CG   . LYS A 1 68  ? 9.342   -6.529  2.400   1.00 0.00 ? 68  LYS A CG   6  
ATOM 8186  C CD   . LYS A 1 68  ? 10.387  -7.622  2.546   1.00 0.00 ? 68  LYS A CD   6  
ATOM 8187  C CE   . LYS A 1 68  ? 9.744   -8.995  2.669   1.00 0.00 ? 68  LYS A CE   6  
ATOM 8188  N NZ   . LYS A 1 68  ? 10.678  -10.083 2.267   1.00 0.00 ? 68  LYS A NZ   6  
ATOM 8189  H H    . LYS A 1 68  ? 8.160   -5.583  -1.344  1.00 0.00 ? 68  LYS A H    6  
ATOM 8190  H HA   . LYS A 1 68  ? 7.654   -4.642  1.226   1.00 0.00 ? 68  LYS A HA   6  
ATOM 8191  H HB2  . LYS A 1 68  ? 8.134   -6.994  0.718   1.00 0.00 ? 68  LYS A HB2  6  
ATOM 8192  H HB3  . LYS A 1 68  ? 9.798   -6.578  0.328   1.00 0.00 ? 68  LYS A HB3  6  
ATOM 8193  H HG2  . LYS A 1 68  ? 9.746   -5.605  2.788   1.00 0.00 ? 68  LYS A HG2  6  
ATOM 8194  H HG3  . LYS A 1 68  ? 8.463   -6.805  2.965   1.00 0.00 ? 68  LYS A HG3  6  
ATOM 8195  H HD2  . LYS A 1 68  ? 11.028  -7.614  1.677   1.00 0.00 ? 68  LYS A HD2  6  
ATOM 8196  H HD3  . LYS A 1 68  ? 10.976  -7.429  3.432   1.00 0.00 ? 68  LYS A HD3  6  
ATOM 8197  H HE2  . LYS A 1 68  ? 9.447   -9.148  3.695   1.00 0.00 ? 68  LYS A HE2  6  
ATOM 8198  H HE3  . LYS A 1 68  ? 8.872   -9.027  2.033   1.00 0.00 ? 68  LYS A HE3  6  
ATOM 8199  H HZ1  . LYS A 1 68  ? 11.558  -10.019 2.818   1.00 0.00 ? 68  LYS A HZ1  6  
ATOM 8200  H HZ2  . LYS A 1 68  ? 10.908  -10.001 1.257   1.00 0.00 ? 68  LYS A HZ2  6  
ATOM 8201  H HZ3  . LYS A 1 68  ? 10.241  -11.011 2.438   1.00 0.00 ? 68  LYS A HZ3  6  
ATOM 8202  N N    . ALA A 1 69  ? 10.688  -3.931  0.134   1.00 0.00 ? 69  ALA A N    6  
ATOM 8203  C CA   . ALA A 1 69  ? 11.831  -3.049  0.337   1.00 0.00 ? 69  ALA A CA   6  
ATOM 8204  C C    . ALA A 1 69  ? 11.389  -1.593  0.436   1.00 0.00 ? 69  ALA A C    6  
ATOM 8205  O O    . ALA A 1 69  ? 12.063  -0.770  1.055   1.00 0.00 ? 69  ALA A O    6  
ATOM 8206  C CB   . ALA A 1 69  ? 12.838  -3.222  -0.789  1.00 0.00 ? 69  ALA A CB   6  
ATOM 8207  H H    . ALA A 1 69  ? 10.689  -4.546  -0.629  1.00 0.00 ? 69  ALA A H    6  
ATOM 8208  H HA   . ALA A 1 69  ? 12.310  -3.333  1.263   1.00 0.00 ? 69  ALA A HA   6  
ATOM 8209  H HB1  . ALA A 1 69  ? 12.689  -2.447  -1.527  1.00 0.00 ? 69  ALA A HB1  6  
ATOM 8210  H HB2  . ALA A 1 69  ? 13.839  -3.152  -0.390  1.00 0.00 ? 69  ALA A HB2  6  
ATOM 8211  H HB3  . ALA A 1 69  ? 12.701  -4.189  -1.250  1.00 0.00 ? 69  ALA A HB3  6  
ATOM 8212  N N    . ALA A 1 70  ? 10.253  -1.281  -0.179  1.00 0.00 ? 70  ALA A N    6  
ATOM 8213  C CA   . ALA A 1 70  ? 9.721   0.076   -0.159  1.00 0.00 ? 70  ALA A CA   6  
ATOM 8214  C C    . ALA A 1 70  ? 8.825   0.297   1.055   1.00 0.00 ? 70  ALA A C    6  
ATOM 8215  O O    . ALA A 1 70  ? 8.607   1.431   1.480   1.00 0.00 ? 70  ALA A O    6  
ATOM 8216  C CB   . ALA A 1 70  ? 8.954   0.361   -1.442  1.00 0.00 ? 70  ALA A CB   6  
ATOM 8217  H H    . ALA A 1 70  ? 9.760   -1.981  -0.656  1.00 0.00 ? 70  ALA A H    6  
ATOM 8218  H HA   . ALA A 1 70  ? 10.555  0.761   -0.108  1.00 0.00 ? 70  ALA A HA   6  
ATOM 8219  H HB1  . ALA A 1 70  ? 9.391   1.214   -1.940  1.00 0.00 ? 70  ALA A HB1  6  
ATOM 8220  H HB2  . ALA A 1 70  ? 9.005   -0.501  -2.091  1.00 0.00 ? 70  ALA A HB2  6  
ATOM 8221  H HB3  . ALA A 1 70  ? 7.922   0.573   -1.205  1.00 0.00 ? 70  ALA A HB3  6  
ATOM 8222  N N    . LYS A 1 71  ? 8.308   -0.795  1.609   1.00 0.00 ? 71  LYS A N    6  
ATOM 8223  C CA   . LYS A 1 71  ? 7.436   -0.721  2.776   1.00 0.00 ? 71  LYS A CA   6  
ATOM 8224  C C    . LYS A 1 71  ? 8.246   -0.482  4.046   1.00 0.00 ? 71  LYS A C    6  
ATOM 8225  O O    . LYS A 1 71  ? 7.840   0.289   4.915   1.00 0.00 ? 71  LYS A O    6  
ATOM 8226  C CB   . LYS A 1 71  ? 6.623   -2.010  2.912   1.00 0.00 ? 71  LYS A CB   6  
ATOM 8227  C CG   . LYS A 1 71  ? 5.795   -2.075  4.183   1.00 0.00 ? 71  LYS A CG   6  
ATOM 8228  C CD   . LYS A 1 71  ? 4.639   -3.053  4.047   1.00 0.00 ? 71  LYS A CD   6  
ATOM 8229  C CE   . LYS A 1 71  ? 5.039   -4.453  4.487   1.00 0.00 ? 71  LYS A CE   6  
ATOM 8230  N NZ   . LYS A 1 71  ? 5.020   -4.595  5.969   1.00 0.00 ? 71  LYS A NZ   6  
ATOM 8231  H H    . LYS A 1 71  ? 8.519   -1.672  1.225   1.00 0.00 ? 71  LYS A H    6  
ATOM 8232  H HA   . LYS A 1 71  ? 6.760   0.108   2.633   1.00 0.00 ? 71  LYS A HA   6  
ATOM 8233  H HB2  . LYS A 1 71  ? 5.954   -2.090  2.067   1.00 0.00 ? 71  LYS A HB2  6  
ATOM 8234  H HB3  . LYS A 1 71  ? 7.300   -2.852  2.905   1.00 0.00 ? 71  LYS A HB3  6  
ATOM 8235  H HG2  . LYS A 1 71  ? 6.427   -2.394  4.998   1.00 0.00 ? 71  LYS A HG2  6  
ATOM 8236  H HG3  . LYS A 1 71  ? 5.399   -1.092  4.395   1.00 0.00 ? 71  LYS A HG3  6  
ATOM 8237  H HD2  . LYS A 1 71  ? 3.819   -2.715  4.662   1.00 0.00 ? 71  LYS A HD2  6  
ATOM 8238  H HD3  . LYS A 1 71  ? 4.327   -3.085  3.013   1.00 0.00 ? 71  LYS A HD3  6  
ATOM 8239  H HE2  . LYS A 1 71  ? 4.348   -5.162  4.057   1.00 0.00 ? 71  LYS A HE2  6  
ATOM 8240  H HE3  . LYS A 1 71  ? 6.036   -4.659  4.126   1.00 0.00 ? 71  LYS A HE3  6  
ATOM 8241  H HZ1  . LYS A 1 71  ? 4.893   -5.594  6.230   1.00 0.00 ? 71  LYS A HZ1  6  
ATOM 8242  H HZ2  . LYS A 1 71  ? 4.238   -4.041  6.371   1.00 0.00 ? 71  LYS A HZ2  6  
ATOM 8243  H HZ3  . LYS A 1 71  ? 5.916   -4.254  6.372   1.00 0.00 ? 71  LYS A HZ3  6  
ATOM 8244  N N    . GLU A 1 72  ? 9.392   -1.148  4.146   1.00 0.00 ? 72  GLU A N    6  
ATOM 8245  C CA   . GLU A 1 72  ? 10.258  -1.006  5.311   1.00 0.00 ? 72  GLU A CA   6  
ATOM 8246  C C    . GLU A 1 72  ? 10.770  0.426   5.437   1.00 0.00 ? 72  GLU A C    6  
ATOM 8247  O O    . GLU A 1 72  ? 11.039  0.905   6.538   1.00 0.00 ? 72  GLU A O    6  
ATOM 8248  C CB   . GLU A 1 72  ? 11.439  -1.975  5.217   1.00 0.00 ? 72  GLU A CB   6  
ATOM 8249  C CG   . GLU A 1 72  ? 11.034  -3.395  4.859   1.00 0.00 ? 72  GLU A CG   6  
ATOM 8250  C CD   . GLU A 1 72  ? 10.789  -4.258  6.082   1.00 0.00 ? 72  GLU A CD   6  
ATOM 8251  O OE1  . GLU A 1 72  ? 10.006  -3.837  6.959   1.00 0.00 ? 72  GLU A OE1  6  
ATOM 8252  O OE2  . GLU A 1 72  ? 11.380  -5.355  6.161   1.00 0.00 ? 72  GLU A OE2  6  
ATOM 8253  H H    . GLU A 1 72  ? 9.662   -1.749  3.420   1.00 0.00 ? 72  GLU A H    6  
ATOM 8254  H HA   . GLU A 1 72  ? 9.676   -1.246  6.188   1.00 0.00 ? 72  GLU A HA   6  
ATOM 8255  H HB2  . GLU A 1 72  ? 12.124  -1.617  4.463   1.00 0.00 ? 72  GLU A HB2  6  
ATOM 8256  H HB3  . GLU A 1 72  ? 11.946  -1.998  6.170   1.00 0.00 ? 72  GLU A HB3  6  
ATOM 8257  H HG2  . GLU A 1 72  ? 10.126  -3.361  4.275   1.00 0.00 ? 72  GLU A HG2  6  
ATOM 8258  H HG3  . GLU A 1 72  ? 11.822  -3.844  4.272   1.00 0.00 ? 72  GLU A HG3  6  
ATOM 8259  N N    . ALA A 1 73  ? 10.903  1.103   4.301   1.00 0.00 ? 73  ALA A N    6  
ATOM 8260  C CA   . ALA A 1 73  ? 11.381  2.480   4.284   1.00 0.00 ? 73  ALA A CA   6  
ATOM 8261  C C    . ALA A 1 73  ? 10.233  3.462   4.491   1.00 0.00 ? 73  ALA A C    6  
ATOM 8262  O O    . ALA A 1 73  ? 10.327  4.377   5.309   1.00 0.00 ? 73  ALA A O    6  
ATOM 8263  C CB   . ALA A 1 73  ? 12.099  2.773   2.975   1.00 0.00 ? 73  ALA A CB   6  
ATOM 8264  H H    . ALA A 1 73  ? 10.672  0.666   3.455   1.00 0.00 ? 73  ALA A H    6  
ATOM 8265  H HA   . ALA A 1 73  ? 12.092  2.596   5.089   1.00 0.00 ? 73  ALA A HA   6  
ATOM 8266  H HB1  . ALA A 1 73  ? 11.450  3.348   2.330   1.00 0.00 ? 73  ALA A HB1  6  
ATOM 8267  H HB2  . ALA A 1 73  ? 12.998  3.335   3.175   1.00 0.00 ? 73  ALA A HB2  6  
ATOM 8268  H HB3  . ALA A 1 73  ? 12.356  1.843   2.490   1.00 0.00 ? 73  ALA A HB3  6  
ATOM 8269  N N    . MET A 1 74  ? 9.151   3.266   3.745   1.00 0.00 ? 74  MET A N    6  
ATOM 8270  C CA   . MET A 1 74  ? 7.985   4.136   3.849   1.00 0.00 ? 74  MET A CA   6  
ATOM 8271  C C    . MET A 1 74  ? 7.053   3.666   4.962   1.00 0.00 ? 74  MET A C    6  
ATOM 8272  O O    . MET A 1 74  ? 5.931   4.153   5.090   1.00 0.00 ? 74  MET A O    6  
ATOM 8273  C CB   . MET A 1 74  ? 7.230   4.173   2.518   1.00 0.00 ? 74  MET A CB   6  
ATOM 8274  C CG   . MET A 1 74  ? 7.765   5.211   1.545   1.00 0.00 ? 74  MET A CG   6  
ATOM 8275  S SD   . MET A 1 74  ? 7.601   6.896   2.167   1.00 0.00 ? 74  MET A SD   6  
ATOM 8276  C CE   . MET A 1 74  ? 5.820   7.087   2.160   1.00 0.00 ? 74  MET A CE   6  
ATOM 8277  H H    . MET A 1 74  ? 9.135   2.520   3.111   1.00 0.00 ? 74  MET A H    6  
ATOM 8278  H HA   . MET A 1 74  ? 8.333   5.131   4.083   1.00 0.00 ? 74  MET A HA   6  
ATOM 8279  H HB2  . MET A 1 74  ? 7.301   3.203   2.051   1.00 0.00 ? 74  MET A HB2  6  
ATOM 8280  H HB3  . MET A 1 74  ? 6.191   4.396   2.713   1.00 0.00 ? 74  MET A HB3  6  
ATOM 8281  H HG2  . MET A 1 74  ? 8.810   5.011   1.364   1.00 0.00 ? 74  MET A HG2  6  
ATOM 8282  H HG3  . MET A 1 74  ? 7.218   5.129   0.618   1.00 0.00 ? 74  MET A HG3  6  
ATOM 8283  H HE1  . MET A 1 74  ? 5.555   8.008   2.659   1.00 0.00 ? 74  MET A HE1  6  
ATOM 8284  H HE2  . MET A 1 74  ? 5.466   7.115   1.140   1.00 0.00 ? 74  MET A HE2  6  
ATOM 8285  H HE3  . MET A 1 74  ? 5.367   6.254   2.677   1.00 0.00 ? 74  MET A HE3  6  
ATOM 8286  N N    . GLU A 1 75  ? 7.528   2.717   5.764   1.00 0.00 ? 75  GLU A N    6  
ATOM 8287  C CA   . GLU A 1 75  ? 6.736   2.182   6.865   1.00 0.00 ? 75  GLU A CA   6  
ATOM 8288  C C    . GLU A 1 75  ? 6.169   3.308   7.725   1.00 0.00 ? 75  GLU A C    6  
ATOM 8289  O O    . GLU A 1 75  ? 5.010   3.265   8.138   1.00 0.00 ? 75  GLU A O    6  
ATOM 8290  C CB   . GLU A 1 75  ? 7.586   1.246   7.726   1.00 0.00 ? 75  GLU A CB   6  
ATOM 8291  C CG   . GLU A 1 75  ? 8.774   1.932   8.380   1.00 0.00 ? 75  GLU A CG   6  
ATOM 8292  C CD   . GLU A 1 75  ? 9.595   0.988   9.236   1.00 0.00 ? 75  GLU A CD   6  
ATOM 8293  O OE1  . GLU A 1 75  ? 9.047   0.454   10.224  1.00 0.00 ? 75  GLU A OE1  6  
ATOM 8294  O OE2  . GLU A 1 75  ? 10.785  0.782   8.918   1.00 0.00 ? 75  GLU A OE2  6  
ATOM 8295  H H    . GLU A 1 75  ? 8.431   2.369   5.611   1.00 0.00 ? 75  GLU A H    6  
ATOM 8296  H HA   . GLU A 1 75  ? 5.916   1.621   6.442   1.00 0.00 ? 75  GLU A HA   6  
ATOM 8297  H HB2  . GLU A 1 75  ? 6.964   0.828   8.504   1.00 0.00 ? 75  GLU A HB2  6  
ATOM 8298  H HB3  . GLU A 1 75  ? 7.958   0.445   7.105   1.00 0.00 ? 75  GLU A HB3  6  
ATOM 8299  H HG2  . GLU A 1 75  ? 9.410   2.338   7.608   1.00 0.00 ? 75  GLU A HG2  6  
ATOM 8300  H HG3  . GLU A 1 75  ? 8.410   2.736   9.004   1.00 0.00 ? 75  GLU A HG3  6  
ATOM 8301  N N    . ASP A 1 76  ? 6.994   4.314   7.991   1.00 0.00 ? 76  ASP A N    6  
ATOM 8302  C CA   . ASP A 1 76  ? 6.577   5.453   8.801   1.00 0.00 ? 76  ASP A CA   6  
ATOM 8303  C C    . ASP A 1 76  ? 6.676   6.751   8.006   1.00 0.00 ? 76  ASP A C    6  
ATOM 8304  O O    . ASP A 1 76  ? 6.639   7.842   8.573   1.00 0.00 ? 76  ASP A O    6  
ATOM 8305  C CB   . ASP A 1 76  ? 7.432   5.547   10.065  1.00 0.00 ? 76  ASP A CB   6  
ATOM 8306  C CG   . ASP A 1 76  ? 8.846   6.009   9.774   1.00 0.00 ? 76  ASP A CG   6  
ATOM 8307  O OD1  . ASP A 1 76  ? 9.085   7.235   9.791   1.00 0.00 ? 76  ASP A OD1  6  
ATOM 8308  O OD2  . ASP A 1 76  ? 9.714   5.146   9.528   1.00 0.00 ? 76  ASP A OD2  6  
ATOM 8309  H H    . ASP A 1 76  ? 7.907   4.291   7.633   1.00 0.00 ? 76  ASP A H    6  
ATOM 8310  H HA   . ASP A 1 76  ? 5.547   5.297   9.085   1.00 0.00 ? 76  ASP A HA   6  
ATOM 8311  H HB2  . ASP A 1 76  ? 6.977   6.250   10.748  1.00 0.00 ? 76  ASP A HB2  6  
ATOM 8312  H HB3  . ASP A 1 76  ? 7.479   4.575   10.534  1.00 0.00 ? 76  ASP A HB3  6  
ATOM 8313  N N    . GLY A 1 77  ? 6.802   6.624   6.689   1.00 0.00 ? 77  GLY A N    6  
ATOM 8314  C CA   . GLY A 1 77  ? 6.906   7.795   5.837   1.00 0.00 ? 77  GLY A CA   6  
ATOM 8315  C C    . GLY A 1 77  ? 5.598   8.554   5.733   1.00 0.00 ? 77  GLY A C    6  
ATOM 8316  O O    . GLY A 1 77  ? 4.534   8.011   6.027   1.00 0.00 ? 77  GLY A O    6  
ATOM 8317  H H    . GLY A 1 77  ? 6.825   5.729   6.291   1.00 0.00 ? 77  GLY A H    6  
ATOM 8318  H HA2  . GLY A 1 77  ? 7.661   8.454   6.240   1.00 0.00 ? 77  GLY A HA2  6  
ATOM 8319  H HA3  . GLY A 1 77  ? 7.206   7.482   4.848   1.00 0.00 ? 77  GLY A HA3  6  
ATOM 8320  N N    . GLU A 1 78  ? 5.678   9.814   5.315   1.00 0.00 ? 78  GLU A N    6  
ATOM 8321  C CA   . GLU A 1 78  ? 4.490   10.648  5.176   1.00 0.00 ? 78  GLU A CA   6  
ATOM 8322  C C    . GLU A 1 78  ? 4.503   11.396  3.846   1.00 0.00 ? 78  GLU A C    6  
ATOM 8323  O O    . GLU A 1 78  ? 5.400   12.197  3.581   1.00 0.00 ? 78  GLU A O    6  
ATOM 8324  C CB   . GLU A 1 78  ? 4.402   11.646  6.333   1.00 0.00 ? 78  GLU A CB   6  
ATOM 8325  C CG   . GLU A 1 78  ? 5.684   12.429  6.560   1.00 0.00 ? 78  GLU A CG   6  
ATOM 8326  C CD   . GLU A 1 78  ? 5.552   13.456  7.668   1.00 0.00 ? 78  GLU A CD   6  
ATOM 8327  O OE1  . GLU A 1 78  ? 5.162   14.604  7.369   1.00 0.00 ? 78  GLU A OE1  6  
ATOM 8328  O OE2  . GLU A 1 78  ? 5.838   13.111  8.834   1.00 0.00 ? 78  GLU A OE2  6  
ATOM 8329  H H    . GLU A 1 78  ? 6.555   10.190  5.096   1.00 0.00 ? 78  GLU A H    6  
ATOM 8330  H HA   . GLU A 1 78  ? 3.626   10.002  5.204   1.00 0.00 ? 78  GLU A HA   6  
ATOM 8331  H HB2  . GLU A 1 78  ? 3.607   12.347  6.128   1.00 0.00 ? 78  GLU A HB2  6  
ATOM 8332  H HB3  . GLU A 1 78  ? 4.169   11.107  7.240   1.00 0.00 ? 78  GLU A HB3  6  
ATOM 8333  H HG2  . GLU A 1 78  ? 6.471   11.738  6.823   1.00 0.00 ? 78  GLU A HG2  6  
ATOM 8334  H HG3  . GLU A 1 78  ? 5.945   12.940  5.645   1.00 0.00 ? 78  GLU A HG3  6  
ATOM 8335  N N    . ILE A 1 79  ? 3.504   11.126  3.013   1.00 0.00 ? 79  ILE A N    6  
ATOM 8336  C CA   . ILE A 1 79  ? 3.400   11.773  1.711   1.00 0.00 ? 79  ILE A CA   6  
ATOM 8337  C C    . ILE A 1 79  ? 2.658   13.101  1.814   1.00 0.00 ? 79  ILE A C    6  
ATOM 8338  O O    . ILE A 1 79  ? 1.638   13.203  2.496   1.00 0.00 ? 79  ILE A O    6  
ATOM 8339  C CB   . ILE A 1 79  ? 2.678   10.873  0.691   1.00 0.00 ? 79  ILE A CB   6  
ATOM 8340  C CG1  . ILE A 1 79  ? 3.204   9.439   0.781   1.00 0.00 ? 79  ILE A CG1  6  
ATOM 8341  C CG2  . ILE A 1 79  ? 2.855   11.420  -0.718  1.00 0.00 ? 79  ILE A CG2  6  
ATOM 8342  C CD1  . ILE A 1 79  ? 2.639   8.520   -0.280  1.00 0.00 ? 79  ILE A CD1  6  
ATOM 8343  H H    . ILE A 1 79  ? 2.820   10.478  3.280   1.00 0.00 ? 79  ILE A H    6  
ATOM 8344  H HA   . ILE A 1 79  ? 4.402   11.959  1.350   1.00 0.00 ? 79  ILE A HA   6  
ATOM 8345  H HB   . ILE A 1 79  ? 1.624   10.878  0.923   1.00 0.00 ? 79  ILE A HB   6  
ATOM 8346  H HG12 . ILE A 1 79  ? 4.277   9.448   0.674   1.00 0.00 ? 79  ILE A HG12 6  
ATOM 8347  H HG13 . ILE A 1 79  ? 2.946   9.029   1.747   1.00 0.00 ? 79  ILE A HG13 6  
ATOM 8348  H HG21 . ILE A 1 79  ? 2.910   12.498  -0.681  1.00 0.00 ? 79  ILE A HG21 6  
ATOM 8349  H HG22 . ILE A 1 79  ? 3.767   11.028  -1.143  1.00 0.00 ? 79  ILE A HG22 6  
ATOM 8350  H HG23 . ILE A 1 79  ? 2.015   11.123  -1.328  1.00 0.00 ? 79  ILE A HG23 6  
ATOM 8351  H HD11 . ILE A 1 79  ? 1.869   7.899   0.154   1.00 0.00 ? 79  ILE A HD11 6  
ATOM 8352  H HD12 . ILE A 1 79  ? 2.219   9.110   -1.080  1.00 0.00 ? 79  ILE A HD12 6  
ATOM 8353  H HD13 . ILE A 1 79  ? 3.429   7.894   -0.670  1.00 0.00 ? 79  ILE A HD13 6  
ATOM 8354  N N    . ASP A 1 80  ? 3.176   14.117  1.132   1.00 0.00 ? 80  ASP A N    6  
ATOM 8355  C CA   . ASP A 1 80  ? 2.562   15.439  1.144   1.00 0.00 ? 80  ASP A CA   6  
ATOM 8356  C C    . ASP A 1 80  ? 2.272   15.890  2.572   1.00 0.00 ? 80  ASP A C    6  
ATOM 8357  O O    . ASP A 1 80  ? 1.165   16.327  2.884   1.00 0.00 ? 80  ASP A O    6  
ATOM 8358  C CB   . ASP A 1 80  ? 1.270   15.432  0.326   1.00 0.00 ? 80  ASP A CB   6  
ATOM 8359  C CG   . ASP A 1 80  ? 1.507   15.765  -1.134  1.00 0.00 ? 80  ASP A CG   6  
ATOM 8360  O OD1  . ASP A 1 80  ? 2.683   15.784  -1.555  1.00 0.00 ? 80  ASP A OD1  6  
ATOM 8361  O OD2  . ASP A 1 80  ? 0.517   16.005  -1.855  1.00 0.00 ? 80  ASP A OD2  6  
ATOM 8362  H H    . ASP A 1 80  ? 3.992   13.973  0.607   1.00 0.00 ? 80  ASP A H    6  
ATOM 8363  H HA   . ASP A 1 80  ? 3.257   16.132  0.696   1.00 0.00 ? 80  ASP A HA   6  
ATOM 8364  H HB2  . ASP A 1 80  ? 0.820   14.452  0.384   1.00 0.00 ? 80  ASP A HB2  6  
ATOM 8365  H HB3  . ASP A 1 80  ? 0.587   16.162  0.737   1.00 0.00 ? 80  ASP A HB3  6  
ATOM 8366  N N    . GLY A 1 81  ? 3.275   15.780  3.438   1.00 0.00 ? 81  GLY A N    6  
ATOM 8367  C CA   . GLY A 1 81  ? 3.107   16.179  4.823   1.00 0.00 ? 81  GLY A CA   6  
ATOM 8368  C C    . GLY A 1 81  ? 1.985   15.428  5.511   1.00 0.00 ? 81  GLY A C    6  
ATOM 8369  O O    . GLY A 1 81  ? 1.382   15.930  6.458   1.00 0.00 ? 81  GLY A O    6  
ATOM 8370  H H    . GLY A 1 81  ? 4.136   15.424  3.133   1.00 0.00 ? 81  GLY A H    6  
ATOM 8371  H HA2  . GLY A 1 81  ? 4.029   15.994  5.354   1.00 0.00 ? 81  GLY A HA2  6  
ATOM 8372  H HA3  . GLY A 1 81  ? 2.890   17.237  4.857   1.00 0.00 ? 81  GLY A HA3  6  
ATOM 8373  N N    . ASN A 1 82  ? 1.703   14.220  5.032   1.00 0.00 ? 82  ASN A N    6  
ATOM 8374  C CA   . ASN A 1 82  ? 0.643   13.399  5.607   1.00 0.00 ? 82  ASN A CA   6  
ATOM 8375  C C    . ASN A 1 82  ? 1.127   11.970  5.837   1.00 0.00 ? 82  ASN A C    6  
ATOM 8376  O O    . ASN A 1 82  ? 1.703   11.347  4.945   1.00 0.00 ? 82  ASN A O    6  
ATOM 8377  C CB   . ASN A 1 82  ? -0.581  13.394  4.689   1.00 0.00 ? 82  ASN A CB   6  
ATOM 8378  C CG   . ASN A 1 82  ? -1.428  14.641  4.848   1.00 0.00 ? 82  ASN A CG   6  
ATOM 8379  O OD1  . ASN A 1 82  ? -1.111  15.522  5.647   1.00 0.00 ? 82  ASN A OD1  6  
ATOM 8380  N ND2  . ASN A 1 82  ? -2.513  14.720  4.086   1.00 0.00 ? 82  ASN A ND2  6  
ATOM 8381  H H    . ASN A 1 82  ? 2.219   13.873  4.275   1.00 0.00 ? 82  ASN A H    6  
ATOM 8382  H HA   . ASN A 1 82  ? 0.368   13.831  6.557   1.00 0.00 ? 82  ASN A HA   6  
ATOM 8383  H HB2  . ASN A 1 82  ? -0.252  13.334  3.661   1.00 0.00 ? 82  ASN A HB2  6  
ATOM 8384  H HB3  . ASN A 1 82  ? -1.192  12.533  4.917   1.00 0.00 ? 82  ASN A HB3  6  
ATOM 8385  H HD21 . ASN A 1 82  ? -2.703  13.980  3.472   1.00 0.00 ? 82  ASN A HD21 6  
ATOM 8386  H HD22 . ASN A 1 82  ? -3.079  15.516  4.168   1.00 0.00 ? 82  ASN A HD22 6  
ATOM 8387  N N    . LYS A 1 83  ? 0.887   11.457  7.038   1.00 0.00 ? 83  LYS A N    6  
ATOM 8388  C CA   . LYS A 1 83  ? 1.295   10.101  7.387   1.00 0.00 ? 83  LYS A CA   6  
ATOM 8389  C C    . LYS A 1 83  ? 0.508   9.072   6.582   1.00 0.00 ? 83  LYS A C    6  
ATOM 8390  O O    . LYS A 1 83  ? -0.720  9.134   6.508   1.00 0.00 ? 83  LYS A O    6  
ATOM 8391  C CB   . LYS A 1 83  ? 1.095   9.855   8.884   1.00 0.00 ? 83  LYS A CB   6  
ATOM 8392  C CG   . LYS A 1 83  ? -0.363  9.739   9.292   1.00 0.00 ? 83  LYS A CG   6  
ATOM 8393  C CD   . LYS A 1 83  ? -0.555  10.045  10.768  1.00 0.00 ? 83  LYS A CD   6  
ATOM 8394  C CE   . LYS A 1 83  ? -0.586  11.543  11.028  1.00 0.00 ? 83  LYS A CE   6  
ATOM 8395  N NZ   . LYS A 1 83  ? -1.430  11.885  12.205  1.00 0.00 ? 83  LYS A NZ   6  
ATOM 8396  H H    . LYS A 1 83  ? 0.423   12.003  7.708   1.00 0.00 ? 83  LYS A H    6  
ATOM 8397  H HA   . LYS A 1 83  ? 2.344   9.999   7.151   1.00 0.00 ? 83  LYS A HA   6  
ATOM 8398  H HB2  . LYS A 1 83  ? 1.598   8.939   9.156   1.00 0.00 ? 83  LYS A HB2  6  
ATOM 8399  H HB3  . LYS A 1 83  ? 1.537   10.675  9.433   1.00 0.00 ? 83  LYS A HB3  6  
ATOM 8400  H HG2  . LYS A 1 83  ? -0.947  10.438  8.712   1.00 0.00 ? 83  LYS A HG2  6  
ATOM 8401  H HG3  . LYS A 1 83  ? -0.703  8.732   9.095   1.00 0.00 ? 83  LYS A HG3  6  
ATOM 8402  H HD2  . LYS A 1 83  ? -1.490  9.615   11.097  1.00 0.00 ? 83  LYS A HD2  6  
ATOM 8403  H HD3  . LYS A 1 83  ? 0.260   9.608   11.326  1.00 0.00 ? 83  LYS A HD3  6  
ATOM 8404  H HE2  . LYS A 1 83  ? 0.422   11.885  11.207  1.00 0.00 ? 83  LYS A HE2  6  
ATOM 8405  H HE3  . LYS A 1 83  ? -0.983  12.038  10.154  1.00 0.00 ? 83  LYS A HE3  6  
ATOM 8406  H HZ1  . LYS A 1 83  ? -1.145  12.807  12.593  1.00 0.00 ? 83  LYS A HZ1  6  
ATOM 8407  H HZ2  . LYS A 1 83  ? -1.322  11.162  12.945  1.00 0.00 ? 83  LYS A HZ2  6  
ATOM 8408  H HZ3  . LYS A 1 83  ? -2.431  11.933  11.926  1.00 0.00 ? 83  LYS A HZ3  6  
ATOM 8409  N N    . VAL A 1 84  ? 1.221   8.125   5.982   1.00 0.00 ? 84  VAL A N    6  
ATOM 8410  C CA   . VAL A 1 84  ? 0.589   7.080   5.185   1.00 0.00 ? 84  VAL A CA   6  
ATOM 8411  C C    . VAL A 1 84  ? 0.880   5.698   5.759   1.00 0.00 ? 84  VAL A C    6  
ATOM 8412  O O    . VAL A 1 84  ? 1.917   5.480   6.387   1.00 0.00 ? 84  VAL A O    6  
ATOM 8413  C CB   . VAL A 1 84  ? 1.064   7.126   3.721   1.00 0.00 ? 84  VAL A CB   6  
ATOM 8414  C CG1  . VAL A 1 84  ? 0.754   8.480   3.101   1.00 0.00 ? 84  VAL A CG1  6  
ATOM 8415  C CG2  . VAL A 1 84  ? 2.551   6.818   3.634   1.00 0.00 ? 84  VAL A CG2  6  
ATOM 8416  H H    . VAL A 1 84  ? 2.196   8.128   6.078   1.00 0.00 ? 84  VAL A H    6  
ATOM 8417  H HA   . VAL A 1 84  ? -0.478  7.248   5.201   1.00 0.00 ? 84  VAL A HA   6  
ATOM 8418  H HB   . VAL A 1 84  ? 0.528   6.370   3.166   1.00 0.00 ? 84  VAL A HB   6  
ATOM 8419  H HG11 . VAL A 1 84  ? 1.007   8.461   2.051   1.00 0.00 ? 84  VAL A HG11 6  
ATOM 8420  H HG12 . VAL A 1 84  ? -0.298  8.697   3.216   1.00 0.00 ? 84  VAL A HG12 6  
ATOM 8421  H HG13 . VAL A 1 84  ? 1.336   9.244   3.596   1.00 0.00 ? 84  VAL A HG13 6  
ATOM 8422  H HG21 . VAL A 1 84  ? 2.761   5.906   4.172   1.00 0.00 ? 84  VAL A HG21 6  
ATOM 8423  H HG22 . VAL A 1 84  ? 2.834   6.699   2.598   1.00 0.00 ? 84  VAL A HG22 6  
ATOM 8424  H HG23 . VAL A 1 84  ? 3.113   7.631   4.069   1.00 0.00 ? 84  VAL A HG23 6  
ATOM 8425  N N    . THR A 1 85  ? -0.042  4.766   5.540   1.00 0.00 ? 85  THR A N    6  
ATOM 8426  C CA   . THR A 1 85  ? 0.115   3.405   6.036   1.00 0.00 ? 85  THR A CA   6  
ATOM 8427  C C    . THR A 1 85  ? 0.123   2.399   4.890   1.00 0.00 ? 85  THR A C    6  
ATOM 8428  O O    . THR A 1 85  ? -0.848  2.290   4.140   1.00 0.00 ? 85  THR A O    6  
ATOM 8429  C CB   . THR A 1 85  ? -1.009  3.033   7.022   1.00 0.00 ? 85  THR A CB   6  
ATOM 8430  O OG1  . THR A 1 85  ? -0.872  3.792   8.229   1.00 0.00 ? 85  THR A OG1  6  
ATOM 8431  C CG2  . THR A 1 85  ? -0.976  1.547   7.345   1.00 0.00 ? 85  THR A CG2  6  
ATOM 8432  H H    . THR A 1 85  ? -0.847  5.001   5.033   1.00 0.00 ? 85  THR A H    6  
ATOM 8433  H HA   . THR A 1 85  ? 1.058   3.347   6.559   1.00 0.00 ? 85  THR A HA   6  
ATOM 8434  H HB   . THR A 1 85  ? -1.960  3.266   6.565   1.00 0.00 ? 85  THR A HB   6  
ATOM 8435  H HG1  . THR A 1 85  ? -0.409  4.612   8.041   1.00 0.00 ? 85  THR A HG1  6  
ATOM 8436  H HG21 . THR A 1 85  ? 0.020   1.269   7.660   1.00 0.00 ? 85  THR A HG21 6  
ATOM 8437  H HG22 . THR A 1 85  ? -1.247  0.981   6.466   1.00 0.00 ? 85  THR A HG22 6  
ATOM 8438  H HG23 . THR A 1 85  ? -1.676  1.336   8.139   1.00 0.00 ? 85  THR A HG23 6  
ATOM 8439  N N    . LEU A 1 86  ? 1.223   1.666   4.760   1.00 0.00 ? 86  LEU A N    6  
ATOM 8440  C CA   . LEU A 1 86  ? 1.357   0.668   3.705   1.00 0.00 ? 86  LEU A CA   6  
ATOM 8441  C C    . LEU A 1 86  ? 0.930   -0.710  4.201   1.00 0.00 ? 86  LEU A C    6  
ATOM 8442  O O    . LEU A 1 86  ? 1.414   -1.188  5.227   1.00 0.00 ? 86  LEU A O    6  
ATOM 8443  C CB   . LEU A 1 86  ? 2.801   0.618   3.203   1.00 0.00 ? 86  LEU A CB   6  
ATOM 8444  C CG   . LEU A 1 86  ? 3.592   1.923   3.303   1.00 0.00 ? 86  LEU A CG   6  
ATOM 8445  C CD1  . LEU A 1 86  ? 5.009   1.729   2.785   1.00 0.00 ? 86  LEU A CD1  6  
ATOM 8446  C CD2  . LEU A 1 86  ? 2.889   3.033   2.536   1.00 0.00 ? 86  LEU A CD2  6  
ATOM 8447  H H    . LEU A 1 86  ? 1.963   1.799   5.388   1.00 0.00 ? 86  LEU A H    6  
ATOM 8448  H HA   . LEU A 1 86  ? 0.711   0.959   2.890   1.00 0.00 ? 86  LEU A HA   6  
ATOM 8449  H HB2  . LEU A 1 86  ? 3.324   -0.131  3.777   1.00 0.00 ? 86  LEU A HB2  6  
ATOM 8450  H HB3  . LEU A 1 86  ? 2.779   0.322   2.164   1.00 0.00 ? 86  LEU A HB3  6  
ATOM 8451  H HG   . LEU A 1 86  ? 3.654   2.220   4.341   1.00 0.00 ? 86  LEU A HG   6  
ATOM 8452  H HD11 . LEU A 1 86  ? 5.664   1.496   3.611   1.00 0.00 ? 86  LEU A HD11 6  
ATOM 8453  H HD12 . LEU A 1 86  ? 5.343   2.637   2.305   1.00 0.00 ? 86  LEU A HD12 6  
ATOM 8454  H HD13 . LEU A 1 86  ? 5.023   0.918   2.073   1.00 0.00 ? 86  LEU A HD13 6  
ATOM 8455  H HD21 . LEU A 1 86  ? 2.682   2.699   1.529   1.00 0.00 ? 86  LEU A HD21 6  
ATOM 8456  H HD22 . LEU A 1 86  ? 3.525   3.906   2.501   1.00 0.00 ? 86  LEU A HD22 6  
ATOM 8457  H HD23 . LEU A 1 86  ? 1.962   3.281   3.030   1.00 0.00 ? 86  LEU A HD23 6  
ATOM 8458  N N    . ASP A 1 87  ? 0.024   -1.344  3.465   1.00 0.00 ? 87  ASP A N    6  
ATOM 8459  C CA   . ASP A 1 87  ? -0.465  -2.669  3.829   1.00 0.00 ? 87  ASP A CA   6  
ATOM 8460  C C    . ASP A 1 87  ? -0.702  -3.520  2.585   1.00 0.00 ? 87  ASP A C    6  
ATOM 8461  O O    . ASP A 1 87  ? -1.306  -3.064  1.615   1.00 0.00 ? 87  ASP A O    6  
ATOM 8462  C CB   . ASP A 1 87  ? -1.757  -2.554  4.638   1.00 0.00 ? 87  ASP A CB   6  
ATOM 8463  C CG   . ASP A 1 87  ? -2.266  -3.902  5.111   1.00 0.00 ? 87  ASP A CG   6  
ATOM 8464  O OD1  . ASP A 1 87  ? -2.676  -4.714  4.256   1.00 0.00 ? 87  ASP A OD1  6  
ATOM 8465  O OD2  . ASP A 1 87  ? -2.254  -4.145  6.336   1.00 0.00 ? 87  ASP A OD2  6  
ATOM 8466  H H    . ASP A 1 87  ? -0.324  -0.911  2.657   1.00 0.00 ? 87  ASP A H    6  
ATOM 8467  H HA   . ASP A 1 87  ? 0.289   -3.145  4.437   1.00 0.00 ? 87  ASP A HA   6  
ATOM 8468  H HB2  . ASP A 1 87  ? -1.578  -1.934  5.504   1.00 0.00 ? 87  ASP A HB2  6  
ATOM 8469  H HB3  . ASP A 1 87  ? -2.519  -2.097  4.024   1.00 0.00 ? 87  ASP A HB3  6  
ATOM 8470  N N    . TRP A 1 88  ? -0.221  -4.758  2.622   1.00 0.00 ? 88  TRP A N    6  
ATOM 8471  C CA   . TRP A 1 88  ? -0.380  -5.673  1.497   1.00 0.00 ? 88  TRP A CA   6  
ATOM 8472  C C    . TRP A 1 88  ? -1.849  -5.811  1.111   1.00 0.00 ? 88  TRP A C    6  
ATOM 8473  O O    . TRP A 1 88  ? -2.680  -6.206  1.928   1.00 0.00 ? 88  TRP A O    6  
ATOM 8474  C CB   . TRP A 1 88  ? 0.200   -7.045  1.844   1.00 0.00 ? 88  TRP A CB   6  
ATOM 8475  C CG   . TRP A 1 88  ? 1.650   -6.999  2.221   1.00 0.00 ? 88  TRP A CG   6  
ATOM 8476  C CD1  . TRP A 1 88  ? 2.194   -7.337  3.427   1.00 0.00 ? 88  TRP A CD1  6  
ATOM 8477  C CD2  . TRP A 1 88  ? 2.740   -6.589  1.388   1.00 0.00 ? 88  TRP A CD2  6  
ATOM 8478  N NE1  . TRP A 1 88  ? 3.556   -7.162  3.394   1.00 0.00 ? 88  TRP A NE1  6  
ATOM 8479  C CE2  . TRP A 1 88  ? 3.916   -6.705  2.154   1.00 0.00 ? 88  TRP A CE2  6  
ATOM 8480  C CE3  . TRP A 1 88  ? 2.837   -6.137  0.069   1.00 0.00 ? 88  TRP A CE3  6  
ATOM 8481  C CZ2  . TRP A 1 88  ? 5.171   -6.384  1.644   1.00 0.00 ? 88  TRP A CZ2  6  
ATOM 8482  C CZ3  . TRP A 1 88  ? 4.083   -5.819  -0.436  1.00 0.00 ? 88  TRP A CZ3  6  
ATOM 8483  C CH2  . TRP A 1 88  ? 5.237   -5.944  0.350   1.00 0.00 ? 88  TRP A CH2  6  
ATOM 8484  H H    . TRP A 1 88  ? 0.252   -5.064  3.424   1.00 0.00 ? 88  TRP A H    6  
ATOM 8485  H HA   . TRP A 1 88  ? 0.164   -5.263  0.659   1.00 0.00 ? 88  TRP A HA   6  
ATOM 8486  H HB2  . TRP A 1 88  ? -0.348  -7.461  2.676   1.00 0.00 ? 88  TRP A HB2  6  
ATOM 8487  H HB3  . TRP A 1 88  ? 0.098   -7.697  0.988   1.00 0.00 ? 88  TRP A HB3  6  
ATOM 8488  H HD1  . TRP A 1 88  ? 1.624   -7.687  4.275   1.00 0.00 ? 88  TRP A HD1  6  
ATOM 8489  H HE1  . TRP A 1 88  ? 4.171   -7.338  4.138   1.00 0.00 ? 88  TRP A HE1  6  
ATOM 8490  H HE3  . TRP A 1 88  ? 1.959   -6.034  -0.552  1.00 0.00 ? 88  TRP A HE3  6  
ATOM 8491  H HZ2  . TRP A 1 88  ? 6.070   -6.476  2.236   1.00 0.00 ? 88  TRP A HZ2  6  
ATOM 8492  H HZ3  . TRP A 1 88  ? 4.177   -5.468  -1.453  1.00 0.00 ? 88  TRP A HZ3  6  
ATOM 8493  H HH2  . TRP A 1 88  ? 6.189   -5.684  -0.086  1.00 0.00 ? 88  TRP A HH2  6  
ATOM 8494  N N    . ALA A 1 89  ? -2.161  -5.483  -0.138  1.00 0.00 ? 89  ALA A N    6  
ATOM 8495  C CA   . ALA A 1 89  ? -3.529  -5.573  -0.633  1.00 0.00 ? 89  ALA A CA   6  
ATOM 8496  C C    . ALA A 1 89  ? -3.968  -7.027  -0.773  1.00 0.00 ? 89  ALA A C    6  
ATOM 8497  O O    . ALA A 1 89  ? -3.589  -7.712  -1.723  1.00 0.00 ? 89  ALA A O    6  
ATOM 8498  C CB   . ALA A 1 89  ? -3.657  -4.850  -1.965  1.00 0.00 ? 89  ALA A CB   6  
ATOM 8499  H H    . ALA A 1 89  ? -1.454  -5.175  -0.743  1.00 0.00 ? 89  ALA A H    6  
ATOM 8500  H HA   . ALA A 1 89  ? -4.174  -5.080  0.080   1.00 0.00 ? 89  ALA A HA   6  
ATOM 8501  H HB1  . ALA A 1 89  ? -4.586  -4.299  -1.987  1.00 0.00 ? 89  ALA A HB1  6  
ATOM 8502  H HB2  . ALA A 1 89  ? -2.830  -4.167  -2.085  1.00 0.00 ? 89  ALA A HB2  6  
ATOM 8503  H HB3  . ALA A 1 89  ? -3.648  -5.572  -2.768  1.00 0.00 ? 89  ALA A HB3  6  
ATOM 8504  N N    . LYS A 1 90  ? -4.768  -7.493  0.180   1.00 0.00 ? 90  LYS A N    6  
ATOM 8505  C CA   . LYS A 1 90  ? -5.259  -8.866  0.163   1.00 0.00 ? 90  LYS A CA   6  
ATOM 8506  C C    . LYS A 1 90  ? -6.166  -9.105  -1.041  1.00 0.00 ? 90  LYS A C    6  
ATOM 8507  O O    . LYS A 1 90  ? -7.013  -8.280  -1.384  1.00 0.00 ? 90  LYS A O    6  
ATOM 8508  C CB   . LYS A 1 90  ? -6.019  -9.173  1.456   1.00 0.00 ? 90  LYS A CB   6  
ATOM 8509  C CG   . LYS A 1 90  ? -6.511  -10.607 1.545   1.00 0.00 ? 90  LYS A CG   6  
ATOM 8510  C CD   . LYS A 1 90  ? -5.453  -11.525 2.135   1.00 0.00 ? 90  LYS A CD   6  
ATOM 8511  C CE   . LYS A 1 90  ? -5.249  -11.258 3.618   1.00 0.00 ? 90  LYS A CE   6  
ATOM 8512  N NZ   . LYS A 1 90  ? -4.345  -12.264 4.243   1.00 0.00 ? 90  LYS A NZ   6  
ATOM 8513  H H    . LYS A 1 90  ? -5.036  -6.899  0.912   1.00 0.00 ? 90  LYS A H    6  
ATOM 8514  H HA   . LYS A 1 90  ? -4.406  -9.523  0.092   1.00 0.00 ? 90  LYS A HA   6  
ATOM 8515  H HB2  . LYS A 1 90  ? -5.366  -8.986  2.296   1.00 0.00 ? 90  LYS A HB2  6  
ATOM 8516  H HB3  . LYS A 1 90  ? -6.874  -8.516  1.521   1.00 0.00 ? 90  LYS A HB3  6  
ATOM 8517  H HG2  . LYS A 1 90  ? -7.390  -10.638 2.173   1.00 0.00 ? 90  LYS A HG2  6  
ATOM 8518  H HG3  . LYS A 1 90  ? -6.764  -10.954 0.553   1.00 0.00 ? 90  LYS A HG3  6  
ATOM 8519  H HD2  . LYS A 1 90  ? -5.765  -12.550 2.005   1.00 0.00 ? 90  LYS A HD2  6  
ATOM 8520  H HD3  . LYS A 1 90  ? -4.519  -11.362 1.616   1.00 0.00 ? 90  LYS A HD3  6  
ATOM 8521  H HE2  . LYS A 1 90  ? -4.817  -10.277 3.738   1.00 0.00 ? 90  LYS A HE2  6  
ATOM 8522  H HE3  . LYS A 1 90  ? -6.208  -11.293 4.112   1.00 0.00 ? 90  LYS A HE3  6  
ATOM 8523  H HZ1  . LYS A 1 90  ? -3.568  -12.498 3.593   1.00 0.00 ? 90  LYS A HZ1  6  
ATOM 8524  H HZ2  . LYS A 1 90  ? -4.874  -13.133 4.459   1.00 0.00 ? 90  LYS A HZ2  6  
ATOM 8525  H HZ3  . LYS A 1 90  ? -3.944  -11.886 5.124   1.00 0.00 ? 90  LYS A HZ3  6  
ATOM 8526  N N    . PRO A 1 91  ? -5.986  -10.261 -1.697  1.00 0.00 ? 91  PRO A N    6  
ATOM 8527  C CA   . PRO A 1 91  ? -6.780  -10.635 -2.871  1.00 0.00 ? 91  PRO A CA   6  
ATOM 8528  C C    . PRO A 1 91  ? -8.229  -10.949 -2.515  1.00 0.00 ? 91  PRO A C    6  
ATOM 8529  O O    . PRO A 1 91  ? -8.516  -11.955 -1.865  1.00 0.00 ? 91  PRO A O    6  
ATOM 8530  C CB   . PRO A 1 91  ? -6.073  -11.890 -3.392  1.00 0.00 ? 91  PRO A CB   6  
ATOM 8531  C CG   . PRO A 1 91  ? -5.392  -12.463 -2.198  1.00 0.00 ? 91  PRO A CG   6  
ATOM 8532  C CD   . PRO A 1 91  ? -4.995  -11.291 -1.344  1.00 0.00 ? 91  PRO A CD   6  
ATOM 8533  H HA   . PRO A 1 91  ? -6.756  -9.866  -3.629  1.00 0.00 ? 91  PRO A HA   6  
ATOM 8534  H HB2  . PRO A 1 91  ? -6.804  -12.575 -3.798  1.00 0.00 ? 91  PRO A HB2  6  
ATOM 8535  H HB3  . PRO A 1 91  ? -5.364  -11.616 -4.157  1.00 0.00 ? 91  PRO A HB3  6  
ATOM 8536  H HG2  . PRO A 1 91  ? -6.072  -13.105 -1.659  1.00 0.00 ? 91  PRO A HG2  6  
ATOM 8537  H HG3  . PRO A 1 91  ? -4.516  -13.016 -2.505  1.00 0.00 ? 91  PRO A HG3  6  
ATOM 8538  H HD2  . PRO A 1 91  ? -5.061  -11.546 -0.297  1.00 0.00 ? 91  PRO A HD2  6  
ATOM 8539  H HD3  . PRO A 1 91  ? -3.996  -10.964 -1.592  1.00 0.00 ? 91  PRO A HD3  6  
ATOM 8540  N N    . LYS A 1 92  ? -9.140  -10.083 -2.945  1.00 0.00 ? 92  LYS A N    6  
ATOM 8541  C CA   . LYS A 1 92  ? -10.561 -10.268 -2.673  1.00 0.00 ? 92  LYS A CA   6  
ATOM 8542  C C    . LYS A 1 92  ? -11.394 -9.986  -3.919  1.00 0.00 ? 92  LYS A C    6  
ATOM 8543  O O    . LYS A 1 92  ? -10.866 -9.571  -4.950  1.00 0.00 ? 92  LYS A O    6  
ATOM 8544  C CB   . LYS A 1 92  ? -11.006 -9.353  -1.530  1.00 0.00 ? 92  LYS A CB   6  
ATOM 8545  C CG   . LYS A 1 92  ? -10.728 -7.881  -1.786  1.00 0.00 ? 92  LYS A CG   6  
ATOM 8546  C CD   . LYS A 1 92  ? -11.891 -7.210  -2.498  1.00 0.00 ? 92  LYS A CD   6  
ATOM 8547  C CE   . LYS A 1 92  ? -11.479 -5.876  -3.103  1.00 0.00 ? 92  LYS A CE   6  
ATOM 8548  N NZ   . LYS A 1 92  ? -10.580 -6.054  -4.276  1.00 0.00 ? 92  LYS A NZ   6  
ATOM 8549  H H    . LYS A 1 92  ? -8.850  -9.300  -3.458  1.00 0.00 ? 92  LYS A H    6  
ATOM 8550  H HA   . LYS A 1 92  ? -10.711 -11.296 -2.379  1.00 0.00 ? 92  LYS A HA   6  
ATOM 8551  H HB2  . LYS A 1 92  ? -12.068 -9.476  -1.379  1.00 0.00 ? 92  LYS A HB2  6  
ATOM 8552  H HB3  . LYS A 1 92  ? -10.487 -9.644  -0.629  1.00 0.00 ? 92  LYS A HB3  6  
ATOM 8553  H HG2  . LYS A 1 92  ? -10.564 -7.385  -0.841  1.00 0.00 ? 92  LYS A HG2  6  
ATOM 8554  H HG3  . LYS A 1 92  ? -9.843  -7.793  -2.400  1.00 0.00 ? 92  LYS A HG3  6  
ATOM 8555  H HD2  . LYS A 1 92  ? -12.241 -7.858  -3.288  1.00 0.00 ? 92  LYS A HD2  6  
ATOM 8556  H HD3  . LYS A 1 92  ? -12.688 -7.043  -1.788  1.00 0.00 ? 92  LYS A HD3  6  
ATOM 8557  H HE2  . LYS A 1 92  ? -12.367 -5.349  -3.416  1.00 0.00 ? 92  LYS A HE2  6  
ATOM 8558  H HE3  . LYS A 1 92  ? -10.964 -5.298  -2.349  1.00 0.00 ? 92  LYS A HE3  6  
ATOM 8559  H HZ1  . LYS A 1 92  ? -9.598  -5.838  -4.010  1.00 0.00 ? 92  LYS A HZ1  6  
ATOM 8560  H HZ2  . LYS A 1 92  ? -10.867 -5.415  -5.045  1.00 0.00 ? 92  LYS A HZ2  6  
ATOM 8561  H HZ3  . LYS A 1 92  ? -10.628 -7.034  -4.619  1.00 0.00 ? 92  LYS A HZ3  6  
ATOM 8562  N N    . GLY A 1 93  ? -12.700 -10.213 -3.816  1.00 0.00 ? 93  GLY A N    6  
ATOM 8563  C CA   . GLY A 1 93  ? -13.586 -9.976  -4.941  1.00 0.00 ? 93  GLY A CA   6  
ATOM 8564  C C    . GLY A 1 93  ? -14.862 -10.789 -4.856  1.00 0.00 ? 93  GLY A C    6  
ATOM 8565  O O    . GLY A 1 93  ? -15.229 -11.268 -3.784  1.00 0.00 ? 93  GLY A O    6  
ATOM 8566  H H    . GLY A 1 93  ? -13.066 -10.543 -2.968  1.00 0.00 ? 93  GLY A H    6  
ATOM 8567  H HA2  . GLY A 1 93  ? -13.841 -8.927  -4.970  1.00 0.00 ? 93  GLY A HA2  6  
ATOM 8568  H HA3  . GLY A 1 93  ? -13.067 -10.235 -5.853  1.00 0.00 ? 93  GLY A HA3  6  
ATOM 8569  N N    . GLU A 1 94  ? -15.540 -10.945 -5.989  1.00 0.00 ? 94  GLU A N    6  
ATOM 8570  C CA   . GLU A 1 94  ? -16.783 -11.704 -6.037  1.00 0.00 ? 94  GLU A CA   6  
ATOM 8571  C C    . GLU A 1 94  ? -16.511 -13.201 -5.925  1.00 0.00 ? 94  GLU A C    6  
ATOM 8572  O O    . GLU A 1 94  ? -15.590 -13.724 -6.551  1.00 0.00 ? 94  GLU A O    6  
ATOM 8573  C CB   . GLU A 1 94  ? -17.539 -11.407 -7.334  1.00 0.00 ? 94  GLU A CB   6  
ATOM 8574  C CG   . GLU A 1 94  ? -16.760 -11.766 -8.588  1.00 0.00 ? 94  GLU A CG   6  
ATOM 8575  C CD   . GLU A 1 94  ? -17.535 -11.475 -9.859  1.00 0.00 ? 94  GLU A CD   6  
ATOM 8576  O OE1  . GLU A 1 94  ? -18.642 -12.031 -10.018 1.00 0.00 ? 94  GLU A OE1  6  
ATOM 8577  O OE2  . GLU A 1 94  ? -17.034 -10.693 -10.693 1.00 0.00 ? 94  GLU A OE2  6  
ATOM 8578  H H    . GLU A 1 94  ? -15.195 -10.538 -6.812  1.00 0.00 ? 94  GLU A H    6  
ATOM 8579  H HA   . GLU A 1 94  ? -17.391 -11.398 -5.199  1.00 0.00 ? 94  GLU A HA   6  
ATOM 8580  H HB2  . GLU A 1 94  ? -18.462 -11.967 -7.335  1.00 0.00 ? 94  GLU A HB2  6  
ATOM 8581  H HB3  . GLU A 1 94  ? -17.769 -10.352 -7.368  1.00 0.00 ? 94  GLU A HB3  6  
ATOM 8582  H HG2  . GLU A 1 94  ? -15.845 -11.194 -8.604  1.00 0.00 ? 94  GLU A HG2  6  
ATOM 8583  H HG3  . GLU A 1 94  ? -16.524 -12.820 -8.560  1.00 0.00 ? 94  GLU A HG3  6  
ATOM 8584  N N    . GLY A 1 95  ? -17.321 -13.886 -5.123  1.00 0.00 ? 95  GLY A N    6  
ATOM 8585  C CA   . GLY A 1 95  ? -17.151 -15.316 -4.942  1.00 0.00 ? 95  GLY A CA   6  
ATOM 8586  C C    . GLY A 1 95  ? -17.131 -15.718 -3.481  1.00 0.00 ? 95  GLY A C    6  
ATOM 8587  O O    . GLY A 1 95  ? -18.101 -15.501 -2.757  1.00 0.00 ? 95  GLY A O    6  
ATOM 8588  H H    . GLY A 1 95  ? -18.039 -13.416 -4.649  1.00 0.00 ? 95  GLY A H    6  
ATOM 8589  H HA2  . GLY A 1 95  ? -17.964 -15.829 -5.435  1.00 0.00 ? 95  GLY A HA2  6  
ATOM 8590  H HA3  . GLY A 1 95  ? -16.220 -15.617 -5.399  1.00 0.00 ? 95  GLY A HA3  6  
ATOM 8591  N N    . GLY A 1 96  ? -16.021 -16.307 -3.046  1.00 0.00 ? 96  GLY A N    6  
ATOM 8592  C CA   . GLY A 1 96  ? -15.900 -16.733 -1.664  1.00 0.00 ? 96  GLY A CA   6  
ATOM 8593  C C    . GLY A 1 96  ? -15.735 -18.234 -1.532  1.00 0.00 ? 96  GLY A C    6  
ATOM 8594  O O    . GLY A 1 96  ? -16.387 -18.866 -0.701  1.00 0.00 ? 96  GLY A O    6  
ATOM 8595  H H    . GLY A 1 96  ? -15.279 -16.455 -3.669  1.00 0.00 ? 96  GLY A H    6  
ATOM 8596  H HA2  . GLY A 1 96  ? -15.042 -16.247 -1.223  1.00 0.00 ? 96  GLY A HA2  6  
ATOM 8597  H HA3  . GLY A 1 96  ? -16.787 -16.431 -1.128  1.00 0.00 ? 96  GLY A HA3  6  
ATOM 8598  N N    . SER A 1 97  ? -14.862 -18.807 -2.355  1.00 0.00 ? 97  SER A N    6  
ATOM 8599  C CA   . SER A 1 97  ? -14.618 -20.244 -2.330  1.00 0.00 ? 97  SER A CA   6  
ATOM 8600  C C    . SER A 1 97  ? -13.312 -20.586 -3.041  1.00 0.00 ? 97  SER A C    6  
ATOM 8601  O O    . SER A 1 97  ? -12.703 -19.735 -3.687  1.00 0.00 ? 97  SER A O    6  
ATOM 8602  C CB   . SER A 1 97  ? -15.780 -20.992 -2.987  1.00 0.00 ? 97  SER A CB   6  
ATOM 8603  O OG   . SER A 1 97  ? -15.831 -20.733 -4.380  1.00 0.00 ? 97  SER A OG   6  
ATOM 8604  H H    . SER A 1 97  ? -14.373 -18.249 -2.995  1.00 0.00 ? 97  SER A H    6  
ATOM 8605  H HA   . SER A 1 97  ? -14.543 -20.550 -1.297  1.00 0.00 ? 97  SER A HA   6  
ATOM 8606  H HB2  . SER A 1 97  ? -15.655 -22.053 -2.835  1.00 0.00 ? 97  SER A HB2  6  
ATOM 8607  H HB3  . SER A 1 97  ? -16.710 -20.671 -2.540  1.00 0.00 ? 97  SER A HB3  6  
ATOM 8608  H HG   . SER A 1 97  ? -14.944 -20.776 -4.745  1.00 0.00 ? 97  SER A HG   6  
ATOM 8609  N N    . GLY A 1 98  ? -12.888 -21.840 -2.915  1.00 0.00 ? 98  GLY A N    6  
ATOM 8610  C CA   . GLY A 1 98  ? -11.657 -22.273 -3.550  1.00 0.00 ? 98  GLY A CA   6  
ATOM 8611  C C    . GLY A 1 98  ? -11.650 -23.760 -3.847  1.00 0.00 ? 98  GLY A C    6  
ATOM 8612  O O    . GLY A 1 98  ? -12.447 -24.526 -3.306  1.00 0.00 ? 98  GLY A O    6  
ATOM 8613  H H    . GLY A 1 98  ? -13.415 -22.476 -2.387  1.00 0.00 ? 98  GLY A H    6  
ATOM 8614  H HA2  . GLY A 1 98  ? -11.531 -21.731 -4.475  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 8615  H HA3  . GLY A 1 98  ? -10.828 -22.045 -2.895  1.00 0.00 ? 98  GLY A HA3  6  
ATOM 8616  N N    . PRO A 1 99  ? -10.734 -24.186 -4.729  1.00 0.00 ? 99  PRO A N    6  
ATOM 8617  C CA   . PRO A 1 99  ? -10.606 -25.594 -5.119  1.00 0.00 ? 99  PRO A CA   6  
ATOM 8618  C C    . PRO A 1 99  ? -10.064 -26.461 -3.988  1.00 0.00 ? 99  PRO A C    6  
ATOM 8619  O O    . PRO A 1 99  ? -9.758  -25.965 -2.904  1.00 0.00 ? 99  PRO A O    6  
ATOM 8620  C CB   . PRO A 1 99  ? -9.612  -25.551 -6.282  1.00 0.00 ? 99  PRO A CB   6  
ATOM 8621  C CG   . PRO A 1 99  ? -8.814  -24.314 -6.053  1.00 0.00 ? 99  PRO A CG   6  
ATOM 8622  C CD   . PRO A 1 99  ? -9.752  -23.328 -5.413  1.00 0.00 ? 99  PRO A CD   6  
ATOM 8623  H HA   . PRO A 1 99  ? -11.547 -25.998 -5.462  1.00 0.00 ? 99  PRO A HA   6  
ATOM 8624  H HB2  . PRO A 1 99  ? -8.989  -26.434 -6.259  1.00 0.00 ? 99  PRO A HB2  6  
ATOM 8625  H HB3  . PRO A 1 99  ? -10.149 -25.506 -7.218  1.00 0.00 ? 99  PRO A HB3  6  
ATOM 8626  H HG2  . PRO A 1 99  ? -7.987  -24.527 -5.393  1.00 0.00 ? 99  PRO A HG2  6  
ATOM 8627  H HG3  . PRO A 1 99  ? -8.454  -23.930 -6.996  1.00 0.00 ? 99  PRO A HG3  6  
ATOM 8628  H HD2  . PRO A 1 99  ? -9.223  -22.708 -4.705  1.00 0.00 ? 99  PRO A HD2  6  
ATOM 8629  H HD3  . PRO A 1 99  ? -10.231 -22.720 -6.166  1.00 0.00 ? 99  PRO A HD3  6  
ATOM 8630  N N    . SER A 1 100 ? -9.948  -27.760 -4.247  1.00 0.00 ? 100 SER A N    6  
ATOM 8631  C CA   . SER A 1 100 ? -9.447  -28.697 -3.249  1.00 0.00 ? 100 SER A CA   6  
ATOM 8632  C C    . SER A 1 100 ? -8.045  -29.179 -3.613  1.00 0.00 ? 100 SER A C    6  
ATOM 8633  O O    . SER A 1 100 ? -7.156  -29.232 -2.764  1.00 0.00 ? 100 SER A O    6  
ATOM 8634  C CB   . SER A 1 100 ? -10.392 -29.893 -3.121  1.00 0.00 ? 100 SER A CB   6  
ATOM 8635  O OG   . SER A 1 100 ? -10.426 -30.647 -4.320  1.00 0.00 ? 100 SER A OG   6  
ATOM 8636  H H    . SER A 1 100 ? -10.209 -28.095 -5.131  1.00 0.00 ? 100 SER A H    6  
ATOM 8637  H HA   . SER A 1 100 ? -9.403  -28.181 -2.302  1.00 0.00 ? 100 SER A HA   6  
ATOM 8638  H HB2  . SER A 1 100 ? -10.055 -30.531 -2.318  1.00 0.00 ? 100 SER A HB2  6  
ATOM 8639  H HB3  . SER A 1 100 ? -11.390 -29.538 -2.904  1.00 0.00 ? 100 SER A HB3  6  
ATOM 8640  H HG   . SER A 1 100 ? -9.853  -31.412 -4.234  1.00 0.00 ? 100 SER A HG   6  
ATOM 8641  N N    . SER A 1 101 ? -7.858  -29.530 -4.881  1.00 0.00 ? 101 SER A N    6  
ATOM 8642  C CA   . SER A 1 101 ? -6.566  -30.012 -5.357  1.00 0.00 ? 101 SER A CA   6  
ATOM 8643  C C    . SER A 1 101 ? -5.437  -29.108 -4.873  1.00 0.00 ? 101 SER A C    6  
ATOM 8644  O O    . SER A 1 101 ? -5.534  -27.883 -4.943  1.00 0.00 ? 101 SER A O    6  
ATOM 8645  C CB   . SER A 1 101 ? -6.558  -30.084 -6.885  1.00 0.00 ? 101 SER A CB   6  
ATOM 8646  O OG   . SER A 1 101 ? -7.069  -31.325 -7.340  1.00 0.00 ? 101 SER A OG   6  
ATOM 8647  H H    . SER A 1 101 ? -8.606  -29.466 -5.510  1.00 0.00 ? 101 SER A H    6  
ATOM 8648  H HA   . SER A 1 101 ? -6.414  -31.003 -4.958  1.00 0.00 ? 101 SER A HA   6  
ATOM 8649  H HB2  . SER A 1 101 ? -7.169  -29.289 -7.284  1.00 0.00 ? 101 SER A HB2  6  
ATOM 8650  H HB3  . SER A 1 101 ? -5.544  -29.973 -7.242  1.00 0.00 ? 101 SER A HB3  6  
ATOM 8651  H HG   . SER A 1 101 ? -7.336  -31.244 -8.259  1.00 0.00 ? 101 SER A HG   6  
ATOM 8652  N N    . GLY A 1 102 ? -4.365  -29.722 -4.381  1.00 0.00 ? 102 GLY A N    6  
ATOM 8653  C CA   . GLY A 1 102 ? -3.232  -28.958 -3.892  1.00 0.00 ? 102 GLY A CA   6  
ATOM 8654  C C    . GLY A 1 102 ? -2.109  -28.872 -4.907  1.00 0.00 ? 102 GLY A C    6  
ATOM 8655  O O    . GLY A 1 102 ? -1.671  -29.889 -5.446  1.00 0.00 ? 102 GLY A O    6  
ATOM 8656  H H    . GLY A 1 102 ? -4.343  -30.701 -4.351  1.00 0.00 ? 102 GLY A H    6  
ATOM 8657  H HA2  . GLY A 1 102 ? -3.562  -27.959 -3.651  1.00 0.00 ? 102 GLY A HA2  6  
ATOM 8658  H HA3  . GLY A 1 102 ? -2.855  -29.429 -2.996  1.00 0.00 ? 102 GLY A HA3  6  
ATOM 8659  N N    . GLY A 1 1   ? 10.604  -2.167  20.133  1.00 0.00 ? 1   GLY A N    7  
ATOM 8660  C CA   . GLY A 1 1   ? 9.376   -2.924  19.984  1.00 0.00 ? 1   GLY A CA   7  
ATOM 8661  C C    . GLY A 1 1   ? 9.615   -4.314  19.428  1.00 0.00 ? 1   GLY A C    7  
ATOM 8662  O O    . GLY A 1 1   ? 10.430  -4.497  18.524  1.00 0.00 ? 1   GLY A O    7  
ATOM 8663  H H1   . GLY A 1 1   ? 11.013  -1.740  19.350  1.00 0.00 ? 1   GLY A H1   7  
ATOM 8664  H HA2  . GLY A 1 1   ? 8.900   -3.011  20.949  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 8665  H HA3  . GLY A 1 1   ? 8.716   -2.391  19.315  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 8666  N N    . SER A 1 2   ? 8.905   -5.298  19.972  1.00 0.00 ? 2   SER A N    7  
ATOM 8667  C CA   . SER A 1 2   ? 9.049   -6.680  19.529  1.00 0.00 ? 2   SER A CA   7  
ATOM 8668  C C    . SER A 1 2   ? 7.971   -7.038  18.511  1.00 0.00 ? 2   SER A C    7  
ATOM 8669  O O    . SER A 1 2   ? 8.265   -7.582  17.446  1.00 0.00 ? 2   SER A O    7  
ATOM 8670  C CB   . SER A 1 2   ? 8.974   -7.631  20.725  1.00 0.00 ? 2   SER A CB   7  
ATOM 8671  O OG   . SER A 1 2   ? 7.821   -7.375  21.509  1.00 0.00 ? 2   SER A OG   7  
ATOM 8672  H H    . SER A 1 2   ? 8.272   -5.089  20.691  1.00 0.00 ? 2   SER A H    7  
ATOM 8673  H HA   . SER A 1 2   ? 10.017  -6.779  19.062  1.00 0.00 ? 2   SER A HA   7  
ATOM 8674  H HB2  . SER A 1 2   ? 8.933   -8.649  20.370  1.00 0.00 ? 2   SER A HB2  7  
ATOM 8675  H HB3  . SER A 1 2   ? 9.851   -7.500  21.342  1.00 0.00 ? 2   SER A HB3  7  
ATOM 8676  H HG   . SER A 1 2   ? 7.461   -8.204  21.830  1.00 0.00 ? 2   SER A HG   7  
ATOM 8677  N N    . SER A 1 3   ? 6.723   -6.729  18.846  1.00 0.00 ? 3   SER A N    7  
ATOM 8678  C CA   . SER A 1 3   ? 5.600   -7.022  17.963  1.00 0.00 ? 3   SER A CA   7  
ATOM 8679  C C    . SER A 1 3   ? 5.564   -6.049  16.789  1.00 0.00 ? 3   SER A C    7  
ATOM 8680  O O    . SER A 1 3   ? 5.470   -4.836  16.976  1.00 0.00 ? 3   SER A O    7  
ATOM 8681  C CB   . SER A 1 3   ? 4.283   -6.952  18.739  1.00 0.00 ? 3   SER A CB   7  
ATOM 8682  O OG   . SER A 1 3   ? 3.214   -7.486  17.977  1.00 0.00 ? 3   SER A OG   7  
ATOM 8683  H H    . SER A 1 3   ? 6.553   -6.296  19.709  1.00 0.00 ? 3   SER A H    7  
ATOM 8684  H HA   . SER A 1 3   ? 5.730   -8.024  17.582  1.00 0.00 ? 3   SER A HA   7  
ATOM 8685  H HB2  . SER A 1 3   ? 4.376   -7.519  19.653  1.00 0.00 ? 3   SER A HB2  7  
ATOM 8686  H HB3  . SER A 1 3   ? 4.061   -5.922  18.975  1.00 0.00 ? 3   SER A HB3  7  
ATOM 8687  H HG   . SER A 1 3   ? 3.082   -8.408  18.212  1.00 0.00 ? 3   SER A HG   7  
ATOM 8688  N N    . GLY A 1 4   ? 5.639   -6.590  15.577  1.00 0.00 ? 4   GLY A N    7  
ATOM 8689  C CA   . GLY A 1 4   ? 5.614   -5.757  14.389  1.00 0.00 ? 4   GLY A CA   7  
ATOM 8690  C C    . GLY A 1 4   ? 4.821   -6.382  13.259  1.00 0.00 ? 4   GLY A C    7  
ATOM 8691  O O    . GLY A 1 4   ? 3.591   -6.336  13.254  1.00 0.00 ? 4   GLY A O    7  
ATOM 8692  H H    . GLY A 1 4   ? 5.713   -7.564  15.488  1.00 0.00 ? 4   GLY A H    7  
ATOM 8693  H HA2  . GLY A 1 4   ? 5.173   -4.804  14.641  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 8694  H HA3  . GLY A 1 4   ? 6.628   -5.595  14.055  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 8695  N N    . SER A 1 5   ? 5.527   -6.967  12.296  1.00 0.00 ? 5   SER A N    7  
ATOM 8696  C CA   . SER A 1 5   ? 4.881   -7.600  11.152  1.00 0.00 ? 5   SER A CA   7  
ATOM 8697  C C    . SER A 1 5   ? 5.621   -8.870  10.744  1.00 0.00 ? 5   SER A C    7  
ATOM 8698  O O    . SER A 1 5   ? 6.848   -8.881  10.640  1.00 0.00 ? 5   SER A O    7  
ATOM 8699  C CB   . SER A 1 5   ? 4.823   -6.629  9.971   1.00 0.00 ? 5   SER A CB   7  
ATOM 8700  O OG   . SER A 1 5   ? 4.353   -7.276  8.801   1.00 0.00 ? 5   SER A OG   7  
ATOM 8701  H H    . SER A 1 5   ? 6.505   -6.971  12.356  1.00 0.00 ? 5   SER A H    7  
ATOM 8702  H HA   . SER A 1 5   ? 3.874   -7.861  11.442  1.00 0.00 ? 5   SER A HA   7  
ATOM 8703  H HB2  . SER A 1 5   ? 4.156   -5.815  10.210  1.00 0.00 ? 5   SER A HB2  7  
ATOM 8704  H HB3  . SER A 1 5   ? 5.813   -6.239  9.780   1.00 0.00 ? 5   SER A HB3  7  
ATOM 8705  H HG   . SER A 1 5   ? 3.446   -7.010  8.631   1.00 0.00 ? 5   SER A HG   7  
ATOM 8706  N N    . SER A 1 6   ? 4.866   -9.940  10.515  1.00 0.00 ? 6   SER A N    7  
ATOM 8707  C CA   . SER A 1 6   ? 5.449   -11.217 10.123  1.00 0.00 ? 6   SER A CA   7  
ATOM 8708  C C    . SER A 1 6   ? 6.146   -11.104 8.770   1.00 0.00 ? 6   SER A C    7  
ATOM 8709  O O    . SER A 1 6   ? 5.786   -10.269 7.942   1.00 0.00 ? 6   SER A O    7  
ATOM 8710  C CB   . SER A 1 6   ? 4.369   -12.299 10.064  1.00 0.00 ? 6   SER A CB   7  
ATOM 8711  O OG   . SER A 1 6   ? 3.595   -12.183 8.882   1.00 0.00 ? 6   SER A OG   7  
ATOM 8712  H H    . SER A 1 6   ? 3.894   -9.868  10.615  1.00 0.00 ? 6   SER A H    7  
ATOM 8713  H HA   . SER A 1 6   ? 6.180   -11.491 10.869  1.00 0.00 ? 6   SER A HA   7  
ATOM 8714  H HB2  . SER A 1 6   ? 4.835   -13.272 10.080  1.00 0.00 ? 6   SER A HB2  7  
ATOM 8715  H HB3  . SER A 1 6   ? 3.716   -12.198 10.919  1.00 0.00 ? 6   SER A HB3  7  
ATOM 8716  H HG   . SER A 1 6   ? 2.684   -12.420 9.071   1.00 0.00 ? 6   SER A HG   7  
ATOM 8717  N N    . GLY A 1 7   ? 7.147   -11.952 8.554   1.00 0.00 ? 7   GLY A N    7  
ATOM 8718  C CA   . GLY A 1 7   ? 7.879   -11.931 7.301   1.00 0.00 ? 7   GLY A CA   7  
ATOM 8719  C C    . GLY A 1 7   ? 7.056   -12.454 6.140   1.00 0.00 ? 7   GLY A C    7  
ATOM 8720  O O    . GLY A 1 7   ? 6.001   -13.061 6.323   1.00 0.00 ? 7   GLY A O    7  
ATOM 8721  H H    . GLY A 1 7   ? 7.390   -12.597 9.251   1.00 0.00 ? 7   GLY A H    7  
ATOM 8722  H HA2  . GLY A 1 7   ? 8.178   -10.916 7.088   1.00 0.00 ? 7   GLY A HA2  7  
ATOM 8723  H HA3  . GLY A 1 7   ? 8.764   -12.542 7.404   1.00 0.00 ? 7   GLY A HA3  7  
ATOM 8724  N N    . PRO A 1 8   ? 7.541   -12.218 4.912   1.00 0.00 ? 8   PRO A N    7  
ATOM 8725  C CA   . PRO A 1 8   ? 6.859   -12.661 3.693   1.00 0.00 ? 8   PRO A CA   7  
ATOM 8726  C C    . PRO A 1 8   ? 6.898   -14.176 3.523   1.00 0.00 ? 8   PRO A C    7  
ATOM 8727  O O    . PRO A 1 8   ? 6.060   -14.754 2.833   1.00 0.00 ? 8   PRO A O    7  
ATOM 8728  C CB   . PRO A 1 8   ? 7.650   -11.977 2.575   1.00 0.00 ? 8   PRO A CB   7  
ATOM 8729  C CG   . PRO A 1 8   ? 9.005   -11.754 3.152   1.00 0.00 ? 8   PRO A CG   7  
ATOM 8730  C CD   . PRO A 1 8   ? 8.794   -11.501 4.619   1.00 0.00 ? 8   PRO A CD   7  
ATOM 8731  H HA   . PRO A 1 8   ? 5.833   -12.323 3.668   1.00 0.00 ? 8   PRO A HA   7  
ATOM 8732  H HB2  . PRO A 1 8   ? 7.690   -12.624 1.710   1.00 0.00 ? 8   PRO A HB2  7  
ATOM 8733  H HB3  . PRO A 1 8   ? 7.175   -11.044 2.311   1.00 0.00 ? 8   PRO A HB3  7  
ATOM 8734  H HG2  . PRO A 1 8   ? 9.616   -12.632 3.007   1.00 0.00 ? 8   PRO A HG2  7  
ATOM 8735  H HG3  . PRO A 1 8   ? 9.465   -10.895 2.687   1.00 0.00 ? 8   PRO A HG3  7  
ATOM 8736  H HD2  . PRO A 1 8   ? 9.614   -11.907 5.194   1.00 0.00 ? 8   PRO A HD2  7  
ATOM 8737  H HD3  . PRO A 1 8   ? 8.685   -10.443 4.808   1.00 0.00 ? 8   PRO A HD3  7  
ATOM 8738  N N    . ASN A 1 9   ? 7.877   -14.812 4.158   1.00 0.00 ? 9   ASN A N    7  
ATOM 8739  C CA   . ASN A 1 9   ? 8.025   -16.261 4.077   1.00 0.00 ? 9   ASN A CA   7  
ATOM 8740  C C    . ASN A 1 9   ? 7.124   -16.957 5.092   1.00 0.00 ? 9   ASN A C    7  
ATOM 8741  O O    . ASN A 1 9   ? 7.510   -17.956 5.698   1.00 0.00 ? 9   ASN A O    7  
ATOM 8742  C CB   . ASN A 1 9   ? 9.483   -16.659 4.316   1.00 0.00 ? 9   ASN A CB   7  
ATOM 8743  C CG   . ASN A 1 9   ? 10.368  -16.354 3.123   1.00 0.00 ? 9   ASN A CG   7  
ATOM 8744  O OD1  . ASN A 1 9   ? 9.982   -15.606 2.224   1.00 0.00 ? 9   ASN A OD1  7  
ATOM 8745  N ND2  . ASN A 1 9   ? 11.563  -16.933 3.109   1.00 0.00 ? 9   ASN A ND2  7  
ATOM 8746  H H    . ASN A 1 9   ? 8.515   -14.296 4.694   1.00 0.00 ? 9   ASN A H    7  
ATOM 8747  H HA   . ASN A 1 9   ? 7.735   -16.568 3.084   1.00 0.00 ? 9   ASN A HA   7  
ATOM 8748  H HB2  . ASN A 1 9   ? 9.863   -16.116 5.169   1.00 0.00 ? 9   ASN A HB2  7  
ATOM 8749  H HB3  . ASN A 1 9   ? 9.533   -17.718 4.517   1.00 0.00 ? 9   ASN A HB3  7  
ATOM 8750  H HD21 . ASN A 1 9   ? 11.804  -17.517 3.859   1.00 0.00 ? 9   ASN A HD21 7  
ATOM 8751  H HD22 . ASN A 1 9   ? 12.156  -16.753 2.350   1.00 0.00 ? 9   ASN A HD22 7  
ATOM 8752  N N    . ALA A 1 10  ? 5.920   -16.423 5.271   1.00 0.00 ? 10  ALA A N    7  
ATOM 8753  C CA   . ALA A 1 10  ? 4.963   -16.994 6.210   1.00 0.00 ? 10  ALA A CA   7  
ATOM 8754  C C    . ALA A 1 10  ? 3.713   -17.485 5.488   1.00 0.00 ? 10  ALA A C    7  
ATOM 8755  O O    . ALA A 1 10  ? 3.566   -17.294 4.280   1.00 0.00 ? 10  ALA A O    7  
ATOM 8756  C CB   . ALA A 1 10  ? 4.592   -15.972 7.274   1.00 0.00 ? 10  ALA A CB   7  
ATOM 8757  H H    . ALA A 1 10  ? 5.670   -15.626 4.759   1.00 0.00 ? 10  ALA A H    7  
ATOM 8758  H HA   . ALA A 1 10  ? 5.436   -17.833 6.700   1.00 0.00 ? 10  ALA A HA   7  
ATOM 8759  H HB1  . ALA A 1 10  ? 3.520   -15.962 7.405   1.00 0.00 ? 10  ALA A HB1  7  
ATOM 8760  H HB2  . ALA A 1 10  ? 5.068   -16.235 8.207   1.00 0.00 ? 10  ALA A HB2  7  
ATOM 8761  H HB3  . ALA A 1 10  ? 4.926   -14.993 6.964   1.00 0.00 ? 10  ALA A HB3  7  
ATOM 8762  N N    . ARG A 1 11  ? 2.814   -18.119 6.234   1.00 0.00 ? 11  ARG A N    7  
ATOM 8763  C CA   . ARG A 1 11  ? 1.577   -18.639 5.665   1.00 0.00 ? 11  ARG A CA   7  
ATOM 8764  C C    . ARG A 1 11  ? 0.954   -17.630 4.706   1.00 0.00 ? 11  ARG A C    7  
ATOM 8765  O O    . ARG A 1 11  ? 0.614   -17.964 3.571   1.00 0.00 ? 11  ARG A O    7  
ATOM 8766  C CB   . ARG A 1 11  ? 0.584   -18.984 6.776   1.00 0.00 ? 11  ARG A CB   7  
ATOM 8767  C CG   . ARG A 1 11  ? 0.707   -20.413 7.281   1.00 0.00 ? 11  ARG A CG   7  
ATOM 8768  C CD   . ARG A 1 11  ? 2.020   -20.633 8.016   1.00 0.00 ? 11  ARG A CD   7  
ATOM 8769  N NE   . ARG A 1 11  ? 2.152   -22.004 8.501   1.00 0.00 ? 11  ARG A NE   7  
ATOM 8770  C CZ   . ARG A 1 11  ? 1.528   -22.465 9.579   1.00 0.00 ? 11  ARG A CZ   7  
ATOM 8771  N NH1  . ARG A 1 11  ? 0.732   -21.669 10.280  1.00 0.00 ? 11  ARG A NH1  7  
ATOM 8772  N NH2  . ARG A 1 11  ? 1.698   -23.726 9.958   1.00 0.00 ? 11  ARG A NH2  7  
ATOM 8773  H H    . ARG A 1 11  ? 2.988   -18.241 7.192   1.00 0.00 ? 11  ARG A H    7  
ATOM 8774  H HA   . ARG A 1 11  ? 1.817   -19.538 5.116   1.00 0.00 ? 11  ARG A HA   7  
ATOM 8775  H HB2  . ARG A 1 11  ? 0.748   -18.316 7.609   1.00 0.00 ? 11  ARG A HB2  7  
ATOM 8776  H HB3  . ARG A 1 11  ? -0.419  -18.842 6.402   1.00 0.00 ? 11  ARG A HB3  7  
ATOM 8777  H HG2  . ARG A 1 11  ? -0.110  -20.617 7.957   1.00 0.00 ? 11  ARG A HG2  7  
ATOM 8778  H HG3  . ARG A 1 11  ? 0.657   -21.087 6.439   1.00 0.00 ? 11  ARG A HG3  7  
ATOM 8779  H HD2  . ARG A 1 11  ? 2.835   -20.421 7.340   1.00 0.00 ? 11  ARG A HD2  7  
ATOM 8780  H HD3  . ARG A 1 11  ? 2.064   -19.957 8.857   1.00 0.00 ? 11  ARG A HD3  7  
ATOM 8781  H HE   . ARG A 1 11  ? 2.735   -22.610 7.998   1.00 0.00 ? 11  ARG A HE   7  
ATOM 8782  H HH11 . ARG A 1 11  ? 0.601   -20.719 9.997   1.00 0.00 ? 11  ARG A HH11 7  
ATOM 8783  H HH12 . ARG A 1 11  ? 0.262   -22.019 11.091  1.00 0.00 ? 11  ARG A HH12 7  
ATOM 8784  H HH21 . ARG A 1 11  ? 2.297   -24.329 9.432   1.00 0.00 ? 11  ARG A HH21 7  
ATOM 8785  H HH22 . ARG A 1 11  ? 1.228   -24.072 10.769  1.00 0.00 ? 11  ARG A HH22 7  
ATOM 8786  N N    . SER A 1 12  ? 0.806   -16.393 5.170   1.00 0.00 ? 12  SER A N    7  
ATOM 8787  C CA   . SER A 1 12  ? 0.219   -15.336 4.356   1.00 0.00 ? 12  SER A CA   7  
ATOM 8788  C C    . SER A 1 12  ? 1.253   -14.749 3.400   1.00 0.00 ? 12  SER A C    7  
ATOM 8789  O O    . SER A 1 12  ? 2.078   -13.924 3.792   1.00 0.00 ? 12  SER A O    7  
ATOM 8790  C CB   . SER A 1 12  ? -0.351  -14.232 5.249   1.00 0.00 ? 12  SER A CB   7  
ATOM 8791  O OG   . SER A 1 12  ? -1.414  -14.721 6.048   1.00 0.00 ? 12  SER A OG   7  
ATOM 8792  H H    . SER A 1 12  ? 1.096   -16.188 6.084   1.00 0.00 ? 12  SER A H    7  
ATOM 8793  H HA   . SER A 1 12  ? -0.583  -15.769 3.777   1.00 0.00 ? 12  SER A HA   7  
ATOM 8794  H HB2  . SER A 1 12  ? 0.428   -13.858 5.896   1.00 0.00 ? 12  SER A HB2  7  
ATOM 8795  H HB3  . SER A 1 12  ? -0.722  -13.428 4.630   1.00 0.00 ? 12  SER A HB3  7  
ATOM 8796  H HG   . SER A 1 12  ? -1.820  -15.475 5.615   1.00 0.00 ? 12  SER A HG   7  
ATOM 8797  N N    . GLN A 1 13  ? 1.202   -15.181 2.144   1.00 0.00 ? 13  GLN A N    7  
ATOM 8798  C CA   . GLN A 1 13  ? 2.134   -14.700 1.132   1.00 0.00 ? 13  GLN A CA   7  
ATOM 8799  C C    . GLN A 1 13  ? 1.971   -13.200 0.911   1.00 0.00 ? 13  GLN A C    7  
ATOM 8800  O O    . GLN A 1 13  ? 0.896   -12.632 1.107   1.00 0.00 ? 13  GLN A O    7  
ATOM 8801  C CB   . GLN A 1 13  ? 1.921   -15.447 -0.186  1.00 0.00 ? 13  GLN A CB   7  
ATOM 8802  C CG   . GLN A 1 13  ? 2.504   -16.851 -0.190  1.00 0.00 ? 13  GLN A CG   7  
ATOM 8803  C CD   . GLN A 1 13  ? 3.994   -16.863 -0.466  1.00 0.00 ? 13  GLN A CD   7  
ATOM 8804  O OE1  . GLN A 1 13  ? 4.427   -16.708 -1.609  1.00 0.00 ? 13  GLN A OE1  7  
ATOM 8805  N NE2  . GLN A 1 13  ? 4.790   -17.048 0.581   1.00 0.00 ? 13  GLN A NE2  7  
ATOM 8806  H H    . GLN A 1 13  ? 0.521   -15.839 1.893   1.00 0.00 ? 13  GLN A H    7  
ATOM 8807  H HA   . GLN A 1 13  ? 3.136   -14.892 1.486   1.00 0.00 ? 13  GLN A HA   7  
ATOM 8808  H HB2  . GLN A 1 13  ? 0.860   -15.520 -0.376  1.00 0.00 ? 13  GLN A HB2  7  
ATOM 8809  H HB3  . GLN A 1 13  ? 2.384   -14.886 -0.983  1.00 0.00 ? 13  GLN A HB3  7  
ATOM 8810  H HG2  . GLN A 1 13  ? 2.329   -17.303 0.775   1.00 0.00 ? 13  GLN A HG2  7  
ATOM 8811  H HG3  . GLN A 1 13  ? 2.006   -17.431 -0.953  1.00 0.00 ? 13  GLN A HG3  7  
ATOM 8812  H HE21 . GLN A 1 13  ? 4.374   -17.166 1.461   1.00 0.00 ? 13  GLN A HE21 7  
ATOM 8813  H HE22 . GLN A 1 13  ? 5.757   -17.061 0.431   1.00 0.00 ? 13  GLN A HE22 7  
ATOM 8814  N N    . PRO A 1 14  ? 3.062   -12.540 0.494   1.00 0.00 ? 14  PRO A N    7  
ATOM 8815  C CA   . PRO A 1 14  ? 3.065   -11.097 0.237   1.00 0.00 ? 14  PRO A CA   7  
ATOM 8816  C C    . PRO A 1 14  ? 2.249   -10.726 -0.996  1.00 0.00 ? 14  PRO A C    7  
ATOM 8817  O O    . PRO A 1 14  ? 1.579   -11.573 -1.587  1.00 0.00 ? 14  PRO A O    7  
ATOM 8818  C CB   . PRO A 1 14  ? 4.546   -10.780 0.014   1.00 0.00 ? 14  PRO A CB   7  
ATOM 8819  C CG   . PRO A 1 14  ? 5.142   -12.062 -0.456  1.00 0.00 ? 14  PRO A CG   7  
ATOM 8820  C CD   . PRO A 1 14  ? 4.377   -13.153 0.240   1.00 0.00 ? 14  PRO A CD   7  
ATOM 8821  H HA   . PRO A 1 14  ? 2.701   -10.542 1.089   1.00 0.00 ? 14  PRO A HA   7  
ATOM 8822  H HB2  . PRO A 1 14  ? 4.642   -10.002 -0.731  1.00 0.00 ? 14  PRO A HB2  7  
ATOM 8823  H HB3  . PRO A 1 14  ? 4.992   -10.454 0.942   1.00 0.00 ? 14  PRO A HB3  7  
ATOM 8824  H HG2  . PRO A 1 14  ? 5.029   -12.148 -1.526  1.00 0.00 ? 14  PRO A HG2  7  
ATOM 8825  H HG3  . PRO A 1 14  ? 6.185   -12.103 -0.183  1.00 0.00 ? 14  PRO A HG3  7  
ATOM 8826  H HD2  . PRO A 1 14  ? 4.282   -14.016 -0.403  1.00 0.00 ? 14  PRO A HD2  7  
ATOM 8827  H HD3  . PRO A 1 14  ? 4.862   -13.422 1.166   1.00 0.00 ? 14  PRO A HD3  7  
ATOM 8828  N N    . SER A 1 15  ? 2.310   -9.455  -1.380  1.00 0.00 ? 15  SER A N    7  
ATOM 8829  C CA   . SER A 1 15  ? 1.574   -8.971  -2.542  1.00 0.00 ? 15  SER A CA   7  
ATOM 8830  C C    . SER A 1 15  ? 2.423   -8.001  -3.358  1.00 0.00 ? 15  SER A C    7  
ATOM 8831  O O    . SER A 1 15  ? 3.310   -7.334  -2.826  1.00 0.00 ? 15  SER A O    7  
ATOM 8832  C CB   . SER A 1 15  ? 0.278   -8.286  -2.102  1.00 0.00 ? 15  SER A CB   7  
ATOM 8833  O OG   . SER A 1 15  ? -0.589  -8.081  -3.203  1.00 0.00 ? 15  SER A OG   7  
ATOM 8834  H H    . SER A 1 15  ? 2.862   -8.827  -0.868  1.00 0.00 ? 15  SER A H    7  
ATOM 8835  H HA   . SER A 1 15  ? 1.329   -9.823  -3.158  1.00 0.00 ? 15  SER A HA   7  
ATOM 8836  H HB2  . SER A 1 15  ? -0.224  -8.905  -1.374  1.00 0.00 ? 15  SER A HB2  7  
ATOM 8837  H HB3  . SER A 1 15  ? 0.513   -7.329  -1.660  1.00 0.00 ? 15  SER A HB3  7  
ATOM 8838  H HG   . SER A 1 15  ? -0.136  -7.568  -3.877  1.00 0.00 ? 15  SER A HG   7  
ATOM 8839  N N    . LYS A 1 16  ? 2.144   -7.929  -4.655  1.00 0.00 ? 16  LYS A N    7  
ATOM 8840  C CA   . LYS A 1 16  ? 2.880   -7.041  -5.548  1.00 0.00 ? 16  LYS A CA   7  
ATOM 8841  C C    . LYS A 1 16  ? 2.394   -5.602  -5.406  1.00 0.00 ? 16  LYS A C    7  
ATOM 8842  O O    . LYS A 1 16  ? 3.175   -4.657  -5.522  1.00 0.00 ? 16  LYS A O    7  
ATOM 8843  C CB   . LYS A 1 16  ? 2.727   -7.501  -6.999  1.00 0.00 ? 16  LYS A CB   7  
ATOM 8844  C CG   . LYS A 1 16  ? 3.301   -8.882  -7.263  1.00 0.00 ? 16  LYS A CG   7  
ATOM 8845  C CD   . LYS A 1 16  ? 3.367   -9.183  -8.751  1.00 0.00 ? 16  LYS A CD   7  
ATOM 8846  C CE   . LYS A 1 16  ? 4.326   -10.326 -9.046  1.00 0.00 ? 16  LYS A CE   7  
ATOM 8847  N NZ   . LYS A 1 16  ? 3.807   -11.629 -8.547  1.00 0.00 ? 16  LYS A NZ   7  
ATOM 8848  H H    . LYS A 1 16  ? 1.425   -8.485  -5.022  1.00 0.00 ? 16  LYS A H    7  
ATOM 8849  H HA   . LYS A 1 16  ? 3.923   -7.084  -5.274  1.00 0.00 ? 16  LYS A HA   7  
ATOM 8850  H HB2  . LYS A 1 16  ? 1.676   -7.517  -7.250  1.00 0.00 ? 16  LYS A HB2  7  
ATOM 8851  H HB3  . LYS A 1 16  ? 3.231   -6.795  -7.643  1.00 0.00 ? 16  LYS A HB3  7  
ATOM 8852  H HG2  . LYS A 1 16  ? 4.299   -8.931  -6.853  1.00 0.00 ? 16  LYS A HG2  7  
ATOM 8853  H HG3  . LYS A 1 16  ? 2.675   -9.620  -6.783  1.00 0.00 ? 16  LYS A HG3  7  
ATOM 8854  H HD2  . LYS A 1 16  ? 2.381   -9.457  -9.098  1.00 0.00 ? 16  LYS A HD2  7  
ATOM 8855  H HD3  . LYS A 1 16  ? 3.702   -8.299  -9.274  1.00 0.00 ? 16  LYS A HD3  7  
ATOM 8856  H HE2  . LYS A 1 16  ? 4.470   -10.391 -10.114 1.00 0.00 ? 16  LYS A HE2  7  
ATOM 8857  H HE3  . LYS A 1 16  ? 5.272   -10.117 -8.568  1.00 0.00 ? 16  LYS A HE3  7  
ATOM 8858  H HZ1  . LYS A 1 16  ? 3.016   -11.470 -7.890  1.00 0.00 ? 16  LYS A HZ1  7  
ATOM 8859  H HZ2  . LYS A 1 16  ? 4.559   -12.145 -8.047  1.00 0.00 ? 16  LYS A HZ2  7  
ATOM 8860  H HZ3  . LYS A 1 16  ? 3.473   -12.210 -9.342  1.00 0.00 ? 16  LYS A HZ3  7  
ATOM 8861  N N    . THR A 1 17  ? 1.099   -5.441  -5.152  1.00 0.00 ? 17  THR A N    7  
ATOM 8862  C CA   . THR A 1 17  ? 0.509   -4.118  -4.994  1.00 0.00 ? 17  THR A CA   7  
ATOM 8863  C C    . THR A 1 17  ? 0.367   -3.752  -3.521  1.00 0.00 ? 17  THR A C    7  
ATOM 8864  O O    . THR A 1 17  ? -0.226  -4.498  -2.740  1.00 0.00 ? 17  THR A O    7  
ATOM 8865  C CB   . THR A 1 17  ? -0.874  -4.035  -5.667  1.00 0.00 ? 17  THR A CB   7  
ATOM 8866  O OG1  . THR A 1 17  ? -0.800  -4.551  -7.001  1.00 0.00 ? 17  THR A OG1  7  
ATOM 8867  C CG2  . THR A 1 17  ? -1.374  -2.599  -5.700  1.00 0.00 ? 17  THR A CG2  7  
ATOM 8868  H H    . THR A 1 17  ? 0.527   -6.233  -5.071  1.00 0.00 ? 17  THR A H    7  
ATOM 8869  H HA   . THR A 1 17  ? 1.163   -3.402  -5.471  1.00 0.00 ? 17  THR A HA   7  
ATOM 8870  H HB   . THR A 1 17  ? -1.572  -4.631  -5.097  1.00 0.00 ? 17  THR A HB   7  
ATOM 8871  H HG1  . THR A 1 17  ? -0.111  -5.218  -7.049  1.00 0.00 ? 17  THR A HG1  7  
ATOM 8872  H HG21 . THR A 1 17  ? -2.447  -2.588  -5.575  1.00 0.00 ? 17  THR A HG21 7  
ATOM 8873  H HG22 . THR A 1 17  ? -1.117  -2.150  -6.648  1.00 0.00 ? 17  THR A HG22 7  
ATOM 8874  H HG23 . THR A 1 17  ? -0.913  -2.039  -4.900  1.00 0.00 ? 17  THR A HG23 7  
ATOM 8875  N N    . LEU A 1 18  ? 0.914   -2.601  -3.146  1.00 0.00 ? 18  LEU A N    7  
ATOM 8876  C CA   . LEU A 1 18  ? 0.847   -2.135  -1.766  1.00 0.00 ? 18  LEU A CA   7  
ATOM 8877  C C    . LEU A 1 18  ? -0.298  -1.145  -1.579  1.00 0.00 ? 18  LEU A C    7  
ATOM 8878  O O    . LEU A 1 18  ? -0.515  -0.266  -2.414  1.00 0.00 ? 18  LEU A O    7  
ATOM 8879  C CB   . LEU A 1 18  ? 2.171   -1.483  -1.362  1.00 0.00 ? 18  LEU A CB   7  
ATOM 8880  C CG   . LEU A 1 18  ? 3.221   -2.415  -0.756  1.00 0.00 ? 18  LEU A CG   7  
ATOM 8881  C CD1  . LEU A 1 18  ? 4.579   -1.732  -0.713  1.00 0.00 ? 18  LEU A CD1  7  
ATOM 8882  C CD2  . LEU A 1 18  ? 2.800   -2.857  0.638   1.00 0.00 ? 18  LEU A CD2  7  
ATOM 8883  H H    . LEU A 1 18  ? 1.373   -2.050  -3.814  1.00 0.00 ? 18  LEU A H    7  
ATOM 8884  H HA   . LEU A 1 18  ? 0.671   -2.994  -1.135  1.00 0.00 ? 18  LEU A HA   7  
ATOM 8885  H HB2  . LEU A 1 18  ? 2.599   -1.032  -2.244  1.00 0.00 ? 18  LEU A HB2  7  
ATOM 8886  H HB3  . LEU A 1 18  ? 1.951   -0.713  -0.636  1.00 0.00 ? 18  LEU A HB3  7  
ATOM 8887  H HG   . LEU A 1 18  ? 3.310   -3.297  -1.375  1.00 0.00 ? 18  LEU A HG   7  
ATOM 8888  H HD11 . LEU A 1 18  ? 4.482   -0.766  -0.241  1.00 0.00 ? 18  LEU A HD11 7  
ATOM 8889  H HD12 . LEU A 1 18  ? 4.950   -1.605  -1.720  1.00 0.00 ? 18  LEU A HD12 7  
ATOM 8890  H HD13 . LEU A 1 18  ? 5.270   -2.341  -0.150  1.00 0.00 ? 18  LEU A HD13 7  
ATOM 8891  H HD21 . LEU A 1 18  ? 3.012   -2.067  1.345   1.00 0.00 ? 18  LEU A HD21 7  
ATOM 8892  H HD22 . LEU A 1 18  ? 3.350   -3.744  0.916   1.00 0.00 ? 18  LEU A HD22 7  
ATOM 8893  H HD23 . LEU A 1 18  ? 1.742   -3.071  0.644   1.00 0.00 ? 18  LEU A HD23 7  
ATOM 8894  N N    . PHE A 1 19  ? -1.028  -1.293  -0.479  1.00 0.00 ? 19  PHE A N    7  
ATOM 8895  C CA   . PHE A 1 19  ? -2.151  -0.411  -0.182  1.00 0.00 ? 19  PHE A CA   7  
ATOM 8896  C C    . PHE A 1 19  ? -1.688  0.816   0.598   1.00 0.00 ? 19  PHE A C    7  
ATOM 8897  O O    . PHE A 1 19  ? -1.145  0.698   1.697   1.00 0.00 ? 19  PHE A O    7  
ATOM 8898  C CB   . PHE A 1 19  ? -3.220  -1.162  0.614   1.00 0.00 ? 19  PHE A CB   7  
ATOM 8899  C CG   . PHE A 1 19  ? -4.459  -0.351  0.868   1.00 0.00 ? 19  PHE A CG   7  
ATOM 8900  C CD1  . PHE A 1 19  ? -5.042  0.384   -0.151  1.00 0.00 ? 19  PHE A CD1  7  
ATOM 8901  C CD2  . PHE A 1 19  ? -5.039  -0.325  2.126   1.00 0.00 ? 19  PHE A CD2  7  
ATOM 8902  C CE1  . PHE A 1 19  ? -6.181  1.132   0.081   1.00 0.00 ? 19  PHE A CE1  7  
ATOM 8903  C CE2  . PHE A 1 19  ? -6.179  0.421   2.364   1.00 0.00 ? 19  PHE A CE2  7  
ATOM 8904  C CZ   . PHE A 1 19  ? -6.751  1.150   1.339   1.00 0.00 ? 19  PHE A CZ   7  
ATOM 8905  H H    . PHE A 1 19  ? -0.807  -2.013  0.149   1.00 0.00 ? 19  PHE A H    7  
ATOM 8906  H HA   . PHE A 1 19  ? -2.574  -0.088  -1.120  1.00 0.00 ? 19  PHE A HA   7  
ATOM 8907  H HB2  . PHE A 1 19  ? -3.510  -2.047  0.068   1.00 0.00 ? 19  PHE A HB2  7  
ATOM 8908  H HB3  . PHE A 1 19  ? -2.810  -1.452  1.570   1.00 0.00 ? 19  PHE A HB3  7  
ATOM 8909  H HD1  . PHE A 1 19  ? -4.599  0.371   -1.135  1.00 0.00 ? 19  PHE A HD1  7  
ATOM 8910  H HD2  . PHE A 1 19  ? -4.592  -0.895  2.929   1.00 0.00 ? 19  PHE A HD2  7  
ATOM 8911  H HE1  . PHE A 1 19  ? -6.627  1.701   -0.722  1.00 0.00 ? 19  PHE A HE1  7  
ATOM 8912  H HE2  . PHE A 1 19  ? -6.621  0.432   3.349   1.00 0.00 ? 19  PHE A HE2  7  
ATOM 8913  H HZ   . PHE A 1 19  ? -7.641  1.733   1.523   1.00 0.00 ? 19  PHE A HZ   7  
ATOM 8914  N N    . VAL A 1 20  ? -1.905  1.993   0.021   1.00 0.00 ? 20  VAL A N    7  
ATOM 8915  C CA   . VAL A 1 20  ? -1.511  3.242   0.662   1.00 0.00 ? 20  VAL A CA   7  
ATOM 8916  C C    . VAL A 1 20  ? -2.731  4.043   1.103   1.00 0.00 ? 20  VAL A C    7  
ATOM 8917  O O    . VAL A 1 20  ? -3.461  4.591   0.276   1.00 0.00 ? 20  VAL A O    7  
ATOM 8918  C CB   . VAL A 1 20  ? -0.655  4.110   -0.280  1.00 0.00 ? 20  VAL A CB   7  
ATOM 8919  C CG1  . VAL A 1 20  ? -0.184  5.368   0.434   1.00 0.00 ? 20  VAL A CG1  7  
ATOM 8920  C CG2  . VAL A 1 20  ? 0.528   3.313   -0.809  1.00 0.00 ? 20  VAL A CG2  7  
ATOM 8921  H H    . VAL A 1 20  ? -2.342  2.023   -0.855  1.00 0.00 ? 20  VAL A H    7  
ATOM 8922  H HA   . VAL A 1 20  ? -0.918  2.999   1.532   1.00 0.00 ? 20  VAL A HA   7  
ATOM 8923  H HB   . VAL A 1 20  ? -1.266  4.407   -1.119  1.00 0.00 ? 20  VAL A HB   7  
ATOM 8924  H HG11 . VAL A 1 20  ? 0.145   5.114   1.431   1.00 0.00 ? 20  VAL A HG11 7  
ATOM 8925  H HG12 . VAL A 1 20  ? 0.636   5.808   -0.115  1.00 0.00 ? 20  VAL A HG12 7  
ATOM 8926  H HG13 . VAL A 1 20  ? -0.999  6.074   0.493   1.00 0.00 ? 20  VAL A HG13 7  
ATOM 8927  H HG21 . VAL A 1 20  ? 1.186   3.969   -1.360  1.00 0.00 ? 20  VAL A HG21 7  
ATOM 8928  H HG22 . VAL A 1 20  ? 1.067   2.875   0.018   1.00 0.00 ? 20  VAL A HG22 7  
ATOM 8929  H HG23 . VAL A 1 20  ? 0.172   2.529   -1.461  1.00 0.00 ? 20  VAL A HG23 7  
ATOM 8930  N N    . LYS A 1 21  ? -2.948  4.107   2.412   1.00 0.00 ? 21  LYS A N    7  
ATOM 8931  C CA   . LYS A 1 21  ? -4.079  4.842   2.965   1.00 0.00 ? 21  LYS A CA   7  
ATOM 8932  C C    . LYS A 1 21  ? -3.603  5.958   3.890   1.00 0.00 ? 21  LYS A C    7  
ATOM 8933  O O    . LYS A 1 21  ? -2.674  5.772   4.675   1.00 0.00 ? 21  LYS A O    7  
ATOM 8934  C CB   . LYS A 1 21  ? -5.006  3.893   3.728   1.00 0.00 ? 21  LYS A CB   7  
ATOM 8935  C CG   . LYS A 1 21  ? -4.487  3.511   5.104   1.00 0.00 ? 21  LYS A CG   7  
ATOM 8936  C CD   . LYS A 1 21  ? -5.565  2.843   5.941   1.00 0.00 ? 21  LYS A CD   7  
ATOM 8937  C CE   . LYS A 1 21  ? -4.994  2.264   7.226   1.00 0.00 ? 21  LYS A CE   7  
ATOM 8938  N NZ   . LYS A 1 21  ? -4.886  3.293   8.297   1.00 0.00 ? 21  LYS A NZ   7  
ATOM 8939  H H    . LYS A 1 21  ? -2.331  3.649   3.021   1.00 0.00 ? 21  LYS A H    7  
ATOM 8940  H HA   . LYS A 1 21  ? -4.624  5.280   2.143   1.00 0.00 ? 21  LYS A HA   7  
ATOM 8941  H HB2  . LYS A 1 21  ? -5.969  4.369   3.849   1.00 0.00 ? 21  LYS A HB2  7  
ATOM 8942  H HB3  . LYS A 1 21  ? -5.132  2.989   3.150   1.00 0.00 ? 21  LYS A HB3  7  
ATOM 8943  H HG2  . LYS A 1 21  ? -3.660  2.827   4.989   1.00 0.00 ? 21  LYS A HG2  7  
ATOM 8944  H HG3  . LYS A 1 21  ? -4.151  4.403   5.612   1.00 0.00 ? 21  LYS A HG3  7  
ATOM 8945  H HD2  . LYS A 1 21  ? -6.319  3.574   6.192   1.00 0.00 ? 21  LYS A HD2  7  
ATOM 8946  H HD3  . LYS A 1 21  ? -6.013  2.045   5.365   1.00 0.00 ? 21  LYS A HD3  7  
ATOM 8947  H HE2  . LYS A 1 21  ? -5.640  1.469   7.566   1.00 0.00 ? 21  LYS A HE2  7  
ATOM 8948  H HE3  . LYS A 1 21  ? -4.011  1.866   7.020   1.00 0.00 ? 21  LYS A HE3  7  
ATOM 8949  H HZ1  . LYS A 1 21  ? -3.885  3.476   8.517   1.00 0.00 ? 21  LYS A HZ1  7  
ATOM 8950  H HZ2  . LYS A 1 21  ? -5.363  2.962   9.160   1.00 0.00 ? 21  LYS A HZ2  7  
ATOM 8951  H HZ3  . LYS A 1 21  ? -5.329  4.180   7.987   1.00 0.00 ? 21  LYS A HZ3  7  
ATOM 8952  N N    . GLY A 1 22  ? -4.248  7.116   3.794   1.00 0.00 ? 22  GLY A N    7  
ATOM 8953  C CA   . GLY A 1 22  ? -3.877  8.244   4.629   1.00 0.00 ? 22  GLY A CA   7  
ATOM 8954  C C    . GLY A 1 22  ? -3.206  9.352   3.841   1.00 0.00 ? 22  GLY A C    7  
ATOM 8955  O O    . GLY A 1 22  ? -2.276  9.995   4.330   1.00 0.00 ? 22  GLY A O    7  
ATOM 8956  H H    . GLY A 1 22  ? -4.982  7.206   3.150   1.00 0.00 ? 22  GLY A H    7  
ATOM 8957  H HA2  . GLY A 1 22  ? -4.766  8.638   5.099   1.00 0.00 ? 22  GLY A HA2  7  
ATOM 8958  H HA3  . GLY A 1 22  ? -3.198  7.901   5.395   1.00 0.00 ? 22  GLY A HA3  7  
ATOM 8959  N N    . LEU A 1 23  ? -3.676  9.575   2.619   1.00 0.00 ? 23  LEU A N    7  
ATOM 8960  C CA   . LEU A 1 23  ? -3.114  10.613  1.761   1.00 0.00 ? 23  LEU A CA   7  
ATOM 8961  C C    . LEU A 1 23  ? -3.981  11.868  1.786   1.00 0.00 ? 23  LEU A C    7  
ATOM 8962  O O    . LEU A 1 23  ? -5.045  11.888  2.405   1.00 0.00 ? 23  LEU A O    7  
ATOM 8963  C CB   . LEU A 1 23  ? -2.982  10.099  0.326   1.00 0.00 ? 23  LEU A CB   7  
ATOM 8964  C CG   . LEU A 1 23  ? -2.109  8.858   0.136   1.00 0.00 ? 23  LEU A CG   7  
ATOM 8965  C CD1  . LEU A 1 23  ? -2.360  8.233   -1.228  1.00 0.00 ? 23  LEU A CD1  7  
ATOM 8966  C CD2  . LEU A 1 23  ? -0.638  9.209   0.301   1.00 0.00 ? 23  LEU A CD2  7  
ATOM 8967  H H    . LEU A 1 23  ? -4.418  9.030   2.285   1.00 0.00 ? 23  LEU A H    7  
ATOM 8968  H HA   . LEU A 1 23  ? -2.133  10.860  2.139   1.00 0.00 ? 23  LEU A HA   7  
ATOM 8969  H HB2  . LEU A 1 23  ? -3.972  9.866   -0.034  1.00 0.00 ? 23  LEU A HB2  7  
ATOM 8970  H HB3  . LEU A 1 23  ? -2.561  10.895  -0.271  1.00 0.00 ? 23  LEU A HB3  7  
ATOM 8971  H HG   . LEU A 1 23  ? -2.366  8.126   0.890   1.00 0.00 ? 23  LEU A HG   7  
ATOM 8972  H HD11 . LEU A 1 23  ? -1.417  7.977   -1.685  1.00 0.00 ? 23  LEU A HD11 7  
ATOM 8973  H HD12 . LEU A 1 23  ? -2.885  8.938   -1.855  1.00 0.00 ? 23  LEU A HD12 7  
ATOM 8974  H HD13 . LEU A 1 23  ? -2.959  7.342   -1.111  1.00 0.00 ? 23  LEU A HD13 7  
ATOM 8975  H HD21 . LEU A 1 23  ? -0.268  9.647   -0.614  1.00 0.00 ? 23  LEU A HD21 7  
ATOM 8976  H HD22 . LEU A 1 23  ? -0.077  8.313   0.525   1.00 0.00 ? 23  LEU A HD22 7  
ATOM 8977  H HD23 . LEU A 1 23  ? -0.526  9.916   1.110   1.00 0.00 ? 23  LEU A HD23 7  
ATOM 8978  N N    . SER A 1 24  ? -3.519  12.913  1.107   1.00 0.00 ? 24  SER A N    7  
ATOM 8979  C CA   . SER A 1 24  ? -4.250  14.173  1.053   1.00 0.00 ? 24  SER A CA   7  
ATOM 8980  C C    . SER A 1 24  ? -5.124  14.241  -0.197  1.00 0.00 ? 24  SER A C    7  
ATOM 8981  O O    . SER A 1 24  ? -4.718  13.807  -1.274  1.00 0.00 ? 24  SER A O    7  
ATOM 8982  C CB   . SER A 1 24  ? -3.278  15.354  1.073   1.00 0.00 ? 24  SER A CB   7  
ATOM 8983  O OG   . SER A 1 24  ? -3.957  16.571  1.330   1.00 0.00 ? 24  SER A OG   7  
ATOM 8984  H H    . SER A 1 24  ? -2.664  12.836  0.634   1.00 0.00 ? 24  SER A H    7  
ATOM 8985  H HA   . SER A 1 24  ? -4.885  14.226  1.925   1.00 0.00 ? 24  SER A HA   7  
ATOM 8986  H HB2  . SER A 1 24  ? -2.541  15.197  1.846   1.00 0.00 ? 24  SER A HB2  7  
ATOM 8987  H HB3  . SER A 1 24  ? -2.784  15.426  0.115   1.00 0.00 ? 24  SER A HB3  7  
ATOM 8988  H HG   . SER A 1 24  ? -4.465  16.824  0.555   1.00 0.00 ? 24  SER A HG   7  
ATOM 8989  N N    . GLU A 1 25  ? -6.325  14.789  -0.043  1.00 0.00 ? 25  GLU A N    7  
ATOM 8990  C CA   . GLU A 1 25  ? -7.256  14.912  -1.158  1.00 0.00 ? 25  GLU A CA   7  
ATOM 8991  C C    . GLU A 1 25  ? -6.537  15.386  -2.417  1.00 0.00 ? 25  GLU A C    7  
ATOM 8992  O O    . GLU A 1 25  ? -7.004  15.162  -3.534  1.00 0.00 ? 25  GLU A O    7  
ATOM 8993  C CB   . GLU A 1 25  ? -8.384  15.885  -0.805  1.00 0.00 ? 25  GLU A CB   7  
ATOM 8994  C CG   . GLU A 1 25  ? -9.155  15.494  0.445   1.00 0.00 ? 25  GLU A CG   7  
ATOM 8995  C CD   . GLU A 1 25  ? -10.412 16.320  0.637   1.00 0.00 ? 25  GLU A CD   7  
ATOM 8996  O OE1  . GLU A 1 25  ? -10.385 17.526  0.312   1.00 0.00 ? 25  GLU A OE1  7  
ATOM 8997  O OE2  . GLU A 1 25  ? -11.422 15.761  1.112   1.00 0.00 ? 25  GLU A OE2  7  
ATOM 8998  H H    . GLU A 1 25  ? -6.591  15.117  0.841   1.00 0.00 ? 25  GLU A H    7  
ATOM 8999  H HA   . GLU A 1 25  ? -7.680  13.937  -1.346  1.00 0.00 ? 25  GLU A HA   7  
ATOM 9000  H HB2  . GLU A 1 25  ? -7.961  16.866  -0.650  1.00 0.00 ? 25  GLU A HB2  7  
ATOM 9001  H HB3  . GLU A 1 25  ? -9.077  15.927  -1.631  1.00 0.00 ? 25  GLU A HB3  7  
ATOM 9002  H HG2  . GLU A 1 25  ? -9.434  14.454  0.370   1.00 0.00 ? 25  GLU A HG2  7  
ATOM 9003  H HG3  . GLU A 1 25  ? -8.516  15.633  1.305   1.00 0.00 ? 25  GLU A HG3  7  
ATOM 9004  N N    . ASP A 1 26  ? -5.398  16.044  -2.229  1.00 0.00 ? 26  ASP A N    7  
ATOM 9005  C CA   . ASP A 1 26  ? -4.613  16.550  -3.349  1.00 0.00 ? 26  ASP A CA   7  
ATOM 9006  C C    . ASP A 1 26  ? -3.586  15.517  -3.803  1.00 0.00 ? 26  ASP A C    7  
ATOM 9007  O O    . ASP A 1 26  ? -3.249  15.438  -4.985  1.00 0.00 ? 26  ASP A O    7  
ATOM 9008  C CB   . ASP A 1 26  ? -3.908  17.850  -2.959  1.00 0.00 ? 26  ASP A CB   7  
ATOM 9009  C CG   . ASP A 1 26  ? -3.192  18.494  -4.130  1.00 0.00 ? 26  ASP A CG   7  
ATOM 9010  O OD1  . ASP A 1 26  ? -3.742  18.463  -5.250  1.00 0.00 ? 26  ASP A OD1  7  
ATOM 9011  O OD2  . ASP A 1 26  ? -2.082  19.029  -3.926  1.00 0.00 ? 26  ASP A OD2  7  
ATOM 9012  H H    . ASP A 1 26  ? -5.077  16.191  -1.314  1.00 0.00 ? 26  ASP A H    7  
ATOM 9013  H HA   . ASP A 1 26  ? -5.290  16.749  -4.165  1.00 0.00 ? 26  ASP A HA   7  
ATOM 9014  H HB2  . ASP A 1 26  ? -4.640  18.549  -2.580  1.00 0.00 ? 26  ASP A HB2  7  
ATOM 9015  H HB3  . ASP A 1 26  ? -3.182  17.641  -2.187  1.00 0.00 ? 26  ASP A HB3  7  
ATOM 9016  N N    . THR A 1 27  ? -3.090  14.726  -2.856  1.00 0.00 ? 27  THR A N    7  
ATOM 9017  C CA   . THR A 1 27  ? -2.100  13.700  -3.158  1.00 0.00 ? 27  THR A CA   7  
ATOM 9018  C C    . THR A 1 27  ? -2.396  13.027  -4.494  1.00 0.00 ? 27  THR A C    7  
ATOM 9019  O O    . THR A 1 27  ? -3.435  12.388  -4.662  1.00 0.00 ? 27  THR A O    7  
ATOM 9020  C CB   . THR A 1 27  ? -2.050  12.626  -2.055  1.00 0.00 ? 27  THR A CB   7  
ATOM 9021  O OG1  . THR A 1 27  ? -1.615  13.211  -0.822  1.00 0.00 ? 27  THR A OG1  7  
ATOM 9022  C CG2  . THR A 1 27  ? -1.112  11.494  -2.445  1.00 0.00 ? 27  THR A CG2  7  
ATOM 9023  H H    . THR A 1 27  ? -3.398  14.838  -1.933  1.00 0.00 ? 27  THR A H    7  
ATOM 9024  H HA   . THR A 1 27  ? -1.132  14.176  -3.213  1.00 0.00 ? 27  THR A HA   7  
ATOM 9025  H HB   . THR A 1 27  ? -3.043  12.222  -1.922  1.00 0.00 ? 27  THR A HB   7  
ATOM 9026  H HG1  . THR A 1 27  ? -0.721  13.547  -0.925  1.00 0.00 ? 27  THR A HG1  7  
ATOM 9027  H HG21 . THR A 1 27  ? -0.381  11.346  -1.663  1.00 0.00 ? 27  THR A HG21 7  
ATOM 9028  H HG22 . THR A 1 27  ? -0.607  11.745  -3.366  1.00 0.00 ? 27  THR A HG22 7  
ATOM 9029  H HG23 . THR A 1 27  ? -1.680  10.587  -2.581  1.00 0.00 ? 27  THR A HG23 7  
ATOM 9030  N N    . THR A 1 28  ? -1.476  13.174  -5.442  1.00 0.00 ? 28  THR A N    7  
ATOM 9031  C CA   . THR A 1 28  ? -1.638  12.581  -6.763  1.00 0.00 ? 28  THR A CA   7  
ATOM 9032  C C    . THR A 1 28  ? -0.830  11.294  -6.891  1.00 0.00 ? 28  THR A C    7  
ATOM 9033  O O    . THR A 1 28  ? 0.133   11.080  -6.156  1.00 0.00 ? 28  THR A O    7  
ATOM 9034  C CB   . THR A 1 28  ? -1.207  13.557  -7.874  1.00 0.00 ? 28  THR A CB   7  
ATOM 9035  O OG1  . THR A 1 28  ? 0.155   13.952  -7.678  1.00 0.00 ? 28  THR A OG1  7  
ATOM 9036  C CG2  . THR A 1 28  ? -2.101  14.788  -7.889  1.00 0.00 ? 28  THR A CG2  7  
ATOM 9037  H H    . THR A 1 28  ? -0.669  13.695  -5.247  1.00 0.00 ? 28  THR A H    7  
ATOM 9038  H HA   . THR A 1 28  ? -2.685  12.352  -6.900  1.00 0.00 ? 28  THR A HA   7  
ATOM 9039  H HB   . THR A 1 28  ? -1.295  13.055  -8.827  1.00 0.00 ? 28  THR A HB   7  
ATOM 9040  H HG1  . THR A 1 28  ? 0.256   14.878  -7.911  1.00 0.00 ? 28  THR A HG1  7  
ATOM 9041  H HG21 . THR A 1 28  ? -3.109  14.498  -8.145  1.00 0.00 ? 28  THR A HG21 7  
ATOM 9042  H HG22 . THR A 1 28  ? -1.732  15.492  -8.621  1.00 0.00 ? 28  THR A HG22 7  
ATOM 9043  H HG23 . THR A 1 28  ? -2.096  15.248  -6.913  1.00 0.00 ? 28  THR A HG23 7  
ATOM 9044  N N    . GLU A 1 29  ? -1.229  10.442  -7.830  1.00 0.00 ? 29  GLU A N    7  
ATOM 9045  C CA   . GLU A 1 29  ? -0.540  9.176   -8.053  1.00 0.00 ? 29  GLU A CA   7  
ATOM 9046  C C    . GLU A 1 29  ? 0.951   9.401   -8.284  1.00 0.00 ? 29  GLU A C    7  
ATOM 9047  O O    . GLU A 1 29  ? 1.772   8.530   -7.998  1.00 0.00 ? 29  GLU A O    7  
ATOM 9048  C CB   . GLU A 1 29  ? -1.148  8.444   -9.251  1.00 0.00 ? 29  GLU A CB   7  
ATOM 9049  C CG   . GLU A 1 29  ? -2.649  8.233   -9.138  1.00 0.00 ? 29  GLU A CG   7  
ATOM 9050  C CD   . GLU A 1 29  ? -3.299  7.943   -10.477 1.00 0.00 ? 29  GLU A CD   7  
ATOM 9051  O OE1  . GLU A 1 29  ? -2.846  8.513   -11.492 1.00 0.00 ? 29  GLU A OE1  7  
ATOM 9052  O OE2  . GLU A 1 29  ? -4.261  7.147   -10.510 1.00 0.00 ? 29  GLU A OE2  7  
ATOM 9053  H H    . GLU A 1 29  ? -2.004  10.669  -8.385  1.00 0.00 ? 29  GLU A H    7  
ATOM 9054  H HA   . GLU A 1 29  ? -0.668  8.569   -7.170  1.00 0.00 ? 29  GLU A HA   7  
ATOM 9055  H HB2  . GLU A 1 29  ? -0.952  9.016   -10.146 1.00 0.00 ? 29  GLU A HB2  7  
ATOM 9056  H HB3  . GLU A 1 29  ? -0.676  7.476   -9.343  1.00 0.00 ? 29  GLU A HB3  7  
ATOM 9057  H HG2  . GLU A 1 29  ? -2.834  7.399   -8.478  1.00 0.00 ? 29  GLU A HG2  7  
ATOM 9058  H HG3  . GLU A 1 29  ? -3.095  9.125   -8.724  1.00 0.00 ? 29  GLU A HG3  7  
ATOM 9059  N N    . GLU A 1 30  ? 1.293   10.575  -8.805  1.00 0.00 ? 30  GLU A N    7  
ATOM 9060  C CA   . GLU A 1 30  ? 2.685   10.914  -9.076  1.00 0.00 ? 30  GLU A CA   7  
ATOM 9061  C C    . GLU A 1 30  ? 3.506   10.909  -7.789  1.00 0.00 ? 30  GLU A C    7  
ATOM 9062  O O    . GLU A 1 30  ? 4.543   10.250  -7.703  1.00 0.00 ? 30  GLU A O    7  
ATOM 9063  C CB   . GLU A 1 30  ? 2.778   12.286  -9.747  1.00 0.00 ? 30  GLU A CB   7  
ATOM 9064  C CG   . GLU A 1 30  ? 2.724   12.226  -11.264 1.00 0.00 ? 30  GLU A CG   7  
ATOM 9065  C CD   . GLU A 1 30  ? 2.790   13.599  -11.905 1.00 0.00 ? 30  GLU A CD   7  
ATOM 9066  O OE1  . GLU A 1 30  ? 3.878   14.211  -11.887 1.00 0.00 ? 30  GLU A OE1  7  
ATOM 9067  O OE2  . GLU A 1 30  ? 1.752   14.060  -12.425 1.00 0.00 ? 30  GLU A OE2  7  
ATOM 9068  H H    . GLU A 1 30  ? 0.593   11.229  -9.012  1.00 0.00 ? 30  GLU A H    7  
ATOM 9069  H HA   . GLU A 1 30  ? 3.084   10.168  -9.746  1.00 0.00 ? 30  GLU A HA   7  
ATOM 9070  H HB2  . GLU A 1 30  ? 1.958   12.899  -9.402  1.00 0.00 ? 30  GLU A HB2  7  
ATOM 9071  H HB3  . GLU A 1 30  ? 3.709   12.752  -9.459  1.00 0.00 ? 30  GLU A HB3  7  
ATOM 9072  H HG2  . GLU A 1 30  ? 3.559   11.640  -11.618 1.00 0.00 ? 30  GLU A HG2  7  
ATOM 9073  H HG3  . GLU A 1 30  ? 1.801   11.750  -11.561 1.00 0.00 ? 30  GLU A HG3  7  
ATOM 9074  N N    . THR A 1 31  ? 3.036   11.649  -6.790  1.00 0.00 ? 31  THR A N    7  
ATOM 9075  C CA   . THR A 1 31  ? 3.726   11.732  -5.509  1.00 0.00 ? 31  THR A CA   7  
ATOM 9076  C C    . THR A 1 31  ? 3.588   10.432  -4.726  1.00 0.00 ? 31  THR A C    7  
ATOM 9077  O O    . THR A 1 31  ? 4.323   10.192  -3.767  1.00 0.00 ? 31  THR A O    7  
ATOM 9078  C CB   . THR A 1 31  ? 3.186   12.893  -4.654  1.00 0.00 ? 31  THR A CB   7  
ATOM 9079  O OG1  . THR A 1 31  ? 4.176   13.306  -3.706  1.00 0.00 ? 31  THR A OG1  7  
ATOM 9080  C CG2  . THR A 1 31  ? 1.917   12.482  -3.922  1.00 0.00 ? 31  THR A CG2  7  
ATOM 9081  H H    . THR A 1 31  ? 2.205   12.152  -6.920  1.00 0.00 ? 31  THR A H    7  
ATOM 9082  H HA   . THR A 1 31  ? 4.773   11.914  -5.706  1.00 0.00 ? 31  THR A HA   7  
ATOM 9083  H HB   . THR A 1 31  ? 2.954   13.723  -5.306  1.00 0.00 ? 31  THR A HB   7  
ATOM 9084  H HG1  . THR A 1 31  ? 4.256   12.643  -3.017  1.00 0.00 ? 31  THR A HG1  7  
ATOM 9085  H HG21 . THR A 1 31  ? 1.165   13.247  -4.047  1.00 0.00 ? 31  THR A HG21 7  
ATOM 9086  H HG22 . THR A 1 31  ? 2.132   12.356  -2.872  1.00 0.00 ? 31  THR A HG22 7  
ATOM 9087  H HG23 . THR A 1 31  ? 1.553   11.551  -4.330  1.00 0.00 ? 31  THR A HG23 7  
ATOM 9088  N N    . LEU A 1 32  ? 2.643   9.594   -5.139  1.00 0.00 ? 32  LEU A N    7  
ATOM 9089  C CA   . LEU A 1 32  ? 2.410   8.316   -4.476  1.00 0.00 ? 32  LEU A CA   7  
ATOM 9090  C C    . LEU A 1 32  ? 3.375   7.252   -4.988  1.00 0.00 ? 32  LEU A C    7  
ATOM 9091  O O    . LEU A 1 32  ? 3.826   6.392   -4.231  1.00 0.00 ? 32  LEU A O    7  
ATOM 9092  C CB   . LEU A 1 32  ? 0.966   7.861   -4.697  1.00 0.00 ? 32  LEU A CB   7  
ATOM 9093  C CG   . LEU A 1 32  ? 0.554   6.570   -3.989  1.00 0.00 ? 32  LEU A CG   7  
ATOM 9094  C CD1  . LEU A 1 32  ? 0.594   6.752   -2.480  1.00 0.00 ? 32  LEU A CD1  7  
ATOM 9095  C CD2  . LEU A 1 32  ? -0.834  6.135   -4.439  1.00 0.00 ? 32  LEU A CD2  7  
ATOM 9096  H H    . LEU A 1 32  ? 2.089   9.840   -5.909  1.00 0.00 ? 32  LEU A H    7  
ATOM 9097  H HA   . LEU A 1 32  ? 2.576   8.457   -3.418  1.00 0.00 ? 32  LEU A HA   7  
ATOM 9098  H HB2  . LEU A 1 32  ? 0.314   8.649   -4.353  1.00 0.00 ? 32  LEU A HB2  7  
ATOM 9099  H HB3  . LEU A 1 32  ? 0.825   7.717   -5.759  1.00 0.00 ? 32  LEU A HB3  7  
ATOM 9100  H HG   . LEU A 1 32  ? 1.252   5.786   -4.249  1.00 0.00 ? 32  LEU A HG   7  
ATOM 9101  H HD11 . LEU A 1 32  ? 1.523   6.360   -2.095  1.00 0.00 ? 32  LEU A HD11 7  
ATOM 9102  H HD12 . LEU A 1 32  ? -0.234  6.223   -2.031  1.00 0.00 ? 32  LEU A HD12 7  
ATOM 9103  H HD13 . LEU A 1 32  ? 0.520   7.803   -2.243  1.00 0.00 ? 32  LEU A HD13 7  
ATOM 9104  H HD21 . LEU A 1 32  ? -0.825  5.077   -4.658  1.00 0.00 ? 32  LEU A HD21 7  
ATOM 9105  H HD22 . LEU A 1 32  ? -1.113  6.684   -5.326  1.00 0.00 ? 32  LEU A HD22 7  
ATOM 9106  H HD23 . LEU A 1 32  ? -1.546  6.334   -3.652  1.00 0.00 ? 32  LEU A HD23 7  
ATOM 9107  N N    . LYS A 1 33  ? 3.690   7.318   -6.277  1.00 0.00 ? 33  LYS A N    7  
ATOM 9108  C CA   . LYS A 1 33  ? 4.605   6.363   -6.891  1.00 0.00 ? 33  LYS A CA   7  
ATOM 9109  C C    . LYS A 1 33  ? 6.043   6.635   -6.463  1.00 0.00 ? 33  LYS A C    7  
ATOM 9110  O O    . LYS A 1 33  ? 6.725   5.749   -5.948  1.00 0.00 ? 33  LYS A O    7  
ATOM 9111  C CB   . LYS A 1 33  ? 4.495   6.428   -8.416  1.00 0.00 ? 33  LYS A CB   7  
ATOM 9112  C CG   . LYS A 1 33  ? 5.290   5.349   -9.130  1.00 0.00 ? 33  LYS A CG   7  
ATOM 9113  C CD   . LYS A 1 33  ? 5.739   5.806   -10.508 1.00 0.00 ? 33  LYS A CD   7  
ATOM 9114  C CE   . LYS A 1 33  ? 7.047   5.146   -10.916 1.00 0.00 ? 33  LYS A CE   7  
ATOM 9115  N NZ   . LYS A 1 33  ? 7.822   5.991   -11.865 1.00 0.00 ? 33  LYS A NZ   7  
ATOM 9116  H H    . LYS A 1 33  ? 3.298   8.027   -6.829  1.00 0.00 ? 33  LYS A H    7  
ATOM 9117  H HA   . LYS A 1 33  ? 4.324   5.375   -6.560  1.00 0.00 ? 33  LYS A HA   7  
ATOM 9118  H HB2  . LYS A 1 33  ? 3.456   6.325   -8.695  1.00 0.00 ? 33  LYS A HB2  7  
ATOM 9119  H HB3  . LYS A 1 33  ? 4.854   7.391   -8.750  1.00 0.00 ? 33  LYS A HB3  7  
ATOM 9120  H HG2  . LYS A 1 33  ? 6.162   5.108   -8.541  1.00 0.00 ? 33  LYS A HG2  7  
ATOM 9121  H HG3  . LYS A 1 33  ? 4.671   4.469   -9.236  1.00 0.00 ? 33  LYS A HG3  7  
ATOM 9122  H HD2  . LYS A 1 33  ? 4.978   5.547   -11.229 1.00 0.00 ? 33  LYS A HD2  7  
ATOM 9123  H HD3  . LYS A 1 33  ? 5.875   6.878   -10.495 1.00 0.00 ? 33  LYS A HD3  7  
ATOM 9124  H HE2  . LYS A 1 33  ? 7.640   4.976   -10.031 1.00 0.00 ? 33  LYS A HE2  7  
ATOM 9125  H HE3  . LYS A 1 33  ? 6.825   4.200   -11.387 1.00 0.00 ? 33  LYS A HE3  7  
ATOM 9126  H HZ1  . LYS A 1 33  ? 8.355   6.717   -11.344 1.00 0.00 ? 33  LYS A HZ1  7  
ATOM 9127  H HZ2  . LYS A 1 33  ? 7.179   6.462   -12.532 1.00 0.00 ? 33  LYS A HZ2  7  
ATOM 9128  H HZ3  . LYS A 1 33  ? 8.492   5.404   -12.402 1.00 0.00 ? 33  LYS A HZ3  7  
ATOM 9129  N N    . GLU A 1 34  ? 6.498   7.866   -6.677  1.00 0.00 ? 34  GLU A N    7  
ATOM 9130  C CA   . GLU A 1 34  ? 7.855   8.253   -6.312  1.00 0.00 ? 34  GLU A CA   7  
ATOM 9131  C C    . GLU A 1 34  ? 8.136   7.935   -4.846  1.00 0.00 ? 34  GLU A C    7  
ATOM 9132  O O    . GLU A 1 34  ? 9.186   7.389   -4.508  1.00 0.00 ? 34  GLU A O    7  
ATOM 9133  C CB   . GLU A 1 34  ? 8.071   9.745   -6.572  1.00 0.00 ? 34  GLU A CB   7  
ATOM 9134  C CG   . GLU A 1 34  ? 7.982   10.126  -8.040  1.00 0.00 ? 34  GLU A CG   7  
ATOM 9135  C CD   . GLU A 1 34  ? 8.789   9.203   -8.933  1.00 0.00 ? 34  GLU A CD   7  
ATOM 9136  O OE1  . GLU A 1 34  ? 10.025  9.363   -8.991  1.00 0.00 ? 34  GLU A OE1  7  
ATOM 9137  O OE2  . GLU A 1 34  ? 8.182   8.318   -9.572  1.00 0.00 ? 34  GLU A OE2  7  
ATOM 9138  H H    . GLU A 1 34  ? 5.906   8.528   -7.092  1.00 0.00 ? 34  GLU A H    7  
ATOM 9139  H HA   . GLU A 1 34  ? 8.538   7.687   -6.928  1.00 0.00 ? 34  GLU A HA   7  
ATOM 9140  H HB2  . GLU A 1 34  ? 7.324   10.305  -6.030  1.00 0.00 ? 34  GLU A HB2  7  
ATOM 9141  H HB3  . GLU A 1 34  ? 9.050   10.023  -6.208  1.00 0.00 ? 34  GLU A HB3  7  
ATOM 9142  H HG2  . GLU A 1 34  ? 6.948   10.086  -8.348  1.00 0.00 ? 34  GLU A HG2  7  
ATOM 9143  H HG3  . GLU A 1 34  ? 8.353   11.133  -8.161  1.00 0.00 ? 34  GLU A HG3  7  
ATOM 9144  N N    . SER A 1 35  ? 7.189   8.281   -3.980  1.00 0.00 ? 35  SER A N    7  
ATOM 9145  C CA   . SER A 1 35  ? 7.335   8.037   -2.550  1.00 0.00 ? 35  SER A CA   7  
ATOM 9146  C C    . SER A 1 35  ? 8.088   6.734   -2.295  1.00 0.00 ? 35  SER A C    7  
ATOM 9147  O O    . SER A 1 35  ? 8.880   6.635   -1.358  1.00 0.00 ? 35  SER A O    7  
ATOM 9148  C CB   . SER A 1 35  ? 5.962   7.985   -1.877  1.00 0.00 ? 35  SER A CB   7  
ATOM 9149  O OG   . SER A 1 35  ? 5.414   9.285   -1.737  1.00 0.00 ? 35  SER A OG   7  
ATOM 9150  H H    . SER A 1 35  ? 6.373   8.713   -4.311  1.00 0.00 ? 35  SER A H    7  
ATOM 9151  H HA   . SER A 1 35  ? 7.902   8.854   -2.130  1.00 0.00 ? 35  SER A HA   7  
ATOM 9152  H HB2  . SER A 1 35  ? 5.292   7.388   -2.476  1.00 0.00 ? 35  SER A HB2  7  
ATOM 9153  H HB3  . SER A 1 35  ? 6.061   7.542   -0.897  1.00 0.00 ? 35  SER A HB3  7  
ATOM 9154  H HG   . SER A 1 35  ? 4.534   9.304   -2.121  1.00 0.00 ? 35  SER A HG   7  
ATOM 9155  N N    . PHE A 1 36  ? 7.834   5.737   -3.137  1.00 0.00 ? 36  PHE A N    7  
ATOM 9156  C CA   . PHE A 1 36  ? 8.487   4.440   -3.003  1.00 0.00 ? 36  PHE A CA   7  
ATOM 9157  C C    . PHE A 1 36  ? 9.631   4.301   -4.003  1.00 0.00 ? 36  PHE A C    7  
ATOM 9158  O O    . PHE A 1 36  ? 9.414   4.292   -5.214  1.00 0.00 ? 36  PHE A O    7  
ATOM 9159  C CB   . PHE A 1 36  ? 7.474   3.312   -3.212  1.00 0.00 ? 36  PHE A CB   7  
ATOM 9160  C CG   . PHE A 1 36  ? 6.242   3.449   -2.363  1.00 0.00 ? 36  PHE A CG   7  
ATOM 9161  C CD1  . PHE A 1 36  ? 5.262   4.375   -2.684  1.00 0.00 ? 36  PHE A CD1  7  
ATOM 9162  C CD2  . PHE A 1 36  ? 6.063   2.651   -1.244  1.00 0.00 ? 36  PHE A CD2  7  
ATOM 9163  C CE1  . PHE A 1 36  ? 4.129   4.503   -1.904  1.00 0.00 ? 36  PHE A CE1  7  
ATOM 9164  C CE2  . PHE A 1 36  ? 4.931   2.774   -0.461  1.00 0.00 ? 36  PHE A CE2  7  
ATOM 9165  C CZ   . PHE A 1 36  ? 3.962   3.700   -0.792  1.00 0.00 ? 36  PHE A CZ   7  
ATOM 9166  H H    . PHE A 1 36  ? 7.193   5.878   -3.864  1.00 0.00 ? 36  PHE A H    7  
ATOM 9167  H HA   . PHE A 1 36  ? 8.887   4.373   -2.004  1.00 0.00 ? 36  PHE A HA   7  
ATOM 9168  H HB2  . PHE A 1 36  ? 7.164   3.303   -4.246  1.00 0.00 ? 36  PHE A HB2  7  
ATOM 9169  H HB3  . PHE A 1 36  ? 7.941   2.370   -2.972  1.00 0.00 ? 36  PHE A HB3  7  
ATOM 9170  H HD1  . PHE A 1 36  ? 5.390   5.002   -3.554  1.00 0.00 ? 36  PHE A HD1  7  
ATOM 9171  H HD2  . PHE A 1 36  ? 6.821   1.925   -0.985  1.00 0.00 ? 36  PHE A HD2  7  
ATOM 9172  H HE1  . PHE A 1 36  ? 3.372   5.228   -2.165  1.00 0.00 ? 36  PHE A HE1  7  
ATOM 9173  H HE2  . PHE A 1 36  ? 4.805   2.145   0.408   1.00 0.00 ? 36  PHE A HE2  7  
ATOM 9174  H HZ   . PHE A 1 36  ? 3.078   3.799   -0.181  1.00 0.00 ? 36  PHE A HZ   7  
ATOM 9175  N N    . ASP A 1 37  ? 10.850  4.195   -3.485  1.00 0.00 ? 37  ASP A N    7  
ATOM 9176  C CA   . ASP A 1 37  ? 12.030  4.057   -4.331  1.00 0.00 ? 37  ASP A CA   7  
ATOM 9177  C C    . ASP A 1 37  ? 12.127  2.646   -4.902  1.00 0.00 ? 37  ASP A C    7  
ATOM 9178  O O    . ASP A 1 37  ? 12.792  1.780   -4.334  1.00 0.00 ? 37  ASP A O    7  
ATOM 9179  C CB   . ASP A 1 37  ? 13.295  4.387   -3.537  1.00 0.00 ? 37  ASP A CB   7  
ATOM 9180  C CG   . ASP A 1 37  ? 14.433  4.849   -4.426  1.00 0.00 ? 37  ASP A CG   7  
ATOM 9181  O OD1  . ASP A 1 37  ? 14.330  5.957   -4.992  1.00 0.00 ? 37  ASP A OD1  7  
ATOM 9182  O OD2  . ASP A 1 37  ? 15.426  4.102   -4.555  1.00 0.00 ? 37  ASP A OD2  7  
ATOM 9183  H H    . ASP A 1 37  ? 10.959  4.210   -2.511  1.00 0.00 ? 37  ASP A H    7  
ATOM 9184  H HA   . ASP A 1 37  ? 11.937  4.756   -5.148  1.00 0.00 ? 37  ASP A HA   7  
ATOM 9185  H HB2  . ASP A 1 37  ? 13.073  5.173   -2.830  1.00 0.00 ? 37  ASP A HB2  7  
ATOM 9186  H HB3  . ASP A 1 37  ? 13.615  3.506   -3.000  1.00 0.00 ? 37  ASP A HB3  7  
ATOM 9187  N N    . GLY A 1 38  ? 11.458  2.421   -6.029  1.00 0.00 ? 38  GLY A N    7  
ATOM 9188  C CA   . GLY A 1 38  ? 11.481  1.113   -6.657  1.00 0.00 ? 38  GLY A CA   7  
ATOM 9189  C C    . GLY A 1 38  ? 10.212  0.820   -7.432  1.00 0.00 ? 38  GLY A C    7  
ATOM 9190  O O    . GLY A 1 38  ? 10.259  0.243   -8.518  1.00 0.00 ? 38  GLY A O    7  
ATOM 9191  H H    . GLY A 1 38  ? 10.945  3.149   -6.437  1.00 0.00 ? 38  GLY A H    7  
ATOM 9192  H HA2  . GLY A 1 38  ? 12.322  1.064   -7.332  1.00 0.00 ? 38  GLY A HA2  7  
ATOM 9193  H HA3  . GLY A 1 38  ? 11.603  0.361   -5.891  1.00 0.00 ? 38  GLY A HA3  7  
ATOM 9194  N N    . SER A 1 39  ? 9.073   1.216   -6.872  1.00 0.00 ? 39  SER A N    7  
ATOM 9195  C CA   . SER A 1 39  ? 7.785   0.988   -7.515  1.00 0.00 ? 39  SER A CA   7  
ATOM 9196  C C    . SER A 1 39  ? 7.858   1.305   -9.006  1.00 0.00 ? 39  SER A C    7  
ATOM 9197  O O    . SER A 1 39  ? 8.744   2.032   -9.455  1.00 0.00 ? 39  SER A O    7  
ATOM 9198  C CB   . SER A 1 39  ? 6.702   1.842   -6.853  1.00 0.00 ? 39  SER A CB   7  
ATOM 9199  O OG   . SER A 1 39  ? 6.862   3.211   -7.179  1.00 0.00 ? 39  SER A OG   7  
ATOM 9200  H H    . SER A 1 39  ? 9.101   1.671   -6.004  1.00 0.00 ? 39  SER A H    7  
ATOM 9201  H HA   . SER A 1 39  ? 7.534   -0.055  -7.393  1.00 0.00 ? 39  SER A HA   7  
ATOM 9202  H HB2  . SER A 1 39  ? 5.731   1.514   -7.193  1.00 0.00 ? 39  SER A HB2  7  
ATOM 9203  H HB3  . SER A 1 39  ? 6.765   1.729   -5.780  1.00 0.00 ? 39  SER A HB3  7  
ATOM 9204  H HG   . SER A 1 39  ? 6.968   3.722   -6.374  1.00 0.00 ? 39  SER A HG   7  
ATOM 9205  N N    . VAL A 1 40  ? 6.919   0.753   -9.769  1.00 0.00 ? 40  VAL A N    7  
ATOM 9206  C CA   . VAL A 1 40  ? 6.875   0.977   -11.209 1.00 0.00 ? 40  VAL A CA   7  
ATOM 9207  C C    . VAL A 1 40  ? 5.704   1.875   -11.590 1.00 0.00 ? 40  VAL A C    7  
ATOM 9208  O O    . VAL A 1 40  ? 5.760   2.597   -12.585 1.00 0.00 ? 40  VAL A O    7  
ATOM 9209  C CB   . VAL A 1 40  ? 6.762   -0.351  -11.980 1.00 0.00 ? 40  VAL A CB   7  
ATOM 9210  C CG1  . VAL A 1 40  ? 8.090   -1.093  -11.964 1.00 0.00 ? 40  VAL A CG1  7  
ATOM 9211  C CG2  . VAL A 1 40  ? 5.653   -1.213  -11.395 1.00 0.00 ? 40  VAL A CG2  7  
ATOM 9212  H H    . VAL A 1 40  ? 6.240   0.183   -9.353  1.00 0.00 ? 40  VAL A H    7  
ATOM 9213  H HA   . VAL A 1 40  ? 7.797   1.460   -11.500 1.00 0.00 ? 40  VAL A HA   7  
ATOM 9214  H HB   . VAL A 1 40  ? 6.512   -0.128  -13.007 1.00 0.00 ? 40  VAL A HB   7  
ATOM 9215  H HG11 . VAL A 1 40  ? 8.580   -0.932  -11.016 1.00 0.00 ? 40  VAL A HG11 7  
ATOM 9216  H HG12 . VAL A 1 40  ? 7.914   -2.150  -12.105 1.00 0.00 ? 40  VAL A HG12 7  
ATOM 9217  H HG13 . VAL A 1 40  ? 8.718   -0.723  -12.761 1.00 0.00 ? 40  VAL A HG13 7  
ATOM 9218  H HG21 . VAL A 1 40  ? 5.117   -0.650  -10.646 1.00 0.00 ? 40  VAL A HG21 7  
ATOM 9219  H HG22 . VAL A 1 40  ? 4.972   -1.506  -12.181 1.00 0.00 ? 40  VAL A HG22 7  
ATOM 9220  H HG23 . VAL A 1 40  ? 6.082   -2.096  -10.944 1.00 0.00 ? 40  VAL A HG23 7  
ATOM 9221  N N    . ARG A 1 41  ? 4.643   1.825   -10.791 1.00 0.00 ? 41  ARG A N    7  
ATOM 9222  C CA   . ARG A 1 41  ? 3.457   2.634   -11.045 1.00 0.00 ? 41  ARG A CA   7  
ATOM 9223  C C    . ARG A 1 41  ? 2.669   2.863   -9.758  1.00 0.00 ? 41  ARG A C    7  
ATOM 9224  O O    . ARG A 1 41  ? 2.955   2.254   -8.727  1.00 0.00 ? 41  ARG A O    7  
ATOM 9225  C CB   . ARG A 1 41  ? 2.565   1.956   -12.087 1.00 0.00 ? 41  ARG A CB   7  
ATOM 9226  C CG   . ARG A 1 41  ? 3.236   1.777   -13.439 1.00 0.00 ? 41  ARG A CG   7  
ATOM 9227  C CD   . ARG A 1 41  ? 2.231   1.393   -14.513 1.00 0.00 ? 41  ARG A CD   7  
ATOM 9228  N NE   . ARG A 1 41  ? 2.871   0.749   -15.657 1.00 0.00 ? 41  ARG A NE   7  
ATOM 9229  C CZ   . ARG A 1 41  ? 3.268   -0.519  -15.659 1.00 0.00 ? 41  ARG A CZ   7  
ATOM 9230  N NH1  . ARG A 1 41  ? 3.091   -1.274  -14.584 1.00 0.00 ? 41  ARG A NH1  7  
ATOM 9231  N NH2  . ARG A 1 41  ? 3.844   -1.033  -16.738 1.00 0.00 ? 41  ARG A NH2  7  
ATOM 9232  H H    . ARG A 1 41  ? 4.658   1.229   -10.013 1.00 0.00 ? 41  ARG A H    7  
ATOM 9233  H HA   . ARG A 1 41  ? 3.782   3.589   -11.429 1.00 0.00 ? 41  ARG A HA   7  
ATOM 9234  H HB2  . ARG A 1 41  ? 2.279   0.981   -11.720 1.00 0.00 ? 41  ARG A HB2  7  
ATOM 9235  H HB3  . ARG A 1 41  ? 1.677   2.554   -12.226 1.00 0.00 ? 41  ARG A HB3  7  
ATOM 9236  H HG2  . ARG A 1 41  ? 3.709   2.706   -13.721 1.00 0.00 ? 41  ARG A HG2  7  
ATOM 9237  H HG3  . ARG A 1 41  ? 3.981   1.000   -13.360 1.00 0.00 ? 41  ARG A HG3  7  
ATOM 9238  H HD2  . ARG A 1 41  ? 1.510   0.711   -14.086 1.00 0.00 ? 41  ARG A HD2  7  
ATOM 9239  H HD3  . ARG A 1 41  ? 1.725   2.285   -14.850 1.00 0.00 ? 41  ARG A HD3  7  
ATOM 9240  H HE   . ARG A 1 41  ? 3.012   1.289   -16.462 1.00 0.00 ? 41  ARG A HE   7  
ATOM 9241  H HH11 . ARG A 1 41  ? 2.657   -0.890  -13.770 1.00 0.00 ? 41  ARG A HH11 7  
ATOM 9242  H HH12 . ARG A 1 41  ? 3.390   -2.229  -14.589 1.00 0.00 ? 41  ARG A HH12 7  
ATOM 9243  H HH21 . ARG A 1 41  ? 3.979   -0.466  -17.551 1.00 0.00 ? 41  ARG A HH21 7  
ATOM 9244  H HH22 . ARG A 1 41  ? 4.143   -1.987  -16.739 1.00 0.00 ? 41  ARG A HH22 7  
ATOM 9245  N N    . ALA A 1 42  ? 1.678   3.745   -9.826  1.00 0.00 ? 42  ALA A N    7  
ATOM 9246  C CA   . ALA A 1 42  ? 0.849   4.053   -8.667  1.00 0.00 ? 42  ALA A CA   7  
ATOM 9247  C C    . ALA A 1 42  ? -0.575  4.400   -9.088  1.00 0.00 ? 42  ALA A C    7  
ATOM 9248  O O    . ALA A 1 42  ? -0.806  4.875   -10.201 1.00 0.00 ? 42  ALA A O    7  
ATOM 9249  C CB   . ALA A 1 42  ? 1.459   5.197   -7.871  1.00 0.00 ? 42  ALA A CB   7  
ATOM 9250  H H    . ALA A 1 42  ? 1.499   4.198   -10.676 1.00 0.00 ? 42  ALA A H    7  
ATOM 9251  H HA   . ALA A 1 42  ? 0.823   3.179   -8.033  1.00 0.00 ? 42  ALA A HA   7  
ATOM 9252  H HB1  . ALA A 1 42  ? 1.480   6.088   -8.481  1.00 0.00 ? 42  ALA A HB1  7  
ATOM 9253  H HB2  . ALA A 1 42  ? 0.865   5.378   -6.988  1.00 0.00 ? 42  ALA A HB2  7  
ATOM 9254  H HB3  . ALA A 1 42  ? 2.466   4.936   -7.581  1.00 0.00 ? 42  ALA A HB3  7  
ATOM 9255  N N    . ARG A 1 43  ? -1.527  4.160   -8.192  1.00 0.00 ? 43  ARG A N    7  
ATOM 9256  C CA   . ARG A 1 43  ? -2.929  4.446   -8.472  1.00 0.00 ? 43  ARG A CA   7  
ATOM 9257  C C    . ARG A 1 43  ? -3.616  5.047   -7.249  1.00 0.00 ? 43  ARG A C    7  
ATOM 9258  O O    . ARG A 1 43  ? -3.240  4.763   -6.112  1.00 0.00 ? 43  ARG A O    7  
ATOM 9259  C CB   . ARG A 1 43  ? -3.656  3.171   -8.903  1.00 0.00 ? 43  ARG A CB   7  
ATOM 9260  C CG   . ARG A 1 43  ? -2.869  2.325   -9.891  1.00 0.00 ? 43  ARG A CG   7  
ATOM 9261  C CD   . ARG A 1 43  ? -3.790  1.531   -10.803 1.00 0.00 ? 43  ARG A CD   7  
ATOM 9262  N NE   . ARG A 1 43  ? -4.358  2.360   -11.863 1.00 0.00 ? 43  ARG A NE   7  
ATOM 9263  C CZ   . ARG A 1 43  ? -5.302  1.939   -12.698 1.00 0.00 ? 43  ARG A CZ   7  
ATOM 9264  N NH1  . ARG A 1 43  ? -5.781  0.708   -12.596 1.00 0.00 ? 43  ARG A NH1  7  
ATOM 9265  N NH2  . ARG A 1 43  ? -5.768  2.752   -13.637 1.00 0.00 ? 43  ARG A NH2  7  
ATOM 9266  H H    . ARG A 1 43  ? -1.281  3.781   -7.323  1.00 0.00 ? 43  ARG A H    7  
ATOM 9267  H HA   . ARG A 1 43  ? -2.967  5.162   -9.280  1.00 0.00 ? 43  ARG A HA   7  
ATOM 9268  H HB2  . ARG A 1 43  ? -3.854  2.570   -8.027  1.00 0.00 ? 43  ARG A HB2  7  
ATOM 9269  H HB3  . ARG A 1 43  ? -4.594  3.443   -9.363  1.00 0.00 ? 43  ARG A HB3  7  
ATOM 9270  H HG2  . ARG A 1 43  ? -2.254  2.975   -10.496 1.00 0.00 ? 43  ARG A HG2  7  
ATOM 9271  H HG3  . ARG A 1 43  ? -2.240  1.640   -9.342  1.00 0.00 ? 43  ARG A HG3  7  
ATOM 9272  H HD2  . ARG A 1 43  ? -3.226  0.727   -11.251 1.00 0.00 ? 43  ARG A HD2  7  
ATOM 9273  H HD3  . ARG A 1 43  ? -4.594  1.120   -10.210 1.00 0.00 ? 43  ARG A HD3  7  
ATOM 9274  H HE   . ARG A 1 43  ? -4.018  3.273   -11.956 1.00 0.00 ? 43  ARG A HE   7  
ATOM 9275  H HH11 . ARG A 1 43  ? -5.433  0.093   -11.889 1.00 0.00 ? 43  ARG A HH11 7  
ATOM 9276  H HH12 . ARG A 1 43  ? -6.493  0.394   -13.226 1.00 0.00 ? 43  ARG A HH12 7  
ATOM 9277  H HH21 . ARG A 1 43  ? -5.409  3.682   -13.717 1.00 0.00 ? 43  ARG A HH21 7  
ATOM 9278  H HH22 . ARG A 1 43  ? -6.478  2.435   -14.265 1.00 0.00 ? 43  ARG A HH22 7  
ATOM 9279  N N    . ILE A 1 44  ? -4.623  5.879   -7.492  1.00 0.00 ? 44  ILE A N    7  
ATOM 9280  C CA   . ILE A 1 44  ? -5.362  6.519   -6.411  1.00 0.00 ? 44  ILE A CA   7  
ATOM 9281  C C    . ILE A 1 44  ? -6.867  6.402   -6.629  1.00 0.00 ? 44  ILE A C    7  
ATOM 9282  O O    . ILE A 1 44  ? -7.355  6.532   -7.752  1.00 0.00 ? 44  ILE A O    7  
ATOM 9283  C CB   . ILE A 1 44  ? -4.989  8.008   -6.278  1.00 0.00 ? 44  ILE A CB   7  
ATOM 9284  C CG1  . ILE A 1 44  ? -3.552  8.152   -5.774  1.00 0.00 ? 44  ILE A CG1  7  
ATOM 9285  C CG2  . ILE A 1 44  ? -5.958  8.716   -5.343  1.00 0.00 ? 44  ILE A CG2  7  
ATOM 9286  C CD1  . ILE A 1 44  ? -3.035  9.573   -5.822  1.00 0.00 ? 44  ILE A CD1  7  
ATOM 9287  H H    . ILE A 1 44  ? -4.876  6.066   -8.420  1.00 0.00 ? 44  ILE A H    7  
ATOM 9288  H HA   . ILE A 1 44  ? -5.103  6.020   -5.489  1.00 0.00 ? 44  ILE A HA   7  
ATOM 9289  H HB   . ILE A 1 44  ? -5.069  8.464   -7.253  1.00 0.00 ? 44  ILE A HB   7  
ATOM 9290  H HG12 . ILE A 1 44  ? -3.500  7.816   -4.751  1.00 0.00 ? 44  ILE A HG12 7  
ATOM 9291  H HG13 . ILE A 1 44  ? -2.902  7.541   -6.383  1.00 0.00 ? 44  ILE A HG13 7  
ATOM 9292  H HG21 . ILE A 1 44  ? -6.412  7.993   -4.681  1.00 0.00 ? 44  ILE A HG21 7  
ATOM 9293  H HG22 . ILE A 1 44  ? -5.423  9.450   -4.760  1.00 0.00 ? 44  ILE A HG22 7  
ATOM 9294  H HG23 . ILE A 1 44  ? -6.726  9.205   -5.923  1.00 0.00 ? 44  ILE A HG23 7  
ATOM 9295  H HD11 . ILE A 1 44  ? -3.180  9.976   -6.813  1.00 0.00 ? 44  ILE A HD11 7  
ATOM 9296  H HD12 . ILE A 1 44  ? -3.570  10.176  -5.105  1.00 0.00 ? 44  ILE A HD12 7  
ATOM 9297  H HD13 . ILE A 1 44  ? -1.981  9.581   -5.583  1.00 0.00 ? 44  ILE A HD13 7  
ATOM 9298  N N    . VAL A 1 45  ? -7.599  6.157   -5.546  1.00 0.00 ? 45  VAL A N    7  
ATOM 9299  C CA   . VAL A 1 45  ? -9.049  6.025   -5.618  1.00 0.00 ? 45  VAL A CA   7  
ATOM 9300  C C    . VAL A 1 45  ? -9.728  7.389   -5.571  1.00 0.00 ? 45  VAL A C    7  
ATOM 9301  O O    . VAL A 1 45  ? -9.176  8.353   -5.039  1.00 0.00 ? 45  VAL A O    7  
ATOM 9302  C CB   . VAL A 1 45  ? -9.591  5.154   -4.469  1.00 0.00 ? 45  VAL A CB   7  
ATOM 9303  C CG1  . VAL A 1 45  ? -9.003  3.753   -4.537  1.00 0.00 ? 45  VAL A CG1  7  
ATOM 9304  C CG2  . VAL A 1 45  ? -9.292  5.801   -3.124  1.00 0.00 ? 45  VAL A CG2  7  
ATOM 9305  H H    . VAL A 1 45  ? -7.153  6.064   -4.679  1.00 0.00 ? 45  VAL A H    7  
ATOM 9306  H HA   . VAL A 1 45  ? -9.295  5.543   -6.553  1.00 0.00 ? 45  VAL A HA   7  
ATOM 9307  H HB   . VAL A 1 45  ? -10.662 5.076   -4.577  1.00 0.00 ? 45  VAL A HB   7  
ATOM 9308  H HG11 . VAL A 1 45  ? -8.033  3.746   -4.060  1.00 0.00 ? 45  VAL A HG11 7  
ATOM 9309  H HG12 . VAL A 1 45  ? -9.660  3.061   -4.031  1.00 0.00 ? 45  VAL A HG12 7  
ATOM 9310  H HG13 . VAL A 1 45  ? -8.896  3.458   -5.571  1.00 0.00 ? 45  VAL A HG13 7  
ATOM 9311  H HG21 . VAL A 1 45  ? -8.894  6.792   -3.283  1.00 0.00 ? 45  VAL A HG21 7  
ATOM 9312  H HG22 . VAL A 1 45  ? -10.203 5.868   -2.546  1.00 0.00 ? 45  VAL A HG22 7  
ATOM 9313  H HG23 . VAL A 1 45  ? -8.569  5.203   -2.589  1.00 0.00 ? 45  VAL A HG23 7  
ATOM 9314  N N    . THR A 1 46  ? -10.932 7.464   -6.130  1.00 0.00 ? 46  THR A N    7  
ATOM 9315  C CA   . THR A 1 46  ? -11.687 8.710   -6.153  1.00 0.00 ? 46  THR A CA   7  
ATOM 9316  C C    . THR A 1 46  ? -13.167 8.462   -5.882  1.00 0.00 ? 46  THR A C    7  
ATOM 9317  O O    . THR A 1 46  ? -13.672 7.362   -6.107  1.00 0.00 ? 46  THR A O    7  
ATOM 9318  C CB   . THR A 1 46  ? -11.539 9.433   -7.506  1.00 0.00 ? 46  THR A CB   7  
ATOM 9319  O OG1  . THR A 1 46  ? -12.002 8.588   -8.565  1.00 0.00 ? 46  THR A OG1  7  
ATOM 9320  C CG2  . THR A 1 46  ? -10.089 9.821   -7.756  1.00 0.00 ? 46  THR A CG2  7  
ATOM 9321  H H    . THR A 1 46  ? -11.319 6.662   -6.538  1.00 0.00 ? 46  THR A H    7  
ATOM 9322  H HA   . THR A 1 46  ? -11.293 9.354   -5.380  1.00 0.00 ? 46  THR A HA   7  
ATOM 9323  H HB   . THR A 1 46  ? -12.138 10.332  -7.484  1.00 0.00 ? 46  THR A HB   7  
ATOM 9324  H HG1  . THR A 1 46  ? -12.067 9.098   -9.376  1.00 0.00 ? 46  THR A HG1  7  
ATOM 9325  H HG21 . THR A 1 46  ? -9.623  10.094  -6.821  1.00 0.00 ? 46  THR A HG21 7  
ATOM 9326  H HG22 . THR A 1 46  ? -10.054 10.659  -8.435  1.00 0.00 ? 46  THR A HG22 7  
ATOM 9327  H HG23 . THR A 1 46  ? -9.563  8.984   -8.189  1.00 0.00 ? 46  THR A HG23 7  
ATOM 9328  N N    . ASP A 1 47  ? -13.856 9.490   -5.400  1.00 0.00 ? 47  ASP A N    7  
ATOM 9329  C CA   . ASP A 1 47  ? -15.279 9.383   -5.100  1.00 0.00 ? 47  ASP A CA   7  
ATOM 9330  C C    . ASP A 1 47  ? -16.110 9.459   -6.377  1.00 0.00 ? 47  ASP A C    7  
ATOM 9331  O O    . ASP A 1 47  ? -15.647 9.959   -7.402  1.00 0.00 ? 47  ASP A O    7  
ATOM 9332  C CB   . ASP A 1 47  ? -15.703 10.490  -4.133  1.00 0.00 ? 47  ASP A CB   7  
ATOM 9333  C CG   . ASP A 1 47  ? -17.108 10.286  -3.601  1.00 0.00 ? 47  ASP A CG   7  
ATOM 9334  O OD1  . ASP A 1 47  ? -17.497 9.120   -3.385  1.00 0.00 ? 47  ASP A OD1  7  
ATOM 9335  O OD2  . ASP A 1 47  ? -17.818 11.294  -3.401  1.00 0.00 ? 47  ASP A OD2  7  
ATOM 9336  H H    . ASP A 1 47  ? -13.397 10.341  -5.242  1.00 0.00 ? 47  ASP A H    7  
ATOM 9337  H HA   . ASP A 1 47  ? -15.448 8.425   -4.632  1.00 0.00 ? 47  ASP A HA   7  
ATOM 9338  H HB2  . ASP A 1 47  ? -15.020 10.509  -3.296  1.00 0.00 ? 47  ASP A HB2  7  
ATOM 9339  H HB3  . ASP A 1 47  ? -15.665 11.440  -4.645  1.00 0.00 ? 47  ASP A HB3  7  
ATOM 9340  N N    . ARG A 1 48  ? -17.340 8.959   -6.307  1.00 0.00 ? 48  ARG A N    7  
ATOM 9341  C CA   . ARG A 1 48  ? -18.235 8.969   -7.458  1.00 0.00 ? 48  ARG A CA   7  
ATOM 9342  C C    . ARG A 1 48  ? -19.127 10.207  -7.442  1.00 0.00 ? 48  ARG A C    7  
ATOM 9343  O O    . ARG A 1 48  ? -19.632 10.632  -8.480  1.00 0.00 ? 48  ARG A O    7  
ATOM 9344  C CB   . ARG A 1 48  ? -19.098 7.706   -7.470  1.00 0.00 ? 48  ARG A CB   7  
ATOM 9345  C CG   . ARG A 1 48  ? -20.178 7.717   -8.539  1.00 0.00 ? 48  ARG A CG   7  
ATOM 9346  C CD   . ARG A 1 48  ? -21.223 6.641   -8.287  1.00 0.00 ? 48  ARG A CD   7  
ATOM 9347  N NE   . ARG A 1 48  ? -22.311 7.121   -7.439  1.00 0.00 ? 48  ARG A NE   7  
ATOM 9348  C CZ   . ARG A 1 48  ? -23.141 6.318   -6.783  1.00 0.00 ? 48  ARG A CZ   7  
ATOM 9349  N NH1  . ARG A 1 48  ? -23.008 5.002   -6.877  1.00 0.00 ? 48  ARG A NH1  7  
ATOM 9350  N NH2  . ARG A 1 48  ? -24.107 6.831   -6.032  1.00 0.00 ? 48  ARG A NH2  7  
ATOM 9351  H H    . ARG A 1 48  ? -17.652 8.574   -5.462  1.00 0.00 ? 48  ARG A H    7  
ATOM 9352  H HA   . ARG A 1 48  ? -17.628 8.988   -8.350  1.00 0.00 ? 48  ARG A HA   7  
ATOM 9353  H HB2  . ARG A 1 48  ? -18.461 6.850   -7.642  1.00 0.00 ? 48  ARG A HB2  7  
ATOM 9354  H HB3  . ARG A 1 48  ? -19.575 7.601   -6.507  1.00 0.00 ? 48  ARG A HB3  7  
ATOM 9355  H HG2  . ARG A 1 48  ? -20.664 8.682   -8.537  1.00 0.00 ? 48  ARG A HG2  7  
ATOM 9356  H HG3  . ARG A 1 48  ? -19.721 7.544   -9.502  1.00 0.00 ? 48  ARG A HG3  7  
ATOM 9357  H HD2  . ARG A 1 48  ? -21.631 6.325   -9.235  1.00 0.00 ? 48  ARG A HD2  7  
ATOM 9358  H HD3  . ARG A 1 48  ? -20.745 5.802   -7.803  1.00 0.00 ? 48  ARG A HD3  7  
ATOM 9359  H HE   . ARG A 1 48  ? -22.427 8.090   -7.356  1.00 0.00 ? 48  ARG A HE   7  
ATOM 9360  H HH11 . ARG A 1 48  ? -22.281 4.613   -7.441  1.00 0.00 ? 48  ARG A HH11 7  
ATOM 9361  H HH12 . ARG A 1 48  ? -23.634 4.400   -6.381  1.00 0.00 ? 48  ARG A HH12 7  
ATOM 9362  H HH21 . ARG A 1 48  ? -24.210 7.823   -5.959  1.00 0.00 ? 48  ARG A HH21 7  
ATOM 9363  H HH22 . ARG A 1 48  ? -24.731 6.226   -5.539  1.00 0.00 ? 48  ARG A HH22 7  
ATOM 9364  N N    . GLU A 1 49  ? -19.316 10.780  -6.257  1.00 0.00 ? 49  GLU A N    7  
ATOM 9365  C CA   . GLU A 1 49  ? -20.148 11.968  -6.108  1.00 0.00 ? 49  GLU A CA   7  
ATOM 9366  C C    . GLU A 1 49  ? -19.320 13.237  -6.288  1.00 0.00 ? 49  GLU A C    7  
ATOM 9367  O O    . GLU A 1 49  ? -19.610 14.064  -7.154  1.00 0.00 ? 49  GLU A O    7  
ATOM 9368  C CB   . GLU A 1 49  ? -20.821 11.976  -4.734  1.00 0.00 ? 49  GLU A CB   7  
ATOM 9369  C CG   . GLU A 1 49  ? -21.707 13.188  -4.498  1.00 0.00 ? 49  GLU A CG   7  
ATOM 9370  C CD   . GLU A 1 49  ? -22.039 13.391  -3.032  1.00 0.00 ? 49  GLU A CD   7  
ATOM 9371  O OE1  . GLU A 1 49  ? -21.209 13.017  -2.178  1.00 0.00 ? 49  GLU A OE1  7  
ATOM 9372  O OE2  . GLU A 1 49  ? -23.130 13.924  -2.740  1.00 0.00 ? 49  GLU A OE2  7  
ATOM 9373  H H    . GLU A 1 49  ? -18.886 10.394  -5.466  1.00 0.00 ? 49  GLU A H    7  
ATOM 9374  H HA   . GLU A 1 49  ? -20.909 11.938  -6.872  1.00 0.00 ? 49  GLU A HA   7  
ATOM 9375  H HB2  . GLU A 1 49  ? -21.428 11.087  -4.639  1.00 0.00 ? 49  GLU A HB2  7  
ATOM 9376  H HB3  . GLU A 1 49  ? -20.057 11.961  -3.971  1.00 0.00 ? 49  GLU A HB3  7  
ATOM 9377  H HG2  . GLU A 1 49  ? -21.197 14.067  -4.860  1.00 0.00 ? 49  GLU A HG2  7  
ATOM 9378  H HG3  . GLU A 1 49  ? -22.629 13.056  -5.045  1.00 0.00 ? 49  GLU A HG3  7  
ATOM 9379  N N    . THR A 1 50  ? -18.289 13.387  -5.463  1.00 0.00 ? 50  THR A N    7  
ATOM 9380  C CA   . THR A 1 50  ? -17.420 14.555  -5.529  1.00 0.00 ? 50  THR A CA   7  
ATOM 9381  C C    . THR A 1 50  ? -16.434 14.443  -6.686  1.00 0.00 ? 50  THR A C    7  
ATOM 9382  O O    . THR A 1 50  ? -16.061 15.444  -7.296  1.00 0.00 ? 50  THR A O    7  
ATOM 9383  C CB   . THR A 1 50  ? -16.636 14.747  -4.217  1.00 0.00 ? 50  THR A CB   7  
ATOM 9384  O OG1  . THR A 1 50  ? -15.884 13.565  -3.919  1.00 0.00 ? 50  THR A OG1  7  
ATOM 9385  C CG2  . THR A 1 50  ? -17.577 15.060  -3.064  1.00 0.00 ? 50  THR A CG2  7  
ATOM 9386  H H    . THR A 1 50  ? -18.109 12.694  -4.794  1.00 0.00 ? 50  THR A H    7  
ATOM 9387  H HA   . THR A 1 50  ? -18.042 15.425  -5.682  1.00 0.00 ? 50  THR A HA   7  
ATOM 9388  H HB   . THR A 1 50  ? -15.954 15.576  -4.341  1.00 0.00 ? 50  THR A HB   7  
ATOM 9389  H HG1  . THR A 1 50  ? -15.295 13.738  -3.180  1.00 0.00 ? 50  THR A HG1  7  
ATOM 9390  H HG21 . THR A 1 50  ? -17.144 14.707  -2.140  1.00 0.00 ? 50  THR A HG21 7  
ATOM 9391  H HG22 . THR A 1 50  ? -18.524 14.569  -3.229  1.00 0.00 ? 50  THR A HG22 7  
ATOM 9392  H HG23 . THR A 1 50  ? -17.730 16.127  -3.005  1.00 0.00 ? 50  THR A HG23 7  
ATOM 9393  N N    . GLY A 1 51  ? -16.015 13.216  -6.984  1.00 0.00 ? 51  GLY A N    7  
ATOM 9394  C CA   . GLY A 1 51  ? -15.076 12.996  -8.068  1.00 0.00 ? 51  GLY A CA   7  
ATOM 9395  C C    . GLY A 1 51  ? -13.682 13.489  -7.736  1.00 0.00 ? 51  GLY A C    7  
ATOM 9396  O O    . GLY A 1 51  ? -13.027 14.123  -8.563  1.00 0.00 ? 51  GLY A O    7  
ATOM 9397  H H    . GLY A 1 51  ? -16.347 12.455  -6.463  1.00 0.00 ? 51  GLY A H    7  
ATOM 9398  H HA2  . GLY A 1 51  ? -15.032 11.938  -8.281  1.00 0.00 ? 51  GLY A HA2  7  
ATOM 9399  H HA3  . GLY A 1 51  ? -15.430 13.516  -8.946  1.00 0.00 ? 51  GLY A HA3  7  
ATOM 9400  N N    . SER A 1 52  ? -13.226 13.199  -6.522  1.00 0.00 ? 52  SER A N    7  
ATOM 9401  C CA   . SER A 1 52  ? -11.902 13.622  -6.080  1.00 0.00 ? 52  SER A CA   7  
ATOM 9402  C C    . SER A 1 52  ? -11.197 12.499  -5.326  1.00 0.00 ? 52  SER A C    7  
ATOM 9403  O O    . SER A 1 52  ? -11.828 11.536  -4.890  1.00 0.00 ? 52  SER A O    7  
ATOM 9404  C CB   . SER A 1 52  ? -12.010 14.861  -5.190  1.00 0.00 ? 52  SER A CB   7  
ATOM 9405  O OG   . SER A 1 52  ? -10.792 15.584  -5.171  1.00 0.00 ? 52  SER A OG   7  
ATOM 9406  H H    . SER A 1 52  ? -13.795 12.690  -5.907  1.00 0.00 ? 52  SER A H    7  
ATOM 9407  H HA   . SER A 1 52  ? -11.324 13.869  -6.958  1.00 0.00 ? 52  SER A HA   7  
ATOM 9408  H HB2  . SER A 1 52  ? -12.791 15.504  -5.566  1.00 0.00 ? 52  SER A HB2  7  
ATOM 9409  H HB3  . SER A 1 52  ? -12.250 14.556  -4.181  1.00 0.00 ? 52  SER A HB3  7  
ATOM 9410  H HG   . SER A 1 52  ? -10.978 16.525  -5.150  1.00 0.00 ? 52  SER A HG   7  
ATOM 9411  N N    . SER A 1 53  ? -9.882  12.631  -5.176  1.00 0.00 ? 53  SER A N    7  
ATOM 9412  C CA   . SER A 1 53  ? -9.089  11.626  -4.478  1.00 0.00 ? 53  SER A CA   7  
ATOM 9413  C C    . SER A 1 53  ? -9.476  11.556  -3.003  1.00 0.00 ? 53  SER A C    7  
ATOM 9414  O O    . SER A 1 53  ? -9.185  12.468  -2.229  1.00 0.00 ? 53  SER A O    7  
ATOM 9415  C CB   . SER A 1 53  ? -7.597  11.942  -4.610  1.00 0.00 ? 53  SER A CB   7  
ATOM 9416  O OG   . SER A 1 53  ? -7.209  12.005  -5.972  1.00 0.00 ? 53  SER A OG   7  
ATOM 9417  H H    . SER A 1 53  ? -9.436  13.421  -5.546  1.00 0.00 ? 53  SER A H    7  
ATOM 9418  H HA   . SER A 1 53  ? -9.288  10.669  -4.936  1.00 0.00 ? 53  SER A HA   7  
ATOM 9419  H HB2  . SER A 1 53  ? -7.390  12.893  -4.145  1.00 0.00 ? 53  SER A HB2  7  
ATOM 9420  H HB3  . SER A 1 53  ? -7.024  11.168  -4.120  1.00 0.00 ? 53  SER A HB3  7  
ATOM 9421  H HG   . SER A 1 53  ? -6.300  12.309  -6.032  1.00 0.00 ? 53  SER A HG   7  
ATOM 9422  N N    . LYS A 1 54  ? -10.134 10.467  -2.623  1.00 0.00 ? 54  LYS A N    7  
ATOM 9423  C CA   . LYS A 1 54  ? -10.562 10.274  -1.242  1.00 0.00 ? 54  LYS A CA   7  
ATOM 9424  C C    . LYS A 1 54  ? -9.394  10.465  -0.279  1.00 0.00 ? 54  LYS A C    7  
ATOM 9425  O O    . LYS A 1 54  ? -9.487  11.229  0.681   1.00 0.00 ? 54  LYS A O    7  
ATOM 9426  C CB   . LYS A 1 54  ? -11.161 8.878   -1.062  1.00 0.00 ? 54  LYS A CB   7  
ATOM 9427  C CG   . LYS A 1 54  ? -12.400 8.634   -1.907  1.00 0.00 ? 54  LYS A CG   7  
ATOM 9428  C CD   . LYS A 1 54  ? -12.850 7.185   -1.833  1.00 0.00 ? 54  LYS A CD   7  
ATOM 9429  C CE   . LYS A 1 54  ? -13.858 6.857   -2.924  1.00 0.00 ? 54  LYS A CE   7  
ATOM 9430  N NZ   . LYS A 1 54  ? -14.611 5.607   -2.626  1.00 0.00 ? 54  LYS A NZ   7  
ATOM 9431  H H    . LYS A 1 54  ? -10.337 9.774   -3.287  1.00 0.00 ? 54  LYS A H    7  
ATOM 9432  H HA   . LYS A 1 54  ? -11.318 11.012  -1.023  1.00 0.00 ? 54  LYS A HA   7  
ATOM 9433  H HB2  . LYS A 1 54  ? -10.418 8.142   -1.331  1.00 0.00 ? 54  LYS A HB2  7  
ATOM 9434  H HB3  . LYS A 1 54  ? -11.428 8.745   -0.024  1.00 0.00 ? 54  LYS A HB3  7  
ATOM 9435  H HG2  . LYS A 1 54  ? -13.199 9.266   -1.549  1.00 0.00 ? 54  LYS A HG2  7  
ATOM 9436  H HG3  . LYS A 1 54  ? -12.177 8.881   -2.936  1.00 0.00 ? 54  LYS A HG3  7  
ATOM 9437  H HD2  . LYS A 1 54  ? -11.989 6.543   -1.950  1.00 0.00 ? 54  LYS A HD2  7  
ATOM 9438  H HD3  . LYS A 1 54  ? -13.304 7.007   -0.869  1.00 0.00 ? 54  LYS A HD3  7  
ATOM 9439  H HE2  . LYS A 1 54  ? -14.556 7.676   -3.008  1.00 0.00 ? 54  LYS A HE2  7  
ATOM 9440  H HE3  . LYS A 1 54  ? -13.331 6.736   -3.858  1.00 0.00 ? 54  LYS A HE3  7  
ATOM 9441  H HZ1  . LYS A 1 54  ? -14.953 5.178   -3.509  1.00 0.00 ? 54  LYS A HZ1  7  
ATOM 9442  H HZ2  . LYS A 1 54  ? -15.427 5.818   -2.018  1.00 0.00 ? 54  LYS A HZ2  7  
ATOM 9443  H HZ3  . LYS A 1 54  ? -13.995 4.927   -2.138  1.00 0.00 ? 54  LYS A HZ3  7  
ATOM 9444  N N    . GLY A 1 55  ? -8.294  9.767   -0.544  1.00 0.00 ? 55  GLY A N    7  
ATOM 9445  C CA   . GLY A 1 55  ? -7.124  9.875   0.308   1.00 0.00 ? 55  GLY A CA   7  
ATOM 9446  C C    . GLY A 1 55  ? -6.409  8.550   0.481   1.00 0.00 ? 55  GLY A C    7  
ATOM 9447  O O    . GLY A 1 55  ? -5.871  8.262   1.551   1.00 0.00 ? 55  GLY A O    7  
ATOM 9448  H H    . GLY A 1 55  ? -8.277  9.173   -1.324  1.00 0.00 ? 55  GLY A H    7  
ATOM 9449  H HA2  . GLY A 1 55  ? -6.440  10.588  -0.128  1.00 0.00 ? 55  GLY A HA2  7  
ATOM 9450  H HA3  . GLY A 1 55  ? -7.432  10.235  1.279   1.00 0.00 ? 55  GLY A HA3  7  
ATOM 9451  N N    . PHE A 1 56  ? -6.403  7.740   -0.572  1.00 0.00 ? 56  PHE A N    7  
ATOM 9452  C CA   . PHE A 1 56  ? -5.751  6.436   -0.530  1.00 0.00 ? 56  PHE A CA   7  
ATOM 9453  C C    . PHE A 1 56  ? -5.727  5.796   -1.915  1.00 0.00 ? 56  PHE A C    7  
ATOM 9454  O O    . PHE A 1 56  ? -6.567  6.094   -2.763  1.00 0.00 ? 56  PHE A O    7  
ATOM 9455  C CB   . PHE A 1 56  ? -6.468  5.515   0.459   1.00 0.00 ? 56  PHE A CB   7  
ATOM 9456  C CG   . PHE A 1 56  ? -7.926  5.326   0.152   1.00 0.00 ? 56  PHE A CG   7  
ATOM 9457  C CD1  . PHE A 1 56  ? -8.853  6.295   0.502   1.00 0.00 ? 56  PHE A CD1  7  
ATOM 9458  C CD2  . PHE A 1 56  ? -8.371  4.179   -0.486  1.00 0.00 ? 56  PHE A CD2  7  
ATOM 9459  C CE1  . PHE A 1 56  ? -10.195 6.123   0.222   1.00 0.00 ? 56  PHE A CE1  7  
ATOM 9460  C CE2  . PHE A 1 56  ? -9.712  4.002   -0.769  1.00 0.00 ? 56  PHE A CE2  7  
ATOM 9461  C CZ   . PHE A 1 56  ? -10.625 4.976   -0.415  1.00 0.00 ? 56  PHE A CZ   7  
ATOM 9462  H H    . PHE A 1 56  ? -6.849  8.026   -1.397  1.00 0.00 ? 56  PHE A H    7  
ATOM 9463  H HA   . PHE A 1 56  ? -4.735  6.585   -0.198  1.00 0.00 ? 56  PHE A HA   7  
ATOM 9464  H HB2  . PHE A 1 56  ? -5.997  4.544   0.441   1.00 0.00 ? 56  PHE A HB2  7  
ATOM 9465  H HB3  . PHE A 1 56  ? -6.387  5.932   1.451   1.00 0.00 ? 56  PHE A HB3  7  
ATOM 9466  H HD1  . PHE A 1 56  ? -8.518  7.194   1.000   1.00 0.00 ? 56  PHE A HD1  7  
ATOM 9467  H HD2  . PHE A 1 56  ? -7.657  3.416   -0.764  1.00 0.00 ? 56  PHE A HD2  7  
ATOM 9468  H HE1  . PHE A 1 56  ? -10.907 6.887   0.499   1.00 0.00 ? 56  PHE A HE1  7  
ATOM 9469  H HE2  . PHE A 1 56  ? -10.045 3.104   -1.267  1.00 0.00 ? 56  PHE A HE2  7  
ATOM 9470  H HZ   . PHE A 1 56  ? -11.674 4.839   -0.635  1.00 0.00 ? 56  PHE A HZ   7  
ATOM 9471  N N    . GLY A 1 57  ? -4.758  4.913   -2.136  1.00 0.00 ? 57  GLY A N    7  
ATOM 9472  C CA   . GLY A 1 57  ? -4.641  4.244   -3.418  1.00 0.00 ? 57  GLY A CA   7  
ATOM 9473  C C    . GLY A 1 57  ? -3.855  2.951   -3.329  1.00 0.00 ? 57  GLY A C    7  
ATOM 9474  O O    . GLY A 1 57  ? -4.055  2.157   -2.410  1.00 0.00 ? 57  GLY A O    7  
ATOM 9475  H H    . GLY A 1 57  ? -4.116  4.714   -1.422  1.00 0.00 ? 57  GLY A H    7  
ATOM 9476  H HA2  . GLY A 1 57  ? -5.632  4.026   -3.789  1.00 0.00 ? 57  GLY A HA2  7  
ATOM 9477  H HA3  . GLY A 1 57  ? -4.145  4.906   -4.113  1.00 0.00 ? 57  GLY A HA3  7  
ATOM 9478  N N    . PHE A 1 58  ? -2.959  2.738   -4.287  1.00 0.00 ? 58  PHE A N    7  
ATOM 9479  C CA   . PHE A 1 58  ? -2.142  1.531   -4.314  1.00 0.00 ? 58  PHE A CA   7  
ATOM 9480  C C    . PHE A 1 58  ? -0.877  1.748   -5.140  1.00 0.00 ? 58  PHE A C    7  
ATOM 9481  O O    . PHE A 1 58  ? -0.902  2.428   -6.166  1.00 0.00 ? 58  PHE A O    7  
ATOM 9482  C CB   . PHE A 1 58  ? -2.943  0.359   -4.886  1.00 0.00 ? 58  PHE A CB   7  
ATOM 9483  C CG   . PHE A 1 58  ? -4.247  0.123   -4.179  1.00 0.00 ? 58  PHE A CG   7  
ATOM 9484  C CD1  . PHE A 1 58  ? -5.334  0.950   -4.409  1.00 0.00 ? 58  PHE A CD1  7  
ATOM 9485  C CD2  . PHE A 1 58  ? -4.385  -0.928  -3.286  1.00 0.00 ? 58  PHE A CD2  7  
ATOM 9486  C CE1  . PHE A 1 58  ? -6.535  0.735   -3.759  1.00 0.00 ? 58  PHE A CE1  7  
ATOM 9487  C CE2  . PHE A 1 58  ? -5.583  -1.148  -2.634  1.00 0.00 ? 58  PHE A CE2  7  
ATOM 9488  C CZ   . PHE A 1 58  ? -6.660  -0.316  -2.871  1.00 0.00 ? 58  PHE A CZ   7  
ATOM 9489  H H    . PHE A 1 58  ? -2.846  3.408   -4.993  1.00 0.00 ? 58  PHE A H    7  
ATOM 9490  H HA   . PHE A 1 58  ? -1.859  1.300   -3.298  1.00 0.00 ? 58  PHE A HA   7  
ATOM 9491  H HB2  . PHE A 1 58  ? -3.160  0.555   -5.926  1.00 0.00 ? 58  PHE A HB2  7  
ATOM 9492  H HB3  . PHE A 1 58  ? -2.353  -0.542  -4.810  1.00 0.00 ? 58  PHE A HB3  7  
ATOM 9493  H HD1  . PHE A 1 58  ? -5.238  1.772   -5.103  1.00 0.00 ? 58  PHE A HD1  7  
ATOM 9494  H HD2  . PHE A 1 58  ? -3.543  -1.579  -3.100  1.00 0.00 ? 58  PHE A HD2  7  
ATOM 9495  H HE1  . PHE A 1 58  ? -7.375  1.386   -3.946  1.00 0.00 ? 58  PHE A HE1  7  
ATOM 9496  H HE2  . PHE A 1 58  ? -5.677  -1.971  -1.941  1.00 0.00 ? 58  PHE A HE2  7  
ATOM 9497  H HZ   . PHE A 1 58  ? -7.597  -0.486  -2.362  1.00 0.00 ? 58  PHE A HZ   7  
ATOM 9498  N N    . VAL A 1 59  ? 0.228   1.167   -4.684  1.00 0.00 ? 59  VAL A N    7  
ATOM 9499  C CA   . VAL A 1 59  ? 1.503   1.296   -5.379  1.00 0.00 ? 59  VAL A CA   7  
ATOM 9500  C C    . VAL A 1 59  ? 1.902   -0.017  -6.044  1.00 0.00 ? 59  VAL A C    7  
ATOM 9501  O O    . VAL A 1 59  ? 2.189   -1.005  -5.367  1.00 0.00 ? 59  VAL A O    7  
ATOM 9502  C CB   . VAL A 1 59  ? 2.624   1.735   -4.419  1.00 0.00 ? 59  VAL A CB   7  
ATOM 9503  C CG1  . VAL A 1 59  ? 3.941   1.880   -5.166  1.00 0.00 ? 59  VAL A CG1  7  
ATOM 9504  C CG2  . VAL A 1 59  ? 2.251   3.035   -3.723  1.00 0.00 ? 59  VAL A CG2  7  
ATOM 9505  H H    . VAL A 1 59  ? 0.184   0.637   -3.860  1.00 0.00 ? 59  VAL A H    7  
ATOM 9506  H HA   . VAL A 1 59  ? 1.392   2.054   -6.141  1.00 0.00 ? 59  VAL A HA   7  
ATOM 9507  H HB   . VAL A 1 59  ? 2.745   0.970   -3.666  1.00 0.00 ? 59  VAL A HB   7  
ATOM 9508  H HG11 . VAL A 1 59  ? 4.025   1.093   -5.902  1.00 0.00 ? 59  VAL A HG11 7  
ATOM 9509  H HG12 . VAL A 1 59  ? 3.972   2.840   -5.659  1.00 0.00 ? 59  VAL A HG12 7  
ATOM 9510  H HG13 . VAL A 1 59  ? 4.761   1.807   -4.467  1.00 0.00 ? 59  VAL A HG13 7  
ATOM 9511  H HG21 . VAL A 1 59  ? 2.906   3.824   -4.060  1.00 0.00 ? 59  VAL A HG21 7  
ATOM 9512  H HG22 . VAL A 1 59  ? 1.228   3.290   -3.961  1.00 0.00 ? 59  VAL A HG22 7  
ATOM 9513  H HG23 . VAL A 1 59  ? 2.352   2.914   -2.655  1.00 0.00 ? 59  VAL A HG23 7  
ATOM 9514  N N    . ASP A 1 60  ? 1.919   -0.020  -7.372  1.00 0.00 ? 60  ASP A N    7  
ATOM 9515  C CA   . ASP A 1 60  ? 2.285   -1.212  -8.129  1.00 0.00 ? 60  ASP A CA   7  
ATOM 9516  C C    . ASP A 1 60  ? 3.800   -1.372  -8.191  1.00 0.00 ? 60  ASP A C    7  
ATOM 9517  O O    . ASP A 1 60  ? 4.525   -0.418  -8.474  1.00 0.00 ? 60  ASP A O    7  
ATOM 9518  C CB   . ASP A 1 60  ? 1.708   -1.140  -9.544  1.00 0.00 ? 60  ASP A CB   7  
ATOM 9519  C CG   . ASP A 1 60  ? 0.208   -0.926  -9.547  1.00 0.00 ? 60  ASP A CG   7  
ATOM 9520  O OD1  . ASP A 1 60  ? -0.229  0.213   -9.280  1.00 0.00 ? 60  ASP A OD1  7  
ATOM 9521  O OD2  . ASP A 1 60  ? -0.531  -1.896  -9.817  1.00 0.00 ? 60  ASP A OD2  7  
ATOM 9522  H H    . ASP A 1 60  ? 1.680   0.798   -7.855  1.00 0.00 ? 60  ASP A H    7  
ATOM 9523  H HA   . ASP A 1 60  ? 1.865   -2.068  -7.622  1.00 0.00 ? 60  ASP A HA   7  
ATOM 9524  H HB2  . ASP A 1 60  ? 2.172   -0.321  -10.073 1.00 0.00 ? 60  ASP A HB2  7  
ATOM 9525  H HB3  . ASP A 1 60  ? 1.923   -2.064  -10.060 1.00 0.00 ? 60  ASP A HB3  7  
ATOM 9526  N N    . PHE A 1 61  ? 4.274   -2.585  -7.924  1.00 0.00 ? 61  PHE A N    7  
ATOM 9527  C CA   . PHE A 1 61  ? 5.704   -2.870  -7.947  1.00 0.00 ? 61  PHE A CA   7  
ATOM 9528  C C    . PHE A 1 61  ? 6.023   -3.967  -8.959  1.00 0.00 ? 61  PHE A C    7  
ATOM 9529  O O    . PHE A 1 61  ? 5.132   -4.675  -9.424  1.00 0.00 ? 61  PHE A O    7  
ATOM 9530  C CB   . PHE A 1 61  ? 6.185   -3.287  -6.556  1.00 0.00 ? 61  PHE A CB   7  
ATOM 9531  C CG   . PHE A 1 61  ? 6.250   -2.149  -5.578  1.00 0.00 ? 61  PHE A CG   7  
ATOM 9532  C CD1  . PHE A 1 61  ? 5.124   -1.762  -4.869  1.00 0.00 ? 61  PHE A CD1  7  
ATOM 9533  C CD2  . PHE A 1 61  ? 7.438   -1.467  -5.367  1.00 0.00 ? 61  PHE A CD2  7  
ATOM 9534  C CE1  . PHE A 1 61  ? 5.182   -0.715  -3.969  1.00 0.00 ? 61  PHE A CE1  7  
ATOM 9535  C CE2  . PHE A 1 61  ? 7.501   -0.419  -4.468  1.00 0.00 ? 61  PHE A CE2  7  
ATOM 9536  C CZ   . PHE A 1 61  ? 6.372   -0.043  -3.767  1.00 0.00 ? 61  PHE A CZ   7  
ATOM 9537  H H    . PHE A 1 61  ? 3.646   -3.305  -7.705  1.00 0.00 ? 61  PHE A H    7  
ATOM 9538  H HA   . PHE A 1 61  ? 6.216   -1.966  -8.240  1.00 0.00 ? 61  PHE A HA   7  
ATOM 9539  H HB2  . PHE A 1 61  ? 5.510   -4.029  -6.157  1.00 0.00 ? 61  PHE A HB2  7  
ATOM 9540  H HB3  . PHE A 1 61  ? 7.174   -3.713  -6.638  1.00 0.00 ? 61  PHE A HB3  7  
ATOM 9541  H HD1  . PHE A 1 61  ? 4.193   -2.287  -5.025  1.00 0.00 ? 61  PHE A HD1  7  
ATOM 9542  H HD2  . PHE A 1 61  ? 8.322   -1.760  -5.915  1.00 0.00 ? 61  PHE A HD2  7  
ATOM 9543  H HE1  . PHE A 1 61  ? 4.297   -0.423  -3.423  1.00 0.00 ? 61  PHE A HE1  7  
ATOM 9544  H HE2  . PHE A 1 61  ? 8.433   0.104   -4.313  1.00 0.00 ? 61  PHE A HE2  7  
ATOM 9545  H HZ   . PHE A 1 61  ? 6.419   0.776   -3.065  1.00 0.00 ? 61  PHE A HZ   7  
ATOM 9546  N N    . ASN A 1 62  ? 7.302   -4.100  -9.294  1.00 0.00 ? 62  ASN A N    7  
ATOM 9547  C CA   . ASN A 1 62  ? 7.741   -5.109  -10.251 1.00 0.00 ? 62  ASN A CA   7  
ATOM 9548  C C    . ASN A 1 62  ? 7.615   -6.510  -9.660  1.00 0.00 ? 62  ASN A C    7  
ATOM 9549  O O    . ASN A 1 62  ? 7.360   -7.477  -10.378 1.00 0.00 ? 62  ASN A O    7  
ATOM 9550  C CB   . ASN A 1 62  ? 9.189   -4.849  -10.671 1.00 0.00 ? 62  ASN A CB   7  
ATOM 9551  C CG   . ASN A 1 62  ? 10.050  -4.378  -9.516  1.00 0.00 ? 62  ASN A CG   7  
ATOM 9552  O OD1  . ASN A 1 62  ? 10.720  -5.177  -8.861  1.00 0.00 ? 62  ASN A OD1  7  
ATOM 9553  N ND2  . ASN A 1 62  ? 10.037  -3.075  -9.260  1.00 0.00 ? 62  ASN A ND2  7  
ATOM 9554  H H    . ASN A 1 62  ? 7.968   -3.505  -8.889  1.00 0.00 ? 62  ASN A H    7  
ATOM 9555  H HA   . ASN A 1 62  ? 7.105   -5.039  -11.121 1.00 0.00 ? 62  ASN A HA   7  
ATOM 9556  H HB2  . ASN A 1 62  ? 9.613   -5.762  -11.063 1.00 0.00 ? 62  ASN A HB2  7  
ATOM 9557  H HB3  . ASN A 1 62  ? 9.204   -4.091  -11.440 1.00 0.00 ? 62  ASN A HB3  7  
ATOM 9558  H HD21 . ASN A 1 62  ? 9.480   -2.498  -9.823  1.00 0.00 ? 62  ASN A HD21 7  
ATOM 9559  H HD22 . ASN A 1 62  ? 10.586  -2.744  -8.519  1.00 0.00 ? 62  ASN A HD22 7  
ATOM 9560  N N    . SER A 1 63  ? 7.795   -6.611  -8.347  1.00 0.00 ? 63  SER A N    7  
ATOM 9561  C CA   . SER A 1 63  ? 7.705   -7.893  -7.659  1.00 0.00 ? 63  SER A CA   7  
ATOM 9562  C C    . SER A 1 63  ? 7.383   -7.696  -6.181  1.00 0.00 ? 63  SER A C    7  
ATOM 9563  O O    . SER A 1 63  ? 7.590   -6.615  -5.629  1.00 0.00 ? 63  SER A O    7  
ATOM 9564  C CB   . SER A 1 63  ? 9.015   -8.669  -7.808  1.00 0.00 ? 63  SER A CB   7  
ATOM 9565  O OG   . SER A 1 63  ? 9.204   -9.100  -9.145  1.00 0.00 ? 63  SER A OG   7  
ATOM 9566  H H    . SER A 1 63  ? 7.996   -5.803  -7.829  1.00 0.00 ? 63  SER A H    7  
ATOM 9567  H HA   . SER A 1 63  ? 6.908   -8.460  -8.117  1.00 0.00 ? 63  SER A HA   7  
ATOM 9568  H HB2  . SER A 1 63  ? 9.841   -8.033  -7.528  1.00 0.00 ? 63  SER A HB2  7  
ATOM 9569  H HB3  . SER A 1 63  ? 8.993   -9.535  -7.163  1.00 0.00 ? 63  SER A HB3  7  
ATOM 9570  H HG   . SER A 1 63  ? 10.066  -9.513  -9.230  1.00 0.00 ? 63  SER A HG   7  
ATOM 9571  N N    . GLU A 1 64  ? 6.876   -8.748  -5.546  1.00 0.00 ? 64  GLU A N    7  
ATOM 9572  C CA   . GLU A 1 64  ? 6.524   -8.690  -4.132  1.00 0.00 ? 64  GLU A CA   7  
ATOM 9573  C C    . GLU A 1 64  ? 7.733   -8.299  -3.287  1.00 0.00 ? 64  GLU A C    7  
ATOM 9574  O O    . GLU A 1 64  ? 7.629   -7.469  -2.384  1.00 0.00 ? 64  GLU A O    7  
ATOM 9575  C CB   . GLU A 1 64  ? 5.976   -10.040 -3.665  1.00 0.00 ? 64  GLU A CB   7  
ATOM 9576  C CG   . GLU A 1 64  ? 4.511   -10.253 -4.008  1.00 0.00 ? 64  GLU A CG   7  
ATOM 9577  C CD   . GLU A 1 64  ? 4.165   -11.717 -4.202  1.00 0.00 ? 64  GLU A CD   7  
ATOM 9578  O OE1  . GLU A 1 64  ? 4.906   -12.577 -3.682  1.00 0.00 ? 64  GLU A OE1  7  
ATOM 9579  O OE2  . GLU A 1 64  ? 3.152   -12.002 -4.874  1.00 0.00 ? 64  GLU A OE2  7  
ATOM 9580  H H    . GLU A 1 64  ? 6.734   -9.582  -6.041  1.00 0.00 ? 64  GLU A H    7  
ATOM 9581  H HA   . GLU A 1 64  ? 5.758   -7.939  -4.012  1.00 0.00 ? 64  GLU A HA   7  
ATOM 9582  H HB2  . GLU A 1 64  ? 6.552   -10.828 -4.126  1.00 0.00 ? 64  GLU A HB2  7  
ATOM 9583  H HB3  . GLU A 1 64  ? 6.085   -10.107 -2.592  1.00 0.00 ? 64  GLU A HB3  7  
ATOM 9584  H HG2  . GLU A 1 64  ? 3.905   -9.859  -3.206  1.00 0.00 ? 64  GLU A HG2  7  
ATOM 9585  H HG3  . GLU A 1 64  ? 4.287   -9.722  -4.922  1.00 0.00 ? 64  GLU A HG3  7  
ATOM 9586  N N    . GLU A 1 65  ? 8.878   -8.905  -3.586  1.00 0.00 ? 65  GLU A N    7  
ATOM 9587  C CA   . GLU A 1 65  ? 10.106  -8.621  -2.853  1.00 0.00 ? 65  GLU A CA   7  
ATOM 9588  C C    . GLU A 1 65  ? 10.419  -7.128  -2.873  1.00 0.00 ? 65  GLU A C    7  
ATOM 9589  O O    . GLU A 1 65  ? 10.539  -6.494  -1.824  1.00 0.00 ? 65  GLU A O    7  
ATOM 9590  C CB   . GLU A 1 65  ? 11.276  -9.407  -3.449  1.00 0.00 ? 65  GLU A CB   7  
ATOM 9591  C CG   . GLU A 1 65  ? 11.265  -10.883 -3.087  1.00 0.00 ? 65  GLU A CG   7  
ATOM 9592  C CD   . GLU A 1 65  ? 11.868  -11.153 -1.723  1.00 0.00 ? 65  GLU A CD   7  
ATOM 9593  O OE1  . GLU A 1 65  ? 11.131  -11.059 -0.719  1.00 0.00 ? 65  GLU A OE1  7  
ATOM 9594  O OE2  . GLU A 1 65  ? 13.077  -11.459 -1.659  1.00 0.00 ? 65  GLU A OE2  7  
ATOM 9595  H H    . GLU A 1 65  ? 8.897   -9.558  -4.317  1.00 0.00 ? 65  GLU A H    7  
ATOM 9596  H HA   . GLU A 1 65  ? 9.960   -8.932  -1.829  1.00 0.00 ? 65  GLU A HA   7  
ATOM 9597  H HB2  . GLU A 1 65  ? 11.240  -9.321  -4.525  1.00 0.00 ? 65  GLU A HB2  7  
ATOM 9598  H HB3  . GLU A 1 65  ? 12.200  -8.977  -3.093  1.00 0.00 ? 65  GLU A HB3  7  
ATOM 9599  H HG2  . GLU A 1 65  ? 10.244  -11.233 -3.088  1.00 0.00 ? 65  GLU A HG2  7  
ATOM 9600  H HG3  . GLU A 1 65  ? 11.832  -11.426 -3.829  1.00 0.00 ? 65  GLU A HG3  7  
ATOM 9601  N N    . ASP A 1 66  ? 10.551  -6.573  -4.073  1.00 0.00 ? 66  ASP A N    7  
ATOM 9602  C CA   . ASP A 1 66  ? 10.850  -5.155  -4.231  1.00 0.00 ? 66  ASP A CA   7  
ATOM 9603  C C    . ASP A 1 66  ? 9.847   -4.299  -3.463  1.00 0.00 ? 66  ASP A C    7  
ATOM 9604  O O    . ASP A 1 66  ? 10.225  -3.367  -2.755  1.00 0.00 ? 66  ASP A O    7  
ATOM 9605  C CB   . ASP A 1 66  ? 10.839  -4.771  -5.711  1.00 0.00 ? 66  ASP A CB   7  
ATOM 9606  C CG   . ASP A 1 66  ? 12.157  -5.071  -6.397  1.00 0.00 ? 66  ASP A CG   7  
ATOM 9607  O OD1  . ASP A 1 66  ? 13.044  -4.192  -6.391  1.00 0.00 ? 66  ASP A OD1  7  
ATOM 9608  O OD2  . ASP A 1 66  ? 12.302  -6.186  -6.940  1.00 0.00 ? 66  ASP A OD2  7  
ATOM 9609  H H    . ASP A 1 66  ? 10.444  -7.131  -4.872  1.00 0.00 ? 66  ASP A H    7  
ATOM 9610  H HA   . ASP A 1 66  ? 11.836  -4.977  -3.830  1.00 0.00 ? 66  ASP A HA   7  
ATOM 9611  H HB2  . ASP A 1 66  ? 10.059  -5.324  -6.214  1.00 0.00 ? 66  ASP A HB2  7  
ATOM 9612  H HB3  . ASP A 1 66  ? 10.639  -3.714  -5.801  1.00 0.00 ? 66  ASP A HB3  7  
ATOM 9613  N N    . ALA A 1 67  ? 8.566   -4.623  -3.610  1.00 0.00 ? 67  ALA A N    7  
ATOM 9614  C CA   . ALA A 1 67  ? 7.509   -3.885  -2.930  1.00 0.00 ? 67  ALA A CA   7  
ATOM 9615  C C    . ALA A 1 67  ? 7.732   -3.871  -1.422  1.00 0.00 ? 67  ALA A C    7  
ATOM 9616  O O    . ALA A 1 67  ? 7.547   -2.846  -0.766  1.00 0.00 ? 67  ALA A O    7  
ATOM 9617  C CB   . ALA A 1 67  ? 6.150   -4.485  -3.260  1.00 0.00 ? 67  ALA A CB   7  
ATOM 9618  H H    . ALA A 1 67  ? 8.327   -5.377  -4.189  1.00 0.00 ? 67  ALA A H    7  
ATOM 9619  H HA   . ALA A 1 67  ? 7.524   -2.868  -3.296  1.00 0.00 ? 67  ALA A HA   7  
ATOM 9620  H HB1  . ALA A 1 67  ? 5.777   -4.048  -4.174  1.00 0.00 ? 67  ALA A HB1  7  
ATOM 9621  H HB2  . ALA A 1 67  ? 6.250   -5.553  -3.386  1.00 0.00 ? 67  ALA A HB2  7  
ATOM 9622  H HB3  . ALA A 1 67  ? 5.461   -4.280  -2.454  1.00 0.00 ? 67  ALA A HB3  7  
ATOM 9623  N N    . LYS A 1 68  ? 8.129   -5.016  -0.877  1.00 0.00 ? 68  LYS A N    7  
ATOM 9624  C CA   . LYS A 1 68  ? 8.377   -5.137  0.555   1.00 0.00 ? 68  LYS A CA   7  
ATOM 9625  C C    . LYS A 1 68  ? 9.523   -4.227  0.987   1.00 0.00 ? 68  LYS A C    7  
ATOM 9626  O O    . LYS A 1 68  ? 9.376   -3.422  1.906   1.00 0.00 ? 68  LYS A O    7  
ATOM 9627  C CB   . LYS A 1 68  ? 8.701   -6.588  0.917   1.00 0.00 ? 68  LYS A CB   7  
ATOM 9628  C CG   . LYS A 1 68  ? 8.736   -6.849  2.413   1.00 0.00 ? 68  LYS A CG   7  
ATOM 9629  C CD   . LYS A 1 68  ? 9.548   -8.089  2.743   1.00 0.00 ? 68  LYS A CD   7  
ATOM 9630  C CE   . LYS A 1 68  ? 10.005  -8.086  4.194   1.00 0.00 ? 68  LYS A CE   7  
ATOM 9631  N NZ   . LYS A 1 68  ? 11.168  -8.990  4.411   1.00 0.00 ? 68  LYS A NZ   7  
ATOM 9632  H H    . LYS A 1 68  ? 8.259   -5.800  -1.452  1.00 0.00 ? 68  LYS A H    7  
ATOM 9633  H HA   . LYS A 1 68  ? 7.480   -4.836  1.074   1.00 0.00 ? 68  LYS A HA   7  
ATOM 9634  H HB2  . LYS A 1 68  ? 7.952   -7.231  0.478   1.00 0.00 ? 68  LYS A HB2  7  
ATOM 9635  H HB3  . LYS A 1 68  ? 9.667   -6.842  0.505   1.00 0.00 ? 68  LYS A HB3  7  
ATOM 9636  H HG2  . LYS A 1 68  ? 9.182   -5.998  2.907   1.00 0.00 ? 68  LYS A HG2  7  
ATOM 9637  H HG3  . LYS A 1 68  ? 7.725   -6.985  2.769   1.00 0.00 ? 68  LYS A HG3  7  
ATOM 9638  H HD2  . LYS A 1 68  ? 8.939   -8.964  2.572   1.00 0.00 ? 68  LYS A HD2  7  
ATOM 9639  H HD3  . LYS A 1 68  ? 10.417  -8.122  2.101   1.00 0.00 ? 68  LYS A HD3  7  
ATOM 9640  H HE2  . LYS A 1 68  ? 10.286  -7.081  4.467   1.00 0.00 ? 68  LYS A HE2  7  
ATOM 9641  H HE3  . LYS A 1 68  ? 9.185   -8.412  4.817   1.00 0.00 ? 68  LYS A HE3  7  
ATOM 9642  H HZ1  . LYS A 1 68  ? 11.232  -9.682  3.638   1.00 0.00 ? 68  LYS A HZ1  7  
ATOM 9643  H HZ2  . LYS A 1 68  ? 11.060  -9.502  5.310   1.00 0.00 ? 68  LYS A HZ2  7  
ATOM 9644  H HZ3  . LYS A 1 68  ? 12.049  -8.439  4.442   1.00 0.00 ? 68  LYS A HZ3  7  
ATOM 9645  N N    . ALA A 1 69  ? 10.663  -4.360  0.317   1.00 0.00 ? 69  ALA A N    7  
ATOM 9646  C CA   . ALA A 1 69  ? 11.832  -3.547  0.629   1.00 0.00 ? 69  ALA A CA   7  
ATOM 9647  C C    . ALA A 1 69  ? 11.483  -2.063  0.637   1.00 0.00 ? 69  ALA A C    7  
ATOM 9648  O O    . ALA A 1 69  ? 12.133  -1.266  1.313   1.00 0.00 ? 69  ALA A O    7  
ATOM 9649  C CB   . ALA A 1 69  ? 12.948  -3.823  -0.367  1.00 0.00 ? 69  ALA A CB   7  
ATOM 9650  H H    . ALA A 1 69  ? 10.718  -5.019  -0.406  1.00 0.00 ? 69  ALA A H    7  
ATOM 9651  H HA   . ALA A 1 69  ? 12.182  -3.830  1.612   1.00 0.00 ? 69  ALA A HA   7  
ATOM 9652  H HB1  . ALA A 1 69  ? 13.699  -4.446  0.098   1.00 0.00 ? 69  ALA A HB1  7  
ATOM 9653  H HB2  . ALA A 1 69  ? 12.543  -4.331  -1.230  1.00 0.00 ? 69  ALA A HB2  7  
ATOM 9654  H HB3  . ALA A 1 69  ? 13.395  -2.890  -0.675  1.00 0.00 ? 69  ALA A HB3  7  
ATOM 9655  N N    . ALA A 1 70  ? 10.453  -1.698  -0.120  1.00 0.00 ? 70  ALA A N    7  
ATOM 9656  C CA   . ALA A 1 70  ? 10.016  -0.310  -0.199  1.00 0.00 ? 70  ALA A CA   7  
ATOM 9657  C C    . ALA A 1 70  ? 9.061   0.031   0.940   1.00 0.00 ? 70  ALA A C    7  
ATOM 9658  O O    . ALA A 1 70  ? 8.931   1.192   1.330   1.00 0.00 ? 70  ALA A O    7  
ATOM 9659  C CB   . ALA A 1 70  ? 9.357   -0.039  -1.543  1.00 0.00 ? 70  ALA A CB   7  
ATOM 9660  H H    . ALA A 1 70  ? 9.974   -2.380  -0.636  1.00 0.00 ? 70  ALA A H    7  
ATOM 9661  H HA   . ALA A 1 70  ? 10.891  0.320   -0.121  1.00 0.00 ? 70  ALA A HA   7  
ATOM 9662  H HB1  . ALA A 1 70  ? 8.416   0.469   -1.385  1.00 0.00 ? 70  ALA A HB1  7  
ATOM 9663  H HB2  . ALA A 1 70  ? 10.005  0.581   -2.143  1.00 0.00 ? 70  ALA A HB2  7  
ATOM 9664  H HB3  . ALA A 1 70  ? 9.181   -0.975  -2.052  1.00 0.00 ? 70  ALA A HB3  7  
ATOM 9665  N N    . LYS A 1 71  ? 8.392   -0.988  1.470   1.00 0.00 ? 71  LYS A N    7  
ATOM 9666  C CA   . LYS A 1 71  ? 7.448   -0.797  2.564   1.00 0.00 ? 71  LYS A CA   7  
ATOM 9667  C C    . LYS A 1 71  ? 8.174   -0.403  3.846   1.00 0.00 ? 71  LYS A C    7  
ATOM 9668  O O    . LYS A 1 71  ? 7.768   0.532   4.537   1.00 0.00 ? 71  LYS A O    7  
ATOM 9669  C CB   . LYS A 1 71  ? 6.640   -2.076  2.796   1.00 0.00 ? 71  LYS A CB   7  
ATOM 9670  C CG   . LYS A 1 71  ? 5.646   -1.968  3.939   1.00 0.00 ? 71  LYS A CG   7  
ATOM 9671  C CD   . LYS A 1 71  ? 4.513   -2.970  3.790   1.00 0.00 ? 71  LYS A CD   7  
ATOM 9672  C CE   . LYS A 1 71  ? 4.930   -4.357  4.254   1.00 0.00 ? 71  LYS A CE   7  
ATOM 9673  N NZ   . LYS A 1 71  ? 6.028   -4.915  3.416   1.00 0.00 ? 71  LYS A NZ   7  
ATOM 9674  H H    . LYS A 1 71  ? 8.538   -1.891  1.116   1.00 0.00 ? 71  LYS A H    7  
ATOM 9675  H HA   . LYS A 1 71  ? 6.774   -0.001  2.286   1.00 0.00 ? 71  LYS A HA   7  
ATOM 9676  H HB2  . LYS A 1 71  ? 6.095   -2.312  1.894   1.00 0.00 ? 71  LYS A HB2  7  
ATOM 9677  H HB3  . LYS A 1 71  ? 7.322   -2.884  3.015   1.00 0.00 ? 71  LYS A HB3  7  
ATOM 9678  H HG2  . LYS A 1 71  ? 6.159   -2.158  4.870   1.00 0.00 ? 71  LYS A HG2  7  
ATOM 9679  H HG3  . LYS A 1 71  ? 5.232   -0.970  3.952   1.00 0.00 ? 71  LYS A HG3  7  
ATOM 9680  H HD2  . LYS A 1 71  ? 3.673   -2.642  4.384   1.00 0.00 ? 71  LYS A HD2  7  
ATOM 9681  H HD3  . LYS A 1 71  ? 4.223   -3.020  2.750   1.00 0.00 ? 71  LYS A HD3  7  
ATOM 9682  H HE2  . LYS A 1 71  ? 5.267   -4.294  5.277   1.00 0.00 ? 71  LYS A HE2  7  
ATOM 9683  H HE3  . LYS A 1 71  ? 4.075   -5.014  4.196   1.00 0.00 ? 71  LYS A HE3  7  
ATOM 9684  H HZ1  . LYS A 1 71  ? 6.949   -4.586  3.770   1.00 0.00 ? 71  LYS A HZ1  7  
ATOM 9685  H HZ2  . LYS A 1 71  ? 5.918   -4.605  2.430   1.00 0.00 ? 71  LYS A HZ2  7  
ATOM 9686  H HZ3  . LYS A 1 71  ? 6.008   -5.954  3.446   1.00 0.00 ? 71  LYS A HZ3  7  
ATOM 9687  N N    . GLU A 1 72  ? 9.249   -1.120  4.157   1.00 0.00 ? 72  GLU A N    7  
ATOM 9688  C CA   . GLU A 1 72  ? 10.031  -0.842  5.356   1.00 0.00 ? 72  GLU A CA   7  
ATOM 9689  C C    . GLU A 1 72  ? 10.525  0.601   5.362   1.00 0.00 ? 72  GLU A C    7  
ATOM 9690  O O    . GLU A 1 72  ? 10.602  1.238   6.412   1.00 0.00 ? 72  GLU A O    7  
ATOM 9691  C CB   . GLU A 1 72  ? 11.220  -1.800  5.449   1.00 0.00 ? 72  GLU A CB   7  
ATOM 9692  C CG   . GLU A 1 72  ? 10.824  -3.267  5.428   1.00 0.00 ? 72  GLU A CG   7  
ATOM 9693  C CD   . GLU A 1 72  ? 11.792  -4.145  6.196   1.00 0.00 ? 72  GLU A CD   7  
ATOM 9694  O OE1  . GLU A 1 72  ? 12.824  -4.540  5.614   1.00 0.00 ? 72  GLU A OE1  7  
ATOM 9695  O OE2  . GLU A 1 72  ? 11.519  -4.437  7.379   1.00 0.00 ? 72  GLU A OE2  7  
ATOM 9696  H H    . GLU A 1 72  ? 9.523   -1.852  3.566   1.00 0.00 ? 72  GLU A H    7  
ATOM 9697  H HA   . GLU A 1 72  ? 9.391   -0.994  6.212   1.00 0.00 ? 72  GLU A HA   7  
ATOM 9698  H HB2  . GLU A 1 72  ? 11.883  -1.615  4.617   1.00 0.00 ? 72  GLU A HB2  7  
ATOM 9699  H HB3  . GLU A 1 72  ? 11.751  -1.607  6.370   1.00 0.00 ? 72  GLU A HB3  7  
ATOM 9700  H HG2  . GLU A 1 72  ? 9.843   -3.368  5.868   1.00 0.00 ? 72  GLU A HG2  7  
ATOM 9701  H HG3  . GLU A 1 72  ? 10.792  -3.603  4.402   1.00 0.00 ? 72  GLU A HG3  7  
ATOM 9702  N N    . ALA A 1 73  ? 10.860  1.111   4.180   1.00 0.00 ? 73  ALA A N    7  
ATOM 9703  C CA   . ALA A 1 73  ? 11.345  2.479   4.048   1.00 0.00 ? 73  ALA A CA   7  
ATOM 9704  C C    . ALA A 1 73  ? 10.223  3.484   4.283   1.00 0.00 ? 73  ALA A C    7  
ATOM 9705  O O    . ALA A 1 73  ? 10.397  4.464   5.008   1.00 0.00 ? 73  ALA A O    7  
ATOM 9706  C CB   . ALA A 1 73  ? 11.965  2.688   2.675   1.00 0.00 ? 73  ALA A CB   7  
ATOM 9707  H H    . ALA A 1 73  ? 10.776  0.553   3.379   1.00 0.00 ? 73  ALA A H    7  
ATOM 9708  H HA   . ALA A 1 73  ? 12.115  2.633   4.791   1.00 0.00 ? 73  ALA A HA   7  
ATOM 9709  H HB1  . ALA A 1 73  ? 12.078  1.733   2.182   1.00 0.00 ? 73  ALA A HB1  7  
ATOM 9710  H HB2  . ALA A 1 73  ? 11.324  3.325   2.084   1.00 0.00 ? 73  ALA A HB2  7  
ATOM 9711  H HB3  . ALA A 1 73  ? 12.934  3.153   2.785   1.00 0.00 ? 73  ALA A HB3  7  
ATOM 9712  N N    . MET A 1 74  ? 9.073   3.236   3.665   1.00 0.00 ? 74  MET A N    7  
ATOM 9713  C CA   . MET A 1 74  ? 7.923   4.121   3.807   1.00 0.00 ? 74  MET A CA   7  
ATOM 9714  C C    . MET A 1 74  ? 6.988   3.624   4.905   1.00 0.00 ? 74  MET A C    7  
ATOM 9715  O O    . MET A 1 74  ? 5.818   4.002   4.954   1.00 0.00 ? 74  MET A O    7  
ATOM 9716  C CB   . MET A 1 74  ? 7.164   4.224   2.483   1.00 0.00 ? 74  MET A CB   7  
ATOM 9717  C CG   . MET A 1 74  ? 7.714   5.289   1.548   1.00 0.00 ? 74  MET A CG   7  
ATOM 9718  S SD   . MET A 1 74  ? 7.530   6.956   2.211   1.00 0.00 ? 74  MET A SD   7  
ATOM 9719  C CE   . MET A 1 74  ? 5.748   7.138   2.180   1.00 0.00 ? 74  MET A CE   7  
ATOM 9720  H H    . MET A 1 74  ? 8.996   2.439   3.099   1.00 0.00 ? 74  MET A H    7  
ATOM 9721  H HA   . MET A 1 74  ? 8.289   5.100   4.079   1.00 0.00 ? 74  MET A HA   7  
ATOM 9722  H HB2  . MET A 1 74  ? 7.215   3.271   1.978   1.00 0.00 ? 74  MET A HB2  7  
ATOM 9723  H HB3  . MET A 1 74  ? 6.130   4.457   2.691   1.00 0.00 ? 74  MET A HB3  7  
ATOM 9724  H HG2  . MET A 1 74  ? 8.763   5.097   1.383   1.00 0.00 ? 74  MET A HG2  7  
ATOM 9725  H HG3  . MET A 1 74  ? 7.187   5.230   0.608   1.00 0.00 ? 74  MET A HG3  7  
ATOM 9726  H HE1  . MET A 1 74  ? 5.290   6.277   2.644   1.00 0.00 ? 74  MET A HE1  7  
ATOM 9727  H HE2  . MET A 1 74  ? 5.468   8.030   2.720   1.00 0.00 ? 74  MET A HE2  7  
ATOM 9728  H HE3  . MET A 1 74  ? 5.412   7.216   1.156   1.00 0.00 ? 74  MET A HE3  7  
ATOM 9729  N N    . GLU A 1 75  ? 7.512   2.775   5.784   1.00 0.00 ? 75  GLU A N    7  
ATOM 9730  C CA   . GLU A 1 75  ? 6.723   2.226   6.880   1.00 0.00 ? 75  GLU A CA   7  
ATOM 9731  C C    . GLU A 1 75  ? 6.080   3.342   7.699   1.00 0.00 ? 75  GLU A C    7  
ATOM 9732  O O    . GLU A 1 75  ? 4.874   3.329   7.946   1.00 0.00 ? 75  GLU A O    7  
ATOM 9733  C CB   . GLU A 1 75  ? 7.599   1.355   7.783   1.00 0.00 ? 75  GLU A CB   7  
ATOM 9734  C CG   . GLU A 1 75  ? 8.760   2.107   8.412   1.00 0.00 ? 75  GLU A CG   7  
ATOM 9735  C CD   . GLU A 1 75  ? 9.714   1.191   9.153   1.00 0.00 ? 75  GLU A CD   7  
ATOM 9736  O OE1  . GLU A 1 75  ? 9.255   0.460   10.055  1.00 0.00 ? 75  GLU A OE1  7  
ATOM 9737  O OE2  . GLU A 1 75  ? 10.921  1.205   8.831   1.00 0.00 ? 75  GLU A OE2  7  
ATOM 9738  H H    . GLU A 1 75  ? 8.452   2.511   5.692   1.00 0.00 ? 75  GLU A H    7  
ATOM 9739  H HA   . GLU A 1 75  ? 5.943   1.614   6.453   1.00 0.00 ? 75  GLU A HA   7  
ATOM 9740  H HB2  . GLU A 1 75  ? 6.987   0.951   8.576   1.00 0.00 ? 75  GLU A HB2  7  
ATOM 9741  H HB3  . GLU A 1 75  ? 7.999   0.541   7.198   1.00 0.00 ? 75  GLU A HB3  7  
ATOM 9742  H HG2  . GLU A 1 75  ? 9.307   2.615   7.632   1.00 0.00 ? 75  GLU A HG2  7  
ATOM 9743  H HG3  . GLU A 1 75  ? 8.368   2.833   9.108   1.00 0.00 ? 75  GLU A HG3  7  
ATOM 9744  N N    . ASP A 1 76  ? 6.894   4.304   8.118   1.00 0.00 ? 76  ASP A N    7  
ATOM 9745  C CA   . ASP A 1 76  ? 6.406   5.428   8.909   1.00 0.00 ? 76  ASP A CA   7  
ATOM 9746  C C    . ASP A 1 76  ? 6.507   6.731   8.122   1.00 0.00 ? 76  ASP A C    7  
ATOM 9747  O O    . ASP A 1 76  ? 6.486   7.819   8.697   1.00 0.00 ? 76  ASP A O    7  
ATOM 9748  C CB   . ASP A 1 76  ? 7.196   5.542   10.213  1.00 0.00 ? 76  ASP A CB   7  
ATOM 9749  C CG   . ASP A 1 76  ? 8.666   5.825   9.977   1.00 0.00 ? 76  ASP A CG   7  
ATOM 9750  O OD1  . ASP A 1 76  ? 9.001   6.978   9.635   1.00 0.00 ? 76  ASP A OD1  7  
ATOM 9751  O OD2  . ASP A 1 76  ? 9.482   4.892   10.132  1.00 0.00 ? 76  ASP A OD2  7  
ATOM 9752  H H    . ASP A 1 76  ? 7.846   4.258   7.889   1.00 0.00 ? 76  ASP A H    7  
ATOM 9753  H HA   . ASP A 1 76  ? 5.368   5.244   9.142   1.00 0.00 ? 76  ASP A HA   7  
ATOM 9754  H HB2  . ASP A 1 76  ? 6.785   6.347   10.806  1.00 0.00 ? 76  ASP A HB2  7  
ATOM 9755  H HB3  . ASP A 1 76  ? 7.109   4.616   10.762  1.00 0.00 ? 76  ASP A HB3  7  
ATOM 9756  N N    . GLY A 1 77  ? 6.619   6.613   6.802   1.00 0.00 ? 77  GLY A N    7  
ATOM 9757  C CA   . GLY A 1 77  ? 6.724   7.789   5.959   1.00 0.00 ? 77  GLY A CA   7  
ATOM 9758  C C    . GLY A 1 77  ? 5.410   8.535   5.839   1.00 0.00 ? 77  GLY A C    7  
ATOM 9759  O O    . GLY A 1 77  ? 4.348   7.985   6.126   1.00 0.00 ? 77  GLY A O    7  
ATOM 9760  H H    . GLY A 1 77  ? 6.631   5.720   6.399   1.00 0.00 ? 77  GLY A H    7  
ATOM 9761  H HA2  . GLY A 1 77  ? 7.467   8.453   6.375   1.00 0.00 ? 77  GLY A HA2  7  
ATOM 9762  H HA3  . GLY A 1 77  ? 7.042   7.483   4.972   1.00 0.00 ? 77  GLY A HA3  7  
ATOM 9763  N N    . GLU A 1 78  ? 5.482   9.793   5.414   1.00 0.00 ? 78  GLU A N    7  
ATOM 9764  C CA   . GLU A 1 78  ? 4.289   10.616  5.259   1.00 0.00 ? 78  GLU A CA   7  
ATOM 9765  C C    . GLU A 1 78  ? 4.307   11.357  3.925   1.00 0.00 ? 78  GLU A C    7  
ATOM 9766  O O    . GLU A 1 78  ? 5.200   12.163  3.663   1.00 0.00 ? 78  GLU A O    7  
ATOM 9767  C CB   . GLU A 1 78  ? 4.182   11.619  6.410   1.00 0.00 ? 78  GLU A CB   7  
ATOM 9768  C CG   . GLU A 1 78  ? 5.457   12.408  6.651   1.00 0.00 ? 78  GLU A CG   7  
ATOM 9769  C CD   . GLU A 1 78  ? 5.357   13.327  7.853   1.00 0.00 ? 78  GLU A CD   7  
ATOM 9770  O OE1  . GLU A 1 78  ? 5.478   12.830  8.992   1.00 0.00 ? 78  GLU A OE1  7  
ATOM 9771  O OE2  . GLU A 1 78  ? 5.159   14.544  7.654   1.00 0.00 ? 78  GLU A OE2  7  
ATOM 9772  H H    . GLU A 1 78  ? 6.359   10.176  5.200   1.00 0.00 ? 78  GLU A H    7  
ATOM 9773  H HA   . GLU A 1 78  ? 3.430   9.963   5.283   1.00 0.00 ? 78  GLU A HA   7  
ATOM 9774  H HB2  . GLU A 1 78  ? 3.387   12.317  6.191   1.00 0.00 ? 78  GLU A HB2  7  
ATOM 9775  H HB3  . GLU A 1 78  ? 3.938   11.084  7.316   1.00 0.00 ? 78  GLU A HB3  7  
ATOM 9776  H HG2  . GLU A 1 78  ? 6.269   11.715  6.813   1.00 0.00 ? 78  GLU A HG2  7  
ATOM 9777  H HG3  . GLU A 1 78  ? 5.666   13.006  5.775   1.00 0.00 ? 78  GLU A HG3  7  
ATOM 9778  N N    . ILE A 1 79  ? 3.317   11.075  3.085   1.00 0.00 ? 79  ILE A N    7  
ATOM 9779  C CA   . ILE A 1 79  ? 3.218   11.714  1.779   1.00 0.00 ? 79  ILE A CA   7  
ATOM 9780  C C    . ILE A 1 79  ? 2.429   13.016  1.862   1.00 0.00 ? 79  ILE A C    7  
ATOM 9781  O O    . ILE A 1 79  ? 1.407   13.092  2.543   1.00 0.00 ? 79  ILE A O    7  
ATOM 9782  C CB   . ILE A 1 79  ? 2.550   10.786  0.747   1.00 0.00 ? 79  ILE A CB   7  
ATOM 9783  C CG1  . ILE A 1 79  ? 3.208   9.405   0.770   1.00 0.00 ? 79  ILE A CG1  7  
ATOM 9784  C CG2  . ILE A 1 79  ? 2.632   11.395  -0.644  1.00 0.00 ? 79  ILE A CG2  7  
ATOM 9785  C CD1  . ILE A 1 79  ? 2.673   8.464   -0.287  1.00 0.00 ? 79  ILE A CD1  7  
ATOM 9786  H H    . ILE A 1 79  ? 2.635   10.423  3.351   1.00 0.00 ? 79  ILE A H    7  
ATOM 9787  H HA   . ILE A 1 79  ? 4.221   11.934  1.440   1.00 0.00 ? 79  ILE A HA   7  
ATOM 9788  H HB   . ILE A 1 79  ? 1.508   10.686  1.009   1.00 0.00 ? 79  ILE A HB   7  
ATOM 9789  H HG12 . ILE A 1 79  ? 4.268   9.515   0.609   1.00 0.00 ? 79  ILE A HG12 7  
ATOM 9790  H HG13 . ILE A 1 79  ? 3.039   8.950   1.736   1.00 0.00 ? 79  ILE A HG13 7  
ATOM 9791  H HG21 . ILE A 1 79  ? 1.789   11.065  -1.232  1.00 0.00 ? 79  ILE A HG21 7  
ATOM 9792  H HG22 . ILE A 1 79  ? 2.616   12.472  -0.567  1.00 0.00 ? 79  ILE A HG22 7  
ATOM 9793  H HG23 . ILE A 1 79  ? 3.549   11.082  -1.121  1.00 0.00 ? 79  ILE A HG23 7  
ATOM 9794  H HD11 . ILE A 1 79  ? 2.337   9.034   -1.140  1.00 0.00 ? 79  ILE A HD11 7  
ATOM 9795  H HD12 . ILE A 1 79  ? 3.454   7.784   -0.593  1.00 0.00 ? 79  ILE A HD12 7  
ATOM 9796  H HD13 . ILE A 1 79  ? 1.844   7.901   0.118   1.00 0.00 ? 79  ILE A HD13 7  
ATOM 9797  N N    . ASP A 1 80  ? 2.909   14.038  1.162   1.00 0.00 ? 80  ASP A N    7  
ATOM 9798  C CA   . ASP A 1 80  ? 2.247   15.337  1.153   1.00 0.00 ? 80  ASP A CA   7  
ATOM 9799  C C    . ASP A 1 80  ? 1.995   15.828  2.576   1.00 0.00 ? 80  ASP A C    7  
ATOM 9800  O O    . ASP A 1 80  ? 0.916   16.332  2.887   1.00 0.00 ? 80  ASP A O    7  
ATOM 9801  C CB   . ASP A 1 80  ? 0.926   15.255  0.387   1.00 0.00 ? 80  ASP A CB   7  
ATOM 9802  C CG   . ASP A 1 80  ? 0.404   16.621  -0.014  1.00 0.00 ? 80  ASP A CG   7  
ATOM 9803  O OD1  . ASP A 1 80  ? 1.231   17.521  -0.272  1.00 0.00 ? 80  ASP A OD1  7  
ATOM 9804  O OD2  . ASP A 1 80  ? -0.832  16.789  -0.071  1.00 0.00 ? 80  ASP A OD2  7  
ATOM 9805  H H    . ASP A 1 80  ? 3.729   13.916  0.638   1.00 0.00 ? 80  ASP A H    7  
ATOM 9806  H HA   . ASP A 1 80  ? 2.899   16.039  0.655   1.00 0.00 ? 80  ASP A HA   7  
ATOM 9807  H HB2  . ASP A 1 80  ? 1.073   14.670  -0.509  1.00 0.00 ? 80  ASP A HB2  7  
ATOM 9808  H HB3  . ASP A 1 80  ? 0.186   14.774  1.009   1.00 0.00 ? 80  ASP A HB3  7  
ATOM 9809  N N    . GLY A 1 81  ? 2.997   15.676  3.436   1.00 0.00 ? 81  GLY A N    7  
ATOM 9810  C CA   . GLY A 1 81  ? 2.864   16.107  4.815   1.00 0.00 ? 81  GLY A CA   7  
ATOM 9811  C C    . GLY A 1 81  ? 1.787   15.344  5.559   1.00 0.00 ? 81  GLY A C    7  
ATOM 9812  O O    . GLY A 1 81  ? 1.243   15.831  6.549   1.00 0.00 ? 81  GLY A O    7  
ATOM 9813  H H    . GLY A 1 81  ? 3.835   15.268  3.131   1.00 0.00 ? 81  GLY A H    7  
ATOM 9814  H HA2  . GLY A 1 81  ? 3.807   15.962  5.319   1.00 0.00 ? 81  GLY A HA2  7  
ATOM 9815  H HA3  . GLY A 1 81  ? 2.617   17.159  4.829   1.00 0.00 ? 81  GLY A HA3  7  
ATOM 9816  N N    . ASN A 1 82  ? 1.477   14.143  5.081   1.00 0.00 ? 82  ASN A N    7  
ATOM 9817  C CA   . ASN A 1 82  ? 0.455   13.311  5.707   1.00 0.00 ? 82  ASN A CA   7  
ATOM 9818  C C    . ASN A 1 82  ? 0.972   11.893  5.932   1.00 0.00 ? 82  ASN A C    7  
ATOM 9819  O O    . ASN A 1 82  ? 1.574   11.291  5.043   1.00 0.00 ? 82  ASN A O    7  
ATOM 9820  C CB   . ASN A 1 82  ? -0.805  13.275  4.840   1.00 0.00 ? 82  ASN A CB   7  
ATOM 9821  C CG   . ASN A 1 82  ? -1.689  14.489  5.054   1.00 0.00 ? 82  ASN A CG   7  
ATOM 9822  O OD1  . ASN A 1 82  ? -1.528  15.223  6.028   1.00 0.00 ? 82  ASN A OD1  7  
ATOM 9823  N ND2  . ASN A 1 82  ? -2.629  14.704  4.142   1.00 0.00 ? 82  ASN A ND2  7  
ATOM 9824  H H    . ASN A 1 82  ? 1.945   13.808  4.288   1.00 0.00 ? 82  ASN A H    7  
ATOM 9825  H HA   . ASN A 1 82  ? 0.211   13.749  6.663   1.00 0.00 ? 82  ASN A HA   7  
ATOM 9826  H HB2  . ASN A 1 82  ? -0.517  13.243  3.799   1.00 0.00 ? 82  ASN A HB2  7  
ATOM 9827  H HB3  . ASN A 1 82  ? -1.375  12.390  5.079   1.00 0.00 ? 82  ASN A HB3  7  
ATOM 9828  H HD21 . ASN A 1 82  ? -2.699  14.076  3.392   1.00 0.00 ? 82  ASN A HD21 7  
ATOM 9829  H HD22 . ASN A 1 82  ? -3.214  15.481  4.255   1.00 0.00 ? 82  ASN A HD22 7  
ATOM 9830  N N    . LYS A 1 83  ? 0.731   11.365  7.127   1.00 0.00 ? 83  LYS A N    7  
ATOM 9831  C CA   . LYS A 1 83  ? 1.169   10.017  7.471   1.00 0.00 ? 83  LYS A CA   7  
ATOM 9832  C C    . LYS A 1 83  ? 0.398   8.974   6.669   1.00 0.00 ? 83  LYS A C    7  
ATOM 9833  O O    . LYS A 1 83  ? -0.832  8.982   6.641   1.00 0.00 ? 83  LYS A O    7  
ATOM 9834  C CB   . LYS A 1 83  ? 0.983   9.765   8.969   1.00 0.00 ? 83  LYS A CB   7  
ATOM 9835  C CG   . LYS A 1 83  ? 1.945   10.551  9.842   1.00 0.00 ? 83  LYS A CG   7  
ATOM 9836  C CD   . LYS A 1 83  ? 1.368   11.901  10.233  1.00 0.00 ? 83  LYS A CD   7  
ATOM 9837  C CE   . LYS A 1 83  ? 0.086   11.747  11.038  1.00 0.00 ? 83  LYS A CE   7  
ATOM 9838  N NZ   . LYS A 1 83  ? -0.240  12.982  11.804  1.00 0.00 ? 83  LYS A NZ   7  
ATOM 9839  H H    . LYS A 1 83  ? 0.246   11.895  7.795   1.00 0.00 ? 83  LYS A H    7  
ATOM 9840  H HA   . LYS A 1 83  ? 2.218   9.937   7.229   1.00 0.00 ? 83  LYS A HA   7  
ATOM 9841  H HB2  . LYS A 1 83  ? -0.025  10.036  9.245   1.00 0.00 ? 83  LYS A HB2  7  
ATOM 9842  H HB3  . LYS A 1 83  ? 1.130   8.712   9.165   1.00 0.00 ? 83  LYS A HB3  7  
ATOM 9843  H HG2  . LYS A 1 83  ? 2.147   9.985   10.739  1.00 0.00 ? 83  LYS A HG2  7  
ATOM 9844  H HG3  . LYS A 1 83  ? 2.866   10.707  9.298   1.00 0.00 ? 83  LYS A HG3  7  
ATOM 9845  H HD2  . LYS A 1 83  ? 2.092   12.434  10.830  1.00 0.00 ? 83  LYS A HD2  7  
ATOM 9846  H HD3  . LYS A 1 83  ? 1.153   12.464  9.336   1.00 0.00 ? 83  LYS A HD3  7  
ATOM 9847  H HE2  . LYS A 1 83  ? -0.725  11.529  10.361  1.00 0.00 ? 83  LYS A HE2  7  
ATOM 9848  H HE3  . LYS A 1 83  ? 0.208   10.926  11.730  1.00 0.00 ? 83  LYS A HE3  7  
ATOM 9849  H HZ1  . LYS A 1 83  ? 0.151   13.815  11.319  1.00 0.00 ? 83  LYS A HZ1  7  
ATOM 9850  H HZ2  . LYS A 1 83  ? 0.168   12.928  12.759  1.00 0.00 ? 83  LYS A HZ2  7  
ATOM 9851  H HZ3  . LYS A 1 83  ? -1.271  13.091  11.883  1.00 0.00 ? 83  LYS A HZ3  7  
ATOM 9852  N N    . VAL A 1 84  ? 1.130   8.074   6.018   1.00 0.00 ? 84  VAL A N    7  
ATOM 9853  C CA   . VAL A 1 84  ? 0.515   7.022   5.218   1.00 0.00 ? 84  VAL A CA   7  
ATOM 9854  C C    . VAL A 1 84  ? 0.833   5.643   5.785   1.00 0.00 ? 84  VAL A C    7  
ATOM 9855  O O    . VAL A 1 84  ? 1.890   5.433   6.381   1.00 0.00 ? 84  VAL A O    7  
ATOM 9856  C CB   . VAL A 1 84  ? 0.986   7.084   3.753   1.00 0.00 ? 84  VAL A CB   7  
ATOM 9857  C CG1  . VAL A 1 84  ? 0.653   8.436   3.141   1.00 0.00 ? 84  VAL A CG1  7  
ATOM 9858  C CG2  . VAL A 1 84  ? 2.478   6.800   3.661   1.00 0.00 ? 84  VAL A CG2  7  
ATOM 9859  H H    . VAL A 1 84  ? 2.107   8.119   6.079   1.00 0.00 ? 84  VAL A H    7  
ATOM 9860  H HA   . VAL A 1 84  ? -0.555  7.171   5.237   1.00 0.00 ? 84  VAL A HA   7  
ATOM 9861  H HB   . VAL A 1 84  ? 0.461   6.322   3.195   1.00 0.00 ? 84  VAL A HB   7  
ATOM 9862  H HG11 . VAL A 1 84  ? 1.040   9.222   3.774   1.00 0.00 ? 84  VAL A HG11 7  
ATOM 9863  H HG12 . VAL A 1 84  ? 1.101   8.508   2.161   1.00 0.00 ? 84  VAL A HG12 7  
ATOM 9864  H HG13 . VAL A 1 84  ? -0.419  8.538   3.056   1.00 0.00 ? 84  VAL A HG13 7  
ATOM 9865  H HG21 . VAL A 1 84  ? 2.769   6.739   2.623   1.00 0.00 ? 84  VAL A HG21 7  
ATOM 9866  H HG22 . VAL A 1 84  ? 3.027   7.597   4.142   1.00 0.00 ? 84  VAL A HG22 7  
ATOM 9867  H HG23 . VAL A 1 84  ? 2.698   5.865   4.153   1.00 0.00 ? 84  VAL A HG23 7  
ATOM 9868  N N    . THR A 1 85  ? -0.089  4.705   5.596   1.00 0.00 ? 85  THR A N    7  
ATOM 9869  C CA   . THR A 1 85  ? 0.092   3.345   6.089   1.00 0.00 ? 85  THR A CA   7  
ATOM 9870  C C    . THR A 1 85  ? 0.102   2.341   4.942   1.00 0.00 ? 85  THR A C    7  
ATOM 9871  O O    . THR A 1 85  ? -0.894  2.181   4.235   1.00 0.00 ? 85  THR A O    7  
ATOM 9872  C CB   . THR A 1 85  ? -1.017  2.957   7.086   1.00 0.00 ? 85  THR A CB   7  
ATOM 9873  O OG1  . THR A 1 85  ? -0.941  3.787   8.250   1.00 0.00 ? 85  THR A OG1  7  
ATOM 9874  C CG2  . THR A 1 85  ? -0.893  1.496   7.490   1.00 0.00 ? 85  THR A CG2  7  
ATOM 9875  H H    . THR A 1 85  ? -0.911  4.934   5.114   1.00 0.00 ? 85  THR A H    7  
ATOM 9876  H HA   . THR A 1 85  ? 1.041   3.300   6.603   1.00 0.00 ? 85  THR A HA   7  
ATOM 9877  H HB   . THR A 1 85  ? -1.976  3.104   6.610   1.00 0.00 ? 85  THR A HB   7  
ATOM 9878  H HG1  . THR A 1 85  ? -0.765  4.694   7.986   1.00 0.00 ? 85  THR A HG1  7  
ATOM 9879  H HG21 . THR A 1 85  ? -1.812  1.172   7.956   1.00 0.00 ? 85  THR A HG21 7  
ATOM 9880  H HG22 . THR A 1 85  ? -0.077  1.383   8.188   1.00 0.00 ? 85  THR A HG22 7  
ATOM 9881  H HG23 . THR A 1 85  ? -0.704  0.895   6.613   1.00 0.00 ? 85  THR A HG23 7  
ATOM 9882  N N    . LEU A 1 86  ? 1.232   1.667   4.763   1.00 0.00 ? 86  LEU A N    7  
ATOM 9883  C CA   . LEU A 1 86  ? 1.372   0.677   3.701   1.00 0.00 ? 86  LEU A CA   7  
ATOM 9884  C C    . LEU A 1 86  ? 0.940   -0.704  4.183   1.00 0.00 ? 86  LEU A C    7  
ATOM 9885  O O    . LEU A 1 86  ? 1.441   -1.206  5.190   1.00 0.00 ? 86  LEU A O    7  
ATOM 9886  C CB   . LEU A 1 86  ? 2.820   0.627   3.210   1.00 0.00 ? 86  LEU A CB   7  
ATOM 9887  C CG   . LEU A 1 86  ? 3.608   1.933   3.312   1.00 0.00 ? 86  LEU A CG   7  
ATOM 9888  C CD1  . LEU A 1 86  ? 5.017   1.751   2.768   1.00 0.00 ? 86  LEU A CD1  7  
ATOM 9889  C CD2  . LEU A 1 86  ? 2.889   3.051   2.571   1.00 0.00 ? 86  LEU A CD2  7  
ATOM 9890  H H    . LEU A 1 86  ? 1.992   1.838   5.358   1.00 0.00 ? 86  LEU A H    7  
ATOM 9891  H HA   . LEU A 1 86  ? 0.733   0.975   2.883   1.00 0.00 ? 86  LEU A HA   7  
ATOM 9892  H HB2  . LEU A 1 86  ? 3.340   -0.119  3.789   1.00 0.00 ? 86  LEU A HB2  7  
ATOM 9893  H HB3  . LEU A 1 86  ? 2.806   0.329   2.171   1.00 0.00 ? 86  LEU A HB3  7  
ATOM 9894  H HG   . LEU A 1 86  ? 3.687   2.218   4.353   1.00 0.00 ? 86  LEU A HG   7  
ATOM 9895  H HD11 . LEU A 1 86  ? 5.690   1.523   3.581   1.00 0.00 ? 86  LEU A HD11 7  
ATOM 9896  H HD12 . LEU A 1 86  ? 5.335   2.661   2.282   1.00 0.00 ? 86  LEU A HD12 7  
ATOM 9897  H HD13 . LEU A 1 86  ? 5.025   0.940   2.055   1.00 0.00 ? 86  LEU A HD13 7  
ATOM 9898  H HD21 . LEU A 1 86  ? 2.067   3.410   3.173   1.00 0.00 ? 86  LEU A HD21 7  
ATOM 9899  H HD22 . LEU A 1 86  ? 2.509   2.673   1.632   1.00 0.00 ? 86  LEU A HD22 7  
ATOM 9900  H HD23 . LEU A 1 86  ? 3.578   3.860   2.382   1.00 0.00 ? 86  LEU A HD23 7  
ATOM 9901  N N    . ASP A 1 87  ? 0.008   -1.314  3.458   1.00 0.00 ? 87  ASP A N    7  
ATOM 9902  C CA   . ASP A 1 87  ? -0.490  -2.638  3.810   1.00 0.00 ? 87  ASP A CA   7  
ATOM 9903  C C    . ASP A 1 87  ? -0.708  -3.486  2.561   1.00 0.00 ? 87  ASP A C    7  
ATOM 9904  O O    . ASP A 1 87  ? -1.267  -3.017  1.570   1.00 0.00 ? 87  ASP A O    7  
ATOM 9905  C CB   . ASP A 1 87  ? -1.796  -2.523  4.598   1.00 0.00 ? 87  ASP A CB   7  
ATOM 9906  C CG   . ASP A 1 87  ? -1.561  -2.372  6.088   1.00 0.00 ? 87  ASP A CG   7  
ATOM 9907  O OD1  . ASP A 1 87  ? -0.674  -1.581  6.473   1.00 0.00 ? 87  ASP A OD1  7  
ATOM 9908  O OD2  . ASP A 1 87  ? -2.266  -3.044  6.870   1.00 0.00 ? 87  ASP A OD2  7  
ATOM 9909  H H    . ASP A 1 87  ? -0.353  -0.862  2.667   1.00 0.00 ? 87  ASP A H    7  
ATOM 9910  H HA   . ASP A 1 87  ? 0.253   -3.118  4.430   1.00 0.00 ? 87  ASP A HA   7  
ATOM 9911  H HB2  . ASP A 1 87  ? -2.344  -1.659  4.250   1.00 0.00 ? 87  ASP A HB2  7  
ATOM 9912  H HB3  . ASP A 1 87  ? -2.388  -3.411  4.433   1.00 0.00 ? 87  ASP A HB3  7  
ATOM 9913  N N    . TRP A 1 88  ? -0.262  -4.736  2.616   1.00 0.00 ? 88  TRP A N    7  
ATOM 9914  C CA   . TRP A 1 88  ? -0.408  -5.650  1.489   1.00 0.00 ? 88  TRP A CA   7  
ATOM 9915  C C    . TRP A 1 88  ? -1.877  -5.832  1.122   1.00 0.00 ? 88  TRP A C    7  
ATOM 9916  O O    . TRP A 1 88  ? -2.710  -6.115  1.982   1.00 0.00 ? 88  TRP A O    7  
ATOM 9917  C CB   . TRP A 1 88  ? 0.220   -7.005  1.819   1.00 0.00 ? 88  TRP A CB   7  
ATOM 9918  C CG   . TRP A 1 88  ? 1.701   -6.935  2.040   1.00 0.00 ? 88  TRP A CG   7  
ATOM 9919  C CD1  . TRP A 1 88  ? 2.376   -7.269  3.179   1.00 0.00 ? 88  TRP A CD1  7  
ATOM 9920  C CD2  . TRP A 1 88  ? 2.689   -6.502  1.098   1.00 0.00 ? 88  TRP A CD2  7  
ATOM 9921  N NE1  . TRP A 1 88  ? 3.724   -7.070  3.002   1.00 0.00 ? 88  TRP A NE1  7  
ATOM 9922  C CE2  . TRP A 1 88  ? 3.942   -6.600  1.733   1.00 0.00 ? 88  TRP A CE2  7  
ATOM 9923  C CE3  . TRP A 1 88  ? 2.637   -6.043  -0.221  1.00 0.00 ? 88  TRP A CE3  7  
ATOM 9924  C CZ2  . TRP A 1 88  ? 5.130   -6.255  1.094   1.00 0.00 ? 88  TRP A CZ2  7  
ATOM 9925  C CZ3  . TRP A 1 88  ? 3.816   -5.700  -0.854  1.00 0.00 ? 88  TRP A CZ3  7  
ATOM 9926  C CH2  . TRP A 1 88  ? 5.049   -5.809  -0.197  1.00 0.00 ? 88  TRP A CH2  7  
ATOM 9927  H H    . TRP A 1 88  ? 0.175   -5.053  3.434   1.00 0.00 ? 88  TRP A H    7  
ATOM 9928  H HA   . TRP A 1 88  ? 0.111   -5.219  0.645   1.00 0.00 ? 88  TRP A HA   7  
ATOM 9929  H HB2  . TRP A 1 88  ? -0.233  -7.395  2.718   1.00 0.00 ? 88  TRP A HB2  7  
ATOM 9930  H HB3  . TRP A 1 88  ? 0.036   -7.687  1.001   1.00 0.00 ? 88  TRP A HB3  7  
ATOM 9931  H HD1  . TRP A 1 88  ? 1.906   -7.633  4.080   1.00 0.00 ? 88  TRP A HD1  7  
ATOM 9932  H HE1  . TRP A 1 88  ? 4.417   -7.239  3.675   1.00 0.00 ? 88  TRP A HE1  7  
ATOM 9933  H HE3  . TRP A 1 88  ? 1.696   -5.952  -0.744  1.00 0.00 ? 88  TRP A HE3  7  
ATOM 9934  H HZ2  . TRP A 1 88  ? 6.088   -6.334  1.587   1.00 0.00 ? 88  TRP A HZ2  7  
ATOM 9935  H HZ3  . TRP A 1 88  ? 3.796   -5.343  -1.873  1.00 0.00 ? 88  TRP A HZ3  7  
ATOM 9936  H HH2  . TRP A 1 88  ? 5.945   -5.530  -0.730  1.00 0.00 ? 88  TRP A HH2  7  
ATOM 9937  N N    . ALA A 1 89  ? -2.187  -5.669  -0.160  1.00 0.00 ? 89  ALA A N    7  
ATOM 9938  C CA   . ALA A 1 89  ? -3.555  -5.819  -0.640  1.00 0.00 ? 89  ALA A CA   7  
ATOM 9939  C C    . ALA A 1 89  ? -3.918  -7.289  -0.814  1.00 0.00 ? 89  ALA A C    7  
ATOM 9940  O O    . ALA A 1 89  ? -3.177  -8.054  -1.433  1.00 0.00 ? 89  ALA A O    7  
ATOM 9941  C CB   . ALA A 1 89  ? -3.739  -5.068  -1.951  1.00 0.00 ? 89  ALA A CB   7  
ATOM 9942  H H    . ALA A 1 89  ? -1.478  -5.445  -0.798  1.00 0.00 ? 89  ALA A H    7  
ATOM 9943  H HA   . ALA A 1 89  ? -4.216  -5.380  0.094   1.00 0.00 ? 89  ALA A HA   7  
ATOM 9944  H HB1  . ALA A 1 89  ? -4.467  -4.281  -1.814  1.00 0.00 ? 89  ALA A HB1  7  
ATOM 9945  H HB2  . ALA A 1 89  ? -2.797  -4.640  -2.256  1.00 0.00 ? 89  ALA A HB2  7  
ATOM 9946  H HB3  . ALA A 1 89  ? -4.087  -5.752  -2.710  1.00 0.00 ? 89  ALA A HB3  7  
ATOM 9947  N N    . LYS A 1 90  ? -5.063  -7.681  -0.264  1.00 0.00 ? 90  LYS A N    7  
ATOM 9948  C CA   . LYS A 1 90  ? -5.525  -9.060  -0.358  1.00 0.00 ? 90  LYS A CA   7  
ATOM 9949  C C    . LYS A 1 90  ? -5.808  -9.441  -1.808  1.00 0.00 ? 90  LYS A C    7  
ATOM 9950  O O    . LYS A 1 90  ? -6.304  -8.639  -2.601  1.00 0.00 ? 90  LYS A O    7  
ATOM 9951  C CB   . LYS A 1 90  ? -6.786  -9.256  0.487   1.00 0.00 ? 90  LYS A CB   7  
ATOM 9952  C CG   . LYS A 1 90  ? -6.501  -9.487  1.960   1.00 0.00 ? 90  LYS A CG   7  
ATOM 9953  C CD   . LYS A 1 90  ? -6.374  -8.175  2.716   1.00 0.00 ? 90  LYS A CD   7  
ATOM 9954  C CE   . LYS A 1 90  ? -7.730  -7.665  3.179   1.00 0.00 ? 90  LYS A CE   7  
ATOM 9955  N NZ   . LYS A 1 90  ? -8.390  -6.825  2.140   1.00 0.00 ? 90  LYS A NZ   7  
ATOM 9956  H H    . LYS A 1 90  ? -5.610  -7.025  0.217   1.00 0.00 ? 90  LYS A H    7  
ATOM 9957  H HA   . LYS A 1 90  ? -4.744  -9.699  0.023   1.00 0.00 ? 90  LYS A HA   7  
ATOM 9958  H HB2  . LYS A 1 90  ? -7.407  -8.376  0.395   1.00 0.00 ? 90  LYS A HB2  7  
ATOM 9959  H HB3  . LYS A 1 90  ? -7.330  -10.110 0.108   1.00 0.00 ? 90  LYS A HB3  7  
ATOM 9960  H HG2  . LYS A 1 90  ? -7.310  -10.060 2.389   1.00 0.00 ? 90  LYS A HG2  7  
ATOM 9961  H HG3  . LYS A 1 90  ? -5.576  -10.039 2.056   1.00 0.00 ? 90  LYS A HG3  7  
ATOM 9962  H HD2  . LYS A 1 90  ? -5.745  -8.327  3.581   1.00 0.00 ? 90  LYS A HD2  7  
ATOM 9963  H HD3  . LYS A 1 90  ? -5.923  -7.438  2.067   1.00 0.00 ? 90  LYS A HD3  7  
ATOM 9964  H HE2  . LYS A 1 90  ? -8.362  -8.511  3.400   1.00 0.00 ? 90  LYS A HE2  7  
ATOM 9965  H HE3  . LYS A 1 90  ? -7.592  -7.074  4.072   1.00 0.00 ? 90  LYS A HE3  7  
ATOM 9966  H HZ1  . LYS A 1 90  ? -8.619  -5.889  2.531   1.00 0.00 ? 90  LYS A HZ1  7  
ATOM 9967  H HZ2  . LYS A 1 90  ? -9.269  -7.279  1.820   1.00 0.00 ? 90  LYS A HZ2  7  
ATOM 9968  H HZ3  . LYS A 1 90  ? -7.757  -6.704  1.324   1.00 0.00 ? 90  LYS A HZ3  7  
ATOM 9969  N N    . PRO A 1 91  ? -5.488  -10.694 -2.165  1.00 0.00 ? 91  PRO A N    7  
ATOM 9970  C CA   . PRO A 1 91  ? -5.701  -11.209 -3.521  1.00 0.00 ? 91  PRO A CA   7  
ATOM 9971  C C    . PRO A 1 91  ? -7.180  -11.390 -3.847  1.00 0.00 ? 91  PRO A C    7  
ATOM 9972  O O    . PRO A 1 91  ? -8.022  -11.448 -2.950  1.00 0.00 ? 91  PRO A O    7  
ATOM 9973  C CB   . PRO A 1 91  ? -4.989  -12.564 -3.501  1.00 0.00 ? 91  PRO A CB   7  
ATOM 9974  C CG   . PRO A 1 91  ? -4.996  -12.975 -2.069  1.00 0.00 ? 91  PRO A CG   7  
ATOM 9975  C CD   . PRO A 1 91  ? -4.894  -11.703 -1.273  1.00 0.00 ? 91  PRO A CD   7  
ATOM 9976  H HA   . PRO A 1 91  ? -5.245  -10.572 -4.264  1.00 0.00 ? 91  PRO A HA   7  
ATOM 9977  H HB2  . PRO A 1 91  ? -5.531  -13.268 -4.117  1.00 0.00 ? 91  PRO A HB2  7  
ATOM 9978  H HB3  . PRO A 1 91  ? -3.982  -12.451 -3.874  1.00 0.00 ? 91  PRO A HB3  7  
ATOM 9979  H HG2  . PRO A 1 91  ? -5.917  -13.489 -1.839  1.00 0.00 ? 91  PRO A HG2  7  
ATOM 9980  H HG3  . PRO A 1 91  ? -4.148  -13.612 -1.866  1.00 0.00 ? 91  PRO A HG3  7  
ATOM 9981  H HD2  . PRO A 1 91  ? -5.458  -11.786 -0.355  1.00 0.00 ? 91  PRO A HD2  7  
ATOM 9982  H HD3  . PRO A 1 91  ? -3.861  -11.471 -1.063  1.00 0.00 ? 91  PRO A HD3  7  
ATOM 9983  N N    . LYS A 1 92  ? -7.491  -11.478 -5.135  1.00 0.00 ? 92  LYS A N    7  
ATOM 9984  C CA   . LYS A 1 92  ? -8.868  -11.654 -5.581  1.00 0.00 ? 92  LYS A CA   7  
ATOM 9985  C C    . LYS A 1 92  ? -9.216  -13.134 -5.701  1.00 0.00 ? 92  LYS A C    7  
ATOM 9986  O O    . LYS A 1 92  ? -10.199 -13.599 -5.126  1.00 0.00 ? 92  LYS A O    7  
ATOM 9987  C CB   . LYS A 1 92  ? -9.083  -10.958 -6.927  1.00 0.00 ? 92  LYS A CB   7  
ATOM 9988  C CG   . LYS A 1 92  ? -8.842  -9.459  -6.881  1.00 0.00 ? 92  LYS A CG   7  
ATOM 9989  C CD   . LYS A 1 92  ? -9.218  -8.793  -8.194  1.00 0.00 ? 92  LYS A CD   7  
ATOM 9990  C CE   . LYS A 1 92  ? -8.124  -8.961  -9.238  1.00 0.00 ? 92  LYS A CE   7  
ATOM 9991  N NZ   . LYS A 1 92  ? -7.028  -7.969  -9.057  1.00 0.00 ? 92  LYS A NZ   7  
ATOM 9992  H H    . LYS A 1 92  ? -6.775  -11.425 -5.804  1.00 0.00 ? 92  LYS A H    7  
ATOM 9993  H HA   . LYS A 1 92  ? -9.515  -11.203 -4.844  1.00 0.00 ? 92  LYS A HA   7  
ATOM 9994  H HB2  . LYS A 1 92  ? -8.409  -11.388 -7.653  1.00 0.00 ? 92  LYS A HB2  7  
ATOM 9995  H HB3  . LYS A 1 92  ? -10.101 -11.127 -7.247  1.00 0.00 ? 92  LYS A HB3  7  
ATOM 9996  H HG2  . LYS A 1 92  ? -9.438  -9.031  -6.089  1.00 0.00 ? 92  LYS A HG2  7  
ATOM 9997  H HG3  . LYS A 1 92  ? -7.794  -9.278  -6.683  1.00 0.00 ? 92  LYS A HG3  7  
ATOM 9998  H HD2  . LYS A 1 92  ? -10.127 -9.241  -8.568  1.00 0.00 ? 92  LYS A HD2  7  
ATOM 9999  H HD3  . LYS A 1 92  ? -9.379  -7.739  -8.021  1.00 0.00 ? 92  LYS A HD3  7  
ATOM 10000 H HE2  . LYS A 1 92  ? -7.714  -9.956  -9.154  1.00 0.00 ? 92  LYS A HE2  7  
ATOM 10001 H HE3  . LYS A 1 92  ? -8.557  -8.831  -10.219 1.00 0.00 ? 92  LYS A HE3  7  
ATOM 10002 H HZ1  . LYS A 1 92  ? -6.239  -8.188  -9.698  1.00 0.00 ? 92  LYS A HZ1  7  
ATOM 10003 H HZ2  . LYS A 1 92  ? -6.680  -7.996  -8.077  1.00 0.00 ? 92  LYS A HZ2  7  
ATOM 10004 H HZ3  . LYS A 1 92  ? -7.374  -7.011  -9.265  1.00 0.00 ? 92  LYS A HZ3  7  
ATOM 10005 N N    . GLY A 1 93  ? -8.402  -13.870 -6.452  1.00 0.00 ? 93  GLY A N    7  
ATOM 10006 C CA   . GLY A 1 93  ? -8.641  -15.290 -6.632  1.00 0.00 ? 93  GLY A CA   7  
ATOM 10007 C C    . GLY A 1 93  ? -8.522  -15.719 -8.081  1.00 0.00 ? 93  GLY A C    7  
ATOM 10008 O O    . GLY A 1 93  ? -8.835  -14.949 -8.990  1.00 0.00 ? 93  GLY A O    7  
ATOM 10009 H H    . GLY A 1 93  ? -7.633  -13.445 -6.887  1.00 0.00 ? 93  GLY A H    7  
ATOM 10010 H HA2  . GLY A 1 93  ? -7.923  -15.842 -6.045  1.00 0.00 ? 93  GLY A HA2  7  
ATOM 10011 H HA3  . GLY A 1 93  ? -9.635  -15.524 -6.280  1.00 0.00 ? 93  GLY A HA3  7  
ATOM 10012 N N    . GLU A 1 94  ? -8.068  -16.949 -8.298  1.00 0.00 ? 94  GLU A N    7  
ATOM 10013 C CA   . GLU A 1 94  ? -7.907  -17.476 -9.648  1.00 0.00 ? 94  GLU A CA   7  
ATOM 10014 C C    . GLU A 1 94  ? -8.996  -18.497 -9.967  1.00 0.00 ? 94  GLU A C    7  
ATOM 10015 O O    . GLU A 1 94  ? -8.731  -19.535 -10.572 1.00 0.00 ? 94  GLU A O    7  
ATOM 10016 C CB   . GLU A 1 94  ? -6.527  -18.120 -9.807  1.00 0.00 ? 94  GLU A CB   7  
ATOM 10017 C CG   . GLU A 1 94  ? -6.353  -19.393 -8.997  1.00 0.00 ? 94  GLU A CG   7  
ATOM 10018 C CD   . GLU A 1 94  ? -5.390  -20.369 -9.645  1.00 0.00 ? 94  GLU A CD   7  
ATOM 10019 O OE1  . GLU A 1 94  ? -5.409  -20.483 -10.889 1.00 0.00 ? 94  GLU A OE1  7  
ATOM 10020 O OE2  . GLU A 1 94  ? -4.619  -21.020 -8.910  1.00 0.00 ? 94  GLU A OE2  7  
ATOM 10021 H H    . GLU A 1 94  ? -7.835  -17.515 -7.533  1.00 0.00 ? 94  GLU A H    7  
ATOM 10022 H HA   . GLU A 1 94  ? -7.990  -16.651 -10.339 1.00 0.00 ? 94  GLU A HA   7  
ATOM 10023 H HB2  . GLU A 1 94  ? -6.371  -18.355 -10.849 1.00 0.00 ? 94  GLU A HB2  7  
ATOM 10024 H HB3  . GLU A 1 94  ? -5.775  -17.412 -9.491  1.00 0.00 ? 94  GLU A HB3  7  
ATOM 10025 H HG2  . GLU A 1 94  ? -5.975  -19.135 -8.020  1.00 0.00 ? 94  GLU A HG2  7  
ATOM 10026 H HG3  . GLU A 1 94  ? -7.315  -19.874 -8.894  1.00 0.00 ? 94  GLU A HG3  7  
ATOM 10027 N N    . GLY A 1 95  ? -10.223 -18.193 -9.554  1.00 0.00 ? 95  GLY A N    7  
ATOM 10028 C CA   . GLY A 1 95  ? -11.333 -19.093 -9.804  1.00 0.00 ? 95  GLY A CA   7  
ATOM 10029 C C    . GLY A 1 95  ? -12.678 -18.423 -9.604  1.00 0.00 ? 95  GLY A C    7  
ATOM 10030 O O    . GLY A 1 95  ? -12.801 -17.207 -9.741  1.00 0.00 ? 95  GLY A O    7  
ATOM 10031 H H    . GLY A 1 95  ? -10.375 -17.351 -9.076  1.00 0.00 ? 95  GLY A H    7  
ATOM 10032 H HA2  . GLY A 1 95  ? -11.270 -19.452 -10.820 1.00 0.00 ? 95  GLY A HA2  7  
ATOM 10033 H HA3  . GLY A 1 95  ? -11.259 -19.933 -9.130  1.00 0.00 ? 95  GLY A HA3  7  
ATOM 10034 N N    . GLY A 1 96  ? -13.692 -19.220 -9.280  1.00 0.00 ? 96  GLY A N    7  
ATOM 10035 C CA   . GLY A 1 96  ? -15.022 -18.679 -9.068  1.00 0.00 ? 96  GLY A CA   7  
ATOM 10036 C C    . GLY A 1 96  ? -15.829 -18.606 -10.349 1.00 0.00 ? 96  GLY A C    7  
ATOM 10037 O O    . GLY A 1 96  ? -16.296 -17.534 -10.736 1.00 0.00 ? 96  GLY A O    7  
ATOM 10038 H H    . GLY A 1 96  ? -13.536 -20.183 -9.185  1.00 0.00 ? 96  GLY A H    7  
ATOM 10039 H HA2  . GLY A 1 96  ? -15.545 -19.306 -8.361  1.00 0.00 ? 96  GLY A HA2  7  
ATOM 10040 H HA3  . GLY A 1 96  ? -14.933 -17.685 -8.655  1.00 0.00 ? 96  GLY A HA3  7  
ATOM 10041 N N    . SER A 1 97  ? -15.993 -19.747 -11.010 1.00 0.00 ? 97  SER A N    7  
ATOM 10042 C CA   . SER A 1 97  ? -16.744 -19.806 -12.259 1.00 0.00 ? 97  SER A CA   7  
ATOM 10043 C C    . SER A 1 97  ? -18.171 -19.305 -12.058 1.00 0.00 ? 97  SER A C    7  
ATOM 10044 O O    . SER A 1 97  ? -18.581 -18.996 -10.940 1.00 0.00 ? 97  SER A O    7  
ATOM 10045 C CB   . SER A 1 97  ? -16.765 -21.238 -12.798 1.00 0.00 ? 97  SER A CB   7  
ATOM 10046 O OG   . SER A 1 97  ? -15.655 -21.480 -13.645 1.00 0.00 ? 97  SER A OG   7  
ATOM 10047 H H    . SER A 1 97  ? -15.596 -20.568 -10.651 1.00 0.00 ? 97  SER A H    7  
ATOM 10048 H HA   . SER A 1 97  ? -16.249 -19.168 -12.975 1.00 0.00 ? 97  SER A HA   7  
ATOM 10049 H HB2  . SER A 1 97  ? -16.731 -21.932 -11.972 1.00 0.00 ? 97  SER A HB2  7  
ATOM 10050 H HB3  . SER A 1 97  ? -17.674 -21.393 -13.362 1.00 0.00 ? 97  SER A HB3  7  
ATOM 10051 H HG   . SER A 1 97  ? -15.176 -22.250 -13.332 1.00 0.00 ? 97  SER A HG   7  
ATOM 10052 N N    . GLY A 1 98  ? -18.924 -19.228 -13.151 1.00 0.00 ? 98  GLY A N    7  
ATOM 10053 C CA   . GLY A 1 98  ? -20.297 -18.764 -13.075 1.00 0.00 ? 98  GLY A CA   7  
ATOM 10054 C C    . GLY A 1 98  ? -21.160 -19.323 -14.189 1.00 0.00 ? 98  GLY A C    7  
ATOM 10055 O O    . GLY A 1 98  ? -21.472 -18.639 -15.164 1.00 0.00 ? 98  GLY A O    7  
ATOM 10056 H H    . GLY A 1 98  ? -18.544 -19.488 -14.017 1.00 0.00 ? 98  GLY A H    7  
ATOM 10057 H HA2  . GLY A 1 98  ? -20.715 -19.063 -12.126 1.00 0.00 ? 98  GLY A HA2  7  
ATOM 10058 H HA3  . GLY A 1 98  ? -20.305 -17.686 -13.137 1.00 0.00 ? 98  GLY A HA3  7  
ATOM 10059 N N    . PRO A 1 99  ? -21.560 -20.596 -14.051 1.00 0.00 ? 99  PRO A N    7  
ATOM 10060 C CA   . PRO A 1 99  ? -22.397 -21.275 -15.045 1.00 0.00 ? 99  PRO A CA   7  
ATOM 10061 C C    . PRO A 1 99  ? -23.820 -20.728 -15.075 1.00 0.00 ? 99  PRO A C    7  
ATOM 10062 O O    . PRO A 1 99  ? -24.268 -20.084 -14.126 1.00 0.00 ? 99  PRO A O    7  
ATOM 10063 C CB   . PRO A 1 99  ? -22.394 -22.732 -14.576 1.00 0.00 ? 99  PRO A CB   7  
ATOM 10064 C CG   . PRO A 1 99  ? -22.127 -22.658 -13.112 1.00 0.00 ? 99  PRO A CG   7  
ATOM 10065 C CD   . PRO A 1 99  ? -21.226 -21.470 -12.914 1.00 0.00 ? 99  PRO A CD   7  
ATOM 10066 H HA   . PRO A 1 99  ? -21.968 -21.212 -16.034 1.00 0.00 ? 99  PRO A HA   7  
ATOM 10067 H HB2  . PRO A 1 99  ? -23.355 -23.181 -14.781 1.00 0.00 ? 99  PRO A HB2  7  
ATOM 10068 H HB3  . PRO A 1 99  ? -21.617 -23.278 -15.090 1.00 0.00 ? 99  PRO A HB3  7  
ATOM 10069 H HG2  . PRO A 1 99  ? -23.054 -22.518 -12.577 1.00 0.00 ? 99  PRO A HG2  7  
ATOM 10070 H HG3  . PRO A 1 99  ? -21.635 -23.561 -12.782 1.00 0.00 ? 99  PRO A HG3  7  
ATOM 10071 H HD2  . PRO A 1 99  ? -21.445 -20.983 -11.976 1.00 0.00 ? 99  PRO A HD2  7  
ATOM 10072 H HD3  . PRO A 1 99  ? -20.190 -21.772 -12.952 1.00 0.00 ? 99  PRO A HD3  7  
ATOM 10073 N N    . SER A 1 100 ? -24.527 -20.990 -16.170 1.00 0.00 ? 100 SER A N    7  
ATOM 10074 C CA   . SER A 1 100 ? -25.899 -20.521 -16.324 1.00 0.00 ? 100 SER A CA   7  
ATOM 10075 C C    . SER A 1 100 ? -26.764 -20.975 -15.152 1.00 0.00 ? 100 SER A C    7  
ATOM 10076 O O    . SER A 1 100 ? -26.843 -22.166 -14.850 1.00 0.00 ? 100 SER A O    7  
ATOM 10077 C CB   . SER A 1 100 ? -26.491 -21.035 -17.638 1.00 0.00 ? 100 SER A CB   7  
ATOM 10078 O OG   . SER A 1 100 ? -26.840 -22.405 -17.539 1.00 0.00 ? 100 SER A OG   7  
ATOM 10079 H H    . SER A 1 100 ? -24.115 -21.509 -16.892 1.00 0.00 ? 100 SER A H    7  
ATOM 10080 H HA   . SER A 1 100 ? -25.880 -19.442 -16.345 1.00 0.00 ? 100 SER A HA   7  
ATOM 10081 H HB2  . SER A 1 100 ? -27.377 -20.467 -17.877 1.00 0.00 ? 100 SER A HB2  7  
ATOM 10082 H HB3  . SER A 1 100 ? -25.763 -20.917 -18.428 1.00 0.00 ? 100 SER A HB3  7  
ATOM 10083 H HG   . SER A 1 100 ? -27.479 -22.523 -16.833 1.00 0.00 ? 100 SER A HG   7  
ATOM 10084 N N    . SER A 1 101 ? -27.410 -20.017 -14.495 1.00 0.00 ? 101 SER A N    7  
ATOM 10085 C CA   . SER A 1 101 ? -28.266 -20.317 -13.353 1.00 0.00 ? 101 SER A CA   7  
ATOM 10086 C C    . SER A 1 101 ? -29.604 -20.887 -13.812 1.00 0.00 ? 101 SER A C    7  
ATOM 10087 O O    . SER A 1 101 ? -30.292 -20.294 -14.643 1.00 0.00 ? 101 SER A O    7  
ATOM 10088 C CB   . SER A 1 101 ? -28.495 -19.057 -12.516 1.00 0.00 ? 101 SER A CB   7  
ATOM 10089 O OG   . SER A 1 101 ? -29.039 -18.013 -13.305 1.00 0.00 ? 101 SER A OG   7  
ATOM 10090 H H    . SER A 1 101 ? -27.306 -19.086 -14.784 1.00 0.00 ? 101 SER A H    7  
ATOM 10091 H HA   . SER A 1 101 ? -27.763 -21.055 -12.746 1.00 0.00 ? 101 SER A HA   7  
ATOM 10092 H HB2  . SER A 1 101 ? -29.182 -19.280 -11.714 1.00 0.00 ? 101 SER A HB2  7  
ATOM 10093 H HB3  . SER A 1 101 ? -27.553 -18.726 -12.103 1.00 0.00 ? 101 SER A HB3  7  
ATOM 10094 H HG   . SER A 1 101 ? -29.494 -18.388 -14.063 1.00 0.00 ? 101 SER A HG   7  
ATOM 10095 N N    . GLY A 1 102 ? -29.967 -22.043 -13.265 1.00 0.00 ? 102 GLY A N    7  
ATOM 10096 C CA   . GLY A 1 102 ? -31.222 -22.675 -13.630 1.00 0.00 ? 102 GLY A CA   7  
ATOM 10097 C C    . GLY A 1 102 ? -31.446 -23.983 -12.898 1.00 0.00 ? 102 GLY A C    7  
ATOM 10098 O O    . GLY A 1 102 ? -30.691 -24.332 -11.991 1.00 0.00 ? 102 GLY A O    7  
ATOM 10099 H H    . GLY A 1 102 ? -29.379 -22.470 -12.608 1.00 0.00 ? 102 GLY A H    7  
ATOM 10100 H HA2  . GLY A 1 102 ? -32.033 -22.001 -13.398 1.00 0.00 ? 102 GLY A HA2  7  
ATOM 10101 H HA3  . GLY A 1 102 ? -31.219 -22.867 -14.693 1.00 0.00 ? 102 GLY A HA3  7  
ATOM 10102 N N    . GLY A 1 1   ? 9.907   -12.885 20.339  1.00 0.00 ? 1   GLY A N    8  
ATOM 10103 C CA   . GLY A 1 1   ? 11.190  -12.542 19.754  1.00 0.00 ? 1   GLY A CA   8  
ATOM 10104 C C    . GLY A 1 1   ? 11.594  -13.492 18.645  1.00 0.00 ? 1   GLY A C    8  
ATOM 10105 O O    . GLY A 1 1   ? 11.227  -14.667 18.660  1.00 0.00 ? 1   GLY A O    8  
ATOM 10106 H H1   . GLY A 1 1   ? 9.079   -12.651 19.871  1.00 0.00 ? 1   GLY A H1   8  
ATOM 10107 H HA2  . GLY A 1 1   ? 11.134  -11.540 19.354  1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10108 H HA3  . GLY A 1 1   ? 11.944  -12.568 20.527  1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10109 N N    . SER A 1 2   ? 12.351  -12.983 17.678  1.00 0.00 ? 2   SER A N    8  
ATOM 10110 C CA   . SER A 1 2   ? 12.801  -13.793 16.552  1.00 0.00 ? 2   SER A CA   8  
ATOM 10111 C C    . SER A 1 2   ? 14.289  -13.583 16.291  1.00 0.00 ? 2   SER A C    8  
ATOM 10112 O O    . SER A 1 2   ? 14.869  -12.582 16.713  1.00 0.00 ? 2   SER A O    8  
ATOM 10113 C CB   . SER A 1 2   ? 11.998  -13.449 15.296  1.00 0.00 ? 2   SER A CB   8  
ATOM 10114 O OG   . SER A 1 2   ? 12.271  -12.128 14.862  1.00 0.00 ? 2   SER A OG   8  
ATOM 10115 H H    . SER A 1 2   ? 12.611  -12.039 17.722  1.00 0.00 ? 2   SER A H    8  
ATOM 10116 H HA   . SER A 1 2   ? 12.634  -14.830 16.803  1.00 0.00 ? 2   SER A HA   8  
ATOM 10117 H HB2  . SER A 1 2   ? 12.259  -14.136 14.505  1.00 0.00 ? 2   SER A HB2  8  
ATOM 10118 H HB3  . SER A 1 2   ? 10.943  -13.534 15.512  1.00 0.00 ? 2   SER A HB3  8  
ATOM 10119 H HG   . SER A 1 2   ? 12.542  -11.594 15.612  1.00 0.00 ? 2   SER A HG   8  
ATOM 10120 N N    . SER A 1 3   ? 14.901  -14.534 15.593  1.00 0.00 ? 3   SER A N    8  
ATOM 10121 C CA   . SER A 1 3   ? 16.323  -14.456 15.279  1.00 0.00 ? 3   SER A CA   8  
ATOM 10122 C C    . SER A 1 3   ? 16.580  -14.845 13.826  1.00 0.00 ? 3   SER A C    8  
ATOM 10123 O O    . SER A 1 3   ? 15.776  -15.538 13.205  1.00 0.00 ? 3   SER A O    8  
ATOM 10124 C CB   . SER A 1 3   ? 17.124  -15.366 16.212  1.00 0.00 ? 3   SER A CB   8  
ATOM 10125 O OG   . SER A 1 3   ? 16.586  -16.677 16.231  1.00 0.00 ? 3   SER A OG   8  
ATOM 10126 H H    . SER A 1 3   ? 14.385  -15.307 15.284  1.00 0.00 ? 3   SER A H    8  
ATOM 10127 H HA   . SER A 1 3   ? 16.640  -13.434 15.427  1.00 0.00 ? 3   SER A HA   8  
ATOM 10128 H HB2  . SER A 1 3   ? 18.147  -15.415 15.872  1.00 0.00 ? 3   SER A HB2  8  
ATOM 10129 H HB3  . SER A 1 3   ? 17.096  -14.963 17.214  1.00 0.00 ? 3   SER A HB3  8  
ATOM 10130 H HG   . SER A 1 3   ? 16.829  -17.111 17.052  1.00 0.00 ? 3   SER A HG   8  
ATOM 10131 N N    . GLY A 1 4   ? 17.710  -14.392 13.289  1.00 0.00 ? 4   GLY A N    8  
ATOM 10132 C CA   . GLY A 1 4   ? 18.054  -14.702 11.914  1.00 0.00 ? 4   GLY A CA   8  
ATOM 10133 C C    . GLY A 1 4   ? 17.640  -13.606 10.952  1.00 0.00 ? 4   GLY A C    8  
ATOM 10134 O O    . GLY A 1 4   ? 17.578  -12.434 11.324  1.00 0.00 ? 4   GLY A O    8  
ATOM 10135 H H    . GLY A 1 4   ? 18.313  -13.843 13.832  1.00 0.00 ? 4   GLY A H    8  
ATOM 10136 H HA2  . GLY A 1 4   ? 19.122  -14.843 11.845  1.00 0.00 ? 4   GLY A HA2  8  
ATOM 10137 H HA3  . GLY A 1 4   ? 17.561  -15.619 11.630  1.00 0.00 ? 4   GLY A HA3  8  
ATOM 10138 N N    . SER A 1 5   ? 17.358  -13.987 9.710   1.00 0.00 ? 5   SER A N    8  
ATOM 10139 C CA   . SER A 1 5   ? 16.953  -13.027 8.690   1.00 0.00 ? 5   SER A CA   8  
ATOM 10140 C C    . SER A 1 5   ? 15.433  -12.907 8.628   1.00 0.00 ? 5   SER A C    8  
ATOM 10141 O O    . SER A 1 5   ? 14.737  -13.868 8.300   1.00 0.00 ? 5   SER A O    8  
ATOM 10142 C CB   . SER A 1 5   ? 17.499  -13.443 7.322   1.00 0.00 ? 5   SER A CB   8  
ATOM 10143 O OG   . SER A 1 5   ? 18.914  -13.509 7.337   1.00 0.00 ? 5   SER A OG   8  
ATOM 10144 H H    . SER A 1 5   ? 17.426  -14.936 9.474   1.00 0.00 ? 5   SER A H    8  
ATOM 10145 H HA   . SER A 1 5   ? 17.367  -12.066 8.956   1.00 0.00 ? 5   SER A HA   8  
ATOM 10146 H HB2  . SER A 1 5   ? 17.108  -14.415 7.063   1.00 0.00 ? 5   SER A HB2  8  
ATOM 10147 H HB3  . SER A 1 5   ? 17.191  -12.721 6.580   1.00 0.00 ? 5   SER A HB3  8  
ATOM 10148 H HG   . SER A 1 5   ? 19.221  -13.987 6.563   1.00 0.00 ? 5   SER A HG   8  
ATOM 10149 N N    . SER A 1 6   ? 14.926  -11.721 8.947   1.00 0.00 ? 6   SER A N    8  
ATOM 10150 C CA   . SER A 1 6   ? 13.489  -11.475 8.933   1.00 0.00 ? 6   SER A CA   8  
ATOM 10151 C C    . SER A 1 6   ? 12.974  -11.349 7.502   1.00 0.00 ? 6   SER A C    8  
ATOM 10152 O O    . SER A 1 6   ? 13.730  -11.039 6.583   1.00 0.00 ? 6   SER A O    8  
ATOM 10153 C CB   . SER A 1 6   ? 13.159  -10.205 9.720   1.00 0.00 ? 6   SER A CB   8  
ATOM 10154 O OG   . SER A 1 6   ? 13.148  -10.458 11.114  1.00 0.00 ? 6   SER A OG   8  
ATOM 10155 H H    . SER A 1 6   ? 15.533  -10.994 9.201   1.00 0.00 ? 6   SER A H    8  
ATOM 10156 H HA   . SER A 1 6   ? 13.004  -12.317 9.405   1.00 0.00 ? 6   SER A HA   8  
ATOM 10157 H HB2  . SER A 1 6   ? 13.901  -9.451  9.509   1.00 0.00 ? 6   SER A HB2  8  
ATOM 10158 H HB3  . SER A 1 6   ? 12.184  -9.845  9.424   1.00 0.00 ? 6   SER A HB3  8  
ATOM 10159 H HG   . SER A 1 6   ? 13.482  -9.689  11.582  1.00 0.00 ? 6   SER A HG   8  
ATOM 10160 N N    . GLY A 1 7   ? 11.679  -11.591 7.323   1.00 0.00 ? 7   GLY A N    8  
ATOM 10161 C CA   . GLY A 1 7   ? 11.083  -11.500 6.002   1.00 0.00 ? 7   GLY A CA   8  
ATOM 10162 C C    . GLY A 1 7   ? 9.604   -11.831 6.009   1.00 0.00 ? 7   GLY A C    8  
ATOM 10163 O O    . GLY A 1 7   ? 8.939   -11.780 7.045   1.00 0.00 ? 7   GLY A O    8  
ATOM 10164 H H    . GLY A 1 7   ? 11.123  -11.834 8.093   1.00 0.00 ? 7   GLY A H    8  
ATOM 10165 H HA2  . GLY A 1 7   ? 11.215  -10.495 5.629   1.00 0.00 ? 7   GLY A HA2  8  
ATOM 10166 H HA3  . GLY A 1 7   ? 11.591  -12.188 5.343   1.00 0.00 ? 7   GLY A HA3  8  
ATOM 10167 N N    . PRO A 1 8   ? 9.066   -12.177 4.831   1.00 0.00 ? 8   PRO A N    8  
ATOM 10168 C CA   . PRO A 1 8   ? 7.649   -12.524 4.678   1.00 0.00 ? 8   PRO A CA   8  
ATOM 10169 C C    . PRO A 1 8   ? 7.303   -13.854 5.339   1.00 0.00 ? 8   PRO A C    8  
ATOM 10170 O O    . PRO A 1 8   ? 7.621   -14.920 4.812   1.00 0.00 ? 8   PRO A O    8  
ATOM 10171 C CB   . PRO A 1 8   ? 7.468   -12.617 3.161   1.00 0.00 ? 8   PRO A CB   8  
ATOM 10172 C CG   . PRO A 1 8   ? 8.824   -12.942 2.637   1.00 0.00 ? 8   PRO A CG   8  
ATOM 10173 C CD   . PRO A 1 8   ? 9.798   -12.259 3.556   1.00 0.00 ? 8   PRO A CD   8  
ATOM 10174 H HA   . PRO A 1 8   ? 7.007   -11.750 5.073   1.00 0.00 ? 8   PRO A HA   8  
ATOM 10175 H HB2  . PRO A 1 8   ? 6.756   -13.396 2.929   1.00 0.00 ? 8   PRO A HB2  8  
ATOM 10176 H HB3  . PRO A 1 8   ? 7.113   -11.671 2.779   1.00 0.00 ? 8   PRO A HB3  8  
ATOM 10177 H HG2  . PRO A 1 8   ? 8.977   -14.010 2.654   1.00 0.00 ? 8   PRO A HG2  8  
ATOM 10178 H HG3  . PRO A 1 8   ? 8.929   -12.563 1.631   1.00 0.00 ? 8   PRO A HG3  8  
ATOM 10179 H HD2  . PRO A 1 8   ? 10.695  -12.851 3.663   1.00 0.00 ? 8   PRO A HD2  8  
ATOM 10180 H HD3  . PRO A 1 8   ? 10.038  -11.272 3.186   1.00 0.00 ? 8   PRO A HD3  8  
ATOM 10181 N N    . ASN A 1 9   ? 6.651   -13.784 6.494   1.00 0.00 ? 9   ASN A N    8  
ATOM 10182 C CA   . ASN A 1 9   ? 6.262   -14.984 7.227   1.00 0.00 ? 9   ASN A CA   8  
ATOM 10183 C C    . ASN A 1 9   ? 5.425   -15.909 6.349   1.00 0.00 ? 9   ASN A C    8  
ATOM 10184 O O    . ASN A 1 9   ? 4.953   -15.512 5.284   1.00 0.00 ? 9   ASN A O    8  
ATOM 10185 C CB   . ASN A 1 9   ? 5.476   -14.607 8.484   1.00 0.00 ? 9   ASN A CB   8  
ATOM 10186 C CG   . ASN A 1 9   ? 6.374   -14.102 9.597   1.00 0.00 ? 9   ASN A CG   8  
ATOM 10187 O OD1  . ASN A 1 9   ? 7.351   -13.396 9.350   1.00 0.00 ? 9   ASN A OD1  8  
ATOM 10188 N ND2  . ASN A 1 9   ? 6.045   -14.464 10.832  1.00 0.00 ? 9   ASN A ND2  8  
ATOM 10189 H H    . ASN A 1 9   ? 6.426   -12.905 6.864   1.00 0.00 ? 9   ASN A H    8  
ATOM 10190 H HA   . ASN A 1 9   ? 7.164   -15.501 7.518   1.00 0.00 ? 9   ASN A HA   8  
ATOM 10191 H HB2  . ASN A 1 9   ? 4.768   -13.829 8.239   1.00 0.00 ? 9   ASN A HB2  8  
ATOM 10192 H HB3  . ASN A 1 9   ? 4.942   -15.474 8.842   1.00 0.00 ? 9   ASN A HB3  8  
ATOM 10193 H HD21 . ASN A 1 9   ? 5.253   -15.028 10.954  1.00 0.00 ? 9   ASN A HD21 8  
ATOM 10194 H HD22 . ASN A 1 9   ? 6.608   -14.151 11.571  1.00 0.00 ? 9   ASN A HD22 8  
ATOM 10195 N N    . ALA A 1 10  ? 5.246   -17.145 6.804   1.00 0.00 ? 10  ALA A N    8  
ATOM 10196 C CA   . ALA A 1 10  ? 4.464   -18.126 6.062   1.00 0.00 ? 10  ALA A CA   8  
ATOM 10197 C C    . ALA A 1 10  ? 2.969   -17.875 6.227   1.00 0.00 ? 10  ALA A C    8  
ATOM 10198 O O    . ALA A 1 10  ? 2.207   -17.951 5.263   1.00 0.00 ? 10  ALA A O    8  
ATOM 10199 C CB   . ALA A 1 10  ? 4.818   -19.535 6.516   1.00 0.00 ? 10  ALA A CB   8  
ATOM 10200 H H    . ALA A 1 10  ? 5.647   -17.402 7.660   1.00 0.00 ? 10  ALA A H    8  
ATOM 10201 H HA   . ALA A 1 10  ? 4.721   -18.036 5.016   1.00 0.00 ? 10  ALA A HA   8  
ATOM 10202 H HB1  . ALA A 1 10  ? 4.711   -19.604 7.589   1.00 0.00 ? 10  ALA A HB1  8  
ATOM 10203 H HB2  . ALA A 1 10  ? 4.155   -20.243 6.041   1.00 0.00 ? 10  ALA A HB2  8  
ATOM 10204 H HB3  . ALA A 1 10  ? 5.838   -19.756 6.241   1.00 0.00 ? 10  ALA A HB3  8  
ATOM 10205 N N    . ARG A 1 11  ? 2.555   -17.577 7.454   1.00 0.00 ? 11  ARG A N    8  
ATOM 10206 C CA   . ARG A 1 11  ? 1.151   -17.317 7.745   1.00 0.00 ? 11  ARG A CA   8  
ATOM 10207 C C    . ARG A 1 11  ? 0.665   -16.071 7.011   1.00 0.00 ? 11  ARG A C    8  
ATOM 10208 O O    . ARG A 1 11  ? -0.458  -16.033 6.508   1.00 0.00 ? 11  ARG A O    8  
ATOM 10209 C CB   . ARG A 1 11  ? 0.943   -17.148 9.252   1.00 0.00 ? 11  ARG A CB   8  
ATOM 10210 C CG   . ARG A 1 11  ? -0.501  -17.330 9.691   1.00 0.00 ? 11  ARG A CG   8  
ATOM 10211 C CD   . ARG A 1 11  ? -0.589  -17.774 11.143  1.00 0.00 ? 11  ARG A CD   8  
ATOM 10212 N NE   . ARG A 1 11  ? -0.568  -19.228 11.273  1.00 0.00 ? 11  ARG A NE   8  
ATOM 10213 C CZ   . ARG A 1 11  ? -1.603  -20.008 10.982  1.00 0.00 ? 11  ARG A CZ   8  
ATOM 10214 N NH1  . ARG A 1 11  ? -2.736  -19.475 10.546  1.00 0.00 ? 11  ARG A NH1  8  
ATOM 10215 N NH2  . ARG A 1 11  ? -1.507  -21.323 11.127  1.00 0.00 ? 11  ARG A NH2  8  
ATOM 10216 H H    . ARG A 1 11  ? 3.211   -17.531 8.182   1.00 0.00 ? 11  ARG A H    8  
ATOM 10217 H HA   . ARG A 1 11  ? 0.578   -18.167 7.405   1.00 0.00 ? 11  ARG A HA   8  
ATOM 10218 H HB2  . ARG A 1 11  ? 1.549   -17.876 9.771   1.00 0.00 ? 11  ARG A HB2  8  
ATOM 10219 H HB3  . ARG A 1 11  ? 1.261   -16.157 9.537   1.00 0.00 ? 11  ARG A HB3  8  
ATOM 10220 H HG2  . ARG A 1 11  ? -1.023  -16.391 9.581   1.00 0.00 ? 11  ARG A HG2  8  
ATOM 10221 H HG3  . ARG A 1 11  ? -0.966  -18.078 9.066   1.00 0.00 ? 11  ARG A HG3  8  
ATOM 10222 H HD2  . ARG A 1 11  ? 0.250   -17.362 11.683  1.00 0.00 ? 11  ARG A HD2  8  
ATOM 10223 H HD3  . ARG A 1 11  ? -1.509  -17.397 11.565  1.00 0.00 ? 11  ARG A HD3  8  
ATOM 10224 H HE   . ARG A 1 11  ? 0.260   -19.643 11.594  1.00 0.00 ? 11  ARG A HE   8  
ATOM 10225 H HH11 . ARG A 1 11  ? -2.812  -18.484 10.435  1.00 0.00 ? 11  ARG A HH11 8  
ATOM 10226 H HH12 . ARG A 1 11  ? -3.514  -20.064 10.326  1.00 0.00 ? 11  ARG A HH12 8  
ATOM 10227 H HH21 . ARG A 1 11  ? -0.654  -21.729 11.455  1.00 0.00 ? 11  ARG A HH21 8  
ATOM 10228 H HH22 . ARG A 1 11  ? -2.287  -21.908 10.908  1.00 0.00 ? 11  ARG A HH22 8  
ATOM 10229 N N    . SER A 1 12  ? 1.519   -15.054 6.954   1.00 0.00 ? 12  SER A N    8  
ATOM 10230 C CA   . SER A 1 12  ? 1.175   -13.804 6.285   1.00 0.00 ? 12  SER A CA   8  
ATOM 10231 C C    . SER A 1 12  ? 1.973   -13.642 4.994   1.00 0.00 ? 12  SER A C    8  
ATOM 10232 O O    . SER A 1 12  ? 3.078   -13.100 5.000   1.00 0.00 ? 12  SER A O    8  
ATOM 10233 C CB   . SER A 1 12  ? 1.436   -12.616 7.212   1.00 0.00 ? 12  SER A CB   8  
ATOM 10234 O OG   . SER A 1 12  ? 0.590   -12.660 8.348   1.00 0.00 ? 12  SER A OG   8  
ATOM 10235 H H    . SER A 1 12  ? 2.400   -15.145 7.374   1.00 0.00 ? 12  SER A H    8  
ATOM 10236 H HA   . SER A 1 12  ? 0.123   -13.836 6.042   1.00 0.00 ? 12  SER A HA   8  
ATOM 10237 H HB2  . SER A 1 12  ? 2.464   -12.640 7.543   1.00 0.00 ? 12  SER A HB2  8  
ATOM 10238 H HB3  . SER A 1 12  ? 1.252   -11.697 6.675   1.00 0.00 ? 12  SER A HB3  8  
ATOM 10239 H HG   . SER A 1 12  ? -0.053  -11.949 8.296   1.00 0.00 ? 12  SER A HG   8  
ATOM 10240 N N    . GLN A 1 13  ? 1.404   -14.115 3.891   1.00 0.00 ? 13  GLN A N    8  
ATOM 10241 C CA   . GLN A 1 13  ? 2.062   -14.024 2.593   1.00 0.00 ? 13  GLN A CA   8  
ATOM 10242 C C    . GLN A 1 13  ? 2.061   -12.586 2.082   1.00 0.00 ? 13  GLN A C    8  
ATOM 10243 O O    . GLN A 1 13  ? 1.084   -11.851 2.228   1.00 0.00 ? 13  GLN A O    8  
ATOM 10244 C CB   . GLN A 1 13  ? 1.369   -14.937 1.580   1.00 0.00 ? 13  GLN A CB   8  
ATOM 10245 C CG   . GLN A 1 13  ? 2.306   -15.490 0.518   1.00 0.00 ? 13  GLN A CG   8  
ATOM 10246 C CD   . GLN A 1 13  ? 1.760   -16.735 -0.151  1.00 0.00 ? 13  GLN A CD   8  
ATOM 10247 O OE1  . GLN A 1 13  ? 0.681   -16.712 -0.745  1.00 0.00 ? 13  GLN A OE1  8  
ATOM 10248 N NE2  . GLN A 1 13  ? 2.503   -17.832 -0.058  1.00 0.00 ? 13  GLN A NE2  8  
ATOM 10249 H H    . GLN A 1 13  ? 0.522   -14.536 3.951   1.00 0.00 ? 13  GLN A H    8  
ATOM 10250 H HA   . GLN A 1 13  ? 3.084   -14.348 2.716   1.00 0.00 ? 13  GLN A HA   8  
ATOM 10251 H HB2  . GLN A 1 13  ? 0.926   -15.769 2.108   1.00 0.00 ? 13  GLN A HB2  8  
ATOM 10252 H HB3  . GLN A 1 13  ? 0.588   -14.379 1.085   1.00 0.00 ? 13  GLN A HB3  8  
ATOM 10253 H HG2  . GLN A 1 13  ? 2.461   -14.733 -0.236  1.00 0.00 ? 13  GLN A HG2  8  
ATOM 10254 H HG3  . GLN A 1 13  ? 3.251   -15.733 0.982   1.00 0.00 ? 13  GLN A HG3  8  
ATOM 10255 H HE21 . GLN A 1 13  ? 3.350   -17.776 0.432   1.00 0.00 ? 13  GLN A HE21 8  
ATOM 10256 H HE22 . GLN A 1 13  ? 2.173   -18.651 -0.481  1.00 0.00 ? 13  GLN A HE22 8  
ATOM 10257 N N    . PRO A 1 14  ? 3.181   -12.175 1.469   1.00 0.00 ? 14  PRO A N    8  
ATOM 10258 C CA   . PRO A 1 14  ? 3.334   -10.822 0.925   1.00 0.00 ? 14  PRO A CA   8  
ATOM 10259 C C    . PRO A 1 14  ? 2.459   -10.589 -0.302  1.00 0.00 ? 14  PRO A C    8  
ATOM 10260 O O    . PRO A 1 14  ? 1.778   -11.500 -0.773  1.00 0.00 ? 14  PRO A O    8  
ATOM 10261 C CB   . PRO A 1 14  ? 4.815   -10.758 0.546   1.00 0.00 ? 14  PRO A CB   8  
ATOM 10262 C CG   . PRO A 1 14  ? 5.208   -12.176 0.309   1.00 0.00 ? 14  PRO A CG   8  
ATOM 10263 C CD   . PRO A 1 14  ? 4.383   -12.998 1.260   1.00 0.00 ? 14  PRO A CD   8  
ATOM 10264 H HA   . PRO A 1 14  ? 3.117   -10.069 1.668   1.00 0.00 ? 14  PRO A HA   8  
ATOM 10265 H HB2  . PRO A 1 14  ? 4.936   -10.160 -0.346  1.00 0.00 ? 14  PRO A HB2  8  
ATOM 10266 H HB3  . PRO A 1 14  ? 5.380   -10.323 1.357   1.00 0.00 ? 14  PRO A HB3  8  
ATOM 10267 H HG2  . PRO A 1 14  ? 4.989   -12.451 -0.712  1.00 0.00 ? 14  PRO A HG2  8  
ATOM 10268 H HG3  . PRO A 1 14  ? 6.259   -12.305 0.516   1.00 0.00 ? 14  PRO A HG3  8  
ATOM 10269 H HD2  . PRO A 1 14  ? 4.128   -13.948 0.815   1.00 0.00 ? 14  PRO A HD2  8  
ATOM 10270 H HD3  . PRO A 1 14  ? 4.915   -13.146 2.189   1.00 0.00 ? 14  PRO A HD3  8  
ATOM 10271 N N    . SER A 1 15  ? 2.484   -9.364  -0.817  1.00 0.00 ? 15  SER A N    8  
ATOM 10272 C CA   . SER A 1 15  ? 1.691   -9.010  -1.988  1.00 0.00 ? 15  SER A CA   8  
ATOM 10273 C C    . SER A 1 15  ? 2.484   -8.111  -2.930  1.00 0.00 ? 15  SER A C    8  
ATOM 10274 O O    . SER A 1 15  ? 3.448   -7.462  -2.524  1.00 0.00 ? 15  SER A O    8  
ATOM 10275 C CB   . SER A 1 15  ? 0.399   -8.310  -1.563  1.00 0.00 ? 15  SER A CB   8  
ATOM 10276 O OG   . SER A 1 15  ? -0.635  -9.248  -1.322  1.00 0.00 ? 15  SER A OG   8  
ATOM 10277 H H    . SER A 1 15  ? 3.047   -8.681  -0.396  1.00 0.00 ? 15  SER A H    8  
ATOM 10278 H HA   . SER A 1 15  ? 1.441   -9.924  -2.507  1.00 0.00 ? 15  SER A HA   8  
ATOM 10279 H HB2  . SER A 1 15  ? 0.578   -7.749  -0.658  1.00 0.00 ? 15  SER A HB2  8  
ATOM 10280 H HB3  . SER A 1 15  ? 0.083   -7.637  -2.347  1.00 0.00 ? 15  SER A HB3  8  
ATOM 10281 H HG   . SER A 1 15  ? -0.432  -10.071 -1.774  1.00 0.00 ? 15  SER A HG   8  
ATOM 10282 N N    . LYS A 1 16  ? 2.072   -8.077  -4.193  1.00 0.00 ? 16  LYS A N    8  
ATOM 10283 C CA   . LYS A 1 16  ? 2.742   -7.257  -5.195  1.00 0.00 ? 16  LYS A CA   8  
ATOM 10284 C C    . LYS A 1 16  ? 2.287   -5.804  -5.102  1.00 0.00 ? 16  LYS A C    8  
ATOM 10285 O O    . LYS A 1 16  ? 3.084   -4.880  -5.271  1.00 0.00 ? 16  LYS A O    8  
ATOM 10286 C CB   . LYS A 1 16  ? 2.462   -7.800  -6.598  1.00 0.00 ? 16  LYS A CB   8  
ATOM 10287 C CG   . LYS A 1 16  ? 2.970   -9.215  -6.815  1.00 0.00 ? 16  LYS A CG   8  
ATOM 10288 C CD   . LYS A 1 16  ? 3.040   -9.563  -8.292  1.00 0.00 ? 16  LYS A CD   8  
ATOM 10289 C CE   . LYS A 1 16  ? 4.076   -10.643 -8.562  1.00 0.00 ? 16  LYS A CE   8  
ATOM 10290 N NZ   . LYS A 1 16  ? 4.517   -10.646 -9.985  1.00 0.00 ? 16  LYS A NZ   8  
ATOM 10291 H H    . LYS A 1 16  ? 1.297   -8.616  -4.457  1.00 0.00 ? 16  LYS A H    8  
ATOM 10292 H HA   . LYS A 1 16  ? 3.803   -7.302  -5.006  1.00 0.00 ? 16  LYS A HA   8  
ATOM 10293 H HB2  . LYS A 1 16  ? 1.396   -7.793  -6.769  1.00 0.00 ? 16  LYS A HB2  8  
ATOM 10294 H HB3  . LYS A 1 16  ? 2.938   -7.155  -7.323  1.00 0.00 ? 16  LYS A HB3  8  
ATOM 10295 H HG2  . LYS A 1 16  ? 3.958   -9.302  -6.388  1.00 0.00 ? 16  LYS A HG2  8  
ATOM 10296 H HG3  . LYS A 1 16  ? 2.301   -9.907  -6.323  1.00 0.00 ? 16  LYS A HG3  8  
ATOM 10297 H HD2  . LYS A 1 16  ? 2.074   -9.918  -8.616  1.00 0.00 ? 16  LYS A HD2  8  
ATOM 10298 H HD3  . LYS A 1 16  ? 3.305   -8.675  -8.850  1.00 0.00 ? 16  LYS A HD3  8  
ATOM 10299 H HE2  . LYS A 1 16  ? 4.933   -10.468 -7.929  1.00 0.00 ? 16  LYS A HE2  8  
ATOM 10300 H HE3  . LYS A 1 16  ? 3.644   -11.604 -8.326  1.00 0.00 ? 16  LYS A HE3  8  
ATOM 10301 H HZ1  . LYS A 1 16  ? 5.430   -11.136 -10.074 1.00 0.00 ? 16  LYS A HZ1  8  
ATOM 10302 H HZ2  . LYS A 1 16  ? 4.626   -9.670  -10.327 1.00 0.00 ? 16  LYS A HZ2  8  
ATOM 10303 H HZ3  . LYS A 1 16  ? 3.814   -11.134 -10.576 1.00 0.00 ? 16  LYS A HZ3  8  
ATOM 10304 N N    . THR A 1 17  ? 1.000   -5.607  -4.830  1.00 0.00 ? 17  THR A N    8  
ATOM 10305 C CA   . THR A 1 17  ? 0.440   -4.267  -4.713  1.00 0.00 ? 17  THR A CA   8  
ATOM 10306 C C    . THR A 1 17  ? 0.314   -3.849  -3.253  1.00 0.00 ? 17  THR A C    8  
ATOM 10307 O O    . THR A 1 17  ? -0.302  -4.548  -2.447  1.00 0.00 ? 17  THR A O    8  
ATOM 10308 C CB   . THR A 1 17  ? -0.945  -4.177  -5.382  1.00 0.00 ? 17  THR A CB   8  
ATOM 10309 O OG1  . THR A 1 17  ? -0.931  -4.875  -6.633  1.00 0.00 ? 17  THR A OG1  8  
ATOM 10310 C CG2  . THR A 1 17  ? -1.343  -2.726  -5.610  1.00 0.00 ? 17  THR A CG2  8  
ATOM 10311 H H    . THR A 1 17  ? 0.415   -6.383  -4.705  1.00 0.00 ? 17  THR A H    8  
ATOM 10312 H HA   . THR A 1 17  ? 1.105   -3.582  -5.218  1.00 0.00 ? 17  THR A HA   8  
ATOM 10313 H HB   . THR A 1 17  ? -1.674  -4.637  -4.730  1.00 0.00 ? 17  THR A HB   8  
ATOM 10314 H HG1  . THR A 1 17  ? -0.553  -4.309  -7.311  1.00 0.00 ? 17  THR A HG1  8  
ATOM 10315 H HG21 . THR A 1 17  ? -0.834  -2.097  -4.894  1.00 0.00 ? 17  THR A HG21 8  
ATOM 10316 H HG22 . THR A 1 17  ? -2.410  -2.622  -5.487  1.00 0.00 ? 17  THR A HG22 8  
ATOM 10317 H HG23 . THR A 1 17  ? -1.065  -2.430  -6.610  1.00 0.00 ? 17  THR A HG23 8  
ATOM 10318 N N    . LEU A 1 18  ? 0.899   -2.705  -2.917  1.00 0.00 ? 18  LEU A N    8  
ATOM 10319 C CA   . LEU A 1 18  ? 0.851   -2.192  -1.552  1.00 0.00 ? 18  LEU A CA   8  
ATOM 10320 C C    . LEU A 1 18  ? -0.341  -1.260  -1.362  1.00 0.00 ? 18  LEU A C    8  
ATOM 10321 O O    . LEU A 1 18  ? -0.723  -0.529  -2.276  1.00 0.00 ? 18  LEU A O    8  
ATOM 10322 C CB   . LEU A 1 18  ? 2.149   -1.454  -1.218  1.00 0.00 ? 18  LEU A CB   8  
ATOM 10323 C CG   . LEU A 1 18  ? 3.278   -2.310  -0.641  1.00 0.00 ? 18  LEU A CG   8  
ATOM 10324 C CD1  . LEU A 1 18  ? 4.607   -1.576  -0.739  1.00 0.00 ? 18  LEU A CD1  8  
ATOM 10325 C CD2  . LEU A 1 18  ? 2.979   -2.684  0.803   1.00 0.00 ? 18  LEU A CD2  8  
ATOM 10326 H H    . LEU A 1 18  ? 1.375   -2.191  -3.603  1.00 0.00 ? 18  LEU A H    8  
ATOM 10327 H HA   . LEU A 1 18  ? 0.744   -3.035  -0.885  1.00 0.00 ? 18  LEU A HA   8  
ATOM 10328 H HB2  . LEU A 1 18  ? 2.512   -0.996  -2.125  1.00 0.00 ? 18  LEU A HB2  8  
ATOM 10329 H HB3  . LEU A 1 18  ? 1.914   -0.684  -0.496  1.00 0.00 ? 18  LEU A HB3  8  
ATOM 10330 H HG   . LEU A 1 18  ? 3.358   -3.223  -1.215  1.00 0.00 ? 18  LEU A HG   8  
ATOM 10331 H HD11 . LEU A 1 18  ? 5.331   -2.208  -1.231  1.00 0.00 ? 18  LEU A HD11 8  
ATOM 10332 H HD12 . LEU A 1 18  ? 4.956   -1.331  0.253   1.00 0.00 ? 18  LEU A HD12 8  
ATOM 10333 H HD13 . LEU A 1 18  ? 4.475   -0.668  -1.309  1.00 0.00 ? 18  LEU A HD13 8  
ATOM 10334 H HD21 . LEU A 1 18  ? 1.926   -2.899  0.908   1.00 0.00 ? 18  LEU A HD21 8  
ATOM 10335 H HD22 . LEU A 1 18  ? 3.244   -1.861  1.451   1.00 0.00 ? 18  LEU A HD22 8  
ATOM 10336 H HD23 . LEU A 1 18  ? 3.553   -3.557  1.075   1.00 0.00 ? 18  LEU A HD23 8  
ATOM 10337 N N    . PHE A 1 19  ? -0.923  -1.289  -0.168  1.00 0.00 ? 19  PHE A N    8  
ATOM 10338 C CA   . PHE A 1 19  ? -2.072  -0.446  0.143   1.00 0.00 ? 19  PHE A CA   8  
ATOM 10339 C C    . PHE A 1 19  ? -1.636  0.813   0.888   1.00 0.00 ? 19  PHE A C    8  
ATOM 10340 O O    . PHE A 1 19  ? -1.110  0.741   1.998   1.00 0.00 ? 19  PHE A O    8  
ATOM 10341 C CB   . PHE A 1 19  ? -3.089  -1.222  0.983   1.00 0.00 ? 19  PHE A CB   8  
ATOM 10342 C CG   . PHE A 1 19  ? -4.360  -0.463  1.237   1.00 0.00 ? 19  PHE A CG   8  
ATOM 10343 C CD1  . PHE A 1 19  ? -4.985  0.230   0.213   1.00 0.00 ? 19  PHE A CD1  8  
ATOM 10344 C CD2  . PHE A 1 19  ? -4.929  -0.442  2.500   1.00 0.00 ? 19  PHE A CD2  8  
ATOM 10345 C CE1  . PHE A 1 19  ? -6.154  0.930   0.445   1.00 0.00 ? 19  PHE A CE1  8  
ATOM 10346 C CE2  . PHE A 1 19  ? -6.098  0.255   2.738   1.00 0.00 ? 19  PHE A CE2  8  
ATOM 10347 C CZ   . PHE A 1 19  ? -6.712  0.942   1.708   1.00 0.00 ? 19  PHE A CZ   8  
ATOM 10348 H H    . PHE A 1 19  ? -0.573  -1.893  0.520   1.00 0.00 ? 19  PHE A H    8  
ATOM 10349 H HA   . PHE A 1 19  ? -2.532  -0.157  -0.789  1.00 0.00 ? 19  PHE A HA   8  
ATOM 10350 H HB2  . PHE A 1 19  ? -3.346  -2.136  0.469   1.00 0.00 ? 19  PHE A HB2  8  
ATOM 10351 H HB3  . PHE A 1 19  ? -2.647  -1.462  1.938   1.00 0.00 ? 19  PHE A HB3  8  
ATOM 10352 H HD1  . PHE A 1 19  ? -4.550  0.222   -0.776  1.00 0.00 ? 19  PHE A HD1  8  
ATOM 10353 H HD2  . PHE A 1 19  ? -4.450  -0.980  3.306   1.00 0.00 ? 19  PHE A HD2  8  
ATOM 10354 H HE1  . PHE A 1 19  ? -6.632  1.466   -0.362  1.00 0.00 ? 19  PHE A HE1  8  
ATOM 10355 H HE2  . PHE A 1 19  ? -6.532  0.262   3.727   1.00 0.00 ? 19  PHE A HE2  8  
ATOM 10356 H HZ   . PHE A 1 19  ? -7.625  1.488   1.892   1.00 0.00 ? 19  PHE A HZ   8  
ATOM 10357 N N    . VAL A 1 20  ? -1.858  1.967   0.266   1.00 0.00 ? 20  VAL A N    8  
ATOM 10358 C CA   . VAL A 1 20  ? -1.489  3.243   0.868   1.00 0.00 ? 20  VAL A CA   8  
ATOM 10359 C C    . VAL A 1 20  ? -2.723  4.010   1.330   1.00 0.00 ? 20  VAL A C    8  
ATOM 10360 O O    . VAL A 1 20  ? -3.579  4.374   0.524   1.00 0.00 ? 20  VAL A O    8  
ATOM 10361 C CB   . VAL A 1 20  ? -0.693  4.119   -0.116  1.00 0.00 ? 20  VAL A CB   8  
ATOM 10362 C CG1  . VAL A 1 20  ? -0.171  5.367   0.580   1.00 0.00 ? 20  VAL A CG1  8  
ATOM 10363 C CG2  . VAL A 1 20  ? 0.450   3.325   -0.732  1.00 0.00 ? 20  VAL A CG2  8  
ATOM 10364 H H    . VAL A 1 20  ? -2.280  1.961   -0.618  1.00 0.00 ? 20  VAL A H    8  
ATOM 10365 H HA   . VAL A 1 20  ? -0.862  3.039   1.724   1.00 0.00 ? 20  VAL A HA   8  
ATOM 10366 H HB   . VAL A 1 20  ? -1.357  4.428   -0.910  1.00 0.00 ? 20  VAL A HB   8  
ATOM 10367 H HG11 . VAL A 1 20  ? 0.508   5.889   -0.078  1.00 0.00 ? 20  VAL A HG11 8  
ATOM 10368 H HG12 . VAL A 1 20  ? -1.000  6.013   0.830   1.00 0.00 ? 20  VAL A HG12 8  
ATOM 10369 H HG13 . VAL A 1 20  ? 0.350   5.083   1.483   1.00 0.00 ? 20  VAL A HG13 8  
ATOM 10370 H HG21 . VAL A 1 20  ? 0.048   2.499   -1.300  1.00 0.00 ? 20  VAL A HG21 8  
ATOM 10371 H HG22 . VAL A 1 20  ? 1.023   3.966   -1.386  1.00 0.00 ? 20  VAL A HG22 8  
ATOM 10372 H HG23 . VAL A 1 20  ? 1.089   2.947   0.052   1.00 0.00 ? 20  VAL A HG23 8  
ATOM 10373 N N    . LYS A 1 21  ? -2.809  4.252   2.634   1.00 0.00 ? 21  LYS A N    8  
ATOM 10374 C CA   . LYS A 1 21  ? -3.937  4.978   3.206   1.00 0.00 ? 21  LYS A CA   8  
ATOM 10375 C C    . LYS A 1 21  ? -3.462  6.214   3.962   1.00 0.00 ? 21  LYS A C    8  
ATOM 10376 O O    . LYS A 1 21  ? -2.378  6.219   4.544   1.00 0.00 ? 21  LYS A O    8  
ATOM 10377 C CB   . LYS A 1 21  ? -4.733  4.067   4.143   1.00 0.00 ? 21  LYS A CB   8  
ATOM 10378 C CG   . LYS A 1 21  ? -3.880  3.388   5.201   1.00 0.00 ? 21  LYS A CG   8  
ATOM 10379 C CD   . LYS A 1 21  ? -4.454  2.039   5.599   1.00 0.00 ? 21  LYS A CD   8  
ATOM 10380 C CE   . LYS A 1 21  ? -5.418  2.167   6.769   1.00 0.00 ? 21  LYS A CE   8  
ATOM 10381 N NZ   . LYS A 1 21  ? -4.753  2.726   7.978   1.00 0.00 ? 21  LYS A NZ   8  
ATOM 10382 H H    . LYS A 1 21  ? -2.094  3.936   3.227   1.00 0.00 ? 21  LYS A H    8  
ATOM 10383 H HA   . LYS A 1 21  ? -4.576  5.291   2.393   1.00 0.00 ? 21  LYS A HA   8  
ATOM 10384 H HB2  . LYS A 1 21  ? -5.488  4.656   4.643   1.00 0.00 ? 21  LYS A HB2  8  
ATOM 10385 H HB3  . LYS A 1 21  ? -5.217  3.300   3.555   1.00 0.00 ? 21  LYS A HB3  8  
ATOM 10386 H HG2  . LYS A 1 21  ? -2.885  3.242   4.809   1.00 0.00 ? 21  LYS A HG2  8  
ATOM 10387 H HG3  . LYS A 1 21  ? -3.835  4.022   6.075   1.00 0.00 ? 21  LYS A HG3  8  
ATOM 10388 H HD2  . LYS A 1 21  ? -4.983  1.619   4.756   1.00 0.00 ? 21  LYS A HD2  8  
ATOM 10389 H HD3  . LYS A 1 21  ? -3.644  1.382   5.882   1.00 0.00 ? 21  LYS A HD3  8  
ATOM 10390 H HE2  . LYS A 1 21  ? -6.229  2.819   6.481   1.00 0.00 ? 21  LYS A HE2  8  
ATOM 10391 H HE3  . LYS A 1 21  ? -5.810  1.188   7.004   1.00 0.00 ? 21  LYS A HE3  8  
ATOM 10392 H HZ1  . LYS A 1 21  ? -5.381  2.641   8.802   1.00 0.00 ? 21  LYS A HZ1  8  
ATOM 10393 H HZ2  . LYS A 1 21  ? -4.528  3.730   7.829   1.00 0.00 ? 21  LYS A HZ2  8  
ATOM 10394 H HZ3  . LYS A 1 21  ? -3.871  2.209   8.172   1.00 0.00 ? 21  LYS A HZ3  8  
ATOM 10395 N N    . GLY A 1 22  ? -4.282  7.261   3.951   1.00 0.00 ? 22  GLY A N    8  
ATOM 10396 C CA   . GLY A 1 22  ? -3.928  8.487   4.641   1.00 0.00 ? 22  GLY A CA   8  
ATOM 10397 C C    . GLY A 1 22  ? -3.261  9.495   3.726   1.00 0.00 ? 22  GLY A C    8  
ATOM 10398 O O    . GLY A 1 22  ? -2.235  10.079  4.077   1.00 0.00 ? 22  GLY A O    8  
ATOM 10399 H H    . GLY A 1 22  ? -5.134  7.199   3.470   1.00 0.00 ? 22  GLY A H    8  
ATOM 10400 H HA2  . GLY A 1 22  ? -4.824  8.927   5.053   1.00 0.00 ? 22  GLY A HA2  8  
ATOM 10401 H HA3  . GLY A 1 22  ? -3.252  8.250   5.449   1.00 0.00 ? 22  GLY A HA3  8  
ATOM 10402 N N    . LEU A 1 23  ? -3.844  9.700   2.550   1.00 0.00 ? 23  LEU A N    8  
ATOM 10403 C CA   . LEU A 1 23  ? -3.299  10.644  1.580   1.00 0.00 ? 23  LEU A CA   8  
ATOM 10404 C C    . LEU A 1 23  ? -4.175  11.888  1.479   1.00 0.00 ? 23  LEU A C    8  
ATOM 10405 O O    . LEU A 1 23  ? -5.356  11.857  1.825   1.00 0.00 ? 23  LEU A O    8  
ATOM 10406 C CB   . LEU A 1 23  ? -3.174  9.981   0.208   1.00 0.00 ? 23  LEU A CB   8  
ATOM 10407 C CG   . LEU A 1 23  ? -2.192  8.813   0.113   1.00 0.00 ? 23  LEU A CG   8  
ATOM 10408 C CD1  . LEU A 1 23  ? -2.209  8.213   -1.284  1.00 0.00 ? 23  LEU A CD1  8  
ATOM 10409 C CD2  . LEU A 1 23  ? -0.787  9.266   0.484   1.00 0.00 ? 23  LEU A CD2  8  
ATOM 10410 H H    . LEU A 1 23  ? -4.659  9.206   2.327   1.00 0.00 ? 23  LEU A H    8  
ATOM 10411 H HA   . LEU A 1 23  ? -2.316  10.937  1.920   1.00 0.00 ? 23  LEU A HA   8  
ATOM 10412 H HB2  . LEU A 1 23  ? -4.150  9.615   -0.072  1.00 0.00 ? 23  LEU A HB2  8  
ATOM 10413 H HB3  . LEU A 1 23  ? -2.860  10.737  -0.497  1.00 0.00 ? 23  LEU A HB3  8  
ATOM 10414 H HG   . LEU A 1 23  ? -2.491  8.042   0.810   1.00 0.00 ? 23  LEU A HG   8  
ATOM 10415 H HD11 . LEU A 1 23  ? -1.244  7.783   -1.503  1.00 0.00 ? 23  LEU A HD11 8  
ATOM 10416 H HD12 . LEU A 1 23  ? -2.431  8.986   -2.005  1.00 0.00 ? 23  LEU A HD12 8  
ATOM 10417 H HD13 . LEU A 1 23  ? -2.967  7.444   -1.337  1.00 0.00 ? 23  LEU A HD13 8  
ATOM 10418 H HD21 . LEU A 1 23  ? -0.444  9.996   -0.234  1.00 0.00 ? 23  LEU A HD21 8  
ATOM 10419 H HD22 . LEU A 1 23  ? -0.122  8.415   0.478   1.00 0.00 ? 23  LEU A HD22 8  
ATOM 10420 H HD23 . LEU A 1 23  ? -0.800  9.708   1.469   1.00 0.00 ? 23  LEU A HD23 8  
ATOM 10421 N N    . SER A 1 24  ? -3.590  12.981  1.001   1.00 0.00 ? 24  SER A N    8  
ATOM 10422 C CA   . SER A 1 24  ? -4.317  14.237  0.856   1.00 0.00 ? 24  SER A CA   8  
ATOM 10423 C C    . SER A 1 24  ? -5.191  14.217  -0.394  1.00 0.00 ? 24  SER A C    8  
ATOM 10424 O O    . SER A 1 24  ? -4.766  13.755  -1.453  1.00 0.00 ? 24  SER A O    8  
ATOM 10425 C CB   . SER A 1 24  ? -3.340  15.412  0.790   1.00 0.00 ? 24  SER A CB   8  
ATOM 10426 O OG   . SER A 1 24  ? -4.026  16.650  0.856   1.00 0.00 ? 24  SER A OG   8  
ATOM 10427 H H    . SER A 1 24  ? -2.645  12.943  0.743   1.00 0.00 ? 24  SER A H    8  
ATOM 10428 H HA   . SER A 1 24  ? -4.951  14.355  1.722   1.00 0.00 ? 24  SER A HA   8  
ATOM 10429 H HB2  . SER A 1 24  ? -2.651  15.352  1.619   1.00 0.00 ? 24  SER A HB2  8  
ATOM 10430 H HB3  . SER A 1 24  ? -2.790  15.368  -0.139  1.00 0.00 ? 24  SER A HB3  8  
ATOM 10431 H HG   . SER A 1 24  ? -4.910  16.546  0.497   1.00 0.00 ? 24  SER A HG   8  
ATOM 10432 N N    . GLU A 1 25  ? -6.414  14.721  -0.262  1.00 0.00 ? 25  GLU A N    8  
ATOM 10433 C CA   . GLU A 1 25  ? -7.348  14.760  -1.381  1.00 0.00 ? 25  GLU A CA   8  
ATOM 10434 C C    . GLU A 1 25  ? -6.637  15.164  -2.670  1.00 0.00 ? 25  GLU A C    8  
ATOM 10435 O O    . GLU A 1 25  ? -7.056  14.790  -3.765  1.00 0.00 ? 25  GLU A O    8  
ATOM 10436 C CB   . GLU A 1 25  ? -8.489  15.736  -1.088  1.00 0.00 ? 25  GLU A CB   8  
ATOM 10437 C CG   . GLU A 1 25  ? -8.858  15.816  0.384   1.00 0.00 ? 25  GLU A CG   8  
ATOM 10438 C CD   . GLU A 1 25  ? -8.021  16.828  1.142   1.00 0.00 ? 25  GLU A CD   8  
ATOM 10439 O OE1  . GLU A 1 25  ? -7.986  18.003  0.720   1.00 0.00 ? 25  GLU A OE1  8  
ATOM 10440 O OE2  . GLU A 1 25  ? -7.400  16.445  2.155   1.00 0.00 ? 25  GLU A OE2  8  
ATOM 10441 H H    . GLU A 1 25  ? -6.694  15.074  0.608   1.00 0.00 ? 25  GLU A H    8  
ATOM 10442 H HA   . GLU A 1 25  ? -7.758  13.769  -1.506  1.00 0.00 ? 25  GLU A HA   8  
ATOM 10443 H HB2  . GLU A 1 25  ? -8.198  16.722  -1.419  1.00 0.00 ? 25  GLU A HB2  8  
ATOM 10444 H HB3  . GLU A 1 25  ? -9.364  15.424  -1.640  1.00 0.00 ? 25  GLU A HB3  8  
ATOM 10445 H HG2  . GLU A 1 25  ? -9.897  16.098  0.467   1.00 0.00 ? 25  GLU A HG2  8  
ATOM 10446 H HG3  . GLU A 1 25  ? -8.714  14.843  0.832   1.00 0.00 ? 25  GLU A HG3  8  
ATOM 10447 N N    . ASP A 1 26  ? -5.561  15.930  -2.529  1.00 0.00 ? 26  ASP A N    8  
ATOM 10448 C CA   . ASP A 1 26  ? -4.791  16.386  -3.681  1.00 0.00 ? 26  ASP A CA   8  
ATOM 10449 C C    . ASP A 1 26  ? -3.795  15.319  -4.124  1.00 0.00 ? 26  ASP A C    8  
ATOM 10450 O O    . ASP A 1 26  ? -3.542  15.147  -5.317  1.00 0.00 ? 26  ASP A O    8  
ATOM 10451 C CB   . ASP A 1 26  ? -4.054  17.684  -3.347  1.00 0.00 ? 26  ASP A CB   8  
ATOM 10452 C CG   . ASP A 1 26  ? -4.954  18.706  -2.682  1.00 0.00 ? 26  ASP A CG   8  
ATOM 10453 O OD1  . ASP A 1 26  ? -6.147  18.773  -3.045  1.00 0.00 ? 26  ASP A OD1  8  
ATOM 10454 O OD2  . ASP A 1 26  ? -4.465  19.439  -1.797  1.00 0.00 ? 26  ASP A OD2  8  
ATOM 10455 H H    . ASP A 1 26  ? -5.277  16.195  -1.629  1.00 0.00 ? 26  ASP A H    8  
ATOM 10456 H HA   . ASP A 1 26  ? -5.482  16.573  -4.489  1.00 0.00 ? 26  ASP A HA   8  
ATOM 10457 H HB2  . ASP A 1 26  ? -3.235  17.463  -2.678  1.00 0.00 ? 26  ASP A HB2  8  
ATOM 10458 H HB3  . ASP A 1 26  ? -3.664  18.112  -4.259  1.00 0.00 ? 26  ASP A HB3  8  
ATOM 10459 N N    . THR A 1 27  ? -3.230  14.605  -3.156  1.00 0.00 ? 27  THR A N    8  
ATOM 10460 C CA   . THR A 1 27  ? -2.259  13.557  -3.445  1.00 0.00 ? 27  THR A CA   8  
ATOM 10461 C C    . THR A 1 27  ? -2.593  12.845  -4.751  1.00 0.00 ? 27  THR A C    8  
ATOM 10462 O O    . THR A 1 27  ? -3.675  12.277  -4.902  1.00 0.00 ? 27  THR A O    8  
ATOM 10463 C CB   . THR A 1 27  ? -2.196  12.520  -2.309  1.00 0.00 ? 27  THR A CB   8  
ATOM 10464 O OG1  . THR A 1 27  ? -1.457  13.049  -1.202  1.00 0.00 ? 27  THR A OG1  8  
ATOM 10465 C CG2  . THR A 1 27  ? -1.547  11.230  -2.788  1.00 0.00 ? 27  THR A CG2  8  
ATOM 10466 H H    . THR A 1 27  ? -3.472  14.789  -2.224  1.00 0.00 ? 27  THR A H    8  
ATOM 10467 H HA   . THR A 1 27  ? -1.287  14.019  -3.537  1.00 0.00 ? 27  THR A HA   8  
ATOM 10468 H HB   . THR A 1 27  ? -3.204  12.300  -1.987  1.00 0.00 ? 27  THR A HB   8  
ATOM 10469 H HG1  . THR A 1 27  ? -0.603  12.614  -1.151  1.00 0.00 ? 27  THR A HG1  8  
ATOM 10470 H HG21 . THR A 1 27  ? -1.283  10.621  -1.936  1.00 0.00 ? 27  THR A HG21 8  
ATOM 10471 H HG22 . THR A 1 27  ? -0.657  11.464  -3.354  1.00 0.00 ? 27  THR A HG22 8  
ATOM 10472 H HG23 . THR A 1 27  ? -2.240  10.690  -3.415  1.00 0.00 ? 27  THR A HG23 8  
ATOM 10473 N N    . THR A 1 28  ? -1.656  12.877  -5.694  1.00 0.00 ? 28  THR A N    8  
ATOM 10474 C CA   . THR A 1 28  ? -1.851  12.234  -6.987  1.00 0.00 ? 28  THR A CA   8  
ATOM 10475 C C    . THR A 1 28  ? -1.002  10.973  -7.108  1.00 0.00 ? 28  THR A C    8  
ATOM 10476 O O    . THR A 1 28  ? -0.069  10.766  -6.334  1.00 0.00 ? 28  THR A O    8  
ATOM 10477 C CB   . THR A 1 28  ? -1.502  13.187  -8.146  1.00 0.00 ? 28  THR A CB   8  
ATOM 10478 O OG1  . THR A 1 28  ? -0.134  13.598  -8.047  1.00 0.00 ? 28  THR A OG1  8  
ATOM 10479 C CG2  . THR A 1 28  ? -2.407  14.409  -8.133  1.00 0.00 ? 28  THR A CG2  8  
ATOM 10480 H H    . THR A 1 28  ? -0.814  13.345  -5.514  1.00 0.00 ? 28  THR A H    8  
ATOM 10481 H HA   . THR A 1 28  ? -2.893  11.964  -7.072  1.00 0.00 ? 28  THR A HA   8  
ATOM 10482 H HB   . THR A 1 28  ? -1.645  12.661  -9.080  1.00 0.00 ? 28  THR A HB   8  
ATOM 10483 H HG1  . THR A 1 28  ? 0.159   13.520  -7.136  1.00 0.00 ? 28  THR A HG1  8  
ATOM 10484 H HG21 . THR A 1 28  ? -2.262  14.954  -7.212  1.00 0.00 ? 28  THR A HG21 8  
ATOM 10485 H HG22 . THR A 1 28  ? -3.437  14.095  -8.208  1.00 0.00 ? 28  THR A HG22 8  
ATOM 10486 H HG23 . THR A 1 28  ? -2.162  15.046  -8.969  1.00 0.00 ? 28  THR A HG23 8  
ATOM 10487 N N    . GLU A 1 29  ? -1.334  10.134  -8.084  1.00 0.00 ? 29  GLU A N    8  
ATOM 10488 C CA   . GLU A 1 29  ? -0.601  8.893   -8.305  1.00 0.00 ? 29  GLU A CA   8  
ATOM 10489 C C    . GLU A 1 29  ? 0.872   9.173   -8.587  1.00 0.00 ? 29  GLU A C    8  
ATOM 10490 O O    . GLU A 1 29  ? 1.731   8.320   -8.363  1.00 0.00 ? 29  GLU A O    8  
ATOM 10491 C CB   . GLU A 1 29  ? -1.215  8.112   -9.470  1.00 0.00 ? 29  GLU A CB   8  
ATOM 10492 C CG   . GLU A 1 29  ? -2.695  7.818   -9.292  1.00 0.00 ? 29  GLU A CG   8  
ATOM 10493 C CD   . GLU A 1 29  ? -3.391  7.518   -10.605 1.00 0.00 ? 29  GLU A CD   8  
ATOM 10494 O OE1  . GLU A 1 29  ? -3.026  6.517   -11.256 1.00 0.00 ? 29  GLU A OE1  8  
ATOM 10495 O OE2  . GLU A 1 29  ? -4.302  8.285   -10.982 1.00 0.00 ? 29  GLU A OE2  8  
ATOM 10496 H H    . GLU A 1 29  ? -2.088  10.354  -8.669  1.00 0.00 ? 29  GLU A H    8  
ATOM 10497 H HA   . GLU A 1 29  ? -0.676  8.299   -7.407  1.00 0.00 ? 29  GLU A HA   8  
ATOM 10498 H HB2  . GLU A 1 29  ? -1.088  8.684   -10.377 1.00 0.00 ? 29  GLU A HB2  8  
ATOM 10499 H HB3  . GLU A 1 29  ? -0.692  7.172   -9.572  1.00 0.00 ? 29  GLU A HB3  8  
ATOM 10500 H HG2  . GLU A 1 29  ? -2.804  6.964   -8.641  1.00 0.00 ? 29  GLU A HG2  8  
ATOM 10501 H HG3  . GLU A 1 29  ? -3.168  8.678   -8.839  1.00 0.00 ? 29  GLU A HG3  8  
ATOM 10502 N N    . GLU A 1 30  ? 1.156   10.375  -9.080  1.00 0.00 ? 30  GLU A N    8  
ATOM 10503 C CA   . GLU A 1 30  ? 2.525   10.767  -9.394  1.00 0.00 ? 30  GLU A CA   8  
ATOM 10504 C C    . GLU A 1 30  ? 3.368   10.863  -8.125  1.00 0.00 ? 30  GLU A C    8  
ATOM 10505 O O    . GLU A 1 30  ? 4.448   10.278  -8.037  1.00 0.00 ? 30  GLU A O    8  
ATOM 10506 C CB   . GLU A 1 30  ? 2.538   12.108  -10.131 1.00 0.00 ? 30  GLU A CB   8  
ATOM 10507 C CG   . GLU A 1 30  ? 2.466   11.972  -11.643 1.00 0.00 ? 30  GLU A CG   8  
ATOM 10508 C CD   . GLU A 1 30  ? 2.942   13.218  -12.364 1.00 0.00 ? 30  GLU A CD   8  
ATOM 10509 O OE1  . GLU A 1 30  ? 4.119   13.594  -12.186 1.00 0.00 ? 30  GLU A OE1  8  
ATOM 10510 O OE2  . GLU A 1 30  ? 2.136   13.817  -13.107 1.00 0.00 ? 30  GLU A OE2  8  
ATOM 10511 H H    . GLU A 1 30  ? 0.428   11.012  -9.237  1.00 0.00 ? 30  GLU A H    8  
ATOM 10512 H HA   . GLU A 1 30  ? 2.948   10.010  -10.036 1.00 0.00 ? 30  GLU A HA   8  
ATOM 10513 H HB2  . GLU A 1 30  ? 1.694   12.695  -9.802  1.00 0.00 ? 30  GLU A HB2  8  
ATOM 10514 H HB3  . GLU A 1 30  ? 3.449   12.633  -9.881  1.00 0.00 ? 30  GLU A HB3  8  
ATOM 10515 H HG2  . GLU A 1 30  ? 3.084   11.141  -11.947 1.00 0.00 ? 30  GLU A HG2  8  
ATOM 10516 H HG3  . GLU A 1 30  ? 1.441   11.779  -11.925 1.00 0.00 ? 30  GLU A HG3  8  
ATOM 10517 N N    . THR A 1 31  ? 2.867   11.607  -7.144  1.00 0.00 ? 31  THR A N    8  
ATOM 10518 C CA   . THR A 1 31  ? 3.573   11.782  -5.881  1.00 0.00 ? 31  THR A CA   8  
ATOM 10519 C C    . THR A 1 31  ? 3.501   10.519  -5.031  1.00 0.00 ? 31  THR A C    8  
ATOM 10520 O O    . THR A 1 31  ? 4.293   10.335  -4.106  1.00 0.00 ? 31  THR A O    8  
ATOM 10521 C CB   . THR A 1 31  ? 2.998   12.962  -5.075  1.00 0.00 ? 31  THR A CB   8  
ATOM 10522 O OG1  . THR A 1 31  ? 3.998   13.488  -4.195  1.00 0.00 ? 31  THR A OG1  8  
ATOM 10523 C CG2  . THR A 1 31  ? 1.784   12.526  -4.268  1.00 0.00 ? 31  THR A CG2  8  
ATOM 10524 H H    . THR A 1 31  ? 2.002   12.049  -7.274  1.00 0.00 ? 31  THR A H    8  
ATOM 10525 H HA   . THR A 1 31  ? 4.608   11.997  -6.105  1.00 0.00 ? 31  THR A HA   8  
ATOM 10526 H HB   . THR A 1 31  ? 2.694   13.736  -5.766  1.00 0.00 ? 31  THR A HB   8  
ATOM 10527 H HG1  . THR A 1 31  ? 4.006   12.981  -3.380  1.00 0.00 ? 31  THR A HG1  8  
ATOM 10528 H HG21 . THR A 1 31  ? 2.061   12.421  -3.230  1.00 0.00 ? 31  THR A HG21 8  
ATOM 10529 H HG22 . THR A 1 31  ? 1.424   11.580  -4.643  1.00 0.00 ? 31  THR A HG22 8  
ATOM 10530 H HG23 . THR A 1 31  ? 1.006   13.269  -4.360  1.00 0.00 ? 31  THR A HG23 8  
ATOM 10531 N N    . LEU A 1 32  ? 2.549   9.649   -5.351  1.00 0.00 ? 32  LEU A N    8  
ATOM 10532 C CA   . LEU A 1 32  ? 2.375   8.401   -4.617  1.00 0.00 ? 32  LEU A CA   8  
ATOM 10533 C C    . LEU A 1 32  ? 3.299   7.316   -5.161  1.00 0.00 ? 32  LEU A C    8  
ATOM 10534 O O    . LEU A 1 32  ? 3.760   6.448   -4.419  1.00 0.00 ? 32  LEU A O    8  
ATOM 10535 C CB   . LEU A 1 32  ? 0.920   7.936   -4.700  1.00 0.00 ? 32  LEU A CB   8  
ATOM 10536 C CG   . LEU A 1 32  ? 0.606   6.594   -4.039  1.00 0.00 ? 32  LEU A CG   8  
ATOM 10537 C CD1  . LEU A 1 32  ? 0.702   6.708   -2.526  1.00 0.00 ? 32  LEU A CD1  8  
ATOM 10538 C CD2  . LEU A 1 32  ? -0.776  6.106   -4.452  1.00 0.00 ? 32  LEU A CD2  8  
ATOM 10539 H H    . LEU A 1 32  ? 1.949   9.851   -6.099  1.00 0.00 ? 32  LEU A H    8  
ATOM 10540 H HA   . LEU A 1 32  ? 2.627   8.586   -3.584  1.00 0.00 ? 32  LEU A HA   8  
ATOM 10541 H HB2  . LEU A 1 32  ? 0.306   8.688   -4.230  1.00 0.00 ? 32  LEU A HB2  8  
ATOM 10542 H HB3  . LEU A 1 32  ? 0.657   7.861   -5.746  1.00 0.00 ? 32  LEU A HB3  8  
ATOM 10543 H HG   . LEU A 1 32  ? 1.331   5.861   -4.364  1.00 0.00 ? 32  LEU A HG   8  
ATOM 10544 H HD11 . LEU A 1 32  ? 0.622   7.746   -2.237  1.00 0.00 ? 32  LEU A HD11 8  
ATOM 10545 H HD12 . LEU A 1 32  ? 1.652   6.315   -2.195  1.00 0.00 ? 32  LEU A HD12 8  
ATOM 10546 H HD13 . LEU A 1 32  ? -0.099  6.145   -2.070  1.00 0.00 ? 32  LEU A HD13 8  
ATOM 10547 H HD21 . LEU A 1 32  ? -0.727  5.056   -4.698  1.00 0.00 ? 32  LEU A HD21 8  
ATOM 10548 H HD22 . LEU A 1 32  ? -1.110  6.664   -5.315  1.00 0.00 ? 32  LEU A HD22 8  
ATOM 10549 H HD23 . LEU A 1 32  ? -1.468  6.254   -3.637  1.00 0.00 ? 32  LEU A HD23 8  
ATOM 10550 N N    . LYS A 1 33  ? 3.568   7.372   -6.461  1.00 0.00 ? 33  LYS A N    8  
ATOM 10551 C CA   . LYS A 1 33  ? 4.440   6.397   -7.105  1.00 0.00 ? 33  LYS A CA   8  
ATOM 10552 C C    . LYS A 1 33  ? 5.898   6.636   -6.726  1.00 0.00 ? 33  LYS A C    8  
ATOM 10553 O O    . LYS A 1 33  ? 6.586   5.725   -6.268  1.00 0.00 ? 33  LYS A O    8  
ATOM 10554 C CB   . LYS A 1 33  ? 4.280   6.465   -8.626  1.00 0.00 ? 33  LYS A CB   8  
ATOM 10555 C CG   . LYS A 1 33  ? 4.987   5.341   -9.363  1.00 0.00 ? 33  LYS A CG   8  
ATOM 10556 C CD   . LYS A 1 33  ? 5.442   5.780   -10.745 1.00 0.00 ? 33  LYS A CD   8  
ATOM 10557 C CE   . LYS A 1 33  ? 6.676   5.014   -11.195 1.00 0.00 ? 33  LYS A CE   8  
ATOM 10558 N NZ   . LYS A 1 33  ? 7.516   5.815   -12.127 1.00 0.00 ? 33  LYS A NZ   8  
ATOM 10559 H H    . LYS A 1 33  ? 3.170   8.087   -7.001  1.00 0.00 ? 33  LYS A H    8  
ATOM 10560 H HA   . LYS A 1 33  ? 4.148   5.415   -6.765  1.00 0.00 ? 33  LYS A HA   8  
ATOM 10561 H HB2  . LYS A 1 33  ? 3.228   6.420   -8.867  1.00 0.00 ? 33  LYS A HB2  8  
ATOM 10562 H HB3  . LYS A 1 33  ? 4.681   7.405   -8.976  1.00 0.00 ? 33  LYS A HB3  8  
ATOM 10563 H HG2  . LYS A 1 33  ? 5.851   5.036   -8.792  1.00 0.00 ? 33  LYS A HG2  8  
ATOM 10564 H HG3  . LYS A 1 33  ? 4.308   4.506   -9.465  1.00 0.00 ? 33  LYS A HG3  8  
ATOM 10565 H HD2  . LYS A 1 33  ? 4.644   5.601   -11.450 1.00 0.00 ? 33  LYS A HD2  8  
ATOM 10566 H HD3  . LYS A 1 33  ? 5.673   6.835   -10.720 1.00 0.00 ? 33  LYS A HD3  8  
ATOM 10567 H HE2  . LYS A 1 33  ? 7.262   4.758   -10.325 1.00 0.00 ? 33  LYS A HE2  8  
ATOM 10568 H HE3  . LYS A 1 33  ? 6.360   4.110   -11.694 1.00 0.00 ? 33  LYS A HE3  8  
ATOM 10569 H HZ1  . LYS A 1 33  ? 8.349   6.187   -11.627 1.00 0.00 ? 33  LYS A HZ1  8  
ATOM 10570 H HZ2  . LYS A 1 33  ? 6.968   6.613   -12.507 1.00 0.00 ? 33  LYS A HZ2  8  
ATOM 10571 H HZ3  . LYS A 1 33  ? 7.838   5.221   -12.919 1.00 0.00 ? 33  LYS A HZ3  8  
ATOM 10572 N N    . GLU A 1 34  ? 6.360   7.867   -6.918  1.00 0.00 ? 34  GLU A N    8  
ATOM 10573 C CA   . GLU A 1 34  ? 7.736   8.225   -6.595  1.00 0.00 ? 34  GLU A CA   8  
ATOM 10574 C C    . GLU A 1 34  ? 8.039   7.948   -5.125  1.00 0.00 ? 34  GLU A C    8  
ATOM 10575 O O    . GLU A 1 34  ? 9.117   7.461   -4.783  1.00 0.00 ? 34  GLU A O    8  
ATOM 10576 C CB   . GLU A 1 34  ? 7.991   9.700   -6.910  1.00 0.00 ? 34  GLU A CB   8  
ATOM 10577 C CG   . GLU A 1 34  ? 7.875   10.035  -8.388  1.00 0.00 ? 34  GLU A CG   8  
ATOM 10578 C CD   . GLU A 1 34  ? 8.283   11.463  -8.696  1.00 0.00 ? 34  GLU A CD   8  
ATOM 10579 O OE1  . GLU A 1 34  ? 7.829   12.379  -7.979  1.00 0.00 ? 34  GLU A OE1  8  
ATOM 10580 O OE2  . GLU A 1 34  ? 9.058   11.664  -9.655  1.00 0.00 ? 34  GLU A OE2  8  
ATOM 10581 H H    . GLU A 1 34  ? 5.762   8.551   -7.286  1.00 0.00 ? 34  GLU A H    8  
ATOM 10582 H HA   . GLU A 1 34  ? 8.389   7.618   -7.204  1.00 0.00 ? 34  GLU A HA   8  
ATOM 10583 H HB2  . GLU A 1 34  ? 7.275   10.301  -6.368  1.00 0.00 ? 34  GLU A HB2  8  
ATOM 10584 H HB3  . GLU A 1 34  ? 8.986   9.959   -6.581  1.00 0.00 ? 34  GLU A HB3  8  
ATOM 10585 H HG2  . GLU A 1 34  ? 8.512   9.367   -8.947  1.00 0.00 ? 34  GLU A HG2  8  
ATOM 10586 H HG3  . GLU A 1 34  ? 6.850   9.895   -8.696  1.00 0.00 ? 34  GLU A HG3  8  
ATOM 10587 N N    . SER A 1 35  ? 7.081   8.264   -4.260  1.00 0.00 ? 35  SER A N    8  
ATOM 10588 C CA   . SER A 1 35  ? 7.246   8.054   -2.826  1.00 0.00 ? 35  SER A CA   8  
ATOM 10589 C C    . SER A 1 35  ? 7.993   6.753   -2.550  1.00 0.00 ? 35  SER A C    8  
ATOM 10590 O O    . SER A 1 35  ? 8.698   6.629   -1.548  1.00 0.00 ? 35  SER A O    8  
ATOM 10591 C CB   . SER A 1 35  ? 5.882   8.029   -2.133  1.00 0.00 ? 35  SER A CB   8  
ATOM 10592 O OG   . SER A 1 35  ? 5.377   9.341   -1.954  1.00 0.00 ? 35  SER A OG   8  
ATOM 10593 H H    . SER A 1 35  ? 6.244   8.650   -4.594  1.00 0.00 ? 35  SER A H    8  
ATOM 10594 H HA   . SER A 1 35  ? 7.824   8.878   -2.435  1.00 0.00 ? 35  SER A HA   8  
ATOM 10595 H HB2  . SER A 1 35  ? 5.185   7.467   -2.735  1.00 0.00 ? 35  SER A HB2  8  
ATOM 10596 H HB3  . SER A 1 35  ? 5.982   7.560   -1.165  1.00 0.00 ? 35  SER A HB3  8  
ATOM 10597 H HG   . SER A 1 35  ? 5.749   9.921   -2.622  1.00 0.00 ? 35  SER A HG   8  
ATOM 10598 N N    . PHE A 1 36  ? 7.834   5.785   -3.446  1.00 0.00 ? 36  PHE A N    8  
ATOM 10599 C CA   . PHE A 1 36  ? 8.492   4.492   -3.300  1.00 0.00 ? 36  PHE A CA   8  
ATOM 10600 C C    . PHE A 1 36  ? 9.634   4.347   -4.302  1.00 0.00 ? 36  PHE A C    8  
ATOM 10601 O O    . PHE A 1 36  ? 9.407   4.249   -5.508  1.00 0.00 ? 36  PHE A O    8  
ATOM 10602 C CB   . PHE A 1 36  ? 7.483   3.358   -3.492  1.00 0.00 ? 36  PHE A CB   8  
ATOM 10603 C CG   . PHE A 1 36  ? 6.239   3.517   -2.665  1.00 0.00 ? 36  PHE A CG   8  
ATOM 10604 C CD1  . PHE A 1 36  ? 5.236   4.387   -3.060  1.00 0.00 ? 36  PHE A CD1  8  
ATOM 10605 C CD2  . PHE A 1 36  ? 6.072   2.795   -1.494  1.00 0.00 ? 36  PHE A CD2  8  
ATOM 10606 C CE1  . PHE A 1 36  ? 4.090   4.535   -2.301  1.00 0.00 ? 36  PHE A CE1  8  
ATOM 10607 C CE2  . PHE A 1 36  ? 4.929   2.939   -0.731  1.00 0.00 ? 36  PHE A CE2  8  
ATOM 10608 C CZ   . PHE A 1 36  ? 3.936   3.810   -1.136  1.00 0.00 ? 36  PHE A CZ   8  
ATOM 10609 H H    . PHE A 1 36  ? 7.259   5.944   -4.225  1.00 0.00 ? 36  PHE A H    8  
ATOM 10610 H HA   . PHE A 1 36  ? 8.896   4.438   -2.301  1.00 0.00 ? 36  PHE A HA   8  
ATOM 10611 H HB2  . PHE A 1 36  ? 7.189   3.319   -4.529  1.00 0.00 ? 36  PHE A HB2  8  
ATOM 10612 H HB3  . PHE A 1 36  ? 7.948   2.423   -3.218  1.00 0.00 ? 36  PHE A HB3  8  
ATOM 10613 H HD1  . PHE A 1 36  ? 5.354   4.954   -3.972  1.00 0.00 ? 36  PHE A HD1  8  
ATOM 10614 H HD2  . PHE A 1 36  ? 6.849   2.113   -1.177  1.00 0.00 ? 36  PHE A HD2  8  
ATOM 10615 H HE1  . PHE A 1 36  ? 3.315   5.216   -2.620  1.00 0.00 ? 36  PHE A HE1  8  
ATOM 10616 H HE2  . PHE A 1 36  ? 4.812   2.370   0.179   1.00 0.00 ? 36  PHE A HE2  8  
ATOM 10617 H HZ   . PHE A 1 36  ? 3.042   3.924   -0.542  1.00 0.00 ? 36  PHE A HZ   8  
ATOM 10618 N N    . ASP A 1 37  ? 10.861  4.334   -3.793  1.00 0.00 ? 37  ASP A N    8  
ATOM 10619 C CA   . ASP A 1 37  ? 12.039  4.200   -4.642  1.00 0.00 ? 37  ASP A CA   8  
ATOM 10620 C C    . ASP A 1 37  ? 12.189  2.767   -5.142  1.00 0.00 ? 37  ASP A C    8  
ATOM 10621 O O    . ASP A 1 37  ? 12.984  1.993   -4.611  1.00 0.00 ? 37  ASP A O    8  
ATOM 10622 C CB   . ASP A 1 37  ? 13.295  4.620   -3.877  1.00 0.00 ? 37  ASP A CB   8  
ATOM 10623 C CG   . ASP A 1 37  ? 13.479  6.125   -3.848  1.00 0.00 ? 37  ASP A CG   8  
ATOM 10624 O OD1  . ASP A 1 37  ? 12.686  6.806   -3.166  1.00 0.00 ? 37  ASP A OD1  8  
ATOM 10625 O OD2  . ASP A 1 37  ? 14.416  6.621   -4.509  1.00 0.00 ? 37  ASP A OD2  8  
ATOM 10626 H H    . ASP A 1 37  ? 10.977  4.416   -2.823  1.00 0.00 ? 37  ASP A H    8  
ATOM 10627 H HA   . ASP A 1 37  ? 11.911  4.853   -5.492  1.00 0.00 ? 37  ASP A HA   8  
ATOM 10628 H HB2  . ASP A 1 37  ? 13.225  4.266   -2.859  1.00 0.00 ? 37  ASP A HB2  8  
ATOM 10629 H HB3  . ASP A 1 37  ? 14.161  4.179   -4.349  1.00 0.00 ? 37  ASP A HB3  8  
ATOM 10630 N N    . GLY A 1 38  ? 11.417  2.420   -6.168  1.00 0.00 ? 38  GLY A N    8  
ATOM 10631 C CA   . GLY A 1 38  ? 11.478  1.080   -6.722  1.00 0.00 ? 38  GLY A CA   8  
ATOM 10632 C C    . GLY A 1 38  ? 10.200  0.689   -7.436  1.00 0.00 ? 38  GLY A C    8  
ATOM 10633 O O    . GLY A 1 38  ? 10.232  -0.045  -8.424  1.00 0.00 ? 38  GLY A O    8  
ATOM 10634 H H    . GLY A 1 38  ? 10.802  3.079   -6.552  1.00 0.00 ? 38  GLY A H    8  
ATOM 10635 H HA2  . GLY A 1 38  ? 12.299  1.028   -7.422  1.00 0.00 ? 38  GLY A HA2  8  
ATOM 10636 H HA3  . GLY A 1 38  ? 11.658  0.379   -5.920  1.00 0.00 ? 38  GLY A HA3  8  
ATOM 10637 N N    . SER A 1 39  ? 9.070   1.178   -6.934  1.00 0.00 ? 39  SER A N    8  
ATOM 10638 C CA   . SER A 1 39  ? 7.774   0.871   -7.527  1.00 0.00 ? 39  SER A CA   8  
ATOM 10639 C C    . SER A 1 39  ? 7.811   1.058   -9.040  1.00 0.00 ? 39  SER A C    8  
ATOM 10640 O O    . SER A 1 39  ? 8.725   1.683   -9.578  1.00 0.00 ? 39  SER A O    8  
ATOM 10641 C CB   . SER A 1 39  ? 6.687   1.759   -6.918  1.00 0.00 ? 39  SER A CB   8  
ATOM 10642 O OG   . SER A 1 39  ? 6.941   3.128   -7.181  1.00 0.00 ? 39  SER A OG   8  
ATOM 10643 H H    . SER A 1 39  ? 9.110   1.757   -6.144  1.00 0.00 ? 39  SER A H    8  
ATOM 10644 H HA   . SER A 1 39  ? 7.546   -0.162  -7.309  1.00 0.00 ? 39  SER A HA   8  
ATOM 10645 H HB2  . SER A 1 39  ? 5.730   1.494   -7.341  1.00 0.00 ? 39  SER A HB2  8  
ATOM 10646 H HB3  . SER A 1 39  ? 6.662   1.609   -5.848  1.00 0.00 ? 39  SER A HB3  8  
ATOM 10647 H HG   . SER A 1 39  ? 7.882   3.300   -7.106  1.00 0.00 ? 39  SER A HG   8  
ATOM 10648 N N    . VAL A 1 40  ? 6.809   0.512   -9.723  1.00 0.00 ? 40  VAL A N    8  
ATOM 10649 C CA   . VAL A 1 40  ? 6.725   0.619   -11.174 1.00 0.00 ? 40  VAL A CA   8  
ATOM 10650 C C    . VAL A 1 40  ? 5.514   1.445   -11.595 1.00 0.00 ? 40  VAL A C    8  
ATOM 10651 O O    . VAL A 1 40  ? 5.533   2.109   -12.632 1.00 0.00 ? 40  VAL A O    8  
ATOM 10652 C CB   . VAL A 1 40  ? 6.641   -0.769  -11.836 1.00 0.00 ? 40  VAL A CB   8  
ATOM 10653 C CG1  . VAL A 1 40  ? 7.965   -1.506  -11.702 1.00 0.00 ? 40  VAL A CG1  8  
ATOM 10654 C CG2  . VAL A 1 40  ? 5.506   -1.581  -11.228 1.00 0.00 ? 40  VAL A CG2  8  
ATOM 10655 H H    . VAL A 1 40  ? 6.109   0.026   -9.238  1.00 0.00 ? 40  VAL A H    8  
ATOM 10656 H HA   . VAL A 1 40  ? 7.622   1.108   -11.526 1.00 0.00 ? 40  VAL A HA   8  
ATOM 10657 H HB   . VAL A 1 40  ? 6.434   -0.633  -12.887 1.00 0.00 ? 40  VAL A HB   8  
ATOM 10658 H HG11 . VAL A 1 40  ? 8.541   -1.376  -12.607 1.00 0.00 ? 40  VAL A HG11 8  
ATOM 10659 H HG12 . VAL A 1 40  ? 8.516   -1.107  -10.863 1.00 0.00 ? 40  VAL A HG12 8  
ATOM 10660 H HG13 . VAL A 1 40  ? 7.777   -2.557  -11.543 1.00 0.00 ? 40  VAL A HG13 8  
ATOM 10661 H HG21 . VAL A 1 40  ? 5.903   -2.492  -10.806 1.00 0.00 ? 40  VAL A HG21 8  
ATOM 10662 H HG22 . VAL A 1 40  ? 5.027   -1.003  -10.450 1.00 0.00 ? 40  VAL A HG22 8  
ATOM 10663 H HG23 . VAL A 1 40  ? 4.785   -1.822  -11.994 1.00 0.00 ? 40  VAL A HG23 8  
ATOM 10664 N N    . ARG A 1 41  ? 4.463   1.399   -10.784 1.00 0.00 ? 41  ARG A N    8  
ATOM 10665 C CA   . ARG A 1 41  ? 3.242   2.142   -11.072 1.00 0.00 ? 41  ARG A CA   8  
ATOM 10666 C C    . ARG A 1 41  ? 2.499   2.488   -9.785  1.00 0.00 ? 41  ARG A C    8  
ATOM 10667 O O    . ARG A 1 41  ? 2.791   1.941   -8.722  1.00 0.00 ? 41  ARG A O    8  
ATOM 10668 C CB   . ARG A 1 41  ? 2.332   1.332   -11.997 1.00 0.00 ? 41  ARG A CB   8  
ATOM 10669 C CG   . ARG A 1 41  ? 2.893   1.152   -13.398 1.00 0.00 ? 41  ARG A CG   8  
ATOM 10670 C CD   . ARG A 1 41  ? 2.969   2.477   -14.141 1.00 0.00 ? 41  ARG A CD   8  
ATOM 10671 N NE   . ARG A 1 41  ? 3.006   2.291   -15.589 1.00 0.00 ? 41  ARG A NE   8  
ATOM 10672 C CZ   . ARG A 1 41  ? 3.014   3.294   -16.459 1.00 0.00 ? 41  ARG A CZ   8  
ATOM 10673 N NH1  . ARG A 1 41  ? 2.988   4.548   -16.030 1.00 0.00 ? 41  ARG A NH1  8  
ATOM 10674 N NH2  . ARG A 1 41  ? 3.048   3.045   -17.762 1.00 0.00 ? 41  ARG A NH2  8  
ATOM 10675 H H    . ARG A 1 41  ? 4.508   0.852   -9.972  1.00 0.00 ? 41  ARG A H    8  
ATOM 10676 H HA   . ARG A 1 41  ? 3.521   3.059   -11.569 1.00 0.00 ? 41  ARG A HA   8  
ATOM 10677 H HB2  . ARG A 1 41  ? 2.180   0.353   -11.566 1.00 0.00 ? 41  ARG A HB2  8  
ATOM 10678 H HB3  . ARG A 1 41  ? 1.380   1.834   -12.075 1.00 0.00 ? 41  ARG A HB3  8  
ATOM 10679 H HG2  . ARG A 1 41  ? 3.886   0.734   -13.328 1.00 0.00 ? 41  ARG A HG2  8  
ATOM 10680 H HG3  . ARG A 1 41  ? 2.254   0.477   -13.948 1.00 0.00 ? 41  ARG A HG3  8  
ATOM 10681 H HD2  . ARG A 1 41  ? 2.103   3.068   -13.886 1.00 0.00 ? 41  ARG A HD2  8  
ATOM 10682 H HD3  . ARG A 1 41  ? 3.864   2.996   -13.831 1.00 0.00 ? 41  ARG A HD3  8  
ATOM 10683 H HE   . ARG A 1 41  ? 3.026   1.372   -15.928 1.00 0.00 ? 41  ARG A HE   8  
ATOM 10684 H HH11 . ARG A 1 41  ? 2.963   4.740   -15.049 1.00 0.00 ? 41  ARG A HH11 8  
ATOM 10685 H HH12 . ARG A 1 41  ? 2.994   5.302   -16.687 1.00 0.00 ? 41  ARG A HH12 8  
ATOM 10686 H HH21 . ARG A 1 41  ? 3.068   2.100   -18.090 1.00 0.00 ? 41  ARG A HH21 8  
ATOM 10687 H HH22 . ARG A 1 41  ? 3.053   3.800   -18.416 1.00 0.00 ? 41  ARG A HH22 8  
ATOM 10688 N N    . ALA A 1 42  ? 1.538   3.400   -9.889  1.00 0.00 ? 42  ALA A N    8  
ATOM 10689 C CA   . ALA A 1 42  ? 0.752   3.817   -8.734  1.00 0.00 ? 42  ALA A CA   8  
ATOM 10690 C C    . ALA A 1 42  ? -0.676  4.165   -9.139  1.00 0.00 ? 42  ALA A C    8  
ATOM 10691 O O    . ALA A 1 42  ? -0.928  4.577   -10.272 1.00 0.00 ? 42  ALA A O    8  
ATOM 10692 C CB   . ALA A 1 42  ? 1.412   5.003   -8.048  1.00 0.00 ? 42  ALA A CB   8  
ATOM 10693 H H    . ALA A 1 42  ? 1.352   3.800   -10.764 1.00 0.00 ? 42  ALA A H    8  
ATOM 10694 H HA   . ALA A 1 42  ? 0.727   2.995   -8.033  1.00 0.00 ? 42  ALA A HA   8  
ATOM 10695 H HB1  . ALA A 1 42  ? 1.312   5.880   -8.671  1.00 0.00 ? 42  ALA A HB1  8  
ATOM 10696 H HB2  . ALA A 1 42  ? 0.933   5.180   -7.096  1.00 0.00 ? 42  ALA A HB2  8  
ATOM 10697 H HB3  . ALA A 1 42  ? 2.459   4.791   -7.890  1.00 0.00 ? 42  ALA A HB3  8  
ATOM 10698 N N    . ARG A 1 43  ? -1.608  3.996   -8.207  1.00 0.00 ? 43  ARG A N    8  
ATOM 10699 C CA   . ARG A 1 43  ? -3.012  4.291   -8.468  1.00 0.00 ? 43  ARG A CA   8  
ATOM 10700 C C    . ARG A 1 43  ? -3.678  4.897   -7.236  1.00 0.00 ? 43  ARG A C    8  
ATOM 10701 O O    . ARG A 1 43  ? -3.331  4.563   -6.103  1.00 0.00 ? 43  ARG A O    8  
ATOM 10702 C CB   . ARG A 1 43  ? -3.753  3.020   -8.888  1.00 0.00 ? 43  ARG A CB   8  
ATOM 10703 C CG   . ARG A 1 43  ? -2.947  2.123   -9.813  1.00 0.00 ? 43  ARG A CG   8  
ATOM 10704 C CD   . ARG A 1 43  ? -3.848  1.338   -10.753 1.00 0.00 ? 43  ARG A CD   8  
ATOM 10705 N NE   . ARG A 1 43  ? -4.386  2.175   -11.822 1.00 0.00 ? 43  ARG A NE   8  
ATOM 10706 C CZ   . ARG A 1 43  ? -3.731  2.439   -12.948 1.00 0.00 ? 43  ARG A CZ   8  
ATOM 10707 N NH1  . ARG A 1 43  ? -2.522  1.934   -13.150 1.00 0.00 ? 43  ARG A NH1  8  
ATOM 10708 N NH2  . ARG A 1 43  ? -4.287  3.209   -13.874 1.00 0.00 ? 43  ARG A NH2  8  
ATOM 10709 H H    . ARG A 1 43  ? -1.346  3.665   -7.323  1.00 0.00 ? 43  ARG A H    8  
ATOM 10710 H HA   . ARG A 1 43  ? -3.057  5.006   -9.275  1.00 0.00 ? 43  ARG A HA   8  
ATOM 10711 H HB2  . ARG A 1 43  ? -4.004  2.454   -8.003  1.00 0.00 ? 43  ARG A HB2  8  
ATOM 10712 H HB3  . ARG A 1 43  ? -4.663  3.300   -9.396  1.00 0.00 ? 43  ARG A HB3  8  
ATOM 10713 H HG2  . ARG A 1 43  ? -2.279  2.735   -10.401 1.00 0.00 ? 43  ARG A HG2  8  
ATOM 10714 H HG3  . ARG A 1 43  ? -2.372  1.430   -9.217  1.00 0.00 ? 43  ARG A HG3  8  
ATOM 10715 H HD2  . ARG A 1 43  ? -3.276  0.534   -11.191 1.00 0.00 ? 43  ARG A HD2  8  
ATOM 10716 H HD3  . ARG A 1 43  ? -4.669  0.927   -10.183 1.00 0.00 ? 43  ARG A HD3  8  
ATOM 10717 H HE   . ARG A 1 43  ? -5.278  2.559   -11.694 1.00 0.00 ? 43  ARG A HE   8  
ATOM 10718 H HH11 . ARG A 1 43  ? -2.102  1.352   -12.454 1.00 0.00 ? 43  ARG A HH11 8  
ATOM 10719 H HH12 . ARG A 1 43  ? -2.032  2.133   -13.999 1.00 0.00 ? 43  ARG A HH12 8  
ATOM 10720 H HH21 . ARG A 1 43  ? -5.198  3.592   -13.726 1.00 0.00 ? 43  ARG A HH21 8  
ATOM 10721 H HH22 . ARG A 1 43  ? -3.794  3.407   -14.721 1.00 0.00 ? 43  ARG A HH22 8  
ATOM 10722 N N    . ILE A 1 44  ? -4.636  5.789   -7.467  1.00 0.00 ? 44  ILE A N    8  
ATOM 10723 C CA   . ILE A 1 44  ? -5.350  6.441   -6.376  1.00 0.00 ? 44  ILE A CA   8  
ATOM 10724 C C    . ILE A 1 44  ? -6.860  6.313   -6.554  1.00 0.00 ? 44  ILE A C    8  
ATOM 10725 O O    . ILE A 1 44  ? -7.387  6.525   -7.646  1.00 0.00 ? 44  ILE A O    8  
ATOM 10726 C CB   . ILE A 1 44  ? -4.982  7.933   -6.274  1.00 0.00 ? 44  ILE A CB   8  
ATOM 10727 C CG1  . ILE A 1 44  ? -3.521  8.091   -5.846  1.00 0.00 ? 44  ILE A CG1  8  
ATOM 10728 C CG2  . ILE A 1 44  ? -5.906  8.641   -5.294  1.00 0.00 ? 44  ILE A CG2  8  
ATOM 10729 C CD1  . ILE A 1 44  ? -3.069  9.532   -5.761  1.00 0.00 ? 44  ILE A CD1  8  
ATOM 10730 H H    . ILE A 1 44  ? -4.868  6.014   -8.392  1.00 0.00 ? 44  ILE A H    8  
ATOM 10731 H HA   . ILE A 1 44  ? -5.065  5.956   -5.454  1.00 0.00 ? 44  ILE A HA   8  
ATOM 10732 H HB   . ILE A 1 44  ? -5.115  8.382   -7.246  1.00 0.00 ? 44  ILE A HB   8  
ATOM 10733 H HG12 . ILE A 1 44  ? -3.387  7.644   -4.874  1.00 0.00 ? 44  ILE A HG12 8  
ATOM 10734 H HG13 . ILE A 1 44  ? -2.888  7.586   -6.561  1.00 0.00 ? 44  ILE A HG13 8  
ATOM 10735 H HG21 . ILE A 1 44  ? -5.319  9.089   -4.506  1.00 0.00 ? 44  ILE A HG21 8  
ATOM 10736 H HG22 . ILE A 1 44  ? -6.458  9.410   -5.813  1.00 0.00 ? 44  ILE A HG22 8  
ATOM 10737 H HG23 . ILE A 1 44  ? -6.595  7.927   -4.869  1.00 0.00 ? 44  ILE A HG23 8  
ATOM 10738 H HD11 . ILE A 1 44  ? -3.236  10.019  -6.710  1.00 0.00 ? 44  ILE A HD11 8  
ATOM 10739 H HD12 . ILE A 1 44  ? -3.629  10.041  -4.991  1.00 0.00 ? 44  ILE A HD12 8  
ATOM 10740 H HD13 . ILE A 1 44  ? -2.016  9.566   -5.521  1.00 0.00 ? 44  ILE A HD13 8  
ATOM 10741 N N    . VAL A 1 45  ? -7.550  5.967   -5.472  1.00 0.00 ? 45  VAL A N    8  
ATOM 10742 C CA   . VAL A 1 45  ? -9.000  5.813   -5.507  1.00 0.00 ? 45  VAL A CA   8  
ATOM 10743 C C    . VAL A 1 45  ? -9.697  7.168   -5.446  1.00 0.00 ? 45  VAL A C    8  
ATOM 10744 O O    . VAL A 1 45  ? -9.166  8.128   -4.888  1.00 0.00 ? 45  VAL A O    8  
ATOM 10745 C CB   . VAL A 1 45  ? -9.499  4.938   -4.343  1.00 0.00 ? 45  VAL A CB   8  
ATOM 10746 C CG1  . VAL A 1 45  ? -8.794  3.590   -4.347  1.00 0.00 ? 45  VAL A CG1  8  
ATOM 10747 C CG2  . VAL A 1 45  ? -9.296  5.651   -3.015  1.00 0.00 ? 45  VAL A CG2  8  
ATOM 10748 H H    . VAL A 1 45  ? -7.073  5.811   -4.630  1.00 0.00 ? 45  VAL A H    8  
ATOM 10749 H HA   . VAL A 1 45  ? -9.262  5.326   -6.435  1.00 0.00 ? 45  VAL A HA   8  
ATOM 10750 H HB   . VAL A 1 45  ? -10.557 4.766   -4.477  1.00 0.00 ? 45  VAL A HB   8  
ATOM 10751 H HG11 . VAL A 1 45  ? -8.693  3.241   -5.364  1.00 0.00 ? 45  VAL A HG11 8  
ATOM 10752 H HG12 . VAL A 1 45  ? -7.816  3.694   -3.901  1.00 0.00 ? 45  VAL A HG12 8  
ATOM 10753 H HG13 . VAL A 1 45  ? -9.376  2.878   -3.779  1.00 0.00 ? 45  VAL A HG13 8  
ATOM 10754 H HG21 . VAL A 1 45  ? -9.034  6.683   -3.197  1.00 0.00 ? 45  VAL A HG21 8  
ATOM 10755 H HG22 . VAL A 1 45  ? -10.209 5.608   -2.439  1.00 0.00 ? 45  VAL A HG22 8  
ATOM 10756 H HG23 . VAL A 1 45  ? -8.502  5.169   -2.465  1.00 0.00 ? 45  VAL A HG23 8  
ATOM 10757 N N    . THR A 1 46  ? -10.892 7.238   -6.023  1.00 0.00 ? 46  THR A N    8  
ATOM 10758 C CA   . THR A 1 46  ? -11.664 8.475   -6.036  1.00 0.00 ? 46  THR A CA   8  
ATOM 10759 C C    . THR A 1 46  ? -13.130 8.212   -5.711  1.00 0.00 ? 46  THR A C    8  
ATOM 10760 O O    . THR A 1 46  ? -13.626 7.100   -5.895  1.00 0.00 ? 46  THR A O    8  
ATOM 10761 C CB   . THR A 1 46  ? -11.571 9.181   -7.401  1.00 0.00 ? 46  THR A CB   8  
ATOM 10762 O OG1  . THR A 1 46  ? -12.069 8.322   -8.432  1.00 0.00 ? 46  THR A OG1  8  
ATOM 10763 C CG2  . THR A 1 46  ? -10.134 9.573   -7.711  1.00 0.00 ? 46  THR A CG2  8  
ATOM 10764 H H    . THR A 1 46  ? -11.263 6.439   -6.452  1.00 0.00 ? 46  THR A H    8  
ATOM 10765 H HA   . THR A 1 46  ? -11.251 9.133   -5.284  1.00 0.00 ? 46  THR A HA   8  
ATOM 10766 H HB   . THR A 1 46  ? -12.173 10.078  -7.367  1.00 0.00 ? 46  THR A HB   8  
ATOM 10767 H HG1  . THR A 1 46  ? -11.967 7.406   -8.163  1.00 0.00 ? 46  THR A HG1  8  
ATOM 10768 H HG21 . THR A 1 46  ? -10.120 10.266  -8.539  1.00 0.00 ? 46  THR A HG21 8  
ATOM 10769 H HG22 . THR A 1 46  ? -9.568  8.691   -7.970  1.00 0.00 ? 46  THR A HG22 8  
ATOM 10770 H HG23 . THR A 1 46  ? -9.694  10.042  -6.843  1.00 0.00 ? 46  THR A HG23 8  
ATOM 10771 N N    . ASP A 1 47  ? -13.818 9.241   -5.228  1.00 0.00 ? 47  ASP A N    8  
ATOM 10772 C CA   . ASP A 1 47  ? -15.229 9.121   -4.880  1.00 0.00 ? 47  ASP A CA   8  
ATOM 10773 C C    . ASP A 1 47  ? -16.102 9.155   -6.130  1.00 0.00 ? 47  ASP A C    8  
ATOM 10774 O O    . ASP A 1 47  ? -15.745 9.776   -7.131  1.00 0.00 ? 47  ASP A O    8  
ATOM 10775 C CB   . ASP A 1 47  ? -15.637 10.244  -3.926  1.00 0.00 ? 47  ASP A CB   8  
ATOM 10776 C CG   . ASP A 1 47  ? -16.950 9.959   -3.223  1.00 0.00 ? 47  ASP A CG   8  
ATOM 10777 O OD1  . ASP A 1 47  ? -17.059 8.893   -2.582  1.00 0.00 ? 47  ASP A OD1  8  
ATOM 10778 O OD2  . ASP A 1 47  ? -17.869 10.800  -3.316  1.00 0.00 ? 47  ASP A OD2  8  
ATOM 10779 H H    . ASP A 1 47  ? -13.366 10.102  -5.104  1.00 0.00 ? 47  ASP A H    8  
ATOM 10780 H HA   . ASP A 1 47  ? -15.368 8.172   -4.384  1.00 0.00 ? 47  ASP A HA   8  
ATOM 10781 H HB2  . ASP A 1 47  ? -14.869 10.369  -3.176  1.00 0.00 ? 47  ASP A HB2  8  
ATOM 10782 H HB3  . ASP A 1 47  ? -15.741 11.163  -4.485  1.00 0.00 ? 47  ASP A HB3  8  
ATOM 10783 N N    . ARG A 1 48  ? -17.247 8.483   -6.064  1.00 0.00 ? 48  ARG A N    8  
ATOM 10784 C CA   . ARG A 1 48  ? -18.170 8.435   -7.192  1.00 0.00 ? 48  ARG A CA   8  
ATOM 10785 C C    . ARG A 1 48  ? -19.167 9.587   -7.127  1.00 0.00 ? 48  ARG A C    8  
ATOM 10786 O O    . ARG A 1 48  ? -19.942 9.803   -8.059  1.00 0.00 ? 48  ARG A O    8  
ATOM 10787 C CB   . ARG A 1 48  ? -18.917 7.100   -7.209  1.00 0.00 ? 48  ARG A CB   8  
ATOM 10788 C CG   . ARG A 1 48  ? -19.516 6.719   -5.865  1.00 0.00 ? 48  ARG A CG   8  
ATOM 10789 C CD   . ARG A 1 48  ? -18.561 5.859   -5.053  1.00 0.00 ? 48  ARG A CD   8  
ATOM 10790 N NE   . ARG A 1 48  ? -18.764 4.434   -5.300  1.00 0.00 ? 48  ARG A NE   8  
ATOM 10791 C CZ   . ARG A 1 48  ? -19.900 3.797   -5.035  1.00 0.00 ? 48  ARG A CZ   8  
ATOM 10792 N NH1  . ARG A 1 48  ? -20.929 4.455   -4.520  1.00 0.00 ? 48  ARG A NH1  8  
ATOM 10793 N NH2  . ARG A 1 48  ? -20.008 2.498   -5.287  1.00 0.00 ? 48  ARG A NH2  8  
ATOM 10794 H H    . ARG A 1 48  ? -17.476 8.008   -5.238  1.00 0.00 ? 48  ARG A H    8  
ATOM 10795 H HA   . ARG A 1 48  ? -17.591 8.525   -8.099  1.00 0.00 ? 48  ARG A HA   8  
ATOM 10796 H HB2  . ARG A 1 48  ? -19.718 7.158   -7.932  1.00 0.00 ? 48  ARG A HB2  8  
ATOM 10797 H HB3  . ARG A 1 48  ? -18.231 6.321   -7.507  1.00 0.00 ? 48  ARG A HB3  8  
ATOM 10798 H HG2  . ARG A 1 48  ? -19.732 7.620   -5.310  1.00 0.00 ? 48  ARG A HG2  8  
ATOM 10799 H HG3  . ARG A 1 48  ? -20.430 6.169   -6.032  1.00 0.00 ? 48  ARG A HG3  8  
ATOM 10800 H HD2  . ARG A 1 48  ? -17.548 6.119   -5.320  1.00 0.00 ? 48  ARG A HD2  8  
ATOM 10801 H HD3  . ARG A 1 48  ? -18.720 6.060   -4.004  1.00 0.00 ? 48  ARG A HD3  8  
ATOM 10802 H HE   . ARG A 1 48  ? -18.017 3.928   -5.680  1.00 0.00 ? 48  ARG A HE   8  
ATOM 10803 H HH11 . ARG A 1 48  ? -20.850 5.434   -4.330  1.00 0.00 ? 48  ARG A HH11 8  
ATOM 10804 H HH12 . ARG A 1 48  ? -21.783 3.974   -4.323  1.00 0.00 ? 48  ARG A HH12 8  
ATOM 10805 H HH21 . ARG A 1 48  ? -19.234 1.999   -5.676  1.00 0.00 ? 48  ARG A HH21 8  
ATOM 10806 H HH22 . ARG A 1 48  ? -20.862 2.020   -5.088  1.00 0.00 ? 48  ARG A HH22 8  
ATOM 10807 N N    . GLU A 1 49  ? -19.143 10.324  -6.021  1.00 0.00 ? 49  GLU A N    8  
ATOM 10808 C CA   . GLU A 1 49  ? -20.046 11.453  -5.835  1.00 0.00 ? 49  GLU A CA   8  
ATOM 10809 C C    . GLU A 1 49  ? -19.319 12.775  -6.067  1.00 0.00 ? 49  GLU A C    8  
ATOM 10810 O O    . GLU A 1 49  ? -19.780 13.626  -6.829  1.00 0.00 ? 49  GLU A O    8  
ATOM 10811 C CB   . GLU A 1 49  ? -20.647 11.429  -4.428  1.00 0.00 ? 49  GLU A CB   8  
ATOM 10812 C CG   . GLU A 1 49  ? -21.835 12.361  -4.257  1.00 0.00 ? 49  GLU A CG   8  
ATOM 10813 C CD   . GLU A 1 49  ? -23.083 11.846  -4.947  1.00 0.00 ? 49  GLU A CD   8  
ATOM 10814 O OE1  . GLU A 1 49  ? -23.314 10.619  -4.921  1.00 0.00 ? 49  GLU A OE1  8  
ATOM 10815 O OE2  . GLU A 1 49  ? -23.831 12.672  -5.513  1.00 0.00 ? 49  GLU A OE2  8  
ATOM 10816 H H    . GLU A 1 49  ? -18.502 10.102  -5.313  1.00 0.00 ? 49  GLU A H    8  
ATOM 10817 H HA   . GLU A 1 49  ? -20.843 11.363  -6.558  1.00 0.00 ? 49  GLU A HA   8  
ATOM 10818 H HB2  . GLU A 1 49  ? -20.969 10.423  -4.205  1.00 0.00 ? 49  GLU A HB2  8  
ATOM 10819 H HB3  . GLU A 1 49  ? -19.884 11.718  -3.720  1.00 0.00 ? 49  GLU A HB3  8  
ATOM 10820 H HG2  . GLU A 1 49  ? -22.043 12.468  -3.203  1.00 0.00 ? 49  GLU A HG2  8  
ATOM 10821 H HG3  . GLU A 1 49  ? -21.582 13.325  -4.674  1.00 0.00 ? 49  GLU A HG3  8  
ATOM 10822 N N    . THR A 1 50  ? -18.179 12.941  -5.404  1.00 0.00 ? 50  THR A N    8  
ATOM 10823 C CA   . THR A 1 50  ? -17.389 14.159  -5.535  1.00 0.00 ? 50  THR A CA   8  
ATOM 10824 C C    . THR A 1 50  ? -16.380 14.039  -6.671  1.00 0.00 ? 50  THR A C    8  
ATOM 10825 O O    . THR A 1 50  ? -15.893 15.043  -7.190  1.00 0.00 ? 50  THR A O    8  
ATOM 10826 C CB   . THR A 1 50  ? -16.639 14.485  -4.230  1.00 0.00 ? 50  THR A CB   8  
ATOM 10827 O OG1  . THR A 1 50  ? -15.687 13.455  -3.941  1.00 0.00 ? 50  THR A OG1  8  
ATOM 10828 C CG2  . THR A 1 50  ? -17.611 14.625  -3.068  1.00 0.00 ? 50  THR A CG2  8  
ATOM 10829 H H    . THR A 1 50  ? -17.864 12.227  -4.812  1.00 0.00 ? 50  THR A H    8  
ATOM 10830 H HA   . THR A 1 50  ? -18.065 14.973  -5.751  1.00 0.00 ? 50  THR A HA   8  
ATOM 10831 H HB   . THR A 1 50  ? -16.116 15.422  -4.358  1.00 0.00 ? 50  THR A HB   8  
ATOM 10832 H HG1  . THR A 1 50  ? -14.798 13.795  -4.068  1.00 0.00 ? 50  THR A HG1  8  
ATOM 10833 H HG21 . THR A 1 50  ? -17.716 15.669  -2.811  1.00 0.00 ? 50  THR A HG21 8  
ATOM 10834 H HG22 . THR A 1 50  ? -17.233 14.080  -2.215  1.00 0.00 ? 50  THR A HG22 8  
ATOM 10835 H HG23 . THR A 1 50  ? -18.572 14.226  -3.353  1.00 0.00 ? 50  THR A HG23 8  
ATOM 10836 N N    . GLY A 1 51  ? -16.070 12.804  -7.055  1.00 0.00 ? 51  GLY A N    8  
ATOM 10837 C CA   . GLY A 1 51  ? -15.120 12.577  -8.128  1.00 0.00 ? 51  GLY A CA   8  
ATOM 10838 C C    . GLY A 1 51  ? -13.726 13.060  -7.781  1.00 0.00 ? 51  GLY A C    8  
ATOM 10839 O O    . GLY A 1 51  ? -12.998 13.548  -8.645  1.00 0.00 ? 51  GLY A O    8  
ATOM 10840 H H    . GLY A 1 51  ? -16.490 12.041  -6.605  1.00 0.00 ? 51  GLY A H    8  
ATOM 10841 H HA2  . GLY A 1 51  ? -15.081 11.519  -8.341  1.00 0.00 ? 51  GLY A HA2  8  
ATOM 10842 H HA3  . GLY A 1 51  ? -15.460 13.099  -9.011  1.00 0.00 ? 51  GLY A HA3  8  
ATOM 10843 N N    . SER A 1 52  ? -13.354 12.926  -6.512  1.00 0.00 ? 52  SER A N    8  
ATOM 10844 C CA   . SER A 1 52  ? -12.040 13.358  -6.051  1.00 0.00 ? 52  SER A CA   8  
ATOM 10845 C C    . SER A 1 52  ? -11.330 12.234  -5.302  1.00 0.00 ? 52  SER A C    8  
ATOM 10846 O O    . SER A 1 52  ? -11.955 11.257  -4.890  1.00 0.00 ? 52  SER A O    8  
ATOM 10847 C CB   . SER A 1 52  ? -12.170 14.585  -5.148  1.00 0.00 ? 52  SER A CB   8  
ATOM 10848 O OG   . SER A 1 52  ? -10.920 15.231  -4.981  1.00 0.00 ? 52  SER A OG   8  
ATOM 10849 H H    . SER A 1 52  ? -13.980 12.529  -5.870  1.00 0.00 ? 52  SER A H    8  
ATOM 10850 H HA   . SER A 1 52  ? -11.454 13.621  -6.920  1.00 0.00 ? 52  SER A HA   8  
ATOM 10851 H HB2  . SER A 1 52  ? -12.866 15.282  -5.590  1.00 0.00 ? 52  SER A HB2  8  
ATOM 10852 H HB3  . SER A 1 52  ? -12.535 14.278  -4.178  1.00 0.00 ? 52  SER A HB3  8  
ATOM 10853 H HG   . SER A 1 52  ? -11.063 16.164  -4.803  1.00 0.00 ? 52  SER A HG   8  
ATOM 10854 N N    . SER A 1 53  ? -10.020 12.380  -5.130  1.00 0.00 ? 53  SER A N    8  
ATOM 10855 C CA   . SER A 1 53  ? -9.224  11.376  -4.434  1.00 0.00 ? 53  SER A CA   8  
ATOM 10856 C C    . SER A 1 53  ? -9.620  11.293  -2.963  1.00 0.00 ? 53  SER A C    8  
ATOM 10857 O O    . SER A 1 53  ? -9.362  12.211  -2.185  1.00 0.00 ? 53  SER A O    8  
ATOM 10858 C CB   . SER A 1 53  ? -7.734  11.703  -4.555  1.00 0.00 ? 53  SER A CB   8  
ATOM 10859 O OG   . SER A 1 53  ? -7.349  11.834  -5.913  1.00 0.00 ? 53  SER A OG   8  
ATOM 10860 H H    . SER A 1 53  ? -9.579  13.181  -5.482  1.00 0.00 ? 53  SER A H    8  
ATOM 10861 H HA   . SER A 1 53  ? -9.413  10.421  -4.901  1.00 0.00 ? 53  SER A HA   8  
ATOM 10862 H HB2  . SER A 1 53  ? -7.529  12.632  -4.044  1.00 0.00 ? 53  SER A HB2  8  
ATOM 10863 H HB3  . SER A 1 53  ? -7.157  10.909  -4.104  1.00 0.00 ? 53  SER A HB3  8  
ATOM 10864 H HG   . SER A 1 53  ? -7.939  12.449  -6.355  1.00 0.00 ? 53  SER A HG   8  
ATOM 10865 N N    . LYS A 1 54  ? -10.250 10.184  -2.589  1.00 0.00 ? 54  LYS A N    8  
ATOM 10866 C CA   . LYS A 1 54  ? -10.682 9.977   -1.212  1.00 0.00 ? 54  LYS A CA   8  
ATOM 10867 C C    . LYS A 1 54  ? -9.532  10.218  -0.239  1.00 0.00 ? 54  LYS A C    8  
ATOM 10868 O O    . LYS A 1 54  ? -9.650  11.013  0.692   1.00 0.00 ? 54  LYS A O    8  
ATOM 10869 C CB   . LYS A 1 54  ? -11.225 8.557   -1.034  1.00 0.00 ? 54  LYS A CB   8  
ATOM 10870 C CG   . LYS A 1 54  ? -12.338 8.206   -2.007  1.00 0.00 ? 54  LYS A CG   8  
ATOM 10871 C CD   . LYS A 1 54  ? -12.872 6.805   -1.760  1.00 0.00 ? 54  LYS A CD   8  
ATOM 10872 C CE   . LYS A 1 54  ? -13.995 6.459   -2.726  1.00 0.00 ? 54  LYS A CE   8  
ATOM 10873 N NZ   . LYS A 1 54  ? -14.687 5.197   -2.343  1.00 0.00 ? 54  LYS A NZ   8  
ATOM 10874 H H    . LYS A 1 54  ? -10.427 9.487   -3.256  1.00 0.00 ? 54  LYS A H    8  
ATOM 10875 H HA   . LYS A 1 54  ? -11.470 10.684  -1.001  1.00 0.00 ? 54  LYS A HA   8  
ATOM 10876 H HB2  . LYS A 1 54  ? -10.417 7.855   -1.175  1.00 0.00 ? 54  LYS A HB2  8  
ATOM 10877 H HB3  . LYS A 1 54  ? -11.609 8.455   -0.029  1.00 0.00 ? 54  LYS A HB3  8  
ATOM 10878 H HG2  . LYS A 1 54  ? -13.145 8.913   -1.888  1.00 0.00 ? 54  LYS A HG2  8  
ATOM 10879 H HG3  . LYS A 1 54  ? -11.953 8.262   -3.015  1.00 0.00 ? 54  LYS A HG3  8  
ATOM 10880 H HD2  . LYS A 1 54  ? -12.069 6.094   -1.890  1.00 0.00 ? 54  LYS A HD2  8  
ATOM 10881 H HD3  . LYS A 1 54  ? -13.248 6.746   -0.748  1.00 0.00 ? 54  LYS A HD3  8  
ATOM 10882 H HE2  . LYS A 1 54  ? -14.712 7.266   -2.728  1.00 0.00 ? 54  LYS A HE2  8  
ATOM 10883 H HE3  . LYS A 1 54  ? -13.578 6.345   -3.716  1.00 0.00 ? 54  LYS A HE3  8  
ATOM 10884 H HZ1  . LYS A 1 54  ? -14.631 5.057   -1.314  1.00 0.00 ? 54  LYS A HZ1  8  
ATOM 10885 H HZ2  . LYS A 1 54  ? -14.239 4.386   -2.816  1.00 0.00 ? 54  LYS A HZ2  8  
ATOM 10886 H HZ3  . LYS A 1 54  ? -15.687 5.238   -2.623  1.00 0.00 ? 54  LYS A HZ3  8  
ATOM 10887 N N    . GLY A 1 55  ? -8.419  9.526   -0.462  1.00 0.00 ? 55  GLY A N    8  
ATOM 10888 C CA   . GLY A 1 55  ? -7.264  9.680   0.403   1.00 0.00 ? 55  GLY A CA   8  
ATOM 10889 C C    . GLY A 1 55  ? -6.483  8.390   0.563   1.00 0.00 ? 55  GLY A C    8  
ATOM 10890 O O    . GLY A 1 55  ? -5.917  8.127   1.624   1.00 0.00 ? 55  GLY A O    8  
ATOM 10891 H H    . GLY A 1 55  ? -8.382  8.905   -1.220  1.00 0.00 ? 55  GLY A H    8  
ATOM 10892 H HA2  . GLY A 1 55  ? -6.613  10.433  -0.015  1.00 0.00 ? 55  GLY A HA2  8  
ATOM 10893 H HA3  . GLY A 1 55  ? -7.598  10.007  1.376   1.00 0.00 ? 55  GLY A HA3  8  
ATOM 10894 N N    . PHE A 1 56  ? -6.453  7.584   -0.492  1.00 0.00 ? 56  PHE A N    8  
ATOM 10895 C CA   . PHE A 1 56  ? -5.738  6.313   -0.464  1.00 0.00 ? 56  PHE A CA   8  
ATOM 10896 C C    . PHE A 1 56  ? -5.677  5.692   -1.856  1.00 0.00 ? 56  PHE A C    8  
ATOM 10897 O O    . PHE A 1 56  ? -6.486  6.010   -2.726  1.00 0.00 ? 56  PHE A O    8  
ATOM 10898 C CB   . PHE A 1 56  ? -6.414  5.345   0.510   1.00 0.00 ? 56  PHE A CB   8  
ATOM 10899 C CG   . PHE A 1 56  ? -7.876  5.140   0.233   1.00 0.00 ? 56  PHE A CG   8  
ATOM 10900 C CD1  . PHE A 1 56  ? -8.809  6.086   0.627   1.00 0.00 ? 56  PHE A CD1  8  
ATOM 10901 C CD2  . PHE A 1 56  ? -8.318  4.002   -0.422  1.00 0.00 ? 56  PHE A CD2  8  
ATOM 10902 C CE1  . PHE A 1 56  ? -10.155 5.899   0.373   1.00 0.00 ? 56  PHE A CE1  8  
ATOM 10903 C CE2  . PHE A 1 56  ? -9.663  3.810   -0.679  1.00 0.00 ? 56  PHE A CE2  8  
ATOM 10904 C CZ   . PHE A 1 56  ? -10.582 4.760   -0.281  1.00 0.00 ? 56  PHE A CZ   8  
ATOM 10905 H H    . PHE A 1 56  ? -6.924  7.849   -1.310  1.00 0.00 ? 56  PHE A H    8  
ATOM 10906 H HA   . PHE A 1 56  ? -4.733  6.507   -0.124  1.00 0.00 ? 56  PHE A HA   8  
ATOM 10907 H HB2  . PHE A 1 56  ? -5.927  4.384   0.447   1.00 0.00 ? 56  PHE A HB2  8  
ATOM 10908 H HB3  . PHE A 1 56  ? -6.316  5.729   1.514   1.00 0.00 ? 56  PHE A HB3  8  
ATOM 10909 H HD1  . PHE A 1 56  ? -8.477  6.978   1.137   1.00 0.00 ? 56  PHE A HD1  8  
ATOM 10910 H HD2  . PHE A 1 56  ? -7.599  3.257   -0.734  1.00 0.00 ? 56  PHE A HD2  8  
ATOM 10911 H HE1  . PHE A 1 56  ? -10.872 6.644   0.685   1.00 0.00 ? 56  PHE A HE1  8  
ATOM 10912 H HE2  . PHE A 1 56  ? -9.993  2.918   -1.190  1.00 0.00 ? 56  PHE A HE2  8  
ATOM 10913 H HZ   . PHE A 1 56  ? -11.633 4.612   -0.480  1.00 0.00 ? 56  PHE A HZ   8  
ATOM 10914 N N    . GLY A 1 57  ? -4.709  4.803   -2.059  1.00 0.00 ? 57  GLY A N    8  
ATOM 10915 C CA   . GLY A 1 57  ? -4.559  4.151   -3.347  1.00 0.00 ? 57  GLY A CA   8  
ATOM 10916 C C    . GLY A 1 57  ? -3.787  2.850   -3.251  1.00 0.00 ? 57  GLY A C    8  
ATOM 10917 O O    . GLY A 1 57  ? -3.931  2.103   -2.283  1.00 0.00 ? 57  GLY A O    8  
ATOM 10918 H H    . GLY A 1 57  ? -4.093  4.587   -1.328  1.00 0.00 ? 57  GLY A H    8  
ATOM 10919 H HA2  . GLY A 1 57  ? -5.539  3.947   -3.752  1.00 0.00 ? 57  GLY A HA2  8  
ATOM 10920 H HA3  . GLY A 1 57  ? -4.035  4.818   -4.016  1.00 0.00 ? 57  GLY A HA3  8  
ATOM 10921 N N    . PHE A 1 58  ? -2.965  2.576   -4.259  1.00 0.00 ? 58  PHE A N    8  
ATOM 10922 C CA   . PHE A 1 58  ? -2.170  1.354   -4.287  1.00 0.00 ? 58  PHE A CA   8  
ATOM 10923 C C    . PHE A 1 58  ? -0.935  1.529   -5.166  1.00 0.00 ? 58  PHE A C    8  
ATOM 10924 O O    . PHE A 1 58  ? -0.998  2.145   -6.230  1.00 0.00 ? 58  PHE A O    8  
ATOM 10925 C CB   . PHE A 1 58  ? -3.012  0.183   -4.797  1.00 0.00 ? 58  PHE A CB   8  
ATOM 10926 C CG   . PHE A 1 58  ? -4.309  0.011   -4.061  1.00 0.00 ? 58  PHE A CG   8  
ATOM 10927 C CD1  . PHE A 1 58  ? -5.358  0.894   -4.263  1.00 0.00 ? 58  PHE A CD1  8  
ATOM 10928 C CD2  . PHE A 1 58  ? -4.481  -1.033  -3.166  1.00 0.00 ? 58  PHE A CD2  8  
ATOM 10929 C CE1  . PHE A 1 58  ? -6.553  0.739   -3.586  1.00 0.00 ? 58  PHE A CE1  8  
ATOM 10930 C CE2  . PHE A 1 58  ? -5.674  -1.193  -2.487  1.00 0.00 ? 58  PHE A CE2  8  
ATOM 10931 C CZ   . PHE A 1 58  ? -6.711  -0.307  -2.698  1.00 0.00 ? 58  PHE A CZ   8  
ATOM 10932 H H    . PHE A 1 58  ? -2.893  3.210   -5.003  1.00 0.00 ? 58  PHE A H    8  
ATOM 10933 H HA   . PHE A 1 58  ? -1.851  1.144   -3.277  1.00 0.00 ? 58  PHE A HA   8  
ATOM 10934 H HB2  . PHE A 1 58  ? -3.241  0.342   -5.840  1.00 0.00 ? 58  PHE A HB2  8  
ATOM 10935 H HB3  . PHE A 1 58  ? -2.446  -0.730  -4.692  1.00 0.00 ? 58  PHE A HB3  8  
ATOM 10936 H HD1  . PHE A 1 58  ? -5.236  1.712   -4.958  1.00 0.00 ? 58  PHE A HD1  8  
ATOM 10937 H HD2  . PHE A 1 58  ? -3.669  -1.728  -3.001  1.00 0.00 ? 58  PHE A HD2  8  
ATOM 10938 H HE1  . PHE A 1 58  ? -7.362  1.434   -3.753  1.00 0.00 ? 58  PHE A HE1  8  
ATOM 10939 H HE2  . PHE A 1 58  ? -5.794  -2.012  -1.793  1.00 0.00 ? 58  PHE A HE2  8  
ATOM 10940 H HZ   . PHE A 1 58  ? -7.643  -0.430  -2.167  1.00 0.00 ? 58  PHE A HZ   8  
ATOM 10941 N N    . VAL A 1 59  ? 0.189   0.982   -4.713  1.00 0.00 ? 59  VAL A N    8  
ATOM 10942 C CA   . VAL A 1 59  ? 1.439   1.076   -5.457  1.00 0.00 ? 59  VAL A CA   8  
ATOM 10943 C C    . VAL A 1 59  ? 1.843   -0.279  -6.027  1.00 0.00 ? 59  VAL A C    8  
ATOM 10944 O O    . VAL A 1 59  ? 2.030   -1.244  -5.286  1.00 0.00 ? 59  VAL A O    8  
ATOM 10945 C CB   . VAL A 1 59  ? 2.581   1.610   -4.571  1.00 0.00 ? 59  VAL A CB   8  
ATOM 10946 C CG1  . VAL A 1 59  ? 3.846   1.807   -5.392  1.00 0.00 ? 59  VAL A CG1  8  
ATOM 10947 C CG2  . VAL A 1 59  ? 2.167   2.907   -3.894  1.00 0.00 ? 59  VAL A CG2  8  
ATOM 10948 H H    . VAL A 1 59  ? 0.177   0.503   -3.858  1.00 0.00 ? 59  VAL A H    8  
ATOM 10949 H HA   . VAL A 1 59  ? 1.291   1.769   -6.273  1.00 0.00 ? 59  VAL A HA   8  
ATOM 10950 H HB   . VAL A 1 59  ? 2.786   0.877   -3.804  1.00 0.00 ? 59  VAL A HB   8  
ATOM 10951 H HG11 . VAL A 1 59  ? 4.410   0.886   -5.411  1.00 0.00 ? 59  VAL A HG11 8  
ATOM 10952 H HG12 . VAL A 1 59  ? 3.581   2.089   -6.401  1.00 0.00 ? 59  VAL A HG12 8  
ATOM 10953 H HG13 . VAL A 1 59  ? 4.447   2.586   -4.946  1.00 0.00 ? 59  VAL A HG13 8  
ATOM 10954 H HG21 . VAL A 1 59  ? 2.135   2.760   -2.825  1.00 0.00 ? 59  VAL A HG21 8  
ATOM 10955 H HG22 . VAL A 1 59  ? 2.884   3.681   -4.129  1.00 0.00 ? 59  VAL A HG22 8  
ATOM 10956 H HG23 . VAL A 1 59  ? 1.191   3.203   -4.247  1.00 0.00 ? 59  VAL A HG23 8  
ATOM 10957 N N    . ASP A 1 60  ? 1.976   -0.343  -7.347  1.00 0.00 ? 60  ASP A N    8  
ATOM 10958 C CA   . ASP A 1 60  ? 2.360   -1.580  -8.017  1.00 0.00 ? 60  ASP A CA   8  
ATOM 10959 C C    . ASP A 1 60  ? 3.866   -1.803  -7.925  1.00 0.00 ? 60  ASP A C    8  
ATOM 10960 O O    . ASP A 1 60  ? 4.645   -0.850  -7.896  1.00 0.00 ? 60  ASP A O    8  
ATOM 10961 C CB   . ASP A 1 60  ? 1.925   -1.547  -9.483  1.00 0.00 ? 60  ASP A CB   8  
ATOM 10962 C CG   . ASP A 1 60  ? 1.652   -2.932  -10.037 1.00 0.00 ? 60  ASP A CG   8  
ATOM 10963 O OD1  . ASP A 1 60  ? 2.556   -3.790  -9.962  1.00 0.00 ? 60  ASP A OD1  8  
ATOM 10964 O OD2  . ASP A 1 60  ? 0.533   -3.157  -10.545 1.00 0.00 ? 60  ASP A OD2  8  
ATOM 10965 H H    . ASP A 1 60  ? 1.813   0.461   -7.884  1.00 0.00 ? 60  ASP A H    8  
ATOM 10966 H HA   . ASP A 1 60  ? 1.857   -2.396  -7.520  1.00 0.00 ? 60  ASP A HA   8  
ATOM 10967 H HB2  . ASP A 1 60  ? 1.022   -0.960  -9.571  1.00 0.00 ? 60  ASP A HB2  8  
ATOM 10968 H HB3  . ASP A 1 60  ? 2.706   -1.090  -10.073 1.00 0.00 ? 60  ASP A HB3  8  
ATOM 10969 N N    . PHE A 1 61  ? 4.270   -3.069  -7.879  1.00 0.00 ? 61  PHE A N    8  
ATOM 10970 C CA   . PHE A 1 61  ? 5.683   -3.417  -7.788  1.00 0.00 ? 61  PHE A CA   8  
ATOM 10971 C C    . PHE A 1 61  ? 6.012   -4.598  -8.696  1.00 0.00 ? 61  PHE A C    8  
ATOM 10972 O O    . PHE A 1 61  ? 5.180   -5.479  -8.912  1.00 0.00 ? 61  PHE A O    8  
ATOM 10973 C CB   . PHE A 1 61  ? 6.056   -3.752  -6.342  1.00 0.00 ? 61  PHE A CB   8  
ATOM 10974 C CG   . PHE A 1 61  ? 6.145   -2.546  -5.452  1.00 0.00 ? 61  PHE A CG   8  
ATOM 10975 C CD1  . PHE A 1 61  ? 7.327   -1.830  -5.349  1.00 0.00 ? 61  PHE A CD1  8  
ATOM 10976 C CD2  . PHE A 1 61  ? 5.048   -2.128  -4.716  1.00 0.00 ? 61  PHE A CD2  8  
ATOM 10977 C CE1  . PHE A 1 61  ? 7.413   -0.719  -4.531  1.00 0.00 ? 61  PHE A CE1  8  
ATOM 10978 C CE2  . PHE A 1 61  ? 5.127   -1.018  -3.897  1.00 0.00 ? 61  PHE A CE2  8  
ATOM 10979 C CZ   . PHE A 1 61  ? 6.311   -0.314  -3.803  1.00 0.00 ? 61  PHE A CZ   8  
ATOM 10980 H H    . PHE A 1 61  ? 3.602   -3.785  -7.905  1.00 0.00 ? 61  PHE A H    8  
ATOM 10981 H HA   . PHE A 1 61  ? 6.256   -2.561  -8.110  1.00 0.00 ? 61  PHE A HA   8  
ATOM 10982 H HB2  . PHE A 1 61  ? 5.310   -4.414  -5.930  1.00 0.00 ? 61  PHE A HB2  8  
ATOM 10983 H HB3  . PHE A 1 61  ? 7.016   -4.246  -6.331  1.00 0.00 ? 61  PHE A HB3  8  
ATOM 10984 H HD1  . PHE A 1 61  ? 8.190   -2.147  -5.918  1.00 0.00 ? 61  PHE A HD1  8  
ATOM 10985 H HD2  . PHE A 1 61  ? 4.121   -2.679  -4.788  1.00 0.00 ? 61  PHE A HD2  8  
ATOM 10986 H HE1  . PHE A 1 61  ? 8.340   -0.171  -4.460  1.00 0.00 ? 61  PHE A HE1  8  
ATOM 10987 H HE2  . PHE A 1 61  ? 4.265   -0.704  -3.328  1.00 0.00 ? 61  PHE A HE2  8  
ATOM 10988 H HZ   . PHE A 1 61  ? 6.376   0.554   -3.163  1.00 0.00 ? 61  PHE A HZ   8  
ATOM 10989 N N    . ASN A 1 62  ? 7.230   -4.609  -9.226  1.00 0.00 ? 62  ASN A N    8  
ATOM 10990 C CA   . ASN A 1 62  ? 7.669   -5.681  -10.112 1.00 0.00 ? 62  ASN A CA   8  
ATOM 10991 C C    . ASN A 1 62  ? 7.482   -7.044  -9.452  1.00 0.00 ? 62  ASN A C    8  
ATOM 10992 O O    . ASN A 1 62  ? 7.293   -8.053  -10.131 1.00 0.00 ? 62  ASN A O    8  
ATOM 10993 C CB   . ASN A 1 62  ? 9.137   -5.485  -10.496 1.00 0.00 ? 62  ASN A CB   8  
ATOM 10994 C CG   . ASN A 1 62  ? 9.300   -4.653  -11.753 1.00 0.00 ? 62  ASN A CG   8  
ATOM 10995 O OD1  . ASN A 1 62  ? 10.026  -3.658  -11.763 1.00 0.00 ? 62  ASN A OD1  8  
ATOM 10996 N ND2  . ASN A 1 62  ? 8.623   -5.057  -12.822 1.00 0.00 ? 62  ASN A ND2  8  
ATOM 10997 H H    . ASN A 1 62  ? 7.849   -3.879  -9.017  1.00 0.00 ? 62  ASN A H    8  
ATOM 10998 H HA   . ASN A 1 62  ? 7.064   -5.641  -11.006 1.00 0.00 ? 62  ASN A HA   8  
ATOM 10999 H HB2  . ASN A 1 62  ? 9.651   -4.984  -9.688  1.00 0.00 ? 62  ASN A HB2  8  
ATOM 11000 H HB3  . ASN A 1 62  ? 9.592   -6.450  -10.663 1.00 0.00 ? 62  ASN A HB3  8  
ATOM 11001 H HD21 . ASN A 1 62  ? 8.064   -5.858  -12.740 1.00 0.00 ? 62  ASN A HD21 8  
ATOM 11002 H HD22 . ASN A 1 62  ? 8.710   -4.537  -13.648 1.00 0.00 ? 62  ASN A HD22 8  
ATOM 11003 N N    . SER A 1 63  ? 7.537   -7.064  -8.124  1.00 0.00 ? 63  SER A N    8  
ATOM 11004 C CA   . SER A 1 63  ? 7.377   -8.303  -7.372  1.00 0.00 ? 63  SER A CA   8  
ATOM 11005 C C    . SER A 1 63  ? 7.180   -8.014  -5.886  1.00 0.00 ? 63  SER A C    8  
ATOM 11006 O O    . SER A 1 63  ? 7.532   -6.940  -5.400  1.00 0.00 ? 63  SER A O    8  
ATOM 11007 C CB   . SER A 1 63  ? 8.595   -9.206  -7.570  1.00 0.00 ? 63  SER A CB   8  
ATOM 11008 O OG   . SER A 1 63  ? 8.560   -9.840  -8.837  1.00 0.00 ? 63  SER A OG   8  
ATOM 11009 H H    . SER A 1 63  ? 7.691   -6.226  -7.639  1.00 0.00 ? 63  SER A H    8  
ATOM 11010 H HA   . SER A 1 63  ? 6.500   -8.808  -7.747  1.00 0.00 ? 63  SER A HA   8  
ATOM 11011 H HB2  . SER A 1 63  ? 9.495   -8.613  -7.503  1.00 0.00 ? 63  SER A HB2  8  
ATOM 11012 H HB3  . SER A 1 63  ? 8.606   -9.965  -6.801  1.00 0.00 ? 63  SER A HB3  8  
ATOM 11013 H HG   . SER A 1 63  ? 8.649   -10.789 -8.724  1.00 0.00 ? 63  SER A HG   8  
ATOM 11014 N N    . GLU A 1 64  ? 6.615   -8.983  -5.172  1.00 0.00 ? 64  GLU A N    8  
ATOM 11015 C CA   . GLU A 1 64  ? 6.370   -8.833  -3.742  1.00 0.00 ? 64  GLU A CA   8  
ATOM 11016 C C    . GLU A 1 64  ? 7.630   -8.362  -3.021  1.00 0.00 ? 64  GLU A C    8  
ATOM 11017 O O    . GLU A 1 64  ? 7.584   -7.436  -2.211  1.00 0.00 ? 64  GLU A O    8  
ATOM 11018 C CB   . GLU A 1 64  ? 5.890   -10.156 -3.143  1.00 0.00 ? 64  GLU A CB   8  
ATOM 11019 C CG   . GLU A 1 64  ? 4.462   -10.512 -3.518  1.00 0.00 ? 64  GLU A CG   8  
ATOM 11020 C CD   . GLU A 1 64  ? 4.225   -12.010 -3.556  1.00 0.00 ? 64  GLU A CD   8  
ATOM 11021 O OE1  . GLU A 1 64  ? 4.975   -12.712 -4.266  1.00 0.00 ? 64  GLU A OE1  8  
ATOM 11022 O OE2  . GLU A 1 64  ? 3.289   -12.479 -2.875  1.00 0.00 ? 64  GLU A OE2  8  
ATOM 11023 H H    . GLU A 1 64  ? 6.356   -9.817  -5.616  1.00 0.00 ? 64  GLU A H    8  
ATOM 11024 H HA   . GLU A 1 64  ? 5.598   -8.089  -3.614  1.00 0.00 ? 64  GLU A HA   8  
ATOM 11025 H HB2  . GLU A 1 64  ? 6.540   -10.949 -3.485  1.00 0.00 ? 64  GLU A HB2  8  
ATOM 11026 H HB3  . GLU A 1 64  ? 5.952   -10.092 -2.066  1.00 0.00 ? 64  GLU A HB3  8  
ATOM 11027 H HG2  . GLU A 1 64  ? 3.793   -10.076 -2.792  1.00 0.00 ? 64  GLU A HG2  8  
ATOM 11028 H HG3  . GLU A 1 64  ? 4.248   -10.104 -4.495  1.00 0.00 ? 64  GLU A HG3  8  
ATOM 11029 N N    . GLU A 1 65  ? 8.753   -9.006  -3.322  1.00 0.00 ? 65  GLU A N    8  
ATOM 11030 C CA   . GLU A 1 65  ? 10.024  -8.655  -2.701  1.00 0.00 ? 65  GLU A CA   8  
ATOM 11031 C C    . GLU A 1 65  ? 10.276  -7.152  -2.789  1.00 0.00 ? 65  GLU A C    8  
ATOM 11032 O O    . GLU A 1 65  ? 10.438  -6.478  -1.772  1.00 0.00 ? 65  GLU A O    8  
ATOM 11033 C CB   . GLU A 1 65  ? 11.171  -9.415  -3.370  1.00 0.00 ? 65  GLU A CB   8  
ATOM 11034 C CG   . GLU A 1 65  ? 11.233  -10.884 -2.987  1.00 0.00 ? 65  GLU A CG   8  
ATOM 11035 C CD   . GLU A 1 65  ? 12.626  -11.467 -3.133  1.00 0.00 ? 65  GLU A CD   8  
ATOM 11036 O OE1  . GLU A 1 65  ? 13.588  -10.836 -2.649  1.00 0.00 ? 65  GLU A OE1  8  
ATOM 11037 O OE2  . GLU A 1 65  ? 12.752  -12.555 -3.733  1.00 0.00 ? 65  GLU A OE2  8  
ATOM 11038 H H    . GLU A 1 65  ? 8.725   -9.736  -3.975  1.00 0.00 ? 65  GLU A H    8  
ATOM 11039 H HA   . GLU A 1 65  ? 9.976   -8.938  -1.661  1.00 0.00 ? 65  GLU A HA   8  
ATOM 11040 H HB2  . GLU A 1 65  ? 11.055  -9.348  -4.442  1.00 0.00 ? 65  GLU A HB2  8  
ATOM 11041 H HB3  . GLU A 1 65  ? 12.106  -8.952  -3.089  1.00 0.00 ? 65  GLU A HB3  8  
ATOM 11042 H HG2  . GLU A 1 65  ? 10.923  -10.988 -1.958  1.00 0.00 ? 65  GLU A HG2  8  
ATOM 11043 H HG3  . GLU A 1 65  ? 10.558  -11.437 -3.622  1.00 0.00 ? 65  GLU A HG3  8  
ATOM 11044 N N    . ASP A 1 66  ? 10.307  -6.635  -4.012  1.00 0.00 ? 66  ASP A N    8  
ATOM 11045 C CA   . ASP A 1 66  ? 10.538  -5.212  -4.235  1.00 0.00 ? 66  ASP A CA   8  
ATOM 11046 C C    . ASP A 1 66  ? 9.534   -4.370  -3.454  1.00 0.00 ? 66  ASP A C    8  
ATOM 11047 O O    . ASP A 1 66  ? 9.879   -3.320  -2.911  1.00 0.00 ? 66  ASP A O    8  
ATOM 11048 C CB   . ASP A 1 66  ? 10.444  -4.886  -5.727  1.00 0.00 ? 66  ASP A CB   8  
ATOM 11049 C CG   . ASP A 1 66  ? 11.583  -5.491  -6.524  1.00 0.00 ? 66  ASP A CG   8  
ATOM 11050 O OD1  . ASP A 1 66  ? 12.724  -5.000  -6.396  1.00 0.00 ? 66  ASP A OD1  8  
ATOM 11051 O OD2  . ASP A 1 66  ? 11.333  -6.457  -7.275  1.00 0.00 ? 66  ASP A OD2  8  
ATOM 11052 H H    . ASP A 1 66  ? 10.170  -7.223  -4.784  1.00 0.00 ? 66  ASP A H    8  
ATOM 11053 H HA   . ASP A 1 66  ? 11.532  -4.979  -3.887  1.00 0.00 ? 66  ASP A HA   8  
ATOM 11054 H HB2  . ASP A 1 66  ? 9.513   -5.271  -6.115  1.00 0.00 ? 66  ASP A HB2  8  
ATOM 11055 H HB3  . ASP A 1 66  ? 10.468  -3.814  -5.856  1.00 0.00 ? 66  ASP A HB3  8  
ATOM 11056 N N    . ALA A 1 67  ? 8.291   -4.837  -3.402  1.00 0.00 ? 67  ALA A N    8  
ATOM 11057 C CA   . ALA A 1 67  ? 7.237   -4.127  -2.687  1.00 0.00 ? 67  ALA A CA   8  
ATOM 11058 C C    . ALA A 1 67  ? 7.582   -3.978  -1.209  1.00 0.00 ? 67  ALA A C    8  
ATOM 11059 O O    . ALA A 1 67  ? 7.377   -2.918  -0.617  1.00 0.00 ? 67  ALA A O    8  
ATOM 11060 C CB   . ALA A 1 67  ? 5.909   -4.850  -2.851  1.00 0.00 ? 67  ALA A CB   8  
ATOM 11061 H H    . ALA A 1 67  ? 8.077   -5.679  -3.855  1.00 0.00 ? 67  ALA A H    8  
ATOM 11062 H HA   . ALA A 1 67  ? 7.141   -3.144  -3.125  1.00 0.00 ? 67  ALA A HA   8  
ATOM 11063 H HB1  . ALA A 1 67  ? 5.782   -5.138  -3.885  1.00 0.00 ? 67  ALA A HB1  8  
ATOM 11064 H HB2  . ALA A 1 67  ? 5.899   -5.731  -2.228  1.00 0.00 ? 67  ALA A HB2  8  
ATOM 11065 H HB3  . ALA A 1 67  ? 5.103   -4.193  -2.560  1.00 0.00 ? 67  ALA A HB3  8  
ATOM 11066 N N    . LYS A 1 68  ? 8.105   -5.047  -0.618  1.00 0.00 ? 68  LYS A N    8  
ATOM 11067 C CA   . LYS A 1 68  ? 8.479   -5.036  0.791   1.00 0.00 ? 68  LYS A CA   8  
ATOM 11068 C C    . LYS A 1 68  ? 9.629   -4.065  1.042   1.00 0.00 ? 68  LYS A C    8  
ATOM 11069 O O    . LYS A 1 68  ? 9.523   -3.165  1.875   1.00 0.00 ? 68  LYS A O    8  
ATOM 11070 C CB   . LYS A 1 68  ? 8.877   -6.442  1.246   1.00 0.00 ? 68  LYS A CB   8  
ATOM 11071 C CG   . LYS A 1 68  ? 8.921   -6.604  2.755   1.00 0.00 ? 68  LYS A CG   8  
ATOM 11072 C CD   . LYS A 1 68  ? 9.696   -7.846  3.161   1.00 0.00 ? 68  LYS A CD   8  
ATOM 11073 C CE   . LYS A 1 68  ? 9.417   -8.231  4.605   1.00 0.00 ? 68  LYS A CE   8  
ATOM 11074 N NZ   . LYS A 1 68  ? 8.067   -8.840  4.766   1.00 0.00 ? 68  LYS A NZ   8  
ATOM 11075 H H    . LYS A 1 68  ? 8.245   -5.863  -1.143  1.00 0.00 ? 68  LYS A H    8  
ATOM 11076 H HA   . LYS A 1 68  ? 7.620   -4.712  1.360   1.00 0.00 ? 68  LYS A HA   8  
ATOM 11077 H HB2  . LYS A 1 68  ? 8.164   -7.150  0.849   1.00 0.00 ? 68  LYS A HB2  8  
ATOM 11078 H HB3  . LYS A 1 68  ? 9.857   -6.671  0.851   1.00 0.00 ? 68  LYS A HB3  8  
ATOM 11079 H HG2  . LYS A 1 68  ? 9.400   -5.737  3.187   1.00 0.00 ? 68  LYS A HG2  8  
ATOM 11080 H HG3  . LYS A 1 68  ? 7.910   -6.683  3.129   1.00 0.00 ? 68  LYS A HG3  8  
ATOM 11081 H HD2  . LYS A 1 68  ? 9.407   -8.666  2.519   1.00 0.00 ? 68  LYS A HD2  8  
ATOM 11082 H HD3  . LYS A 1 68  ? 10.754  -7.653  3.047   1.00 0.00 ? 68  LYS A HD3  8  
ATOM 11083 H HE2  . LYS A 1 68  ? 10.163  -8.942  4.926   1.00 0.00 ? 68  LYS A HE2  8  
ATOM 11084 H HE3  . LYS A 1 68  ? 9.477   -7.344  5.218   1.00 0.00 ? 68  LYS A HE3  8  
ATOM 11085 H HZ1  . LYS A 1 68  ? 7.355   -8.265  4.272   1.00 0.00 ? 68  LYS A HZ1  8  
ATOM 11086 H HZ2  . LYS A 1 68  ? 7.816   -8.892  5.774   1.00 0.00 ? 68  LYS A HZ2  8  
ATOM 11087 H HZ3  . LYS A 1 68  ? 8.058   -9.800  4.367   1.00 0.00 ? 68  LYS A HZ3  8  
ATOM 11088 N N    . ALA A 1 69  ? 10.725  -4.253  0.315   1.00 0.00 ? 69  ALA A N    8  
ATOM 11089 C CA   . ALA A 1 69  ? 11.893  -3.392  0.456   1.00 0.00 ? 69  ALA A CA   8  
ATOM 11090 C C    . ALA A 1 69  ? 11.498  -1.920  0.404   1.00 0.00 ? 69  ALA A C    8  
ATOM 11091 O O    . ALA A 1 69  ? 12.185  -1.063  0.960   1.00 0.00 ? 69  ALA A O    8  
ATOM 11092 C CB   . ALA A 1 69  ? 12.914  -3.705  -0.627  1.00 0.00 ? 69  ALA A CB   8  
ATOM 11093 H H    . ALA A 1 69  ? 10.749  -4.988  -0.333  1.00 0.00 ? 69  ALA A H    8  
ATOM 11094 H HA   . ALA A 1 69  ? 12.346  -3.599  1.415   1.00 0.00 ? 69  ALA A HA   8  
ATOM 11095 H HB1  . ALA A 1 69  ? 12.744  -3.061  -1.478  1.00 0.00 ? 69  ALA A HB1  8  
ATOM 11096 H HB2  . ALA A 1 69  ? 13.909  -3.539  -0.242  1.00 0.00 ? 69  ALA A HB2  8  
ATOM 11097 H HB3  . ALA A 1 69  ? 12.812  -4.736  -0.930  1.00 0.00 ? 69  ALA A HB3  8  
ATOM 11098 N N    . ALA A 1 70  ? 10.388  -1.633  -0.267  1.00 0.00 ? 70  ALA A N    8  
ATOM 11099 C CA   . ALA A 1 70  ? 9.902   -0.264  -0.390  1.00 0.00 ? 70  ALA A CA   8  
ATOM 11100 C C    . ALA A 1 70  ? 8.992   0.103   0.777   1.00 0.00 ? 70  ALA A C    8  
ATOM 11101 O O    . ALA A 1 70  ? 8.818   1.279   1.096   1.00 0.00 ? 70  ALA A O    8  
ATOM 11102 C CB   . ALA A 1 70  ? 9.169   -0.081  -1.711  1.00 0.00 ? 70  ALA A CB   8  
ATOM 11103 H H    . ALA A 1 70  ? 9.883   -2.359  -0.689  1.00 0.00 ? 70  ALA A H    8  
ATOM 11104 H HA   . ALA A 1 70  ? 10.758  0.396   -0.388  1.00 0.00 ? 70  ALA A HA   8  
ATOM 11105 H HB1  . ALA A 1 70  ? 9.853   0.306   -2.451  1.00 0.00 ? 70  ALA A HB1  8  
ATOM 11106 H HB2  . ALA A 1 70  ? 8.781   -1.033  -2.042  1.00 0.00 ? 70  ALA A HB2  8  
ATOM 11107 H HB3  . ALA A 1 70  ? 8.353   0.613   -1.576  1.00 0.00 ? 70  ALA A HB3  8  
ATOM 11108 N N    . LYS A 1 71  ? 8.413   -0.911  1.411   1.00 0.00 ? 71  LYS A N    8  
ATOM 11109 C CA   . LYS A 1 71  ? 7.521   -0.697  2.544   1.00 0.00 ? 71  LYS A CA   8  
ATOM 11110 C C    . LYS A 1 71  ? 8.312   -0.348  3.801   1.00 0.00 ? 71  LYS A C    8  
ATOM 11111 O O    . LYS A 1 71  ? 7.982   0.602   4.509   1.00 0.00 ? 71  LYS A O    8  
ATOM 11112 C CB   . LYS A 1 71  ? 6.671   -1.945  2.794   1.00 0.00 ? 71  LYS A CB   8  
ATOM 11113 C CG   . LYS A 1 71  ? 5.859   -1.881  4.076   1.00 0.00 ? 71  LYS A CG   8  
ATOM 11114 C CD   . LYS A 1 71  ? 4.631   -2.773  4.004   1.00 0.00 ? 71  LYS A CD   8  
ATOM 11115 C CE   . LYS A 1 71  ? 4.991   -4.234  4.225   1.00 0.00 ? 71  LYS A CE   8  
ATOM 11116 N NZ   . LYS A 1 71  ? 5.138   -4.556  5.672   1.00 0.00 ? 71  LYS A NZ   8  
ATOM 11117 H H    . LYS A 1 71  ? 8.592   -1.828  1.110   1.00 0.00 ? 71  LYS A H    8  
ATOM 11118 H HA   . LYS A 1 71  ? 6.870   0.130   2.303   1.00 0.00 ? 71  LYS A HA   8  
ATOM 11119 H HB2  . LYS A 1 71  ? 5.989   -2.072  1.966   1.00 0.00 ? 71  LYS A HB2  8  
ATOM 11120 H HB3  . LYS A 1 71  ? 7.323   -2.805  2.848   1.00 0.00 ? 71  LYS A HB3  8  
ATOM 11121 H HG2  . LYS A 1 71  ? 6.478   -2.204  4.900   1.00 0.00 ? 71  LYS A HG2  8  
ATOM 11122 H HG3  . LYS A 1 71  ? 5.542   -0.861  4.240   1.00 0.00 ? 71  LYS A HG3  8  
ATOM 11123 H HD2  . LYS A 1 71  ? 3.929   -2.468  4.765   1.00 0.00 ? 71  LYS A HD2  8  
ATOM 11124 H HD3  . LYS A 1 71  ? 4.177   -2.667  3.029   1.00 0.00 ? 71  LYS A HD3  8  
ATOM 11125 H HE2  . LYS A 1 71  ? 4.211   -4.851  3.806   1.00 0.00 ? 71  LYS A HE2  8  
ATOM 11126 H HE3  . LYS A 1 71  ? 5.923   -4.442  3.722   1.00 0.00 ? 71  LYS A HE3  8  
ATOM 11127 H HZ1  . LYS A 1 71  ? 5.125   -5.587  5.811   1.00 0.00 ? 71  LYS A HZ1  8  
ATOM 11128 H HZ2  . LYS A 1 71  ? 4.356   -4.135  6.213   1.00 0.00 ? 71  LYS A HZ2  8  
ATOM 11129 H HZ3  . LYS A 1 71  ? 6.037   -4.179  6.032   1.00 0.00 ? 71  LYS A HZ3  8  
ATOM 11130 N N    . GLU A 1 72  ? 9.359   -1.123  4.071   1.00 0.00 ? 72  GLU A N    8  
ATOM 11131 C CA   . GLU A 1 72  ? 10.196  -0.894  5.242   1.00 0.00 ? 72  GLU A CA   8  
ATOM 11132 C C    . GLU A 1 72  ? 10.732  0.534   5.257   1.00 0.00 ? 72  GLU A C    8  
ATOM 11133 O O    . GLU A 1 72  ? 10.955  1.114   6.320   1.00 0.00 ? 72  GLU A O    8  
ATOM 11134 C CB   . GLU A 1 72  ? 11.360  -1.888  5.266   1.00 0.00 ? 72  GLU A CB   8  
ATOM 11135 C CG   . GLU A 1 72  ? 10.923  -3.340  5.171   1.00 0.00 ? 72  GLU A CG   8  
ATOM 11136 C CD   . GLU A 1 72  ? 11.874  -4.283  5.881   1.00 0.00 ? 72  GLU A CD   8  
ATOM 11137 O OE1  . GLU A 1 72  ? 12.671  -3.806  6.715   1.00 0.00 ? 72  GLU A OE1  8  
ATOM 11138 O OE2  . GLU A 1 72  ? 11.822  -5.499  5.601   1.00 0.00 ? 72  GLU A OE2  8  
ATOM 11139 H H    . GLU A 1 72  ? 9.571   -1.866  3.468   1.00 0.00 ? 72  GLU A H    8  
ATOM 11140 H HA   . GLU A 1 72  ? 9.587   -1.047  6.120   1.00 0.00 ? 72  GLU A HA   8  
ATOM 11141 H HB2  . GLU A 1 72  ? 12.016  -1.675  4.435   1.00 0.00 ? 72  GLU A HB2  8  
ATOM 11142 H HB3  . GLU A 1 72  ? 11.908  -1.758  6.188   1.00 0.00 ? 72  GLU A HB3  8  
ATOM 11143 H HG2  . GLU A 1 72  ? 9.944   -3.438  5.616   1.00 0.00 ? 72  GLU A HG2  8  
ATOM 11144 H HG3  . GLU A 1 72  ? 10.873  -3.619  4.129   1.00 0.00 ? 72  GLU A HG3  8  
ATOM 11145 N N    . ALA A 1 73  ? 10.937  1.096   4.070   1.00 0.00 ? 73  ALA A N    8  
ATOM 11146 C CA   . ALA A 1 73  ? 11.445  2.456   3.946   1.00 0.00 ? 73  ALA A CA   8  
ATOM 11147 C C    . ALA A 1 73  ? 10.352  3.479   4.237   1.00 0.00 ? 73  ALA A C    8  
ATOM 11148 O O    . ALA A 1 73  ? 10.541  4.390   5.043   1.00 0.00 ? 73  ALA A O    8  
ATOM 11149 C CB   . ALA A 1 73  ? 12.022  2.679   2.556   1.00 0.00 ? 73  ALA A CB   8  
ATOM 11150 H H    . ALA A 1 73  ? 10.740  0.583   3.259   1.00 0.00 ? 73  ALA A H    8  
ATOM 11151 H HA   . ALA A 1 73  ? 12.243  2.582   4.664   1.00 0.00 ? 73  ALA A HA   8  
ATOM 11152 H HB1  . ALA A 1 73  ? 11.422  3.408   2.031   1.00 0.00 ? 73  ALA A HB1  8  
ATOM 11153 H HB2  . ALA A 1 73  ? 13.036  3.041   2.640   1.00 0.00 ? 73  ALA A HB2  8  
ATOM 11154 H HB3  . ALA A 1 73  ? 12.016  1.748   2.010   1.00 0.00 ? 73  ALA A HB3  8  
ATOM 11155 N N    . MET A 1 74  ? 9.210   3.322   3.577   1.00 0.00 ? 74  MET A N    8  
ATOM 11156 C CA   . MET A 1 74  ? 8.087   4.233   3.767   1.00 0.00 ? 74  MET A CA   8  
ATOM 11157 C C    . MET A 1 74  ? 7.264   3.834   4.988   1.00 0.00 ? 74  MET A C    8  
ATOM 11158 O O    . MET A 1 74  ? 6.192   4.387   5.232   1.00 0.00 ? 74  MET A O    8  
ATOM 11159 C CB   . MET A 1 74  ? 7.198   4.248   2.521   1.00 0.00 ? 74  MET A CB   8  
ATOM 11160 C CG   . MET A 1 74  ? 7.713   5.160   1.419   1.00 0.00 ? 74  MET A CG   8  
ATOM 11161 S SD   . MET A 1 74  ? 7.617   6.905   1.861   1.00 0.00 ? 74  MET A SD   8  
ATOM 11162 C CE   . MET A 1 74  ? 5.844   7.155   1.875   1.00 0.00 ? 74  MET A CE   8  
ATOM 11163 H H    . MET A 1 74  ? 9.119   2.576   2.948   1.00 0.00 ? 74  MET A H    8  
ATOM 11164 H HA   . MET A 1 74  ? 8.487   5.223   3.925   1.00 0.00 ? 74  MET A HA   8  
ATOM 11165 H HB2  . MET A 1 74  ? 7.133   3.244   2.128   1.00 0.00 ? 74  MET A HB2  8  
ATOM 11166 H HB3  . MET A 1 74  ? 6.210   4.581   2.802   1.00 0.00 ? 74  MET A HB3  8  
ATOM 11167 H HG2  . MET A 1 74  ? 8.743   4.911   1.216   1.00 0.00 ? 74  MET A HG2  8  
ATOM 11168 H HG3  . MET A 1 74  ? 7.122   4.994   0.530   1.00 0.00 ? 74  MET A HG3  8  
ATOM 11169 H HE1  . MET A 1 74  ? 5.463   7.090   0.866   1.00 0.00 ? 74  MET A HE1  8  
ATOM 11170 H HE2  . MET A 1 74  ? 5.378   6.395   2.485   1.00 0.00 ? 74  MET A HE2  8  
ATOM 11171 H HE3  . MET A 1 74  ? 5.621   8.130   2.282   1.00 0.00 ? 74  MET A HE3  8  
ATOM 11172 N N    . GLU A 1 75  ? 7.772   2.871   5.750   1.00 0.00 ? 75  GLU A N    8  
ATOM 11173 C CA   . GLU A 1 75  ? 7.082   2.398   6.945   1.00 0.00 ? 75  GLU A CA   8  
ATOM 11174 C C    . GLU A 1 75  ? 6.594   3.571   7.790   1.00 0.00 ? 75  GLU A C    8  
ATOM 11175 O O    . GLU A 1 75  ? 5.499   3.531   8.352   1.00 0.00 ? 75  GLU A O    8  
ATOM 11176 C CB   . GLU A 1 75  ? 8.007   1.506   7.775   1.00 0.00 ? 75  GLU A CB   8  
ATOM 11177 C CG   . GLU A 1 75  ? 9.151   2.260   8.433   1.00 0.00 ? 75  GLU A CG   8  
ATOM 11178 C CD   . GLU A 1 75  ? 10.100  1.344   9.180   1.00 0.00 ? 75  GLU A CD   8  
ATOM 11179 O OE1  . GLU A 1 75  ? 9.639   0.630   10.096  1.00 0.00 ? 75  GLU A OE1  8  
ATOM 11180 O OE2  . GLU A 1 75  ? 11.304  1.340   8.849   1.00 0.00 ? 75  GLU A OE2  8  
ATOM 11181 H H    . GLU A 1 75  ? 8.631   2.468   5.503   1.00 0.00 ? 75  GLU A H    8  
ATOM 11182 H HA   . GLU A 1 75  ? 6.228   1.819   6.627   1.00 0.00 ? 75  GLU A HA   8  
ATOM 11183 H HB2  . GLU A 1 75  ? 7.426   1.028   8.550   1.00 0.00 ? 75  GLU A HB2  8  
ATOM 11184 H HB3  . GLU A 1 75  ? 8.427   0.747   7.132   1.00 0.00 ? 75  GLU A HB3  8  
ATOM 11185 H HG2  . GLU A 1 75  ? 9.706   2.783   7.669   1.00 0.00 ? 75  GLU A HG2  8  
ATOM 11186 H HG3  . GLU A 1 75  ? 8.740   2.975   9.131   1.00 0.00 ? 75  GLU A HG3  8  
ATOM 11187 N N    . ASP A 1 76  ? 7.414   4.613   7.876   1.00 0.00 ? 76  ASP A N    8  
ATOM 11188 C CA   . ASP A 1 76  ? 7.067   5.797   8.653   1.00 0.00 ? 76  ASP A CA   8  
ATOM 11189 C C    . ASP A 1 76  ? 7.145   7.054   7.791   1.00 0.00 ? 76  ASP A C    8  
ATOM 11190 O O    . ASP A 1 76  ? 7.372   8.152   8.297   1.00 0.00 ? 76  ASP A O    8  
ATOM 11191 C CB   . ASP A 1 76  ? 7.996   5.932   9.860   1.00 0.00 ? 76  ASP A CB   8  
ATOM 11192 C CG   . ASP A 1 76  ? 9.310   6.602   9.507   1.00 0.00 ? 76  ASP A CG   8  
ATOM 11193 O OD1  . ASP A 1 76  ? 10.021  6.084   8.620   1.00 0.00 ? 76  ASP A OD1  8  
ATOM 11194 O OD2  . ASP A 1 76  ? 9.627   7.644   10.118  1.00 0.00 ? 76  ASP A OD2  8  
ATOM 11195 H H    . ASP A 1 76  ? 8.273   4.584   7.405   1.00 0.00 ? 76  ASP A H    8  
ATOM 11196 H HA   . ASP A 1 76  ? 6.052   5.679   9.002   1.00 0.00 ? 76  ASP A HA   8  
ATOM 11197 H HB2  . ASP A 1 76  ? 7.505   6.523   10.620  1.00 0.00 ? 76  ASP A HB2  8  
ATOM 11198 H HB3  . ASP A 1 76  ? 8.208   4.950   10.255  1.00 0.00 ? 76  ASP A HB3  8  
ATOM 11199 N N    . GLY A 1 77  ? 6.958   6.883   6.486   1.00 0.00 ? 77  GLY A N    8  
ATOM 11200 C CA   . GLY A 1 77  ? 7.013   8.012   5.575   1.00 0.00 ? 77  GLY A CA   8  
ATOM 11201 C C    . GLY A 1 77  ? 5.695   8.757   5.495   1.00 0.00 ? 77  GLY A C    8  
ATOM 11202 O O    . GLY A 1 77  ? 4.646   8.212   5.836   1.00 0.00 ? 77  GLY A O    8  
ATOM 11203 H H    . GLY A 1 77  ? 6.781   5.984   6.139   1.00 0.00 ? 77  GLY A H    8  
ATOM 11204 H HA2  . GLY A 1 77  ? 7.780   8.694   5.910   1.00 0.00 ? 77  GLY A HA2  8  
ATOM 11205 H HA3  . GLY A 1 77  ? 7.270   7.652   4.590   1.00 0.00 ? 77  GLY A HA3  8  
ATOM 11206 N N    . GLU A 1 78  ? 5.750   10.006  5.044   1.00 0.00 ? 78  GLU A N    8  
ATOM 11207 C CA   . GLU A 1 78  ? 4.551   10.827  4.922   1.00 0.00 ? 78  GLU A CA   8  
ATOM 11208 C C    . GLU A 1 78  ? 4.513   11.540  3.574   1.00 0.00 ? 78  GLU A C    8  
ATOM 11209 O O    . GLU A 1 78  ? 5.381   12.358  3.269   1.00 0.00 ? 78  GLU A O    8  
ATOM 11210 C CB   . GLU A 1 78  ? 4.491   11.853  6.056   1.00 0.00 ? 78  GLU A CB   8  
ATOM 11211 C CG   . GLU A 1 78  ? 5.757   12.682  6.194   1.00 0.00 ? 78  GLU A CG   8  
ATOM 11212 C CD   . GLU A 1 78  ? 5.737   13.579  7.416   1.00 0.00 ? 78  GLU A CD   8  
ATOM 11213 O OE1  . GLU A 1 78  ? 4.899   14.504  7.458   1.00 0.00 ? 78  GLU A OE1  8  
ATOM 11214 O OE2  . GLU A 1 78  ? 6.559   13.357  8.329   1.00 0.00 ? 78  GLU A OE2  8  
ATOM 11215 H H    . GLU A 1 78  ? 6.617   10.384  4.787   1.00 0.00 ? 78  GLU A H    8  
ATOM 11216 H HA   . GLU A 1 78  ? 3.694   10.174  4.995   1.00 0.00 ? 78  GLU A HA   8  
ATOM 11217 H HB2  . GLU A 1 78  ? 3.664   12.523  5.876   1.00 0.00 ? 78  GLU A HB2  8  
ATOM 11218 H HB3  . GLU A 1 78  ? 4.325   11.332  6.988   1.00 0.00 ? 78  GLU A HB3  8  
ATOM 11219 H HG2  . GLU A 1 78  ? 6.603   12.015  6.270   1.00 0.00 ? 78  GLU A HG2  8  
ATOM 11220 H HG3  . GLU A 1 78  ? 5.865   13.299  5.314   1.00 0.00 ? 78  GLU A HG3  8  
ATOM 11221 N N    . ILE A 1 79  ? 3.503   11.223  2.771   1.00 0.00 ? 79  ILE A N    8  
ATOM 11222 C CA   . ILE A 1 79  ? 3.352   11.833  1.456   1.00 0.00 ? 79  ILE A CA   8  
ATOM 11223 C C    . ILE A 1 79  ? 2.581   13.145  1.544   1.00 0.00 ? 79  ILE A C    8  
ATOM 11224 O O    . ILE A 1 79  ? 1.581   13.243  2.256   1.00 0.00 ? 79  ILE A O    8  
ATOM 11225 C CB   . ILE A 1 79  ? 2.628   10.890  0.478   1.00 0.00 ? 79  ILE A CB   8  
ATOM 11226 C CG1  . ILE A 1 79  ? 3.254   9.494   0.523   1.00 0.00 ? 79  ILE A CG1  8  
ATOM 11227 C CG2  . ILE A 1 79  ? 2.677   11.453  -0.935  1.00 0.00 ? 79  ILE A CG2  8  
ATOM 11228 C CD1  . ILE A 1 79  ? 2.698   8.549   -0.520  1.00 0.00 ? 79  ILE A CD1  8  
ATOM 11229 H H    . ILE A 1 79  ? 2.844   10.563  3.071   1.00 0.00 ? 79  ILE A H    8  
ATOM 11230 H HA   . ILE A 1 79  ? 4.340   12.033  1.067   1.00 0.00 ? 79  ILE A HA   8  
ATOM 11231 H HB   . ILE A 1 79  ? 1.593   10.822  0.777   1.00 0.00 ? 79  ILE A HB   8  
ATOM 11232 H HG12 . ILE A 1 79  ? 4.317   9.577   0.361   1.00 0.00 ? 79  ILE A HG12 8  
ATOM 11233 H HG13 . ILE A 1 79  ? 3.075   9.059   1.495   1.00 0.00 ? 79  ILE A HG13 8  
ATOM 11234 H HG21 . ILE A 1 79  ? 3.534   11.049  -1.454  1.00 0.00 ? 79  ILE A HG21 8  
ATOM 11235 H HG22 . ILE A 1 79  ? 1.776   11.178  -1.463  1.00 0.00 ? 79  ILE A HG22 8  
ATOM 11236 H HG23 . ILE A 1 79  ? 2.756   12.528  -0.891  1.00 0.00 ? 79  ILE A HG23 8  
ATOM 11237 H HD11 . ILE A 1 79  ? 3.498   7.942   -0.918  1.00 0.00 ? 79  ILE A HD11 8  
ATOM 11238 H HD12 . ILE A 1 79  ? 1.952   7.913   -0.069  1.00 0.00 ? 79  ILE A HD12 8  
ATOM 11239 H HD13 . ILE A 1 79  ? 2.249   9.120   -1.320  1.00 0.00 ? 79  ILE A HD13 8  
ATOM 11240 N N    . ASP A 1 80  ? 3.052   14.152  0.816   1.00 0.00 ? 80  ASP A N    8  
ATOM 11241 C CA   . ASP A 1 80  ? 2.405   15.459  0.809   1.00 0.00 ? 80  ASP A CA   8  
ATOM 11242 C C    . ASP A 1 80  ? 2.262   16.001  2.227   1.00 0.00 ? 80  ASP A C    8  
ATOM 11243 O O    . ASP A 1 80  ? 1.238   16.585  2.579   1.00 0.00 ? 80  ASP A O    8  
ATOM 11244 C CB   . ASP A 1 80  ? 1.031   15.368  0.143   1.00 0.00 ? 80  ASP A CB   8  
ATOM 11245 C CG   . ASP A 1 80  ? 1.125   15.257  -1.366  1.00 0.00 ? 80  ASP A CG   8  
ATOM 11246 O OD1  . ASP A 1 80  ? 2.079   14.616  -1.856  1.00 0.00 ? 80  ASP A OD1  8  
ATOM 11247 O OD2  . ASP A 1 80  ? 0.245   15.811  -2.057  1.00 0.00 ? 80  ASP A OD2  8  
ATOM 11248 H H    . ASP A 1 80  ? 3.853   14.012  0.269   1.00 0.00 ? 80  ASP A H    8  
ATOM 11249 H HA   . ASP A 1 80  ? 3.027   16.133  0.240   1.00 0.00 ? 80  ASP A HA   8  
ATOM 11250 H HB2  . ASP A 1 80  ? 0.513   14.496  0.518   1.00 0.00 ? 80  ASP A HB2  8  
ATOM 11251 H HB3  . ASP A 1 80  ? 0.461   16.252  0.387   1.00 0.00 ? 80  ASP A HB3  8  
ATOM 11252 N N    . GLY A 1 81  ? 3.297   15.804  3.039   1.00 0.00 ? 81  GLY A N    8  
ATOM 11253 C CA   . GLY A 1 81  ? 3.265   16.278  4.410   1.00 0.00 ? 81  GLY A CA   8  
ATOM 11254 C C    . GLY A 1 81  ? 2.212   15.575  5.243   1.00 0.00 ? 81  GLY A C    8  
ATOM 11255 O O    . GLY A 1 81  ? 1.762   16.102  6.260   1.00 0.00 ? 81  GLY A O    8  
ATOM 11256 H H    . GLY A 1 81  ? 4.088   15.332  2.703   1.00 0.00 ? 81  GLY A H    8  
ATOM 11257 H HA2  . GLY A 1 81  ? 4.234   16.113  4.859   1.00 0.00 ? 81  GLY A HA2  8  
ATOM 11258 H HA3  . GLY A 1 81  ? 3.057   17.338  4.407   1.00 0.00 ? 81  GLY A HA3  8  
ATOM 11259 N N    . ASN A 1 82  ? 1.816   14.383  4.810   1.00 0.00 ? 82  ASN A N    8  
ATOM 11260 C CA   . ASN A 1 82  ? 0.807   13.607  5.522   1.00 0.00 ? 82  ASN A CA   8  
ATOM 11261 C C    . ASN A 1 82  ? 1.283   12.176  5.752   1.00 0.00 ? 82  ASN A C    8  
ATOM 11262 O O    . ASN A 1 82  ? 1.847   11.546  4.857   1.00 0.00 ? 82  ASN A O    8  
ATOM 11263 C CB   . ASN A 1 82  ? -0.507  13.600  4.738   1.00 0.00 ? 82  ASN A CB   8  
ATOM 11264 C CG   . ASN A 1 82  ? -1.334  14.847  4.984   1.00 0.00 ? 82  ASN A CG   8  
ATOM 11265 O OD1  . ASN A 1 82  ? -1.063  15.612  5.910   1.00 0.00 ? 82  ASN A OD1  8  
ATOM 11266 N ND2  . ASN A 1 82  ? -2.349  15.057  4.154   1.00 0.00 ? 82  ASN A ND2  8  
ATOM 11267 H H    . ASN A 1 82  ? 2.212   14.015  3.992   1.00 0.00 ? 82  ASN A H    8  
ATOM 11268 H HA   . ASN A 1 82  ? 0.642   14.078  6.479   1.00 0.00 ? 82  ASN A HA   8  
ATOM 11269 H HB2  . ASN A 1 82  ? -0.289  13.539  3.682   1.00 0.00 ? 82  ASN A HB2  8  
ATOM 11270 H HB3  . ASN A 1 82  ? -1.090  12.740  5.032   1.00 0.00 ? 82  ASN A HB3  8  
ATOM 11271 H HD21 . ASN A 1 82  ? -2.505  14.405  3.439   1.00 0.00 ? 82  ASN A HD21 8  
ATOM 11272 H HD22 . ASN A 1 82  ? -2.899  15.856  4.290   1.00 0.00 ? 82  ASN A HD22 8  
ATOM 11273 N N    . LYS A 1 83  ? 1.052   11.668  6.958   1.00 0.00 ? 83  LYS A N    8  
ATOM 11274 C CA   . LYS A 1 83  ? 1.454   10.311  7.308   1.00 0.00 ? 83  LYS A CA   8  
ATOM 11275 C C    . LYS A 1 83  ? 0.641   9.284   6.526   1.00 0.00 ? 83  LYS A C    8  
ATOM 11276 O O    . LYS A 1 83  ? -0.579  9.402   6.410   1.00 0.00 ? 83  LYS A O    8  
ATOM 11277 C CB   . LYS A 1 83  ? 1.283   10.077  8.810   1.00 0.00 ? 83  LYS A CB   8  
ATOM 11278 C CG   . LYS A 1 83  ? -0.138  10.295  9.301   1.00 0.00 ? 83  LYS A CG   8  
ATOM 11279 C CD   . LYS A 1 83  ? -0.365  9.648   10.657  1.00 0.00 ? 83  LYS A CD   8  
ATOM 11280 C CE   . LYS A 1 83  ? 0.167   10.518  11.786  1.00 0.00 ? 83  LYS A CE   8  
ATOM 11281 N NZ   . LYS A 1 83  ? -0.518  10.231  13.077  1.00 0.00 ? 83  LYS A NZ   8  
ATOM 11282 H H    . LYS A 1 83  ? 0.598   12.220  7.630   1.00 0.00 ? 83  LYS A H    8  
ATOM 11283 H HA   . LYS A 1 83  ? 2.496   10.198  7.051   1.00 0.00 ? 83  LYS A HA   8  
ATOM 11284 H HB2  . LYS A 1 83  ? 1.569   9.061   9.039   1.00 0.00 ? 83  LYS A HB2  8  
ATOM 11285 H HB3  . LYS A 1 83  ? 1.933   10.754  9.344   1.00 0.00 ? 83  LYS A HB3  8  
ATOM 11286 H HG2  . LYS A 1 83  ? -0.322  11.356  9.386   1.00 0.00 ? 83  LYS A HG2  8  
ATOM 11287 H HG3  . LYS A 1 83  ? -0.826  9.865   8.587   1.00 0.00 ? 83  LYS A HG3  8  
ATOM 11288 H HD2  . LYS A 1 83  ? -1.424  9.498   10.802  1.00 0.00 ? 83  LYS A HD2  8  
ATOM 11289 H HD3  . LYS A 1 83  ? 0.142   8.693   10.680  1.00 0.00 ? 83  LYS A HD3  8  
ATOM 11290 H HE2  . LYS A 1 83  ? 1.224   10.331  11.899  1.00 0.00 ? 83  LYS A HE2  8  
ATOM 11291 H HE3  . LYS A 1 83  ? 0.010   11.555  11.528  1.00 0.00 ? 83  LYS A HE3  8  
ATOM 11292 H HZ1  . LYS A 1 83  ? -1.461  10.668  13.086  1.00 0.00 ? 83  LYS A HZ1  8  
ATOM 11293 H HZ2  . LYS A 1 83  ? 0.037   10.615  13.868  1.00 0.00 ? 83  LYS A HZ2  8  
ATOM 11294 H HZ3  . LYS A 1 83  ? -0.622  9.204   13.206  1.00 0.00 ? 83  LYS A HZ3  8  
ATOM 11295 N N    . VAL A 1 84  ? 1.324   8.277   5.993   1.00 0.00 ? 84  VAL A N    8  
ATOM 11296 C CA   . VAL A 1 84  ? 0.664   7.228   5.225   1.00 0.00 ? 84  VAL A CA   8  
ATOM 11297 C C    . VAL A 1 84  ? 0.933   5.853   5.827   1.00 0.00 ? 84  VAL A C    8  
ATOM 11298 O O    . VAL A 1 84  ? 2.009   5.600   6.370   1.00 0.00 ? 84  VAL A O    8  
ATOM 11299 C CB   . VAL A 1 84  ? 1.128   7.231   3.756   1.00 0.00 ? 84  VAL A CB   8  
ATOM 11300 C CG1  . VAL A 1 84  ? 0.864   8.586   3.116   1.00 0.00 ? 84  VAL A CG1  8  
ATOM 11301 C CG2  . VAL A 1 84  ? 2.601   6.866   3.662   1.00 0.00 ? 84  VAL A CG2  8  
ATOM 11302 H H    . VAL A 1 84  ? 2.295   8.237   6.119   1.00 0.00 ? 84  VAL A H    8  
ATOM 11303 H HA   . VAL A 1 84  ? -0.399  7.417   5.245   1.00 0.00 ? 84  VAL A HA   8  
ATOM 11304 H HB   . VAL A 1 84  ? 0.559   6.487   3.218   1.00 0.00 ? 84  VAL A HB   8  
ATOM 11305 H HG11 . VAL A 1 84  ? 1.401   9.350   3.658   1.00 0.00 ? 84  VAL A HG11 8  
ATOM 11306 H HG12 . VAL A 1 84  ? 1.197   8.570   2.088   1.00 0.00 ? 84  VAL A HG12 8  
ATOM 11307 H HG13 . VAL A 1 84  ? -0.194  8.799   3.149   1.00 0.00 ? 84  VAL A HG13 8  
ATOM 11308 H HG21 . VAL A 1 84  ? 2.868   6.715   2.626   1.00 0.00 ? 84  VAL A HG21 8  
ATOM 11309 H HG22 . VAL A 1 84  ? 3.198   7.666   4.074   1.00 0.00 ? 84  VAL A HG22 8  
ATOM 11310 H HG23 . VAL A 1 84  ? 2.784   5.958   4.217   1.00 0.00 ? 84  VAL A HG23 8  
ATOM 11311 N N    . THR A 1 85  ? -0.053  4.967   5.729   1.00 0.00 ? 85  THR A N    8  
ATOM 11312 C CA   . THR A 1 85  ? 0.077   3.617   6.265   1.00 0.00 ? 85  THR A CA   8  
ATOM 11313 C C    . THR A 1 85  ? 0.100   2.582   5.146   1.00 0.00 ? 85  THR A C    8  
ATOM 11314 O O    . THR A 1 85  ? -0.890  2.397   4.437   1.00 0.00 ? 85  THR A O    8  
ATOM 11315 C CB   . THR A 1 85  ? -1.074  3.285   7.233   1.00 0.00 ? 85  THR A CB   8  
ATOM 11316 O OG1  . THR A 1 85  ? -1.056  4.188   8.344   1.00 0.00 ? 85  THR A OG1  8  
ATOM 11317 C CG2  . THR A 1 85  ? -0.962  1.853   7.735   1.00 0.00 ? 85  THR A CG2  8  
ATOM 11318 H H    . THR A 1 85  ? -0.886  5.228   5.285   1.00 0.00 ? 85  THR A H    8  
ATOM 11319 H HA   . THR A 1 85  ? 1.007   3.563   6.812   1.00 0.00 ? 85  THR A HA   8  
ATOM 11320 H HB   . THR A 1 85  ? -2.011  3.394   6.706   1.00 0.00 ? 85  THR A HB   8  
ATOM 11321 H HG1  . THR A 1 85  ? -0.464  3.851   9.021   1.00 0.00 ? 85  THR A HG1  8  
ATOM 11322 H HG21 . THR A 1 85  ? -0.377  1.272   7.038   1.00 0.00 ? 85  THR A HG21 8  
ATOM 11323 H HG22 . THR A 1 85  ? -1.950  1.424   7.822   1.00 0.00 ? 85  THR A HG22 8  
ATOM 11324 H HG23 . THR A 1 85  ? -0.481  1.847   8.701   1.00 0.00 ? 85  THR A HG23 8  
ATOM 11325 N N    . LEU A 1 86  ? 1.234   1.907   4.994   1.00 0.00 ? 86  LEU A N    8  
ATOM 11326 C CA   . LEU A 1 86  ? 1.386   0.888   3.962   1.00 0.00 ? 86  LEU A CA   8  
ATOM 11327 C C    . LEU A 1 86  ? 1.007   -0.489  4.496   1.00 0.00 ? 86  LEU A C    8  
ATOM 11328 O O    . LEU A 1 86  ? 1.489   -0.913  5.546   1.00 0.00 ? 86  LEU A O    8  
ATOM 11329 C CB   . LEU A 1 86  ? 2.826   0.868   3.445   1.00 0.00 ? 86  LEU A CB   8  
ATOM 11330 C CG   . LEU A 1 86  ? 3.573   2.202   3.487   1.00 0.00 ? 86  LEU A CG   8  
ATOM 11331 C CD1  . LEU A 1 86  ? 5.036   2.006   3.124   1.00 0.00 ? 86  LEU A CD1  8  
ATOM 11332 C CD2  . LEU A 1 86  ? 2.919   3.209   2.552   1.00 0.00 ? 86  LEU A CD2  8  
ATOM 11333 H H    . LEU A 1 86  ? 1.988   2.099   5.590   1.00 0.00 ? 86  LEU A H    8  
ATOM 11334 H HA   . LEU A 1 86  ? 0.724   1.140   3.148   1.00 0.00 ? 86  LEU A HA   8  
ATOM 11335 H HB2  . LEU A 1 86  ? 3.381   0.160   4.040   1.00 0.00 ? 86  LEU A HB2  8  
ATOM 11336 H HB3  . LEU A 1 86  ? 2.803   0.533   2.418   1.00 0.00 ? 86  LEU A HB3  8  
ATOM 11337 H HG   . LEU A 1 86  ? 3.529   2.600   4.492   1.00 0.00 ? 86  LEU A HG   8  
ATOM 11338 H HD11 . LEU A 1 86  ? 5.272   0.953   3.137   1.00 0.00 ? 86  LEU A HD11 8  
ATOM 11339 H HD12 . LEU A 1 86  ? 5.657   2.523   3.841   1.00 0.00 ? 86  LEU A HD12 8  
ATOM 11340 H HD13 . LEU A 1 86  ? 5.219   2.405   2.137   1.00 0.00 ? 86  LEU A HD13 8  
ATOM 11341 H HD21 . LEU A 1 86  ? 2.399   2.683   1.765   1.00 0.00 ? 86  LEU A HD21 8  
ATOM 11342 H HD22 . LEU A 1 86  ? 3.679   3.843   2.119   1.00 0.00 ? 86  LEU A HD22 8  
ATOM 11343 H HD23 . LEU A 1 86  ? 2.218   3.813   3.107   1.00 0.00 ? 86  LEU A HD23 8  
ATOM 11344 N N    . ASP A 1 87  ? 0.141   -1.183  3.766   1.00 0.00 ? 87  ASP A N    8  
ATOM 11345 C CA   . ASP A 1 87  ? -0.301  -2.515  4.164   1.00 0.00 ? 87  ASP A CA   8  
ATOM 11346 C C    . ASP A 1 87  ? -0.530  -3.400  2.943   1.00 0.00 ? 87  ASP A C    8  
ATOM 11347 O O    . ASP A 1 87  ? -1.019  -2.937  1.912   1.00 0.00 ? 87  ASP A O    8  
ATOM 11348 C CB   . ASP A 1 87  ? -1.585  -2.423  4.990   1.00 0.00 ? 87  ASP A CB   8  
ATOM 11349 C CG   . ASP A 1 87  ? -2.437  -3.671  4.876   1.00 0.00 ? 87  ASP A CG   8  
ATOM 11350 O OD1  . ASP A 1 87  ? -3.145  -3.815  3.857   1.00 0.00 ? 87  ASP A OD1  8  
ATOM 11351 O OD2  . ASP A 1 87  ? -2.398  -4.504  5.806   1.00 0.00 ? 87  ASP A OD2  8  
ATOM 11352 H H    . ASP A 1 87  ? -0.208  -0.791  2.938   1.00 0.00 ? 87  ASP A H    8  
ATOM 11353 H HA   . ASP A 1 87  ? 0.476   -2.954  4.771   1.00 0.00 ? 87  ASP A HA   8  
ATOM 11354 H HB2  . ASP A 1 87  ? -1.327  -2.280  6.030   1.00 0.00 ? 87  ASP A HB2  8  
ATOM 11355 H HB3  . ASP A 1 87  ? -2.166  -1.579  4.649   1.00 0.00 ? 87  ASP A HB3  8  
ATOM 11356 N N    . TRP A 1 88  ? -0.170  -4.672  3.065   1.00 0.00 ? 88  TRP A N    8  
ATOM 11357 C CA   . TRP A 1 88  ? -0.335  -5.622  1.971   1.00 0.00 ? 88  TRP A CA   8  
ATOM 11358 C C    . TRP A 1 88  ? -1.806  -5.768  1.594   1.00 0.00 ? 88  TRP A C    8  
ATOM 11359 O O    . TRP A 1 88  ? -2.652  -6.027  2.449   1.00 0.00 ? 88  TRP A O    8  
ATOM 11360 C CB   . TRP A 1 88  ? 0.243   -6.984  2.358   1.00 0.00 ? 88  TRP A CB   8  
ATOM 11361 C CG   . TRP A 1 88  ? 1.721   -6.954  2.602   1.00 0.00 ? 88  TRP A CG   8  
ATOM 11362 C CD1  . TRP A 1 88  ? 2.366   -7.248  3.769   1.00 0.00 ? 88  TRP A CD1  8  
ATOM 11363 C CD2  . TRP A 1 88  ? 2.739   -6.609  1.655   1.00 0.00 ? 88  TRP A CD2  8  
ATOM 11364 N NE1  . TRP A 1 88  ? 3.723   -7.107  3.606   1.00 0.00 ? 88  TRP A NE1  8  
ATOM 11365 C CE2  . TRP A 1 88  ? 3.977   -6.716  2.318   1.00 0.00 ? 88  TRP A CE2  8  
ATOM 11366 C CE3  . TRP A 1 88  ? 2.725   -6.222  0.313   1.00 0.00 ? 88  TRP A CE3  8  
ATOM 11367 C CZ2  . TRP A 1 88  ? 5.187   -6.449  1.682   1.00 0.00 ? 88  TRP A CZ2  8  
ATOM 11368 C CZ3  . TRP A 1 88  ? 3.926   -5.956  -0.317  1.00 0.00 ? 88  TRP A CZ3  8  
ATOM 11369 C CH2  . TRP A 1 88  ? 5.143   -6.072  0.367   1.00 0.00 ? 88  TRP A CH2  8  
ATOM 11370 H H    . TRP A 1 88  ? 0.215   -4.981  3.912   1.00 0.00 ? 88  TRP A H    8  
ATOM 11371 H HA   . TRP A 1 88  ? 0.206   -5.240  1.118   1.00 0.00 ? 88  TRP A HA   8  
ATOM 11372 H HB2  . TRP A 1 88  ? -0.237  -7.328  3.262   1.00 0.00 ? 88  TRP A HB2  8  
ATOM 11373 H HB3  . TRP A 1 88  ? 0.049   -7.688  1.562   1.00 0.00 ? 88  TRP A HB3  8  
ATOM 11374 H HD1  . TRP A 1 88  ? 1.868   -7.545  4.680   1.00 0.00 ? 88  TRP A HD1  8  
ATOM 11375 H HE1  . TRP A 1 88  ? 4.398   -7.262  4.299   1.00 0.00 ? 88  TRP A HE1  8  
ATOM 11376 H HE3  . TRP A 1 88  ? 1.796   -6.127  -0.231  1.00 0.00 ? 88  TRP A HE3  8  
ATOM 11377 H HZ2  . TRP A 1 88  ? 6.134   -6.534  2.195   1.00 0.00 ? 88  TRP A HZ2  8  
ATOM 11378 H HZ3  . TRP A 1 88  ? 3.935   -5.655  -1.354  1.00 0.00 ? 88  TRP A HZ3  8  
ATOM 11379 H HH2  . TRP A 1 88  ? 6.057   -5.854  -0.164  1.00 0.00 ? 88  TRP A HH2  8  
ATOM 11380 N N    . ALA A 1 89  ? -2.103  -5.601  0.310   1.00 0.00 ? 89  ALA A N    8  
ATOM 11381 C CA   . ALA A 1 89  ? -3.471  -5.717  -0.180  1.00 0.00 ? 89  ALA A CA   8  
ATOM 11382 C C    . ALA A 1 89  ? -3.906  -7.177  -0.251  1.00 0.00 ? 89  ALA A C    8  
ATOM 11383 O O    . ALA A 1 89  ? -3.592  -7.883  -1.210  1.00 0.00 ? 89  ALA A O    8  
ATOM 11384 C CB   . ALA A 1 89  ? -3.601  -5.058  -1.545  1.00 0.00 ? 89  ALA A CB   8  
ATOM 11385 H H    . ALA A 1 89  ? -1.384  -5.396  -0.324  1.00 0.00 ? 89  ALA A H    8  
ATOM 11386 H HA   . ALA A 1 89  ? -4.117  -5.192  0.509   1.00 0.00 ? 89  ALA A HA   8  
ATOM 11387 H HB1  . ALA A 1 89  ? -4.225  -4.180  -1.461  1.00 0.00 ? 89  ALA A HB1  8  
ATOM 11388 H HB2  . ALA A 1 89  ? -2.623  -4.772  -1.901  1.00 0.00 ? 89  ALA A HB2  8  
ATOM 11389 H HB3  . ALA A 1 89  ? -4.048  -5.753  -2.239  1.00 0.00 ? 89  ALA A HB3  8  
ATOM 11390 N N    . LYS A 1 90  ? -4.630  -7.624  0.769   1.00 0.00 ? 90  LYS A N    8  
ATOM 11391 C CA   . LYS A 1 90  ? -5.110  -9.000  0.823   1.00 0.00 ? 90  LYS A CA   8  
ATOM 11392 C C    . LYS A 1 90  ? -6.591  -9.074  0.466   1.00 0.00 ? 90  LYS A C    8  
ATOM 11393 O O    . LYS A 1 90  ? -7.381  -8.192  0.805   1.00 0.00 ? 90  LYS A O    8  
ATOM 11394 C CB   . LYS A 1 90  ? -4.880  -9.588  2.217   1.00 0.00 ? 90  LYS A CB   8  
ATOM 11395 C CG   . LYS A 1 90  ? -3.441  -10.001 2.473   1.00 0.00 ? 90  LYS A CG   8  
ATOM 11396 C CD   . LYS A 1 90  ? -3.344  -11.012 3.603   1.00 0.00 ? 90  LYS A CD   8  
ATOM 11397 C CE   . LYS A 1 90  ? -2.014  -11.749 3.579   1.00 0.00 ? 90  LYS A CE   8  
ATOM 11398 N NZ   . LYS A 1 90  ? -2.085  -13.046 4.306   1.00 0.00 ? 90  LYS A NZ   8  
ATOM 11399 H H    . LYS A 1 90  ? -4.848  -7.013  1.504   1.00 0.00 ? 90  LYS A H    8  
ATOM 11400 H HA   . LYS A 1 90  ? -4.549  -9.575  0.102   1.00 0.00 ? 90  LYS A HA   8  
ATOM 11401 H HB2  . LYS A 1 90  ? -5.158  -8.851  2.956   1.00 0.00 ? 90  LYS A HB2  8  
ATOM 11402 H HB3  . LYS A 1 90  ? -5.509  -10.459 2.335   1.00 0.00 ? 90  LYS A HB3  8  
ATOM 11403 H HG2  . LYS A 1 90  ? -3.037  -10.443 1.574   1.00 0.00 ? 90  LYS A HG2  8  
ATOM 11404 H HG3  . LYS A 1 90  ? -2.866  -9.124  2.736   1.00 0.00 ? 90  LYS A HG3  8  
ATOM 11405 H HD2  . LYS A 1 90  ? -3.439  -10.495 4.547   1.00 0.00 ? 90  LYS A HD2  8  
ATOM 11406 H HD3  . LYS A 1 90  ? -4.145  -11.730 3.502   1.00 0.00 ? 90  LYS A HD3  8  
ATOM 11407 H HE2  . LYS A 1 90  ? -1.739  -11.936 2.552   1.00 0.00 ? 90  LYS A HE2  8  
ATOM 11408 H HE3  . LYS A 1 90  ? -1.264  -11.126 4.044   1.00 0.00 ? 90  LYS A HE3  8  
ATOM 11409 H HZ1  . LYS A 1 90  ? -1.230  -13.179 4.884   1.00 0.00 ? 90  LYS A HZ1  8  
ATOM 11410 H HZ2  . LYS A 1 90  ? -2.157  -13.832 3.629   1.00 0.00 ? 90  LYS A HZ2  8  
ATOM 11411 H HZ3  . LYS A 1 90  ? -2.918  -13.062 4.929   1.00 0.00 ? 90  LYS A HZ3  8  
ATOM 11412 N N    . PRO A 1 91  ? -6.979  -10.151 -0.233  1.00 0.00 ? 91  PRO A N    8  
ATOM 11413 C CA   . PRO A 1 91  ? -8.368  -10.366 -0.649  1.00 0.00 ? 91  PRO A CA   8  
ATOM 11414 C C    . PRO A 1 91  ? -9.284  -10.680 0.529   1.00 0.00 ? 91  PRO A C    8  
ATOM 11415 O O    . PRO A 1 91  ? -8.901  -11.399 1.453   1.00 0.00 ? 91  PRO A O    8  
ATOM 11416 C CB   . PRO A 1 91  ? -8.274  -11.571 -1.588  1.00 0.00 ? 91  PRO A CB   8  
ATOM 11417 C CG   . PRO A 1 91  ? -7.048  -12.297 -1.153  1.00 0.00 ? 91  PRO A CG   8  
ATOM 11418 C CD   . PRO A 1 91  ? -6.092  -11.241 -0.671  1.00 0.00 ? 91  PRO A CD   8  
ATOM 11419 H HA   . PRO A 1 91  ? -8.757  -9.516  -1.189  1.00 0.00 ? 91  PRO A HA   8  
ATOM 11420 H HB2  . PRO A 1 91  ? -9.158  -12.185 -1.480  1.00 0.00 ? 91  PRO A HB2  8  
ATOM 11421 H HB3  . PRO A 1 91  ? -8.189  -11.231 -2.609  1.00 0.00 ? 91  PRO A HB3  8  
ATOM 11422 H HG2  . PRO A 1 91  ? -7.290  -12.978 -0.351  1.00 0.00 ? 91  PRO A HG2  8  
ATOM 11423 H HG3  . PRO A 1 91  ? -6.624  -12.834 -1.988  1.00 0.00 ? 91  PRO A HG3  8  
ATOM 11424 H HD2  . PRO A 1 91  ? -5.503  -11.614 0.154   1.00 0.00 ? 91  PRO A HD2  8  
ATOM 11425 H HD3  . PRO A 1 91  ? -5.451  -10.916 -1.478  1.00 0.00 ? 91  PRO A HD3  8  
ATOM 11426 N N    . LYS A 1 92  ? -10.496 -10.136 0.492   1.00 0.00 ? 92  LYS A N    8  
ATOM 11427 C CA   . LYS A 1 92  ? -11.468 -10.358 1.555   1.00 0.00 ? 92  LYS A CA   8  
ATOM 11428 C C    . LYS A 1 92  ? -12.530 -11.363 1.120   1.00 0.00 ? 92  LYS A C    8  
ATOM 11429 O O    . LYS A 1 92  ? -13.008 -11.323 -0.013  1.00 0.00 ? 92  LYS A O    8  
ATOM 11430 C CB   . LYS A 1 92  ? -12.132 -9.038  1.952   1.00 0.00 ? 92  LYS A CB   8  
ATOM 11431 C CG   . LYS A 1 92  ? -12.779 -9.071  3.326   1.00 0.00 ? 92  LYS A CG   8  
ATOM 11432 C CD   . LYS A 1 92  ? -13.215 -7.685  3.770   1.00 0.00 ? 92  LYS A CD   8  
ATOM 11433 C CE   . LYS A 1 92  ? -13.685 -7.686  5.217   1.00 0.00 ? 92  LYS A CE   8  
ATOM 11434 N NZ   . LYS A 1 92  ? -14.157 -6.341  5.648   1.00 0.00 ? 92  LYS A NZ   8  
ATOM 11435 H H    . LYS A 1 92  ? -10.743 -9.571  -0.271  1.00 0.00 ? 92  LYS A H    8  
ATOM 11436 H HA   . LYS A 1 92  ? -10.941 -10.757 2.409   1.00 0.00 ? 92  LYS A HA   8  
ATOM 11437 H HB2  . LYS A 1 92  ? -11.385 -8.258  1.948   1.00 0.00 ? 92  LYS A HB2  8  
ATOM 11438 H HB3  . LYS A 1 92  ? -12.893 -8.799  1.224   1.00 0.00 ? 92  LYS A HB3  8  
ATOM 11439 H HG2  . LYS A 1 92  ? -13.645 -9.715  3.290   1.00 0.00 ? 92  LYS A HG2  8  
ATOM 11440 H HG3  . LYS A 1 92  ? -12.068 -9.461  4.040   1.00 0.00 ? 92  LYS A HG3  8  
ATOM 11441 H HD2  . LYS A 1 92  ? -12.381 -7.006  3.676   1.00 0.00 ? 92  LYS A HD2  8  
ATOM 11442 H HD3  . LYS A 1 92  ? -14.026 -7.352  3.138   1.00 0.00 ? 92  LYS A HD3  8  
ATOM 11443 H HE2  . LYS A 1 92  ? -14.496 -8.391  5.318   1.00 0.00 ? 92  LYS A HE2  8  
ATOM 11444 H HE3  . LYS A 1 92  ? -12.863 -7.990  5.848   1.00 0.00 ? 92  LYS A HE3  8  
ATOM 11445 H HZ1  . LYS A 1 92  ? -15.111 -6.160  5.274   1.00 0.00 ? 92  LYS A HZ1  8  
ATOM 11446 H HZ2  . LYS A 1 92  ? -13.513 -5.606  5.292   1.00 0.00 ? 92  LYS A HZ2  8  
ATOM 11447 H HZ3  . LYS A 1 92  ? -14.187 -6.288  6.686   1.00 0.00 ? 92  LYS A HZ3  8  
ATOM 11448 N N    . GLY A 1 93  ? -12.896 -12.262 2.029   1.00 0.00 ? 93  GLY A N    8  
ATOM 11449 C CA   . GLY A 1 93  ? -13.901 -13.262 1.720   1.00 0.00 ? 93  GLY A CA   8  
ATOM 11450 C C    . GLY A 1 93  ? -14.357 -14.025 2.948   1.00 0.00 ? 93  GLY A C    8  
ATOM 11451 O O    . GLY A 1 93  ? -14.053 -13.636 4.075   1.00 0.00 ? 93  GLY A O    8  
ATOM 11452 H H    . GLY A 1 93  ? -12.481 -12.245 2.917   1.00 0.00 ? 93  GLY A H    8  
ATOM 11453 H HA2  . GLY A 1 93  ? -14.754 -12.774 1.274   1.00 0.00 ? 93  GLY A HA2  8  
ATOM 11454 H HA3  . GLY A 1 93  ? -13.487 -13.963 1.009   1.00 0.00 ? 93  GLY A HA3  8  
ATOM 11455 N N    . GLU A 1 94  ? -15.091 -15.112 2.730   1.00 0.00 ? 94  GLU A N    8  
ATOM 11456 C CA   . GLU A 1 94  ? -15.592 -15.928 3.829   1.00 0.00 ? 94  GLU A CA   8  
ATOM 11457 C C    . GLU A 1 94  ? -14.492 -16.196 4.853   1.00 0.00 ? 94  GLU A C    8  
ATOM 11458 O O    . GLU A 1 94  ? -14.624 -15.851 6.026   1.00 0.00 ? 94  GLU A O    8  
ATOM 11459 C CB   . GLU A 1 94  ? -16.144 -17.253 3.299   1.00 0.00 ? 94  GLU A CB   8  
ATOM 11460 C CG   . GLU A 1 94  ? -16.551 -18.224 4.395   1.00 0.00 ? 94  GLU A CG   8  
ATOM 11461 C CD   . GLU A 1 94  ? -15.397 -19.083 4.872   1.00 0.00 ? 94  GLU A CD   8  
ATOM 11462 O OE1  . GLU A 1 94  ? -14.925 -19.932 4.086   1.00 0.00 ? 94  GLU A OE1  8  
ATOM 11463 O OE2  . GLU A 1 94  ? -14.965 -18.907 6.030   1.00 0.00 ? 94  GLU A OE2  8  
ATOM 11464 H H    . GLU A 1 94  ? -15.300 -15.370 1.808   1.00 0.00 ? 94  GLU A H    8  
ATOM 11465 H HA   . GLU A 1 94  ? -16.389 -15.383 4.310   1.00 0.00 ? 94  GLU A HA   8  
ATOM 11466 H HB2  . GLU A 1 94  ? -17.010 -17.049 2.687   1.00 0.00 ? 94  GLU A HB2  8  
ATOM 11467 H HB3  . GLU A 1 94  ? -15.388 -17.726 2.691   1.00 0.00 ? 94  GLU A HB3  8  
ATOM 11468 H HG2  . GLU A 1 94  ? -16.932 -17.661 5.234   1.00 0.00 ? 94  GLU A HG2  8  
ATOM 11469 H HG3  . GLU A 1 94  ? -17.329 -18.870 4.014   1.00 0.00 ? 94  GLU A HG3  8  
ATOM 11470 N N    . GLY A 1 95  ? -13.406 -16.814 4.398   1.00 0.00 ? 95  GLY A N    8  
ATOM 11471 C CA   . GLY A 1 95  ? -12.299 -17.118 5.286   1.00 0.00 ? 95  GLY A CA   8  
ATOM 11472 C C    . GLY A 1 95  ? -11.164 -17.829 4.576   1.00 0.00 ? 95  GLY A C    8  
ATOM 11473 O O    . GLY A 1 95  ? -10.017 -17.389 4.631   1.00 0.00 ? 95  GLY A O    8  
ATOM 11474 H H    . GLY A 1 95  ? -13.356 -17.065 3.452   1.00 0.00 ? 95  GLY A H    8  
ATOM 11475 H HA2  . GLY A 1 95  ? -11.926 -16.197 5.708   1.00 0.00 ? 95  GLY A HA2  8  
ATOM 11476 H HA3  . GLY A 1 95  ? -12.658 -17.749 6.087   1.00 0.00 ? 95  GLY A HA3  8  
ATOM 11477 N N    . GLY A 1 96  ? -11.485 -18.933 3.908   1.00 0.00 ? 96  GLY A N    8  
ATOM 11478 C CA   . GLY A 1 96  ? -10.472 -19.688 3.195   1.00 0.00 ? 96  GLY A CA   8  
ATOM 11479 C C    . GLY A 1 96  ? -10.798 -21.167 3.117   1.00 0.00 ? 96  GLY A C    8  
ATOM 11480 O O    . GLY A 1 96  ? -10.314 -21.960 3.924   1.00 0.00 ? 96  GLY A O    8  
ATOM 11481 H H    . GLY A 1 96  ? -12.417 -19.236 3.899   1.00 0.00 ? 96  GLY A H    8  
ATOM 11482 H HA2  . GLY A 1 96  ? -10.385 -19.297 2.192   1.00 0.00 ? 96  GLY A HA2  8  
ATOM 11483 H HA3  . GLY A 1 96  ? -9.525  -19.567 3.701   1.00 0.00 ? 96  GLY A HA3  8  
ATOM 11484 N N    . SER A 1 97  ? -11.624 -21.538 2.144   1.00 0.00 ? 97  SER A N    8  
ATOM 11485 C CA   . SER A 1 97  ? -12.020 -22.931 1.968   1.00 0.00 ? 97  SER A CA   8  
ATOM 11486 C C    . SER A 1 97  ? -11.704 -23.410 0.555   1.00 0.00 ? 97  SER A C    8  
ATOM 11487 O O    . SER A 1 97  ? -11.176 -22.659 -0.265  1.00 0.00 ? 97  SER A O    8  
ATOM 11488 C CB   . SER A 1 97  ? -13.514 -23.099 2.254   1.00 0.00 ? 97  SER A CB   8  
ATOM 11489 O OG   . SER A 1 97  ? -13.744 -23.350 3.629   1.00 0.00 ? 97  SER A OG   8  
ATOM 11490 H H    . SER A 1 97  ? -11.978 -20.859 1.532   1.00 0.00 ? 97  SER A H    8  
ATOM 11491 H HA   . SER A 1 97  ? -11.458 -23.527 2.672   1.00 0.00 ? 97  SER A HA   8  
ATOM 11492 H HB2  . SER A 1 97  ? -14.035 -22.196 1.973   1.00 0.00 ? 97  SER A HB2  8  
ATOM 11493 H HB3  . SER A 1 97  ? -13.896 -23.930 1.679   1.00 0.00 ? 97  SER A HB3  8  
ATOM 11494 H HG   . SER A 1 97  ? -14.670 -23.196 3.832   1.00 0.00 ? 97  SER A HG   8  
ATOM 11495 N N    . GLY A 1 98  ? -12.031 -24.669 0.276   1.00 0.00 ? 98  GLY A N    8  
ATOM 11496 C CA   . GLY A 1 98  ? -11.776 -25.228 -1.038  1.00 0.00 ? 98  GLY A CA   8  
ATOM 11497 C C    . GLY A 1 98  ? -11.312 -26.670 -0.974  1.00 0.00 ? 98  GLY A C    8  
ATOM 11498 O O    . GLY A 1 98  ? -12.094 -27.605 -1.152  1.00 0.00 ? 98  GLY A O    8  
ATOM 11499 H H    . GLY A 1 98  ? -12.450 -25.221 0.969   1.00 0.00 ? 98  GLY A H    8  
ATOM 11500 H HA2  . GLY A 1 98  ? -12.683 -25.178 -1.621  1.00 0.00 ? 98  GLY A HA2  8  
ATOM 11501 H HA3  . GLY A 1 98  ? -11.013 -24.639 -1.525  1.00 0.00 ? 98  GLY A HA3  8  
ATOM 11502 N N    . PRO A 1 99  ? -10.010 -26.866 -0.715  1.00 0.00 ? 99  PRO A N    8  
ATOM 11503 C CA   . PRO A 1 99  ? -9.414  -28.202 -0.623  1.00 0.00 ? 99  PRO A CA   8  
ATOM 11504 C C    . PRO A 1 99  ? -9.876  -28.959 0.618   1.00 0.00 ? 99  PRO A C    8  
ATOM 11505 O O    . PRO A 1 99  ? -9.466  -30.096 0.851   1.00 0.00 ? 99  PRO A O    8  
ATOM 11506 C CB   . PRO A 1 99  ? -7.912  -27.916 -0.548  1.00 0.00 ? 99  PRO A CB   8  
ATOM 11507 C CG   . PRO A 1 99  ? -7.817  -26.541 0.018   1.00 0.00 ? 99  PRO A CG   8  
ATOM 11508 C CD   . PRO A 1 99  ? -9.021  -25.799 -0.492  1.00 0.00 ? 99  PRO A CD   8  
ATOM 11509 H HA   . PRO A 1 99  ? -9.626  -28.793 -1.503  1.00 0.00 ? 99  PRO A HA   8  
ATOM 11510 H HB2  . PRO A 1 99  ? -7.437  -28.643 0.096   1.00 0.00 ? 99  PRO A HB2  8  
ATOM 11511 H HB3  . PRO A 1 99  ? -7.482  -27.967 -1.537  1.00 0.00 ? 99  PRO A HB3  8  
ATOM 11512 H HG2  . PRO A 1 99  ? -7.833  -26.586 1.097   1.00 0.00 ? 99  PRO A HG2  8  
ATOM 11513 H HG3  . PRO A 1 99  ? -6.910  -26.066 -0.325  1.00 0.00 ? 99  PRO A HG3  8  
ATOM 11514 H HD2  . PRO A 1 99  ? -9.372  -25.096 0.249   1.00 0.00 ? 99  PRO A HD2  8  
ATOM 11515 H HD3  . PRO A 1 99  ? -8.787  -25.291 -1.416  1.00 0.00 ? 99  PRO A HD3  8  
ATOM 11516 N N    . SER A 1 100 ? -10.730 -28.321 1.410   1.00 0.00 ? 100 SER A N    8  
ATOM 11517 C CA   . SER A 1 100 ? -11.245 -28.933 2.630   1.00 0.00 ? 100 SER A CA   8  
ATOM 11518 C C    . SER A 1 100 ? -11.849 -30.303 2.337   1.00 0.00 ? 100 SER A C    8  
ATOM 11519 O O    . SER A 1 100 ? -12.573 -30.478 1.358   1.00 0.00 ? 100 SER A O    8  
ATOM 11520 C CB   . SER A 1 100 ? -12.296 -28.028 3.276   1.00 0.00 ? 100 SER A CB   8  
ATOM 11521 O OG   . SER A 1 100 ? -11.826 -26.695 3.379   1.00 0.00 ? 100 SER A OG   8  
ATOM 11522 H H    . SER A 1 100 ? -11.020 -27.416 1.171   1.00 0.00 ? 100 SER A H    8  
ATOM 11523 H HA   . SER A 1 100 ? -10.418 -29.056 3.314   1.00 0.00 ? 100 SER A HA   8  
ATOM 11524 H HB2  . SER A 1 100 ? -13.192 -28.036 2.675   1.00 0.00 ? 100 SER A HB2  8  
ATOM 11525 H HB3  . SER A 1 100 ? -12.522 -28.395 4.267   1.00 0.00 ? 100 SER A HB3  8  
ATOM 11526 H HG   . SER A 1 100 ? -12.351 -26.126 2.811   1.00 0.00 ? 100 SER A HG   8  
ATOM 11527 N N    . SER A 1 101 ? -11.544 -31.273 3.194   1.00 0.00 ? 101 SER A N    8  
ATOM 11528 C CA   . SER A 1 101 ? -12.052 -32.629 3.026   1.00 0.00 ? 101 SER A CA   8  
ATOM 11529 C C    . SER A 1 101 ? -13.471 -32.612 2.465   1.00 0.00 ? 101 SER A C    8  
ATOM 11530 O O    . SER A 1 101 ? -13.790 -33.347 1.532   1.00 0.00 ? 101 SER A O    8  
ATOM 11531 C CB   . SER A 1 101 ? -12.029 -33.374 4.362   1.00 0.00 ? 101 SER A CB   8  
ATOM 11532 O OG   . SER A 1 101 ? -12.859 -32.734 5.317   1.00 0.00 ? 101 SER A OG   8  
ATOM 11533 H H    . SER A 1 101 ? -10.960 -31.071 3.955   1.00 0.00 ? 101 SER A H    8  
ATOM 11534 H HA   . SER A 1 101 ? -11.407 -33.141 2.327   1.00 0.00 ? 101 SER A HA   8  
ATOM 11535 H HB2  . SER A 1 101 ? -12.382 -34.383 4.215   1.00 0.00 ? 101 SER A HB2  8  
ATOM 11536 H HB3  . SER A 1 101 ? -11.017 -33.398 4.740   1.00 0.00 ? 101 SER A HB3  8  
ATOM 11537 H HG   . SER A 1 101 ? -13.780 -32.888 5.095   1.00 0.00 ? 101 SER A HG   8  
ATOM 11538 N N    . GLY A 1 102 ? -14.318 -31.765 3.041   1.00 0.00 ? 102 GLY A N    8  
ATOM 11539 C CA   . GLY A 1 102 ? -15.693 -31.667 2.587   1.00 0.00 ? 102 GLY A CA   8  
ATOM 11540 C C    . GLY A 1 102 ? -16.231 -30.252 2.667   1.00 0.00 ? 102 GLY A C    8  
ATOM 11541 O O    . GLY A 1 102 ? -17.209 -29.914 2.001   1.00 0.00 ? 102 GLY A O    8  
ATOM 11542 H H    . GLY A 1 102 ? -14.008 -31.203 3.782   1.00 0.00 ? 102 GLY A H    8  
ATOM 11543 H HA2  . GLY A 1 102 ? -15.747 -32.004 1.562   1.00 0.00 ? 102 GLY A HA2  8  
ATOM 11544 H HA3  . GLY A 1 102 ? -16.309 -32.309 3.199   1.00 0.00 ? 102 GLY A HA3  8  
ATOM 11545 N N    . GLY A 1 1   ? 5.041   3.186   24.214  1.00 0.00 ? 1   GLY A N    9  
ATOM 11546 C CA   . GLY A 1 1   ? 6.045   2.185   23.905  1.00 0.00 ? 1   GLY A CA   9  
ATOM 11547 C C    . GLY A 1 1   ? 5.446   0.930   23.302  1.00 0.00 ? 1   GLY A C    9  
ATOM 11548 O O    . GLY A 1 1   ? 5.597   -0.163  23.848  1.00 0